Sequence alignment for CL0302

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------IYI----V----------------------------
C2XKX5_BACCE/12-239--------------------------------------------IYI----V----------------------------
B9BUU1_9BURK/13-199--------------------------------------------VYI----V----------------------------
B9BQL6_9BURK/13-201--------------------------------------------IFV----V----------------------------
A8MKG9_ALKOO/16-197--------------------------------------------IYI----V----------------------------
D1N5Z5_9BACT/4-169--------------------------------------------IET----V----------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------VII----V----------------------------
Q12VI5_METBU/19-180--------------------------------------------LYF----I----------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------AYV----F----------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------VWL----M----------------------------
C2SK71_BACCE/15-171--------------------------------------------IFV----S----------------------------
C3Q562_9BACE/31-198--------------------------------------------TYI----M----------------------------
D7W5E5_9FLAO/27-172--------------------------------------------VYV----M----------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------VYV----M----------------------------
C6C1I6_DESAD/28-165--------------------------------------------IFI----M----------------------------
C5KCK7_PERM5/16-196--------------------------------------------VVI----V----------------------------
B7FS57_PHATC/11-216--------------------------------------------VVV----V----------------------------
C3XU32_BRAFL/3-238--------------------------------------------NQI----V----------------------------
CE022_DANRE/15-248--------------------------------------------VWI----V----------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------VWV----V----------------------------
A7UTP5_ANOGA/103-265--------------------------------------------IFV----V----------------------------
B3M7P2_DROAN/118-284--------------------------------------------VFI----V----------------------------
B4N4R0_DROWI/108-274--------------------------------------------VFI----V----------------------------
A7SLH9_NEMVE/10-251--------------------------------------------VKI----C----------------------------
B7PMV1_IXOSC/7-174--------------------------------------------VYV----V----------------------------
A9VAD6_MONBE/67-213--------------------------------------------ERE----R----------------------------
A6UPR5_METVS/56-208--------------------------------------------GRI----V----------------------------
A9AA45_METM6/55-201--------------------------------------------GRI----V----------------------------
A6UX51_META3/57-190--------------------------------------------GRI----V----------------------------
D0MD43_RHOM4/57-211--------------------------------------------GLI----V----------------------------
Q181H4_CLOD6/78-183--------------------------------------------IYV----F----------------------------
B6G251_9FIRM/77-182--------------------------------------------VYI----F----------------------------
B0A6K5_9FIRM/76-181--------------------------------------------VYI----F----------------------------
C0CJH7_9FIRM/6-165--------------------------------------------VYI----M----------------------------

PF00491

SPEB3_SCHPO/85-387------------------------------------------FDIAF----I.GMPFDT...G.TSY-------------
ARGI_COCP7/16-318------------------------------------------HQLGV----V.AVGFSD.....GQP-------------
Q6BJQ5_DEBHA/76-370------------------------------------------YDIGI----I.GVPFDT...A.TSY-------------
Q6BVQ4_DEBHA/136-428------------------------------------------FDIGI----V.GATFDT...G.VSF-------------
Q6BWL4_DEBHA/179-480------------------------------------------IDIAV----V.GAPFDT...G.VSF-------------
A1ERP9_VIBCL/33-299------------------------------------------ADVVV----L.GVPLDM...A.TSG-------------
A0RLF1_BACAH/22-286------------------------------------------SEVVI----Y.GMPMDW...T.VSY-------------
A1RXI5_THEPD/26-288------------------------------------------SAYVV----V.GAPFDS...T.ATG-------------
ARGI1_XENLA/6-306------------------------------------------HSVGV----I.GAPFSK.....GQP-------------
SPEB_MOUSE/77-350------------------------------------------LDAAF----I.GVPLDT...G.TSN-------------
Q9V2I5_PYRAB/21-279------------------------------------------ADYVI----M.GLPFDG...T.TSY-------------
A4XKN0_CALS8/20-281------------------------------------------SKVVL----A.GIPMDF...T.VSF-------------
Q55U21_CRYNB/69-375------------------------------------------FDIAL----L.GVPFDS...A.VSF-------------
A4J1T2_DESRM/21-282------------------------------------------SSVVL----V.GAPMDF...T.VSF-------------
B8GAJ6_CHLAD/41-309------------------------------------------AKVVL----L.GCPQDIGVQR.NRG-------------
Q8ZVI7_PYRAE/9-263------------------------------------------KDVKL----L.GAPMED...T.LSF-------------
A1VQK9_POLNA/34-307------------------------------------------LNAAF----I.GVPLDI...G.TSN-------------
HUTG_HALSA/36-303------------------------------------------YDAVL----V.GEPYDGAVIG....-------------
Q15JE9_STRHY/25-310------------------------------------------AAAAV----V.GSGYSL.....GSA-------------
Q1Q9T2_PSYCK/6-313------------------------------------------KNIRI----V.EVYSDI.....AGY-------------
Q3AGG3_SYNSC/27-286------------------------------------------CRVGL----F.GVPYDG...T.TSF-------------
Q2K8A9_RHIEC/46-316------------------------------------------IDIAL----F.GIPMDL...G.VTN-------------
A0B180_BURCH/43-310------------------------------------------VDVAI----S.GVPLDL...A.TTY-------------
Q2F6C6_BOMMO/21-320------------------------------------------NRVGV----I.GVPFEK.....GQK-------------
B2JW15_BURP8/32-305------------------------------------------FDIAL----A.GVPFDG...G.VTA-------------
Q6TA07_STRCL/27-300------------------------------------------HDVVV----V.GAPYDG...G.TSY-------------
A1B175_PARDP/5-250------------------------------------------SSLDA----S.GVARGV.....LWT-------------
ARGI_STAAC/5-298------------------------------------------KAIDI----I.GAPSTF.....GQR-------------
Q982X2_RHILO/42-307------------------------------------------ADAVV----W.GIPFDA...A.VTN-------------
Q0FAM8_9RHOB/4-297------------------------------------------KKYTI----I.GIPLDC.....GKT-------------
Q1Z9W0_PHOPR/33-298------------------------------------------ADVII----T.GVPFDL...A.TTG-------------
HUTG_BACHD/35-311------------------------------------------DGFGL----I.GAPLSK...S.SIS-------------
HUTG_RHOSR/40-314------------------------------------------GACVL----I.GFSSDEGVER.NKG-------------
O68051_RHOCA/3-297------------------------------------------RSSII----L.GAPIQS.....GTH-------------
ARGI1_HUMAN/6-305------------------------------------------RTIGI----I.GAPFSK.....GQP-------------
SPEB_CHRVO/44-311------------------------------------------VDVAV----S.GIPLDL...S.VTF-------------
ARGI_BACSU/3-292------------------------------------------KTISV----I.GMPMDL.....GQA-------------
Q97ZX8_SULSO/24-289------------------------------------------SPFVI----I.GIPMDI...T.SSY-------------
HUTG_VIBVY/45-328------------------------------------------YGVAL----L.GFACDAGVAR.NKG-------------
A9BRG6_DELAS/16-312------------------------------------------RALRL----I.GVPTDI.....GAS-------------
A1ESE8_VIBCL/43-325------------------------------------------PGVAL----I.GFECDAGVER.NKG-------------
HUTG_AROAE/40-323------------------------------------------PGIVL----L.GFPCDLGVRR.NHG-------------
Q6MM35_BDEBA/43-314------------------------------------------YDFAI----L.GFPDDEGIGL.NGG-------------
A1RB53_ARTAT/29-311------------------------------------------ARVAI----L.GVASSA.....GSP-------------
Q1J2W9_DEIGD/37-306------------------------------------------ADVAV----L.GIPYDI...A.LGF-------------
Q1ZN31_PHOAS/36-323------------------------------------------PGITL----L.GFACDEGVFR.NKG-------------
Q2JER0_FRASC/40-318------------------------------------------PDVAV----V.GAPFDI...S.TTH-------------
Q3J346_RHOS4/3-296------------------------------------------KTCIL----I.GAPIDS.....GQR-------------
A9B324_HERA2/22-290------------------------------------------SKVVV----L.PIPFEA...T.VSY-------------
HUTG_LEGPL/46-318------------------------------------------KKTIF----L.GFASDAGIKR.NLG-------------
Q9YBG0_AERPE/29-298------------------------------------------SLFSV----I.GVPYDS...T.SSF-------------
Q1GI44_SILST/34-307------------------------------------------LDVAV----L.GVPMDI...G.TSW-------------
Q9HJB2_THEAC/33-293------------------------------------------SDYVI----F.GVPFDN...T.SSY-------------
A0RXD6_CENSY/22-283------------------------------------------AAAVV----F.GVPFDS...T.HSY-------------
A8LLU9_DINSH/46-312------------------------------------------VDVAV----S.GVPFDL...S.VTN-------------
Q1V061_PELUQ/39-314------------------------------------------CDVAI----V.GIPFDA...G.TSY-------------
SPEB_BACHD/22-286------------------------------------------SKAVI----F.GMPMDW...T.VSF-------------
Q0AG49_NITEC/44-311------------------------------------------AELVI----S.DIPLDL...A.VSY-------------
Q2CCZ9_9RHOB/3-297------------------------------------------KHIIL----I.GAPVDS.....GKR-------------
Q0W940_UNCMA/16-280------------------------------------------AAFVI----Y.GVPFDN...T.SSF-------------
Q97BB8_THEVO/33-293------------------------------------------AKYVV----F.GIPFDN...T.SSY-------------
ARGI_BREBE/3-294------------------------------------------KNMSI----V.GVPMDL.....GAD-------------
Q6MHV0_BDEBA/36-309------------------------------------------YEVGI----F.GIPYDG...G.VSY-------------
Q98MW3_RHILO/19-296------------------------------------------PRAVI----F.GAGHGSTYPG.KD.-------------
A0LG67_SYNFM/34-297------------------------------------------AGAVI----I.PVPYDA...T.TTY-------------
Q1EQG5_STRKN/2-295------------------------------------------RNIVV----V.DAPSNL.....GLR-------------
Q1Q5Q5_9BACT/32-299------------------------------------------SKVIL----F.GVPYDG...T.VSY-------------
A0NSP7_9RHOB/73-349------------------------------------------YDAAV----I.GIPFDG...G.TTY-------------
HUTG_BACSU/35-311------------------------------------------KGPAL----I.GVPLSK...S.SIS-------------
B8FZG3_DESHD/20-281------------------------------------------ADAVI----L.GIPMDY...T.VSF-------------
Q9K5Y7_BACHD/5-297------------------------------------------QKVSI----I.GVPMDL.....GQK-------------
Q7W6W6_BORPA/29-307------------------------------------------ARAAI----L.GIPFDC...G.THA-------------
Q6W399_9CREN/23-284------------------------------------------SVAVI----F.GVPFDS...T.HSY-------------
Q0AE23_NITEC/40-304------------------------------------------VDVVV----T.GVPLDI...A.TTN-------------
Q1MIP6_RHIL3/52-317------------------------------------------VDVAV----W.GIPFDA...A.TSN-------------
A2CDX1_PROM3/29-293------------------------------------------CNVGL----F.GVPYDG...T.SSF-------------
Q164F4_ROSDO/46-312------------------------------------------ADIAI----T.GVPFDQ...A.VTN-------------
Q164F5_ROSDO/34-308------------------------------------------LDVAI----V.GIPMDI...G.TSW-------------
Q0G0L1_9RHIZ/42-312------------------------------------------TDVAV----W.GIPYDG...A.VSN-------------
Q15X44_PSEA6/42-323------------------------------------------PHCCL----I.GLACDLGVKE.NKG-------------
A0SJA7_STAXY/3-297------------------------------------------KTVEI----I.GVPATF.....GQR-------------
Q1N5V2_9GAMM/42-308------------------------------------------ADVVV----S.GVPFDM...A.TSG-------------
Q4CMT4_TRYCC/16-290------------------------------------------GPVAA----F.GYEA..........-------------
Q2CC50_9RHOB/34-307------------------------------------------LDACF----V.GIPMDI...G.TSN-------------
Q11J67_MESSB/42-307------------------------------------------ADAVV----W.GIPFDA...A.VSN-------------
Q1AWJ4_RUBXD/5-295------------------------------------------PPVAI----L.GVPMDL.....GQD-------------
Q46EM0_METBF/17-282------------------------------------------ARYVI----F.GVPFDN...T.SSY-------------
Q8TZN1_PYRFU/56-314------------------------------------------ADYVI----L.GLPYDG...T.TSY-------------
Q18F18_HALWD/14-268------------------------------------------AEYVI----I.GAPLDV...S.TSF-------------
Q5V1C2_HALMA/37-301------------------------------------------YDVVL----V.GEPYDGAVIG....-------------
Q5WL42_BACSK/7-290------------------------------------------F..GI----V.GFPWDG...G.ASL-------------
Q7UZH9_PROMP/24-288------------------------------------------CSIGI----F.GVNYDG...T.CSY-------------
Q6CLB8_KLULA/137-438------------------------------------------MDIAI----V.GAPFDT...S.VSY-------------
A0JT79_ARTS2/57-331------------------------------------------ADITV----V.GVPFDS...G.VSY-------------
Q2KVZ3_BORA1/13-287------------------------------------------PGVCV----L.GIPFDC...G.THP-------------
A8H965_SHEPA/50-335------------------------------------------VRFAI----I.GIGEDIGPRA.NLG-------------
Q75TI1_GEOSE/31-304------------------------------------------IDFAV----L.GVPFDT...A.ASN-------------
B2UBQ2_RALPJ/40-316------------------------------------------NTVAL----A.GFACDAGVAR.NHG-------------
Q165U0_ROSDO/35-314------------------------------------------ADVAV----L.GAPFDG...G.TQW-------------
B1YHV3_EXIS2/22-286------------------------------------------AKGVL----Y.GMPMDW...T.VSF-------------
Q5WIT9_BACSK/27-306------------------------------------------IDAVV----Y.GIPWEG...AVTWG-------------
Q13CK1_RHOPS/14-311------------------------------------------RRVAL----L.GVPIEI.....GAG-------------
Q1YMK4_MOBAS/42-312------------------------------------------TDVTV----W.GIPFDA...S.VSN-------------
A1C610_ASPCL/68-380------------------------------------------YDIAV----I.GAPFDT...A.VSY-------------
Q39HU1_BURS3/40-306------------------------------------------VDLAI----T.GVPFDS...A.ASH-------------
Q05V55_9SYNE/29-297------------------------------------------CQVGL----F.GVPYDG...T.TSF-------------
Q1AS11_RUBXD/33-307------------------------------------------ADAAV----V.GAPFDT...G.ATF-------------
A0NXD9_9RHOB/25-301------------------------------------------ADVAV----L.GAPFDF...G.TQW-------------
SPEB_NEIMA/35-300------------------------------------------ADWVI----T.GVPYDM...A.VSG-------------
A3QIE0_SHELP/50-335------------------------------------------VRFVI----L.GIGEDIGPRA.NLG-------------
Q28QX8_JANSC/39-314------------------------------------------VDIGI----F.GLPWDG...A.TSN-------------
A1WGI6_VEREI/22-320------------------------------------------RPIAL----I.GAPTDI.....GAG-------------
A1WER7_VEREI/22-295------------------------------------------LDVGF----V.GVPLDL...G.TSH-------------
A1T3A2_MYCVP/88-364------------------------------------------AEVAI----F.GVPLDA...G.ATY-------------
HUTG_ENT38/42-310------------------------------------------SGIAL----M.GFASDEGVKR.NHG-------------
A8LRL4_DINSH/4-296------------------------------------------QKCIL----I.GAGMDC.....GKR-------------
Q46TX4_CUPPJ/2-296------------------------------------------KPITL----F.GAPTDV.....GAS-------------
A5V551_SPHWW/4-298------------------------------------------RRIAL----V.GAPVAL.....GAS-------------
Q2B9I2_9BACI/37-317------------------------------------------EPNVI----IYGAPLSR...S.SIS-------------
Q1I7X5_PSEE4/43-309------------------------------------------VDVVV----S.GVPFDT...A.TSN-------------
Q11NZ4_CYTH3/3-310------------------------------------------KPDIL----V.SVPSDI.....GAQ-------------
Q5V4R8_HALMA/3-300------------------------------------------EQVRV----L.GVPMDL.....GAD-------------
SPEB_SERP5/33-298------------------------------------------AEWVI----T.GIPFDM...A.TSG-------------
Q6AG97_LEIXX/4-273------------------------------------------ASFLV----I...PQWQ........-------------
Q12BY7_POLSJ/72-342------------------------------------------LDVAL----I.GVPMDL...G.VTN-------------
HUTG_VIBF1/45-345------------------------------------------DGIML----L.GFACDEGVIR.NKG-------------
Q0UDP7_PHANO/4-284------------------------------------------NSITV----I.FSPYHV...GLRDH-------------
Q0FAR0_9RHOB/34-308------------------------------------------ADAAI----I.GAPFDS...G.AQY-------------
Q3IVT5_RHOS4/32-308------------------------------------------LDAAI----V.GLPSDS...G.APF-------------
HUTG_GEOKA/44-315------------------------------------------RAAAF----I.GFACDEGVRR.NQG-------------
SPEB_BLOFL/33-298------------------------------------------NDWVI----T.GVPFDI...A.TSG-------------
A0ZFA2_NODSP/30-338------------------------------------------ANLIV----I.PVPWEV...T.VSY-------------
A2C5F5_PROM1/29-293------------------------------------------CRVSL----L.GVPYDG...T.CCF-------------
A4XT95_PSEMY/38-311------------------------------------------LDAAF----V.GVPLDI...G.TSL-------------
Q5WB32_BACSK/22-286------------------------------------------ADAVI----Y.GMPMDW...T.VSF-------------
Q6C6P6_YARLI/9-306------------------------------------------RKLSI----V.SAPFSG.....GQP-------------
HUTG_NOCFA/35-303------------------------------------------NSCVF----V.GFASDEGVRR.NKG-------------
Q12UU8_METBU/17-282------------------------------------------ASYVI----F.GVPFDR...T.SSF-------------
A1UHG9_MYCSK/34-307------------------------------------------TDVAV----V.GVPFDS...G.VSY-------------
A0B2Z1_BURCH/72-345------------------------------------------LDACF----V.GVPFDL...G.TSN-------------
ARGI_BACCD/2-295------------------------------------------KPISI----I.GVPMDL.....GQT-------------
Q213G1_RHOPB/11-309------------------------------------------KRLAV----L.GAAVDL.....GAS-------------
A7NL23_ROSCS/33-307------------------------------------------VDVAV----V.GLPFDT...G.ATF-------------
Q28PV5_JANSC/46-313------------------------------------------VDVAV----T.GIPFDQ...A.VTN-------------
A0QRD0_MYCS2/43-317------------------------------------------HDIAV----V.GVPFDS...G.VTY-------------
Q02UC9_PSEAB/35-308------------------------------------------LQVGL----I.GVPWDG...G.TTN-------------
Q1MAU5_RHIL3/40-310------------------------------------------LDVAL----I.GVPMDL...G.VTN-------------
ARGI_NEUCR/47-354------------------------------------------RDLGI----V.AVGFSG.....GQC-------------
A5ENL2_BRASB/10-307------------------------------------------SRVAV----L.GAPIDL.....GAS-------------
Q12LW8_SHEDO/33-299------------------------------------------ANVVV----I.GLPFDL...A.TTG-------------
Q2W8C1_MAGSA/22-290------------------------------------------ATFCI----A.GIPFDL...G.VTN-------------
Q6CIB4_KLULA/61-358------------------------------------------FDIGV----I.GVPFDT...A.VSF-------------
C5PF24_COCP7/77-371------------------------------------------YDIAI----L.GAPFDT...A.VTA-------------
A1SLP1_NOCSJ/31-312------------------------------------------ADVVV----L.GAPFDG...G.TSH-------------
A0RH36_BACAH/35-312------------------------------------------FGAAL----I.GAPLSK...P.SIS-------------
Q7P2W8_FUSNV/500-780------------------------------------------MKNVL----I.GVQTNL.....GVN-------------
A6UDJ1_SINMW/2-296------------------------------------------KTITL----I.GAPIEE.....GSG-------------
Q28VR8_JANSC/34-309------------------------------------------ADVAI----L.GAPFDF...G.TQW-------------
B4STA0_STRM5/5-299------------------------------------------ISVSL----I.GVPTDV.....GAG-------------
A6U7T5_SINMW/42-307------------------------------------------VDAVV----W.GVPFDA...A.TSN-------------
Q0UYW2_PHANO/16-320------------------------------------------HDLGV----V.AVGFSG.....GQP-------------
O96394_LEIAM/13-316------------------------------------------KKMSI----V.LAPFSG.....GQP-------------
Y309_METJA/21-281------------------------------------------AEGVI----F.SIPYDE...T.TSF-------------
Q9RZ04_DEIRA/29-298------------------------------------------ADVAA----L.GVPFDI...A.LGF-------------
Q6CLS8_KLULA/13-315------------------------------------------KKLGI----V.LAPFSG.....GQP-------------
A2BIW8_HYPBU/25-300------------------------------------------AEAVI----V.GVPFDY...T.SSY-------------
Q21RM0_RHOFD/15-309------------------------------------------GNISL----I.GVPTDI.....GAG-------------
Q6L151_PICTO/19-280------------------------------------------ARYVL----F.GVPFDN...T.SSY-------------
Q4P4M4_USTMA/13-318------------------------------------------KTVAI----V.GCPFSG.....GQR-------------
Q0I684_SYNS3/31-289------------------------------------------CRIAL----F.GVPYDG...T.TSF-------------
A1B165_PARDP/30-308------------------------------------------ADIAF----L.GIPYGSAYTM.DEV-------------
Q11QL1_CYTH3/66-323------------------------------------------VHIAL----V.GLSEERGSTT....-------------
Q16AD8_ROSDO/4-296------------------------------------------QKCIL----I.GVPMDC.....GKR-------------
Q3SMM1_THIDA/8-294------------------------------------------RSIIV----I.GAASCA.....GAP-------------
Q5AK86_CANAL/12-313------------------------------------------KKASI----I.TAPFSG.....GQP-------------
Q1IPT1_KORVE/2-256------------------------------------------NPIAL----L.GIAYDE...K.SSF-------------
Q7VSA1_BORPE/8-302------------------------------------------HGVSL----I.GAPTDI.....GAG-------------
Q82LW5_STRAW/2-295------------------------------------------RSIVV----L.DAPSNL.....GLR-------------
A0BHR2_PARTE/9-311------------------------------------------NAVGL----F.GSAVHE.....GQT-------------
A1UI81_MYCSK/60-335------------------------------------------YDIAI----L.GVPFDG...G.TSY-------------
HUTG_COREF/43-309------------------------------------------EGVVT----L.GFASDEGNLR.NHG-------------
Q2JWU8_SYNJA/14-265------------------------------------------ARVVL----I...PTAF........-------------
B0K9I6_THEP3/23-285------------------------------------------AEVVI----L.GLPMDY...T.VSF-------------
Q49V90_STAS1/26-305------------------------------------------TDVIV----Y.GAPFEG...ESTWG-------------
Q4JAE9_SULAC/24-287------------------------------------------SPFVI----V.GIPLDI...T.SSF-------------
A1UE14_MYCSK/29-310------------------------------------------ADIVI----L.GAPLDG...G.TTY-------------
A0P3L0_9RHOB/6-302------------------------------------------KQIVL----V.GAPVDE.....GAG-------------
Q0FDK0_9RHOB/32-317------------------------------------------QDIAL----V.GVPHST...GNGTT-------------
Q1YIK6_MOBAS/68-338------------------------------------------LDVAM----I.GVPMDL...G.VTN-------------
Q088H7_SHEFN/48-332------------------------------------------AQFAI----I.AIAEDVGPRA.NLG-------------
Q5JI38_PYRKO/22-281------------------------------------------ARFIL----L.GVPFDG...T.TSY-------------
Q975R8_SULTO/24-287------------------------------------------SPFVI----I.GLPLDI...T.SSF-------------
Q1LGD2_RALME/2-296------------------------------------------KPVTL----I.GAPTDV.....GAS-------------
ARGI_AGRT5/19-313------------------------------------------KTCQI----L.GAPVQS.....GAS-------------
Q1D421_MYXXD/27-337------------------------------------------AHVIL----I.PVPFEA...T.TSY-------------
SPEB1_SCHPO/74-375------------------------------------------FDIAF----L.GAPFDT...G.TSY-------------
YHMF_METFE/21-281------------------------------------------KVFGL----L.GVPFDS...T.STY-------------
ARGI_YEAST/13-329------------------------------------------RELSI----V.LAPFSG.....GQG-------------
A7NMZ3_ROSCS/53-326------------------------------------------TALQV----I.GVRYR.........-------------
A9BN56_DELAS/71-341------------------------------------------LQAAL----I.GVPMDL...G.ISN-------------
Q5A4M3_CANAL/50-340------------------------------------------FDIGI----I.GVPFDT...A.VSY-------------
Q4T7Z4_TETNG/3-305------------------------------------------RKVGL----I.GAPFAK.....GQP-------------
A2BTR8_PROMS/23-287------------------------------------------CSIGI----F.GVNYDG...T.CSF-------------
Q0FX33_9RHOB/3-297------------------------------------------GTCAL----L.GAPIET.....GAS-------------
A1RBR9_ARTAT/55-335------------------------------------------YDIAI----V.GVPFDG...G.TSF-------------
A1VTU0_POLNA/3-297------------------------------------------QHIRL----I.GAPTDV.....GAG-------------
Q4RH16_TETNG/25-302------------------------------------------QSVAV----L.GAPFSR.....GQK-------------
Q0UMJ9_PHANO/68-378------------------------------------------YDIAI----L.GAPFDT...A.VSY-------------
Q2U075_ASPOR/4-285------------------------------------------NTITL----I.ISPYHV...GLRDH-------------
A1SM48_NOCSJ/41-314------------------------------------------FDVAV----V.GVPFDS...G.VTY-------------
Q1GI45_SILST/67-333------------------------------------------ADIAV----T.GIPFDQ...A.VTN-------------
A0Y6C5_9GAMM/33-299------------------------------------------ADVVV----L.GLPFDL...A.TSG-------------
PAH_STRCL/30-303------------------------------------------YDVVV----I.GAPYDG...G.TSY-------------
Q1IHQ4_KORVE/16-311------------------------------------------KKIRV----L.GVPLDL.....GQS-------------
Q5K413_AGABI/11-307------------------------------------------LTAAI----V.GCPFSG.....GQR-------------
Q6L2W0_PICTO/21-293------------------------------------------PDIVI----T.GVPYDG...GIISH-------------
A0R8M1_BACAH/3-293------------------------------------------KEISV----I.GVPMDL.....GQM-------------
Q89H72_BRAJA/11-308------------------------------------------RRIAL----L.GAPIDM.....GAS-------------
Q0FFB5_9RHOB/42-315------------------------------------------VDFGL----I.GVPWDA...G.TTN-------------
A1ZN63_9BACT/41-299------------------------------------------KHLAI----V.GVTEERGTQT....-------------
A0Z3U1_9GAMM/41-307------------------------------------------VDVAV----L.GVPFDL...A.TTN-------------
B1KRD6_SHEWM/33-299------------------------------------------ADVVV----L.GLPFDM...A.TTG-------------
Q489X2_COLP3/36-310------------------------------------------LDIGI----V.GVPLDI...G.ASN-------------
Q7V9I4_PROMA/29-293------------------------------------------CNLGI----Y.GVNYDG...T.TSF-------------
SPEB1_SYNY3/26-297------------------------------------------AAVVV----V.PIPYEA...T.TSY-------------
Q6FP31_CANGA/10-317------------------------------------------RQLSL----V.LAPFSG.....GQG-------------
Q2CAN0_9RHOB/40-305------------------------------------------VDVVV----S.GVPFDS...A.VTN-------------
A5G414_GEOUR/41-319------------------------------------------YDVIV----A.GVPWEG...TVTWG-------------
A0YPG8_LYNSP/25-295------------------------------------------AQVAL----L.PIPFEA...T.TSY-------------
Q3SVS2_NITWN/5-302------------------------------------------RKVAL----L.GVPIDM.....GAS-------------
SPEB2_SCHPO/89-401------------------------------------------FDIAI----I.GVPFDT...A.VSH-------------
Q8XPR0_RALSO/29-309------------------------------------------ADIAV----L.GMPFGTPYSA.ADF-------------
Q52V70_9ACTO/41-314------------------------------------------TDIAV----V.GVPFDS...G.VTY-------------
Q08C97_DANRE/85-358------------------------------------------LDAAF----V.GVPIDT...G.TSN-------------
A4G0Y7_METM5/19-278------------------------------------------ADFVI----F.GIPFDA...T.TSY-------------
Q47TW8_THEFY/41-314------------------------------------------TDIAV----V.GIPFDS...G.VSY-------------
A9KQ98_CLOPH/18-281------------------------------------------SEMVL----F.GAPYDG...T.TSY-------------
A1BCD2_PARDP/35-312------------------------------------------LDVAI----L.GIPWDG...G.TTN-------------
B9LGA1_CHLSY/41-309------------------------------------------AQVVI----L.GCPQDIGVLR.NRG-------------
ARGI_ASHGO/93-395------------------------------------------KKASL----V.MAPFSG.....GQG-------------
A1B3P5_PARDP/3-295------------------------------------------H.CIL----I.GAPVDE.....GQR-------------
Q1QTM4_CHRSD/39-312------------------------------------------LDAAF----V.GIPMDI...G.TSN-------------
Q6C732_YARLI/86-381------------------------------------------FDIAL----V.GAPFDT...A.VTF-------------
A0LDK6_MAGSM/20-293------------------------------------------ARVVI----L.PLPYEG...T.VSY-------------
Q47D78_DECAR/17-302------------------------------------------SRIRI----I.GAASGL.....GAQ-------------
Q3JAG2_NITOC/2-290------------------------------------------KIIRI----I.GVASGW.....GAL-------------
A6UC62_SINMW/70-340------------------------------------------LQVAM----I.GVPMDL...G.VTN-------------
A3DDA1_CLOTH/24-286------------------------------------------ASIVM----A.GVPMDF...T.CSF-------------
A1CKP4_ASPCL/16-320------------------------------------------NELGV----V.AVGFNG.....GQC-------------
B8G5W4_CHLAD/5-298------------------------------------------ATITI----I.GVPLDL.....GAG-------------
ARGI1_SCHPO/22-319------------------------------------------NAVSI----I.NMPFSG.....GQP-------------
Q1QAH6_PSYCK/33-307------------------------------------------LDVAF----V.GVPLDI...G.ASN-------------
HUTG_PHOLL/44-316------------------------------------------HYVAL----L.GFECDEGVKR.NQG-------------
Q1MB14_RHIL3/6-300------------------------------------------RSVTL----I.GAPLEE.....GSG-------------
Q3IQJ3_NATPD/45-332------------------------------------------ADAAV----L.GVPYDG...A.VSN-------------
A5FB51_FLAJ1/47-336------------------------------------------AKYVL----L.GIPEDIGVRA.NYG-------------
Q2BIH2_9GAMM/39-305------------------------------------------AEVVV----S.GVPYDM...S.TSG-------------
SPEB2_SYNY3/83-361------------------------------------------YDVAI----V.GVPHDS...G.TTY-------------
Q5LKZ4_SILPO/42-315------------------------------------------VQIGL----V.GVPWDA...G.TTN-------------
Q2RHH4_MOOTA/26-287------------------------------------------ARAVL----A.GIPFDA...T.TSF-------------
Q2B080_9BACI/2-294------------------------------------------KKLSI----I.GMPMDL.....GQM-------------
Q17HI3_AEDAE/32-333------------------------------------------EKIGI----V.GVPFEK.....GQR-------------
A1RP77_SHESW/50-343------------------------------------------AQFAI----L.GVGEDIGPRA.NFG-------------
A3CU48_METMJ/19-276------------------------------------------ARYAV----F.GVPYDG...T.TSF-------------
HUTG_HAHCH/40-316------------------------------------------AGVAL----I.GYPCDLGVYI.NKG-------------
Q4QBG9_LEIMA/24-299------------------------------------------GPVAL----M.GCSV..........-------------
Q8RA93_THETN/28-290------------------------------------------ADIVL----V.GVPMDY...S.VSF-------------
Q8END5_OCEIH/29-310------------------------------------------KDVLI----Y.GVPWEG...AVTWG-------------
Q493F1_BLOPB/33-298------------------------------------------SDWVI----T.GVPFDL...A.TSG-------------
Q5ANN8_CANAL/115-414------------------------------------------IDIAI----V.GAPFDT...G.TSY-------------
A0NZA6_9RHOB/69-339------------------------------------------LDIAL----L.GVPMDL...G.VTN-------------
A1VGG3_DESVV/22-283------------------------------------------ARFHV----I.PAPFEA...S.VSY-------------
B2T8M0_BURPP/39-312------------------------------------------VDIGL----I.GVPWDG...G.TTN-------------
Q2LPR8_SYNAS/65-343------------------------------------------RDVIF----S.GVPWEG...TVTWG-------------
A1ST87_PSYIN/33-299------------------------------------------ADIAV----L.GLPFDL...A.TTG-------------
ARGI1_ARATH/63-338------------------------------------------ASTSL----L.GVPLGH...N.SSF-------------
Q5HZ88_XENLA/108-381------------------------------------------LDAAF----I.GVPLDT...G.TSN-------------
O29611_ARCFU/17-266------------------------------------------AEYLI----Y.GIPYDA...T.QSF-------------
Q1V7V4_VIBAL/45-328------------------------------------------HGVSL----L.GFATDAGVAR.NKG-------------
ARGI_LITCT/7-306------------------------------------------RSVGV----L.GAPFSK.....GQA-------------
Q5SJ85_THET8/15-277------------------------------------------ARVVV----L.PVPYDL...S.LSF-------------
A0R0G1_MYCS2/40-312------------------------------------------ADVAV----V.GVPFDS...A.VTY-------------
A1CFK4_ASPCL/83-374------------------------------------------YDIAF----L.GAPFDT...A.VTG-------------
B8I5M8_CLOCE/21-282------------------------------------------SDIVI----F.GAPYDG...T.TTF-------------
A1TIE4_ACIAC/8-305------------------------------------------RPVTL----I.GVPTDV.....GAA-------------
B1KR08_SHEWM/50-335------------------------------------------ARFAI----F.GIGEDIGPRA.NLG-------------
Q0FJQ8_9RHOB/38-313------------------------------------------ADAAI----L.GAPYDA...G.TQW-------------
A1T9H7_MYCVP/46-324------------------------------------------PDVAV----V.GAPFDV...G.TTN-------------
Q97VA3_SULSO/30-299------------------------------------------IKAAF----L.GIPFDD...A.VTY-------------
B1YR75_BURA4/21-323------------------------------------------RPIEL----I.AAPSSL.....GLK-------------
Q8TXD6_METKA/24-253------------------------------------------PDVAV----V.GLPRERVLPEY...-------------
Q581Y0_TRYB2/24-298------------------------------------------GPVAL----F.GYGA..........-------------
Q4J720_SULAC/30-299------------------------------------------VKAAF----L.GIPFDD...A.VTY-------------
Q3J2B4_RHOS4/46-312------------------------------------------VDLAI----T.GVAFDQ...A.VTN-------------
A1CGK0_ASPCL/61-357------------------------------------------LDIAI----L.GFPYDT...S.TSY-------------
Q10Y47_TRIEI/24-296------------------------------------------AKVVI----V.PIPYEA...T.TTY-------------
A5G278_ACICJ/28-297------------------------------------------AAHVV----A.GIPLDV...G.VTN-------------
ARGI_SOYBN/71-346------------------------------------------ATSTL----L.GVPLGH...N.SSF-------------
A0NYN1_9RHOB/60-337------------------------------------------PRAVI----F.GAGHGSTYPG.RD.-------------
Q98B74_RHILO/368-601------------------------------------------VSISA----EQGAA........GIL-------------
O76895_DROME/30-333------------------------------------------QSLGI----I.GVPFAK.....GQA-------------
A1W2M6_ACISJ/2-298------------------------------------------TTLTL----I.GAPTDV.....GAS-------------
Q4A3J0_CYPCA/24-323------------------------------------------QSVAI----L.GAPFSK.....GQK-------------
B2TBR8_BURPP/45-312------------------------------------------VDVAV----S.GIPLDL...A.TTF-------------
A8GC83_SERP5/32-305------------------------------------------LDAAF----V.GIPLDI...G.TSN-------------
B7WTA0_COMTE/4-303------------------------------------------TSCTL----I.GLPTDV.....GAS-------------
Q0F026_9PROT/13-273------------------------------------------HEIRI----I.GAPFDG...T.ASF-------------
A7NJ86_ROSCS/2-295------------------------------------------RDVAI----I.GVPLDL.....GAG-------------
Q1GHG8_SILST/4-296------------------------------------------RHCIL----V.GAPVDS.....GKR-------------
Q9HP79_HALSA/17-266------------------------------------------ADYVV----V.GAPLDV...S.TSF-------------
Q65P52_BACLD/4-300------------------------------------------QQISM----I.GVPMDL.....GQL-------------
Q4A3J2_CYPCA/25-324------------------------------------------HCVGI----I.GAPFSK.....GQQ-------------
Q67TJ0_SYMTH/28-290------------------------------------------ARAVL----W.GIGQDF...T.TSY-------------
A4XZN2_PSEMY/43-309------------------------------------------VDLAI----S.GVPFDT...A.TTN-------------
Q5LVU6_SILPO/18-278------------------------------------------ARFRI----I.PVPLER...T.VSY-------------
A1A614_XENLA/26-326------------------------------------------HSVAV----I.GAPFSK.....GQK-------------
A4YE21_METS5/29-295------------------------------------------VEAVF----I.GIPFDD...A.TTY-------------
Q5QV39_IDILO/51-340------------------------------------------QRVAL----V.GIPESIGVRA.NLG-------------
A1ZJF0_9BACT/15-273------------------------------------------TRLAV----V.GIPLDE...N.SSY-------------
A1SAJ7_SHEAM/49-334------------------------------------------ARFVL----L.GVGEDAGPRA.NLG-------------
Q6ANF4_DESPS/59-334------------------------------------------IDFAV----L.GIPFDT...A.TTY-------------
Q0SVK6_CLOPS/20-280------------------------------------------SSIVV----F.GAPFDS...T.TSF-------------
A1RSZ1_PYRIL/9-263------------------------------------------RDVKL----F.GAPMED...T.VSF-------------
Q5V104_HALMA/12-261------------------------------------------ADYAI----V.GAPLDA...S.TSF-------------
Q5QTW3_IDILO/29-298------------------------------------------GHTHI----L.GFGFDG...T.ACF-------------
A0NU34_9RHOB/41-306------------------------------------------IDLAV----W.GIPFDA...S.VSN-------------
A1ZV42_9BACT/26-290------------------------------------------AQIVI----L.PIPYDK...T.STW-------------
Q222F3_RHOFD/24-298------------------------------------------QPFAV----V.GVPFDG...A.VTH-------------
ARGI2_MOUSE/24-324------------------------------------------HSVAI----V.GAPFSR.....GQK-------------
Q1Z3J6_PHOPR/33-324------------------------------------------VGAVL----F.GVASDLSLGR.FRG-------------
Q315M1_DESDG/23-287------------------------------------------ARFHI----I.PAGYEA...S.VSY-------------
A7IL28_XANP2/50-316------------------------------------------AEVVV----W.GVPLDV...A.VSN-------------
Q18A84_CLOD6/21-285------------------------------------------SNLIV----F.GVGFDG...T.TSN-------------
Q07N69_RHOP5/13-310------------------------------------------KRVAL----L.GVPVDL.....GAS-------------
A0M038_GRAFK/2-255------------------------------------------KKIII----Q.GIKFDE...K.SSF-------------
B8FW33_DESHD/4-296------------------------------------------RKVRI----I.GVPIDL.....GAD-------------
Q5V6R7_HALMA/44-335------------------------------------------VDIGI----L.GAPLDT...A.TTI-------------
Q5LRK8_SILPO/33-325------------------------------------------KTCIL----I.GAPVDS.....GKR-------------
Q9K8M2_BACHD/4-296------------------------------------------KKIAV----I.GAPMDL.....GQN-------------
Q3ABP1_CARHZ/20-281------------------------------------------AAFVL----F.GIPMDF...T.VSF-------------
A9CJC2_AGRT5/42-307------------------------------------------VSTAI----W.GIPFDA...A.TSN-------------
Q0FFC7_9RHOB/42-306------------------------------------------VDVAV----S.GVPFDN...A.VTY-------------
Q7U3K9_SYNPX/21-280------------------------------------------CRVGL----F.GVPYDG...T.TSF-------------
Q4D5Y5_TRYCC/22-297------------------------------------------AEIVI----I.GFPYDEGCVR.NGG-------------
A1STQ5_PSYIN/47-343------------------------------------------SGITL----L.GFCCDEGVRR.NKG-------------
Q7VY32_BORPE/13-287------------------------------------------ALACV----L.GIPFDC...G.THP-------------
Q9CL61_PASMU/34-299------------------------------------------AEWVI----T.GVPFDA...S.VSG-------------

PF00850

A0B6D0_METTP/17-279H............................G.YS.VLK.....DRIRP....SFDALMN......S.GLVDGVEVQVFRP.
A0B926_METTP/7-310T..........DMF..MGYSFGP......E.HP.LQP.....ARIML....TYRMIEE......Y.G.........FFLG
A0DIS2_PARTE/29-344H............F.SA.K..E.........HC.ENP.....QRTQSIDKTIQNYLSS......K.D.........LKNK
A0LGT0_SYNFM/15-314H....................CTG....SN.HP.ESP.....ERLEA....VYRGVEE......A.G.........LFPR
A0YQ85_LYNSP/13-307H....................KTG....LL.HP.ERP.....ERLSA....IVKALKA......T.P.........WAAQ
A1RXP5_THEPD/28-317R..........DEW...............................TL....ARRLFYEKYLGFLR.R.........TFKV
A1W7T1_ACISJ/25-356HAPEHEFFRGERI................P.CF.ENP.....TRAAY....VEAALTA......R.G............H
A1ZSA9_9BACT/6-274N..........KQQTVQSIGSDS......P.SA.GKP.....KLVLQ....AWKKLGY......PME.........IMKV
A2BL29_HYPBU/15-315H.....................EP...PYGSHP.ESP.....ERLAI....ALESLAK......T.G.........LYTL
A2R705_ASPNC/140-407H..........CEVRPT....AD......V.HP.EDP.....RRIYY....IYKELCR......A.G.........LVDD
A3CXQ9_METMJ/14-294H....................DM.....EA.HP.ESG.....ARLRA....ALSGIPE......N..............V
A3DNS7_STAMF/16-313H..........SPW.FE..............HP.ENP.....GRIKY....VIDGIKR......N.G.........LTDY
A3GH68_PICST/21-341S..........ERV..T..KICD......L.LP.SNK.....GRQS.....LISSLLS......AYG.........LR.E
A3GTQ3_VIBCL/7-300H..........PIY..SQLDLPV......G.HR.YPI.....NKYRL....LYEEIVRQR..EQSEAWQA..SFEFHTP.
A3IXM3_9CHRO/8-295H..........DQY..VVP.LPD......G.HR.FPM.....EKFSL....LYELLLREK..VVKSNN.......IYTP.
A3JI99_9ALTE/13-341H..........PKS..YFSRGKM......R.QPQETP.....ERLTE....LLKAPQM......M.G............L
A3W9J6_9SPHN/44-368HAPLRELNNGEWM................D.FA.ESP.....ARLAS....IHASI..........G.........TG.E
A3WE49_9SPHN/7-292H..........ADY..MAP.RPT......R.GS.FKF.....DKYYL....VMEELRGSG..AAIME.........HAP.
A3WNS9_9GAMM/8-295H..........PIY..SELQLPE......R.HR.YPI.....HKYKM....LYQWALAHG..ARPDQ........FIQP.
A3Y9Y0_9GAMM/13-341QVKAE.IHNGELV................P.PF.ECK.....ERIDY....ILSELDK......R.G.........FD.K
A3ZYN7_9PLAN/13-308H....................DT.....GN.HP.ESA.....QRLLA....VTARLEQ......T.G.........LLDQ
A4BCK9_9GAMM/15-306H....................DMG....ED.HP.ESP.....RRTEI....IRERLIE......S.G.........LMEQ
A4BMJ9_9GAMM/17-332HR.......PTQDL..SDGYPGV......N.HP.EVP.....SRVDR....VLEGFAT......VWE.........VTVR
A4C5S3_9GAMM/8-296H..........PCY..STLDLPA......T.HR.FPI.....KKYRL....LFEAIKTLD..DSNHFQ.......FQLP.
A4C8Y5_9GAMM/14-303H....................KMI....VD.HP.ECP.....ERLDA....IQDRLVA......S.G.........VDVT
A4S2N1_OSTLU/197-606H.................VSFKP........HQ.ESP.....ERIVA....ILAELQR..................VIDR
A4S898_OSTLU/22-313H..........ASY..SKPVMPR......G.HR.FPM.....TVFQR....VHDILREEG..VIARGQT.....NCFVPG
A4U490_9PROT/14-308H....................DT.....GDYHP.ECA.....DRLKA....VLAGLET........E.........EFSL
A4WPH0_RHOS5/24-326P....................VGGLVQPGGGLP.ESP.....ETKRR....LKNLLDV......T.G.........LSGE
A4X4X7_SALTO/10-318D..........ENL..LSYNLGD........HP.LDP.....VRVEL....TVALARE......L.G.........VLGR
A4YNH4_BRASO/45-371HDPQFYLVRGVIK................R.TT.EQP.....ERADR....L...LAG......L.K.........AGNH
A5D0K9_PELTS/22-316H....................ET.....HG.CP.ESP.....ARVKH....TYEILKI......A.G.........MLEK
A5H660_SCHMA/8-358G..........DQY....RQLCC......S.SP.KFG.....DRYA.....LVMDLIN......AYK.........LIPE
A6C208_9PLAN/13-308H....................DT.....GD.LP.ENA.....TRILP....AMRRASQ......I.A.........MHAH
A6C6K6_9PLAN/13-308H....................ET.....GA.HP.ESS.....LRLET....VMNQVST......A.A.........IPNL
A6E8D2_9SPHI/7-293H..........EQY..VHP.LPE......G.HR.FPM.....LKYEL....IPQQLLHQG..WISSEQ.......LFAP.
A6FY71_9DELT/35-323G..........HHY..R..............HE.FPSVPVDGMRGER....ILSALVREG..LVGPEC.......VVRP.
A6GQW9_9BURK/14-305H....................NPG....LG.HP.ESM.....ARLRV....IREKLES......S.E.........LWPR
A6Q2Z0_NITSB/15-300H....................GS.....DE.HI.ENR.....FRVLS....IDDALN.........D.........FP.M
A6QAF4_SULNB/14-302H....................DTG....TA.HP.ESR.....YRLEA....IEKAVA.........P.........LKKR
A6QHR8_STAAE/14-324D...........KL..LQYRFHD......Q.HP.FNQ.....MRLKL....TTELLLN......A.N.........LLSP
A6R4B6_AJECN/49-360P..........DVE..P.HHFGS......S.HP.MKP.....WRLT.....LTKQIVM......AYG.........M..H
A6VSZ5_MARMS/14-305H....................DMG....ED.HP.ESP.....LRLGA....IQNRLIM......G.Q.........LMDF
A7E372_BOVIN/21-321S..........PRYNITFLGLEK......L.HP.FDA.....GKWGK....VISLLKEEK..LLSDSM.......LVEA.
A7SSG8_NEMVE/23-333N..........TLICSL.Y...............EVP.....DRIGR....PYEKHKE......Y.G.........LL.D
A7SUP8_NEMVE/23-330S..........EDS....VNLCD......K.LP.KVT.....GRAS.....LTSSLIE......AYG.........LLKD
A7TRW5_VANPO/9-404T..........SRF..Q.SQVAD......L.LP.CNK.....YKKSQ....LTYSLLV......SYG.........LL.D
A8ABS4_IGNH4/14-309H..................KTPP......G.HP.ESP.....ERVKA....ILDLMKR........T.........KLPN
A8MBN2_CALMQ/13-310H..................ETPS......N.HP.ESP.....NRVLS....ALSGLSG.....................L
A8ZT95_DESOH/16-310H....................KTG....HA.HP.ESP.....SRLAS....IYRMVDR......H...........FAGT
A9A062_DESOH/259-573H..........VRE..R............G.YV.ESP.....VRVKS....ILKHLER......S.D.........L..F
A9B5I1_HERA2/14-309H....................DQ.....PE.HP.ENA.....NRLRA....IHAMLAA......DYE.........LQQH
A9W0L9_METEP/18-304H..........PAY..EAE.LPE......G.HR.FPM.....RKYGR....LAELLRAR...GLVPDG.......FVTP.
B0T7F0_CAUSK/32-328Q....................PD......R.HV.YDP.....EVVRR....FRNLVDV......S.G.........LLKK
B2JV93_BURP8/15-309H....................QPG....PH.HP.ESP.....KRLDT....VLKTLRS........P.........EFAA
B4U8T2_HYDS0/14-304H....................DE.....PK.HP.ENA.....NRLKV....ALEYIYK......S.D.........IKNI
B9LI73_CHLSY/14-310H....................TW.....HG.HV.EQA.....ERLHA....IRRAIEV......D.G.........LWPR
C5KDG6_PERM5/340-870H...............GRWVRSI......K.RVLQTR.....KRYIVP..DCKESLWDSCAWADSVS.............
E0TF48_PARBH/5-292Y..........SSD..FTIALPA......G.HR.FPA.....IKYQL....LKTALIEER..LLPAE........RLAPS
E2RU63_GIAIC/11-320N..........PLF..PTFYFGL......H.HP.MKP.....FRIA.....LVNELIL......AYG.........L..D
F2G2X2_ALTMD/14-319H....................DLG....KD.HP.ESP.....DRLFA....IDDQLLS......S.G.........LDMV
O58986_PYRHO/14-303H.....................KP....KNYHP.ENP.....GRLWI....ILTAIRELG.LENQ...........IVEP
O67135_AQUAE/10-314L...........DY..GKYRYPK......N.HP.LKI.....PRVSL....LLRFLDA......M.N.........LIDE
HDA1_YEAST/69-395H..........AKIFTSYFEYID......P.HP.EDP.....RRIYR....IYKILAE......N.G.........LIND
Q00U49_OSTTA/445-741H..........ADW..ARVDLPD......G.HR.FPM.....DKYQL....ARLALQNDD..TLRGKI......ELRAS.
Q027B1_SOLUE/10-293C..........DQH..P.IPLPP......G.HK.FPT.....QKYAM....LRSKLEA......E.HR......FELTPA
Q02CA3_SOLUE/14-311H....................LAG....RR.HP.ECP.....ARFDA....VLDGLDR......A.G.........LLAK
Q0A6Z7_ALHEH/46-336W....................N.........YP.EHP.....GRLTA....IMDLLVR......E.P.........VPGV
Q0ARF0_MARMM/14-308H..................LVPP......G.HP.EHV.....GRYEA....VREALLALPGCDWREA.............
Q0EVU6_9PROT/10-312P...........EL..AAYGFGE......G.HP.FGP.....DRMNA....FWHEALR......Q.G.........LHKH
Q0FL11_9RHOB/14-304H....................VTP....EG.HP.EQV.....ARLEH....VLHALAP..................LD.L
Q0G2C9_9RHIZ/12-346HRPQQYGVHGRLV................T.PL.ENP.....NRAET....LRERLTG......M.G.........LTHR
Q0HTM8_SHESR/7-295H..........ASY..SKLALPS......H.HR.FPT.....TKYAR....LYQYLLDNQ..LAVPAQ.......FHTP.
Q0W553_UNCMA/15-300H....................GT.....ES.HI.ENA.....RRLTA....IMGGLNS......S.E.........LMGH
Q11YA3_CYTH3/7-294H..........PVY..NHP.VPE......G.HR.FPM.....LKYDL....IAEQLVYEG..TITESN.......LTTP.
Q15WQ0_PSEA6/14-301H..........PIY..SQLDLPF......K.HR.FPI.....EKYQA....IYDKLIGLG..VPQGQ........FHQP.
Q1CZX8_MYXXD/21-314H....................DPG....QG.HP.ESP.....SRLRR....ILGVLAS......T.P.........VKGT
Q1H8P7_PLADU/25-312H..........HDY..VSE.LPK......G.HR.FAM.....KKFHG....VFNYLLKDN..IIQMKQ.......VAEP.
Q1IJP8_KORVE/31-346S..........DHY..R...LPL......GEHV.FPT.....QKYEL....VKQELLEEG..VASTQD.......FLTP.
Q1N4R7_9GAMM/15-306H....................SVP....PQ.HP.ESP.....LRNLA....VETKLRQ......S.G.........LWND
Q1NWE2_9DELT/15-311H....................DPG....PG.HV.EVP.....ARLLG....LYRELAS......D.E.........QRRR
Q1PVG5_9BACT/13-309H....................DTG....IG.HP.ENA.....RRIEN....TIKYLES......D.N.........FLAH
Q1Q8W0_PSYCK/7-294S..........DIF..RYS.VPE......K.HR.FPM.....QKYTM....IPERLLAEK..TISANN.......FFAP.
Q1YFS2_MOBAS/8-295H..........PAF..DAD.FDA......A.HR.FPM.....SKFSR....LAEILVEDG..LVAPGG.......YHEP.
HDA6_CAEEL/438-748H............F.DL.E..ED......N.HP.EKP.....ARTRR....ILKTLRE......S.G.........VL.E
Q22CW6_TETTS/20-322H....................KLSK..QPP.HP.ECP.....ERIEK....IIENLKK......T.G.........LWSQ
Q232Y2_TETTS/86-443H..........PSYNITACGIEK......L.HP.FDS.....VKYGR....VFNILKEKGFLQEQGF.........YKP.
Q23M98_TETTS/2143-2453H....................KSV....RQ.HV.ECP.....ARLQS....IFNHLTT......Q.G.........LLKS
Q29CG7_DROPS/25-326S..........KSYAVRFHGLER......L.HP.FNA.....AKGKH....IHKALCAEL..SLVEGS.......FYEP.
Q2BQU8_9GAMM/14-305H....................NMG....PE.HP.ESP.....VRLLA....IKKVLEK......T.G.........LMQE
Q2FQ17_METHJ/14-290H............................ENYP.ECP.....DRVKV....TAQYLIK......N.D............I
Q2FQW8_METHJ/14-311H..........EQS...............SSHP.ERR.....ERLSY....TLDQLEE......E.G.........IFDL
Q2IF50_ANADE/16-319H....................DPG....PG.HP.ERQ.....ARLEA....ALEALAA......DPA.........LGPE
Q2JQR9_SYNJA/13-301H....................DAG....PF.HP.ERP.....ARLQA....IVKALRG......A.S.........FAEH
Q2KBQ8_RHIEC/14-309H....................VTP....AG.HP.ERS.....DRIRA....INVALEH........P.........NFER
Q2LUP3_SYNAS/17-292WA........ISP................T.HP.ERE.....ERLLY....TQDQVFE......E.G.........LLDL
Q2LVD3_SYNAS/15-311H....................LTG....PG.HP.ESP.....RRLEV....IYDMLED......R.D.........MQGR
Q2R9B1_ORYSJ/26-342D..........PGI..AHIKFSD......D.HV.MVP.....ARVA.....MAHSLVG......VYG.........M..L
Q2S035_SALRD/7-313H..........DRY..LDYHFGP......Q.HP.FSP.....VRQEM....TMDLLAA......L.G.........APLN
Q2SC27_HAHCH/8-315S..........PHYDFRLPGLAA......L.HP.FDA.....SKYSR....AWSVLREHFGEKLADIT.......LQIN.
Q30PJ4_SULDN/258-572H..........VQE..L............G.YV.EAP.....VRIPI....ILEALDK......T.G.........L..F
Q31EP6_THICR/49-347H....................DM.....SG.HP.ENA.....QRLVA....INNEMEK......Q.G.........IWPQ
Q31HC2_THICR/13-304H....................SNG....WG.HP.ENA.....QRVVR....IEQALTD......A.R.........LLSN
Q38C74_TRYB2/21-323D............C..TLSALVP......Q.HA.MKP.....YRLL.....VTMELIA......SLG.........L..K
Q39UV4_GEOMG/11-315N...........DF..SRFSYGD......D.HP.FKI.....QRIIL....ARELMGM......L.G.........LTEL
Q3AFN8_CARHZ/10-319S..........DDY..LSYRLAE......D.HP.LNP.....QRYAL....AVELMKI......A.E.........VLKE
Q3AX40_SYNS9/8-294H..........PRY..SAE.LPS......T.HR.FPM.....AKFKL....LHQLLLDQG..LIERKQ.......IHVP.
Q3IHM6_PSEHT/12-298H..........PNY..SFS.FDP......K.HR.FVM.....SKFAH....LYQHVKQLG..LVGDN........LVQP.
Q3SA60_9EURY/14-304H..........N.........MH......G.SP.EKP.....ERIEN....VYKYLKM........K.........LSDQ
Q3UG37_MOUSE/97-402H............C..L.W..DD......S.FP.ESP.....ERLHA....IREQLIL......E.G.........LL.G
Q3ZWU5_DEHSC/14-306H....................DT......GTHV.ENP.....DRLLA....IMEYLET......H.G.........LKDR
Q4D762_TRYCC/47-388Y..........ACP..VFSHKKS......G.DA.MNT.....VSSD.....VFEWVLE......PLP.........V...
Q4FNF7_PELUB/14-306H....................NTG....DG.HP.EKI.....DRVTV....VIDNFKK......L.D.........NK.N
Q4JA06_SULAC/13-290H..........RSS...............TYHV.ENP.....ERLKI....VLKALEG......R.T.........IIKP
Q4KAJ1_PSEF5/12-340HHGTE.LKDGVLK................P.SF.EQP.....SRADT....VRDRVRH......V.G.........LG.E
Q4MYQ3_THEPA/25-416H....................DDM...NQD.HV.ESH.....KRLSS....ILERLNE......A.K.........ISLK
Q4P2D6_USTMA/326-751H..........AAYLEYLCNKAP......N.HP.PQS.....HRKPH....QTSPSKSIPEDSETYT.............
Q4QAJ4_LEIMA/91-404H..........SVT..A.IAYAE......G.HL.MRP.....SRVR.....ALHALVH......SLG.........LDNA
Q4QI60_LEIMA/58-432H.................RSDMN......R.SP.ETP.....HRLQR....AIETLQG......CER.........ALDV
Q4TFH7_TETNG/505-904H............L.NL.W..DR......H.HP.EQP.....QRIFK....IFSKHQE......L.G.........LV.D
HDA21_DICDI/1072-1486H..........LVP..D............D.HP.ESP.....KRLSS....VIKAIND......FSR.........QSDR
Y535_METJA/17-305H.....................KP....KSYHV.ENP.....ERVLT....ILNSLKSNGFDDIV...........LIE.
Q59Q78_CANAL/56-379S..........EFA..T..KIVD......L.LP.SNK.....GRQS.....LVLGLIE......AYK.........LI.D
Q5AF34_CANAL/175-593H..........AFGRKWVTKSYL......S.TIFERP.....QRLLASCIGVASAVSMFPFYYKVIN.........STKR
Q5K8L3_CRYNJ/64-492S..........PAL..Q..RLSD......D.LP.SNV.....GRSS.....MVHDLIR......SLD.........LLDF
Q5KKR8_CRYNJ/28-368H..........DVG..N.YHFGL......G.HP.MKP.....HRIR.....MTHNLVV......NYG.........LADD
Q5XQ67_9ARCH/18-315H....................DT......GVHP.ETA.....ERLRA....IIRKLEE......T.G.........IAEK
Q60DG7_ORYSJ/34-350HDAGRGVFDSGRDP..GFLDVLD......Q.HP.ENA.....DRVRN....MVSILRR........G.........PIAR
Q6AJC0_DESPS/18-318H....................DTG...GGG.HP.EVP.....ARLEV....ILKCLEE......S.P.........LLPH
Q6AKN4_DESPS/15-311H....................QIE...AAS.H..ESP.....NRLRE....LFPAVRK........R.........YNGD
Q6C3Y5_YARLI/54-352H..........PLA....SKVCS......G.RP.SNE.....GRAA.....LVDSLLVALQLHKSYK.........LIPI
Q6CGA7_YARLI/254-648H..........TFGRSWMGKKYK......D.SLVERP.....ERLKATSLGVGAAIANNPGKFEIEE.........SVRQ
Q6FWB7_CANGA/8-383A..........SQF..Q.SQVVD......L.LP.CNK.....RQKSQ....LIYSMLE......SYG.........LL.E
HDAH_ALCSD/31-329Q..........PIS..H....HL......A.HP.DTK.....RRFHE.......LVCA......S.G.........QIEH
Q72NV2_LEPIC/14-310H....................NANS..TIP.HY.ENS.....DRLLA....CLNRLHQ......S.S.........YFNS
Q741C0_MYCPA/14-307H....................RTA....PG.HP.ERP.....DRYRA....VAAALSR........P.........GFDA
Q7PS30_ANOGA/118-424H............R.CL.W..DT......N.YP.ECP.....ERYLR....VMERFTI......G.Q.........LV.D
Q86YH7_HUMAN/553-881H...........QCTCG.S..SS......S.HP.EHA.....GRIQS....IWSRLQE......T.G.........LR.G
Q8EP92_OCEIH/11-321A...........DY..LKYHFHE......N.HP.FNQ.....KRVLL....TKELLEA......H.Q.........VLSN
Q8I4I9_CAEEL/17-318H....................ECKYDSTMA....ECP.....KRMKL....IYERLQK......D.K.........LLDG
Q8IR37_DROME/555-861H............C.NL.N..DT......G.HP.EQP.....SRIQH....IHKMHDD......Y.G.........LL.K
Q8LK09_MAIZE/215-515H...........SELEV.K..PN......P.HP.ERP.....DRLRA....IAASLAA......A.G.........IFPS
Q8SQN9_ENCCU/9-289E..........EVG..L.FHYGP......R.HP.MKP.....FRTV.....VTHSLVK......SFG.........L..D
HDA14_ARATH/75-387H....................NK.....ES.HP.ECS.....ARVPA....IVNALEM......N.E.........LTPK
Q98RL4_GUITH/12-313S..........KIG..N.FAYSR......F.HP.MQP.....IRLS.....MTSELIY......SYG.........M..E
Q9K0J2_NEIMB/35-328H....................EPG....AN.HP.DSP.....DRILC....IEQALRR......A.G.........IWQH
Q9U266_CAEEL/18-319H..........DQP..W....PS......Y.HI.EVP.....RRLDA....ILERLNT......T.K.........LLTD
Q9YG09_AERPE/14-309HSP.....DPYD...................HP.ENP.....SRLVE....AVRGLEE......S.G.........VYKH

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------------------------------------------
C2XKX5_BACCE/12-239--------------------------------------------------------------------------------
B9BUU1_9BURK/13-199--------------------------------------------------------------------------------
B9BQL6_9BURK/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
D1N5Z5_9BACT/4-169--------------------------------------------------------------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C2SK71_BACCE/15-171--------------------------------------------------------------------------------
C3Q562_9BACE/31-198--------------------------------------------------------------------------------
D7W5E5_9FLAO/27-172--------------------------------------------------------------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UPR5_METVS/56-208--------------------------------------------------------------------------------
A9AA45_METM6/55-201--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------
Q181H4_CLOD6/78-183--------------------------------------------------------------------------------
B6G251_9FIRM/77-182--------------------------------------------------------------------------------
B0A6K5_9FIRM/76-181--------------------------------------------------------------------------------
C0CJH7_9FIRM/6-165--------------------------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387---------------------------------------------------------------------.RPGA.R-FGP
ARGI_COCP7/16-318---------------------------------------------------------------------.NQGV..-.DP
Q6BJQ5_DEBHA/76-370---------------------------------------------------------------------.RPGA.R-FGP
Q6BVQ4_DEBHA/136-428---------------------------------------------------------------------.RPGS.R-FGP
Q6BWL4_DEBHA/179-480---------------------------------------------------------------------.RPGA.R-FGP
A1ERP9_VIBCL/33-299---------------------------------------------------------------------.RPGA.R-MGP
A0RLF1_BACAH/22-286---------------------------------------------------------------------.RPGS.R-FGP
A1RXI5_THEPD/26-288---------------------------------------------------------------------.VPGQ.R-FAP
ARGI1_XENLA/6-306---------------------------------------------------------------------.RRGV.E-EGP
SPEB_MOUSE/77-350---------------------------------------------------------------------.RPGA.R-FGP
Q9V2I5_PYRAB/21-279---------------------------------------------------------------------.KPGA.R-FGP
A4XKN0_CALS8/20-281---------------------------------------------------------------------.KPGS.R-FGP
Q55U21_CRYNB/69-375---------------------------------------------------------------------.RPGA.R-FGP
A4J1T2_DESRM/21-282---------------------------------------------------------------------.RPGT.R-QGP
B8GAJ6_CHLAD/41-309---------------------------------------------------------------------.RTGA.A-QGP
Q8ZVI7_PYRAE/9-263---------------------------------------------------------------------.RPGA.R-FAP
A1VQK9_POLNA/34-307---------------------------------------------------------------------.RPGA.R-FGP
HUTG_HALSA/36-303---------------------------------------------------------------------.RRGA.R-DGP
Q15JE9_STRHY/25-310---------------------------------------------------------------------.HQGA.E-NGP
Q1Q9T2_PSYCK/6-313---------------------------------------------------------------------.KKGA.S-LGI
Q3AGG3_SYNSC/27-286---------------------------------------------------------------------.RPGT.R-FGP
Q2K8A9_RHIEC/46-316---------------------------------------------------------------------.RSGA.R-FGP
A0B180_BURCH/43-310---------------------------------------------------------------------.RSGA.R-LGP
Q2F6C6_BOMMO/21-320---------------------------------------------------------------------.KYGV.S-IAP
B2JW15_BURP8/32-305---------------------------------------------------------------------.RPGA.R-FGP
Q6TA07_STRCL/27-300---------------------------------------------------------------------.RPGA.R-FAP
A1B175_PARDP/5-250---------------------------------------------------------------------...GP.S-LHP
ARGI_STAAC/5-298---------------------------------------------------------------------.KLGV.D-LGP
Q982X2_RHILO/42-307---------------------------------------------------------------------.RPGA.R-FGP
Q0FAM8_9RHOB/4-297---------------------------------------------------------------------.TKGC.L-MGP
Q1Z9W0_PHOPR/33-298---------------------------------------------------------------------.RSGS.R-MGP
HUTG_BACHD/35-311---------------------------------------------------------------------.HSGA.S-FAP
HUTG_RHOSR/40-314---------------------------------------------------------------------.RRGA.A-RGP
O68051_RHOCA/3-297---------------------------------------------------------------------.QPGC.V-MGP
ARGI1_HUMAN/6-305---------------------------------------------------------------------.RGGV.E-EGP
SPEB_CHRVO/44-311---------------------------------------------------------------------.RSGA.R-MGP
ARGI_BACSU/3-292---------------------------------------------------------------------.RRGV.D-MGP
Q97ZX8_SULSO/24-289---------------------------------------------------------------------.RPGS.R-FAP
HUTG_VIBVY/45-328---------------------------------------------------------------------.RIGA.K-KSP
A9BRG6_DELAS/16-312---------------------------------------------------------------------.RLGS.A-MGP
A1ESE8_VIBCL/43-325---------------------------------------------------------------------.RTGA.K-HAP
HUTG_AROAE/40-323---------------------------------------------------------------------.RAGA.A-EGP
Q6MM35_BDEBA/43-314---------------------------------------------------------------------.RVGA.Q-VAP
A1RB53_ARTAT/29-311---------------------------------------------------------------------.HDGA.E-NGP
Q1J2W9_DEIGD/37-306---------------------------------------------------------------------.RPGA.R-YAP
Q1ZN31_PHOAS/36-323---------------------------------------------------------------------.RIGA.C-EGP
Q2JER0_FRASC/40-318---------------------------------------------------------------------.RPGA.R-FGP
Q3J346_RHOS4/3-296---------------------------------------------------------------------.RPGC.L-MGP
A9B324_HERA2/22-290---------------------------------------------------------------------.GGGT.V-NGP
HUTG_LEGPL/46-318---------------------------------------------------------------------.RTGA.K-LGP
Q9YBG0_AERPE/29-298---------------------------------------------------------------------.RPGQ.R-FAP
Q1GI44_SILST/34-307---------------------------------------------------------------------.RSGT.R-FGP
Q9HJB2_THEAC/33-293---------------------------------------------------------------------.RRGS.K-YAP
A0RXD6_CENSY/22-283---------------------------------------------------------------------.RPGT.R-FGP
A8LLU9_DINSH/46-312---------------------------------------------------------------------.RPGC.R-LGP
Q1V061_PELUQ/39-314---------------------------------------------------------------------.RPGA.R-FGP
SPEB_BACHD/22-286---------------------------------------------------------------------.RPSS.R-FGP
Q0AG49_NITEC/44-311---------------------------------------------------------------------.RSGA.R-FGP
Q2CCZ9_9RHOB/3-297---------------------------------------------------------------------.NQGC.R-MGP
Q0W940_UNCMA/16-280---------------------------------------------------------------------.RAGS.R-WAP
Q97BB8_THEVO/33-293---------------------------------------------------------------------.RRGS.K-YAP
ARGI_BREBE/3-294---------------------------------------------------------------------.RRGV.D-MGP
Q6MHV0_BDEBA/36-309---------------------------------------------------------------------.RPGG.R-FAP
Q98MW3_RHILO/19-296---------------------------------------------------------------------.SSGH.A-LAA
A0LG67_SYNFM/34-297---------------------------------------------------------------------.RAGT.R-EGP
Q1EQG5_STRKN/2-295---------------------------------------------------------------------.PPAP.G-TVP
Q1Q5Q5_9BACT/32-299---------------------------------------------------------------------.QSGT.K-KGP
A0NSP7_9RHOB/73-349---------------------------------------------------------------------.RPGT.R-FGP
HUTG_BACSU/35-311---------------------------------------------------------------------.HSGA.S-FAP
B8FZG3_DESHD/20-281---------------------------------------------------------------------.RPGT.R-LGP
Q9K5Y7_BACHD/5-297---------------------------------------------------------------------.RRGV.D-MGP
Q7W6W6_BORPA/29-307---------------------------------------------------------------------FRIGA.R-QGP
Q6W399_9CREN/23-284---------------------------------------------------------------------.KPGC.R-FGP
Q0AE23_NITEC/40-304---------------------------------------------------------------------.RSGA.R-LGP
Q1MIP6_RHIL3/52-317---------------------------------------------------------------------.RPGT.R-FGP
A2CDX1_PROM3/29-293---------------------------------------------------------------------.RPGS.R-FGP
Q164F4_ROSDO/46-312---------------------------------------------------------------------.RPGT.R-LGP
Q164F5_ROSDO/34-308---------------------------------------------------------------------.RSGT.R-FGP
Q0G0L1_9RHIZ/42-312---------------------------------------------------------------------.RPGA.R-FGP
Q15X44_PSEA6/42-323---------------------------------------------------------------------.RVGA.K-TGP
A0SJA7_STAXY/3-297---------------------------------------------------------------------.KLGV.N-LGP
Q1N5V2_9GAMM/42-308---------------------------------------------------------------------.RSGA.R-FGP
Q4CMT4_TRYCC/16-290---------------------------------------------------------------------...GA.S-NSS
Q2CC50_9RHOB/34-307---------------------------------------------------------------------.RPGT.R-LGP
Q11J67_MESSB/42-307---------------------------------------------------------------------.RPGA.R-FGP
Q1AWJ4_RUBXD/5-295---------------------------------------------------------------------.RRGV.D-MGP
Q46EM0_METBF/17-282---------------------------------------------------------------------.RAGS.R-WAP
Q8TZN1_PYRFU/56-314---------------------------------------------------------------------.KPGA.R-FGP
Q18F18_HALWD/14-268---------------------------------------------------------------------.LPGT.R-FGP
Q5V1C2_HALMA/37-301---------------------------------------------------------------------.RPGA.R-AGP
Q5WL42_BACSK/7-290---------------------------------------------------------------------GRPGS.R-FAP
Q7UZH9_PROMP/24-288---------------------------------------------------------------------.KSGT.R-FGP
Q6CLB8_KLULA/137-438---------------------------------------------------------------------.RPGA.R-FGP
A0JT79_ARTS2/57-331---------------------------------------------------------------------.RPGA.R-FGA
Q2KVZ3_BORA1/13-287---------------------------------------------------------------------FRVGS.R-QGP
A8H965_SHEPA/50-335---------------------------------------------------------------------.RGGA.T-DAF
Q75TI1_GEOSE/31-304---------------------------------------------------------------------.RTGQ.R-YGP
B2UBQ2_RALPJ/40-316---------------------------------------------------------------------.RTGA.Q-AGP
Q165U0_ROSDO/35-314---------------------------------------------------------------------.RAGA.R-FGP
B1YHV3_EXIS2/22-286---------------------------------------------------------------------.RPGS.R-FGP
Q5WIT9_BACSK/27-306---------------------------------------------------------------------DYTGC.E-LGP
Q13CK1_RHOPS/14-311---------------------------------------------------------------------.LRGT.L-MGP
Q1YMK4_MOBAS/42-312---------------------------------------------------------------------.RPGT.R-FGP
A1C610_ASPCL/68-380---------------------------------------------------------------------.RPGA.R-FGP
Q39HU1_BURS3/40-306---------------------------------------------------------------------.RPGT.R-FGP
Q05V55_9SYNE/29-297---------------------------------------------------------------------.RPGT.R-FGP
Q1AS11_RUBXD/33-307---------------------------------------------------------------------.RVGA.R-FGP
A0NXD9_9RHOB/25-301---------------------------------------------------------------------.RSGA.R-MGP
SPEB_NEIMA/35-300---------------------------------------------------------------------.RSGA.R-FGP
A3QIE0_SHELP/50-335---------------------------------------------------------------------.RGGA.V-DGF
Q28QX8_JANSC/39-314---------------------------------------------------------------------.RPGA.R-HGP
A1WGI6_VEREI/22-320---------------------------------------------------------------------.VRGA.S-MGP
A1WER7_VEREI/22-295---------------------------------------------------------------------.RSGT.R-FGP
A1T3A2_MYCVP/88-364---------------------------------------------------------------------.RPGT.R-FGP
HUTG_ENT38/42-310---------------------------------------------------------------------.RTGA.A-QAP
A8LRL4_DINSH/4-296---------------------------------------------------------------------.RRGC.L-MGP
Q46TX4_CUPPJ/2-296---------------------------------------------------------------------.TRGC.T-MGP
A5V551_SPHWW/4-298---------------------------------------------------------------------.RPGC.A-MGP
Q2B9I2_9BACI/37-317---------------------------------------------------------------------.VSGA.S-LYP
Q1I7X5_PSEE4/43-309---------------------------------------------------------------------.RPGA.R-FGP
Q11NZ4_CYTH3/3-310---------------------------------------------------------------------.RMGT.S-LAV
Q5V4R8_HALMA/3-300---------------------------------------------------------------------.RRGV.D-MGP
SPEB_SERP5/33-298---------------------------------------------------------------------.RAGG.R-HGP
Q6AG97_LEIXX/4-273---------------------------------------------------------------------.GSGS.S-RAM
Q12BY7_POLSJ/72-342---------------------------------------------------------------------.RAGA.R-LGP
HUTG_VIBF1/45-345---------------------------------------------------------------------.RKGA.Y-AAP
Q0UDP7_PHANO/4-284---------------------------------------------------------------------.RVGD..-.GP
Q0FAR0_9RHOB/34-308---------------------------------------------------------------------.RSGA.R-FGP
Q3IVT5_RHOS4/32-308---------------------------------------------------------------------.RTGA.R-FAP
HUTG_GEOKA/44-315---------------------------------------------------------------------.RQGA.K-EAP
SPEB_BLOFL/33-298---------------------------------------------------------------------.RSGS.R-FGP
A0ZFA2_NODSP/30-338---------------------------------------------------------------------.GAGT.A-KAP
A2C5F5_PROM1/29-293---------------------------------------------------------------------.RPGA.R-FGP
A4XT95_PSEMY/38-311---------------------------------------------------------------------.RSGT.R-FGP
Q5WB32_BACSK/22-286---------------------------------------------------------------------.RPGS.R-FGP
Q6C6P6_YARLI/9-306---------------------------------------------------------------------.KGGV.D-KGP
HUTG_NOCFA/35-303---------------------------------------------------------------------.RVGA.A-AGP
Q12UU8_METBU/17-282---------------------------------------------------------------------.RAGS.R-WAP
A1UHG9_MYCSK/34-307---------------------------------------------------------------------.RPGA.R-FGP
A0B2Z1_BURCH/72-345---------------------------------------------------------------------.RTGA.R-FGP
ARGI_BACCD/2-295---------------------------------------------------------------------.RRGV.D-MGP
Q213G1_RHOPB/11-309---------------------------------------------------------------------.QPGT.L-MGP
A7NL23_ROSCS/33-307---------------------------------------------------------------------.KVGA.R-FGP
Q28PV5_JANSC/46-313---------------------------------------------------------------------.RPGT.R-LGP
A0QRD0_MYCS2/43-317---------------------------------------------------------------------.RPGA.R-FGP
Q02UC9_PSEAB/35-308---------------------------------------------------------------------.RAGA.R-HGP
Q1MAU5_RHIL3/40-310---------------------------------------------------------------------.RAGA.R-LGP
ARGI_NEUCR/47-354---------------------------------------------------------------------.KPGV.D-AAP
A5ENL2_BRASB/10-307---------------------------------------------------------------------.VRGT.L-MGP
Q12LW8_SHEDO/33-299---------------------------------------------------------------------.RSGG.R-MGP
Q2W8C1_MAGSA/22-290---------------------------------------------------------------------.RSGA.R-EGP
Q6CIB4_KLULA/61-358---------------------------------------------------------------------.RGGA.R-FGP
C5PF24_COCP7/77-371---------------------------------------------------------------------.RPGA.R-YGP
A1SLP1_NOCSJ/31-312---------------------------------------------------------------------.RPGT.R-FGP
A0RH36_BACAH/35-312---------------------------------------------------------------------.HSGA.S-FAP
Q7P2W8_FUSNV/500-780---------------------------------------------------------------------.KTGT.E-FGP
A6UDJ1_SINMW/2-296---------------------------------------------------------------------.RRGA.G-MGP
Q28VR8_JANSC/34-309---------------------------------------------------------------------.RPGA.R-FGP
B4STA0_STRM5/5-299---------------------------------------------------------------------.HRGA.R-LGP
A6U7T5_SINMW/42-307---------------------------------------------------------------------.RPGA.R-FGP
Q0UYW2_PHANO/16-320---------------------------------------------------------------------.KPGV.D-AAP
O96394_LEIAM/13-316---------------------------------------------------------------------.HSGV.E-LGP
Y309_METJA/21-281---------------------------------------------------------------------.KPGA.R-EGG
Q9RZ04_DEIRA/29-298---------------------------------------------------------------------.RPGA.R-FAP
Q6CLS8_KLULA/13-315---------------------------------------------------------------------.KSGV.E-NGP
A2BIW8_HYPBU/25-300---------------------------------------------------------------------.RPGS.R-FAP
Q21RM0_RHOFD/15-309---------------------------------------------------------------------.MLGA.R-MGP
Q6L151_PICTO/19-280---------------------------------------------------------------------.RRGS.R-LSP
Q4P4M4_USTMA/13-318---------------------------------------------------------------------.RKGV.D-TGP
Q0I684_SYNS3/31-289---------------------------------------------------------------------.RPGT.R-FGP
A1B165_PARDP/30-308---------------------------------------------------------------------.TNDQ.T-RAP
Q11QL1_CYTH3/66-323---------------------------------------------------------------------.NMGA.E-KGA
Q16AD8_ROSDO/4-296---------------------------------------------------------------------.RQGC.L-MGP
Q3SMM1_THIDA/8-294---------------------------------------------------------------------.DPGC.A-AGP
Q5AK86_CANAL/12-313---------------------------------------------------------------------.KGGV.E-LGP
Q1IPT1_KORVE/2-256---------------------------------------------------------------------.LRGP.A-EAP
Q7VSA1_BORPE/8-302---------------------------------------------------------------------.QRGA.S-MGP
Q82LW5_STRAW/2-295---------------------------------------------------------------------.PPAP.G-TVP
A0BHR2_PARTE/9-311---------------------------------------------------------------------.KTGT.E-LAP
A1UI81_MYCSK/60-335---------------------------------------------------------------------.RPGA.R-FGP
HUTG_COREF/43-309---------------------------------------------------------------------.TAGA.A-LGP
Q2JWU8_SYNJA/14-265---------------------------------------------------------------------...GPDT-QAP
B0K9I6_THEP3/23-285---------------------------------------------------------------------.KAGS.R-FGP
Q49V90_STAS1/26-305---------------------------------------------------------------------DYTGV.E-LGP
Q4JAE9_SULAC/24-287---------------------------------------------------------------------.RPGS.R-FAP
A1UE14_MYCSK/29-310---------------------------------------------------------------------.RSGA.R-FGP
A0P3L0_9RHOB/6-302---------------------------------------------------------------------.QRGC.L-MGP
Q0FDK0_9RHOB/32-317---------------------------------------------------------------------.ERDQ.H-LGP
Q1YIK6_MOBAS/68-338---------------------------------------------------------------------.RNGS.R-FGP
Q088H7_SHEFN/48-332---------------------------------------------------------------------.RGGA.D-DAF
Q5JI38_PYRKO/22-281---------------------------------------------------------------------.KAGA.R-FGP
Q975R8_SULTO/24-287---------------------------------------------------------------------.RPGS.R-FAP
Q1LGD2_RALME/2-296---------------------------------------------------------------------.IRGA.S-MGP
ARGI_AGRT5/19-313---------------------------------------------------------------------.QPGC.L-MGP
Q1D421_MYXXD/27-337---------------------------------------------------------------------.GGGT.S-EGP
SPEB1_SCHPO/74-375---------------------------------------------------------------------.RPGA.R-FGP
YHMF_METFE/21-281---------------------------------------------------------------------.KPGS.R-FGP
ARGI_YEAST/13-329---------------------------------------------------------------------.KLGV.E-KGP
A7NMZ3_ROSCS/53-326---------------------------------------------------------------------...GS.T-PAE
A9BN56_DELAS/71-341---------------------------------------------------------------------.RSGC.R-FGP
Q5A4M3_CANAL/50-340---------------------------------------------------------------------.RPGA.R-FGP
Q4T7Z4_TETNG/3-305---------------------------------------------------------------------.RSGV.E-RGP
A2BTR8_PROMS/23-287---------------------------------------------------------------------.KPGA.R-FGP
Q0FX33_9RHOB/3-297---------------------------------------------------------------------.QRGC.I-MGP
A1RBR9_ARTAT/55-335---------------------------------------------------------------------.RPGA.R-FGP
A1VTU0_POLNA/3-297---------------------------------------------------------------------.TRGA.S-MGP
Q4RH16_TETNG/25-302---------------------------------------------------------------------.RRGV.E-HGP
Q0UMJ9_PHANO/68-378---------------------------------------------------------------------.RPGA.R-FGP
Q2U075_ASPOR/4-285---------------------------------------------------------------------.RVGN..-.GP
A1SM48_NOCSJ/41-314---------------------------------------------------------------------.RPGA.R-FGP
Q1GI45_SILST/67-333---------------------------------------------------------------------.RPGT.R-LGP
A0Y6C5_9GAMM/33-299---------------------------------------------------------------------.RPGA.R-LGP
PAH_STRCL/30-303---------------------------------------------------------------------.RPGA.R-FGP
Q1IHQ4_KORVE/16-311---------------------------------------------------------------------.RRGV.D-MGP
Q5K413_AGABI/11-307---------------------------------------------------------------------.RTGV.D-QGP
Q6L2W0_PICTO/21-293---------------------------------------------------------------------.RRGA.R-YGP
A0R8M1_BACAH/3-293---------------------------------------------------------------------.RRGV.D-MGP
Q89H72_BRAJA/11-308---------------------------------------------------------------------.QRGT.L-MGP
Q0FFB5_9RHOB/42-315---------------------------------------------------------------------.RPGP.R-HGP
A1ZN63_9BACT/41-299---------------------------------------------------------------------.NQGV.A-KAA
A0Z3U1_9GAMM/41-307---------------------------------------------------------------------.RSGT.R-LGP
B1KRD6_SHEWM/33-299---------------------------------------------------------------------.RSGG.R-MGP
Q489X2_COLP3/36-310---------------------------------------------------------------------.RSGT.R-FGP
Q7V9I4_PROMA/29-293---------------------------------------------------------------------.RPGA.R-FGP
SPEB1_SYNY3/26-297---------------------------------------------------------------------.RKGC.E-HGP
Q6FP31_CANGA/10-317---------------------------------------------------------------------.KLGV.E-KGP
Q2CAN0_9RHOB/40-305---------------------------------------------------------------------.RPGC.R-LGP
A5G414_GEOUR/41-319---------------------------------------------------------------------TFSGC.E-LSP
A0YPG8_LYNSP/25-295---------------------------------------------------------------------.RKGC.E-NGP
Q3SVS2_NITWN/5-302---------------------------------------------------------------------.QRGT.L-MGP
SPEB2_SCHPO/89-401---------------------------------------------------------------------.RPGA.R-FGP
Q8XPR0_RALSO/29-309---------------------------------------------------------------------.SNDQ.T-NAP
Q52V70_9ACTO/41-314---------------------------------------------------------------------.RPGA.R-FGG
Q08C97_DANRE/85-358---------------------------------------------------------------------.RPGA.R-FGP
A4G0Y7_METM5/19-278---------------------------------------------------------------------.KPGA.R-FGP
Q47TW8_THEFY/41-314---------------------------------------------------------------------.RPGA.R-FGP
A9KQ98_CLOPH/18-281---------------------------------------------------------------------.RPGT.R-FAS
A1BCD2_PARDP/35-312---------------------------------------------------------------------.RAGA.R-HGP
B9LGA1_CHLSY/41-309---------------------------------------------------------------------.RPGA.A-QGP
ARGI_ASHGO/93-395---------------------------------------------------------------------.KSGV.E-DGP
A1B3P5_PARDP/3-295---------------------------------------------------------------------.RPGC.L-MGP
Q1QTM4_CHRSD/39-312---------------------------------------------------------------------.RPGT.R-LGP
Q6C732_YARLI/86-381---------------------------------------------------------------------.RSGA.R-FGP
A0LDK6_MAGSM/20-293---------------------------------------------------------------------.GTGT.S-QGP
Q47D78_DECAR/17-302---------------------------------------------------------------------.DQAC.E-DGP
Q3JAG2_NITOC/2-290---------------------------------------------------------------------.DRRC.E-AGP
A6UC62_SINMW/70-340---------------------------------------------------------------------.RPGA.R-FGP
A3DDA1_CLOTH/24-286---------------------------------------------------------------------.RPGT.R-FGP
A1CKP4_ASPCL/16-320---------------------------------------------------------------------.KLGV.E-AAP
B8G5W4_CHLAD/5-298---------------------------------------------------------------------.RRGV.D-MGP
ARGI1_SCHPO/22-319---------------------------------------------------------------------.KDGA.E-LAP
Q1QAH6_PSYCK/33-307---------------------------------------------------------------------.RSGA.R-LGP
HUTG_PHOLL/44-316---------------------------------------------------------------------.RPGA.N-QGP
Q1MB14_RHIL3/6-300---------------------------------------------------------------------.RRGA.A-MGP
Q3IQJ3_NATPD/45-332---------------------------------------------------------------------.RPGA.R-FGP
A5FB51_FLAJ1/47-336---------------------------------------------------------------------.RPGT.A-SAW
Q2BIH2_9GAMM/39-305---------------------------------------------------------------------.RSGA.R-FGP
SPEB2_SYNY3/83-361---------------------------------------------------------------------.RPGT.R-FGP
Q5LKZ4_SILPO/42-315---------------------------------------------------------------------.RPGP.R-HGP
Q2RHH4_MOOTA/26-287---------------------------------------------------------------------.RPGT.R-WGP
Q2B080_9BACI/2-294---------------------------------------------------------------------.RRGV.D-MGP
Q17HI3_AEDAE/32-333---------------------------------------------------------------------.KKGV.G-LGP
A1RP77_SHESW/50-343---------------------------------------------------------------------.RSGA.T-DAF
A3CU48_METMJ/19-276---------------------------------------------------------------------.RPGT.R-FGP
HUTG_HAHCH/40-316---------------------------------------------------------------------.RVGA.A-NGP
Q4QBG9_LEIMA/24-299---------------------------------------------------------------------...GA.H-MSS
Q8RA93_THETN/28-290---------------------------------------------------------------------.KPGT.R-FGP
Q8END5_OCEIH/29-310---------------------------------------------------------------------DYTGC.E-LGP
Q493F1_BLOPB/33-298---------------------------------------------------------------------.RSGS.R-FGP
Q5ANN8_CANAL/115-414---------------------------------------------------------------------.RPGA.R-FGP
A0NZA6_9RHOB/69-339---------------------------------------------------------------------.RNGT.R-FGP
A1VGG3_DESVV/22-283---------------------------------------------------------------------.GGGT.A-AGP
B2T8M0_BURPP/39-312---------------------------------------------------------------------.RPGA.R-HGP
Q2LPR8_SYNAS/65-343---------------------------------------------------------------------SFSGC.E-LAP
A1ST87_PSYIN/33-299---------------------------------------------------------------------.RSGA.R-MGP
ARGI1_ARATH/63-338---------------------------------------------------------------------.LQGP.A-FAP
Q5HZ88_XENLA/108-381---------------------------------------------------------------------.RPGA.R-FGP
O29611_ARCFU/17-266---------------------------------------------------------------------.KPGS.R-FAP
Q1V7V4_VIBAL/45-328---------------------------------------------------------------------.RIGA.K-KAP
ARGI_LITCT/7-306---------------------------------------------------------------------.RGGV.E-EGP
Q5SJ85_THET8/15-277---------------------------------------------------------------------.LPGA.R-RGP
A0R0G1_MYCS2/40-312---------------------------------------------------------------------.RPGA.R-FGP
A1CFK4_ASPCL/83-374---------------------------------------------------------------------.RPGA.R-FGP
B8I5M8_CLOCE/21-282---------------------------------------------------------------------.RPGT.R-FAP
A1TIE4_ACIAC/8-305---------------------------------------------------------------------.RLGA.A-MGP
B1KR08_SHEWM/50-335---------------------------------------------------------------------.RGGA.T-DAF
Q0FJQ8_9RHOB/38-313---------------------------------------------------------------------.RAGA.R-FGP
A1T9H7_MYCVP/46-324---------------------------------------------------------------------.RPGA.R-FGP
Q97VA3_SULSO/30-299---------------------------------------------------------------------.RPGA.R-FGP
B1YR75_BURA4/21-323---------------------------------------------------------------------.PNGA.G-REP
Q8TXD6_METKA/24-253---------------------------------------------------------------------.PTGQ.A-EAP
Q581Y0_TRYB2/24-298---------------------------------------------------------------------...GM.P-RRA
Q4J720_SULAC/30-299---------------------------------------------------------------------.RTGA.R-FGP
Q3J2B4_RHOS4/46-312---------------------------------------------------------------------.RTGT.R-FGP
A1CGK0_ASPCL/61-357---------------------------------------------------------------------.RPGA.R-FGP
Q10Y47_TRIEI/24-296---------------------------------------------------------------------.RRGC.V-NGP
A5G278_ACICJ/28-297---------------------------------------------------------------------.RAGT.R-SGP
ARGI_SOYBN/71-346---------------------------------------------------------------------.LEGP.A-FAP
A0NYN1_9RHOB/60-337---------------------------------------------------------------------.SNGY.T-GAA
Q98B74_RHILO/368-601---------------------------------------------------------------------AREGT..-...
O76895_DROME/30-333---------------------------------------------------------------------.KQGV.E-LAP
A1W2M6_ACISJ/2-298---------------------------------------------------------------------.VLGA.S-MGP
Q4A3J0_CYPCA/24-323---------------------------------------------------------------------.RRGV.E-HGP
B2TBR8_BURPP/45-312---------------------------------------------------------------------.RPGT.R-FGP
A8GC83_SERP5/32-305---------------------------------------------------------------------.RSGT.R-YGP
B7WTA0_COMTE/4-303---------------------------------------------------------------------.RLGA.A-MGP
Q0F026_9PROT/13-273---------------------------------------------------------------------.RPGS.R-FGP
A7NJ86_ROSCS/2-295---------------------------------------------------------------------.RRGV.D-MGP
Q1GHG8_SILST/4-296---------------------------------------------------------------------.RTGC.L-MGP
Q9HP79_HALSA/17-266---------------------------------------------------------------------.QPGT.R-FGP
Q65P52_BACLD/4-300---------------------------------------------------------------------.RRGV.D-MGP
Q4A3J2_CYPCA/25-324---------------------------------------------------------------------.RDGV.Q-RGP
Q67TJ0_SYMTH/28-290---------------------------------------------------------------------.RPGT.R-FGP
A4XZN2_PSEMY/43-309---------------------------------------------------------------------.RPGS.R-FGP
Q5LVU6_SILPO/18-278---------------------------------------------------------------------.GSGT.A-GGP
A1A614_XENLA/26-326---------------------------------------------------------------------.RRGV.E-HGP
A4YE21_METS5/29-295---------------------------------------------------------------------.RPGA.R-FGP
Q5QV39_IDILO/51-340---------------------------------------------------------------------.RAGA.D-DGW
A1ZJF0_9BACT/15-273---------------------------------------------------------------------.MDGA.R-LGP
A1SAJ7_SHEAM/49-334---------------------------------------------------------------------.RGGA.T-NAF
Q6ANF4_DESPS/59-334---------------------------------------------------------------------.KPGC.R-FGP
Q0SVK6_CLOPS/20-280---------------------------------------------------------------------.RPGT.R-FAS
A1RSZ1_PYRIL/9-263---------------------------------------------------------------------.RPGT.R-FAP
Q5V104_HALMA/12-261---------------------------------------------------------------------.RPGA.R-FGP
Q5QTW3_IDILO/29-298---------------------------------------------------------------------.RKGT.R-EGP
A0NU34_9RHOB/41-306---------------------------------------------------------------------.RPGA.R-FGP
A1ZV42_9BACT/26-290---------------------------------------------------------------------.IKGA.D-KGP
Q222F3_RHOFD/24-298---------------------------------------------------------------------.RPGA.R-FGP
ARGI2_MOUSE/24-324---------------------------------------------------------------------.KLGV.E-YGP
Q1Z3J6_PHOPR/33-324---------------------------------------------------------------------.RLSD.S-DGP
Q315M1_DESDG/23-287---------------------------------------------------------------------.GGGT.F-RGP
A7IL28_XANP2/50-316---------------------------------------------------------------------.RPGT.R-FGP
Q18A84_CLOD6/21-285---------------------------------------------------------------------.RPGA.R-FAS
Q07N69_RHOP5/13-310---------------------------------------------------------------------.QRGT.L-MGP
A0M038_GRAFK/2-255---------------------------------------------------------------------.QKGP.K-LAP
B8FW33_DESHD/4-296---------------------------------------------------------------------.RRGV.D-MGP
Q5V6R7_HALMA/44-335---------------------------------------------------------------------.RPGT.R-YGP
Q5LRK8_SILPO/33-325---------------------------------------------------------------------.RTGC.L-MGP
Q9K8M2_BACHD/4-296---------------------------------------------------------------------.RRGV.D-MGP
Q3ABP1_CARHZ/20-281---------------------------------------------------------------------.RPGA.R-MAP
A9CJC2_AGRT5/42-307---------------------------------------------------------------------.RPGA.R-FGP
Q0FFC7_9RHOB/42-306---------------------------------------------------------------------.RPGC.R-LGP
Q7U3K9_SYNPX/21-280---------------------------------------------------------------------.RPGT.R-FGP
Q4D5Y5_TRYCC/22-297---------------------------------------------------------------------.RAGA.K-KGP
A1STQ5_PSYIN/47-343---------------------------------------------------------------------.RIGA.F-HGP
Q7VY32_BORPE/13-287---------------------------------------------------------------------FRVGA.R-QGP
Q9CL61_PASMU/34-299---------------------------------------------------------------------.RAGT.R-FGA

PF00850

A0B6D0_METTP/17-279........................................................................QPAP.VEL
A0B926_METTP/7-310YDTE................................................................VQMPYYAS.EDD
A0DIS2_PARTE/29-344VEQ.................................................................LSQFEQCD.INH
A0LGT0_SYNFM/15-314LTL..................................................................IKASPAK.LKW
A0YQ85_LYNSP/13-307IDWQFPTAV......................................................TKDSKTKLKPL......
A1RXP5_THEPD/28-317EV...................................................................HEVKRYP.ESV
A1W7T1_ACISJ/25-356VL....................................................................HPPDVDCTEV
A1ZSA9_9BACT/6-274........................................................................RPLT.VDE
A2BL29_HYPBU/15-315VHI.................................................................QPAPRRGLERDR
A2R705_ASPNC/140-407PESCRPLV.......................................................SRPLKRINARNAT.EAE
A3CXQ9_METMJ/14-294RW...................................................................RAPVRAT.ESD
A3DNS7_STAMF/16-313TR...................................................................FVKHSYE.EKE
A3GH68_PICST/21-341RCYG................................................................IIGEYRAS.RQE
A3GTQ3_VIBCL/7-300........................................................................IAAE.LSR
A3IXM3_9CHRO/8-295........................................................................ECPE.KSL
A3JI99_9ALTE/13-341EV...................................................................TTAKEIG.IEP
A3W9J6_9SPHN/44-368A......................................................................PRDHG.MAP
A3WE49_9SPHN/7-292........................................................................DPMP.RDW
A3WNS9_9GAMM/8-295........................................................................TPMN.WSQ
A3Y9Y0_9GAMM/13-341PI....................................................................SEQAFN.LDT
A3ZYN7_9PLAN/13-308CLR..................................................................PQWAHAT.AQD
A4BCK9_9GAMM/15-306LLP..................................................................LKAFQAT.KSQ
A4BMJ9_9GAMM/17-332T......................................................................VEHLA.WDA
A4C5S3_9GAMM/8-296........................................................................TPAT.SQQ
A4C8Y5_9GAMM/14-303IAH..................................................................KLAPKAT.LAH
A4S2N1_OSTLU/197-606GELAMGE..........................................................LDKTCTFGAAE.PSD
A4S898_OSTLU/22-313........................................................................RAPS.VDE
A4U490_9PROT/14-308LQR..................................................................EEAPQAS.REH
A4WPH0_RHOS5/24-326LRM..................................................................LHAAPAT.EEE
A4X4X7_SALTO/10-318SGVR................................................................LVEPKPVD.DEL
A4YNH4_BRASO/45-371EL...................................................................VAPIQFG.QEA
A5D0K9_PELTS/22-316LVT..................................................................IKPRPAT.VEE
A5H660_SCHMA/8-358LSRVP..............................................................PLQWDSPSRMYEA
A6C208_9PLAN/13-308CRQ..................................................................RSWNEVT.DTV
A6C6K6_9PLAN/13-308MIL..................................................................KDPTVGA.GEE
A6E8D2_9SPHI/7-293........................................................................DLLN.EEL
A6FY71_9DELT/35-323........................................................................TPAA.FVK
A6GQW9_9BURK/14-305LVH..................................................................CEAPEVA.WSA
A6Q2Z0_NITSB/15-300IP...................................................................FPVHMAS.KEE
A6QAF4_SULNB/14-302LID..................................................................VSPISVS.EKV
A6QHR8_STAAE/14-324EQI..................................................................VQPRIAT.DDE
A6R4B6_AJECN/49-360HAMD................................................................LYKTREAT.YEE
A6VSZ5_MARMS/14-305LRR..................................................................LESDPAT.REQ
A7E372_BOVIN/21-321........................................................................REAS.DED
A7SSG8_NEMVE/23-333RCY.................................................................KIPSRHAT.EED
A7SUP8_NEMVE/23-330RNIR................................................................VIAPRKAT.ASE
A7TRW5_VANPO/9-404GFDV................................................................IIDDPCCN.KKD
A8ABS4_IGNH4/14-309YVE.................................................................VRSPVPID.ERE
A8MBN2_CALMQ/13-310AK....................................................................VIKPMV.NVD
A8ZT95_DESOH/16-310VTT..................................................................MTPEPAT.LDQ
A9A062_DESOH/259-573SV...................................................................LPVRHFA.DDH
A9B5I1_HERA2/14-309LTP..................................................................LAPRHAT.AAE
A9W0L9_METEP/18-304........................................................................EPAD.AAL
B0T7F0_CAUSK/32-328LVD..................................................................IPARLAT.GLE
B2JV93_BURP8/15-309LAW..................................................................RDAPMGT.VEQ
B4U8T2_HYDS0/14-304LSF..................................................................EKPRKAT.VEE
B9LI73_CHLSY/14-310LLQ..................................................................LPIRPAT.EAE
C5KDG6_PERM5/340-870........................................................................SPVTIPDV
E0TF48_PARBH/5-292........................................................................PAAR.EGE
E2RU63_GIAIC/11-320EHLN................................................................YYTPRDAT.FQD
F2G2X2_ALTMD/14-319CEH..................................................................ADATPIA.EAY
O58986_PYRHO/14-303........................................................................LPID.EAQ
O67135_AQUAE/10-314KEL..................................................................IKSRPAT.KEE
HDA1_YEAST/69-395PTLSGVDDL......................................................GDLMLKIPVRAAT.SEE
Q00U49_OSTTA/445-741........................................................................PLVD.IED
Q027B1_SOLUE/10-293........................................................................PPAE.IAQ
Q02CA3_SOLUE/14-311MLR..................................................................VEARDAT.QEE
Q0A6Z7_ALHEH/46-336TF...................................................................RTGRAAT.PAE
Q0ARF0_MARMM/14-308........................................................................PTAA.MTD
Q0EVU6_9PROT/10-312VSM..................................................................TAPVMAT.RAA
Q0FL11_9RHOB/14-304LR...................................................................LSAPPAS.DED
Q0G2C9_9RHIZ/12-346Q......................................................................PEDVG.VEA
Q0HTM8_SHESR/7-295........................................................................SPMT.AED
Q0W553_UNCMA/15-300VDV..................................................................VSLGRAA.ERQ
Q11YA3_CYTH3/7-294........................................................................VRIA.SED
Q15WQ0_PSEA6/14-301........................................................................HALT.PSQ
Q1CZX8_MYXXD/21-314VM...................................................................TAPRSAT.EAE
Q1H8P7_PLADU/25-312........................................................................DEVS.SQV
Q1IJP8_KORVE/31-346........................................................................TPAT.EAD
Q1N4R7_9GAMM/15-306LSI..................................................................EQAKPVS.REI
Q1NWE2_9DELT/15-311FLF..................................................................PEFAAAG.QEV
Q1PVG5_9BACT/13-309VTI..................................................................EKPRAAL.PEE
Q1Q8W0_PSYCK/7-294........................................................................TRLS.EDE
Q1YFS2_MOBAS/8-295........................................................................APAP.QNW
HDA6_CAEEL/438-748KCVD................................................................RNCERIAT.NEE
Q22CW6_TETTS/20-322LDV.................................................................INQVEPIQ.KDI
Q232Y2_TETTS/86-443........................................................................KEKV.GRG
Q23M98_TETTS/2143-2453PLVH...............................................................IVDKLKPAE.KSI
Q29CG7_DROPS/25-326........................................................................EELT.KHQ
Q2BQU8_9GAMM/14-305LEQ..................................................................LESVHIL.PEQ
Q2FQ17_METHJ/14-290KMF..................................................................TEPRVFD.ESW
Q2FQW8_METHJ/14-311PQIR................................................................LLTPKPAM.RDD
Q2IF50_ANADE/16-319VLE.................................................................RVEAARAT.EQA
Q2JQR9_SYNJA/13-301LEW..................................................................RDPPLAD.LAQ
Q2KBQ8_RHIEC/14-309LER..................................................................RQAPQAS.EDA
Q2LUP3_SYNAS/17-292ENII................................................................EYKPSIAS.YSD
Q2LVD3_SYNAS/15-311FQD..................................................................VPAREAR.MDE
Q2R9B1_ORYSJ/26-342GDMR................................................................RLRTRPAT.EAE
Q2S035_SALRD/7-313PV....................................................................APSVAT.REE
Q2SC27_HAHCH/8-315........................................................................DPAT.TES
Q30PJ4_SULDN/258-572LR...................................................................IQPKHVS.DKL
Q31EP6_THICR/49-347LTP..................................................................VATRLAT.NEE
Q31HC2_THICR/13-304TLH..................................................................KSILPAT.EID
Q38C74_TRYB2/21-323RFCR................................................................TVVPPPIG.IKE
Q39UV4_GEOMG/11-315PGAC................................................................IHDCPRAD.EAS
Q3AFN8_CARHZ/10-319EEI..................................................................IPPRSAT.LKE
Q3AX40_SYNS9/8-294........................................................................LSIA.RRD
Q3IHM6_PSEHT/12-298........................................................................LLGT.PEA
Q3SA60_9EURY/14-304VDF.................................................................FDIREPAN.MED
Q3UG37_MOUSE/97-402RCV.................................................................SFQARFAE.KEE
Q3ZWU5_DEHSC/14-306LVH..................................................................IEPKRVG.MRE
Q4D762_TRYCC/47-388..........................................................................VG.VED
Q4FNF7_PELUB/14-306LIW..................................................................KKPSKFN.RSL
Q4JA06_SULAC/13-290........................................................................KPVD.EED
Q4KAJ1_PSEF5/12-340II....................................................................GPRRFD.RAC
Q4MYQ3_THEPA/25-416FEHELPLT........................................................GHLYHVQPREVP.RQI
Q4P2D6_USTMA/326-751........................................................................SSDG.EGD
Q4QAJ4_LEIMA/91-404ECMT................................................................VCHARPAT.AEE
Q4QI60_LEIMA/58-432........................................................................LPVELLAP
Q4TFH7_TETNG/505-904RCQ.................................................................RIPARLAT.EEE
HDA21_DICDI/1072-1486LII.................................................................KNDPEEIN.DKW
Y535_METJA/17-305........................................................................GKST.INE
Q59Q78_CANAL/56-379LCDG................................................................TIDIYPAQ.TKD
Q5AF34_CANAL/175-593........................................................................GSVF.SSH
Q5K8L3_CRYNJ/64-492EELKERFLKSDNPEDEDGKSEDDDDNEADRNEVNNGDKQGADGEPQRRKPGSPTASPPHAQNKKATVVFPQPSLGT.KAC
Q5KKR8_CRYNJ/28-368YEAMEEEGRRKVNARMGMEND.............................EARWVNAEMRGSRAKRMQIFRPRRAT.KTD
Q5XQ67_9ARCH/18-315LRR..................................................................IVPTKAS.KEQ
Q60DG7_ORYSJ/34-350FIS.................................................................WHSGRPAH.AAE
Q6AJC0_DESPS/18-318LKF..................................................................VASRLAR.RAS
Q6AKN4_DESPS/15-311LRI..................................................................ITPHEAN.TET
Q6C3Y5_YARLI/54-352........................................................................TPAT.AAE
Q6CGA7_YARLI/254-648........................................................................ANLS.SEH
Q6FWB7_CANGA/8-383CFDH................................................................IIDVPSCQ.RKD
HDAH_ALCSD/31-329LTP..................................................................IAAVAAT.DAD
Q72NV2_LEPIC/14-310LFF..................................................................PEMKKLP.NEF
Q741C0_MYCPA/14-307LVR..................................................................ETAEPAE.LAA
Q7PS30_ANOGA/118-424RCQ.................................................................FVAPRPAT.RAE
Q86YH7_HUMAN/553-881KCE.................................................................CIRGRKAT.LEE
Q8EP92_OCEIH/11-321HDL..................................................................ISPRLAT.EEE
Q8I4I9_CAEEL/17-318AVK..................................................................IDAREAN.DSE
Q8IR37_DROME/555-861QMK.................................................................QLSPRAAT.TDE
Q8LK09_MAIZE/215-515KCA.................................................................LVPPREIT.KEE
Q8SQN9_ENCCU/9-289KKMT................................................................IVKPE....VFP
HDA14_ARATH/75-387FRGSQI............................................................LELANFKTAT.VED
Q98RL4_GUITH/12-313KFLR................................................................IIRTEKKT.NSE
Q9K0J2_NEIMB/35-328LQT..................................................................IEAEEIS.DTR
Q9U266_CAEEL/18-319PRIE................................................................HIPRREAE.ESE
Q9YG09_AERPE/14-309LE...................................................................AVTPPVG.DVG

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------------------------------------------
C2XKX5_BACCE/12-239--------------------------------------------------------------------------------
B9BUU1_9BURK/13-199--------------------------------------------------------------------------------
B9BQL6_9BURK/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
D1N5Z5_9BACT/4-169--------------------------------------------------------------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C2SK71_BACCE/15-171--------------------------------------------------------------------------------
C3Q562_9BACE/31-198--------------------------------------------------------------------------------
D7W5E5_9FLAO/27-172--------------------------------------------------------------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UPR5_METVS/56-208--------------------------------------------------------------------------------
A9AA45_METM6/55-201--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------
Q181H4_CLOD6/78-183--------------------------------------------------------------------------------
B6G251_9FIRM/77-182--------------------------------------------------------------------------------
B0A6K5_9FIRM/76-181--------------------------------------------------------------------------------
C0CJH7_9FIRM/6-165--------------------------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387S......SLR------------------------------------------------------------EGSR-RIN.-
ARGI_COCP7/16-318S......GLI------------------------------------------------------------EA..-..G.-
Q6BJQ5_DEBHA/76-370R......AIR------------------------------------------------------------SASQ-RQT.-
Q6BVQ4_DEBHA/136-428L......GIR------------------------------------------------------------MATK-RMS.-
Q6BWL4_DEBHA/179-480D......SIR------------------------------------------------------------SASK-RLGG-
A1ERP9_VIBCL/33-299D......AIR------------------------------------------------------------RASV-NLA.-
A0RLF1_BACAH/22-286A......RIR------------------------------------------------------------EVSI-GLE.-
A1RXI5_THEPD/26-288Q......RIR------------------------------------------------------------EVSV-ELE.-
ARGI1_XENLA/6-306K......YLR------------------------------------------------------------EA..-...G-
SPEB_MOUSE/77-350C......RIR------------------------------------------------------------EESL-MLG.-
Q9V2I5_PYRAB/21-279V......LIR------------------------------------------------------------QATL-NLE.-
A4XKN0_CALS8/20-281S......KIR------------------------------------------------------------EVSV-GLE.-
Q55U21_CRYNB/69-375Y......ALR------------------------------------------------------------SGSR-RQR.-
A4J1T2_DESRM/21-282Q......SIR------------------------------------------------------------QVSI-GLE.-
B8GAJ6_CHLAD/41-309T......AIR------------------------------------------------------------RCFY-RLG.-
Q8ZVI7_PYRAE/9-263Q......KIR------------------------------------------------------------QIL.-PYL.-
A1VQK9_POLNA/34-307R......QIR------------------------------------------------------------AESS-LIR.-
HUTG_HALSA/36-303S......AIR------------------------------------------------------------ESLA-GVK.-
Q15JE9_STRHY/25-310F......FLR------------------------------------------------------------TLSQ-AHTW-
Q1Q9T2_PSYCK/6-313D......ALK------------------------------------------------------------AS..-....-
Q3AGG3_SYNSC/27-286A......AIR------------------------------------------------------------EVSA-GLE.-
Q2K8A9_RHIEC/46-316R......AVR------------------------------------------------------------NVDR-.VG.-
A0B180_BURCH/43-310A......AIR------------------------------------------------------------AASV-QLA.-
Q2F6C6_BOMMO/21-320A......AVR------------------------------------------------------------AA..-...G-
B2JW15_BURP8/32-305R......EIR------------------------------------------------------------NMST-MMR.-
Q6TA07_STRCL/27-300R......AIR------------------------------------------------------------HESS-LIH.-
A1B175_PARDP/5-250V......ACN------------------------------------------------------------RKSE-FFND-
ARGI_STAAC/5-298T......AIR------------------------------------------------------------YA..-...G-
Q982X2_RHILO/42-307Q......AIR------------------------------------------------------------RASA-ILD.-
Q0FAM8_9RHOB/4-297D......AYR------------------------------------------------------------TA..-...G-
Q1Z9W0_PHOPR/33-298G......AIR------------------------------------------------------------QASI-NLA.-
HUTG_BACHD/35-311T......VIR------------------------------------------------------------KCLH-AFS.-
HUTG_RHOSR/40-314D......ALR------------------------------------------------------------GALS-SMA.-
O68051_RHOCA/3-297A......SLR------------------------------------------------------------TA..-...G-
ARGI1_HUMAN/6-305T......VLR------------------------------------------------------------KA..-...G-
SPEB_CHRVO/44-311Q......AIR------------------------------------------------------------AASV-QLA.-
ARGI_BACSU/3-292S......AIR------------------------------------------------------------YA..-...H-
Q97ZX8_SULSO/24-289S......SIR------------------------------------------------------------ESAQ-YIE.-
HUTG_VIBVY/45-328D......LIR------------------------------------------------------------RALA-NLA.-
A9BRG6_DELAS/16-312D......ALR------------------------------------------------------------VA..-...G-
A1ESE8_VIBCL/43-325S......LIK------------------------------------------------------------QALA-NLA.-
HUTG_AROAE/40-323A......ALR------------------------------------------------------------RTLA-NLA.-
Q6MM35_BDEBA/43-314R......EIR------------------------------------------------------------TYLY-KMT.-
A1RB53_ARTAT/29-311A......FLR------------------------------------------------------------AASR-RYTW-
Q1J2W9_DEIGD/37-306R......ALR------------------------------------------------------------EAS.-....-
Q1ZN31_PHOAS/36-323S......EIR------------------------------------------------------------KALA-NMA.-
Q2JER0_FRASC/40-318R......AMR------------------------------------------------------------ANAY-NP..-
Q3J346_RHOS4/3-296A......AYR------------------------------------------------------------VA..-...G-
A9B324_HERA2/22-290S......AII------------------------------------------------------------EASQ-QVE.-
HUTG_LEGPL/46-318D......QIK------------------------------------------------------------TQLA-KLPC-
Q9YBG0_AERPE/29-298R......EIR------------------------------------------------------------RASI-ELE.-
Q1GI44_SILST/34-307K......QIR------------------------------------------------------------AESA-MIR.-
Q9HJB2_THEAC/33-293D......SIR------------------------------------------------------------SAYV-NLE.-
A0RXD6_CENSY/22-283D......AIR------------------------------------------------------------EAFN-NIE.-
A8LLU9_DINSH/46-312R......AIR------------------------------------------------------------EASS-LQP.-
Q1V061_PELUQ/39-314M......SIR------------------------------------------------------------QASR-HLR.-
SPEB_BACHD/22-286N......RIR------------------------------------------------------------EASL-GLE.-
Q0AG49_NITEC/44-311L......GIR------------------------------------------------------------QASA-EVA.-
Q2CCZ9_9RHOB/3-297D......ALR------------------------------------------------------------VA..-...G-
Q0W940_UNCMA/16-280D......EMR------------------------------------------------------------KMSY-NFE.-
Q97BB8_THEVO/33-293D......SIR------------------------------------------------------------GAYV-NLE.-
ARGI_BREBE/3-294S......AIR------------------------------------------------------------YA..-...G-
Q6MHV0_BDEBA/36-309A......KVR------------------------------------------------------------EVSS-LGR.-
Q98MW3_RHILO/19-296D......AIR------------------------------------------------------------AAS.-QDD.-
A0LG67_SYNFM/34-297R......AIL------------------------------------------------------------AASR-ELE.-
Q1EQG5_STRKN/2-295GCYKLAGAMR------------------------------------------------------------ER..-...G-
Q1Q5Q5_9BACT/32-299N......AIL------------------------------------------------------------DASV-NIE.-
A0NSP7_9RHOB/73-349Q......GVR------------------------------------------------------------KISA-LYTP-
HUTG_BACSU/35-311G......TIR------------------------------------------------------------QALK-HSS.-
B8FZG3_DESHD/20-281L......SIR------------------------------------------------------------NVSI-GIE.-
Q9K5Y7_BACHD/5-297S......AMR------------------------------------------------------------YA..-...G-
Q7W6W6_BORPA/29-307Q......SIR------------------------------------------------------------EQSR-LMRT-
Q6W399_9CREN/23-284D......AIR------------------------------------------------------------DAFN-NIE.-
Q0AE23_NITEC/40-304R......AIR------------------------------------------------------------NASL-SLA.-
Q1MIP6_RHIL3/52-317Q......AIR------------------------------------------------------------RASA-IFD.-
A2CDX1_PROM3/29-293A......AIR------------------------------------------------------------DVSN-GLE.-
Q164F4_ROSDO/46-312R......AIR------------------------------------------------------------EASA-LQP.-
Q164F5_ROSDO/34-308K......EVR------------------------------------------------------------AESA-MIR.-
Q0G0L1_9RHIZ/42-312Q......AIR------------------------------------------------------------RASA-IFD.-
Q15X44_PSEA6/42-323N......AIR------------------------------------------------------------SALA-NLP.-
A0SJA7_STAXY/3-297D......AIR------------------------------------------------------------YA..-...G-
Q1N5V2_9GAMM/42-308Q......GIR------------------------------------------------------------SASA-NLI.-
Q4CMT4_TRYCC/16-290M.......LF------------------------------------------------------------DYFS-QSPV-
Q2CC50_9RHOB/34-307R......QIR------------------------------------------------------------DESR-MLR.-
Q11J67_MESSB/42-307Q......AIR------------------------------------------------------------RASV-IFD.-
Q1AWJ4_RUBXD/5-295S......AIR------------------------------------------------------------YA..-...R-
Q46EM0_METBF/17-282D......AMR------------------------------------------------------------QASA-NFE.-
Q8TZN1_PYRFU/56-314V......LIR------------------------------------------------------------QATL-NFE.-
Q18F18_HALWD/14-268D......RIR------------------------------------------------------------QFAR-PFD.-
Q5V1C2_HALMA/37-301A......ALR------------------------------------------------------------RELG-GTK.-
Q5WL42_BACSK/7-290E......KIR------------------------------------------------------------EAFA-WFAN-
Q7UZH9_PROMP/24-288N......AIR------------------------------------------------------------LVST-CLE.-
Q6CLB8_KLULA/137-438N......GIR------------------------------------------------------------QGSR-RLG.-
A0JT79_ARTS2/57-331N......HVR------------------------------------------------------------EASR-LLR.-
Q2KVZ3_BORA1/13-287D......AIR------------------------------------------------------------EQSR-LLRP-
A8H965_SHEPA/50-335D......SAM------------------------------------------------------------GQFL-NLQ.-
Q75TI1_GEOSE/31-304Q......HIR------------------------------------------------------------NFSV-LLR.-
B2UBQ2_RALPJ/40-316A......AIR------------------------------------------------------------KMLA-NLP.-
Q165U0_ROSDO/35-314R......GVR------------------------------------------------------------EAST-LFS.-
B1YHV3_EXIS2/22-286A......RIR------------------------------------------------------------EVSL-GLE.-
Q5WIT9_BACSK/27-306K......VMR------------------------------------------------------------LCSA-RYSG-
Q13CK1_RHOPS/14-311A......ALR------------------------------------------------------------TA..-...G-
Q1YMK4_MOBAS/42-312Q......ALR------------------------------------------------------------RASA-IFD.-
A1C610_ASPCL/68-380R......AIR------------------------------------------------------------AASA-RQM.-
Q39HU1_BURS3/40-306R......GLR------------------------------------------------------------IAST-GIA.-
Q05V55_9SYNE/29-297A......AVR------------------------------------------------------------DVSN-GLE.-
Q1AS11_RUBXD/33-307E......AIR------------------------------------------------------------SVSH-LLR.-
A0NXD9_9RHOB/25-301R......AIR------------------------------------------------------------EAST-LFS.-
SPEB_NEIMA/35-300E......AIR------------------------------------------------------------RASV-NLA.-
A3QIE0_SHELP/50-335E......AAM------------------------------------------------------------AQFC-NFQ.-
Q28QX8_JANSC/39-314R......ALR------------------------------------------------------------DAST-MIR.-
A1WGI6_VEREI/22-320E......ALR------------------------------------------------------------VA..-...G-
A1WER7_VEREI/22-295R......QIR------------------------------------------------------------AESV-LLR.-
A1T3A2_MYCVP/88-364Q......GIR------------------------------------------------------------RSTN-LFGT-
HUTG_ENT38/42-310D......VLR------------------------------------------------------------KALA-NMA.-
A8LRL4_DINSH/4-296D......AYR------------------------------------------------------------TA..-...G-
Q46TX4_CUPPJ/2-296E......ALR------------------------------------------------------------IA..-...D-
A5V551_SPHWW/4-298E......AMR------------------------------------------------------------IA..-...G-
Q2B9I2_9BACI/37-317D......EFR------------------------------------------------------------KMWK-GYA.-
Q1I7X5_PSEE4/43-309R......AIR------------------------------------------------------------TASV-QQA.-
Q11NZ4_CYTH3/3-310D......ALL------------------------------------------------------------VA..-...D-
Q5V4R8_HALMA/3-300S......AIR------------------------------------------------------------YG..-...G-
SPEB_SERP5/33-298A......AIR------------------------------------------------------------QVST-NLA.-
Q6AG97_LEIXX/4-273RLIDGAEAVL------------------------------------------------------------GDLP-VSRT-
Q12BY7_POLSJ/72-342R......AVR------------------------------------------------------------NVER-.IG.-
HUTG_VIBF1/45-345Q......VIR------------------------------------------------------------RALA-NLA.-
Q0UDP7_PHANO/4-284N......RIR------------------------------------------------------------AMGV-IEEL-
Q0FAR0_9RHOB/34-308R......SVR------------------------------------------------------------EAST-LFS.-
Q3IVT5_RHOS4/32-308N......ALR------------------------------------------------------------AMSV-MLR.-
HUTG_GEOKA/44-315A......AVK------------------------------------------------------------AALA-RLP.-
SPEB_BLOFL/33-298A......SIR------------------------------------------------------------KASI-NLA.-
A0ZFA2_NODSP/30-338Q......QIL------------------------------------------------------------DASI-QLD.-
A2C5F5_PROM1/29-293S......AVR------------------------------------------------------------EDSY-GIE.-
A4XT95_PSEMY/38-311R......EIR------------------------------------------------------------AQSV-MIR.-
Q5WB32_BACSK/22-286A......RIR------------------------------------------------------------EASL-GLE.-
Q6C6P6_YARLI/9-306E......YLL------------------------------------------------------------GG..-...G-
HUTG_NOCFA/35-303D......ALR------------------------------------------------------------QAMA-PMA.-
Q12UU8_METBU/17-282D......AIR------------------------------------------------------------SATA-NFE.-
A1UHG9_MYCSK/34-307A......HIR------------------------------------------------------------ASSK-LLR.-
A0B2Z1_BURCH/72-345R......QIR------------------------------------------------------------TESV-LLR.-
ARGI_BACCD/2-295S......AMR------------------------------------------------------------YA..-...G-
Q213G1_RHOPB/11-309A......ALR------------------------------------------------------------TA..-...G-
A7NL23_ROSCS/33-307E......AIR------------------------------------------------------------SASV-LLR.-
Q28PV5_JANSC/46-313R......AIR------------------------------------------------------------AASA-LQP.-
A0QRD0_MYCS2/43-317S......AIR------------------------------------------------------------EASR-LLK.-
Q02UC9_PSEAB/35-308R......EVR------------------------------------------------------------NLSS-LMR.-
Q1MAU5_RHIL3/40-310R......AVR------------------------------------------------------------AIER-.IG.-
ARGI_NEUCR/47-354S......ALI------------------------------------------------------------ES..-...G-
A5ENL2_BRASB/10-307A......ALR------------------------------------------------------------TA..-...G-
Q12LW8_SHEDO/33-299E......AIR------------------------------------------------------------RASV-NLA.-
Q2W8C1_MAGSA/22-290Q......AVR------------------------------------------------------------RASR-MLA.-
Q6CIB4_KLULA/61-358Q......AIR------------------------------------------------------------KASQ-RQT.-
C5PF24_COCP7/77-371G......GIR------------------------------------------------------------RGSA-RMR.-
A1SLP1_NOCSJ/31-312S......AIR------------------------------------------------------------QTDY-LPQ.-
A0RH36_BACAH/35-312K......TIR------------------------------------------------------------SMLD-AYS.-
Q7P2W8_FUSNV/500-780D......DLI------------------------------------------------------------QA..-..YP-
A6UDJ1_SINMW/2-296T......ALR------------------------------------------------------------IA..-...G-
Q28VR8_JANSC/34-309R......AIR------------------------------------------------------------EAST-LFA.-
B4STA0_STRM5/5-299E......ALR------------------------------------------------------------VA..-...G-
A6U7T5_SINMW/42-307Q......AIR------------------------------------------------------------RASA-IFD.-
Q0UYW2_PHANO/16-320M......ALI------------------------------------------------------------EA..-...G-
O96394_LEIAM/13-316D......YLL------------------------------------------------------------KQ..-...G-
Y309_METJA/21-281N......AIR------------------------------------------------------------TASW-GLE.-
Q9RZ04_DEIRA/29-298R......ALR------------------------------------------------------------EAS.-....-
Q6CLS8_KLULA/13-315K......YLM------------------------------------------------------------KQ..-...G-
A2BIW8_HYPBU/25-300R......AIR------------------------------------------------------------EAAA-NIE.-
Q21RM0_RHOFD/15-309E......ALR------------------------------------------------------------VA..-...G-
Q6L151_PICTO/19-280N......YIR------------------------------------------------------------YAYN-NLE.-
Q4P4M4_USTMA/13-318V......SLV------------------------------------------------------------QA..-...G-
Q0I684_SYNS3/31-289A......AIR------------------------------------------------------------EVST-GLE.-
A1B165_PARDP/30-308T......AVR------------------------------------------------------------QAT.-DRA.-
Q11QL1_CYTH3/66-323D......EIR------------------------------------------------------------KKLY-VLRR-
Q16AD8_ROSDO/4-296D......AYR------------------------------------------------------------TA..-...G-
Q3SMM1_THIDA/8-294D......ALH------------------------------------------------------------HY..-...E-
Q5AK86_CANAL/12-313D......YIL------------------------------------------------------------KA..-...G-
Q1IPT1_KORVE/2-256A......AIR------------------------------------------------------------RALA-SDSA-
Q7VSA1_BORPE/8-302E......ALR------------------------------------------------------------VA..-...G-
Q82LW5_STRAW/2-295GCYKLAGALR------------------------------------------------------------EQ..-...R-
A0BHR2_PARTE/9-311R......ALR------------------------------------------------------------EG..-...G-
A1UI81_MYCSK/60-335M......GVR------------------------------------------------------------QAAR-TLR.-
HUTG_COREF/43-309D......AIR------------------------------------------------------------GVLG-LVA.-
Q2JWU8_SYNJA/14-265L......AIL------------------------------------------------------------NAGA-ELCA-
B0K9I6_THEP3/23-285A......AIR------------------------------------------------------------QASY-GLE.-
Q49V90_STAS1/26-305K......QIR------------------------------------------------------------VCSA-RYSQ-
Q4JAE9_SULAC/24-287S......VIR------------------------------------------------------------EVAQ-YIE.-
A1UE14_MYCSK/29-310S......ALR------------------------------------------------------------QACY-LPQ.-
A0P3L0_9RHOB/6-302D......AYR------------------------------------------------------------TA..-...G-
Q0FDK0_9RHOB/32-317R......ALR------------------------------------------------------------NVSA-VHRR-
Q1YIK6_MOBAS/68-338R......ALR------------------------------------------------------------TMER-.VG.-
Q088H7_SHEFN/48-332I......ASM------------------------------------------------------------KQLI-NLQ.-
Q5JI38_PYRKO/22-281T......LIR------------------------------------------------------------QATL-NLE.-
Q975R8_SULTO/24-287S......TIR------------------------------------------------------------EYAQ-FIE.-
Q1LGD2_RALME/2-296E......ALR------------------------------------------------------------VA..-...D-
ARGI_AGRT5/19-313D......AFR------------------------------------------------------------TA..-...G-
Q1D421_MYXXD/27-337T......AVL------------------------------------------------------------EASR-QVD.-
SPEB1_SCHPO/74-375S......GIR------------------------------------------------------------EGSR-RLN.-
YHMF_METFE/21-281L......MIR------------------------------------------------------------QASY-NFE.-
ARGI_YEAST/13-329K......YML------------------------------------------------------------KH..-...G-
A7NMZ3_ROSCS/53-326N......DER------------------------------------------------------------ALDA-YAAS-
A9BN56_DELAS/71-341R......ALR------------------------------------------------------------SIER-.VG.-
Q5A4M3_CANAL/50-340R......AIR------------------------------------------------------------DASQ-RQN.-
Q4T7Z4_TETNG/3-305D......LIR------------------------------------------------------------AA..-...G-
A2BTR8_PROMS/23-287E......AIR------------------------------------------------------------QVSS-CLE.-
Q0FX33_9RHOB/3-297A......SLR------------------------------------------------------------TA..-...G-
A1RBR9_ARTAT/55-335A......AVR------------------------------------------------------------EASR-LLR.-
A1VTU0_POLNA/3-297E......AFR------------------------------------------------------------VA..-...G-
Q4RH16_TETNG/25-302K......VIR------------------------------------------------------------DA..-...G-
Q0UMJ9_PHANO/68-378R......AIR------------------------------------------------------------AGSS-RQT.-
Q2U075_ASPOR/4-285H......RIQ------------------------------------------------------------SQGL-IPTL-
A1SM48_NOCSJ/41-314S......HIR------------------------------------------------------------QGSR-LLR.-
Q1GI45_SILST/67-333R......AVR------------------------------------------------------------EASA-LQS.-
A0Y6C5_9GAMM/33-299D......AIR------------------------------------------------------------RASV-HLA.-
PAH_STRCL/30-303Q......AIR------------------------------------------------------------SESG-LIH.-
Q1IHQ4_KORVE/16-311S......AVR------------------------------------------------------------VA..-...G-
Q5K413_AGABI/11-307I......RLV------------------------------------------------------------EA..-...G-
Q6L2W0_PICTO/21-293E......RIR------------------------------------------------------------EIMN-SYS.-
A0R8M1_BACAH/3-293S......AIR------------------------------------------------------------YA..-...G-
Q89H72_BRAJA/11-308P......ALR------------------------------------------------------------TA..-...G-
Q0FFB5_9RHOB/42-315R......QMR------------------------------------------------------------DLST-MIR.-
A1ZN63_9BACT/41-299N......EIR------------------------------------------------------------KRLY-RLKK-
A0Z3U1_9GAMM/41-307R......GIR------------------------------------------------------------TASA-SLA.-
B1KRD6_SHEWM/33-299G......AIR------------------------------------------------------------QASV-NLA.-
Q489X2_COLP3/36-310R......SVR------------------------------------------------------------NESV-LVR.-
Q7V9I4_PROMA/29-293S......SIR------------------------------------------------------------QVSN-GIE.-
SPEB1_SYNY3/26-297E......AVL------------------------------------------------------------EASD-QLE.-
Q6FP31_CANGA/10-317K......YML------------------------------------------------------------KH..-...G-
Q2CAN0_9RHOB/40-305R......AIR------------------------------------------------------------EAST-QLA.-
A5G414_GEOUR/41-319K......TIR------------------------------------------------------------HASA-RYGG-
A0YPG8_LYNSP/25-295A......ALL------------------------------------------------------------EASH-QLE.-
Q3SVS2_NITWN/5-302A......ALR------------------------------------------------------------TA..-...G-
SPEB2_SCHPO/89-401K......GIR------------------------------------------------------------SASS-RQM.-
Q8XPR0_RALSO/29-309A......AIR------------------------------------------------------------QAT.-DRV.-
Q52V70_9ACTO/41-314N......AIR------------------------------------------------------------EASR-TLR.-
Q08C97_DANRE/85-358R......HIR------------------------------------------------------------AESA-MIR.-
A4G0Y7_METM5/19-278D......EVR------------------------------------------------------------NASW-GLE.-
Q47TW8_THEFY/41-314A......AIR------------------------------------------------------------EASR-LLR.-
A9KQ98_CLOPH/18-281A......AIR------------------------------------------------------------NESY-GIE.-
A1BCD2_PARDP/35-312R......EVR------------------------------------------------------------NQSS-LMR.-
B9LGA1_CHLSY/41-309T......AIR------------------------------------------------------------RCLY-RLG.-
ARGI_ASHGO/93-395K......YLL------------------------------------------------------------KQ..-...G-
A1B3P5_PARDP/3-295A......AYR------------------------------------------------------------VA..-...G-
Q1QTM4_CHRSD/39-312R......QIR------------------------------------------------------------DESR-MLR.-
Q6C732_YARLI/86-381A......GIR------------------------------------------------------------KGSR-RMS.-
A0LDK6_MAGSM/20-293R......AIL------------------------------------------------------------EASK-QLE.-
Q47D78_DECAR/17-302V......AFH------------------------------------------------------------HS..-...Q-
Q3JAG2_NITOC/2-290E......ALR------------------------------------------------------------RR..-...G-
A6UC62_SINMW/70-340R......ALR------------------------------------------------------------AIER-.IG.-
A3DDA1_CLOTH/24-286Q......KIR------------------------------------------------------------EVSI-GIE.-
A1CKP4_ASPCL/16-320L......ALI------------------------------------------------------------EA..-...G-
B8G5W4_CHLAD/5-298S......AIR------------------------------------------------------------YA..-...G-
ARGI1_SCHPO/22-319E......MIE------------------------------------------------------------AA..-...G-
Q1QAH6_PSYCK/33-307R......QIR------------------------------------------------------------DESR-MIR.-
HUTG_PHOLL/44-316D......YLR------------------------------------------------------------QSLA-NMA.-
Q1MB14_RHIL3/6-300A......ALR------------------------------------------------------------IA..-...G-
Q3IQJ3_NATPD/45-332R......AVR------------------------------------------------------------RASG-WLA.-
A5FB51_FLAJ1/47-336E......NAI------------------------------------------------------------KSIA-NIQ.-
Q2BIH2_9GAMM/39-305E......GVR------------------------------------------------------------AASA-NLV.-
SPEB2_SYNY3/83-361Q......GIR------------------------------------------------------------RISA-LYTP-
Q5LKZ4_SILPO/42-315R......QLR------------------------------------------------------------DLST-MIR.-
Q2RHH4_MOOTA/26-287R......AIR------------------------------------------------------------SVSE-VLE.-
Q2B080_9BACI/2-294S......AIR------------------------------------------------------------YA..-...G-
Q17HI3_AEDAE/32-333K......AIR------------------------------------------------------------EA..-...G-
A1RP77_SHESW/50-343T......TSM------------------------------------------------------------QQWL-NLQ.-
A3CU48_METMJ/19-276R......AIR------------------------------------------------------------EVSF-NFE.-
HUTG_HAHCH/40-316D......EII------------------------------------------------------------KALA-NLP.-
Q4QBG9_LEIMA/24-299T......KLL------------------------------------------------------------NHFY-TSSR-
Q8RA93_THETN/28-290S......SIR------------------------------------------------------------QASY-GLE.-
Q8END5_OCEIH/29-310K......AIR------------------------------------------------------------LNSE-RYSG-
Q493F1_BLOPB/33-298T......AIR------------------------------------------------------------QASI-NLA.-
Q5ANN8_CANAL/115-414E......SIR------------------------------------------------------------SNSR-RLG.-
A0NZA6_9RHOB/69-339R......ALR------------------------------------------------------------TIER-.IG.-
A1VGG3_DESVV/22-283D......AIL------------------------------------------------------------DASD-QLE.-
B2T8M0_BURPP/39-312R......QVR------------------------------------------------------------DIST-MVR.-
Q2LPR8_SYNAS/65-343R......AIR------------------------------------------------------------HSAA-RYGG-
A1ST87_PSYIN/33-299T......AIR------------------------------------------------------------QASI-NLA.-
ARGI1_ARATH/63-338P......RIR------------------------------------------------------------EAIW-CGST-
Q5HZ88_XENLA/108-381R......HIR------------------------------------------------------------GESC-MIR.-
O29611_ARCFU/17-266N......AIR------------------------------------------------------------EASW-NLE.-
Q1V7V4_VIBAL/45-328D......LIR------------------------------------------------------------RALA-NLA.-
ARGI_LITCT/7-306I......YIR------------------------------------------------------------RA..-...G-
Q5SJ85_THET8/15-277E......AIL------------------------------------------------------------LASR-ELE.-
A0R0G1_MYCS2/40-312N......AIR------------------------------------------------------------QASR-LVR.-
A1CFK4_ASPCL/83-374G......GIR------------------------------------------------------------LGSR-RL..-
B8I5M8_CLOCE/21-282S......AMR------------------------------------------------------------IDSI-GLE.-
A1TIE4_ACIAC/8-305D......ALR------------------------------------------------------------VA..-...Q-
B1KR08_SHEWM/50-335E......AAM------------------------------------------------------------AQFL-NLQ.-
Q0FJQ8_9RHOB/38-313R......GVR------------------------------------------------------------EAST-LFS.-
A1T9H7_MYCVP/46-324R......AIR------------------------------------------------------------ATAY-EP..-
Q97VA3_SULSO/30-299M......GIR------------------------------------------------------------QGSR-LLR.-
B1YR75_BURA4/21-323DTWRGPGALL------------------------------------------------------------AT..-...G-
Q8TXD6_METKA/24-253N......AVR------------------------------------------------------------SAAS-TLDF-
Q581Y0_TRYB2/24-298P.......LL------------------------------------------------------------DFFL-QSPR-
Q4J720_SULAC/30-299M......AVR------------------------------------------------------------QGSR-LLR.-
Q3J2B4_RHOS4/46-312R......AIR------------------------------------------------------------EAST-LQP.-
A1CGK0_ASPCL/61-357R......GIR------------------------------------------------------------AGSS-REK.-
Q10Y47_TRIEI/24-296A......VLL------------------------------------------------------------NASQ-QLE.-
A5G278_ACICJ/28-297A......AIR------------------------------------------------------------VASR-MLA.-
ARGI_SOYBN/71-346P......FIR------------------------------------------------------------EGIW-CGSA-
A0NYN1_9RHOB/60-337D......AIR------------------------------------------------------------AAS.-QED.-
Q98B74_RHILO/368-601.......GAR------------------------------------------------------------LEAM-N...-
O76895_DROME/30-333D......LLR------------------------------------------------------------QS..-...S-
A1W2M6_ACISJ/2-298D......ALR------------------------------------------------------------IA..-...G-
Q4A3J0_CYPCA/24-323K......AIR------------------------------------------------------------DA..-...G-
B2TBR8_BURPP/45-312A......GVR------------------------------------------------------------AASV-QLA.-
A8GC83_SERP5/32-305R......QIR------------------------------------------------------------QESV-MIR.-
B7WTA0_COMTE/4-303D......ALR------------------------------------------------------------VA..-...Q-
Q0F026_9PROT/13-273S......AIR------------------------------------------------------------DASD-GIE.-
A7NJ86_ROSCS/2-295S......AIR------------------------------------------------------------YA..-...G-
Q1GHG8_SILST/4-296D......AYR------------------------------------------------------------TA..-...G-
Q9HP79_HALSA/17-266G......ELR------------------------------------------------------------TYAA-TFE.-
Q65P52_BACLD/4-300S......AIR------------------------------------------------------------CA..-...G-
Q4A3J2_CYPCA/25-324D......LIR------------------------------------------------------------AA..-...G-
Q67TJ0_SYMTH/28-290G......RIR------------------------------------------------------------EASY-GIE.-
A4XZN2_PSEMY/43-309R......AIR------------------------------------------------------------AASI-QSA.-
Q5LVU6_SILPO/18-278A......AII------------------------------------------------------------EASN-ELER-
A1A614_XENLA/26-326A......AIR------------------------------------------------------------SA..-...G-
A4YE21_METS5/29-295M......GIR------------------------------------------------------------DGSR-LLR.-
Q5QV39_IDILO/51-340Q......AFL------------------------------------------------------------KSFL-NLQ.-
A1ZJF0_9BACT/15-273D......SLR------------------------------------------------------------AALH-SGES-
A1SAJ7_SHEAM/49-334E......AML------------------------------------------------------------KYLV-NLQ.-
Q6ANF4_DESPS/59-334A......GIR------------------------------------------------------------AAST-ILK.-
Q0SVK6_CLOPS/20-280Q......VMR------------------------------------------------------------GESW-GLE.-
A1RSZ1_PYRIL/9-263Q......KIR------------------------------------------------------------VIM.-PYL.-
Q5V104_HALMA/12-261D......RIR------------------------------------------------------------KFGQ-QFD.-
Q5QTW3_IDILO/29-298D......GLR------------------------------------------------------------AVSE-DIES-
A0NU34_9RHOB/41-306Q......GVR------------------------------------------------------------RASA-IFD.-
A1ZV42_9BACT/26-290Q......AIL------------------------------------------------------------EASY-NME.-
Q222F3_RHOFD/24-298Q......EIR------------------------------------------------------------RASL-MLC.-
ARGI2_MOUSE/24-324A......AIR------------------------------------------------------------EA..-...G-
Q1Z3J6_PHOPR/33-324E......SIC------------------------------------------------------------RALK-KEY.-
Q315M1_DESDG/23-287A......AIL------------------------------------------------------------AASR-QLE.-
A7IL28_XANP2/50-316R......AIR------------------------------------------------------------AAST-ILD.-
Q18A84_CLOD6/21-285S......SMR------------------------------------------------------------KEFY-GLE.-
Q07N69_RHOP5/13-310A......ALR------------------------------------------------------------TA..-...G-
A0M038_GRAFK/2-255P......RIR------------------------------------------------------------KVLN-CGSA-
B8FW33_DESHD/4-296S......AIR------------------------------------------------------------YA..-...G-
Q5V6R7_HALMA/44-335R......AVR------------------------------------------------------------AAST-VPS.-
Q5LRK8_SILPO/33-325D......SYR------------------------------------------------------------TA..-...G-
Q9K8M2_BACHD/4-296S......ALR------------------------------------------------------------YA..-...G-
Q3ABP1_CARHZ/20-281Q......HIR------------------------------------------------------------QVSF-GLE.-
A9CJC2_AGRT5/42-307Q......AIR------------------------------------------------------------RASA-IFD.-
Q0FFC7_9RHOB/42-306R......AIR------------------------------------------------------------QASV-QLA.-
Q7U3K9_SYNPX/21-280A......AIR------------------------------------------------------------EVSQ-GLE.-
Q4D5Y5_TRYCC/22-297A......AFR------------------------------------------------------------FFLQ-RLGS-
A1STQ5_PSYIN/47-343D......LIR------------------------------------------------------------QALA-NSA.-
Q7VY32_BORPE/13-287D......AIR------------------------------------------------------------EQSR-LLRP-
Q9CL61_PASMU/34-299E......AIR------------------------------------------------------------RASV-NLA.-

PF00850

A0B6D0_METTP/17-279V.A....EAH............................................................TENH.MQNM.
A0B926_METTP/7-310L.L....MVH............................................................DPGY.IQAV.
A0DIS2_PARTE/29-344L.R....LVH............................................................DEKY.IDFV.
A0LGT0_SYNFM/15-314I.E....AVH............................................................SPKH.IMRF.
A0YQ85_LYNSP/13-307L.E....EVH............................................................SVDY.IRRV.
A1RXP5_THEPD/28-317L.L....LAH............................................................DKEY.VDYV.
A1W7T1_ACISJ/25-356L.A....KIH............................................................APRY.LAFL.
A1ZSA9_9BACT/6-274L.C....LAH............................................................DPSY.VRGV.
A2BL29_HYPBU/15-315I.L....EVH............................................................DPAY.VEKV.
A2R705_ASPNC/140-407I.S....LIH............................................................TPDH.FAFV.
A3CXQ9_METMJ/14-294L.Q....RVH............................................................DPRY.VRWV.
A3DNS7_STAMF/16-313V.LQVLNRVH............................................................CRKY.IEYI.
A3GH68_PICST/21-341L.A....SYH............................................................DENF.VDFLL
A3GTQ3_VIBCL/7-300I.T....RLH............................................................DPDY.VQAL.
A3IXM3_9CHRO/8-295L.E....LVH............................................................CPDY.ITAY.
A3JI99_9ALTE/13-341I.L....VVH............................................................DFDY.VNFL.
A3W9J6_9SPHN/44-368I.E....AVH............................................................DSEY.LSFL.
A3WE49_9SPHN/7-292L.E....AVH............................................................DPQY.VEEV.
A3WNS9_9GAMM/8-295V.A....LAH............................................................SSNY.INKL.
A3Y9Y0_9GAMM/13-341V.H....KVH............................................................SKDY.VSFL.
A3ZYN7_9PLAN/13-308I.Q....LIH............................................................TAAM.RTSV.
A4BCK9_9GAMM/15-306I.L....RVH............................................................HSTY.VDQL.
A4BMJ9_9GAMM/17-332V.N....GLH............................................................DPEY.VRFL.
A4C5S3_9GAMM/8-296L.L....LCH............................................................SSEY.VMQF.
A4C8Y5_9GAMM/14-303I.G....LAH............................................................SEQH.IAHI.
A4S2N1_OSTLU/197-606I.L....RAH............................................................DENY.VRVL.
A4S898_OSTLU/22-313L.C....RAH............................................................DEDY.VRDV.
A4U490_9PROT/14-308L.L....RAH............................................................CPHH.VDHV.
A4WPH0_RHOS5/24-326L.R....LVH............................................................PQGY.LAEF.
A4X4X7_SALTO/10-318L.T....RVH............................................................DPAY.LEAV.
A4YNH4_BRASO/45-371R.A....RVH............................................................SPEY.LNFL.
A5D0K9_PELTS/22-316V.S....LVH............................................................LPAY.IERV.
A5H660_SCHMA/8-358V.T....AFH............................................................STEY.VDAL.
A6C208_9PLAN/13-308L.E....RVH............................................................SQQY.IRFV.
A6C6K6_9PLAN/13-308L.L....RVH............................................................PETY.LNQL.
A6E8D2_9SPHI/7-293V.L....RSH............................................................DPKY.WEHL.
A6FY71_9DELT/35-323L.A....RVH............................................................DQAY.LERL.
A6GQW9_9BURK/14-305V.T....AVH............................................................NPAY.VESI.
A6Q2Z0_NITSB/15-300L.Y....QIH............................................................EAHY.VDWV.
A6QAF4_SULNB/14-302L.E....LVH............................................................TPEH.IETV.
A6QHR8_STAAE/14-324L.M....LIH............................................................KYDY.VEAI.
A6R4B6_AJECN/49-360M.A....EFH............................................................SPEY.LDFL.
A6VSZ5_MARMS/14-305L.L....LAH............................................................DEAY.VDSI.
A7E372_BOVIN/21-321L.L....VVH............................................................TRRY.LNEL.
A7SSG8_NEMVE/23-333L.L....CLH............................................................SKEH.IDKM.
A7SUP8_NEMVE/23-330L.A....AFH............................................................SSEY.VNCM.
A7TRW5_VANPO/9-404L.L....QFH............................................................SRDY.IDLLL
A8ABS4_IGNH4/14-309L.E....LVH............................................................DRDY.VEYV.
A8MBN2_CALMQ/13-310L.IETAGLVH............................................................EYHY.VEYV.
A8ZT95_DESOH/16-310L.E....LVH............................................................TPGH.VKKI.
A9A062_DESOH/259-573I.T....AVH............................................................DKHF.VRYL.
A9B5I1_HERA2/14-309I.E....AVH............................................................VPSH.LPTL.
A9W0L9_METEP/18-304L.S....GAH............................................................DPVY.VAAV.
B0T7F0_CAUSK/32-328I.G....RVH............................................................TSDH.INQI.
B2JV93_BURP8/15-309V.Q....LIH............................................................RQDF.IDEV.
B4U8T2_HYDS0/14-304V.S....KIH............................................................DTYY.IQEI.
B9LI73_CHLSY/14-310L.L....AVH............................................................SSSM.LHRV.
C5KDG6_PERM5/340-870LVT....NIH............................................................SKRY.LHDL.
E0TF48_PARBH/5-292I.K....VAH............................................................TESY.IASL.
E2RU63_GIAIC/11-320M.A....LYH............................................................TPDY.IRFL.
F2G2X2_ALTMD/14-319L.T....LAH............................................................DPYY.VKSV.
O58986_PYRHO/14-303I.Y....KIH............................................................DPEY.VKRI.
O67135_AQUAE/10-314L.L....LFH............................................................TEDY.INTL.
HDA1_YEAST/69-395I.L....EVH............................................................TKEH.LEFI.
Q00U49_OSTTA/445-741L.E....AAH............................................................CGEY.VRKV.
Q027B1_SOLUE/10-293L.E....LAH............................................................EEQY.VRAI.
Q02CA3_SOLUE/14-311L.T....LCH............................................................TPDY.LKTA.
Q0A6Z7_ALHEH/46-336L.G....RVH............................................................TLSY.LETI.
Q0ARF0_MARMM/14-308V.A....RFH............................................................SAAH.VDRV.
Q0EVU6_9PROT/10-312I.E....RFH............................................................TPEY.VTRV.
Q0FL11_9RHOB/14-304L.A....RVH............................................................PAAY.IARI.
Q0G2C9_9RHIZ/12-346I.T....AVH............................................................AGHY.VDFL.
Q0HTM8_SHESR/7-295V.M....QVH............................................................QQDY.VEQF.
Q0W553_UNCMA/15-300L.T....RVH............................................................DLDY.VRHI.
Q11YA3_CYTH3/7-294L.L....RSQ............................................................DATY.VHKL.
Q15WQ0_PSEA6/14-301L.N....RVY............................................................SPDY.VNDL.
Q1CZX8_MYXXD/21-314L.A....SVH............................................................TPEL.LAYL.
Q1H8P7_PLADU/25-312A.G....LVH............................................................TPEY.VEKF.
Q1IJP8_KORVE/31-346V.L....LVH............................................................SHFY.VDKL.
Q1N4R7_9GAMM/15-306F.Q....LIH............................................................SKGY.IDQL.
Q1NWE2_9DELT/15-311L.A....LNH............................................................SHKY.IAQV.
Q1PVG5_9BACT/13-309I.G....FIH............................................................PKTY.ISTI.
Q1Q8W0_PSYCK/7-294I.L....TTH............................................................TADY.WYQL.
Q1YFS2_MOBAS/8-295L.R....LAH............................................................DPLY.VDQV.
HDA6_CAEEL/438-748I.R....LVH............................................................TKKM.LEHL.
Q22CW6_TETTS/20-322L.N....KVH............................................................RDSY.VDLV.
Q232Y2_TETTS/86-443L......MLHL.........................................................GMSPLY.LLYL.
Q23M98_TETTS/2143-2453V.K....YAH............................................................DDNY.IEFI.
Q29CG7_DROPS/25-326L.R....RIH............................................................TREY.LRSL.
Q2BQU8_9GAMM/14-305I.Q....LAH............................................................AHLH.QKRL.
Q2FQ17_METHJ/14-290I.Q....QVH............................................................TPEY.INNI.
Q2FQW8_METHJ/14-311V.L....LVH............................................................TKEY.LHFL.
Q2IF50_ANADE/16-319L.L....RVH............................................................TPGH.LARV.
Q2JQR9_SYNJA/13-301L.E....RVH............................................................PRWH.IQRV.
Q2KBQ8_RHIEC/14-309V.L....LAH............................................................PEEH.LKAV.
Q2LUP3_SYNAS/17-292I.N....RVH............................................................F.........
Q2LVD3_SYNAS/15-311L.H....LIH............................................................LPDY.VNRV.
Q2R9B1_ORYSJ/26-342I.R....RFH............................................................SPEY.VDLL.
Q2S035_SALRD/7-313V.R....RVH............................................................GEQF.VEKV.
Q2SC27_HAHCH/8-315L.A....LAH............................................................SREY.LASL.
Q30PJ4_SULDN/258-572L.K....QVH............................................................LGAY.VDYL.
Q31EP6_THICR/49-347L.L....LAH............................................................TQSY.IDEI.
Q31HC2_THICR/13-304V.L....RVH............................................................SSPF.WETL.
Q38C74_TRYB2/21-323L.L....TYH............................................................AEDY.ILNL.
Q39UV4_GEOMG/11-315L.L....TFH............................................................SPDY.LQRL.
Q3AFN8_CARHZ/10-319L.Y....LVH............................................................DPAY.VEAV.
Q3AX40_SYNS9/8-294L.E....EIH............................................................PRRY.HETF.
Q3IHM6_PSEHT/12-298L.E....LVH............................................................CENY.IHDL.
Q3SA60_9EURY/14-304I.L....AVH............................................................TEPY.LEFL.
Q3UG37_MOUSE/97-402L.M....LVH............................................................SLEY.IDLM.
Q3ZWU5_DEHSC/14-306L.E....SFH............................................................KRSY.ISRV.
Q4D762_TRYCC/47-388M.T....AFH............................................................DRAY.LNYL.
Q4FNF7_PELUB/14-306L.E....ITH............................................................NSDY.INFV.
Q4JA06_SULAC/13-290V.K....LIH............................................................NEDY.VKLV.
Q4KAJ1_PSEF5/12-340Y.V....AAH............................................................SERY.VSFL.
Q4MYQ3_THEPA/25-416L.L....LCH............................................................TEKY.LDQV.
Q4P2D6_USTMA/326-751D......AMH.................................................................LSEV.
Q4QAJ4_LEIMA/91-404M.G....AFH............................................................RSAY.LECL.
Q4QI60_LEIMA/58-432F......TVH......................................................................
Q4TFH7_TETNG/505-904L.S....MCHRSGSALSVGSEPFLLPLRARIISPLGLVWPLDRRLPTSHASCVCTINPGCVHFCVCVCVRSLQH.VEQM.
HDA21_DICDI/1072-1486I.L....TVH............................................................SPEY.LRLL.
Y535_METJA/17-305I.L....EIH............................................................SRDY.VYSI.
Q59Q78_CANAL/56-379L.T....TYH............................................................DDEF.VKHLM
Q5AF34_CANAL/175-593V.R....KIH............................................................GRNW.PKKL.
Q5K8L3_CRYNJ/64-492L.L....KYH............................................................DRSY.IERLL
Q5KKR8_CRYNJ/28-368M.T....RFH............................................................TDEY.IELL.
Q5XQ67_9ARCH/18-315L.R....YVH............................................................APEY.IKEV.
Q60DG7_ORYSJ/34-350L.L....SFH............................................................SAEY.IEEL.
Q6AJC0_DESPS/18-318L.L....LAH............................................................EEDW.LFRF.
Q6AKN4_DESPS/15-311I.E....KVH............................................................SNFY.LSQI.
Q6C3Y5_YARLI/54-352L.Q....RYH............................................................SLEY.VSAV.
Q6CGA7_YARLI/254-648V.T....AVH............................................................GVEY.INLL.
Q6FWB7_CANGA/8-383L.E....KFH............................................................SKDY.LNVIL
HDAH_ALCSD/31-329I.L....RAH............................................................SAAH.LENM.
Q72NV2_LEPIC/14-310L.N....EIH............................................................SQNH.IQKI.
Q741C0_MYCPA/14-307T.R....YVH............................................................SNRY.VDAP.
Q7PS30_ANOGA/118-424L.L....TKH............................................................TAEQ.IELL.
Q86YH7_HUMAN/553-881L.Q....TVH............................................................SEAH.TLLY.
Q8EP92_OCEIH/11-321L.L....LFH............................................................HPNY.METV.
Q8I4I9_CAEEL/17-318I.R....LNH............................................................PQQL.IDEI.
Q8IR37_DROME/555-861V.C....LAH............................................................TRAH.VNTV.
Q8LK09_MAIZE/215-515L.L....MVH............................................................SPDH.IESV.
Q8SQN9_ENCCU/9-289L.S....SYH............................................................TEEY.LGNL.
HDA14_ARATH/75-387I.A....NVH............................................................DKAY.VFGL.
Q98RL4_GUITH/12-313M.F....NIH............................................................SSIFEFNVI.
Q9K0J2_NEIMB/35-328L.A....LVH............................................................SSKY.LNRL.
Q9U266_CAEEL/18-319I.L....AVH............................................................TKRY.VDDV.
Q9YG09_AERPE/14-309LYT....RVH............................................................SPAY.LRHV.

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------------------------------------------
C2XKX5_BACCE/12-239--------------------------------------------------------------------------------
B9BUU1_9BURK/13-199--------------------------------------------------------------------------------
B9BQL6_9BURK/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
D1N5Z5_9BACT/4-169--------------------------------------------------------------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C2SK71_BACCE/15-171--------------------------------------------------------------------------------
C3Q562_9BACE/31-198--------------------------------------------------------------------------------
D7W5E5_9FLAO/27-172--------------------------------------------------------------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UPR5_METVS/56-208--------------------------------------------------------------------------------
A9AA45_METM6/55-201--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------
Q181H4_CLOD6/78-183--------------------------------------------------------------------------------
B6G251_9FIRM/77-182--------------------------------------------------------------------------------
B0A6K5_9FIRM/76-181--------------------------------------------------------------------------------
C0CJH7_9FIRM/6-165--------------------------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387-----------------------------------------------------......TKYGAVNVPLEINP.......
ARGI_COCP7/16-318-----------------------------------------------------......LLDQ.LRDDLE..........
Q6BJQ5_DEBHA/76-370-----------------------------------------------------......SLRG.YNQRADFNP.......
Q6BVQ4_DEBHA/136-428-----------------------------------------------------......SGSI.SPFRKNFS........
Q6BWL4_DEBHA/179-480-----------------------------------------------------VSPDRGRGNPNTNMTEINPYD......
A1ERP9_VIBCL/33-299-----------------------------------------------------......WEGKKFP.W.DFN........
A0RLF1_BACAH/22-286-----------------------------------------------------......E....YSPYLDRE........
A1RXI5_THEPD/26-288-----------------------------------------------------......T....FLPDLQID........
ARGI1_XENLA/6-306-----------------------------------------------------.....LIEKLR.EF..G..........
SPEB_MOUSE/77-350-----------------------------------------------------......A....VNPSTGAL........
Q9V2I5_PYRAB/21-279-----------------------------------------------------......S....YILDYDVD........
A4XKN0_CALS8/20-281-----------------------------------------------------......E....YSVYQDKN........
Q55U21_CRYNB/69-375-----------------------------------------------------......P.DRGYNSRLEVNP.......
A4J1T2_DESRM/21-282-----------------------------------------------------......E....YSVMLDRD........
B8GAJ6_CHLAD/41-309-----------------------------------------------------................VAG........
Q8ZVI7_PYRAE/9-263-----------------------------------------------------......EYTTLFGNVAEPIC.......
A1VQK9_POLNA/34-307-----------------------------------------------------......P....YNMATGAA........
HUTG_HALSA/36-303-----------------------------------------------------......T....HHFDAG..........
Q15JE9_STRHY/25-310-----------------------------------------------------G..AEQPGIVQLRNGRV..........
Q1Q9T2_PSYCK/6-313-----------------------------------------------------...........................
Q3AGG3_SYNSC/27-286-----------------------------------------------------......T....YCPQLNLD........
Q2K8A9_RHIEC/46-316-----------------------------------------------------......P....YDHVLRTA........
A0B180_BURCH/43-310-----------------------------------------------------......ELHP.YP.W.GFD........
Q2F6C6_BOMMO/21-320-----------------------------------------------------.....LIDELK.EID.G..........
B2JW15_BURP8/32-305-----------------------------------------------------......G....IHHVTRFN........
Q6TA07_STRCL/27-300-----------------------------------------------------......G....VGIDRGPG........
A1B175_PARDP/5-250-----------------------------------------------------P..WTASMMPRGDMRFS..........
ARGI_STAAC/5-298-----------------------------------------------------.....LISRLK.QL..D..........
Q982X2_RHILO/42-307-----------------------------------------------------......NDPQ.YP.F.SRD........
Q0FAM8_9RHOB/4-297-----------------------------------------------------.....IVEMIS.GL..G..........
Q1Z9W0_PHOPR/33-298-----------------------------------------------------......WEGKRWP.W.TFN........
HUTG_BACHD/35-311-----------------------------------------------------......T....YSVEEDLD........
HUTG_RHOSR/40-314-----------------------------------------------------..............LAE..........
O68051_RHOCA/3-297-----------------------------------------------------.....LIASLT.AL..G..........
ARGI1_HUMAN/6-305-----------------------------------------------------.....LLEKLK.EQ..E..........
SPEB_CHRVO/44-311-----------------------------------------------------......ELKP.YP.W.GFD........
ARGI_BACSU/3-292-----------------------------------------------------.....LIERLS.DM..G..........
Q97ZX8_SULSO/24-289-----------------------------------------------------......F....YSIRNDVD........
HUTG_VIBVY/45-328-----------------------------------------------------..............WHS..........
A9BRG6_DELAS/16-312-----------------------------------------------------.....LGPALR.QL..G..........
A1ESE8_VIBCL/43-325-----------------------------------------------------..............WHH..........
HUTG_AROAE/40-323-----------------------------------------------------..............WHG..........
Q6MM35_BDEBA/43-314-----------------------------------------------------..............PHLQS........
A1RB53_ARTAT/29-311-----------------------------------------------------G..YPDGCLMNAETRRT..........
Q1J2W9_DEIGD/37-306-----------------------------------------------------.....LRYVPPFTDLSGRT........
Q1ZN31_PHOAS/36-323-----------------------------------------------------..............WHH..........
Q2JER0_FRASC/40-318-----------------------------------------------------.........GTYHLDLGIE........
Q3J346_RHOS4/3-296-----------------------------------------------------.....LGRALA.DL..G..........
A9B324_HERA2/22-290-----------------------------------------------------......F....YDREFDTE........
HUTG_LEGPL/46-318-----------------------------------------------------H...NN.....................
Q9YBG0_AERPE/29-298-----------------------------------------------------......S....NGYYVEGD........
Q1GI44_SILST/34-307-----------------------------------------------------......P....YNMATGAA........
Q9HJB2_THEAC/33-293-----------------------------------------------------......S....FEFSYRFD........
A0RXD6_CENSY/22-283-----------------------------------------------------......V....FHPGLRAD........
A8LLU9_DINSH/46-312-----------------------------------------------------......FDPP.YG.W.GFD........
Q1V061_PELUQ/39-314-----------------------------------------------------......T...NYHPSYDVE........
SPEB_BACHD/22-286-----------------------------------------------------......E....YSPYMDKH........
Q0AG49_NITEC/44-311-----------------------------------------------------......SLKP.YP.W.GFD........
Q2CCZ9_9RHOB/3-297-----------------------------------------------------.....LAAAAE.AL..G..........
Q0W940_UNCMA/16-280-----------------------------------------------------......T....YNPDFGVD........
Q97BB8_THEVO/33-293-----------------------------------------------------......S....YEYSYGID........
ARGI_BREBE/3-294-----------------------------------------------------.....VVARLE.KM..G..........
Q6MHV0_BDEBA/36-309-----------------------------------------------------......G....FHMTRMEN........
Q98MW3_RHILO/19-296-----------------------------------------------------.....ASLVEHWDFDLGGPL.......
A0LG67_SYNFM/34-297-----------------------------------------------------......P....YDEETCTE........
Q1EQG5_STRKN/2-295-----------------------------------------------------.....ILRRLG................
Q1Q5Q5_9BACT/32-299-----------------------------------------------------......P....YDDELGN.........
A0NSP7_9RHOB/73-349-----------------------------------------------------.....YNYEMGVDLREQ..........
HUTG_BACSU/35-311-----------------------------------------------------......A....YSAELGEH........
B8FZG3_DESHD/20-281-----------------------------------------------------......E....YSVYLDKD........
Q9K5Y7_BACHD/5-297-----------------------------------------------------.....LIEEIE.AL..G..........
Q7W6W6_BORPA/29-307-----------------------------------------------------....FNPELADYNPLQR..........
Q6W399_9CREN/23-284-----------------------------------------------------......I....FQPEFGID........
Q0AE23_NITEC/40-304-----------------------------------------------------......WERP.WP.W.NID........
Q1MIP6_RHIL3/52-317-----------------------------------------------------......NDAQ.YP.F.NRE........
A2CDX1_PROM3/29-293-----------------------------------------------------......T....YCPQLDLD........
Q164F4_ROSDO/46-312-----------------------------------------------------......YDPP.YG.W.PFD........
Q164F5_ROSDO/34-308-----------------------------------------------------......P....YNMGTGAA........
Q0G0L1_9RHIZ/42-312-----------------------------------------------------......NDPQ.YP.I.HRD........
Q15X44_PSEA6/42-323-----------------------------------------------------..............YQH..........
A0SJA7_STAXY/3-297-----------------------------------------------------.....IEERIK.AI..G..........
Q1N5V2_9GAMM/42-308-----------------------------------------------------......WEGARWP.W.DFA........
Q4CMT4_TRYCC/16-290-----------------------------------------------------D..CDHYAELIFHDSGPIECP......
Q2CC50_9RHOB/34-307-----------------------------------------------------......P....YNMATGAA........
Q11J67_MESSB/42-307-----------------------------------------------------......NDPQ.YP.F.HLD........
Q1AWJ4_RUBXD/5-295-----------------------------------------------------.....LQPALE.EL..G..........
Q46EM0_METBF/17-282-----------------------------------------------------......S....YNPTFDID........
Q8TZN1_PYRFU/56-314-----------------------------------------------------......S....YILDYDVD........
Q18F18_HALWD/14-268-----------------------------------------------------......D....YDRRTDLH........
Q5V1C2_HALMA/37-301-----------------------------------------------------......T....HHIERG..........
Q5WL42_BACSK/7-290-----------------------------------------------------....RIE....NNQVYNVEKRK....T
Q7UZH9_PROMP/24-288-----------------------------------------------------......T....FCPRLGKD........
Q6CLB8_KLULA/137-438-----------------------------------------------------......N.GISPV..RGFPGSKLR.KL
A0JT79_ARTS2/57-331-----------------------------------------------------......P....YNPAWDVS........
Q2KVZ3_BORA1/13-287-----------------------------------------------------F..DLFRRAGVENPAQF..........
A8H965_SHEPA/50-335-----------------------------------------------------.....S.....................
Q75TI1_GEOSE/31-304-----------------------------------------------------......P....YNPDMDID........
B2UBQ2_RALPJ/40-316-----------------------------------------------------..............ARA..........
Q165U0_ROSDO/35-314-----------------------------------------------------.....FGHAGAYDHEDDATY.......
B1YHV3_EXIS2/22-286-----------------------------------------------------......E....YSPYLDGD........
Q5WIT9_BACSK/27-306-----------------------------------------------------....YLPELDHIDVFEH..........
Q13CK1_RHOPS/14-311-----------------------------------------------------.....IGRLLE.QL..R..........
Q1YMK4_MOBAS/42-312-----------------------------------------------------......NDPQ.FP.F.NQD........
A1C610_ASPCL/68-380-----------------------------------------------------......A.GTSYNTRAGINP.......
Q39HU1_BURS3/40-306-----------------------------------------------------......WERP.WP.W.SFD........
Q05V55_9SYNE/29-297-----------------------------------------------------......S....YCPQLQID........
Q1AS11_RUBXD/33-307-----------------------------------------------------......R....HNPSLGVT........
A0NXD9_9RHOB/25-301-----------------------------------------------------.....FGHAGAYDFEDDITY.......
SPEB_NEIMA/35-300-----------------------------------------------------......WEHRRFP.W.TFD........
A3QIE0_SHELP/50-335-----------------------------------------------------.....S.....................
Q28QX8_JANSC/39-314-----------------------------------------------------......E....MNRSTGQL........
A1WGI6_VEREI/22-320-----------------------------------------------------.....LQAALQ.GH..G..........
A1WER7_VEREI/22-295-----------------------------------------------------......P....YQMATRAA........
A1T3A2_MYCVP/88-364-----------------------------------------------------.....YNYESGVDLREQ..........
HUTG_ENT38/42-310-----------------------------------------------------..............SHH..........
A8LRL4_DINSH/4-296-----------------------------------------------------.....LIDTLG.DL..G..........
Q46TX4_CUPPJ/2-296-----------------------------------------------------.....IVPALA.RM..G..........
A5V551_SPHWW/4-298-----------------------------------------------------.....LAEALA.EL..G..........
Q2B9I2_9BACI/37-317-----------------------------------------------------......A....YNLDEDID........
Q1I7X5_PSEE4/43-309-----------------------------------------------------......WARH.WP.W.AFD........
Q11NZ4_CYTH3/3-310-----------------------------------------------------.....AERAQP.....V..........
Q5V4R8_HALMA/3-300-----------------------------------------------------.....LADQLS.DI..G..........
SPEB_SERP5/33-298-----------------------------------------------------......WEGNRWP.W.NFD........
Q6AG97_LEIXX/4-273-----------------------------------------------------H..VVTVPAAAGEA.............
Q12BY7_POLSJ/72-342-----------------------------------------------------......P....YEHALGLA........
HUTG_VIBF1/45-345-----------------------------------------------------..............WHH..........
Q0UDP7_PHANO/4-284-----------------------------------------------------K..KLGVTIHVVELPPV..........
Q0FAR0_9RHOB/34-308-----------------------------------------------------.....FGHAGAYDHEDDITY.......
Q3IVT5_RHOS4/32-308-----------------------------------------------------......P....INPYRGHIN.......
HUTG_GEOKA/44-315-----------------------------------------------------..............WHLP.........
SPEB_BLOFL/33-298-----------------------------------------------------......WENCRWP.W.NFD........
A0ZFA2_NODSP/30-338-----------------------------------------------------......L....FDFDHPD.........
A2C5F5_PROM1/29-293-----------------------------------------------------......T....YCPQLNLD........
A4XT95_PSEMY/38-311-----------------------------------------------------......P....YNMATGAA........
Q5WB32_BACSK/22-286-----------------------------------------------------......E....YSPYADKH........
Q6C6P6_YARLI/9-306-----------------------------------------------------.....LEKHLQ.SL..D..........
HUTG_NOCFA/35-303-----------------------------------------------------..............LDR..........
Q12UU8_METBU/17-282-----------------------------------------------------......S....YNSFYDID........
A1UHG9_MYCSK/34-307-----------------------------------------------------......T....YHPRLDVE........
A0B2Z1_BURCH/72-345-----------------------------------------------------......P....YNMATRAA........
ARGI_BACCD/2-295-----------------------------------------------------.....VIERLE.RL..H..........
Q213G1_RHOPB/11-309-----------------------------------------------------.....LLPLLT.AL..G..........
A7NL23_ROSCS/33-307-----------------------------------------------------......P....YNPELDVH........
Q28PV5_JANSC/46-313-----------------------------------------------------......FDPP.YG.WDGYS........
A0QRD0_MYCS2/43-317-----------------------------------------------------......P....YHPALDVS........
Q02UC9_PSEAB/35-308-----------------------------------------------------......K....VHHVSRIA........
Q1MAU5_RHIL3/40-310-----------------------------------------------------......P....YEHVLRVA........
ARGI_NEUCR/47-354-----------------------------------------------------.....LLTQLREEL..G..........
A5ENL2_BRASB/10-307-----------------------------------------------------.....LVPLLE.SL..G..........
Q12LW8_SHEDO/33-299-----------------------------------------------------......WEDTRWP.W.DFS........
Q2W8C1_MAGSA/22-290-----------------------------------------------------......D....GANPAGWS........
Q6CIB4_KLULA/61-358-----------------------------------------------------......S.MRGFNFRADINP.......
C5PF24_COCP7/77-371-----------------------------------------------------......A.GSAWSVYSGVNN.......
A1SLP1_NOCSJ/31-312-----------------------------------------------------......DG.SRPHLALRVD........
A0RH36_BACAH/35-312-----------------------------------------------------......T....YAITEEHD........
Q7P2W8_FUSNV/500-780-----------------------------------------------------....DTFDEME.....L..........
A6UDJ1_SINMW/2-296-----------------------------------------------------.....IDTVLA.EL..G..........
Q28VR8_JANSC/34-309-----------------------------------------------------.....FGHAGAYDHEDDVTY.......
B4STA0_STRM5/5-299-----------------------------------------------------.....LPEALE.AR..G..........
A6U7T5_SINMW/42-307-----------------------------------------------------......NDPQ.YP.F.QRD........
Q0UYW2_PHANO/16-320-----------------------------------------------------.....LIQQLEHDL..E..........
O96394_LEIAM/13-316-----------------------------------------------------.....LQQDME.KL..G..........
Y309_METJA/21-281-----------------------------------------------------......T....YSPILDRD........
Q9RZ04_DEIRA/29-298-----------------------------------------------------.....LRSVPPFTGLDGKT........
Q6CLS8_KLULA/13-315-----------------------------------------------------.....LRSDIE.SL..G..........
A2BIW8_HYPBU/25-300-----------------------------------------------------......F....YSLRANLD........
Q21RM0_RHOFD/15-309-----------------------------------------------------.....LAQALT.QL..G..........
Q6L151_PICTO/19-280-----------------------------------------------------......S....FEINYKYN........
Q4P4M4_USTMA/13-318-----------------------------------------------------.....ICQQLE.SL..G..........
Q0I684_SYNS3/31-289-----------------------------------------------------......T....YCPQLDRD........
A1B165_PARDP/30-308-----------------------------------------------------.....VRLLDRYDFDIGGTL.......
Q11QL1_CYTH3/66-323-----------------------------------------------------G..AGS.....................
Q16AD8_ROSDO/4-296-----------------------------------------------------.....LAPAIR.DL..G..........
Q3SMM1_THIDA/8-294-----------------------------------------------------.....VFHDTP.LQ..R..........
Q5AK86_CANAL/12-313-----------------------------------------------------.....FQKQIE.SL..G..........
Q1IPT1_KORVE/2-256-----------------------------------------------------....NSWSEDGRD..TS..........
Q7VSA1_BORPE/8-302-----------------------------------------------------.....LVRLLE.RR..G..........
Q82LW5_STRAW/2-295-----------------------------------------------------.....IVQRLG................
A0BHR2_PARTE/9-311-----------------------------------------------------.....LISALY.NL..G..........
A1UI81_MYCSK/60-335-----------------------------------------------------......P...GYHVELGVA........
HUTG_COREF/43-309-----------------------------------------------------..............VHD..........
Q2JWU8_SYNJA/14-265-----------------------------------------------------F..EPRLGINVDEIAVA..........
B0K9I6_THEP3/23-285-----------------------------------------------------......Y....YSVYLDRR........
Q49V90_STAS1/26-305-----------------------------------------------------....YLPELNHIDISEH..........
Q4JAE9_SULAC/24-287-----------------------------------------------------......F....YSMRTGID........
A1UE14_MYCSK/29-310-----------------------------------------------------......DG.SRPSLALRVD........
A0P3L0_9RHOB/6-302-----------------------------------------------------.....LQDTLR.AL..G..........
Q0FDK0_9RHOB/32-317-----------------------------------------------------A..HADFKIDPWTL.............
Q1YIK6_MOBAS/68-338-----------------------------------------------------......P....YNHVLKTM........
Q088H7_SHEFN/48-332-----------------------------------------------------.....S.....................
Q5JI38_PYRKO/22-281-----------------------------------------------------......S....YILDYDLD........
Q975R8_SULTO/24-287-----------------------------------------------------......F....YSIRTGID........
Q1LGD2_RALME/2-296-----------------------------------------------------.....IAGALV.RN..G..........
ARGI_AGRT5/19-313-----------------------------------------------------.....LTQVLT.EL..G..........
Q1D421_MYXXD/27-337-----------------------------------------------------......L....FDVETGR.........
SPEB1_SCHPO/74-375-----------------------------------------------------......L.YGGYNVPMETNP.......
YHMF_METFE/21-281-----------------------------------------------------......N....YSLHYRK.........
ARGI_YEAST/13-329-----------------------------------------------------.....LQTSIE.DL..G..........
A7NMZ3_ROSCS/53-326-----------------------------------------------------G..VYHAASVPTTISEP..........
A9BN56_DELAS/71-341-----------------------------------------------------......P....YNHVLRSA........
Q5A4M3_CANAL/50-340-----------------------------------------------------......N.LRGFNPKALFDP.......
Q4T7Z4_TETNG/3-305-----------------------------------------------------.....LLHRLQ.EL..E..........
A2BTR8_PROMS/23-287-----------------------------------------------------......T....YCPKIKKD........
Q0FX33_9RHOB/3-297-----------------------------------------------------.....LAEGLA.GL..G..........
A1RBR9_ARTAT/55-335-----------------------------------------------------......P...GYHPELDVE........
A1VTU0_POLNA/3-297-----------------------------------------------------.....LQPTLE.GH..G..........
Q4RH16_TETNG/25-302-----------------------------------------------------.....LIDRLS.AL..D..........
Q0UMJ9_PHANO/68-378-----------------------------------------------------......S.FRGFNPRANLNP.......
Q2U075_ASPOR/4-285-----------------------------------------------------K..EQGLQFRIHEIPSV..........
A1SM48_NOCSJ/41-314-----------------------------------------------------......P....YNPALDVS........
Q1GI45_SILST/67-333-----------------------------------------------------......PDAP.YG.W.DIC........
A0Y6C5_9GAMM/33-299-----------------------------------------------------......WEDTKYP.W.TFP........
PAH_STRCL/30-303-----------------------------------------------------......G....VGIDRGPG........
Q1IHQ4_KORVE/16-311-----------------------------------------------------.....LEAKLE.AL..G..........
Q5K413_AGABI/11-307-----------------------------------------------------.....LVEQLK.GL..G..........
Q6L2W0_PICTO/21-293-----------------------------------------------------......SYCT......DHNV.......
A0R8M1_BACAH/3-293-----------------------------------------------------.....VIERIE.EI..G..........
Q89H72_BRAJA/11-308-----------------------------------------------------.....LATLLE.SL..D..........
Q0FFB5_9RHOB/42-315-----------------------------------------------------......A....MNGATRIK........
A1ZN63_9BACT/41-299-----------------------------------------------------G..KGA.....................
A0Z3U1_9GAMM/41-307-----------------------------------------------------......WENQVQG.W.DFS........
B1KRD6_SHEWM/33-299-----------------------------------------------------......WEETRWP.W.NFK........
Q489X2_COLP3/36-310-----------------------------------------------------......P....YGMYTKAA........
Q7V9I4_PROMA/29-293-----------------------------------------------------......S....FCPQLNLD........
SPEB1_SYNY3/26-297-----------------------------------------------------......A....YDEELGTS........
Q6FP31_CANGA/10-317-----------------------------------------------------.....LQKDLE.EL..G..........
Q2CAN0_9RHOB/40-305-----------------------------------------------------......ELKA.FP.F.GFD........
A5G414_GEOUR/41-319-----------------------------------------------------....FLPEY.ELDLFDY..........
A0YPG8_LYNSP/25-295-----------------------------------------------------......C....YDDELERE........
Q3SVS2_NITWN/5-302-----------------------------------------------------.....ITPVLE.SL..G..........
SPEB2_SCHPO/89-401-----------------------------------------------------......A.IRGFNPSLNVNP.......
Q8XPR0_RALSO/29-309-----------------------------------------------------.....ARAPGHYDFDIDGPLL......
Q52V70_9ACTO/41-314-----------------------------------------------------......P....YNPAQNVY........
Q08C97_DANRE/85-358-----------------------------------------------------......A....YCGWTRAA........
A4G0Y7_METM5/19-278-----------------------------------------------------......T....FSPILKRD........
Q47TW8_THEFY/41-314-----------------------------------------------------......P....YNPGLDVS........
A9KQ98_CLOPH/18-281-----------------------------------------------------......T....FSPYQEKD........
A1BCD2_PARDP/35-312-----------------------------------------------------......R....VHHVTGIA........
B9LGA1_CHLSY/41-309-----------------------------------------------------................ITG........
ARGI_ASHGO/93-395-----------------------------------------------------.....LREGVE.GL..G..........
A1B3P5_PARDP/3-295-----------------------------------------------------.....LASTLI.DL..G..........
Q1QTM4_CHRSD/39-312-----------------------------------------------------......P....YNMATRAA........
Q6C732_YARLI/86-381-----------------------------------------------------......P.GQVSPYREGFML.......
A0LDK6_MAGSM/20-293-----------------------------------------------------......V....WDELHGRE........
Q47D78_DECAR/17-302-----------------------------------------------------.....AWHELE.HH..P..........
Q3JAG2_NITOC/2-290-----------------------------------------------------.....LVAHLR.QQ..G..........
A6UC62_SINMW/70-340-----------------------------------------------------......P....YNHVLGCA........
A3DDA1_CLOTH/24-286-----------------------------------------------------......E....YSVYMDRD........
A1CKP4_ASPCL/16-320-----------------------------------------------------.....LLNQVRDDL..G..........
B8G5W4_CHLAD/5-298-----------------------------------------------------.....LSRRLA.EL..G..........
ARGI1_SCHPO/22-319-----------------------------------------------------.....LPEDLE.RL..G..........
Q1QAH6_PSYCK/33-307-----------------------------------------------------......P....YNVATRAA........
HUTG_PHOLL/44-316-----------------------------------------------------..............SHK..........
Q1MB14_RHIL3/6-300-----------------------------------------------------.....VDQTLI.EL..G..........
Q3IQJ3_NATPD/45-332-----------------------------------------------------...........YLSGYKGGLTNVRTEQ
A5FB51_FLAJ1/47-336-----------------------------------------------------.....H.....................
Q2BIH2_9GAMM/39-305-----------------------------------------------------......WEGARWP.W.NFA........
SPEB2_SYNY3/83-361-----------------------------------------------------.....YNFEMGVDLREQ..........
Q5LKZ4_SILPO/42-315-----------------------------------------------------......A....GNPATGVN........
Q2RHH4_MOOTA/26-287-----------------------------------------------------......E....YSPYLQRE........
Q2B080_9BACI/2-294-----------------------------------------------------.....VNERLK.SL..F..........
Q17HI3_AEDAE/32-333-----------------------------------------------------.....LIDSIQ.EISTK..........
A1RP77_SHESW/50-343-----------------------------------------------------.....S.....................
A3CU48_METMJ/19-276-----------------------------------------------------......S....YDPATKID........
HUTG_HAHCH/40-316-----------------------------------------------------..............WRL..........
Q4QBG9_LEIMA/24-299-----------------------------------------------------D..CDMYAELTFHEPGPVECP......
Q8RA93_THETN/28-290-----------------------------------------------------......T....YSVYLDRR........
Q8END5_OCEIH/29-310-----------------------------------------------------....YLPELNDIDVLQH..........
Q493F1_BLOPB/33-298-----------------------------------------------------......WEHFRWP.W.NVN........
Q5ANN8_CANAL/115-414-----------------------------------------------------......S.AWKSTKKRFNYPVNP...Y
A0NZA6_9RHOB/69-339-----------------------------------------------------......P....YDHVLRTS........
A1VGG3_DESVV/22-283-----------------------------------------------------...........LWDGLSI.........
B2T8M0_BURPP/39-312-----------------------------------------------------......N....VNRSSNIN........
Q2LPR8_SYNAS/65-343-----------------------------------------------------....FLPEY.ELDFFDY..........
A1ST87_PSYIN/33-299-----------------------------------------------------......WEGKRFP.W.KFN........
ARGI1_ARATH/63-338-----------------------------------------------------....NSATEEGKELKDP..........
Q5HZ88_XENLA/108-381-----------------------------------------------------......R....YNIATKAA........
O29611_ARCFU/17-266-----------------------------------------------------......S....YSNLFDVE........
Q1V7V4_VIBAL/45-328-----------------------------------------------------..............WHQ..........
ARGI_LITCT/7-306-----------------------------------------------------.....LIEKLE.EL..E..........
Q5SJ85_THET8/15-277-----------------------------------------------------......P....FLLELGAA........
A0R0G1_MYCS2/40-312-----------------------------------------------------......G....YNPELDIA........
A1CFK4_ASPCL/83-374-----------------------------------------------------.........GGWSIYTGENV.......
B8I5M8_CLOCE/21-282-----------------------------------------------------......T....YSPYFDAD........
A1TIE4_ACIAC/8-305-----------------------------------------------------.....LGPALE.RL..G..........
B1KR08_SHEWM/50-335-----------------------------------------------------.....S.....................
Q0FJQ8_9RHOB/38-313-----------------------------------------------------.....FGHAGAYDHEDDVTY.......
A1T9H7_MYCVP/46-324-----------------------------------------------------.........GTYHMDLGLE........
Q97VA3_SULSO/30-299-----------------------------------------------------......P....YNQFLDTY........
B1YR75_BURA4/21-323-----------------------------------------------------.....LAARLG................
Q8TXD6_METKA/24-253-----------------------------------------------------Y...DP.....................
Q581Y0_TRYB2/24-298-----------------------------------------------------D..CDHYAELTIHDKGPIECP......
Q4J720_SULAC/30-299-----------------------------------------------------......P....YNQFLDTY........
Q3J2B4_RHOS4/46-312-----------------------------------------------------......YDRP.FG.W.GFD........
A1CGK0_ASPCL/61-357-----------------------------------------------------......K.GRSYNTVWGVDP.......
Q10Y47_TRIEI/24-296-----------------------------------------------------......C....YDEELDRE........
A5G278_ACICJ/28-297-----------------------------------------------------......G....NHHPHYRV........
ARGI_SOYBN/71-346-----------------------------------------------------....NSTTEEGKDLKDL..........
A0NYN1_9RHOB/60-337-----------------------------------------------------.....ADLVDNWDFDLGGPL.......
Q98B74_RHILO/368-601-----------------------------------------------------...........................
O76895_DROME/30-333-----------------------------------------------------.....LRQVLQ.SSHDG..........
A1W2M6_ACISJ/2-298-----------------------------------------------------.....IARAMQ.AR..G..........
Q4A3J0_CYPCA/24-323-----------------------------------------------------.....LVERLS.NL..D..........
B2TBR8_BURPP/45-312-----------------------------------------------------......ELGA.FP.W.GVD........
A8GC83_SERP5/32-305-----------------------------------------------------......P....YNMGTAAA........
B7WTA0_COMTE/4-303-----------------------------------------------------.....LGPALE.RL..G..........
Q0F026_9PROT/13-273-----------------------------------------------------......T....WSPDLDSD........
A7NJ86_ROSCS/2-295-----------------------------------------------------.....LRERIV.AL..G..........
Q1GHG8_SILST/4-296-----------------------------------------------------.....LAQALE.SL..G..........
Q9HP79_HALSA/17-266-----------------------------------------------------......D....YHHRTGTH........
Q65P52_BACLD/4-300-----------------------------------------------------.....VNERLE.CL..C..........
Q4A3J2_CYPCA/25-324-----------------------------------------------------.....LVQKLK.GQ..G..........
Q67TJ0_SYMTH/28-290-----------------------------------------------------......E....FSYHSRMS........
A4XZN2_PSEMY/43-309-----------------------------------------------------......WARH.YP.W.EFD........
Q5LVU6_SILPO/18-278-----------------------------------------------------I..TNGA..........E.........
A1A614_XENLA/26-326-----------------------------------------------------.....LIDRLS.NL..G..........
A4YE21_METS5/29-295-----------------------------------------------------......P....YNPFQKVY........
Q5QV39_IDILO/51-340-----------------------------------------------------.....K.....................
A1ZJF0_9BACT/15-273-----------------------------------------------------....NMSTESEVDLSKH..........
A1SAJ7_SHEAM/49-334-----------------------------------------------------.....S.....................
Q6ANF4_DESPS/59-334-----------------------------------------------------......S....YEEVLDVD........
Q0SVK6_CLOPS/20-280-----------------------------------------------------......S....YSPYQDLD........
A1RSZ1_PYRIL/9-263-----------------------------------------------------......EYTTVFGNMAKPIC.......
Q5V104_HALMA/12-261-----------------------------------------------------......D....YDHRTDQH........
Q5QTW3_IDILO/29-298-----------------------------------------------------Y..SPYLDADLEDQTFY..........
A0NU34_9RHOB/41-306-----------------------------------------------------......GDPQ.YP.F.EMD........
A1ZV42_9BACT/26-290-----------------------------------------------------......F....YDIETQTE........
Q222F3_RHOFD/24-298-----------------------------------------------------......D...GSHPFFGVS........
ARGI2_MOUSE/24-324-----------------------------------------------------.....LLKRLS.RL..G..........
Q1Z3J6_PHOPR/33-324-----------------------------------------------------..............KGS..........
Q315M1_DESDG/23-287-----------------------------------------------------...........LWDGLSD.........
A7IL28_XANP2/50-316-----------------------------------------------------......GDPF.YP.F.GID........
Q18A84_CLOD6/21-285-----------------------------------------------------......T....YSPFLDLD........
Q07N69_RHOP5/13-310-----------------------------------------------------.....LVPMLQ.SL..D..........
A0M038_GRAFK/2-255-----------------------------------------------------....NMYAENLTNIENS..........
B8FW33_DESHD/4-296-----------------------------------------------------.....LHERLK.KL..G..........
Q5V6R7_HALMA/44-335-----------------------------------------------------......PPYEHFNIETGID........
Q5LRK8_SILPO/33-325-----------------------------------------------------.....LAEALA.DL..G..........
Q9K8M2_BACHD/4-296-----------------------------------------------------.....LIERLQ.SI..G..........
Q3ABP1_CARHZ/20-281-----------------------------------------------------......E....YDWDLEKS........
A9CJC2_AGRT5/42-307-----------------------------------------------------......NDPQ.YP.F.ARD........
Q0FFC7_9RHOB/42-306-----------------------------------------------------......ELDA.FP.F.GFN........
Q7U3K9_SYNPX/21-280-----------------------------------------------------......T....YCPQLDLD........
Q4D5Y5_TRYCC/22-297-----------------------------------------------------V..NNLELNVDASH.............
A1STQ5_PSYIN/47-343-----------------------------------------------------..............WHHQT........
Q7VY32_BORPE/13-287-----------------------------------------------------Y..DLARRAGVDNPVEF..........
Q9CL61_PASMU/34-299-----------------------------------------------------......WEHCRFP.W.DFD........

PF00850

A0B6D0_METTP/17-279.....................................................R..........................
A0B926_METTP/7-310.....................................................K..............EERPDPALG...
A0DIS2_PARTE/29-344.....................................................EGLFNAV..GNEQ.....LTK......
A0LGT0_SYNFM/15-314.....................................................EEACLLE..MGE...............
A0YQ85_LYNSP/13-307.....................................................KAISVNG..GGY...............
A1RXP5_THEPD/28-317.....................................................KRMSE..........LGAGLLDY....
A1W7T1_ACISJ/25-356.....................................................ASAWQQW..VSLG.....EGQDRVQPF
A1ZSA9_9BACT/6-274.....................................................LKGNIKN..GFDNK.............
A2BL29_HYPBU/15-315.....................................................EELAGRG..GGYI..............
A2R705_ASPNC/140-407.....................................................ESTK.DM..SDDE.....LIA......
A3CXQ9_METMJ/14-294.....................................................REMATGT..CF................
A3DNS7_STAMF/16-313.....................................................MKCRNNA..PCQI..............
A3GH68_PICST/21-341QDRL............................................RLDRTVTSL.AS..NHDTINDEISISES....
A3GTQ3_VIBCL/7-300.....................................................LEGTLSA..AKMRRIGFPW........
A3IXM3_9CHRO/8-295.....................................................CQGTLSD..KVQRRIGLPW........
A3JI99_9ALTE/13-341.....................................................KHGYEEW..MASG.....EKMGEE...
A3W9J6_9SPHN/44-368.....................................................KAAHDEW..LAAG.....REGDAIGYA
A3WE49_9SPHN/7-292.....................................................FSAQVPH..AKERRIGFPV........
A3WNS9_9GAMM/8-295.....................................................ITNQFDK..KEWRKVGFPW........
A3Y9Y0_9GAMM/13-341.....................................................QSVWQKW..QAAG.....HTCDAIPNI
A3ZYN7_9PLAN/13-308.....................................................EGFSLKG..GGR...............
A4BCK9_9GAMM/15-306.....................................................DRINPKY..GLIQ..............
A4BMJ9_9GAMM/17-332.....................................................GELRELL..QEGEEYIPSIFQPDLSAA
A4C5S3_9GAMM/8-296.....................................................LTGELDS..KAIRKMGFPW........
A4C8Y5_9GAMM/14-303.....................................................LATLPQA..GLAD..............
A4S2N1_OSTLU/197-606.....................................................AELSDRV..GQTPIAFTPYCQNHNGVP
A4S898_OSTLU/22-313.....................................................RASALDA..KREREIGLPW........
A4U490_9PROT/14-308.....................................................LSSVPEP..GEFFH.............
A4WPH0_RHOS5/24-326.....................................................KALSDRG..GGELGLR...........
A4X4X7_SALTO/10-318.....................................................RNA...........PQDPFFTGFG...
A4YNH4_BRASO/45-371.....................................................EEAWDAW..AALS.....DAGSEMIPN
A5D0K9_PELTS/22-316.....................................................KEFSKRG..GGS...............
A5H660_SCHMA/8-358.....................................................KKLQMLH..CEEKELTADDELLM....
A6C208_9PLAN/13-308.....................................................KEFCEQG..GGH...............
A6C6K6_9PLAN/13-308.....................................................QAFSAAG..GGR...............
A6E8D2_9SPHI/7-293.....................................................KMLSLPP..KDQRRIGLPL........
A6FY71_9DELT/35-323.....................................................ESAAVME..QAFGEVVPPGP.......
A6GQW9_9BURK/14-305.....................................................KARFPLK..RNID..............
A6Q2Z0_NITSB/15-300.....................................................EHAYENG..YRF...............
A6QAF4_SULNB/14-302.....................................................REASQQN..RS................
A6QHR8_STAAE/14-324.....................................................KHASHG.......IISEDEAKKYG...
A6R4B6_AJECN/49-360.....................................................QT...VI..PSDMENTALNDRMA....
A6VSZ5_MARMS/14-305.....................................................FARAPEE..GHVE..............
A7E372_BOVIN/21-321.....................................................KWSFAVA..TITEIPPVIFL.......
A7SSG8_NEMVE/23-333.....................................................KSTQ.DM..KPRD.....LFN......
A7SUP8_NEMVE/23-330.....................................................RRAAEAV..SDGSEECEDLVE......
A7TRW5_VANPO/9-404DPVYNRIIQYDDDESKWSQLHPYIRDWLDSHPEEVPTSGMIEKRAGLLEFYKKY...NRF..KKKRSISEA.FSESESES
A8ABS4_IGNH4/14-309.....................................................KRVIEAG..GGYL..............
A8MBN2_CALMQ/13-310.....................................................TSLCATG..GWL...............
A8ZT95_DESOH/16-310.....................................................LKTAEHK....................
A9A062_DESOH/259-573.....................................................QAACASV..PENE.....SIYPYVFPI
A9B5I1_HERA2/14-309.....................................................QRMAQF...GDW...............
A9W0L9_METEP/18-304.....................................................LAAQVPR..VIERAIGLPV........
B0T7F0_CAUSK/32-328.....................................................KIMSGFP..TGGE..............
B2JV93_BURP8/15-309.....................................................AESAPSH..GYMP..............
B4U8T2_HYDS0/14-304.....................................................YEFCKKG..GGY...............
B9LI73_CHLSY/14-310.....................................................RQLASYG..GGQ...............
C5KDG6_PERM5/340-870.....................................................VSIDNYL..QQQVELKDKPLEEIA...
E0TF48_PARBH/5-292.....................................................REGTIDP..RAMRRIGFPW........
E2RU63_GIAIC/11-320.....................................................KNITPET..LSKFQDLA..........
F2G2X2_ALTMD/14-319.....................................................FEQAAQA..MFSDHEKTQYSERKDS..
O58986_PYRHO/14-303.....................................................RGLSLNG..GGYL..............
O67135_AQUAE/10-314.....................................................MEAERCQ......CVPKGAREKYN...
HDA1_YEAST/69-395.....................................................ESTE.KM..SREE.....LLK......
Q00U49_OSTTA/445-741.....................................................LTRTLSE..QEVRTIGFPM........
Q027B1_SOLUE/10-293.....................................................LHGDVDP..RVMRRIGFPW........
Q02CA3_SOLUE/14-311.....................................................RSDVAS.....G......RPY......
Q0A6Z7_ALHEH/46-336.....................................................YALRGKH..AW................
Q0ARF0_MARMM/14-308.....................................................LTACADA..PAGQWLALDPD.......
Q0EVU6_9PROT/10-312.....................................................IELS..........ISGEGFLDY....
Q0FL11_9RHOB/14-304.....................................................AGAEPTE..GEIA..............
Q0G2C9_9RHIZ/12-346.....................................................RGAWSRF..QALR.....NAGPEVLPN
Q0HTM8_SHESR/7-295.....................................................IQGSLSS..TALRRIGFPW........
Q0W553_UNCMA/15-300.....................................................ETSGTGM....................
Q11YA3_CYTH3/7-294.....................................................NTLSLSP..SEIRKTGFEL........
Q15WQ0_PSEA6/14-301.....................................................TRGMLDP..KAMRRIGFPW........
Q1CZX8_MYXXD/21-314.....................................................QRINGHR..AQ................
Q1H8P7_PLADU/25-312.....................................................FTGKTSE..KEQRRTGFKW........
Q1IJP8_KORVE/31-346.....................................................IEGTLTA..REELALEIPY........
Q1N4R7_9GAMM/15-306.....................................................YNISPPK..GMIL..............
Q1NWE2_9DELT/15-311.....................................................AATAGRP..FEV...............
Q1PVG5_9BACT/13-309.....................................................QQIADSG..GGW...............
Q1Q8W0_PSYCK/7-294.....................................................KTQTLPR..KEARAIGFEM........
Q1YFS2_MOBAS/8-295.....................................................LFSAVPP..QMEKAIGFRV........
HDA6_CAEEL/438-748.....................................................RTTETMK..DEEL.....MEE......
Q22CW6_TETTS/20-322.....................................................EQMWPEG..CEKENMVLNG........
Q232Y2_TETTS/86-443.....................................................NYAAYVS..KCIEIPLFFL........
Q23M98_TETTS/2143-2453.....................................................EGMWPEK..TKKKEIYMLD........
Q29CG7_DROPS/25-326.....................................................RWSLNVA..RIAEVSLMAFV.......
Q2BQU8_9GAMM/14-305.....................................................EMKLPEH..GVVY..............
Q2FQ17_METHJ/14-290.....................................................ITTGS......................
Q2FQW8_METHJ/14-311.....................................................EEASVNG..AII...............
Q2IF50_ANADE/16-319.....................................................RGHVEAA..ARTG.....M........
Q2JQR9_SYNJA/13-301.....................................................AELAEAG..GGR...............
Q2KBQ8_RHIEC/14-309.....................................................MREIPEEEDGINQ..............
Q2LUP3_SYNAS/17-292................................................................................
Q2LVD3_SYNAS/15-311.....................................................ASTARME..YSC...............
Q2R9B1_ORYSJ/26-342.....................................................RD...LT..PESYFNDAALRQKA....
Q2S035_SALRD/7-313.....................................................EAASDG.......TPP.PEARAFG...
Q2SC27_HAHCH/8-315.....................................................SHSAAIS..RVVENSLLKWL.......
Q30PJ4_SULDN/258-572.....................................................RRACEII..EPGK.....SIYPIVFPL
Q31EP6_THICR/49-347.....................................................EILSDSG..GGF...............
Q31HC2_THICR/13-304.....................................................KKHLPEN..GFVK..............
Q38C74_TRYB2/21-323..............................................................GLHSNRSWLWNTEV....
Q39UV4_GEOMG/11-315.....................................................REFSDS.......D.EPRADFRYG...
Q3AFN8_CARHZ/10-319.....................................................MNL.SK.......NPENVNGSRFG...
Q3AX40_SYNS9/8-294.....................................................SRDQLTR..PEQRRIGLPA........
Q3IHM6_PSEHT/12-298.....................................................YHNQLDE..KAMRRIGLPW........
Q3SA60_9EURY/14-304.....................................................ERMSMRG..PTF...............
Q3UG37_MOUSE/97-402.....................................................ETTQ.YM..NEGE.....LRV......
Q3ZWU5_DEHSC/14-306.....................................................EEVGFSG..GGW...............
Q4D762_TRYCC/47-388.....................................................SIREALS..EVDERASTVKRSRAEGIQ
Q4FNF7_PELUB/14-306.....................................................EKSFPEK....G......LSF......
Q4JA06_SULAC/13-290.....................................................KVASQMG..EPL...............
Q4KAJ1_PSEF5/12-340.....................................................ENAWSEW..TATG.....RSHDALPLV
Q4MYQ3_THEPA/25-416.....................................................SFWTGQL..SKLN.....SSSKGKRAY
Q4P2D6_USTMA/326-751.....................................................PEHLPQG..DLYLAGPSDQ........
Q4QAJ4_LEIMA/91-404.....................................................RQAPVIC..GNPLDEMSLAFQKE....
Q4QI60_LEIMA/58-432.....................................................KDSSSGS..DLGRAVPLISAANRSQWI
Q4TFH7_TETNG/505-904.....................................................RATA.TM..KPRD.....LHR......
HDA21_DICDI/1072-1486.....................................................EDLTEKL..DANEIRPLNVNNDGASTG
Y535_METJA/17-305.....................................................INLS.KS..FNYY..............
Q59Q78_CANAL/56-379GPRT............................................FLDKNFNKIDKA..ETDLTN..IVIEEN....
Q5AF34_CANAL/175-593.....................................................FELCLES..HEKLNNDELEVPDD....
Q5K8L3_CRYNJ/64-492MAHT............................................DRDPNDPTHLPS..SPSSSASSPRPAKI....
Q5KKR8_CRYNJ/28-368.....................................................ES...VL..PENA..DALTGNRS....
Q5XQ67_9ARCH/18-315.....................................................EAMCRRG..GGA...............
Q60DG7_ORYSJ/34-350.....................................................VQANAVG..AKK...............
Q6AJC0_DESPS/18-318.....................................................EEAVLFG..KSH...............
Q6AKN4_DESPS/15-311.....................................................REHALKS..NPFS..............
Q6C3Y5_YARLI/54-352.....................................................LKKGQSE..KTL...............
Q6CGA7_YARLI/254-648.....................................................EKLCLES..KDKLEAGQLELPPG....
Q6FWB7_CANGA/8-383DEQLNWNPQIDGNEDQLMELRKAW...NDITTSNEASKPDFKTYSELLHYYRDHIEVSEH..NKKRTALEAELSDVES..
HDAH_ALCSD/31-329.....................................................KRVSNLP..TGGD.....TG.......
Q72NV2_LEPIC/14-310.....................................................ENSKGKR..GY................
Q741C0_MYCPA/14-307.....................................................EAARPQH..GYVY..............
Q7PS30_ANOGA/118-424.....................................................AQTHGSQ..DEPE.....LER......
Q86YH7_HUMAN/553-881.....................................................GTNPLNR..QKLD.....SKK......
Q8EP92_OCEIH/11-321.....................................................KRAGSG.......EITEESALEYG...
Q8I4I9_CAEEL/17-318.....................................................VSLNSTE..KCEE..............
Q8IR37_DROME/555-861.....................................................RRLL.GR..EPKE.....LHD......
Q8LK09_MAIZE/215-515.....................................................EQTK...............NM......
Q8SQN9_ENCCU/9-289................................................................................
HDA14_ARATH/75-387.....................................................EKAMDEA..SDSG.....LIFI.....
Q98RL4_GUITH/12-313.....................................................KK...KN..FESI......NYIT....
Q9K0J2_NEIMB/35-328.....................................................ESCLPQK..GK................
Q9U266_CAEEL/18-319.....................................................KSTETMT..VEQQ.....ES.......
Q9YG09_AERPE/14-309.....................................................LSTAESG..LDWL..............

PF12640

B5Z5P5_BACCE/12-235----------------------------------------------E---------------------------------
C2XKX5_BACCE/12-239----------------------------------------------E---------------------------------
B9BUU1_9BURK/13-199----------------------------------------------E---------------------------------
B9BQL6_9BURK/13-201----------------------------------------------E---------------------------------
A8MKG9_ALKOO/16-197----------------------------------------------E---------------------------------
D1N5Z5_9BACT/4-169----------------------------------------------D---------------------------------
Q0YSC5_9CHLB/5-197----------------------------------------------E---------------------------------
Q12VI5_METBU/19-180----------------------------------------------I---------------------------------
Q1CZJ9_MYXXD/103-253----------------------------------------------D---------------------------------
Q6ARQ8_DESPS/48-185----------------------------------------------D---------------------------------
C2SK71_BACCE/15-171----------------------------------------------C---------------------------------
C3Q562_9BACE/31-198----------------------------------------------D---------------------------------
D7W5E5_9FLAO/27-172----------------------------------------------D---------------------------------
A3TZZ3_9RHOB/31-170----------------------------------------------D---------------------------------
C6C1I6_DESAD/28-165----------------------------------------------D---------------------------------
C5KCK7_PERM5/16-196----------------------------------------------D---------------------------------
B7FS57_PHATC/11-216----------------------------------------------E---------------------------------
C3XU32_BRAFL/3-238----------------------------------------------.---------------------------------
CE022_DANRE/15-248----------------------------------------------E---------------------------------
Q1RMV5_BOVIN/19-257----------------------------------------------E---------------------------------
A7UTP5_ANOGA/103-265----------------------------------------------E---------------------------------
B3M7P2_DROAN/118-284----------------------------------------------D---------------------------------
B4N4R0_DROWI/108-274----------------------------------------------D---------------------------------
A7SLH9_NEMVE/10-251----------------------------------------------E---------------------------------
B7PMV1_IXOSC/7-174----------------------------------------------E---------------------------------
A9VAD6_MONBE/67-213----------------------------------------------E---------------------------------
A6UPR5_METVS/56-208----------------------------------------------K---------------------------------
A9AA45_METM6/55-201----------------------------------------------K---------------------------------
A6UX51_META3/57-190----------------------------------------------K---------------------------------
D0MD43_RHOM4/57-211----------------------------------------------D---------------------------------
Q181H4_CLOD6/78-183----------------------------------------------D---------------------------------
B6G251_9FIRM/77-182----------------------------------------------D---------------------------------
B0A6K5_9FIRM/76-181----------------------------------------------D---------------------------------
C0CJH7_9FIRM/6-165----------------------------------------------E---------------------------------

PF00491

SPEB3_SCHPO/85-387..FKSWAKLV....................................D......CGD.I........PVT...........
ARGI_COCP7/16-318......YDIR....................................H......DGQ.V........HTYAEFVPEH....
Q6BJQ5_DEBHA/76-370..YTSWAKVI....................................D......CGD.M........PVT...........
Q6BVQ4_DEBHA/136-428..LFKDGKIV....................................D......CGD.P........PMT...........
Q6BWL4_DEBHA/179-480.PRSHNLSII....................................D......CGD.V........PMT...........
A1ERP9_VIBCL/33-299..LFKKINVI....................................D......AGD.L........VFD...........
A0RLF1_BACAH/22-286...LEEVKYF....................................D......AGD.I........PLP...........
A1RXI5_THEPD/26-288...VERLAVN....................................D......AGD.L........PVL...........
ARGI1_XENLA/6-306......NDVR....................................D......CGD.L........DFPDVPND......
SPEB_MOUSE/77-350..PFQSLRVA....................................D......LGN.V........NVN...........
Q9V2I5_PYRAB/21-279...IAELKIA....................................D......AGD.V........AL............
A4XKN0_CALS8/20-281...LFNKAFC....................................D......MGD.L........ELP...........
Q55U21_CRYNB/69-375..YSGDLSIL....................................D......CGD.V........PVT...........
A4J1T2_DESRM/21-282...LADYAYY....................................D......AGD.V........AIP...........
B8GAJ6_CHLAD/41-309...LADLPIC....................................D......LGD.V........PVD...........
Q8ZVI7_PYRAE/9-263..DLGDVELL....................................Q......GRP........................
A1VQK9_POLNA/34-307..PFDALQVA....................................D......LGD.V........PIN...........
HUTG_HALSA/36-303....AVSGVA....................................D......LGDVV......................
Q15JE9_STRHY/25-310....PLERAV....................................D......IGDVL......................
Q1Q9T2_PSYCK/6-313..............................................S......KEL.N........ADYFEKLQFDSIED
Q3AGG3_SYNSC/27-286...LEDLNFA....................................D......LGA.V........EIP...........
Q2K8A9_RHIEC/46-316..PTAHARVA....................................D......VGD.V........PFK...........
A0B180_BURCH/43-310..PFDDLAAV....................................D......YGD.C........WFD...........
Q2F6C6_BOMMO/21-320......LDVK....................................D......FGD.I........ETSSCENN......
B2JW15_BURP8/32-305..PFDACRVA....................................D......IGD.V........PFT...........
Q6TA07_STRCL/27-300..VFDRIDVV....................................D......GGD.I........DLS...........
A1B175_PARDP/5-250.....................................................CGS........................
ARGI_STAAC/5-298......LDVY....................................D......KGD.I........KVPAVNIEKF....
Q982X2_RHILO/42-307..LFEHLAVV....................................D......YGD.C........LLD...........
Q0FAM8_9RHOB/4-297......HYVD....................................D......IGN.I........FPDEFEENN.....
Q1Z9W0_PHOPR/33-298..LTQAIKIE....................................D......CGD.L........VFD...........
HUTG_BACHD/35-311...LAQLKLT....................................D......LGD.I........TMH...........
HUTG_RHOSR/40-314.....PLRVY....................................D......AGT.V........AVT...........
O68051_RHOCA/3-297......WRIE....................................D......QGD.L........SIGPQAAVA.....
ARGI1_HUMAN/6-305......CDVK....................................D......YGD.L........PFADIPND......
SPEB_CHRVO/44-311..PFEDLAVV....................................D......YGD.C........WFD...........
ARGI_BACSU/3-292......YTVE....................................D......LGD.I........PINREKIK......
Q97ZX8_SULSO/24-289...MGEIGFN....................................D......VGD.I........ILH...........
HUTG_VIBVY/45-328.....PHPLY....................................D......LGT.V........VCD...........
A9BRG6_DELAS/16-312......CQVS....................................D......IGN.L........AGPPNPQT......
A1ESE8_VIBCL/43-325.....PIPIY....................................D......LGN.I........RCE...........
HUTG_AROAE/40-323.....EWPVY....................................D......AGD.AGDVGASTHDAG...........
Q6MM35_BDEBA/43-314...TRLPKIL....................................D......LGD.L........VDK...........
A1RB53_ARTAT/29-311....DFA.AV....................................D......LGDIV......................
Q1J2W9_DEIGD/37-306..RLADVTFA....................................D......AGD.V........VLP...........
Q1ZN31_PHOAS/36-323.....QLPIY....................................D......GGD.T........HCD...........
Q2JER0_FRASC/40-318..IFDWLDVV....................................D......AGD.A........HCP...........
Q3J346_RHOS4/3-296......HAVE....................................D......RGD.V........ALGPLPEMT.....
A9B324_HERA2/22-290..PAKNWGVH....................................T......LPS.V........EVN...........
HUTG_LEGPL/46-318......KHYV....................................D......LGN.V........ICE...........
Q9YBG0_AERPE/29-298...IDRVPIA....................................D......EGD.V........AAV...........
Q1GI44_SILST/34-307..PFDALNIA....................................D......IGD.L........AIN...........
Q9HJB2_THEAC/33-293...LLRARIS....................................D......LGD.M........EE............
A0RXD6_CENSY/22-283...LEEVRID....................................D......LGN.A........KH............
A8LLU9_DINSH/46-312..PLSEFTVV....................................D......YGD.L........AFD...........
Q1V061_PELUQ/39-314..PFKVQQVA....................................D......AGD.I........TCN...........
SPEB_BACHD/22-286...LEEVAYF....................................D......AGD.M........LLP...........
Q0AG49_NITEC/44-311..PFENLAVI....................................D......FGD.C........FLD...........
Q2CCZ9_9RHOB/3-297......YGVT....................................D......LGN.L........TPEAADVAP.....
Q0W940_UNCMA/16-280...LTDVPIH....................................D......MGN.C........DT............
Q97BB8_THEVO/33-293...LLASGMA....................................D......LGD.M........EE............
ARGI_BREBE/3-294......FNIE....................................D......RGD.I........FVTLPHHF......
Q6MHV0_BDEBA/36-309..FFENLKVA....................................D......IGD.C........PTV...........
Q98MW3_RHILO/19-296.FNGKPASCV....................................D......AGD.I........STI...........
A0LG67_SYNFM/34-297...AYRHGIA....................................T......LEE.L........PVV...........
Q1EQG5_STRKN/2-295........AF....................................E......GGV.V........VPPRYDRGD.....
Q1Q5Q5_9BACT/32-299...IFKIGIF....................................T......VGN.L........NIE...........
A0NSP7_9RHOB/73-349......MTLC....................................D......VGDIF......................
HUTG_BACSU/35-311...VVSELLY....................................D......LGD.I........DIH...........
B8FZG3_DESHD/20-281...LSDYAYC....................................D......CGD.L........SLP...........
Q9K5Y7_BACHD/5-297......FEVK....................................D......YGD.I........PINRPATSE.....
Q7W6W6_BORPA/29-307......LGVI....................................D......CGNVR......................
Q6W399_9CREN/23-284...LETVNIN....................................D......LGN.T........KH............
Q0AE23_NITEC/40-304..PMTALRVI....................................D......CGD.C........EPV...........
Q1MIP6_RHIL3/52-317..LFAEMAVI....................................D......YGD.C........LFD...........
A2CDX1_PROM3/29-293...LEEIAFT....................................D......LGA.L........DIP...........
Q164F4_ROSDO/46-312..VLSEFAII....................................D......YGD.L........AFD...........
Q164F5_ROSDO/34-308..PFDSLQVA....................................D......IGD.L........AIN...........
Q0G0L1_9RHIZ/42-312..LFEHLSVV....................................D......YGD.C........ALD...........
Q15X44_PSEA6/42-323.....NVSLL....................................D......KGD.V........VAN...........
A0SJA7_STAXY/3-297......LSVK....................................D......SGN.I........AVPKLDLEKF....
Q1N5V2_9GAMM/42-308..LDDHLKVA....................................D......VGN.V........NFK...........
Q4CMT4_TRYCC/16-290PETVLFMPVL....................................K......CGHMLE......RASV...........
Q2CC50_9RHOB/34-307..PFEHLQVA....................................D......IGD.V........AIN...........
Q11J67_MESSB/42-307..LFDTLAVV....................................D......YGD.C........LLD...........
Q1AWJ4_RUBXD/5-295......YRVS....................................D......LGN.V........EVPIPEAAS.....
Q46EM0_METBF/17-282...LVDLPIY....................................D......AGN.L........ET............
Q8TZN1_PYRFU/56-314...LAEAKIA....................................D......AGD.V........AL............
Q18F18_HALWD/14-268...FSACGVI....................................D......QGN.V........RA............
Q5V1C2_HALMA/37-301....PVRSVA....................................D......LGD.I......................
Q5WL42_BACSK/7-290FTLPKN.ALT....................................D......YGN.I........EIA...........
Q7UZH9_PROMP/24-288...LEDFNYV....................................D......FGS.L........EID...........
Q6CLB8_KLULA/137-438DPYHSGYKIV....................................D......CGD.I........PMT...........
A0JT79_ARTS2/57-331..PFENVQVA....................................D......AGD.M........AVN...........
Q2KVZ3_BORA1/13-287......LRAV....................................D......AGNVV......................
A8H965_SHEPA/50-335......NRFL....................................TGEQSLVLGQ.VDTQDLQLPANA...........
Q75TI1_GEOSE/31-304..IFAYCSGV....................................D......YGD.V........DVI...........
B2UBQ2_RALPJ/40-316.....GRVVV....................................D......AGD.V........TCQ...........
Q165U0_ROSDO/35-314..LPADVRIV....................................D......MGD.A........DIV...........
B1YHV3_EXIS2/22-286...IADAKLF....................................D......AGD.I........PLP...........
Q5WIT9_BACSK/27-306......IRLG....................................D......AGD.V........DV............
Q13CK1_RHOPS/14-311......IEVE....................................D......HGD.M........TRPQRDRGN.....
Q1YMK4_MOBAS/42-312..LFETLSVV....................................D......YGD.C........LLD...........
A1C610_ASPCL/68-380..YSSWATVK....................................D......CGD.I........PIT...........
Q39HU1_BURS3/40-306..PFDVLAAV....................................D......YGD.C........AFD...........
Q05V55_9SYNE/29-297...LEDLAYA....................................D......LGA.V........DIP...........
Q1AS11_RUBXD/33-307..LFDHLSVI....................................D......YGD.V........PVV...........
A0NXD9_9RHOB/25-301.LPAETTRIV....................................D......LGD.A........DIV...........
SPEB_NEIMA/35-300..VRERLNII....................................D......CGD.L........VFS...........
A3QIE0_SHELP/50-335......NQFL....................................DGGHCLVLGQ.IATDDLQLPEGS...........
Q28QX8_JANSC/39-314..PFQAANIA....................................D......LGD.V........AMS...........
A1WGI6_VEREI/22-320......LQSF....................................D......RGN.L........SGPANPWQ......
A1WER7_VEREI/22-295..PFDALRVA....................................D......LGD.V........AIN...........
A1T3A2_MYCVP/88-364......LNMV....................................D......IGDVF......................
HUTG_ENT38/42-310....GHDRLV....................................D......MGT.F........TVE...........
A8LRL4_DINSH/4-296......WQTE....................................D......RGN.L........PGPTWVAD......
Q46TX4_CUPPJ/2-296......LDVS....................................D......AGN.I........AGPVNPLA......
A5V551_SPHWW/4-298......HEVS....................................D......HGD.V........APMRADDV......
Q2B9I2_9BACI/37-317...LTSLTAA....................................D......AGD.V........LMH...........
Q1I7X5_PSEE4/43-309..PFDHLAVI....................................D......YGD.C........AFD...........
Q11NZ4_CYTH3/3-310......LKQF....................................S......KKT.L........SSFPEKRGE.....
Q5V4R8_HALMA/3-300......IDCI....................................D......GGD.I........AVPRPEERDPD...
SPEB_SERP5/33-298..LRDRVNVV....................................D......CGD.I........VFN...........
Q6AG97_LEIXX/4-273.....................................................LGTGV......................
Q12BY7_POLSJ/72-342..PVTRLKMA....................................D......VGD.V........PMR...........
HUTG_VIBF1/45-345.....QSDVY....................................D......GGD.I........QCN...........
Q0UDP7_PHANO/4-284..............................................D...................DFE...........
Q0FAR0_9RHOB/34-308..LDNNINIV....................................D......MGD.A........DII...........
Q3IVT5_RHOS4/32-308..IFEVLRVA....................................D......AGD.A........TCV...........
HUTG_GEOKA/44-315....EGVVVY....................................D......AGD.V........VCI...........
SPEB_BLOFL/33-298..IRQKLKII....................................D......CGD.L........IYK...........
A0ZFA2_NODSP/30-338...GWKQGIFMMEIPQDICEKNEYYRTLAAKIIARLAQGEQLTATPD......LTP.V........LTA...........
A2C5F5_PROM1/29-293...LEDIKFA....................................D......IGS.L........DVP...........
A4XT95_PSEMY/38-311..PFDSLNVA....................................D......IGD.V........AIN...........
Q5WB32_BACSK/22-286...LEEINYF....................................D......AGD.I........PLP...........
Q6C6P6_YARLI/9-306......WDTK....................................F......DGH.L........EFPVPESD......
HUTG_NOCFA/35-303.....PRRAY....................................D......AGT.V........EVV...........
Q12UU8_METBU/17-282...ISEIPAH....................................D......AGN.F........EA............
A1UHG9_MYCSK/34-307..PFAVQQVV....................................D......AGD.I........AVN...........
A0B2Z1_BURCH/72-345..PFDSLQIA....................................D......IGD.V........AIN...........
ARGI_BACCD/2-295......YDIE....................................D......LGD.I........PIGKAERLH.....
Q213G1_RHOPB/11-309......FVVE....................................D......HGDLL........PTPPIDDAD.....
A7NL23_ROSCS/33-307..VFTTLSCI....................................D......YGD.A........PVV...........
Q28PV5_JANSC/46-313..PLEALAIA....................................D......YGD.M........AFD...........
A0QRD0_MYCS2/43-317..PFAQAQVV....................................D......AGD.L........GVN...........
Q02UC9_PSEAB/35-308..PYDLVRVG....................................D......LGD.A........PVN...........
Q1MAU5_RHIL3/40-310..PMGGLKVA....................................D......VGD.V........PMR...........
ARGI_NEUCR/47-354......YRLH....................................G......DDE.V........HLYTDLVPKE....
A5ENL2_BRASB/10-307......LDVT....................................D......YGD.V........GIADMTDLS.....
Q12LW8_SHEDO/33-299..LNQCIKIV....................................D......AGD.L........VFN...........
Q2W8C1_MAGSA/22-290..DPAQMSIA....................................D......LGD.F........SLA...........
Q6CIB4_KLULA/61-358..YQDWASVV....................................D......CGD.V........PVT...........
C5PF24_COCP7/77-371..LRSWAKIV....................................D......CGD.A........PLT...........
A1SLP1_NOCSJ/31-312..ALRDLRVV....................................D......AGD.V........EMP...........
A0RH36_BACAH/35-312...MKESVLY....................................D......CGD.I........TMH...........
Q7P2W8_FUSNV/500-780......ISVE....................................R........Q.............KEDF.......
A6UDJ1_SINMW/2-296......HTVT....................................D......EGD.L........KPVPARDL......
Q28VR8_JANSC/34-309..LGPGTKII....................................D......MGD.A........DII...........
B4STA0_STRM5/5-299......VDVR....................................D......LGN.L........DGPRNPWT......
A6U7T5_SINMW/42-307..LFSQMATI....................................D......YGD.C........LLD...........
Q0UYW2_PHANO/16-320......MNVS....................................Y......DGT.V........HNYSELLPSD....
O96394_LEIAM/13-316......WDTR....................................L......ERV.F........DGKVVEARKAS...
Y309_METJA/21-281...LAELKYC....................................D......LKD.L........DL............
Q9RZ04_DEIRA/29-298..RLQGVTFA....................................D......AGD.V........ILP...........
Q6CLS8_KLULA/13-315......WETT....................................L......EEP.L........KGRDFESGKND...
A2BIW8_HYPBU/25-300...VENIGIS....................................D......LGD.I........AV............
Q21RM0_RHOFD/15-309......LDVK....................................D......CGN.L........HGPANPWL......
Q6L151_PICTO/19-280...IPDAGIC....................................D......LGD.L........PV............
Q4P4M4_USTMA/13-318......WKVD....................................F......TDH..........HSFDHINQGID...
Q0I684_SYNS3/31-289...LEDIPYA....................................D......IGA.V........EIP...........
A1B165_PARDP/30-308.YDGRDVRAV....................................D......CGD.V........TGD...........
Q11QL1_CYTH3/66-323......NNIV....................................D......LGN.L......................
Q16AD8_ROSDO/4-296......YVAE....................................D......RGN.I........SPGAFTPD......
Q3SMM1_THIDA/8-294......V..A....................................W......DAI.L........RVPRM.........
Q5AK86_CANAL/12-313......WTTD....................................L......KEP.L........EGTDYEKMKT....
Q1IPT1_KORVE/2-256......LMLE....................................D......CGD.L........RGFS..........
Q7VSA1_BORPE/8-302......LQVT....................................D......RGN.L........QGAPNPWR......
Q82LW5_STRAW/2-295........AL....................................E......GGV.V........VPPRYDRGE.....
A0BHR2_PARTE/9-311......WEIN....................................D......MGD.I........QGKNYRLHN.....
A1UI81_MYCSK/60-335..PLERVQVV....................................D......AGD.V........TVT...........
HUTG_COREF/43-309.....ARPRY....................................D......AGT.I........RVG...........
Q2JWU8_SYNJA/14-265..............................................Q......LPGLV......................
B0K9I6_THEP3/23-285...LEDKKFY....................................D......LGD.L........VLP...........
Q49V90_STAS1/26-305......LTMG....................................D......VGD.V........PF............
Q4JAE9_SULAC/24-287...MGEIGFS....................................D......VGD.I........VMH...........
A1UE14_MYCSK/29-310..GLKDLRVY....................................D......AGD.V........ALY...........
A0P3L0_9RHOB/6-302......HSVS....................................D......HGN.L........SPADVGSLT.....
Q0FDK0_9RHOB/32-317......AKIT....................................D......LGD.V......................
Q1YIK6_MOBAS/68-338..PTASLKVA....................................D......IGD.V........PFR...........
Q088H7_SHEFN/48-332......NRFL....................................NGNECAILGQ.ISLD.TSLPTTA...........
Q5JI38_PYRKO/22-281...IAELPIA....................................D......IGD.I........AVV...........
Q975R8_SULTO/24-287...MGEVGFN....................................D......VGD.V........VMH...........
Q1LGD2_RALME/2-296......LDVT....................................D......LGN.L........VGPGNPNL......
ARGI_AGRT5/19-313......WAVT....................................D......LGD.A........TPTVEPELS.....
Q1D421_MYXXD/27-337...PYERGIAMLPEPQELRDWNTRAK...ERAQVVIEAGGIHSGEAA......LIQ.A........AQD...........
SPEB1_SCHPO/74-375..FNNWAKIV....................................D......CGD.I........PLT...........
YHMF_METFE/21-281...KLDVPII....................................D......LGD.I........EVI...........
ARGI_YEAST/13-329......WSTE....................................L......EPS.M........DEAQFVGKLKMEKD
A7NMZ3_ROSCS/53-326......RMPA...........................................TQRRI......................
A9BN56_DELAS/71-341..PTRELRVA....................................D......IGD.V........PLS...........
Q5A4M3_CANAL/50-340..YQSWARII....................................D......CGD.I........PVT...........
Q4T7Z4_TETNG/3-305.....................................................................DEP........
A2BTR8_PROMS/23-287...LEDIMYV....................................D......FGS.I........LID...........
Q0FX33_9RHOB/3-297......WEVS....................................D......RGD.V........SIAPQASQP.....
A1RBR9_ARTAT/55-335..PVYEAQVV....................................D......AGD.I........ACT...........
A1VTU0_POLNA/3-297......LRVT....................................D......RGN.I........NGPANPWQ......
Q4RH16_TETNG/25-302......YSVH....................................D......FGD.L........TFLTIEED......
Q0UMJ9_PHANO/68-378..YTSWASIV....................................D......CGD.I........PVT...........
Q2U075_ASPOR/4-285..............................................D...................NFE...........
A1SM48_NOCSJ/41-314..PFAGVQVV....................................D......AGD.I........AAN...........
Q1GI45_SILST/67-333..PASELAIV....................................D......YGD.L........AFD...........
A0Y6C5_9GAMM/33-299..LFERLTVA....................................D......AGD.F........TYP...........
PAH_STRCL/30-303..TFDLINCV....................................D......AGD.I........NLT...........
Q1IHQ4_KORVE/16-311......HVVE....................................D......GGN.V........SVPLAETKD.....
Q5K413_AGABI/11-307......WNVV....................................F......DGH..........HQFEEYNNLD....
Q6L2W0_PICTO/21-293..DLNSLKIL....................................D......AGN.I........DV............
A0R8M1_BACAH/3-293......YDVK....................................D......MGD.I........CIEREKEV......
Q89H72_BRAJA/11-308......FEVV....................................D......YGD.L........SVAEVRDLA.....
Q0FFB5_9RHOB/42-315..PFELANFA....................................D......LGD.A........PVN...........
A1ZN63_9BACT/41-299......YQIV....................................D......LGN.L......................
A0Z3U1_9GAMM/41-307..PLEELAIV....................................D......YGD.C........PFD...........
B1KRD6_SHEWM/33-299..LSDHLSIV....................................D......AGD.L........VYD...........
Q489X2_COLP3/36-310..PFDSFQIA....................................D......IGD.T........PIN...........
Q7V9I4_PROMA/29-293...LEDINFT....................................D......FGN.L........EIN...........
SPEB1_SYNY3/26-297..PCHDLGIY....................................T......CAP.L........ADSNK.........
Q6FP31_CANGA/10-317......WGTE....................................I......QSP.L........DEEEYVKKVKE...
Q2CAN0_9RHOB/40-305..PFEHLAVT....................................D......WGD.C........MID...........
A5G414_GEOUR/41-319......LKIG....................................D......IGD.V........PV............
A0YPG8_LYNSP/25-295..VCFAVGIY....................................T......HPA.I........ADTR..........
Q3SVS2_NITWN/5-302......IDVL....................................D......HGD.I........ALAGVAPAT.....
SPEB2_SCHPO/89-401..YESWAKIL....................................D......CGD.I........PVS...........
Q8XPR0_RALSO/29-309.QGRDDIRFV....................................D......CGD.I........VPD...........
Q52V70_9ACTO/41-314..PFHFSQVA....................................D......AGD.I........SAN...........
Q08C97_DANRE/85-358..PYESIKVA....................................D......IGD.I........NVN...........
A4G0Y7_METM5/19-278...LIDVKIC....................................D......KYN.L........LM............
Q47TW8_THEFY/41-314..PFAEVQVA....................................D......GGD.I........AVN...........
A9KQ98_CLOPH/18-281...LTDYQIF....................................D......GGD.L........ELP...........
A1BCD2_PARDP/35-312..PYERLAVA....................................D......IGD.L........VVQ...........
B9LGA1_CHLSY/41-309...LQHLTIC....................................D......LGD.V........DTT...........
ARGI_ASHGO/93-395......WEIE....................................V......QRP.L........DGHDFEERKQR...
A1B3P5_PARDP/3-295......HTVE....................................D......RGD.L........SPAPGRGQA.....
Q1QTM4_CHRSD/39-312..PFDSLQVA....................................D......IGD.V........PIN...........
Q6C732_YARLI/86-381..YDDWAKFV....................................D......CGD.V........AMH...........
A0LDK6_MAGSM/20-293..ILPELPTH....................................T......LQP.P........SLE...........
Q47D78_DECAR/17-302......L.VD....................................W......GKT.L........FAPDNDGT......
Q3JAG2_NITOC/2-290......MPVS....................................W......EIT.I........QPQES.........
A6UC62_SINMW/70-340..PVHDLRVA....................................D......IGD.V........PFR...........
A3DDA1_CLOTH/24-286...LTQCSFF....................................D......AGD.L........DLP...........
A1CKP4_ASPCL/16-320......YDVH....................................Y......DDT.V........HFYENLTPMN....
B8G5W4_CHLAD/5-298......YQVI....................................D......YGN.L........VTPMVETIPL....
ARGI1_SCHPO/22-319......YSVN....................................V..........V........QNPKFKSRPLK...
Q1QAH6_PSYCK/33-307..PFESLQVA....................................D......IGD.V........PIN...........
HUTG_PHOLL/44-316....GHDKLV....................................D......LGS.I........RAN...........
Q1MB14_RHIL3/6-300......HDVA....................................D......IGD.L........RIVPAMDL......
Q3IQJ3_NATPD/45-332QVSFSALDIV....................................D......CGD.V........PVF...........
A5FB51_FLAJ1/47-336......NRFS....................................KGSQIIVLGQ.LDVSAEMRDVENL..........
Q2BIH2_9GAMM/39-305..LDDHLKVE....................................D......AGN.V........LFK...........
SPEB2_SYNY3/83-361......ISLC....................................D......VGDIF......................
Q5LKZ4_SILPO/42-315..PFALVNCA....................................D......LGD.V........APN...........
Q2RHH4_MOOTA/26-287...LTGVPFY....................................D......AGD.L........DLP...........
Q2B080_9BACI/2-294......EHIH....................................D......LGD.I........AIGRPEVEI.....
Q17HI3_AEDAE/32-333......LDIR....................................D......YGD.I........QYEALNLQG.....
A1RP77_SHESW/50-343......NRFL....................................SGAECLVLGQ.VNTADLQQQTTSNT.........
A3CU48_METMJ/19-276...FSEVPIT....................................D......LGD.L........AV............
HUTG_HAHCH/40-316.....THPVY....................................D......CGN.I.........QW...........
Q4QBG9_LEIMA/24-299PETVIFFPVI....................................Q......CGEMLDE...KGE..............
Q8RA93_THETN/28-290...LEDKKIC....................................D......LGD.L........VLP...........
Q8END5_OCEIH/29-310......YSFG....................................D......LGD.V........DV............
Q493F1_BLOPB/33-298..IRKNLHII....................................D......CGD.L........IYK...........
Q5ANN8_CANAL/115-414DETTHNYSII....................................D......CGD.V........AMT...........
A0NZA6_9RHOB/69-339..PMGKAKIA....................................D......IGD.V........PLL...........
A1VGG3_DESVV/22-283...PAAQGVH...........................................THP..........PVD...........
B2T8M0_BURPP/39-312..PFGLCNCA....................................D......LGD.A........PVN...........
Q2LPR8_SYNAS/65-343......LTVA....................................D......AGD.V........SV............
A1ST87_PSYIN/33-299..LLKKTKII....................................D......AGD.L........VYS...........
ARGI1_ARATH/63-338......RVLT....................................D......VGD.V........PVQEI.........
Q5HZ88_XENLA/108-381..PFESLMVA....................................D......IGD.V........NVN...........
O29611_ARCFU/17-266...LSLVKVG....................................D......AGN.I........NC............
Q1V7V4_VIBAL/45-328.....DAPLY....................................D......LGT.V........VCE...........
ARGI_LITCT/7-306......YEVR....................................D......YGD.L........HFPELPCD......
Q5SJ85_THET8/15-277...PEEVGIH....................................AAEPVPWVAG.M........AEE...........
A0R0G1_MYCS2/40-312..PFQVCQFA....................................D......AGD.I........ACN...........
A1CFK4_ASPCL/83-374..LEGWAKIV....................................D......CGD.A........PLT...........
B8I5M8_CLOCE/21-282...ISDYKIH....................................D......YGD.L........DLP...........
A1TIE4_ACIAC/8-305......LEVE....................................D......LGN.L........HGPPNPRGE.....
B1KR08_SHEWM/50-335......NRFF....................................DGKSCLVLGQ.IKTDDLQLSEEA...........
Q0FJQ8_9RHOB/38-313..LGEEVRIV....................................D......MGD.A........DIV...........
A1T9H7_MYCVP/46-324..IFDWLEVV....................................D......FGD.A........YCP...........
Q97VA3_SULSO/30-299..PFDKLNAC....................................D......MGD.I........NVI...........
B1YR75_BURA4/21-323........AR....................................V.......AW.L........AHPAYVFEP.....
Q8TXD6_METKA/24-253..............................................E......VGDPLEI...LTL..............
Q581Y0_TRYB2/24-298PETVMFMPVL....................................N......CGQMLD......EAAG...........
Q4J720_SULAC/30-299..PFDKLNAC....................................D......LGD.V........NII...........
Q3J2B4_RHOS4/46-312..PLEELTVV....................................D......YGD.L........AFD...........
A1CGK0_ASPCL/61-357..FEEELSIV....................................D......CGD.I........PIT...........
Q10Y47_TRIEI/24-296..TGLEVGIY....................................T......HEP.I........ADTRN.........
A5G278_ACICJ/28-297..MVDDMDLA....................................D......AGD.F........AIA...........
ARGI_SOYBN/71-346......RIMV....................................D......VGD.I........PIQEM.........
A0NYN1_9RHOB/60-337.FDSKPACCT....................................D......IGN.V........VTL...........
Q98B74_RHILO/368-601......FDVV....................................E......LAD........................
O76895_DROME/30-333......LVIR....................................D......YGN.L........QYAVDEPLLQQ...
A1W2M6_ACISJ/2-298......FDVR....................................D......QGN.L........AGPGNPQA......
Q4A3J0_CYPCA/24-323......YAVH....................................D......FGD.L........AFKHLEKD......
B2TBR8_BURPP/45-312..PFDHLNVV....................................D......YGD.C........WFD...........
A8GC83_SERP5/32-305..PFERLQVA....................................D......LGD.I........AIN...........
B7WTA0_COMTE/4-303......VQVS....................................D......LGN.L........AGPGNPRGA.....
Q0F026_9PROT/13-273...LESVHYA....................................D......AGD.L........ELP...........
A7NJ86_ROSCS/2-295......CQVR....................................D......LGN.I........SVPLAEQIEP....
Q1GHG8_SILST/4-296......HTVE....................................D......IGN.V........TPAPHAPD......
Q9HP79_HALSA/17-266...FSALSVT....................................D......YGD.V........RA............
Q65P52_BACLD/4-300......QDIE....................................D......LGD.M........TIGQREDEKEG...
Q4A3J2_CYPCA/25-324......CVVK....................................D......YGN.L........TFEDIPND......
Q67TJ0_SYMTH/28-290...LTDKNFF....................................D......LGD.V........AVV...........
A4XZN2_PSEMY/43-309..PFDVLACV....................................D......YGD.C........HFD...........
Q5LVU6_SILPO/18-278...PCAQGIY...........................................TEPPL......................
A1A614_XENLA/26-326......CNVC....................................D......FGD.L........HFSQVPNDE.....
A4YE21_METS5/29-295..PLDELSAC....................................D......GGD.V........DVI...........
Q5QV39_IDILO/51-340......TGLL....................................STHELLLVGA.VNCDDLNEKAAEL..........
A1ZJF0_9BACT/15-273......ISWL....................................D......VGN.L........ELTSG.........
A1SAJ7_SHEAM/49-334......NRFY....................................RGDDCLLLGQ.LDFGDLLPGEDA...........
Q6ANF4_DESPS/59-334..IFEECSGV....................................D......YGD.I........DII...........
Q0SVK6_CLOPS/20-280...LYDFNIF....................................D......GGE.I........ELP...........
A1RSZ1_PYRIL/9-263..DLGDVELL....................................Q......GAP........................
Q5V104_HALMA/12-261...FTDCSVY....................................D......HGD.I........GP............
Q5QTW3_IDILO/29-298..............................................D......LGN.L........RLG...........
A0NU34_9RHOB/41-306..PFEVLACV....................................D......YGD.C........VFD...........
A1ZV42_9BACT/26-290...VYKRGIY....................................T......APP.V........TEN...........
Q222F3_RHOFD/24-298..PIGH..LG....................................D......ALD.M........RLP...........
ARGI2_MOUSE/24-324......CHLK....................................D......FGD.L........SFTNVPQDD.....
Q1Z3J6_PHOPR/33-324....PSFPLY....................................D......AGI.ID......EL.D...........
Q315M1_DESDG/23-287...PSRLGLF............................................TH.C........PVD...........
A7IL28_XANP2/50-316..PFETLDVV....................................D......GGD.C........VFD...........
Q18A84_CLOD6/21-285...LEDYNIC....................................D......YGD.L........EIS...........
Q07N69_RHOP5/13-310......LAVE....................................D......HGD.V........AVAALPELD.....
A0M038_GRAFK/2-255.......SID....................................D......KGD.F........EIS...........
B8FW33_DESHD/4-296......WEVE....................................D......VGN.I........DVPIAETRE.....
Q5V6R7_HALMA/44-335..PFDTFSVA....................................D......TGD.A........AVS...........
Q5LRK8_SILPO/33-325......HRVE....................................D......LGN.L........SPAEHAPE......
Q9K8M2_BACHD/4-296......YHVD....................................D......MGD.I........PIDRPGEVS.....
Q3ABP1_CARHZ/20-281...LNDVNFY....................................D......MGD.V........ALT...........
A9CJC2_AGRT5/42-307..LFAHMPTI....................................D......YGD.C........LLD...........
Q0FFC7_9RHOB/42-306..LFENLSIV....................................D......YGD.C........HLD...........
Q7U3K9_SYNPX/21-280...LEDLAYA....................................D......LGA.V........DIP...........
Q4D5Y5_TRYCC/22-297......LKLY....................................D......AGD........................
A1STQ5_PSYIN/47-343...DSGASFY....................................D......GGN.V........FCH...........
Q7VY32_BORPE/13-287......LRLL....................................D......LGNVA......................
Q9CL61_PASMU/34-299..VRERLKIV....................................D......CGD.L........VYS...........

PF00850

A0B6D0_METTP/17-279..........------------------------------------..................................
A0B926_METTP/7-310........LD------------------------------------.......................EPD.TPV....
A0DIS2_PARTE/29-344.........D------------------------------------VK....................YFDD.TYL....
A0LGT0_SYNFM/15-314.........F------------------------------------D......................HPD.NQM....
A0YQ85_LYNSP/13-307.........L------------------------------------D.......................GD.TPL....
A1RXP5_THEPD/28-317.........G------------------------------------.........................D.TPA....
A1W7T1_ACISJ/25-356PSVWPVRTLR------------------------------------SDIEPDNFI......AKLGLYSMDNG.SPL....
A1ZSA9_9BACT/6-274..........------------------------------------..................................
A2BL29_HYPBU/15-315..........------------------------------------.......................DPD.TYV....
A2R705_ASPNC/140-407.........L------------------------------------EH....................TRDS.IYF....
A3CXQ9_METMJ/14-294.........L------------------------------------D.......................VN.TYV....
A3DNS7_STAMF/16-313..........------------------------------------.......................DPD.TYF....
A3GH68_PICST/21-341..........------------------------------------QRY.................GLVHD..CYI....
A3GTQ3_VIBCL/7-300..........------------------------------------..................................
A3IXM3_9CHRO/8-295..........------------------------------------..................................
A3JI99_9ALTE/13-341........VQ------------------------------------TTVYVPNNNSGLGILAKAAKYQADGS.API....
A3W9J6_9SPHN/44-368....FPVCGR------------------------------------RRLSLDRID......AKLGAFGFDAA.SPI....
A3WE49_9SPHN/7-292..........------------------------------------..................................
A3WNS9_9GAMM/8-295..........------------------------------------..................................
A3Y9Y0_9GAMM/13-341W...PSRSMP------------------------------------SKVIPSNIE......AQLGHYALAAE.TAI....
A3ZYN7_9PLAN/13-308.........I------------------------------------E.......................ED.TVV....
A4BCK9_9GAMM/15-306.........A------------------------------------D.......................PD.TLM....
A4BMJ9_9GAMM/17-332PLRLRGGMYC------------------------------------R......................EIG.TPL....
A4C5S3_9GAMM/8-296..........------------------------------------..................................
A4C8Y5_9GAMM/14-303.........L------------------------------------D.......................GD.TWL....
A4S2N1_OSTLU/197-606EKLQKPAENS------------------------------------D..........................TFF....
A4S898_OSTLU/22-313..........------------------------------------..................................
A4U490_9PROT/14-308.........I------------------------------------D.......................PD.TIL....
A4WPH0_RHOS5/24-326..........------------------------------------...........................TPF....
A4X4X7_SALTO/10-318........LG------------------------------------.......................TPD.NPV....
A4YNH4_BRASO/45-371M..HPVRNAA------------------------------------TYPTHIVG........RLGWHTTDTS.API....
A5D0K9_PELTS/22-316.........F------------------------------------G......................NN..TTG....
A5H660_SCHMA/8-358..........------------------------------------DSF.................SLNYD..CPG....
A6C208_9PLAN/13-308.........I------------------------------------S.......................ED.TVV....
A6C6K6_9PLAN/13-308.........I------------------------------------E.......................SD.TVM....
A6E8D2_9SPHI/7-293..........------------------------------------..................................
A6FY71_9DELT/35-323..........------------------------------------..................................
A6GQW9_9BURK/14-305.........I------------------------------------D.......................GD.TTL....
A6Q2Z0_NITSB/15-300.........I------------------------------------L......................NED.TLL....
A6QAF4_SULNB/14-302..........------------------------------------I......................DSD.TIC....
A6QHR8_STAAE/14-324........LN------------------------------------.......................DEE.NGQ....
A6R4B6_AJECN/49-360..........------------------------------------GFN..................FGDD..CPV....
A6VSZ5_MARMS/14-305.........L------------------------------------E.......................PE.TLM....
A7E372_BOVIN/21-321..........------------------------------------..................................
A7SSG8_NEMVE/23-333.........L------------------------------------GE....................EYDS.IYM....
A7SUP8_NEMVE/23-330..........------------------------------------FG...................LGYD..CPP....
A7TRW5_VANPO/9-404ESGSGSGSEA------------------------------------NEYFQINNSRERQQDVYKKFNLEGD..CPL....
A8ABS4_IGNH4/14-309..........------------------------------------.......................DPD.TYA....
A8MBN2_CALMQ/13-310..........------------------------------------.......................DQD.TYV....
A8ZT95_DESOH/16-310.........I------------------------------------TS....................MAPD.TPV....
A9A062_DESOH/259-573RNSTRPPKSL------------------------------------PMRAG..............YYCIDTF.TPL....
A9B5I1_HERA2/14-309.........A------------------------------------D.......................AE.TYI....
A9W0L9_METEP/18-304..........------------------------------------..................................
B0T7F0_CAUSK/32-328..........------------------------------------.......................PGDDAPV....
B2JV93_BURP8/15-309.........L------------------------------------D......................GGD.TVM....
B4U8T2_HYDS0/14-304.........L------------------------------------D.......................PD.TYA....
B9LI73_CHLSY/14-310.........I------------------------------------D.......................SD.TYV....
C5KDG6_PERM5/340-870........DS------------------------------------ELPVVDLCSKRCARLVGRALTLWPGE.CCM....
E0TF48_PARBH/5-292..........------------------------------------..................................
E2RU63_GIAIC/11-320..........------------------------------------KRY.................NITED..CPV....
F2G2X2_ALTMD/14-319......VAWL------------------------------------D.......................ED.TGL....
O58986_PYRHO/14-303..........------------------------------------.......................DAD.TYV....
O67135_AQUAE/10-314........IG------------------------------------.......................GYE.NPV....
HDA1_YEAST/69-395.........E------------------------------------TE....................KGDS.VYF....
Q00U49_OSTTA/445-741..........------------------------------------..................................
Q027B1_SOLUE/10-293..........------------------------------------..................................
Q02CA3_SOLUE/14-311.........L------------------------------------S......................TGD.TDI....
Q0A6Z7_ALHEH/46-336.........L------------------------------------D......................VDT.TAV....
Q0ARF0_MARMM/14-308..........------------------------------------...........................TLV....
Q0EVU6_9PROT/10-312.........G------------------------------------.........................D.TPA....
Q0FL11_9RHOB/14-304.........L------------------------------------D.......................GD.TWM....
Q0G2C9_9RHIZ/12-346V..HPYHAGA------------------------------------SSLGARPAPRTTGILGQTGWYIGDLS.CAM....
Q0HTM8_SHESR/7-295..........------------------------------------..................................
Q0W553_UNCMA/15-300.........L------------------------------------D.......................PD.TEM....
Q11YA3_CYTH3/7-294..........------------------------------------..................................
Q15WQ0_PSEA6/14-301..........------------------------------------..................................
Q1CZX8_MYXXD/21-314.........I------------------------------------D.......................PD.TQV....
Q1H8P7_PLADU/25-312..........------------------------------------..................................
Q1IJP8_KORVE/31-346..........------------------------------------..................................
Q1N4R7_9GAMM/15-306.........A------------------------------------D.......................PD.TPL....
Q1NWE2_9DELT/15-311.........L------------------------------------D.......................PD.THT....
Q1PVG5_9BACT/13-309.........L------------------------------------D.......................GD.TAV....
Q1Q8W0_PSYCK/7-294..........------------------------------------..................................
Q1YFS2_MOBAS/8-295..........------------------------------------..................................
HDA6_CAEEL/438-748.........A------------------------------------EK....................EFNS.IYL....
Q22CW6_TETTS/20-322..........------------------------------------...........................CYY....
Q232Y2_TETTS/86-443..........------------------------------------..................................
Q23M98_TETTS/2143-2453..........------------------------------------...........................TYF....
Q29CG7_DROPS/25-326..........------------------------------------..................................
Q2BQU8_9GAMM/14-305.........T------------------------------------D.......................ED.TAL....
Q2FQ17_METHJ/14-290..........------------------------------------...........................VDY....
Q2FQW8_METHJ/14-311..........------------------------------------.......................DAD.TYV....
Q2IF50_ANADE/16-319.........L------------------------------------DW....................LEPE.TPV....
Q2JQR9_SYNJA/13-301.........L------------------------------------D.......................AD.TAV....
Q2KBQ8_RHIEC/14-309.........L------------------------------------E.......................AD.TYA....
Q2LUP3_SYNAS/17-292..........------------------------------------CV....................PDAR.AVT....
Q2LVD3_SYNAS/15-311.........L------------------------------------D.......................PD.TDT....
Q2R9B1_ORYSJ/26-342..........------------------------------------EDDHG..............IGGDDD..CPA....
Q2S035_SALRD/7-313........LD------------------------------------.......................TGD.VPV....
Q2SC27_HAHCH/8-315..........------------------------------------..................................
Q30PJ4_SULDN/258-572RNMARPPKDI------------------------------------ELQVG..............YYALDTF.TPL....
Q31EP6_THICR/49-347.........Y------------------------------------EP....................YQGD.TYL....
Q31HC2_THICR/13-304.........I------------------------------------D.......................ED.TSL....
Q38C74_TRYB2/21-323..........------------------------------------SKV.................TFSGD..CPP....
Q39UV4_GEOMG/11-315........LG------------------------------------.......................DLD.NPV....
Q3AFN8_CARHZ/10-319........LG------------------------------------.......................SED.NPV....
Q3AX40_SYNS9/8-294..........------------------------------------..................................
Q3IHM6_PSEHT/12-298..........------------------------------------..................................
Q3SA60_9EURY/14-304..........------------------------------------L......................GDS.TYL....
Q3UG37_MOUSE/97-402.........L------------------------------------AE....................TYDS.VYL....
Q3ZWU5_DEHSC/14-306.........L------------------------------------D.......................QD.TVI....
Q4D762_TRYCC/47-388PPVSRRSSAQ------------------------------------TQPPLRVLPDLVPISTDEEYGLVNE..NMP....
Q4FNF7_PELUB/14-306.........L------------------------------------D.......................GD.TIV....
Q4JA06_SULAC/13-290..........------------------------------------.......................DAD.TYT....
Q4KAJ1_PSEF5/12-340W...PVRDLA------------------------------------NQQVPEFID......GKLGFFAMDAG.SPI....
Q4MYQ3_THEPA/25-416TS.SKKFQSL------------------------------------YP....................LDVD.TYM....
Q4P2D6_USTMA/326-751..........------------------------------------...........................SGM....
Q4QAJ4_LEIMA/91-404..........------------------------------------FDVPF..............ASQDSD..CPL....
Q4QI60_LEIMA/58-432PARLATYDEV------------------------------------CSFQDPQVYEHFLKSGAALADLKSDV.YCN....
Q4TFH7_TETNG/505-904.........L------------------------------------GN....................EFNS.IYI....
HDA21_DICDI/1072-1486INQFSTSTPI------------------------------------TTTGTATVTPGSTTSSTNGEQCEDGD.TFV....
Y535_METJA/17-305..........------------------------------------.......................DGD.TYL....
Q59Q78_CANAL/56-379..........------------------------------------DLDEK..............YGLTFD..CYP....
Q5AF34_CANAL/175-593........WN------------------------------------.......................VGD.IYL....
Q5K8L3_CRYNJ/64-492..........------------------------------------ARTDP..............YNLSHD..NPV....
Q5KKR8_CRYNJ/28-368..........------------------------------------RGL..................TGSD..CPA....
Q5XQ67_9ARCH/18-315.........L------------------------------------D.......................PD.TPL....
Q60DG7_ORYSJ/34-350..........------------------------------------L......................CEG.TFL....
Q6AJC0_DESPS/18-318.........I------------------------------------D......................HLD.NQI....
Q6AKN4_DESPS/15-311.........Y------------------------------------D.......................QD.TYL....
Q6C3Y5_YARLI/54-352..........------------------------------------DKM.................GLIHD..CPI....
Q6CGA7_YARLI/254-648........WP------------------------------------.......................EGD.IYL....
Q6FWB7_CANGA/8-383......GDEV------------------------------------TRRSTL...........AKFNLLDD..CPI....
HDAH_ALCSD/31-329..........------------------------------------.......................DGI.TMM....
Q72NV2_LEPIC/14-310.........F------------------------------------D.......................SD.TPF....
Q741C0_MYCPA/14-307.........L------------------------------------D......................GGD.TMM....
Q7PS30_ANOGA/118-424.........L------------------------------------SS....................HYDA.IFI....
Q86YH7_HUMAN/553-881.........L------------------------------------LG....................SLAS.VFVRLPC
Q8EP92_OCEIH/11-321........IG------------------------------------.......................TED.TPA....
Q8I4I9_CAEEL/17-318..........------------------------------------YC....................KDKEILWT....
Q8IR37_DROME/555-861.........A------------------------------------AG....................IYNS.VYL....
Q8LK09_MAIZE/215-515.........L------------------------------------YS....................YFTSDTYA....
Q8SQN9_ENCCU/9-289..........------------------------------------GKN..................ETPD..CPN....
HDA14_ARATH/75-387.........E------------------------------------G......................SGP.TYA....
Q98RL4_GUITH/12-313..........------------------------------------IDK..................YDAD..CPI....
Q9K0J2_NEIMB/35-328.........I------------------------------------SR....................LDND.TAI....
Q9U266_CAEEL/18-319.........F------------------------------------CT...................KYED..IYV....
Q9YG09_AERPE/14-309..........------------------------------------.......................DPD.TYV....

PF12640

B5Z5P5_BACCE/12-235------------------DH-----HHVLEPWAIYRERN..---------------------------------------
C2XKX5_BACCE/12-239------------------EH-----HHVLEPWAIYRERN..---------------------------------------
B9BUU1_9BURK/13-199------------------SH-----HHVLQSWGEVRRALS.---------------------------------------
B9BQL6_9BURK/13-201------------------SH-----HHVLRGWAEVRRSQPS---------------------------------------
A8MKG9_ALKOO/16-197------------------NH-----HEVIIPWSEYASHNE.---------------------------------------
D1N5Z5_9BACT/4-169------------------LH-----HQVLTAWASYRSTLA.---------------------------------------
Q0YSC5_9CHLB/5-197------------------NH-----HEVLDAWSKE......---------------------------------------
Q12VI5_METBU/19-180------------------DH-----AAALIAWIKAFNEGII---------------------------------------
Q1CZJ9_MYXXD/103-253------------------PH-----RLALPAWACALGDTE.---------------------------------------
Q6ARQ8_DESPS/48-185------------------DH-----KWAFWAWISYIDRVKT---------------------------------------
C2SK71_BACCE/15-171------------------EH-----NWAFAAWELHKRAGNL---------------------------------------
C3Q562_9BACE/31-198------------------NH-----LAAGWCWYNTLDRH..---------------------------------------
D7W5E5_9FLAO/27-172------------------NH-----LCAAWCWLQETDIT..---------------------------------------
A3TZZ3_9RHOB/31-170------------------NH-----RAALWCWLQELDLT..---------------------------------------
C6C1I6_DESAD/28-165------------------NH-----RAAFWCWMESLKKG..---------------------------------------
C5KCK7_PERM5/16-196------------------SH-----TEGLPAVHMAVRRGWI---------------------------------------
B7FS57_PHATC/11-216------------------SH-----QHALEHIHFMLRRKKI---------------------------------------
C3XU32_BRAFL/3-238------------------..-----LQALYYIYRAIGSHHL---------------------------------------
CE022_DANRE/15-248------------------DH-----HEVVQHIYRAIGSRHI---------------------------------------
Q1RMV5_BOVIN/19-257------------------DH-----QEVLPFIYRAIGSKHL---------------------------------------
A7UTP5_ANOGA/103-265------------------DH-----HEVLTFLYRCLGSKHL---------------------------------------
B3M7P2_DROAN/118-284------------------YH-----NDVLEFIYRCLGTRHL---------------------------------------
B4N4R0_DROWI/108-274------------------YH-----NDVMEFIYRCLGTRHL---------------------------------------
A7SLH9_NEMVE/10-251------------------NH-----DEVLFHIYRAIAGRYL---------------------------------------
B7PMV1_IXOSC/7-174------------------PH-----HHALHHIYRAIGRKKL---------------------------------------
A9VAD6_MONBE/67-213------------------RE-----RESLRERERE......---------------------------------------
A6UPR5_METVS/56-208------------------KH-----HEAFYFWNELIEKNQL---------------------------------------
A9AA45_METM6/55-201------------------KH-----HKAFYFWRELIEKNKL---------------------------------------
A6UX51_META3/57-190------------------KH-----HEAFYFWNELINNNKL---------------------------------------
D0MD43_RHOM4/57-211------------------EH-----HEIFFDWRRRIQEGLL---------------------------------------
Q181H4_CLOD6/78-183------------------NH-----NHAFYFWAKSLLKGEF---------------------------------------
B6G251_9FIRM/77-182------------------NH-----NHSFYFWMKCLKEGLF---------------------------------------
B0A6K5_9FIRM/76-181------------------NH-----NHAFYFWMKSLHEGLF---------------------------------------
C0CJH7_9FIRM/6-165------------------EH-----HEAFYYWNYFIECGLI---------------------------------------

PF00491

SPEB3_SCHPO/85-387...............T.YDI-----LK.A...MDQLESAYF---------------------------------------
ARGI_COCP7/16-318........DPNHRGM...KK-----PRTVSAATQQLSRQVY---------------------------------------
Q6BJQ5_DEBHA/76-370..............P..MDN-----SL.A...FKQMNKGFE---------------------------------------
Q6BVQ4_DEBHA/136-428..............P..IDN-----RI.A...LDQLYRAER---------------------------------------
Q6BWL4_DEBHA/179-480..............P..FDN-----RI.A...LNQLYRGQR---------------------------------------
A1ERP9_VIBCL/33-299..............C..GDA-----ED.F...TYRLEAATS---------------------------------------
A0RLF1_BACAH/22-286..............F..GNA-----QR.S...LDMIEEYVS---------------------------------------
A1RXI5_THEPD/26-288..............T...SV-----EA.L...IDILGGVAR---------------------------------------
ARGI1_XENLA/6-306.........TPFNNV...KN-----PRTVGKATEILANAVT---------------------------------------
SPEB_MOUSE/77-350..............L..YNL-----QD.S...CLLIREAYQ---------------------------------------
Q9V2I5_PYRAB/21-279...................P-----VN.V...EDAIKVGIE---------------------------------------
A4XKN0_CALS8/20-281..............F..GNV-----GK.S...IDIIYEFAR---------------------------------------
Q55U21_CRYNB/69-375..............P..FDP-----AT.A...VKQINSAYR---------------------------------------
A4J1T2_DESRM/21-282..............F..GHV-----LE.S...LERISKVVG---------------------------------------
B8GAJ6_CHLAD/41-309..................SS-----.......LETIHALQH---------------------------------------
Q8ZVI7_PYRAE/9-263....................-----EE.N...LARIEAKLK---------------------------------------
A1VQK9_POLNA/34-307..............T..YNL-----HK.S...VEIIEQHYQ---------------------------------------
HUTG_HALSA/36-303..................LP-----DGDVADTQAAVREAAA---------------------------------------
Q15JE9_STRHY/25-310..................FD-----GMTLADAQEALAQVIA---------------------------------------
Q1Q9T2_PSYCK/6-313D..SNNEGESQFAHA...KY-----ADVIEPIISKLAHKIK---------------------------------------
Q3AGG3_SYNSC/27-286..............F..GNP-----EP.V...LTKVKQATE---------------------------------------
Q2K8A9_RHIEC/46-316..............SR.FDL-----AA.S...HDDIEKFVG---------------------------------------
A0B180_BURCH/43-310..............A..HNP-----LS.I...KPAIVEHAR---------------------------------------
Q2F6C6_BOMMO/21-320.........VNVNNM...NH-----LPLVSACNKNLSERVS---------------------------------------
B2JW15_BURP8/32-305..............DL.YHL-----ER.A...HDDIRRFFE---------------------------------------
Q6TA07_STRCL/27-300..............P..FSM-----DL.A...MDTATVALT---------------------------------------
A1B175_PARDP/5-250....................-----........GELGAGFA---------------------------------------
ARGI_STAAC/5-298........HSEQKGL...RN-----YDEIIDVNQKLNKEVS---------------------------------------
Q982X2_RHILO/42-307..............S..GNH-----QK.T...PGTIEREAA---------------------------------------
Q0FAM8_9RHOB/4-297.........DKHPNL...FK-----LNENIAWVRKISQIA.---------------------------------------
Q1Z9W0_PHOPR/33-298..............C..GDP-----AQ.M...SERLEIHAD---------------------------------------
HUTG_BACHD/35-311..............V..TDI-----VG.S...QARIEETMT---------------------------------------
HUTG_RHOSR/40-314..................DN-----R......LEAGQMALG---------------------------------------
O68051_RHOCA/3-297.........HANPAV...HH-----LAETRAWIALLAARAE---------------------------------------
ARGI1_HUMAN/6-305.........SPFQIV...KN-----PRSVGKASEQLAGKVA---------------------------------------
SPEB_CHRVO/44-311..............A..HNP-----LT.I...KPSIIEHAR---------------------------------------
ARGI_BACSU/3-292..........NDEEL...KN-----LNSVLAGNEKLAQKVN---------------------------------------
Q97ZX8_SULSO/24-289..............P..SNV-----EE.N...LSRISSVIS---------------------------------------
HUTG_VIBVY/45-328..................DD-----L......LESSQQHCA---------------------------------------
A9BRG6_DELAS/16-312.........PPEQGL...RH-----LAPARAWMDAVHQAVG---------------------------------------
A1ESE8_VIBCL/43-325..................GD-----E......LEQAQQECA---------------------------------------
HUTG_AROAE/40-323..................EQ-----T......LETMQGDYA---------------------------------------
Q6MM35_BDEBA/43-314..................EK-----P......LAERHEKAR---------------------------------------
A1RB53_ARTAT/29-311..................PV-----GSSAQEVADEIGSVVA---------------------------------------
Q1J2W9_DEIGD/37-306..............S..LEP-----EL.A...RERITQTAR---------------------------------------
Q1ZN31_PHOAS/36-323..................NH-----D......LTKAQKCLA---------------------------------------
Q2JER0_FRASC/40-318..............H..GLT-----EA.S...HRNIRAKVA---------------------------------------
Q3J346_RHOS4/3-296.........PPEGPV...HD-----LPETIGWTAALKTAV.---------------------------------------
A9B324_HERA2/22-290..............D..QDP-----DS.A...MQSIAQAVE---------------------------------------
HUTG_LEGPL/46-318..................ND-----E......LELSQSQFA---------------------------------------
Q9YBG0_AERPE/29-298..............P..GST-----LL.T...LERVARVVE---------------------------------------
Q1GI44_SILST/34-307..............T..FNL-----AE.S...LRIIEDSYD---------------------------------------
Q9HJB2_THEAC/33-293..............S..EDV-----EY.V...VDQVDRVTK---------------------------------------
A0RXD6_CENSY/22-283..............T..VSP-----DV.M...VEMVGRITA---------------------------------------
A8LLU9_DINSH/46-312..............Y..GRA-----AG.F...PAALEAHIR---------------------------------------
Q1V061_PELUQ/39-314..............P..FSI-----DE.S...IKQIETGAT---------------------------------------
SPEB_BACHD/22-286..............F..GNP-----QR.S...LEMIESYVD---------------------------------------
Q0AG49_NITEC/44-311..............V..HNP-----MS.I...HEAIIDHAR---------------------------------------
Q2CCZ9_9RHOB/3-297.........VGNPAV...HS-----LAETVGWTRTLAAEA.---------------------------------------
Q0W940_UNCMA/16-280..............Y..ASI-----ED.T...LLEVYQTSK---------------------------------------
Q97BB8_THEVO/33-293..............S..EDV-----EY.V...IDTVESVVS---------------------------------------
ARGI_BREBE/3-294.........TETENH...KY-----LDEVVEANEKLANVVS---------------------------------------
Q6MHV0_BDEBA/36-309..............P..IDQ-----KQ.T...YEKIEKFVG---------------------------------------
Q98MW3_RHILO/19-296..............L..HDN-----AE.N...RVRIEAKTR---------------------------------------
A0LG67_SYNFM/34-297..............V..SSP-----RD.M...LDSVRVVGA---------------------------------------
Q1EQG5_STRKN/2-295........WQEGDGV...FN-----AAAIASYTVRLADRVE---------------------------------------
Q1Q5Q5_9BACT/32-299..............EF.YTN-----EKKV...MEEIFTCSR---------------------------------------
A0NSP7_9RHOB/73-349..................TI-----PANIEKTFDQITRAVS---------------------------------------
HUTG_BACSU/35-311..............V..TDI-----VK.S...HHHIFQTMH---------------------------------------
B8FZG3_DESHD/20-281..............F..GNV-----EK.S...LQVIEAAAR---------------------------------------
Q9K5Y7_BACHD/5-297.........TQEGPL...RN-----LDEVVKVSEELCKGVA---------------------------------------
Q7W6W6_BORPA/29-307..................VV-----PSDILDAFERIEQAVG---------------------------------------
Q6W399_9CREN/23-284..............T..VVA-----TE.M...LQIVENITT---------------------------------------
Q0AE23_NITEC/40-304..............T..DDL-----LS.V....AHIEAHIA---------------------------------------
Q1MIP6_RHIL3/52-317..............Y..GNH-----QD.T...PAAIERQAN---------------------------------------
A2CDX1_PROM3/29-293..............F..GDP-----KP.V...VEAVKKATQ---------------------------------------
Q164F4_ROSDO/46-312..............Y..GNV-----AA.F...PETLKAHIS---------------------------------------
Q164F5_ROSDO/34-308..............T..FSL-----AK.S...LKIIEESYH---------------------------------------
Q0G0L1_9RHIZ/42-312..............H..RRP-----EI.A...HTAIRAEAS---------------------------------------
Q15X44_PSEA6/42-323..................EC-----.......LDSCQQNYA---------------------------------------
A0SJA7_STAXY/3-297........NSEQEGL...RN-----IEEIIETSNILSDAVS---------------------------------------
Q1N5V2_9GAMM/42-308..............H..GEP-----QT.L...VDNLQRHIL---------------------------------------
Q4CMT4_TRYCC/16-290..................TP-----TPTSDDWYMAALEATT---------------------------------------
Q2CC50_9RHOB/34-307..............T..FDL-----RD.S...VRRIEAHYD---------------------------------------
Q11J67_MESSB/42-307..............Y..GRH-----DL.T...PAAIETEAS---------------------------------------
Q1AWJ4_RUBXD/5-295.........GGDGKA...WR-----LRAVREVCSAVSRRAR---------------------------------------
Q46EM0_METBF/17-282..............S..ALV-----DE.T...LQNLYEATK---------------------------------------
Q8TZN1_PYRFU/56-314...................P-----VS.I...EEALKVAEE---------------------------------------
Q18F18_HALWD/14-268..............W..DDA-----TE.Y...LEWLNGELT---------------------------------------
Q5V1C2_HALMA/37-301..................EI-----PAGG...VEQVQRAVR---------------------------------------
Q5WL42_BACSK/7-290..............A..YST-----DQ.T...FAQAEAKLK---------------------------------------
Q7UZH9_PROMP/24-288..............K..NDS-----IS.V...IKAVKSATD---------------------------------------
Q6CLB8_KLULA/137-438..............P..FDN-----KL.A...LNQLYRGQR---------------------------------------
A0JT79_ARTS2/57-331..............P..FNI-----NE.A...IETIQQNAL---------------------------------------
Q2KVZ3_BORA1/13-287..................CW-----PGDPERSYPVIETAVD---------------------------------------
A8H965_SHEPA/50-335...................S-----ADALRDNVEKLDQRVI---------------------------------------
Q75TI1_GEOSE/31-304..............P..GNA-----LR.T...YDRIVEELR---------------------------------------
B2UBQ2_RALPJ/40-316..................GD-----A......LEDAQSELS---------------------------------------
Q165U0_ROSDO/35-314..............H..TAT-----EK.S...HDNIETGVR---------------------------------------
B1YHV3_EXIS2/22-286..............F..GNA-----QK.S...LDMIEEYVD---------------------------------------
Q5WIT9_BACSK/27-306..................VP-----AD.VDETMRRIERFAA---------------------------------------
Q13CK1_RHOPS/14-311........DPTPANA...NF-----YGEVRSWVGAISARAY---------------------------------------
Q1YMK4_MOBAS/42-312..............Y..RLP-----ET.A...HETIRAEAA---------------------------------------
A1C610_ASPCL/68-380..............P..FDN-----GL.A...ERQMYEAFL---------------------------------------
Q39HU1_BURS3/40-306..............L..GQP-----ES.V...PGAIERHAD---------------------------------------
Q05V55_9SYNE/29-297..............F..GAP-----EP.V...VAAVHRATR---------------------------------------
Q1AS11_RUBXD/33-307..............P..GYI-----EE.S...YARIEEGLA---------------------------------------
A0NXD9_9RHOB/25-301..............H..TDT-----IE.S...HKRIEYGVR---------------------------------------
SPEB_NEIMA/35-300..............F..GDS-----RD.F...VEKMEAHAG---------------------------------------
A3QIE0_SHELP/50-335...................S-----AQALRENVDKLDERVI---------------------------------------
Q28QX8_JANSC/39-314..............P..VDQ-----DE.A...LRDAQAFVA---------------------------------------
A1WGI6_VEREI/22-320.........APVQGY...RH-----LPEVVQWNQRVFDAVS---------------------------------------
A1WER7_VEREI/22-295..............P..YNL-----ID.S...IARIERAFD---------------------------------------
A1T3A2_MYCVP/88-364..................TI-----PGNLEKSFDQISQAMA---------------------------------------
HUTG_ENT38/42-310..................AD-----Q......LEAAQHALS---------------------------------------
A8LRL4_DINSH/4-296.........TPPGEL...HA-----LSETITWTRLLSEAA.---------------------------------------
Q46TX4_CUPPJ/2-296.........PPVQGL...RH-----LDEVVAWNRGVFEAST---------------------------------------
A5V551_SPHWW/4-298.........SLEGHA...RH-----AAHIAGWARALDEAAY---------------------------------------
Q2B9I2_9BACI/37-317..............T..TDI-----PL.S...HSRIQETAC---------------------------------------
Q1I7X5_PSEE4/43-309..............N..GTP-----ES.V...PDSIQAHAE---------------------------------------
Q11NZ4_CYTH3/3-310........TGPYVQG...KY-----AKLLSELNNNTAKEIS---------------------------------------
Q5V4R8_HALMA/3-300......AGGLDSGRA...KF-----FRETKEVCEDVTTAVD---------------------------------------
SPEB_SERP5/33-298..............F..GDA-----QS.M...SDNLQAHAE---------------------------------------
Q6AG97_LEIXX/4-273..................QR-----YSSLTAIRELAAAEIE---------------------------------------
Q12BY7_POLSJ/72-342..............SR.FSL-----DE.C...HADIEACFN---------------------------------------
HUTG_VIBF1/45-345..................DG-----D......LELAQKQLG---------------------------------------
Q0UDP7_PHANO/4-284..................GE-----IGRSFELLRRTSKVVS---------------------------------------
Q0FAR0_9RHOB/34-308..............H..TNT-----KK.S...HENIEIAVR---------------------------------------
Q3IVT5_RHOS4/32-308..............P..GYE-----IE.S...LAALERALD---------------------------------------
HUTG_GEOKA/44-315..................DE-----R......LEQSQTELG---------------------------------------
SPEB_BLOFL/33-298..............S..GNV-----QD.F...TNILQKHIE---------------------------------------
A0ZFA2_NODSP/30-338..............IN.QAG-----EQ.V...NQWLFTQCQ---------------------------------------
A2C5F5_PROM1/29-293..............L..GDA-----KL.T...LDYIKDATN---------------------------------------
A4XT95_PSEMY/38-311..............T..FNL-----LD.A...VRIIEEAYD---------------------------------------
Q5WB32_BACSK/22-286..............F..GNA-----AR.S...LDIVEEYVD---------------------------------------
Q6C6P6_YARLI/9-306.........EDIGKM...KR-----PRYVAEASRRVYKAVS---------------------------------------
HUTG_NOCFA/35-303..................GE-----A......LEEGQRALG---------------------------------------
Q12UU8_METBU/17-282..............G..ALV-----DD.V...LDELYLDVI---------------------------------------
A1UHG9_MYCSK/34-307..............P..FDI-----AE.A...ITAIERHSD---------------------------------------
A0B2Z1_BURCH/72-345..............P..YNL-----HD.S...IARIEAAYD---------------------------------------
ARGI_BACCD/2-295........EQGDSRL...RN-----LKAVAEANEKLAAAVD---------------------------------------
Q213G1_RHOPB/11-309........EALPANA...RQ-----YRQIQGWVRALSARAY---------------------------------------
A7NL23_ROSCS/33-307..............P..GFI-----QE.S...HAAITTTLR---------------------------------------
Q28PV5_JANSC/46-313..............Y..AHT-----AD.V...PERIEAHIA---------------------------------------
A0QRD0_MYCS2/43-317..............P..FNI-----DE.A...VGQIRDGVT---------------------------------------
Q02UC9_PSEAB/35-308..............P..IDL-----LD.S...LRRIEGFYR---------------------------------------
Q1MAU5_RHIL3/40-310..............SR.FGL-----AE.C...HADIEACYR---------------------------------------
ARGI_NEUCR/47-354........DPPHRNM...KN-----PRAVSNVTKRIAEQVH---------------------------------------
A5ENL2_BRASB/10-307........DDPPAKA...KH-----YRQIQRWSRVLARRSH---------------------------------------
Q12LW8_SHEDO/33-299..............C..GDQ-----ED.F...TTRLEAFAT---------------------------------------
Q2W8C1_MAGSA/22-290..............L..GDI-----PR.S...LEMIEQQAA---------------------------------------
Q6CIB4_KLULA/61-358..............P..MDN-----CL.A...LKMMTAAYE---------------------------------------
C5PF24_COCP7/77-371..............F..LDN-----TI.A...LKQLDKAHK---------------------------------------
A1SLP1_NOCSJ/31-312..............P..GDI-----TR.A...LGNLEEAVY---------------------------------------
A0RH36_BACAH/35-312..............V..TDI-----KE.S...HNRIAKTVG---------------------------------------
Q7P2W8_FUSNV/500-780..........NDKKL...KF-----KNTVLDTCEKIAKRVN---------------------------------------
A6UDJ1_SINMW/2-296.........AKHPGA...NN-----LQTVAAFARALDEAVH---------------------------------------
Q28VR8_JANSC/34-309..............H..TQT-----EA.S...HANIETGVR---------------------------------------
B4STA0_STRM5/5-299.........APVEGY...RH-----LDEVVAWNHALMEASY---------------------------------------
A6U7T5_SINMW/42-307..............Y..GNH-----QK.T...PQTIEREAM---------------------------------------
Q0UYW2_PHANO/16-320........DPDYRGM...KR-----PKFASAVTQSVSAQVY---------------------------------------
O96394_LEIAM/13-316......DNGDRIGRV...KR-----PRLTAECTEKIYKCVR---------------------------------------
Y309_METJA/21-281..............Y..GSQ-----EE.I...FGTIHSVSR---------------------------------------
Q9RZ04_DEIRA/29-298..............S..LEP-----QL.A...HDRITEAAR---------------------------------------
Q6CLS8_KLULA/13-315.......ETDVYGIM...KR-----PNLVGEATKLIYESVK---------------------------------------
A2BIW8_HYPBU/25-300..............S..SQP-----LE.T...LQRIEQVTR---------------------------------------
Q21RM0_RHOFD/15-309.........QAVNGF...RH-----LPQVVQWNQLLHEALY---------------------------------------
Q6L151_PICTO/19-280..............Y..EDV-----EY.V...LSEVETVTR---------------------------------------
Q4P4M4_USTMA/13-318.......SDTDIGNM...KL-----PRTVSAVTKEVAEVVE---------------------------------------
Q0I684_SYNS3/31-289..............Y..GDP-----QP.V...VDAVRHATG---------------------------------------
A1B165_PARDP/30-308..............P..VDP-----KA.H...SRNAEEAVR---------------------------------------
Q11QL1_CYTH3/66-323..................RV-----GINVEESYLRIKEVCE---------------------------------------
Q16AD8_ROSDO/4-296.........THDGRL...YA-----LNETIAWTRSLKEAA.---------------------------------------
Q3SMM1_THIDA/8-294............PPQ...AA-----LIAVSALNRKLAEKVH---------------------------------------
Q5AK86_CANAL/12-313.......NDKDDFGV...KN-----SKIVSESCQKIHDAVK---------------------------------------
Q1IPT1_KORVE/2-256.............KD..P..-----.......ISEIETFVA---------------------------------------
Q7VSA1_BORPE/8-302.........PPANGY...RH-----LNEVIGWNQLVHDAVS---------------------------------------
Q82LW5_STRAW/2-295........WQEGDGV...FN-----AAALASYTRKLADRIE---------------------------------------
A0BHR2_PARTE/9-311.........VKSQQF...RN-----SQQIGVINGEINKKSF---------------------------------------
A1UI81_MYCSK/60-335..............P..YDI-----AE.A...CRQIQNHAA---------------------------------------
HUTG_COREF/43-309..................GD-----.......LERGHDELS---------------------------------------
Q2JWU8_SYNJA/14-265...................D-----EPPYGMCEAAVIQAWR---------------------------------------
B0K9I6_THEP3/23-285..............Y..GNV-----KK.S...LDLISKATE---------------------------------------
Q49V90_STAS1/26-305..................VA-----HD.NKQSYDNISDFAK---------------------------------------
Q4JAE9_SULAC/24-287..............P..SNV-----EE.N...IKRIKDVVS---------------------------------------
A1UE14_MYCSK/29-310..............S..GNV-----EQ.A...VQLIEEEVF---------------------------------------
A0P3L0_9RHOB/6-302.........PPNPVL...RN-----YGAYVAWTRALHQKAA---------------------------------------
Q0FDK0_9RHOB/32-317...............P.FPR-----ANDNEDCIERITDFFT---------------------------------------
Q1YIK6_MOBAS/68-338..............SR.FDL-----AT.S...HEDIERTAA---------------------------------------
Q088H7_SHEFN/48-332...................T-----VEQLRQATAQLDDIVI---------------------------------------
Q5JI38_PYRKO/22-281..............A..GDP-----RK.T...ADRVR...E---------------------------------------
Q975R8_SULTO/24-287..............P..SDV-----EE.N...IRRISDVTS---------------------------------------
Q1LGD2_RALME/2-296.........PPTDGV...RH-----LPEVVAWNRLVMDATY---------------------------------------
ARGI_AGRT5/19-313.........HPNSAV...KN-----LDALVGWTRSLSQKAL---------------------------------------
Q1D421_MYXXD/27-337..............VN.VLC-----DQ.M...NEHVYRTTK---------------------------------------
SPEB1_SCHPO/74-375..............S..YDN-----AV.A...IKQIENGHF---------------------------------------
YHMF_METFE/21-281..............L..GDF-----KN.T...CRNISEKVQ---------------------------------------
ARGI_YEAST/13-329STTGGSSVMIDGVKA...KR-----ADLVGEATKLVYNSVS---------------------------------------
A7NMZ3_ROSCS/53-326..................DE-----PSNLGWICRAIADDVA---------------------------------------
A9BN56_DELAS/71-341..............SR.YSL-----EQ.S...HRDIESIFA---------------------------------------
Q5A4M3_CANAL/50-340..............P..MDN-----SA.A...YKQMSEAFK---------------------------------------
Q4T7Z4_TETNG/3-305...........VGGV...KH-----VRAVGRANQTLSEAVR---------------------------------------
A2BTR8_PROMS/23-287..............K..NDS-----KS.V...IESVKSATN---------------------------------------
Q0FX33_9RHOB/3-297.........HANPAL...HH-----LAETSAWIAALHAAAY---------------------------------------
A1RBR9_ARTAT/55-335..............P..YDI-----TR.A...VREIEEQAL---------------------------------------
A1VTU0_POLNA/3-297.........APVSGY...RH-----LAEVAAWNHAVHKEVH---------------------------------------
Q4RH16_TETNG/25-302.........EPYMDV...RS-----PRNVGAANKMLSGAVS---------------------------------------
Q0UMJ9_PHANO/68-378..............P..FDN-----AL.A...LRQMSEAFL---------------------------------------
Q2U075_ASPOR/4-285..................GE-----IGRSFEILRRISVAVT---------------------------------------
A1SM48_NOCSJ/41-314..............P..FSI-----ED.G...LEQIEAGVR---------------------------------------
Q1GI45_SILST/67-333..............Y..ANV-----PA.F...PDTLTDHIR---------------------------------------
A0Y6C5_9GAMM/33-299..............V..GDP-----EY.F...TAQLEMAAE---------------------------------------
PAH_STRCL/30-303..............P..FDM-----NI.A...IDTAQSHLS---------------------------------------
Q1IHQ4_KORVE/16-311.........PGPHSA...KY-----LSEIAQTCQKHADLVL---------------------------------------
Q5K413_AGABI/11-307........DAPIGIM...KN-----PRTVSQVNRSVAGVVM---------------------------------------
Q6L2W0_PICTO/21-293..............N...FI-----DY.N...IEKIKDDYY---------------------------------------
A0R8M1_BACAH/3-293.........DVNTSL...RN-----LTQVATVCNELASKVD---------------------------------------
Q89H72_BRAJA/11-308........DRPPEKA...NH-----YREIQRWTRVLSRRGY---------------------------------------
Q0FFB5_9RHOB/42-315..............P..ADI-----QD.C...MNRITEFYN---------------------------------------
A1ZN63_9BACT/41-299..................RS-----GMSLEETYTRLRQSCE---------------------------------------
A0Z3U1_9GAMM/41-307..............A..GTP-----EK.V...PEQIYQQAK---------------------------------------
B1KRD6_SHEWM/33-299..............C..GDS-----AD.F...TQRVEDFAT---------------------------------------
Q489X2_COLP3/36-310..............T..FNL-----AD.S...IRIIEAHYD---------------------------------------
Q7V9I4_PROMA/29-293..............F..GAP-----EP.V...IKKVKTASN---------------------------------------
SPEB1_SYNY3/26-297.............HPA.LAG-----DA.M...VTEVCDGIA---------------------------------------
Q6FP31_CANGA/10-317......NTQDQFGII...KR-----PQLVGEATELIYKSVT---------------------------------------
Q2CAN0_9RHOB/40-305..............P..HHP-----AG.V...VPSIEAHAD---------------------------------------
A5G414_GEOUR/41-319..................NP-----ND.ELATMKNVYETM