Sequence alignment for CL0302

PF12640

B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------

PF00491

E7F8R4_DANRE/27-322----SVGIIGA----PFSK-----GQQ-KDG-------------------------------------------------
SPEB3_SCHPO/85-387---FDIAFIGM----PFDT---G-TSY-RPG-------------------------------------------------
Q6BJQ5_DEBHA/76-370---YDIGIIGV----PFDT---A-TSY-RPG-------------------------------------------------
Q6BVQ4_DEBHA/136-428---FDIGIVGA----TFDT---G-VSF-RPG-------------------------------------------------
Q6BWL4_DEBHA/179-480---IDIAVVGA----PFDT---G-VSF-RPG-------------------------------------------------
A1RXI5_THEPD/26-288---SAYVVVGA----PFDS---T-ATG-VPG-------------------------------------------------
SPEB_MOUSE/77-350---LDAAFIGV----PLDT---G-TSN-RPG-------------------------------------------------
A4XKN0_CALS8/20-281---SKVVLAGI----PMDF---T-VSF-KPG-------------------------------------------------
A4J1T2_DESRM/21-282---SSVVLVGA----PMDF---T-VSF-RPG-------------------------------------------------
A1VQK9_POLNA/34-307---LNAAFIGV----PLDI---G-TSN-RPG-------------------------------------------------
Q2K8A9_RHIEC/46-316---IDIALFGI----PMDL---G-VTN-RSG-------------------------------------------------
B2JW15_PARP8/32-305---FDIALAGV----PFDG---G-VTA-RPG-------------------------------------------------
Q982X2_RHILO/42-307---ADAVVWGI----PFDA---A-VTN-RPG-------------------------------------------------
HUTG_BACHD/35-311---DGFGLIGA----PLSK---S-SIS-HSG-------------------------------------------------
HUTG_RHOJR/40-314---GACVLIGF----SSDEGVER-NKG-RRG-------------------------------------------------
ARGI1_HUMAN/6-305---RTIGIIGA----PFSK-----GQP-RGG-------------------------------------------------
SPEB_CHRVO/44-311---VDVAVSGI----PLDL---S-VTF-RSG-------------------------------------------------
ARGI_BACSU/3-292---KTISVIGM----PMDL-----GQA-RRG-------------------------------------------------
Q97ZX8_SULSO/24-289---SPFVIIGI----PMDI---T-SSY-RPG-------------------------------------------------
HUTG_VIBVY/45-328---YGVALLGF----ACDAGVAR-NKG-RIG-------------------------------------------------
A9BRG6_DELAS/16-312---RALRLIGV----PTDI-----GAS-RLG-------------------------------------------------
HUTG_AROAE/40-323---PGIVLLGF----PCDLGVRR-NHG-RAG-------------------------------------------------
A1RB53_PAEAT/29-311---ARVAILGV----ASSA-----GSP-HDG-------------------------------------------------
Q1J2W9_DEIGD/37-306---ADVAVLGI----PYDI---A-LGF-RPG-------------------------------------------------
Q2JER0_FRACC/40-318---PDVAVVGA----PFDI---S-TTH-RPG-------------------------------------------------
Q3J346_RHOS4/3-296---KTCILIGA----PIDS-----GQR-RPG-------------------------------------------------
A9B324_HERA2/22-290---SKVVVLPI----PFEA---T-VSY-GGG-------------------------------------------------
Q9YBG0_AERPE/29-298---SLFSVIGV----PYDS---T-SSF-RPG-------------------------------------------------
Q1GI44_RUEST/34-307---LDVAVLGV----PMDI---G-TSW-RSG-------------------------------------------------
Q9HJB2_THEAC/33-293---SDYVIFGV----PFDN---T-SSY-RRG-------------------------------------------------
A0RXD6_CENSY/22-283---AAAVVFGV----PFDS---T-HSY-RPG-------------------------------------------------
A8LLU9_DINSH/46-312---VDVAVSGV----PFDL---S-VTN-RPG-------------------------------------------------
SPEB_BACHD/22-286---SKAVIFGM----PMDW---T-VSF-RPS-------------------------------------------------
Q0W940_METAR/16-280---AAFVIYGV----PFDN---T-SSF-RAG-------------------------------------------------
Q6MHV0_BDEBA/36-309---YEVGIFGI----PYDG---G-VSY-RPG-------------------------------------------------
Q98MW3_RHILO/19-296---PRAVIFGA----GHGSTYPG-KD--SSG-------------------------------------------------
A0LG67_SYNFM/34-297---AGAVIIPV----PYDA---T-TTY-RAG-------------------------------------------------
HUTG_BACSU/35-311---KGPALIGV----PLSK---S-SIS-HSG-------------------------------------------------
Q9K5Y7_BACHD/5-297---QKVSIIGV----PMDL-----GQK-RRG-------------------------------------------------
Q164F4_ROSDO/46-312---ADIAITGV----PFDQ---A-VTN-RPG-------------------------------------------------
Q164F5_ROSDO/34-308---LDVAIVGI----PMDI---G-TSW-RSG-------------------------------------------------
Q15X44_PSEA6/42-323---PHCCLIGL----ACDLGVKE-NKG-RVG-------------------------------------------------
Q11J67_CHESB/42-307---ADAVVWGI----PFDA---A-VSN-RPG-------------------------------------------------
Q1AWJ4_RUBXD/5-295---PPVAILGV----PMDL-----GQD-RRG-------------------------------------------------
Q5WL42_BACSK/7-290---F--GIVGF----PWDG---G-ASLGRPG-------------------------------------------------
Q7UZH9_PROMP/24-288---CSIGIFGV----NYDG---T-CSY-KSG-------------------------------------------------
Q6CLB8_KLULA/137-438---MDIAIVGA----PFDT---S-VSY-RPG-------------------------------------------------
A0JT79_ARTS2/57-331---ADITVVGV----PFDS---G-VSY-RPG-------------------------------------------------
Q2KVZ3_BORA1/13-287---PGVCVLGI----PFDC---G-THPFRVG-------------------------------------------------
B2UBQ2_RALPJ/40-316---NTVALAGF----ACDAGVAR-NHG-RTG-------------------------------------------------
Q165U0_ROSDO/35-314---ADVAVLGA----PFDG---G-TQW-RAG-------------------------------------------------
B1YHV3_EXIS2/22-286---AKGVLYGM----PMDW---T-VSF-RPG-------------------------------------------------
Q5WIT9_BACSK/27-306---IDAVVYGI----PWEG---AVTWGDYTG-------------------------------------------------
A1C610_ASPCL/68-380---YDIAVIGA----PFDT---A-VSY-RPG-------------------------------------------------
Q1AS11_RUBXD/33-307---ADAAVVGA----PFDT---G-ATF-RVG-------------------------------------------------
Q28QX8_JANSC/39-314---VDIGIFGL----PWDG---A-TSN-RPG-------------------------------------------------
A1WGI6_VEREI/22-320---RPIALIGA----PTDI-----GAG-VRG-------------------------------------------------
A1WER7_VEREI/22-295---LDVGFVGV----PLDL---G-TSH-RSG-------------------------------------------------
A1T3A2_MYCVP/88-364---AEVAIFGV----PLDA---G-ATY-RPG-------------------------------------------------
A8LRL4_DINSH/4-296---QKCILIGA----GMDC-----GKR-RRG-------------------------------------------------
A5V551_SPHWW/4-298---RRIALVGA----PVAL-----GAS-RPG-------------------------------------------------
Q11NZ4_CYTH3/3-310---KPDILVSV----PSDI-----GAQ-RMG-------------------------------------------------
Q5V4R8_HALMA/3-300---EQVRVLGV----PMDL-----GAD-RRG-------------------------------------------------
Q12BY7_POLSJ/72-342---LDVALIGV----PMDL---G-VTN-RAG-------------------------------------------------
HUTG_VIBF1/45-345---DGIMLLGF----ACDEGVIR-NKG-RKG-------------------------------------------------
Q3IVT5_RHOS4/32-308---LDAAIVGL----PSDS---G-APF-RTG-------------------------------------------------
HUTG_GEOKA/44-315---RAAAFIGF----ACDEGVRR-NQG-RQG-------------------------------------------------
SPEB_BLOFL/33-298---NDWVITGV----PFDI---A-TSG-RSG-------------------------------------------------
A0ZFA2_NODSP/30-338---ANLIVIPV----PWEV---T-VSY-GAG-------------------------------------------------
A4XT95_PSEMY/38-311---LDAAFVGV----PLDI---G-TSL-RSG-------------------------------------------------
Q5WB32_BACSK/22-286---ADAVIYGM----PMDW---T-VSF-RPG-------------------------------------------------
Q6C6P6_YARLI/9-306---RKLSIVSA----PFSG-----GQP-KGG-------------------------------------------------
Q12UU8_METBU/17-282---ASYVIFGV----PFDR---T-SSF-RAG-------------------------------------------------
Q213G1_RHOPB/11-309---KRLAVLGA----AVDL-----GAS-QPG-------------------------------------------------
Q28PV5_JANSC/46-313---VDVAVTGI----PFDQ---A-VTN-RPG-------------------------------------------------
A0QRD0_MYCS2/43-317---HDIAVVGV----PFDS---G-VTY-RPG-------------------------------------------------
ARGI_NEUCR/47-354---RDLGIVAV----GFSG-----GQC-KPG-------------------------------------------------
Q12LW8_SHEDO/33-299---ANVVVIGL----PFDL---A-TTG-RSG-------------------------------------------------
Q2W8C1_MAGSA/22-290---ATFCIAGI----PFDL---G-VTN-RSG-------------------------------------------------
GBU1_KLULA/61-358---FDIGVIGV----PFDT---A-VSF-RGG-------------------------------------------------
A1SLP1_NOCSJ/31-312---ADVVVLGA----PFDG---G-TSH-RPG-------------------------------------------------
Q28VR8_JANSC/34-309---ADVAILGA----PFDF---G-TQW-RPG-------------------------------------------------
Q0UYW2_PHANO/16-320---HDLGVVAV----GFSG-----GQP-KPG-------------------------------------------------
Y309_METJA/21-281---AEGVIFSI----PYDE---T-TSF-KPG-------------------------------------------------
Q9RZ04_DEIRA/29-298---ADVAALGV----PFDI---A-LGF-RPG-------------------------------------------------
ARGI_KLULA/13-315---KKLGIVLA----PFSG-----GQP-KSG-------------------------------------------------
A2BIW8_HYPBU/25-300---AEAVIVGV----PFDY---T-SSY-RPG-------------------------------------------------
Q21RM0_RHOFT/15-309---GNISLIGV----PTDI-----GAG-MLG-------------------------------------------------
Q6L151_PICTO/19-280---ARYVLFGV----PFDN---T-SSY-RRG-------------------------------------------------
A0A0D1DTD8_USTMA/13-318---KTVAIVGC----PFSG-----GQR-RKG-------------------------------------------------
A1B165_PARDP/30-308---ADIAFLGI----PYGSAYTM-DEV-TND-------------------------------------------------
Q16AD8_ROSDO/4-296---QKCILIGV----PMDC-----GKR-RQG-------------------------------------------------
Q3SMM1_THIDA/8-294---RSIIVIGA----ASCA-----GAP-DPG-------------------------------------------------
A0A1D8PP00_CANAL/12-313---KKASIITA----PFSG-----GQP-KGG-------------------------------------------------
Q7VSA1_BORPE/8-302---HGVSLIGA----PTDI-----GAG-QRG-------------------------------------------------
A0BHR2_PARTE/9-311---NAVGLFGS----AVHE-----GQT-KTG-------------------------------------------------
Q4JAE9_SULAC/24-287---SPFVIVGI----PLDI---T-SSF-RPG-------------------------------------------------
Q975R8_SULTO/24-287---SPFVIIGL----PLDI---T-SSF-RPG-------------------------------------------------
Q1LGD2_CUPMC/2-296---KPVTLIGA----PTDV-----GAS-IRG-------------------------------------------------
ARGI_AGRFC/19-313---KTCQILGA----PVQS-----GAS-QPG-------------------------------------------------
Q1D421_MYXXD/27-337---AHVILIPV----PFEA---T-TSY-GGG-------------------------------------------------
SPEB1_SCHPO/74-375---FDIAFLGA----PFDT---G-TSY-RPG-------------------------------------------------
ARGI_YEAST/13-329---RELSIVLA----PFSG-----GQG-KLG-------------------------------------------------
A9BN56_DELAS/71-341---LQAALIGV----PMDL---G-ISN-RSG-------------------------------------------------
A0A1D8PPP3_CANAL/50-340---FDIGIIGV----PFDT---A-VSY-RPG-------------------------------------------------
A1RBR9_PAEAT/55-335---YDIAIVGV----PFDG---G-TSF-RPG-------------------------------------------------
A1VTU0_POLNA/3-297---QHIRLIGA----PTDV-----GAG-TRG-------------------------------------------------
Q0UMJ9_PHANO/68-378---YDIAILGA----PFDT---A-VSY-RPG-------------------------------------------------
A1SM48_NOCSJ/41-314---FDVAVVGV----PFDS---G-VTY-RPG-------------------------------------------------
Q1GI45_RUEST/67-333---ADIAVTGI----PFDQ---A-VTN-RPG-------------------------------------------------
Q1IHQ4_KORVE/16-311---KKIRVLGV----PLDL-----GQS-RRG-------------------------------------------------
Q6L2W0_PICTO/21-293---PDIVITGV----PYDG---GIISH-RRG-------------------------------------------------
Q89H72_BRADU/11-308---RRIALLGA----PIDM-----GAS-QRG-------------------------------------------------
Q489X2_COLP3/36-310---LDIGIVGV----PLDI---G-ASN-RSG-------------------------------------------------
Q7V9I4_PROMA/29-293---CNLGIYGV----NYDG---T-TSF-RPG-------------------------------------------------
SPEB1_SYNY3/26-297---AAVVVVPI----PYEA---T-TSY-RKG-------------------------------------------------
Q6FP31_CANGA/10-317---RQLSLVLA----PFSG-----GQG-KLG-------------------------------------------------
A5G414_GEOUR/41-319---YDVIVAGV----PWEG---TVTWGTFSG-------------------------------------------------
Q3SVS2_NITWN/5-302---RKVALLGV----PIDM-----GAS-QRG-------------------------------------------------
SPEB2_SCHPO/89-401---FDIAIIGV----PFDT---A-VSH-RPG-------------------------------------------------
Q8XPR0_RALSO/29-309---ADIAVLGM----PFGTPYSA-ADF-SND-------------------------------------------------
Q47TW8_THEFY/41-314---TDIAVVGI----PFDS---G-VSY-RPG-------------------------------------------------
A9KQ98_LACP7/18-281---SEMVLFGA----PYDG---T-TSY-RPG-------------------------------------------------
A1BCD2_PARDP/35-312---LDVAILGI----PWDG---G-TTN-RAG-------------------------------------------------
ARGI_ASHGO/93-395---KKASLVMA----PFSG-----GQG-KSG-------------------------------------------------
A1B3P5_PARDP/3-295---H-CILIGA----PVDE-----GQR-RPG-------------------------------------------------
Q1QTM4_CHRSD/39-312---LDAAFVGI----PMDI---G-TSN-RPG-------------------------------------------------
Q6C732_YARLI/86-381---FDIALVGA----PFDT---A-VTF-RSG-------------------------------------------------
A0LDK6_MAGMM/20-293---ARVVILPL----PYEG---T-VSY-GTG-------------------------------------------------
Q47D78_DECAR/17-302---SRIRIIGA----ASGL-----GAQ-DQA-------------------------------------------------
Q3JAG2_NITOC/2-290---KIIRIIGV----ASGW-----GAL-DRR-------------------------------------------------
A3DDA1_CLOTH/24-286---ASIVMAGV----PMDF---T-CSF-RPG-------------------------------------------------
A1CKP4_ASPCL/16-320---NELGVVAV----GFNG-----GQC-KLG-------------------------------------------------
ARGI1_SCHPO/22-319---NAVSIINM----PFSG-----GQP-KDG-------------------------------------------------
HUTG_PHOLL/44-316---HYVALLGF----ECDEGVKR-NQG-RPG-------------------------------------------------
A0A1U7EWX2_NATPD/45-332---ADAAVLGV----PYDG---A-VSN-RPG-------------------------------------------------
SPEB2_SYNY3/83-361---YDVAIVGV----PHDS---G-TTY-RPG-------------------------------------------------
Q5LKZ4_RUEPO/42-315---VQIGLVGV----PWDA---G-TTN-RPG-------------------------------------------------
Q2RHH4_MOOTA/26-287---ARAVLAGI----PFDA---T-TSF-RPG-------------------------------------------------
Q17HI3_AEDAE/32-333---EKIGIVGV----PFEK-----GQR-KKG-------------------------------------------------
A3CU48_METMJ/19-276---ARYAVFGV----PYDG---T-TSF-RPG-------------------------------------------------
HUTG_HAHCH/40-316---AGVALIGY----PCDLGVYI-NKG-RVG-------------------------------------------------
Q8RA93_CALS4/28-290---ADIVLVGV----PMDY---S-VSF-KPG-------------------------------------------------
Q8END5_OCEIH/29-310---KDVLIYGV----PWEG---AVTWGDYTG-------------------------------------------------
Q5ANN8_CANAL/115-414---IDIAIVGA----PFDT---G-TSY-RPG-------------------------------------------------
Q2LPR8_SYNAS/65-343---RDVIFSGV----PWEG---TVTWGSFSG-------------------------------------------------
A1ST87_PSYIN/33-299---ADIAVLGL----PFDL---A-TTG-RSG-------------------------------------------------
ARGI1_ARATH/63-338---ASTSLLGV----PLGH---N-SSF-LQG-------------------------------------------------
A0R0G1_MYCS2/40-312---ADVAVVGV----PFDS---A-VTY-RPG-------------------------------------------------
A1CFK4_ASPCL/83-374---YDIAFLGA----PFDT---A-VTG-RPG-------------------------------------------------
B8I5M8_CLOCE/21-282---SDIVIFGA----PYDG---T-TTF-RPG-------------------------------------------------
A1TIE4_ACIAC/8-305---RPVTLIGV----PTDV-----GAA-RLG-------------------------------------------------
A1T9H7_MYCVP/46-324---PDVAVVGA----PFDV---G-TTN-RPG-------------------------------------------------
Q97VA3_SULSO/30-299---IKAAFLGI----PFDD---A-VTY-RPG-------------------------------------------------
Q4J720_SULAC/30-299---VKAAFLGI----PFDD---A-VTY-RTG-------------------------------------------------
Q3J2B4_RHOS4/46-312---VDLAITGV----AFDQ---A-VTN-RTG-------------------------------------------------
A1CGK0_ASPCL/61-357---LDIAILGF----PYDT---S-TSY-RPG-------------------------------------------------
Q10Y47_TRIEI/24-296---AKVVIVPI----PYEA---T-TTY-RRG-------------------------------------------------
A5G278_ACICJ/28-297---AAHVVAGI----PLDV---G-VTN-RAG-------------------------------------------------
ARGI_SOYBN/71-346---ATSTLLGV----PLGH---N-SSF-LEG-------------------------------------------------
O76895_DROME/30-333---QSLGIIGV----PFAK-----GQA-KQG-------------------------------------------------
A1W2M6_ACISJ/2-298---TTLTLIGA----PTDV-----GAS-VLG-------------------------------------------------
Q1GHG8_RUEST/4-296---RHCILVGA----PVDS-----GKR-RTG-------------------------------------------------
Q65P52_BACLD/4-300---QQISMIGV----PMDL-----GQL-RRG-------------------------------------------------
Q67TJ0_SYMTH/28-290---ARAVLWGI----GQDF---T-TSY-RPG-------------------------------------------------
A4XZN2_PSEMY/43-309---VDLAISGV----PFDT---A-TTN-RPG-------------------------------------------------
A4YE21_METS5/29-295---VEAVFIGI----PFDD---A-TTY-RPG-------------------------------------------------
Q6ANF4_DESPS/59-334---IDFAVLGI----PFDT---A-TTY-KPG-------------------------------------------------
Q222F3_RHOFT/24-298---QPFAVVGV----PFDG---A-VTH-RPG-------------------------------------------------
ARGI2_MOUSE/24-324---HSVAIVGA----PFSR-----GQK-KLG-------------------------------------------------
Q315M1_DESAG/23-287---ARFHIIPA----GYEA---S-VSY-GGG-------------------------------------------------
A7IL28_XANP2/50-316---AEVVVWGV----PLDV---A-VSN-RPG-------------------------------------------------
Q18A84_PEPD6/21-285---SNLIVFGV----GFDG---T-TSN-RPG-------------------------------------------------
Q5V6R7_HALMA/44-335---VDIGILGA----PLDT---A-TTI-RPG-------------------------------------------------
Q5LRK8_RUEPO/33-325---KTCILIGA----PVDS-----GKR-RTG-------------------------------------------------
Q9K8M2_BACHD/4-296---KKIAVIGA----PMDL-----GQN-RRG-------------------------------------------------
Q3ABP1_CARHZ/20-281---AAFVLFGI----PMDF---T-VSF-RPG-------------------------------------------------
A9CJC2_AGRFC/42-307---VSTAIWGI----PFDA---A-TSN-RPG-------------------------------------------------
Q7U3K9_SYNPX/21-280---CRVGLFGV----PYDG---T-TSF-RPG-------------------------------------------------
A1STQ5_PSYIN/47-343---SGITLLGF----CCDEGVRR-NKG-RIG-------------------------------------------------
Q7VY32_BORPE/13-287---ALACVLGI----PFDC---G-THPFRVG-------------------------------------------------
Q9CL61_PASMU/34-299---AEWVITGV----PFDA---S-VSG-RAG-------------------------------------------------
A4IB49_LEIIN/14-315----KMSIVLA----PFSG-----GQP-HSG-------------------------------------------------
A5UXL8_ROSS1/34-305----DVAVVGL----PFDT---G-ATF-KVG-------------------------------------------------
A9WCM8_CHLAA/41-307---AQVVILGC----PQDIGVLR-NRG-RPG-------------------------------------------------
B4EIP8_BURCJ/49-320----DACFVGV----PFDL---G-TSN-RTG-------------------------------------------------
B4ELX2_BURCJ/44-308----DVAISGV----PLDL---A-TTY-RSG-------------------------------------------------
B5GLC8_STRC2/31-301----DVVVIGA----PYDG---G-TSY-RPG-------------------------------------------------
B9A9C6_BOMMO/12-304----RVGVIGV----PFEK-----GQK-KYG-------------------------------------------------
C0ZIM2_BREBN/4-293----NMSIVGV----PMDL-----GAD-RRG-------------------------------------------------
D0J7J2_COMT2/7-302------TLIGL----PTDI-----GAS-RLG-------------------------------------------------
D5AV62_RHOCB/6-296------IILGA----PIQS-----GTH-QPG-------------------------------------------------
D5SKW9_STRC2/134-404----DVVVVGA----PYDG---G-TSY-RPG-------------------------------------------------
E3GWR7_METFV/23-279-----FGLLGV----PFDS---T-STY-KPG-------------------------------------------------
E9CYX8_COCPS/18-317-----LGVVAV----GFSD-----GQP-NQG-------------------------------------------------
F1QJZ3_DANRE/86-357----DAAFIGV----PIDT---G-TSN-RPG-------------------------------------------------
F6SZP1_XENTR/61-332----DAAFIGV----PLDT---G-TSN-RPG-------------------------------------------------
A0A0D8JTR5_COCIM/78-370----DIAILGA----PFDT---A-VTA-RPG-------------------------------------------------
K5X448_AGABU/13-305-----AAIVGC----PFSG-----GQR-RTG-------------------------------------------------
SPEB_NEIMB/35-299---ADWVITGV----PYDM---A-VSG-RSG-------------------------------------------------
Q05AR1_XENTR/27-324----SVAVIGA----PFSK-----GQK-RRG-------------------------------------------------
Q24ZK6_DESHY/5-295----KVRIIGV----PIDL-----GAD-RRG-------------------------------------------------
Q251M0_DESHY/26-286---ADAVILGI----PMDY---T-VSF-RPG-------------------------------------------------
Q2FW91_STAA8/6-296----AIDIIGA----PSTF-----GQR-KLG-------------------------------------------------
Q2K3I8_RHIEC/7-299----SVTLIGA----PLEE-----GSG-RRG-------------------------------------------------
Q2K9W6_RHIEC/65-328----DVAVWGI----PFDA---A-TSN-RPG-------------------------------------------------
Q3IKA3_PSEHT/33-297---ADVVVLGL----PFDM---A-TSG-RPG-------------------------------------------------
Q46IA1_PROMT/31-292-----VSLLGV----PYDG---T-CCF-RPG-------------------------------------------------
Q4FL05_PELUB/40-312----DVAIVGI----PFDA---G-TSY-RAG-------------------------------------------------
Q5KIC1_CRYNJ/70-373----DIALLGV----PFDS---A-VSF-RPG-------------------------------------------------
Q5L3P6_GEOKA/3-294----PISIIGV----PMDL-----GQT-RRG-------------------------------------------------
HUTG_LEGPH/47-315----KTIFLGF----ASDTGIKR-NLG-RTG-------------------------------------------------
Q6LHE2_PHOPR/35-321-----AVLFGV----ASDLSLGR-FRG-RLS-------------------------------------------------
Q6LWW9_METMP/19-277---ADFVIFGI----PFDA---T-TSY-KPG-------------------------------------------------
Q6N0N3_RHOPA/14-309----RVALLGV----PIEI-----GAG-LRG-------------------------------------------------
Q6PH54_DANRE/25-322----SVAILGA----PFSK-----GQK-RRG-------------------------------------------------
Q72EZ7_DESVH/23-282----RFHVIPA----PFEA---S-VSY-GGG-------------------------------------------------
Q7V3X2_PROMM/30-287----NVGLFGV----PYDG---T-SSF-RPG-------------------------------------------------
SPEB_BACAN/23-284----EVVIYGM----PMDW---T-VSY-RPG-------------------------------------------------
Q81VP0_BACAN/4-292----EISVIGV----PMDL-----GQM-RRG-------------------------------------------------
Q81Y48_BACAN/37-311-----AALIGA----PLSK---P-SIS-HSG-------------------------------------------------
Q82VE5_NITEU/46-310----ELVISGI----PLDL---A-VSY-RSG-------------------------------------------------
HUTG_VIBPA/47-325-----VSILGF----ATDAGVAR-NKG-RIG-------------------------------------------------
Q88KU3_PSEPK/34-298----DVVVSGV----PFDT---A-TSN-RPG-------------------------------------------------
Q8RG18_FUSNN/503-779------VLIGV----QTNL-----GVN-KTG-------------------------------------------------
Q8TJ04_METAC/18-281----RYVIFGV----PFDN---T-SSY-RAG-------------------------------------------------
Q8XMY7_CLOPE/21-278----SIVVFGA----PFDS---T-TSF-RPG-------------------------------------------------
Q92LN4_RHIME/3-295----TITLIGA----PIEE-----GSG-RRG-------------------------------------------------
Q92MV8_RHIME/71-339----QVAMIGV----PMDL---G-VTN-RPG-------------------------------------------------
Q92QR6_RHIME/44-306-----AVVWGI----PFDA---A-TSN-RPG-------------------------------------------------
GPUA_PSEAE/36-307----QVGLIGV----PWDG---G-TTN-RAG-------------------------------------------------
Q9KLD2_VIBCH/33-297---ADVVVLGV----PLDM---A-TSG-RPG-------------------------------------------------
HUTG_VIBCH/44-322----GVALIGF----ECDAGVER-NKG-RTG-------------------------------------------------
U5L6E1_9BACI/3-293----KLSIIGM----PMDL-----GQM-RRG-------------------------------------------------
U5LEA0_9BACI/39-314----NVIIYGA----PLSR---S-SIS-VSG-------------------------------------------------

PF00850

Q5K8L3_CRYNJ/30-447LP-SNVGRSS-----MVHDLIR------SLD----LLDFEELKERFLKSDNPEDEDGKSEDDDDNEADRNEVNNGDKQGA
HDAC4_HUMAN/675-992HP-EHAGRIQS----IWSRLQE------T-G----LRGKCEC--------------------------------------
A0DIS2_PARTE/35-343HC-ENPQRTQSIDKTIQNYLSS------K-D----LKNKVEQ--------------------------------------
A0LGT0_SYNFM/21-313HP-ESPERLEA----VYRGVEE------A-G----LFPRLTL--------------------------------------
A1W7T1_ACISJ/39-355CF-ENPTRAAY----VEAALTA------R-G-------HVL---------------------------------------
A2BL29_HYPBU/22-314HP-ESPERLAI----ALESLAK------T-G----LYTLVHI--------------------------------------
A3DNS7_STAMF/22-312HP-ENPGRIKY----VIDGIKR------N-G----LTDYTR---------------------------------------
A3GH68_PICST/31-340LP-SNKGRQS-----LISSLLS------AYG----LR-ERCY--------------------------------------
A4S2N1_OSTLU/203-605HQ-ESPERIVA----ILAELQR-------------VIDRGELAMG-----------------------------------
A4S898_OSTLU/34-312HR-FPMTVFQR----VHDILREEG--VIARGQTNCFVPG-----------------------------------------
A4X4X7_SALTO/21-317HP-LDPVRVEL----TVALARE------L-G----VLGRSGV--------------------------------------
A4YNH4_BRASO/59-370TT-EQPERADR----L---LAG------L-K----AGNHEL---------------------------------------
A6QAF4_SULNB/20-301HP-ESRYRLEA----IEKAVA---------P----LKKRLID--------------------------------------
A6R4B6_AJECN/60-359HP-MKPWRLT-----LTKQIVM------AYG----M--HHAM--------------------------------------
A6VSZ5_MARMS/20-304HP-ESPLRLGA----IQNRLIM------G-Q----LMDFLRR--------------------------------------
A7SSG8_NEMVE/31-332---EVPDRIGR----PYEKHKE------Y-G----LL-DRCY--------------------------------------
A7SUP8_NEMVE/33-329LP-KVTGRAS-----LTSSLIE------AYG----LLKDRNI--------------------------------------
A7TRW5_VANPO/20-403LP-CNKYKKSQ----LTYSLLV------SYG----LL-DGFD--------------------------------------
A8ABS4_IGNH4/20-308HP-ESPERVKA----ILDLMKR--------T----KLPNYVE--------------------------------------
A8ZT95_DESOH/22-309HP-ESPSRLAS----IYRMVDR------H------FAGTVTT--------------------------------------
A9A062_DESOH/265-572YV-ESPVRVKS----ILKHLER------S-D----L--FSV---------------------------------------
A9B5I1_HERA2/19-308HP-ENANRLRA----IHAMLAA------DYE----LQQHLTP--------------------------------------
B0T7F0_CAUSK/36-327HV-YDPEVVRR----FRNLVDV------S-G----LLKKLVD--------------------------------------
B2JV93_PARP8/21-308HP-ESPKRLDT----VLKTLRS--------P----EFAALAW--------------------------------------
B4U8T2_HYDS0/19-303HP-ENANRLKV----ALEYIYK------S-D----IKNILSF--------------------------------------
C5KDG6_PERM5/349-869RVLQTRKRYIVP--DCKESLWDSCAWADSVS-------------------------------------------------
E0TF48_PARBH/17-291HR-FPAIKYQL----LKTALIEER--LLPAE---RLAPS-----------------------------------------
E2RU63_GIAIC/23-319HP-MKPFRIA-----LVNELIL------AYG----L--DEHL--------------------------------------
O67135_AQUAE/21-313HP-LKIPRVSL----LLRFLDA------M-N----LIDEKEL--------------------------------------
HDA1_YEAST/83-394HP-EDPRRIYR----IYKILAE------N-G----LINDPTLSGVDD---------------------------------
Q02CA3_SOLUE/20-310HP-ECPARFDA----VLDGLDR------A-G----LLAKMLR--------------------------------------
Q0A6Z7_ALKEH/48-335YP-EHPGRLTA----IMDLLVR------E-P----VPGVTF---------------------------------------
Q0ARF0_MARMM/20-307HP-EHVGRYEA----VREALLALPGCDWREA-------------------------------------------------
Q15WQ0_PSEA6/26-300HR-FPIEKYQA----IYDKLIGLG--VPQGQ---FHQP------------------------------------------
Q1CZX8_MYXXD/27-313HP-ESPSRLRR----ILGVLAS------T-P----VKGTVM---------------------------------------
HDA6_CAEEL/446-747HP-EKPARTRR----ILKTLRE------S-G----VL-EKCV--------------------------------------
Q29CG7_DROPS/39-325HP-FNAAKGKH----IHKALCAEL--SLVEGS--FYEP------------------------------------------
Q2FQW8_METHJ/20-310HP-ERRERLSY----TLDQLEE------E-G----IFDLPQI--------------------------------------
Q2IF50_ANADE/22-318HP-ERQARLEA----ALEALAA------DPA----LGPEVLE--------------------------------------
Q2KBQ8_RHIEC/20-308HP-ERSDRIRA----INVALEH--------P----NFERLER--------------------------------------
Q2LVD3_SYNAS/21-310HP-ESPRRLEV----IYDMLED------R-D----MQGRFQD--------------------------------------
Q2R9B1_ORYSJ/38-341HV-MVPARVA-----MAHSLVG------VYG----M--LGDM--------------------------------------
Q2S035_SALRD/19-312HP-FSPVRQEM----TMDLLAA------L-G----APLNPV---------------------------------------
Q2SC27_HAHCH/22-314HP-FDASKYSR----AWSVLREHFGEKLADIT--LQIN------------------------------------------
Q30PJ4_SULDN/264-571YV-EAPVRIPI----ILEALDK------T-G----L--FLR---------------------------------------
Q31EP6_HYDCU/54-346HP-ENAQRLVA----INNEMEK------Q-G----IWPQLTP--------------------------------------
Q31HC2_HYDCU/19-303HP-ENAQRVVR----IEQALTD------A-R----LLSNTLH--------------------------------------
Q38C74_TRYB2/31-322HA-MKPYRLL-----VTMELIA------SLG----L--KRFC--------------------------------------
Q39UV4_GEOMG/22-314HP-FKIQRIIL----ARELMGM------L-G----LTELPGA--------------------------------------
Q3AFN8_CARHZ/22-318HP-LNPQRYAL----AVELMKI------A-E----VLKEEEI--------------------------------------
Q4D762_TRYCC/59-387DA-MNTVSSD-----VFEWVLE------PLP----V--------------------------------------------
Q4FNF7_PELUB/20-305HP-EKIDRVTV----VIDNFKK------L-D----NK-NLIW--------------------------------------
Q4KAJ1_PSEF5/25-339SF-EQPSRADT----VRDRVRH------V-G----LG-EII---------------------------------------
Q4MYQ3_THEPA/32-415HV-ESHKRLSS----ILERLNE------A-K----ISLKFEHELPL----------------------------------
Q4QAJ4_LEIMA/102-403HL-MRPSRVR-----ALHALVH------SLG----LDNAECM--------------------------------------
Q4QI60_LEIMA/65-431SP-ETPHRLQR----AIETLQG------CER----ALDV-----------------------------------------
HDA21_DICDI/1078-1485HP-ESPKRLSS----VIKAIND------FSR----QSDRLII--------------------------------------
Q5KKR8_CRYNJ/39-367HP-MKPHRIR-----MTHNLVV------NYG----LADDYEAMEEEGRRKVNARMGMEND--------------------
Q60DG7_ORYSJ/56-349HP-ENADRVRN----MVSILRR--------G----PIARFIS--------------------------------------
Q6AJC0_DESPS/25-317HP-EVPARLEV----ILKCLEE------S-P----LLPHLKF--------------------------------------
Q6AKN4_DESPS/22-310H--ESPNRLRE----LFPAVRK--------R----YNGDLRI--------------------------------------
Q6C3Y5_YARLI/64-351RP-SNEGRAA-----LVDSLLVALQLHKSYK----LIPI-----------------------------------------
Q6CGA7_YARLI/268-647SLVERPERLKATSLGVGAAIANNPGKFEIEE----SVRQ-----------------------------------------
Q6FWB7_CANGA/19-382LP-CNKRQKSQ----LIYSMLE------SYG----LL-ECFD--------------------------------------
Q741C0_MYCPA/20-306HP-ERPDRYRA----VAAALSR--------P----GFDALVR--------------------------------------
Q7PS30_ANOGA/126-423YP-ECPERYLR----VMERFTI------G-Q----LV-DRCQ--------------------------------------
Q8EP92_OCEIH/22-320HP-FNQKRVLL----TKELLEA------H-Q----VLSNHDL--------------------------------------
Q8I4I9_CAEEL/27-317---ECPKRMKL----IYERLQK------D-K----LLDGAVK--------------------------------------
Q8IR37_DROME/563-860HP-EQPSRIQH----IHKMHDD------Y-G----LL-KQMK--------------------------------------
HDA14_ARATH/80-386HP-ECSARVPA----IVNALEM------N-E----LTPKFRGSQ------------------------------------
Q9K0J2_NEIMB/41-327HP-DSPDRILC----IEQALRR------A-G----IWQHLQT--------------------------------------
Q9U266_CAEEL/26-318HI-EVPRRLDA----ILERLNT------T-K----LLTDPRI--------------------------------------
G4VAN3_SCHMA/18-356SP-KFGDRYA-----LVMDLIN------AYK----LIPELSRV-------------------------------------
K3ZRV5_SETIT/232-519HP-ERPDRLRA----IAASLAA------A-G----IFPSKCA--------------------------------------
Q22CW6_TETTS/28-319HP-ECPERIEK----IIENLKK------T-G----LWSQLDV--------------------------------------
Q2G292_STAA8/25-322HP-FNQMRLKL----TTELLLN------ANL----LSPEQI---------------------------------------
Q8F7M9_LEPIN/22-309HY-ENSDRLLA----CLNRLHQ------S-S----YFNSLFF--------------------------------------
V6EZA3_9PROT/20-307HP-ECADRLKA----VLAGLET-----EEFS----LLQRE----------------------------------------
W7X9B2_TETTS/39-342HV-ECPARLQS----IFNHLTT------Q-G----LLKSPLVH-------------------------------------

PF12640

B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------

PF00491

E7F8R4_DANRE/27-322--------------------------VQEGADLIRAA----G-------L----VQK-----------------------
SPEB3_SCHPO/85-387--------------------------ARFGPSSLREGSRRIN-------TKYGAVNV-----------------------
Q6BJQ5_DEBHA/76-370--------------------------ARFGPRAIRSASQRQT-------SLRG-YNQ-----------------------
Q6BVQ4_DEBHA/136-428--------------------------SRFGPLGIRMATKRMS-------SGSI-SPF-----------------------
Q6BWL4_DEBHA/179-480--------------------------ARFGPDSIRSASKRLGGVSPDRGRGNPNTNM-----------------------
A1RXI5_THEPD/26-288--------------------------QRFAPQRIREVSVELE-------T----FLP-----------------------
SPEB_MOUSE/77-350--------------------------ARFGPCRIREESLMLG-------A----VNP-----------------------
A4XKN0_CALS8/20-281--------------------------SRFGPSKIREVSVGLE-------E----YSV-----------------------
A4J1T2_DESRM/21-282--------------------------TRQGPQSIRQVSIGLE-------E----YSV-----------------------
A1VQK9_POLNA/34-307--------------------------ARFGPRQIRAESSLIR-------P----YNM-----------------------
Q2K8A9_RHIEC/46-316--------------------------ARFGPRAVRNVDR-VG-------P----YDH-----------------------
B2JW15_PARP8/32-305--------------------------ARFGPREIRNMSTMMR-------G----IHH-----------------------
Q982X2_RHILO/42-307--------------------------ARFGPQAIRRASAILD-------NDPQ-YP------------------------
HUTG_BACHD/35-311--------------------------ASFAPTVIRKCLHAFS-------T----YSV-----------------------
HUTG_RHOJR/40-314--------------------------AARGPDALRGALSSMA--------------------------------------
ARGI1_HUMAN/6-305--------------------------VEEGPTVLRKA-----G-----LLEKLK-EQ-----------------------
SPEB_CHRVO/44-311--------------------------ARMGPQAIRAASVQLA-------ELKP-YP------------------------
ARGI_BACSU/3-292--------------------------VDMGPSAIRYA-----H-----LIERLS-DM-----------------------
Q97ZX8_SULSO/24-289--------------------------SRFAPSSIRESAQYIE-------F----YSI-----------------------
HUTG_VIBVY/45-328--------------------------AKKSPDLIRRALANLA--------------------------------------
A9BRG6_DELAS/16-312--------------------------SAMGPDALRVA-----G-----LGPALR-QL-----------------------
HUTG_AROAE/40-323--------------------------AAEGPAALRRTLANLA--------------------------------------
A1RB53_PAEAT/29-311--------------------------AENGPAFLRAASRRYTWG--YPDGCLMNAET-----------------------
Q1J2W9_DEIGD/37-306--------------------------ARYAPRALREAS----------LRYVPPFTD-----------------------
Q2JER0_FRACC/40-318--------------------------ARFGPRAMRANAYNP-----------GTYHL-----------------------
Q3J346_RHOS4/3-296--------------------------CLMGPAAYRVA-----G-----LGRALA-DL-----------------------
A9B324_HERA2/22-290--------------------------TVNGPSAIIEASQQVE-------F----YDR-----------------------
Q9YBG0_AERPE/29-298--------------------------QRFAPREIRRASIELE-------S----NGY-----------------------
Q1GI44_RUEST/34-307--------------------------TRFGPKQIRAESAMIR-------P----YNM-----------------------
Q9HJB2_THEAC/33-293--------------------------SKYAPDSIRSAYVNLE-------S----FEF-----------------------
A0RXD6_CENSY/22-283--------------------------TRFGPDAIREAFNNIE-------V----FHP-----------------------
A8LLU9_DINSH/46-312--------------------------CRLGPRAIREASSLQP-------FDPP-YG------------------------
SPEB_BACHD/22-286--------------------------SRFGPNRIREASLGLE-------E----YSP-----------------------
Q0W940_METAR/16-280--------------------------SRWAPDEMRKMSYNFE-------T----YNP-----------------------
Q6MHV0_BDEBA/36-309--------------------------GRFAPAKVREVSSLGR-------G----FHM-----------------------
Q98MW3_RHILO/19-296--------------------------HALAADAIRAAS-QDD------ASLVEHWDF-----------------------
A0LG67_SYNFM/34-297--------------------------TREGPRAILAASRELE-------P----YDE-----------------------
HUTG_BACSU/35-311--------------------------ASFAPGTIRQALKHSS-------A----YSA-----------------------
Q9K5Y7_BACHD/5-297--------------------------VDMGPSAMRYA-----G-----LIEEIE-AL-----------------------
Q164F4_ROSDO/46-312--------------------------TRLGPRAIREASALQP-------YDPP-YG------------------------
Q164F5_ROSDO/34-308--------------------------TRFGPKEVRAESAMIR-------P----YNM-----------------------
Q15X44_PSEA6/42-323--------------------------AKTGPNAIRSALANLP--------------------------------------
Q11J67_CHESB/42-307--------------------------ARFGPQAIRRASVIFD-------NDPQ-YP------------------------
Q1AWJ4_RUBXD/5-295--------------------------VDMGPSAIRYA-----R-----LQPALE-EL-----------------------
Q5WL42_BACSK/7-290--------------------------SRFAPEKIREAFAWFAN----RIE----NNQ-----------------------
Q7UZH9_PROMP/24-288--------------------------TRFGPNAIRLVSTCLE-------T----FCP-----------------------
Q6CLB8_KLULA/137-438--------------------------ARFGPNGIRQGSRRLG-------N-GISPV------------------------
A0JT79_ARTS2/57-331--------------------------ARFGANHVREASRLLR-------P----YNP-----------------------
Q2KVZ3_BORA1/13-287--------------------------SRQGPDAIREQSRLLRPF--DLFRRAGVENP-----------------------
B2UBQ2_RALPJ/40-316--------------------------AQAGPAAIRKMLANLP--------------------------------------
Q165U0_ROSDO/35-314--------------------------ARFGPRGVREASTLFS------FGHAGAYDH-----------------------
B1YHV3_EXIS2/22-286--------------------------SRFGPARIREVSLGLE-------E----YSP-----------------------
Q5WIT9_BACSK/27-306--------------------------CELGPKVMRLCSARYSG----YLPELDHIDV-----------------------
A1C610_ASPCL/68-380--------------------------ARFGPRAIRAASARQM-------A-GTSYNT-----------------------
Q1AS11_RUBXD/33-307--------------------------ARFGPEAIRSVSHLLR-------R----HNP-----------------------
Q28QX8_JANSC/39-314--------------------------ARHGPRALRDASTMIR-------E----MNR-----------------------
A1WGI6_VEREI/22-320--------------------------ASMGPEALRVA-----G-----LQAALQ-GH-----------------------
A1WER7_VEREI/22-295--------------------------TRFGPRQIRAESVLLR-------P----YQM-----------------------
A1T3A2_MYCVP/88-364--------------------------TRFGPQGIRRSTNLFGT-----YNYESGVDL-----------------------
A8LRL4_DINSH/4-296--------------------------CLMGPDAYRTA-----G-----LIDTLG-DL-----------------------
A5V551_SPHWW/4-298--------------------------CAMGPEAMRIA-----G-----LAEALA-EL-----------------------
Q11NZ4_CYTH3/3-310--------------------------TSLAVDALLVA-----D-----AERAQP--------------------------
Q5V4R8_HALMA/3-300--------------------------VDMGPSAIRYG-----G-----LADQLS-DI-----------------------
Q12BY7_POLSJ/72-342--------------------------ARLGPRAVRNVER-IG-------P----YEH-----------------------
HUTG_VIBF1/45-345--------------------------AYAAPQVIRRALANLA--------------------------------------
Q3IVT5_RHOS4/32-308--------------------------ARFAPNALRAMSVMLR-------P----INP-----------------------
HUTG_GEOKA/44-315--------------------------AKEAPAAVKAALARLP--------------------------------------
SPEB_BLOFL/33-298--------------------------SRFGPASIRKASINLA-------WENCRWP------------------------
A0ZFA2_NODSP/30-338--------------------------TAKAPQQILDASIQLD-------L----FDF-----------------------
A4XT95_PSEMY/38-311--------------------------TRFGPREIRAQSVMIR-------P----YNM-----------------------
Q5WB32_BACSK/22-286--------------------------SRFGPARIREASLGLE-------E----YSP-----------------------
Q6C6P6_YARLI/9-306--------------------------VDKGPEYLLGG-----G-----LEKHLQ-SL-----------------------
Q12UU8_METBU/17-282--------------------------SRWAPDAIRSATANFE-------S----YNS-----------------------
Q213G1_RHOPB/11-309--------------------------TLMGPAALRTA-----G-----LLPLLT-AL-----------------------
Q28PV5_JANSC/46-313--------------------------TRLGPRAIRAASALQP-------FDPP-YG------------------------
A0QRD0_MYCS2/43-317--------------------------ARFGPSAIREASRLLK-------P----YHP-----------------------
ARGI_NEUCR/47-354--------------------------VDAAPSALIES-----G-----LLTQLREEL-----------------------
Q12LW8_SHEDO/33-299--------------------------GRMGPEAIRRASVNLA-------WEDTRWP------------------------
Q2W8C1_MAGSA/22-290--------------------------AREGPQAVRRASRMLA-------D----GAN-----------------------
GBU1_KLULA/61-358--------------------------ARFGPQAIRKASQRQT-------S-MRGFNF-----------------------
A1SLP1_NOCSJ/31-312--------------------------TRFGPSAIRQTDYLPQ-------DG-SRPHL-----------------------
Q28VR8_JANSC/34-309--------------------------ARFGPRAIREASTLFA------FGHAGAYDH-----------------------
Q0UYW2_PHANO/16-320--------------------------VDAAPMALIEA-----G-----LIQQLEHDL-----------------------
Y309_METJA/21-281--------------------------AREGGNAIRTASWGLE-------T----YSP-----------------------
Q9RZ04_DEIRA/29-298--------------------------ARFAPRALREAS----------LRSVPPFTG-----------------------
ARGI_KLULA/13-315--------------------------VENGPKYLMKQ-----G-----LRSDIE-SL-----------------------
A2BIW8_HYPBU/25-300--------------------------SRFAPRAIREAAANIE-------F----YSL-----------------------
Q21RM0_RHOFT/15-309--------------------------ARMGPEALRVA-----G-----LAQALT-QL-----------------------
Q6L151_PICTO/19-280--------------------------SRLSPNYIRYAYNNLE-------S----FEI-----------------------
A0A0D1DTD8_USTMA/13-318--------------------------VDTGPVSLVQA-----G-----ICQQLE-SL-----------------------
A1B165_PARDP/30-308--------------------------QTRAPTAVRQAT-DRA------VRLLDRYDF-----------------------
Q16AD8_ROSDO/4-296--------------------------CLMGPDAYRTA-----G-----LAPAIR-DL-----------------------
Q3SMM1_THIDA/8-294--------------------------CAAGPDALHHY-----E-----VFHDTP-LQ-----------------------
A0A1D8PP00_CANAL/12-313--------------------------VELGPDYILKA-----G-----FQKQIE-SL-----------------------
Q7VSA1_BORPE/8-302--------------------------ASMGPEALRVA-----G-----LVRLLE-RR-----------------------
A0BHR2_PARTE/9-311--------------------------TELAPRALREG-----G-----LISALY-NL-----------------------
Q4JAE9_SULAC/24-287--------------------------SRFAPSVIREVAQYIE-------F----YSM-----------------------
Q975R8_SULTO/24-287--------------------------SRFAPSTIREYAQFIE-------F----YSI-----------------------
Q1LGD2_CUPMC/2-296--------------------------ASMGPEALRVA-----D-----IAGALV-RN-----------------------
ARGI_AGRFC/19-313--------------------------CLMGPDAFRTA-----G-----LTQVLT-EL-----------------------
Q1D421_MYXXD/27-337--------------------------TSEGPTAVLEASRQVD-------L----FDV-----------------------
SPEB1_SCHPO/74-375--------------------------ARFGPSGIREGSRRLN-------L-YGGYNV-----------------------
ARGI_YEAST/13-329--------------------------VEKGPKYMLKH-----G-----LQTSIE-DL-----------------------
A9BN56_DELAS/71-341--------------------------CRFGPRALRSIER-VG-------P----YNH-----------------------
A0A1D8PPP3_CANAL/50-340--------------------------ARFGPRAIRDASQRQN-------N-LRGFNP-----------------------
A1RBR9_PAEAT/55-335--------------------------ARFGPAAVREASRLLR-------P---GYHP-----------------------
A1VTU0_POLNA/3-297--------------------------ASMGPEAFRVA-----G-----LQPTLE-GH-----------------------
Q0UMJ9_PHANO/68-378--------------------------ARFGPRAIRAGSSRQT-------S-FRGFNP-----------------------
A1SM48_NOCSJ/41-314--------------------------ARFGPSHIRQGSRLLR-------P----YNP-----------------------
Q1GI45_RUEST/67-333--------------------------TRLGPRAVREASALQS-------PDAP-YG------------------------
Q1IHQ4_KORVE/16-311--------------------------VDMGPSAVRVA-----G-----LEAKLE-AL-----------------------
Q6L2W0_PICTO/21-293--------------------------ARYGPERIREIMNSYS-------SYCT---------------------------
Q89H72_BRADU/11-308--------------------------TLMGPPALRTA-----G-----LATLLE-SL-----------------------
Q489X2_COLP3/36-310--------------------------TRFGPRSVRNESVLVR-------P----YGM-----------------------
Q7V9I4_PROMA/29-293--------------------------ARFGPSSIRQVSNGIE-------S----FCP-----------------------
SPEB1_SYNY3/26-297--------------------------CEHGPEAVLEASDQLE-------A----YDE-----------------------
Q6FP31_CANGA/10-317--------------------------VEKGPKYMLKH-----G-----LQKDLE-EL-----------------------
A5G414_GEOUR/41-319--------------------------CELSPKTIRHASARYGG----FLPEY-ELDL-----------------------
Q3SVS2_NITWN/5-302--------------------------TLMGPAALRTA-----G-----ITPVLE-SL-----------------------
SPEB2_SCHPO/89-401--------------------------ARFGPKGIRSASSRQM-------A-IRGFNP-----------------------
Q8XPR0_RALSO/29-309--------------------------QTNAPAAIRQAT-DRV------ARAPGHYDF-----------------------
Q47TW8_THEFY/41-314--------------------------ARFGPAAIREASRLLR-------P----YNP-----------------------
A9KQ98_LACP7/18-281--------------------------TRFASAAIRNESYGIE-------T----FSP-----------------------
A1BCD2_PARDP/35-312--------------------------ARHGPREVRNQSSLMR-------R----VHH-----------------------
ARGI_ASHGO/93-395--------------------------VEDGPKYLLKQ-----G-----LREGVE-GL-----------------------
A1B3P5_PARDP/3-295--------------------------CLMGPAAYRVA-----G-----LASTLI-DL-----------------------
Q1QTM4_CHRSD/39-312--------------------------TRLGPRQIRDESRMLR-------P----YNM-----------------------
Q6C732_YARLI/86-381--------------------------ARFGPAGIRKGSRRMS-------P-GQVSPY-----------------------
A0LDK6_MAGMM/20-293--------------------------TSQGPRAILEASKQLE-------V----WDE-----------------------
Q47D78_DECAR/17-302--------------------------CEDGPVAFHHS-----Q-----AWHELE-HH-----------------------
Q3JAG2_NITOC/2-290--------------------------CEAGPEALRRR-----G-----LVAHLR-QQ-----------------------
A3DDA1_CLOTH/24-286--------------------------TRFGPQKIREVSIGIE-------E----YSV-----------------------
A1CKP4_ASPCL/16-320--------------------------VEAAPLALIEA-----G-----LLNQVRDDL-----------------------
ARGI1_SCHPO/22-319--------------------------AELAPEMIEAA-----G-----LPEDLE-RL-----------------------
HUTG_PHOLL/44-316--------------------------ANQGPDYLRQSLANMA--------------------------------------
A0A1U7EWX2_NATPD/45-332--------------------------ARFGPRAVRRASGWLA------------YLS-----------------------
SPEB2_SYNY3/83-361--------------------------TRFGPQGIRRISALYTP-----YNFEMGVDL-----------------------
Q5LKZ4_RUEPO/42-315--------------------------PRHGPRQLRDLSTMIR-------A----GNP-----------------------
Q2RHH4_MOOTA/26-287--------------------------TRWGPRAIRSVSEVLE-------E----YSP-----------------------
Q17HI3_AEDAE/32-333--------------------------VGLGPKAIREA-----G-----LIDSIQ-EI-----------------------
A3CU48_METMJ/19-276--------------------------TRFGPRAIREVSFNFE-------S----YDP-----------------------
HUTG_HAHCH/40-316--------------------------AANGPDEIIKALANLP--------------------------------------
Q8RA93_CALS4/28-290--------------------------TRFGPSSIRQASYGLE-------T----YSV-----------------------
Q8END5_OCEIH/29-310--------------------------CELGPKAIRLNSERYSG----YLPELNDIDV-----------------------
Q5ANN8_CANAL/115-414--------------------------ARFGPESIRSNSRRLG-------S-AWKSTK-----------------------
Q2LPR8_SYNAS/65-343--------------------------CELAPRAIRHSAARYGG----FLPEY-ELDF-----------------------
A1ST87_PSYIN/33-299--------------------------ARMGPTAIRQASINLA-------WEGKRFP------------------------
ARGI1_ARATH/63-338--------------------------PAFAPPRIREAIWCGST----NSATEEGKEL-----------------------
A0R0G1_MYCS2/40-312--------------------------ARFGPNAIRQASRLVR-------G----YNP-----------------------
A1CFK4_ASPCL/83-374--------------------------ARFGPGGIRLGSRRL-----------GGWSI-----------------------
B8I5M8_CLOCE/21-282--------------------------TRFAPSAMRIDSIGLE-------T----YSP-----------------------
A1TIE4_ACIAC/8-305--------------------------AAMGPDALRVA-----Q-----LGPALE-RL-----------------------
A1T9H7_MYCVP/46-324--------------------------ARFGPRAIRATAYEP-----------GTYHM-----------------------
Q97VA3_SULSO/30-299--------------------------ARFGPMGIRQGSRLLR-------P----YNQ-----------------------
Q4J720_SULAC/30-299--------------------------ARFGPMAVRQGSRLLR-------P----YNQ-----------------------
Q3J2B4_RHOS4/46-312--------------------------TRFGPRAIREASTLQP-------YDRP-FG------------------------
A1CGK0_ASPCL/61-357--------------------------ARFGPRGIRAGSSREK-------K-GRSYNT-----------------------
Q10Y47_TRIEI/24-296--------------------------CVNGPAVLLNASQQLE-------C----YDE-----------------------
A5G278_ACICJ/28-297--------------------------TRSGPAAIRVASRMLA-------G----NHH-----------------------
ARGI_SOYBN/71-346--------------------------PAFAPPFIREGIWCGSA----NSTTEEGKDL-----------------------
O76895_DROME/30-333--------------------------VELAPDLLRQS-----S-----LRQVLQ-SS-----------------------
A1W2M6_ACISJ/2-298--------------------------ASMGPDALRIA-----G-----IARAMQ-AR-----------------------
Q1GHG8_RUEST/4-296--------------------------CLMGPDAYRTA-----G-----LAQALE-SL-----------------------
Q65P52_BACLD/4-300--------------------------VDMGPSAIRCA-----G-----VNERLE-CL-----------------------
Q67TJ0_SYMTH/28-290--------------------------TRFGPGRIREASYGIE-------E----FSY-----------------------
A4XZN2_PSEMY/43-309--------------------------SRFGPRAIRAASIQSA-------WARH-YP------------------------
A4YE21_METS5/29-295--------------------------ARFGPMGIRDGSRLLR-------P----YNP-----------------------
Q6ANF4_DESPS/59-334--------------------------CRFGPAGIRAASTILK-------S----YEE-----------------------
Q222F3_RHOFT/24-298--------------------------ARFGPQEIRRASLMLC-------D---GSHP-----------------------
ARGI2_MOUSE/24-324--------------------------VEYGPAAIREA-----G-----LLKRLS-RL-----------------------
Q315M1_DESAG/23-287--------------------------TFRGPAAILAASRQLE------------LWD-----------------------
A7IL28_XANP2/50-316--------------------------TRFGPRAIRAASTILD-------GDPF-YP------------------------
Q18A84_PEPD6/21-285--------------------------ARFASSSMRKEFYGLE-------T----YSP-----------------------
Q5V6R7_HALMA/44-335--------------------------TRYGPRAVRAASTVPS-------PPYEHFNI-----------------------
Q5LRK8_RUEPO/33-325--------------------------CLMGPDSYRTA-----G-----LAEALA-DL-----------------------
Q9K8M2_BACHD/4-296--------------------------VDMGPSALRYA-----G-----LIERLQ-SI-----------------------
Q3ABP1_CARHZ/20-281--------------------------ARMAPQHIRQVSFGLE-------E----YDW-----------------------
A9CJC2_AGRFC/42-307--------------------------ARFGPQAIRRASAIFD-------NDPQ-YP------------------------
Q7U3K9_SYNPX/21-280--------------------------TRFGPAAIREVSQGLE-------T----YCP-----------------------
A1STQ5_PSYIN/47-343--------------------------AFHGPDLIRQALANSA--------------------------------------
Q7VY32_BORPE/13-287--------------------------ARQGPDAIREQSRLLRPY--DLARRAGVDNP-----------------------
Q9CL61_PASMU/34-299--------------------------TRFGAEAIRRASVNLA-------WEHCRFP------------------------
A4IB49_LEIIN/14-315--------------------------VELGPDYLLKQGLQQD-------MEKLGWNT-----------------------
A5UXL8_ROSS1/34-305--------------------------ARFGPEAIRSASVLLR-------P----YNP-----------------------
A9WCM8_CHLAA/41-307--------------------------AAQGPTAIRRCLYRLG-------ITG----L-----------------------
B4EIP8_BURCJ/49-320--------------------------ARFGPRQIRTESVLLR-------P----YNM-----------------------
B4ELX2_BURCJ/44-308--------------------------ARLGPAAIRAASVQLAE----LNPYPWGF-------------------------
B5GLC8_STRC2/31-301--------------------------ARFGPQAIRSESGLIH-------G----VGI-----------------------
B9A9C6_BOMMO/12-304--------------------------VSIAPAAVRAA----G------LIDELK-EI-----------------------
C0ZIM2_BREBN/4-293--------------------------VDMGPSAIRYAGVVAR----------LE--------------------------
D0J7J2_COMT2/7-302--------------------------AAMGPDALRVA--QLG-------P-ALQ--------------------------
D5AV62_RHOCB/6-296--------------------------CVMGPASLRTAGLIAS-------L---T--------------------------
D5SKW9_STRC2/134-404--------------------------ARFAPRAIRHESSLIH-------G----VGI-----------------------
E3GWR7_METFV/23-279--------------------------SRFGPLMIRQASYNFE-------NYSLHYRK-----------------------
E9CYX8_COCPS/18-317--------------------------V--DPSGLIEAGL-LDQ-----LRDDLEYDI-----------------------
F1QJZ3_DANRE/86-357--------------------------ARFGPRHIRAESAMIR-------A----YCG-----------------------
F6SZP1_XENTR/61-332--------------------------ARFGPRHIRGESCMVR-------R----YNI-----------------------
A0A0D8JTR5_COCIM/78-370--------------------------ARYGPGGIRRGSARMR-------A-GSAWSV-----------------------
K5X448_AGABU/13-305--------------------------VDQGPIRLVEAGLVEQ-------LKGLGWNV-----------------------
SPEB_NEIMB/35-299--------------------------ARFGPEAIRRASVNLA-------WEHRRFPW-----------------------
Q05AR1_XENTR/27-324--------------------------VEHGPAAIRSA----G------LIDRLS-NL-----------------------
Q24ZK6_DESHY/5-295--------------------------VDMGPSAIRYAGLHE----------RLK--------------------------
Q251M0_DESHY/26-286--------------------------TRLGPLSIRNVSIGIE-------E----YSV-----------------------
Q2FW91_STAA8/6-296--------------------------VDLGPTAIRYAGLIS----------RLK-QL-----------------------
Q2K3I8_RHIEC/7-299--------------------------AAMGPAALRIAGVDQT-------LIDLGHDV-----------------------
Q2K9W6_RHIEC/65-328--------------------------TRFGPQAIRRASAIFD-------N-DAQYPF-----------------------
Q3IKA3_PSEHT/33-297--------------------------ARLGPDAIRRASVHLA-------WEGTKYPW-----------------------
Q46IA1_PROMT/31-292--------------------------ARFGPSAIREDSYGIE-------TYCPQL-------------------------
Q4FL05_PELUB/40-312--------------------------ARFGPMSIRQASRHLR------TN----YHP-----------------------
Q5KIC1_CRYNJ/70-373--------------------------ARFGPYALRSGSRRQR-------P-DRGYNS-----------------------
Q5L3P6_GEOKA/3-294--------------------------VDMGPSAMRYAGIIER----------LE--------------------------
HUTG_LEGPH/47-315--------------------------AKLGPDQIKTQLAKLP-------C----HNN-----------------------
Q6LHE2_PHOPR/35-321--------------------------DSDGPESICRALKKEY-------K------------------------------
Q6LWW9_METMP/19-277--------------------------ARFGPDEVRNASWGLET-----FSPILKK-------------------------
Q6N0N3_RHOPA/14-309--------------------------TLMGPAALRTA--GIGR-----VLDQ----------------------------
Q6PH54_DANRE/25-322--------------------------VEHGPKAIRDAGLVE----------RL-SNL-----------------------
Q72EZ7_DESVH/23-282--------------------------TGAGPDAILDASDQLE-------L------------------------------
Q7V3X2_PROMM/30-287--------------------------SRFGPTAIRDVSNGLE-------TYCPQL-------------------------
SPEB_BACAN/23-284--------------------------SRFGPARIREVSIGLE-------E----YSP-----------------------
Q81VP0_BACAN/4-292--------------------------VDMGPSAIRYAGVIER----------IE-EI-----------------------
Q81Y48_BACAN/37-311--------------------------ASFAPKTIRSMLDAYS-------TYAIT--E-----------------------
Q82VE5_NITEU/46-310--------------------------ARFGPLGIRQASAEVAS----LKPYPWGF-------------------------
HUTG_VIBPA/47-325--------------------------AKKAPDLIRRALANLA-------W------------------------------
Q88KU3_PSEPK/34-298--------------------------ARFGPRAIRAASVQQA-------W-ARHWPW-----------------------
Q8RG18_FUSNN/503-779--------------------------TEFGPDDLIQAYP--D-------T-FDEMEL-----------------------
Q8TJ04_METAC/18-281--------------------------SRWAPDAMRQVSANFE-------SYNPTFDI-----------------------
Q8XMY7_CLOPE/21-278--------------------------TRFASQVMRGESWGLE-------S----YSP-----------------------
Q92LN4_RHIME/3-295--------------------------AAMGPTALRIA--GIDT-----VL------A-----------------------
Q92MV8_RHIME/71-339--------------------------SRFGPRALRAI-ERIG-------P----YNH-----------------------
Q92QR6_RHIME/44-306--------------------------ARFGPQAIRRASAIFD-------N-DPQYPF-----------------------
GPUA_PSEAE/36-307--------------------------ARHGPREVRNLSSLMRKV--HHVS------------------------------
Q9KLD2_VIBCH/33-297--------------------------ARMGPDAIRRASVNLA-------WEGKKFPW-----------------------
HUTG_VIBCH/44-322--------------------------AKHAPSLIKQALANLA-------W-----H------------------------
U5L6E1_9BACI/3-293--------------------------VDMGPSAIRYAGVNER-------L---K-SL-----------------------
U5LEA0_9BACI/39-314--------------------------ASLYPDEFRKMWKGYA-------A----YNL-----------------------

PF00850

Q5K8L3_CRYNJ/30-447DGEPQRRKPGSPTASPPHAQNKKATVVFPQPSLGT-KACL-L----KYHDRSYIERLLMAHT------------------
HDAC4_HUMAN/675-992----------------------------IRGRKAT-LEEL-Q----TVHSEAHTLLY-----------------------
A0DIS2_PARTE/35-343---------------------------LSQFEQCD-INHL-R----LVHDEKYIDFV-----------------------
A0LGT0_SYNFM/21-313----------------------------IKASPAK-LKWI-E----AVHSPKHIMRF-----------------------
A1W7T1_ACISJ/39-355-----------------------------HPPDVDCTEVL-A----KIHAPRYLAFL-----------------------
A2BL29_HYPBU/22-314---------------------------QPAPRRGLERDRI-L----EVHDPAYVEKV-----------------------
A3DNS7_STAMF/22-312----------------------------FVKHSYE-EKEV-LQVLNRVHCRKYIEYI-----------------------
A3GH68_PICST/31-340--------------------------GIIGEYRAS-RQEL-A----SYHDENFVDFLLQDRL------------------
A4S2N1_OSTLU/203-605-----------------------ELDKTCTFGAAE-PSDI-L----RAHDENYVRVL-----------------------
A4S898_OSTLU/34-312-------------------------------RAPS-VDEL-C----RAHDEDYVRDV-----------------------
A4X4X7_SALTO/21-317--------------------------RLVEPKPVD-DELL-T----RVHDPAYLEAV-----------------------
A4YNH4_BRASO/59-370----------------------------VAPIQFG-QEAR-A----RVHSPEYLNFL-----------------------
A6QAF4_SULNB/20-301----------------------------VSPISVS-EKVL-E----LVHTPEHIETV-----------------------
A6R4B6_AJECN/60-359--------------------------DLYKTREAT-YEEM-A----EFHSPEYLDFL-----------------------
A6VSZ5_MARMS/20-304----------------------------LESDPAT-REQL-L----LAHDEAYVDSI-----------------------
A7SSG8_NEMVE/31-332---------------------------KIPSRHAT-EEDL-L----CLHSKEHIDKM-----------------------
A7SUP8_NEMVE/33-329--------------------------RVIAPRKAT-ASEL-A----AFHSSEYVNCM-----------------------
A7TRW5_VANPO/20-403--------------------------VIIDDPCCN-KKDL-L----QFHSRDYIDLLLDPVYNRIIQYDDDESKWSQLHP
A8ABS4_IGNH4/20-308---------------------------VRSPVPID-EREL-E----LVHDRDYVEYV-----------------------
A8ZT95_DESOH/22-309----------------------------MTPEPAT-LDQL-E----LVHTPGHVKKI-----------------------
A9A062_DESOH/265-572----------------------------LPVRHFA-DDHI-T----AVHDKHFVRYL-----------------------
A9B5I1_HERA2/19-308----------------------------LAPRHAT-AAEI-E----AVHVPSHLPTL-----------------------
B0T7F0_CAUSK/36-327----------------------------IPARLAT-GLEI-G----RVHTSDHINQI-----------------------
B2JV93_PARP8/21-308----------------------------RDAPMGT-VEQV-Q----LIHRQDFIDEV-----------------------
B4U8T2_HYDS0/19-303----------------------------EKPRKAT-VEEV-S----KIHDTYYIQEI-----------------------
C5KDG6_PERM5/349-869-------------------------------SPVTIPDVLVT----NIHSKRYLHDL-----------------------
E0TF48_PARBH/17-291-------------------------------PAAR-EGEI-K----VAHTESYIASL-----------------------
E2RU63_GIAIC/23-319--------------------------NYYTPRDAT-FQDM-A----LYHTPDYIRFL-----------------------
O67135_AQUAE/21-313----------------------------IKSRPAT-KEEL-L----LFHTEDYINTL-----------------------
HDA1_YEAST/83-394---------------------LGDLMLKIPVRAAT-SEEI-L----EVHTKEHLEFI-----------------------
Q02CA3_SOLUE/20-310----------------------------VEARDAT-QEEL-T----LCHTPDYLKTA-----------------------
Q0A6Z7_ALKEH/48-335----------------------------RTGRAAT-PAEL-G----RVHTLSYLETI-----------------------
Q0ARF0_MARMM/20-307-------------------------------PTAA-MTDV-A----RFHSAAHVDRV-----------------------
Q15WQ0_PSEA6/26-300-------------------------------HALT-PSQL-N----RVYSPDYVNDL-----------------------
Q1CZX8_MYXXD/27-313----------------------------TAPRSAT-EAEL-A----SVHTPELLAYL-----------------------
HDA6_CAEEL/446-747--------------------------DRNCERIAT-NEEI-R----LVHTKKMLEHL-----------------------
Q29CG7_DROPS/39-325-------------------------------EELT-KHQL-R----RIHTREYLRSL-----------------------
Q2FQW8_METHJ/20-310--------------------------RLLTPKPAM-RDDV-L----LVHTKEYLHFL-----------------------
Q2IF50_ANADE/22-318---------------------------RVEAARAT-EQAL-L----RVHTPGHLARV-----------------------
Q2KBQ8_RHIEC/20-308----------------------------RQAPQAS-EDAV-L----LAHPEEHLKAV-----------------------
Q2LVD3_SYNAS/21-310----------------------------VPAREAR-MDEL-H----LIHLPDYVNRV-----------------------
Q2R9B1_ORYSJ/38-341--------------------------RRLRTRPAT-EAEI-R----RFHSPEYVDLL-----------------------
Q2S035_SALRD/19-312-----------------------------APSVAT-REEV-R----RVHGEQFVEKV-----------------------
Q2SC27_HAHCH/22-314-------------------------------DPAT-TESL-A----LAHSREYLASL-----------------------
Q30PJ4_SULDN/264-571----------------------------IQPKHVS-DKLL-K----QVHLGAYVDYL-----------------------
Q31EP6_HYDCU/54-346----------------------------VATRLAT-NEEL-L----LAHTQSYIDEI-----------------------
Q31HC2_HYDCU/19-303----------------------------KSILPAT-EIDV-L----RVHSSPFWETL-----------------------
Q38C74_TRYB2/31-322--------------------------RTVVPPPIG-IKEL-L----TYHAEDYILNL-----------------------
Q39UV4_GEOMG/22-314--------------------------CIHDCPRAD-EASL-L----TFHSPDYLQRL-----------------------
Q3AFN8_CARHZ/22-318----------------------------IPPRSAT-LKEL-Y----LVHDPAYVEAV-----------------------
Q4D762_TRYCC/59-387---------------------------------VG-VEDM-T----AFHDRAYLNYL-----------------------
Q4FNF7_PELUB/20-305----------------------------KKPSKFN-RSLL-E----ITHNSDYINFV-----------------------
Q4KAJ1_PSEF5/25-339-----------------------------GPRRFD-RACY-V----AAHSERYVSFL-----------------------
Q4MYQ3_THEPA/32-415----------------------TGHLYHVQPREVP-RQIL-L----LCHTEKYLDQV-----------------------
Q4QAJ4_LEIMA/102-403--------------------------TVCHARPAT-AEEM-G----AFHRSAYLECL-----------------------
Q4QI60_LEIMA/65-431-------------------------------LPVELLAPF------TVH-------------------------------
HDA21_DICDI/1078-1485---------------------------KNDPEEIN-DKWI-L----TVHSPEYLRLL-----------------------
Q5KKR8_CRYNJ/39-367---------EARWVNAEMRGSRAKRMQIFRPRRAT-KTDM-T----RFHTDEYIELL-----------------------
Q60DG7_ORYSJ/56-349---------------------------WHSGRPAH-AAEL-L----SFHSAEYIEEL-----------------------
Q6AJC0_DESPS/25-317----------------------------VASRLAR-RASL-L----LAHEEDWLFRF-----------------------
Q6AKN4_DESPS/22-310----------------------------ITPHEAN-TETI-E----KVHSNFYLSQI-----------------------
Q6C3Y5_YARLI/64-351-------------------------------TPAT-AAEL-Q----RYHSLEYVSAV-----------------------
Q6CGA7_YARLI/268-647-------------------------------ANLS-SEHV-T----AVHGVEYINLL-----------------------
Q6FWB7_CANGA/19-382--------------------------HIIDVPSCQ-RKDL-E----KFHSKDYLNVILDEQLNWNPQIDGNEDQLMELRK
Q741C0_MYCPA/20-306----------------------------ETAEPAE-LAAT-R----YVHSNRYVDAP-----------------------
Q7PS30_ANOGA/126-423---------------------------FVAPRPAT-RAEL-L----TKHTAEQIELL-----------------------
Q8EP92_OCEIH/22-320----------------------------ISPRLAT-EEEL-L----LFHHPNYMETV-----------------------
Q8I4I9_CAEEL/27-317----------------------------IDAREAN-DSEI-R----LNHPQQLIDEI-----------------------
Q8IR37_DROME/563-860---------------------------QLSPRAAT-TDEV-C----LAHTRAHVNTV-----------------------
HDA14_ARATH/80-386------------------------ILELANFKTAT-VEDI-A----NVHDKAYVFGL-----------------------
Q9K0J2_NEIMB/41-327----------------------------IEAEEIS-DTRL-A----LVHSSKYLNRL-----------------------
Q9U266_CAEEL/26-318--------------------------EHIPRREAE-ESEI-L----AVHTKRYVDDV-----------------------
G4VAN3_SCHMA/18-356-------------------------PPLQWDSPSRMYEAV-T----AFHSTEYVDAL-----------------------
K3ZRV5_SETIT/232-519---------------------------LVPPREIT-KEEL-L----MVHTPDHIESV-----------------------
Q22CW6_TETTS/28-319---------------------------INQVEPIQ-KDIL-N----KVHRDSYVDLV-----------------------
Q2G292_STAA8/25-322----------------------------VQPRIAT-DDEL-M----LIHKYDYVEAI-----------------------
Q8F7M9_LEPIN/22-309----------------------------PEMKKLP-NEFL-N----EIHSQNHIQKI-----------------------
V6EZA3_9PROT/20-307-----------------------------EAPQAS-REHL-L----RAHCPHHVDHV-----------------------
W7X9B2_TETTS/39-342--------------------------IVDKLKPAE-KSIV-K----YAHDDNYIEFI-----------------------

PF12640

B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------

PF00491

E7F8R4_DANRE/27-322-------------------------------LKG--------------QGCVVK--------------------------
SPEB3_SCHPO/85-387-------------------------------PLEIN---------PFKSWAKLV--------------------------
Q6BJQ5_DEBHA/76-370-------------------------------RADFN---------PYTSWAKVI--------------------------
Q6BVQ4_DEBHA/136-428-------------------------------RKNFS----------LFKDGKIV--------------------------
Q6BWL4_DEBHA/179-480-------------------------------TEINPY-------DPRSHNLSII--------------------------
A1RXI5_THEPD/26-288-------------------------------DLQI-----------DVERLAVN--------------------------
SPEB_MOUSE/77-350-------------------------------STGAL----------PFQSLRVA--------------------------
A4XKN0_CALS8/20-281-------------------------------YQDK-----------NLFNKAFC--------------------------
A4J1T2_DESRM/21-282-------------------------------MLDR-----------DLADYAYY--------------------------
A1VQK9_POLNA/34-307-------------------------------ATGAA----------PFDALQVA--------------------------
Q2K8A9_RHIEC/46-316-------------------------------VLRTA----------PTAHARVA--------------------------
B2JW15_PARP8/32-305-------------------------------VTRFN----------PFDACRVA--------------------------
Q982X2_RHILO/42-307-------------------------------F-SRD----------LFEHLAVV--------------------------
HUTG_BACHD/35-311-------------------------------EEDL-----------DLAQLKLT--------------------------
HUTG_RHOJR/40-314-------------------------------LAE---------------PLRVY--------------------------
ARGI1_HUMAN/6-305---------------------------------E----------------CDVK--------------------------
SPEB_CHRVO/44-311-------------------------------W-GFD----------PFEDLAVV--------------------------
ARGI_BACSU/3-292---------------------------------G----------------YTVE--------------------------
Q97ZX8_SULSO/24-289-------------------------------RNDV-----------DMGEIGFN--------------------------
HUTG_VIBVY/45-328-------------------------------WHS---------------PHPLY--------------------------
A9BRG6_DELAS/16-312---------------------------------G----------------CQVS--------------------------
HUTG_AROAE/40-323-------------------------------WHG---------------EWPVY--------------------------
A1RB53_PAEAT/29-311-------------------------------RRT--------------DFA-AV--------------------------
Q1J2W9_DEIGD/37-306-------------------------------LSGRT----------RLADVTFA--------------------------
Q2JER0_FRACC/40-318-------------------------------DLGIE----------IFDWLDVV--------------------------
Q3J346_RHOS4/3-296---------------------------------G----------------HAVE--------------------------
A9B324_HERA2/22-290-------------------------------EFDTE----------PAKNWGVH--------------------------
Q9YBG0_AERPE/29-298-------------------------------YVEG-----------DIDRVPIA--------------------------
Q1GI44_RUEST/34-307-------------------------------ATGAA----------PFDALNIA--------------------------
Q9HJB2_THEAC/33-293-------------------------------SYRF-----------DLLRARIS--------------------------
A0RXD6_CENSY/22-283-------------------------------GLRA-----------DLEEVRID--------------------------
A8LLU9_DINSH/46-312-------------------------------W-GFD----------PLSEFTVV--------------------------
SPEB_BACHD/22-286-------------------------------YMDK-----------HLEEVAYF--------------------------
Q0W940_METAR/16-280-------------------------------DFGV-----------DLTDVPIH--------------------------
Q6MHV0_BDEBA/36-309-------------------------------TRMEN----------FFENLKVA--------------------------
Q98MW3_RHILO/19-296-------------------------------DLGGPL--------FNGKPASCV--------------------------
A0LG67_SYNFM/34-297-------------------------------ETCT-----------EAYRHGIA--------------------------
HUTG_BACSU/35-311-------------------------------ELGE-----------HVVSELLY--------------------------
Q9K5Y7_BACHD/5-297---------------------------------G----------------FEVK--------------------------
Q164F4_ROSDO/46-312-------------------------------W-PFD----------VLSEFAII--------------------------
Q164F5_ROSDO/34-308-------------------------------GTGAA----------PFDSLQVA--------------------------
Q15X44_PSEA6/42-323-------------------------------YQH---------------NVSLL--------------------------
Q11J67_CHESB/42-307-------------------------------F-HLD----------LFDTLAVV--------------------------
Q1AWJ4_RUBXD/5-295---------------------------------G----------------YRVS--------------------------
Q5WL42_BACSK/7-290-------------------------------VYNVEKRK----TFTLPKN-ALT--------------------------
Q7UZH9_PROMP/24-288-------------------------------RLGK-----------DLEDFNYV--------------------------
Q6CLB8_KLULA/137-438--------------------------------RGFPGSKL-RKLDPYHSGYKIV--------------------------
A0JT79_ARTS2/57-331-------------------------------AWDVS----------PFENVQVA--------------------------
Q2KVZ3_BORA1/13-287-------------------------------AQF----------------LRAV--------------------------
B2UBQ2_RALPJ/40-316-------------------------------ARA---------------GRVVV--------------------------
Q165U0_ROSDO/35-314-------------------------------EDDAT---------YLPADVRIV--------------------------
B1YHV3_EXIS2/22-286-------------------------------YLDG-----------DIADAKLF--------------------------
Q5WIT9_BACSK/27-306-------------------------------FEH----------------IRLG--------------------------
A1C610_ASPCL/68-380-------------------------------RAGIN---------PYSSWATVK--------------------------
Q1AS11_RUBXD/33-307-------------------------------SLGVT----------LFDHLSVI--------------------------
Q28QX8_JANSC/39-314-------------------------------STGQL----------PFQAANIA--------------------------
A1WGI6_VEREI/22-320---------------------------------G----------------LQSF--------------------------
A1WER7_VEREI/22-295-------------------------------ATRAA----------PFDALRVA--------------------------
A1T3A2_MYCVP/88-364-------------------------------REQ----------------LNMV--------------------------
A8LRL4_DINSH/4-296---------------------------------G----------------WQTE--------------------------
A5V551_SPHWW/4-298---------------------------------G----------------HEVS--------------------------
Q11NZ4_CYTH3/3-310---------------------------------V----------------LKQF--------------------------
Q5V4R8_HALMA/3-300---------------------------------G----------------IDCI--------------------------
Q12BY7_POLSJ/72-342-------------------------------ALGLA----------PVTRLKMA--------------------------
HUTG_VIBF1/45-345-------------------------------WHH---------------QSDVY--------------------------
Q3IVT5_RHOS4/32-308-------------------------------YRGHI---------NIFEVLRVA--------------------------
HUTG_GEOKA/44-315-------------------------------WHL-------------PEGVVVY--------------------------
SPEB_BLOFL/33-298-------------------------------W-NFD----------IRQKLKII--------------------------
A0ZFA2_NODSP/30-338-------------------------------DHPD------------GWKQGIFMMEIPQDICEKNEYYRTLAAKIIARL
A4XT95_PSEMY/38-311-------------------------------ATGAA----------PFDSLNVA--------------------------
Q5WB32_BACSK/22-286-------------------------------YADK-----------HLEEINYF--------------------------
Q6C6P6_YARLI/9-306---------------------------------D----------------WDTK--------------------------
Q12UU8_METBU/17-282-------------------------------FYDI-----------DISEIPAH--------------------------
Q213G1_RHOPB/11-309---------------------------------G----------------FVVE--------------------------
Q28PV5_JANSC/46-313-------------------------------WDGYS----------PLEALAIA--------------------------
A0QRD0_MYCS2/43-317-------------------------------ALDVS----------PFAQAQVV--------------------------
ARGI_NEUCR/47-354---------------------------------G----------------YRLH--------------------------
Q12LW8_SHEDO/33-299-------------------------------W-DFS----------LNQCIKIV--------------------------
Q2W8C1_MAGSA/22-290-------------------------------PAGWS----------DPAQMSIA--------------------------
GBU1_KLULA/61-358-------------------------------RADIN---------PYQDWASVV--------------------------
A1SLP1_NOCSJ/31-312-------------------------------ALRVD----------ALRDLRVV--------------------------
Q28VR8_JANSC/34-309-------------------------------EDDVT---------YLGPGTKII--------------------------
Q0UYW2_PHANO/16-320---------------------------------E----------------MNVS--------------------------
Y309_METJA/21-281-------------------------------ILDR-----------DLAELKYC--------------------------
Q9RZ04_DEIRA/29-298-------------------------------LDGKT----------RLQGVTFA--------------------------
ARGI_KLULA/13-315---------------------------------G----------------WETT--------------------------
A2BIW8_HYPBU/25-300-------------------------------RANL-----------DVENIGIS--------------------------
Q21RM0_RHOFT/15-309---------------------------------G----------------LDVK--------------------------
Q6L151_PICTO/19-280-------------------------------NYKY-----------NIPDAGIC--------------------------
A0A0D1DTD8_USTMA/13-318---------------------------------G----------------WKVD--------------------------
A1B165_PARDP/30-308-------------------------------DIGGTL--------YDGRDVRAV--------------------------
Q16AD8_ROSDO/4-296---------------------------------G----------------YVAE--------------------------
Q3SMM1_THIDA/8-294---------------------------------R----------------V--A--------------------------
A0A1D8PP00_CANAL/12-313---------------------------------G----------------WTTD--------------------------
Q7VSA1_BORPE/8-302---------------------------------G----------------LQVT--------------------------
A0BHR2_PARTE/9-311---------------------------------G----------------WEIN--------------------------
Q4JAE9_SULAC/24-287-------------------------------RTGI-----------DMGEIGFS--------------------------
Q975R8_SULTO/24-287-------------------------------RTGI-----------DMGEVGFN--------------------------
Q1LGD2_CUPMC/2-296---------------------------------G----------------LDVT--------------------------
ARGI_AGRFC/19-313---------------------------------G----------------WAVT--------------------------
Q1D421_MYXXD/27-337-------------------------------ETGR------------PYERGIAMLPEPQELRDWNTRAK---ERAQVVI
SPEB1_SCHPO/74-375-------------------------------PMETN---------PFNNWAKIV--------------------------
ARGI_YEAST/13-329---------------------------------G----------------WSTE--------------------------
A9BN56_DELAS/71-341-------------------------------VLRSA----------PTRELRVA--------------------------
A0A1D8PPP3_CANAL/50-340-------------------------------KALFD---------PYQSWARII--------------------------
A1RBR9_PAEAT/55-335-------------------------------ELDVE----------PVYEAQVV--------------------------
A1VTU0_POLNA/3-297---------------------------------G----------------LRVT--------------------------
Q0UMJ9_PHANO/68-378-------------------------------RANLN---------PYTSWASIV--------------------------
A1SM48_NOCSJ/41-314-------------------------------ALDVS----------PFAGVQVV--------------------------
Q1GI45_RUEST/67-333-------------------------------W-DIC----------PASELAIV--------------------------
Q1IHQ4_KORVE/16-311---------------------------------G----------------HVVE--------------------------
Q6L2W0_PICTO/21-293---------------------------------DHN---------VDLNSLKIL--------------------------
Q89H72_BRADU/11-308---------------------------------D----------------FEVV--------------------------
Q489X2_COLP3/36-310-------------------------------YTKAA----------PFDSFQIA--------------------------
Q7V9I4_PROMA/29-293-------------------------------QLNL-----------DLEDINFT--------------------------
SPEB1_SYNY3/26-297-------------------------------ELGTS----------PCHDLGIY--------------------------
Q6FP31_CANGA/10-317---------------------------------G----------------WGTE--------------------------
A5G414_GEOUR/41-319-------------------------------FDY----------------LKIG--------------------------
Q3SVS2_NITWN/5-302---------------------------------G----------------IDVL--------------------------
SPEB2_SCHPO/89-401-------------------------------SLNVN---------PYESWAKIL--------------------------
Q8XPR0_RALSO/29-309-------------------------------DIDGPL-------LQGRDDIRFV--------------------------
Q47TW8_THEFY/41-314-------------------------------GLDVS----------PFAEVQVA--------------------------
A9KQ98_LACP7/18-281-------------------------------YQEK-----------DLTDYQIF--------------------------
A1BCD2_PARDP/35-312-------------------------------VTGIA----------PYERLAVA--------------------------
ARGI_ASHGO/93-395---------------------------------G----------------WEIE--------------------------
A1B3P5_PARDP/3-295---------------------------------G----------------HTVE--------------------------
Q1QTM4_CHRSD/39-312-------------------------------ATRAA----------PFDSLQVA--------------------------
Q6C732_YARLI/86-381-------------------------------REGFM---------LYDDWAKFV--------------------------
A0LDK6_MAGMM/20-293-------------------------------LHGRE----------ILPELPTH--------------------------
Q47D78_DECAR/17-302---------------------------------P----------------L-VD--------------------------
Q3JAG2_NITOC/2-290---------------------------------G----------------MPVS--------------------------
A3DDA1_CLOTH/24-286-------------------------------YMDR-----------DLTQCSFF--------------------------
A1CKP4_ASPCL/16-320---------------------------------G----------------YDVH--------------------------
ARGI1_SCHPO/22-319---------------------------------G----------------YSVN--------------------------
HUTG_PHOLL/44-316-------------------------------SHK--------------GHDKLV--------------------------
A0A1U7EWX2_NATPD/45-332-------------------------------GYKGGLTNVRTEQQVSFSALDIV--------------------------
SPEB2_SYNY3/83-361-------------------------------REQ----------------ISLC--------------------------
Q5LKZ4_RUEPO/42-315-------------------------------ATGVN----------PFALVNCA--------------------------
Q2RHH4_MOOTA/26-287-------------------------------YLQR-----------ELTGVPFY--------------------------
Q17HI3_AEDAE/32-333-------------------------------STK----------------LDIR--------------------------
A3CU48_METMJ/19-276-------------------------------ATKI-----------DFSEVPIT--------------------------
HUTG_HAHCH/40-316-------------------------------WRL---------------THPVY--------------------------
Q8RA93_CALS4/28-290-------------------------------YLDR-----------RLEDKKIC--------------------------
Q8END5_OCEIH/29-310-------------------------------LQH----------------YSFG--------------------------
Q5ANN8_CANAL/115-414-------------------------------KRFNYPVN---PYDETTHNYSII--------------------------
Q2LPR8_SYNAS/65-343-------------------------------FDY----------------LTVA--------------------------
A1ST87_PSYIN/33-299-------------------------------W-KFN----------LLKKTKII--------------------------
ARGI1_ARATH/63-338-------------------------------KDP----------------RVLT--------------------------
A0R0G1_MYCS2/40-312-------------------------------ELDIA----------PFQVCQFA--------------------------
A1CFK4_ASPCL/83-374-------------------------------YTGEN---------VLEGWAKIV--------------------------
B8I5M8_CLOCE/21-282-------------------------------YFDA-----------DISDYKIH--------------------------
A1TIE4_ACIAC/8-305---------------------------------G----------------LEVE--------------------------
A1T9H7_MYCVP/46-324-------------------------------DLGLE----------IFDWLEVV--------------------------
Q97VA3_SULSO/30-299-------------------------------FLDTY----------PFDKLNAC--------------------------
Q4J720_SULAC/30-299-------------------------------FLDTY----------PFDKLNAC--------------------------
Q3J2B4_RHOS4/46-312-------------------------------W-GFD----------PLEELTVV--------------------------
A1CGK0_ASPCL/61-357-------------------------------VWGVD---------PFEEELSIV--------------------------
Q10Y47_TRIEI/24-296-------------------------------ELDRE----------TGLEVGIY--------------------------
A5G278_ACICJ/28-297-------------------------------PHYRV----------MVDDMDLA--------------------------
ARGI_SOYBN/71-346-------------------------------KDL----------------RIMV--------------------------
O76895_DROME/30-333-------------------------------HDG----------------LVIR--------------------------
A1W2M6_ACISJ/2-298---------------------------------G----------------FDVR--------------------------
Q1GHG8_RUEST/4-296---------------------------------G----------------HTVE--------------------------
Q65P52_BACLD/4-300---------------------------------C----------------QDIE--------------------------
Q67TJ0_SYMTH/28-290-------------------------------HSRM-----------SLTDKNFF--------------------------
A4XZN2_PSEMY/43-309-------------------------------W-EFD----------PFDVLACV--------------------------
A4YE21_METS5/29-295-------------------------------FQKVY----------PLDELSAC--------------------------
Q6ANF4_DESPS/59-334-------------------------------VLDVD----------IFEECSGV--------------------------
Q222F3_RHOFT/24-298-------------------------------FFGVS----------PIGH--LG--------------------------
ARGI2_MOUSE/24-324---------------------------------G----------------CHLK--------------------------
Q315M1_DESAG/23-287-------------------------------GLSD------------PSRLGLF--------------------------
A7IL28_XANP2/50-316-------------------------------F-GID----------PFETLDVV--------------------------
Q18A84_PEPD6/21-285-------------------------------FLDL-----------DLEDYNIC--------------------------
Q5V6R7_HALMA/44-335-------------------------------ETGID----------PFDTFSVA--------------------------
Q5LRK8_RUEPO/33-325---------------------------------G----------------HRVE--------------------------
Q9K8M2_BACHD/4-296---------------------------------G----------------YHVD--------------------------
Q3ABP1_CARHZ/20-281-------------------------------DLEK-----------SLNDVNFY--------------------------
A9CJC2_AGRFC/42-307-------------------------------F-ARD----------LFAHMPTI--------------------------
Q7U3K9_SYNPX/21-280-------------------------------QLDL-----------DLEDLAYA--------------------------
A1STQ5_PSYIN/47-343-------------------------------WHHQ-----------TDSGASFY--------------------------
Q7VY32_BORPE/13-287-------------------------------VEF----------------LRLL--------------------------
Q9CL61_PASMU/34-299-------------------------------W-DFD----------VRERLKIV--------------------------
A4IB49_LEIIN/14-315-------------------------------RLERVFD------GKAVEARKAS--------------------------
A5UXL8_ROSS1/34-305-------------------------------ELDVH----------VFATLSCI--------------------------
A9WCM8_CHLAA/41-307------------------------------------------------QHLTIC--------------------------
B4EIP8_BURCJ/49-320-------------------------------ATRAA----------PFDSLQIA--------------------------
B4ELX2_BURCJ/44-308---------------------------------NP------------FDDLAVV--------------------------
B5GLC8_STRC2/31-301-------------------------------DRGPG----------TFDLINCV--------------------------
B9A9C6_BOMMO/12-304------------------------------------------------DGLDVK--------------------------
C0ZIM2_BREBN/4-293-------------------------------KMG----------------FNIE--------------------------
D0J7J2_COMT2/7-302-------------------------------RLG----------------VQVS--------------------------
D5AV62_RHOCB/6-296-------------------------------ALG----------------WRIE--------------------------
D5SKW9_STRC2/134-404-------------------------------DRGPG----------VFDRIDVV--------------------------
E3GWR7_METFV/23-279-------------------------------KLD----------------VPII--------------------------
E9CYX8_COCPS/18-317-------------------------------RHD----------------GQVH--------------------------
F1QJZ3_DANRE/86-357-------------------------------WTRAA----------PYESIKVA--------------------------
F6SZP1_XENTR/61-332-------------------------------STRAA----------PFESLMVA--------------------------
A0A0D8JTR5_COCIM/78-370-------------------------------YSGVN---------NLRSWAKIV--------------------------
K5X448_AGABU/13-305-------------------------------VFD--------------GHHQFE--------------------------
SPEB_NEIMB/35-299-------------------------------TFDV------------RERLNII--------------------------
Q05AR1_XENTR/27-324---------------------------------G----------------CNVC--------------------------
Q24ZK6_DESHY/5-295-------------------------------KLG----------------WEVE--------------------------
Q251M0_DESHY/26-286-------------------------------YLDK-----------DLSDYAYC--------------------------
Q2FW91_STAA8/6-296---------------------------------D----------------LDVY--------------------------
Q2K3I8_RHIEC/7-299-------------------------------ADN--------------GDLGIV--------------------------
Q2K9W6_RHIEC/65-328-------------------------------NRDL------------FADMAVI--------------------------
Q3IKA3_PSEHT/33-297-------------------------------TFPL------------FEHLKVA--------------------------
Q46IA1_PROMT/31-292---------------------------------DL-----------DLEDINFT--------------------------
Q4FL05_PELUB/40-312-------------------------------SYDVE----------PFKVQQVA--------------------------
Q5KIC1_CRYNJ/70-373-------------------------------RLEVN---------PYSGDLSIL--------------------------
Q5L3P6_GEOKA/3-294-------------------------------RLH----------------YDIE--------------------------
HUTG_LEGPH/47-315--------------------------------------------------KHYV--------------------------
Q6LHE2_PHOPR/35-321---------------------------------G-------------SPSFPLY--------------------------
Q6LWW9_METMP/19-277---------------------------------D-------------LIDVKIC--------------------------
Q6N0N3_RHOPA/14-309--------------------------------LG----------------FAVE--------------------------
Q6PH54_DANRE/25-322---------------------------------D----------------YPVH--------------------------
Q72EZ7_DESVH/23-282-------------------------------WDGLS----------IPAAQGIH--------------------------
Q7V3X2_PROMM/30-287---------------------------------DL-----------DLEDLAFT--------------------------
SPEB_BACAN/23-284-------------------------------YLDR-----------ELEEVKYF--------------------------
Q81VP0_BACAN/4-292---------------------------------G----------------YDVK--------------------------
Q81Y48_BACAN/37-311-------------------------------EHD-------------MKESVLY--------------------------
Q82VE5_NITEU/46-310---------------------------------DP------------FEHLAVI--------------------------
HUTG_VIBPA/47-325--------------------------------HK---------------DAPLY--------------------------
Q88KU3_PSEPK/34-298-------------------------------AFDP------------FDHLAVI--------------------------
Q8RG18_FUSNN/503-779---------------------------------I-------------SVERQKE--------------------------
Q8TJ04_METAC/18-281-------------------------------DLV---------------DLPIY--------------------------
Q8XMY7_CLOPE/21-278-------------------------------YQDL-----------DLYDFNIF--------------------------
Q92LN4_RHIME/3-295-------------------------------ELG----------------HTVN--------------------------
Q92MV8_RHIME/71-339-------------------------------VLGCA----------PVHDLRVA--------------------------
Q92QR6_RHIME/44-306-------------------------------QRDL------------FADMATI--------------------------
GPUA_PSEAE/36-307---------------------------------RIA----------PYDLVRVG--------------------------
Q9KLD2_VIBCH/33-297-------------------------------DFNL------------FKKINVI--------------------------
HUTG_VIBCH/44-322--------------------------------HP----------------IPIY--------------------------
U5L6E1_9BACI/3-293-------------------------------FE------------------HIH--------------------------
U5LEA0_9BACI/39-314-------------------------------DEDI-----------DLTSLTAA--------------------------

PF00850

Q5K8L3_CRYNJ/30-447--------------------------DRDPNDPTHLPS--SPSSSASSPRPAKIA-------------------------
HDAC4_HUMAN/675-992-------------------------------GTNPLNR--QKLDSKKLLGSLASVFVR----------------------
A0DIS2_PARTE/35-343-------------------------------EGLFNAV--GNEQ-----LTK--DV------------------------
A0LGT0_SYNFM/21-313-------------------------------EEACLLE--MGE-----------F-------------------------
A1W7T1_ACISJ/39-355-------------------------------ASAWQQW--VSLG-----EGQDRVQPFPSVWPVRTL----RSDIEPDNF
A2BL29_HYPBU/22-314-------------------------------EELAGRG--GGYI------------------------------------
A3DNS7_STAMF/22-312-------------------------------MKCRNNA--PCQI------------------------------------
A3GH68_PICST/31-340--------------------------RLDRTVTSL-AS--NHDTINDEISISESQR------------------------
A4S2N1_OSTLU/203-605-------------------------------AELSDRV--GQTPIAFTPYCQNHNGVPEKLQ---------------KPA
A4S898_OSTLU/34-312-------------------------------RASALDA--KREREIGLPW------------------------------
A4X4X7_SALTO/21-317-------------------------------RNA-----------PQDPFFTGFGL------------------------
A4YNH4_BRASO/59-370-------------------------------EEAWDAW--AALS-----DAGSEMIPNMHPVRNAA-------TYPTHIV
A6QAF4_SULNB/20-301-------------------------------REASQQN--RS--------------------------------------
A6R4B6_AJECN/60-359-------------------------------QT---VI--PSDMENTALNDRMAGF------------------------
A6VSZ5_MARMS/20-304-------------------------------FARAPEE--GHVE----------L-------------------------
A7SSG8_NEMVE/31-332-------------------------------KSTQ-DM--KPRD-----LFN--LG------------------------
A7SUP8_NEMVE/33-329-------------------------------RRAAEAV--SDGSEECEDLVE--F-------------------------
A7TRW5_VANPO/20-403YIRDWLDSHPEEVPTSGMIEKRAGLLEFYKKY---NRF--KKKRSISEA-FSESESESESGSGSGSEANEYFQINNSRER
A8ABS4_IGNH4/20-308-------------------------------KRVIEAG--GGYL------------------------------------
A8ZT95_DESOH/22-309-------------------------------LKTAEHK----------------IT------------------------
A9A062_DESOH/265-572-------------------------------QAACASV--PENE-----SIYPYVFPIRNSTRP----------PKSLPM
A9B5I1_HERA2/19-308-------------------------------QRMAQF---GDW-----------A-------------------------
B0T7F0_CAUSK/36-327-------------------------------KIMSGFP--TGGE------------------------------------
B2JV93_PARP8/21-308-------------------------------AESAPSH--GYMP----------L-------------------------
B4U8T2_HYDS0/19-303-------------------------------YEFCKKG--GGY-----------L-------------------------
C5KDG6_PERM5/349-869-------------------------------VSIDNYL--QQQVELKDKPLEEIADSELPVVDL-----------CSKRC
E0TF48_PARBH/17-291-------------------------------REGTIDP--RAMRRIGFPW------------------------------
E2RU63_GIAIC/23-319-------------------------------KNITPET--LSKFQDLA------KR------------------------
O67135_AQUAE/21-313-------------------------------MEAERCQ------CVPKGAREKYNI------------------------
HDA1_YEAST/83-394-------------------------------ESTE-KM--SREE-----LLK--ET------------------------
Q02CA3_SOLUE/20-310-------------------------------RSDVAS-----G------RPY--L-------------------------
Q0A6Z7_ALKEH/48-335-------------------------------YALRGKH--AW------------L-------------------------
Q0ARF0_MARMM/20-307-------------------------------LTACADA--PAGQWLALDPD-----------------------------
Q15WQ0_PSEA6/26-300-------------------------------TRGMLDP--KAMRRIGFPW------------------------------
Q1CZX8_MYXXD/27-313-------------------------------QRINGHR--AQ------------I-------------------------
HDA6_CAEEL/446-747-------------------------------RTTETMK--DEEL-----MEE--AE------------------------
Q29CG7_DROPS/39-325-------------------------------RWSLNVA--RIAEVSLMAFV-----------------------------
Q2FQW8_METHJ/20-310-------------------------------EEASVNG--AII-------------------------------------
Q2IF50_ANADE/22-318-------------------------------RGHVEAA--ARTG-----M----LD------------------------
Q2KBQ8_RHIEC/20-308-------------------------------MREIPEEEDGINQ----------L-------------------------
Q2LVD3_SYNAS/21-310-------------------------------ASTARME--YSC-----------L-------------------------
Q2R9B1_ORYSJ/38-341-------------------------------RD---LT--PESYFNDAALRQKAEDD-----------------------
Q2S035_SALRD/19-312-------------------------------EAASDG-------TPP-PEARAFGL------------------------
Q2SC27_HAHCH/22-314-------------------------------SHSAAIS--RVVENSLLKWL-----------------------------
Q30PJ4_SULDN/264-571-------------------------------RRACEII--EPGK-----SIYPIVFPLRNMARP----------PKDIEL
Q31EP6_HYDCU/54-346-------------------------------EILSDSG--GGF-----------YE------------------------
Q31HC2_HYDCU/19-303-------------------------------KKHLPEN--GFVK----------I-------------------------
Q38C74_TRYB2/31-322----------------------------------------GLHSNRSWLWNTEVSK------------------------
Q39UV4_GEOMG/22-314-------------------------------REFSDS-------D-EPRADFRYGL------------------------
Q3AFN8_CARHZ/22-318-------------------------------MNL-SK-------NPENVNGSRFGL------------------------
Q4D762_TRYCC/59-387-------------------------------SIREALS--EVDERASTVKRSRAEGIQPPVSRRSSAQTQPPLRVLPDLV
Q4FNF7_PELUB/20-305-------------------------------EKSFPEK----G------LSF--L-------------------------
Q4KAJ1_PSEF5/25-339-------------------------------ENAWSEW--TATG-----RSHDALPLVWPVRDLAN-------QQVPEFI
Q4MYQ3_THEPA/32-415-------------------------------SFWTGQL--SKLN-----SSSKGKRAYTSSK---------------KFQ
Q4QAJ4_LEIMA/102-403-------------------------------RQAPVIC--GNPLDEMSLAFQKEFDV-----------------------
Q4QI60_LEIMA/65-431-------------------------------KDSSSGS--DLGRAVPLISAANRSQWIPARLATYDEVCSFQDPQVYEHF
HDA21_DICDI/1078-1485-------------------------------EDLTEKL--DANEIRPLNVNNDGASTGINQFSTSTPITTTGTATVTPGS
Q5KKR8_CRYNJ/39-367-------------------------------ES---VL--PENA--DALTGNRSRG------------------------
Q60DG7_ORYSJ/56-349-------------------------------VQANAVG--AKK-------------------------------------
Q6AJC0_DESPS/25-317-------------------------------EEAVLFG--KSH-----------I-------------------------
Q6AKN4_DESPS/22-310-------------------------------REHALKS--NPFS----------Y-------------------------
Q6C3Y5_YARLI/64-351-------------------------------LKKGQSE--KTL-----------DK------------------------
Q6CGA7_YARLI/268-647-------------------------------EKLCLES--KDKLEAGQLELPPGW-------------------------
Q6FWB7_CANGA/19-382AW---NDITTSNEASKPDFKTYSELLHYYRDHIEVSEH--NKKRTALEAELSDVESGDEVT----------------RRS
Q741C0_MYCPA/20-306-------------------------------EAARPQH--GYVY----------L-------------------------
Q7PS30_ANOGA/126-423-------------------------------AQTHGSQ--DEPE-----LER--LS------------------------
Q8EP92_OCEIH/22-320-------------------------------KRAGSG-------EITEESALEYGI------------------------
Q8I4I9_CAEEL/27-317-------------------------------VSLNSTE--KCEE----------Y-------------------------
Q8IR37_DROME/563-860-------------------------------RRLL-GR--EPKE-----LHD--AA------------------------
HDA14_ARATH/80-386-------------------------------EKAMDEA--SDSG-----LIFI-E-------------------------
Q9K0J2_NEIMB/41-327-------------------------------ESCLPQK--GK------------IS------------------------
Q9U266_CAEEL/26-318-------------------------------KSTETMT--VEQQ-----ES---FC------------------------
G4VAN3_SCHMA/18-356-------------------------------KKLQMLH--CEEKELTADDELLMDS------------------------
K3ZRV5_SETIT/232-519-------------------------------EQTKNML--YSYF------------------------------------
Q22CW6_TETTS/28-319-------------------------------EQMWPEG--CEKENMVL--------------------------------
Q2G292_STAA8/25-322-------------------------------KHASHGI--ISEDEAKKYGL-----------------------------
Q8F7M9_LEPIN/22-309-------------------------------ENSKGKR--GYF-------------------------------------
V6EZA3_9PROT/20-307-------------------------------LSSVPEP--GEFF-----H---I--------------------------
W7X9B2_TETTS/39-342-------------------------------EGMWPEK--TKKKEIY---------------------------------

PF12640

B4E7R4_BURCJ/13-201---------------I----------------------------------------------------------------
A8MKG9_ALKOO/16-197---------------I----------------------------------------------------------------
Q12VI5_METBU/19-180---------------L----------------------------------------------------------------
Q1CZJ9_MYXXD/103-253---------------A----------------------------------------------------------------
Q6ARQ8_DESPS/48-185---------------V----------------------------------------------------------------
C6C1I6_DESAD/28-165---------------I----------------------------------------------------------------
C5KCK7_PERM5/16-196---------------V----------------------------------------------------------------
B7FS57_PHATC/11-216---------------V----------------------------------------------------------------
C3XU32_BRAFL/3-238---------------N----------------------------------------------------------------
CE022_DANRE/15-248---------------V----------------------------------------------------------------
Q1RMV5_BOVIN/19-257---------------V----------------------------------------------------------------
A7UTP5_ANOGA/103-265---------------I----------------------------------------------------------------
B3M7P2_DROAN/118-284---------------V----------------------------------------------------------------
B4N4R0_DROWI/108-274---------------V----------------------------------------------------------------
A7SLH9_NEMVE/10-251---------------V----------------------------------------------------------------
B7PMV1_IXOSC/7-174---------------V----------------------------------------------------------------
A9VAD6_MONBE/67-213---------------E----------------------------------------------------------------
A6UX51_META3/57-190---------------G----------------------------------------------------------------
D0MD43_RHOM4/57-211---------------G----------------------------------------------------------------

PF00491

E7F8R4_DANRE/27-322----------DYGN-V--------TFENLPNDE------------SIGRLKTP--RAVG-----R-A------NELLSGA
SPEB3_SCHPO/85-387----------DCGD-I--------PVT---------------------------TYDIL-----K-A------MDQLESA
Q6BJQ5_DEBHA/76-370----------DCGD-M--------PVT-------------------------P--MDNS-----L-A------FKQMNKG
Q6BVQ4_DEBHA/136-428----------DCGD-P--------PMT-------------------------P--IDNR-----I-A------LDQLYRA
Q6BWL4_DEBHA/179-480----------DCGD-V--------PMT-------------------------P--FDNR-----I-A------LNQLYRG
A1RXI5_THEPD/26-288----------DAGD-L--------PVL-------------------------T---SVE-----A-L------IDILGGV
SPEB_MOUSE/77-350----------DLGN-V--------NVN-------------------------L--YNLQ-----D-S------CLLIREA
A4XKN0_CALS8/20-281----------DMGD-L--------ELP-------------------------F--GNVG-----K-S------IDIIYEF
A4J1T2_DESRM/21-282----------DAGD-V--------AIP-------------------------F--GHVL-----E-S------LERISKV
A1VQK9_POLNA/34-307----------DLGD-V--------PIN-------------------------T--YNLH-----K-S------VEIIEQH
Q2K8A9_RHIEC/46-316----------DVGD-V--------PFK-------------------------S-RFDLA-----A-S------HDDIEKF
B2JW15_PARP8/32-305----------DIGD-V--------PFT-------------------------D-LYHLE-----R-A------HDDIRRF
Q982X2_RHILO/42-307----------DYGD-C--------LLD-------------------------S--GNHQ-----K-T------PGTIERE
HUTG_BACHD/35-311----------DLGD-I--------TMH-------------------------V--TDIV-----G-S------QARIEET
HUTG_RHOJR/40-314----------DAGT-V--------AVT-----------------------------DNR--------------LEAGQMA
ARGI1_HUMAN/6-305----------DYGD-L--------PFADIPND---------------SPFQIV---KNP-----RSVG---KASEQLAGK
SPEB_CHRVO/44-311----------DYGD-C--------WFD-------------------------A--HNPL-----T-I------KPSIIEH
ARGI_BACSU/3-292----------DLGD-I--------PINREKI----------------KNDEEL---KNL-----NSVL---AGNEKLAQK
Q97ZX8_SULSO/24-289----------DVGD-I--------ILH-------------------------P--SNVE-----E-N------LSRISSV
HUTG_VIBVY/45-328----------DLGT-V--------VCD-----------------------------DDL--------------LESSQQH
A9BRG6_DELAS/16-312----------DIGN-L--------AGPPNPQT---------------PPEQGL---RHL-----APAR---AWMDAVHQA
HUTG_AROAE/40-323----------DAGD-AGDVGASTHDAG-----------------------------EQT--------------LETMQGD
A1RB53_PAEAT/29-311----------DLGDIV----------------------------------------PVG-----SSAQ---EVADEIGSV
Q1J2W9_DEIGD/37-306----------DAGD-V--------VLP-------------------------S--LEPE-----L-A------RERITQT
Q2JER0_FRACC/40-318----------DAGD-A--------HCP-------------------------H--GLTE-----A-S------HRNIRAK
Q3J346_RHOS4/3-296----------DRGD-V--------ALGPLPEM--------------TPPEGPV---HDL-----PETI---GWTAALKTA
A9B324_HERA2/22-290----------TLPS-V--------EVN-------------------------D--QDPD-----S-A------MQSIAQA
Q9YBG0_AERPE/29-298----------DEGD-V--------AAV-------------------------P--GSTL-----L-T------LERVARV
Q1GI44_RUEST/34-307----------DIGD-L--------AIN-------------------------T--FNLA-----E-S------LRIIEDS
Q9HJB2_THEAC/33-293----------DLGD-M--------EE--------------------------S--EDVE-----Y-V------VDQVDRV
A0RXD6_CENSY/22-283----------DLGN-A--------KH--------------------------T--VSPD-----V-M------VEMVGRI
A8LLU9_DINSH/46-312----------DYGD-L--------AFD-------------------------Y--GRAA-----G-F------PAALEAH
SPEB_BACHD/22-286----------DAGD-M--------LLP-------------------------F--GNPQ-----R-S------LEMIESY
Q0W940_METAR/16-280----------DMGN-C--------DT--------------------------Y--ASIE-----D-T------LLEVYQT
Q6MHV0_BDEBA/36-309----------DIGD-C--------PTV-------------------------P--IDQK-----Q-T------YEKIEKF
Q98MW3_RHILO/19-296----------DAGD-I--------STI-------------------------L--HDNA-----E-N------RVRIEAK
A0LG67_SYNFM/34-297----------TLEE-L--------PVV-------------------------V--SSPR-----D-M------LDSVRVV
HUTG_BACSU/35-311----------DLGD-I--------DIH-------------------------V--TDIV-----K-S------HHHIFQT
Q9K5Y7_BACHD/5-297----------DYGD-I--------PINRPATS--------------ETQEGPL---RNL-----DEVV---KVSEELCKG
Q164F4_ROSDO/46-312----------DYGD-L--------AFD-------------------------Y--GNVA-----A-F------PETLKAH
Q164F5_ROSDO/34-308----------DIGD-L--------AIN-------------------------T--FSLA-----K-S------LKIIEES
Q15X44_PSEA6/42-323----------DKGD-V--------VAN-----------------------------EC---------------LDSCQQN
Q11J67_CHESB/42-307----------DYGD-C--------LLD-------------------------Y--GRHD-----L-T------PAAIETE
Q1AWJ4_RUBXD/5-295----------DLGN-V--------EVPIPEAA--------------SGGDGKA---WRL-----RAVR---EVCSAVSRR
Q5WL42_BACSK/7-290----------DYGN-I--------EIA-------------------------A--YSTD-----Q-T------FAQAEAK
Q7UZH9_PROMP/24-288----------DFGS-L--------EID-------------------------K--NDSI-----S-V------IKAVKSA
Q6CLB8_KLULA/137-438----------DCGD-I--------PMT-------------------------P--FDNK-----L-A------LNQLYRG
A0JT79_ARTS2/57-331----------DAGD-M--------AVN-------------------------P--FNIN-----E-A------IETIQQN
Q2KVZ3_BORA1/13-287----------DAGNVV----------------------------------------CWP-----GDPE---RSYPVIETA
B2UBQ2_RALPJ/40-316----------DAGD-V--------TCQ-----------------------------GDA--------------LEDAQSE
Q165U0_ROSDO/35-314----------DMGD-A--------DIV-------------------------H--TATE-----K-S------HDNIETG
B1YHV3_EXIS2/22-286----------DAGD-I--------PLP-------------------------F--GNAQ-----K-S------LDMIEEY
Q5WIT9_BACSK/27-306----------DAGD-V--------DV------------------------------VPA-----D-VD---ETMRRIERF
A1C610_ASPCL/68-380----------DCGD-I--------PIT-------------------------P--FDNG-----L-A------ERQMYEA
Q1AS11_RUBXD/33-307----------DYGD-V--------PVV-------------------------P--GYIE-----E-S------YARIEEG
Q28QX8_JANSC/39-314----------DLGD-V--------AMS-------------------------P--VDQD-----E-A------LRDAQAF
A1WGI6_VEREI/22-320----------DRGN-L--------SGPANPWQ---------------APVQGY---RHL-----PEVV---QWNQRVFDA
A1WER7_VEREI/22-295----------DLGD-V--------AIN-------------------------P--YNLI-----D-S------IARIERA
A1T3A2_MYCVP/88-364----------DIGDVF----------------------------------------TIP-----GNLE---KSFDQISQA
A8LRL4_DINSH/4-296----------DRGN-L--------PGPTWVAD---------------TPPGEL---HAL-----SETI---TWTRLLSEA
A5V551_SPHWW/4-298----------DHGD-V--------APMRADDV---------------SLEGHA---RHA-----AHIA---GWARALDEA
Q11NZ4_CYTH3/3-310----------SKKT-L--------SSFPEKRGE-------------TGPYVQG---KYA-----KLLS---ELNNNTAKE
Q5V4R8_HALMA/3-300----------DGGD-I--------AVPRPEERDPD---------AGGLDSGRA---KFF-----RETK---EVCEDVTTA
Q12BY7_POLSJ/72-342----------DVGD-V--------PMR-------------------------S-RFSLD-----E-C------HADIEAC
HUTG_VIBF1/45-345----------DGGD-I--------QCN-----------------------------DGD--------------LELAQKQ
Q3IVT5_RHOS4/32-308----------DAGD-A--------TCV-------------------------P--GYEI-----E-S------LAALERA
HUTG_GEOKA/44-315----------DAGD-V--------VCI-----------------------------DER--------------LEQSQTE
SPEB_BLOFL/33-298----------DCGD-L--------IYK-------------------------S--GNVQ-----D-F------TNILQKH
A0ZFA2_NODSP/30-338AQGEQLTATPDLTP-V--------LTA-------------------------I-NQAGE-----Q-V------NQWLFTQ
A4XT95_PSEMY/38-311----------DIGD-V--------AIN-------------------------T--FNLL-----D-A------VRIIEEA
Q5WB32_BACSK/22-286----------DAGD-I--------PLP-------------------------F--GNAA-----R-S------LDIVEEY
Q6C6P6_YARLI/9-306----------FDGH-L--------EFPVPESD---------------EDIGKM---KRP-----RYVA---EASRRVYKA
Q12UU8_METBU/17-282----------DAGN-F--------EA--------------------------G--ALVD-----D-V------LDELYLD
Q213G1_RHOPB/11-309----------DHGDLL--------PTPPIDDAD-------------EALPANA---RQY-----RQIQ---GWVRALSAR
Q28PV5_JANSC/46-313----------DYGD-M--------AFD-------------------------Y--AHTA-----D-V------PERIEAH
A0QRD0_MYCS2/43-317----------DAGD-L--------GVN-------------------------P--FNID-----E-A------VGQIRDG
ARGI_NEUCR/47-354----------GDDE-V--------HLYTDLVPK------------EDPPHRNM---KNP-----RAVS---NVTKRIAEQ
Q12LW8_SHEDO/33-299----------DAGD-L--------VFN-------------------------C--GDQE-----D-F------TTRLEAF
Q2W8C1_MAGSA/22-290----------DLGD-F--------SLA-------------------------L--GDIP-----R-S------LEMIEQQ
GBU1_KLULA/61-358----------DCGD-V--------PVT-------------------------P--MDNC-----L-A------LKMMTAA
A1SLP1_NOCSJ/31-312----------DAGD-V--------EMP-------------------------P--GDIT-----R-A------LGNLEEA
Q28VR8_JANSC/34-309----------DMGD-A--------DII-------------------------H--TQTE-----A-S------HANIETG
Q0UYW2_PHANO/16-320----------YDGT-V--------HNYSELLPS------------DDPDYRGM---KRP-----KFAS---AVTQSVSAQ
Y309_METJA/21-281----------DLKD-L--------DL--------------------------Y--GSQE-----E-I------FGTIHSV
Q9RZ04_DEIRA/29-298----------DAGD-V--------ILP-------------------------S--LEPQ-----L-A------HDRITEA
ARGI_KLULA/13-315----------LEEP-L--------KGRDFESGKN----------DETDVYGIM---KRP-----NLVG---EATKLIYES
A2BIW8_HYPBU/25-300----------DLGD-I--------AV--------------------------S--SQPL-----E-T------LQRIEQV
Q21RM0_RHOFT/15-309----------DCGN-L--------HGPANPWL---------------QAVNGF---RHL-----PQVV---QWNQLLHEA
Q6L151_PICTO/19-280----------DLGD-L--------PV--------------------------Y--EDVE-----Y-V------LSEVETV
A0A0D1DTD8_USTMA/13-318----------FTDH----------HSFDHINQGI----------DSDTDIGNM---KLP-----RTVS---AVTKEVAEV
A1B165_PARDP/30-308----------DCGD-V--------TGD-------------------------P--VDPK-----A-H------SRNAEEA
Q16AD8_ROSDO/4-296----------DRGN-I--------SPGAFTPD---------------THDGRL---YAL-----NETI---AWTRSLKEA
Q3SMM1_THIDA/8-294----------WDAI-L--------RVPRM---------------------PPQ---AAL-----IAVS---ALNRKLAEK
A0A1D8PP00_CANAL/12-313----------LKEP-L--------EGTDYEKMKT-----------NDKDDFGV---KNS-----KIVS---ESCQKIHDA
Q7VSA1_BORPE/8-302----------DRGN-L--------QGAPNPWR---------------PPANGY---RHL-----NEVI---GWNQLVHDA
A0BHR2_PARTE/9-311----------DMGD-I--------QGKNYRLH--------------NVKSQQF---RNS-----QQIG---VINGEINKK
Q4JAE9_SULAC/24-287----------DVGD-I--------VMH-------------------------P--SNVE-----E-N------IKRIKDV
Q975R8_SULTO/24-287----------DVGD-V--------VMH-------------------------P--SDVE-----E-N------IRRISDV
Q1LGD2_CUPMC/2-296----------DLGN-L--------VGPGNPNL---------------PPTDGV---RHL-----PEVV---AWNRLVMDA
ARGI_AGRFC/19-313----------DLGD-A--------TPTVEPEL--------------SHPNSAV---KNL-----DALV---GWTRSLSQK
Q1D421_MYXXD/27-337EAGGIHSGEAALIQ-A--------AQD-------------------------V-NVLCD-----Q-M------NEHVYRT
SPEB1_SCHPO/74-375----------DCGD-I--------PLT-------------------------S--YDNA-----V-A------IKQIENG
ARGI_YEAST/13-329----------LEPS-M--------DEAQFVGKLKMEKDSTTGGSSVMIDGVKA---KRA-----DLVG---EATKLVYNS
A9BN56_DELAS/71-341----------DIGD-V--------PLS-------------------------S-RYSLE-----Q-S------HRDIESI
A0A1D8PPP3_CANAL/50-340----------DCGD-I--------PVT-------------------------P--MDNS-----A-A------YKQMSEA
A1RBR9_PAEAT/55-335----------DAGD-I--------ACT-------------------------P--YDIT-----R-A------VREIEEQ
A1VTU0_POLNA/3-297----------DRGN-I--------NGPANPWQ---------------APVSGY---RHL-----AEVA---AWNHAVHKE
Q0UMJ9_PHANO/68-378----------DCGD-I--------PVT-------------------------P--FDNA-----L-A------LRQMSEA
A1SM48_NOCSJ/41-314----------DAGD-I--------AAN-------------------------P--FSIE-----D-G------LEQIEAG
Q1GI45_RUEST/67-333----------DYGD-L--------AFD-------------------------Y--ANVP-----A-F------PDTLTDH
Q1IHQ4_KORVE/16-311----------DGGN-V--------SVPLAETK--------------DPGPHSA---KYL-----SEIA---QTCQKHADL
Q6L2W0_PICTO/21-293----------DAGN-I--------DV--------------------------N---FID-----Y-N------IEKIKDD
Q89H72_BRADU/11-308----------DYGD-L--------SVAEVRDLA-------------DRPPEKA---NHY-----REIQ---RWTRVLSRR
Q489X2_COLP3/36-310----------DIGD-T--------PIN-------------------------T--FNLA-----D-S------IRIIEAH
Q7V9I4_PROMA/29-293----------DFGN-L--------EIN-------------------------F--GAPE-----P-V------IKKVKTA
SPEB1_SYNY3/26-297----------TCAP-L--------ADSN----------------------KHP-ALAGD-----A-M------VTEVCDG
Q6FP31_CANGA/10-317----------IQSP-L--------DEEEYVKKVKE---------NTQDQFGII---KRP-----QLVG---EATELIYKS
A5G414_GEOUR/41-319----------DIGD-V--------PV------------------------------NPN-----D-EL---ATMKNVYET
Q3SVS2_NITWN/5-302----------DHGD-I--------ALAGVAPAT-------------DAIPAKA---NNY-----RDIQ---TWIRALSPR
SPEB2_SCHPO/89-401----------DCGD-I--------PVS-------------------------S--YDNQ-----L-A------VRQMTEG
Q8XPR0_RALSO/29-309----------DCGD-I--------VPD-------------------------L--AQPP-----GEH------YARAEAA
Q47TW8_THEFY/41-314----------DGGD-I--------AVN-------------------------P--FAIK-----E-A------IATVEAS
A9KQ98_LACP7/18-281----------DGGD-L--------ELP-------------------------F--GDPV-----R-P------LSLIEEF
A1BCD2_PARDP/35-312----------DIGD-L--------VVQ-------------------------P--IDLM-----A-A------LRQIEDG
ARGI_ASHGO/93-395----------VQRP-L--------DGHDFEERKQ----------RATEVVGRA---KNP-----TLVG---EATHLIHDA
A1B3P5_PARDP/3-295----------DRGD-L--------SPAPGRGQ--------------ACANPAV---HHL-----PEII---AWTEALRAS
Q1QTM4_CHRSD/39-312----------DIGD-V--------PIN-------------------------T--FDLK-----K-S------IGIIENF
Q6C732_YARLI/86-381----------DCGD-V--------AMH-------------------------P--LDNR-----Y-A------LNQLYRG
A0LDK6_MAGMM/20-293----------TLQP-P--------SLE-------------------------N--LNPE-----Q-V------VQRIYAT
Q47D78_DECAR/17-302----------WGKT-L--------FAPDNDG----------------TSTTAR-------------IA---ELCRHLADE
Q3JAG2_NITOC/2-290----------WEIT-I--------QPQES---------------------QDD---NAV-----MAVQ---ALSVELSQV
A3DDA1_CLOTH/24-286----------DAGD-L--------DLP-------------------------F--GDVD-----K-S------LKLIGDV
A1CKP4_ASPCL/16-320----------YDDT-V--------HFYENLTPM------------NDPDHRGM---KKP-----RGVS---IATETISKQ
ARGI1_SCHPO/22-319----------V----V--------QNPKFKSRPL----------KEGPNQALM---KNP-----LYVS---NVTRQVRNI
HUTG_PHOLL/44-316----------DLGS-I--------RAN-----------------------------PNQ--------------LSEAQQA
A0A1U7EWX2_NATPD/45-332----------DCGD-V--------PVF---------------------------PMDRE-----R-T------ADSIAAH
SPEB2_SYNY3/83-361----------DVGDIF----------------------------------------TIP-----ANNE---KSFDQISKG
Q5LKZ4_RUEPO/42-315----------DLGD-V--------APN-------------------------P--IDIM-----D-C------MDRISRF
Q2RHH4_MOOTA/26-287----------DAGD-L--------DLP-------------------------P--GRVE-----A-S------LERMEAA
Q17HI3_AEDAE/32-333----------DYGD-I--------QYEALNLQ--------------GRLATNM---KQL-----EHVA---SCTKLLSQR
A3CU48_METMJ/19-276----------DLGD-L--------AV--------------------------S--RLPE-----E-V------AGQVADV
HUTG_HAHCH/40-316----------DCGN-I---------QW-----------------------------EGE--------------LEDAQAA
Q8RA93_CALS4/28-290----------DLGD-L--------VLP-------------------------Y--GNIE-----K-S------LRLIEEV
Q8END5_OCEIH/29-310----------DLGD-V--------DV------------------------------VPA-----D-SP---ETMRRIEQF
Q5ANN8_CANAL/115-414----------DCGD-V--------AMT-------------------------P--FDNR-----I-A------LNQLYRG
Q2LPR8_SYNAS/65-343----------DAGD-V--------SV------------------------------DPN-----S-PE---KTMNNIYSS
A1ST87_PSYIN/33-299----------DAGD-L--------VYS-------------------------T--GDAN-----A-F------TQKVTAA
ARGI1_ARATH/63-338----------DVGD-V--------PVQE----------------------IRDCGVDDD-----R-L------MNVISES
A0R0G1_MYCS2/40-312----------DAGD-I--------ACN-------------------------P--FDIG-----Q-A------VDQVTAE
A1CFK4_ASPCL/83-374----------DCGD-A--------PLT-------------------------W--LDNT-----V-A------LKQLDLA
B8I5M8_CLOCE/21-282----------DYGD-L--------DLP-------------------------F--GSPN-----K-A------LHMISET
A1TIE4_ACIAC/8-305----------DLGN-L--------HGPPNPRG--------------ERTAEGL---RNL-----AECE---AWNRSTHDA
A1T9H7_MYCVP/46-324----------DFGD-A--------YCP-------------------------H--GQTE-----V-S------HRNIRER
Q97VA3_SULSO/30-299----------DMGD-I--------NVI-------------------------P--GYIE-----D-T------MNAIQTS
Q4J720_SULAC/30-299----------DLGD-V--------NII-------------------------P--GYIE-----D-T------IKIIEKD
Q3J2B4_RHOS4/46-312----------DYGD-L--------AFD-------------------------Y--ARTA-----E-F------PARLTAH
A1CGK0_ASPCL/61-357----------DCGD-I--------PIT-------------------------P--FDAA-----H-A------FKQMEQG
Q10Y47_TRIEI/24-296----------THEP-I--------ADTR----------------------NGK-KITPL-----D-M------LKVTQET
A5G278_ACICJ/28-297----------DAGD-F--------AIA-------------------------L--GDLP-----G-S------LALIEAQ
ARGI_SOYBN/71-346----------DVGD-I--------PIQE----------------------MRDCGIGDE-----R-L------MKVVSDS
O76895_DROME/30-333----------DYGN-L--------QYAVDEPLLQ----------QQRVHYHHI---RNY-----ADFM---ACNRALIEQ
A1W2M6_ACISJ/2-298----------DQGN-L--------AGPGNPQA---------------EPASGF---RHL-----AEVA---AWNRAVYEA
Q1GHG8_RUEST/4-296----------DIGN-V--------TPAPHAPD---------------DGTGKL---HEP-----NLTR---AWTESLSEA
Q65P52_BACLD/4-300----------DLGD-M--------TIGQREDEKE----------GGEPASEEL---RNL-----KAIT---KASVKLAET
Q67TJ0_SYMTH/28-290----------DLGD-V--------AVV-------------------------F--GDVQ-----E-S------LRRAEEV
A4XZN2_PSEMY/43-309----------DYGD-C--------HFD-------------------------H--GTPQ-----H-T------PAAIEAH
A4YE21_METS5/29-295----------DGGD-V--------DVI-------------------------P--GHIE-----D-T------MKRIEEV
Q6ANF4_DESPS/59-334----------DYGD-I--------DII-------------------------P--GHLD-----E-S------FERIEEG
Q222F3_RHOFT/24-298----------DALD-M--------RLP-------------------------N-ASPLA-----D-V------RQQIQAQ
ARGI2_MOUSE/24-324----------DFGD-L--------SFTNVPQD--------------DPYNNLV---VYP-----RSVG---LANQELAEV
Q315M1_DESAG/23-287------------TH-C--------PVD-------------------------C-DAETA-----E-V------LMRIEAS
A7IL28_XANP2/50-316----------DGGD-C--------VFD-------------------------Y--GLPA-----G-I------PAAIAAQ
Q18A84_PEPD6/21-285----------DYGD-L--------EIS-------------------------V--GSTE-----Q-V------LKEIYQE
Q5V6R7_HALMA/44-335----------DTGD-A--------AVS-------------------------P--GDTR-----Q-S------QLNIEDA
Q5LRK8_RUEPO/33-325----------DLGN-L--------SPAEHAPE---------------PSDTHL---HQP-----NRTI---GWTNRLIRA
Q9K8M2_BACHD/4-296----------DMGD-I--------PIDRPGEV--------------SEEKTNL---KNL-----GEVI---KANELLCLH
Q3ABP1_CARHZ/20-281----------DMGD-V--------ALT-------------------------L--GRIE-----E-S------FTSIRTV
A9CJC2_AGRFC/42-307----------DYGD-C--------LLD-------------------------Y--GNHW-----K-T------PDTIEKE
Q7U3K9_SYNPX/21-280----------DLGA-V--------DIP-------------------------F--GAPE-----P-V------VNAVQQA
A1STQ5_PSYIN/47-343----------DGGN-V--------FCH-----------------------------QKN--------------LEESQKA
Q7VY32_BORPE/13-287----------DLGNVA----------------------------------------CVP-----GDPQ---ASYPAIEQA
Q9CL61_PASMU/34-299----------DCGD-L--------VYS-------------------------F--GDNQ-----N-F------VEELEAH
A4IB49_LEIIN/14-315----------DNGD-R--------IGR-------------------------V---KRP-----R-LTA--ECTEKIYKC
A5UXL8_ROSS1/34-305----------DYGD-A--------PVA-------------------------P--GFIH-----E-S------HAAITAT
A9WCM8_CHLAA/41-307----------DLGD-V--------DTT-------------------------G---DLE-----T-I------HARQQAL
B4EIP8_BURCJ/49-320----------DIGD-V--------AIN-------------------------P--YNLH-----D-S------IARIEAA
B4ELX2_BURCJ/44-308----------DYGD-C--------WFD-------------------------A---HNP-----LSI------KPAIVEH
B5GLC8_STRC2/31-301----------DAGD-I--------NLT-------------------------P--FDMN-----I-A------IDTAQSH
B9A9C6_BOMMO/12-304----------DFGD-I--------ETSSCENN---------------VNVNNM---NH--------LPLVSACNKNLSER
C0ZIM2_BREBN/4-293----------DRGD-I--------FVTRPHHFT------------ETENHKYL---DE--------VV---EANEKLANV
D0J7J2_COMT2/7-302----------DLGN-L--------SGPANPRGAR-----------DAQGLRNL-------------AEC-LSWNRIAHDA
D5AV62_RHOCB/6-296----------DQGD-L--------SIGPQAAVAH-----------ANPAVHHL---AE--------TR---AWIALLAAR
D5SKW9_STRC2/134-404----------DGGD-I--------DLS-------------------------P---FSM-----DLA------MDTATVA
E3GWR7_METFV/23-279----------DLGD-I--------EVI-------------------------L--GDFK-----N-T------CRNISEK
E9CYX8_COCPS/18-317----------T---------------YAEFVPEHD---------PNHRGMKKP---RT--------VS---AATQQLSRQ
F1QJZ3_DANRE/86-357----------DIGD-I--------NVN-------------------------L--FDLK-----D-T------CKKIQEA
F6SZP1_XENTR/61-332----------DIGD-V--------NVN-------------------------L--YDLK-----D-S------CRRIRET
A0A0D8JTR5_COCIM/78-370----------DCGD-A--------PLT-------------------------F--LDNT-----I-A------LKQLDKA
K5X448_AGABU/13-305----------EYNN-L--------DDAP----------------------IGI--MKNP-----R-TVS--QVNRSVAGV
SPEB_NEIMB/35-299----------DCGD-L--------VFS-------------------------F--GDSR-----D-F------VEKMEAH
Q05AR1_XENTR/27-324----------DFGD-L--------HFSQVPND--------------ELYNSIV---KHP-----RTVG---LACKVLAEE
Q24ZK6_DESHY/5-295----------DVGN-I--------DVPIAETREI----------KDPLLKYLP---EIS-----E-V------NQKLYPL
Q251M0_DESHY/26-286----------DCGD-L--------SLP-------------------------F--GNVE-----K-S------LQVIEAA
Q2FW91_STAA8/6-296----------DKGD-I--------KVPAVNIEKFH---------SEQKGLRNY-----D-----E-II---DVNQKLNKE
Q2K3I8_RHIEC/7-299----------PAMD-L--------PNH-------------------------P-KAHNL-----R-IVG--AFTRALESS
Q2K9W6_RHIEC/65-328----------DYGD-C--------LLD-------------------------Y--GNHQ-----D-T------PGAIERQ
Q3IKA3_PSEHT/33-297----------DAGD-F--------TYP-------------------------V--GDAE-----Y-F------TAQLEQA
Q46IA1_PROMT/31-292----------DIGS-L--------DVP-------------------------L--GDAE-----L-T------LDYISDA
Q4FL05_PELUB/40-312----------DAGD-I--------TCN-------------------------P--FNID-----E-A------IKQIEEG
Q5KIC1_CRYNJ/70-373----------DCGD-V--------PVT-------------------------P--FDPA-----T-A------VKQINSA
Q5L3P6_GEOKA/3-294----------DLGD-I--------PIGKAERLH-------------EQGDSRL---RNL-----KAVA---EANEKLATA
HUTG_LEGPH/47-315----------DLGN-V--------VCE-------------------------N---DEL-----ELS------QSQFAQI
Q6LHE2_PHOPR/35-321----------DAGI-I--------DEL-----------------------------DGL-----E-F------NELQALQ
Q6LWW9_METMP/19-277----------DKYN-L--------LME-----------------------------GNQ-----SEI------INRAYSA
Q6N0N3_RHOPA/14-309----------DHGD-M--------TRPALDGGN-------------DPVPANA---NY--------YSEVRSWVGAISAR
Q6PH54_DANRE/25-322----------DFGD-L--------TFKHLEKDE------------HFMHVPFP---RTV-----GRA------NQLLSGA
Q72EZ7_DESVH/23-282----------THPP-V--------DCT-------------------------G---DAE-----A-V------LDRISRA
Q7V3X2_PROMM/30-287----------DLGA-L--------EIP-------------------------C--GDPK-----P-V------VEAVKKA
SPEB_BACAN/23-284----------DAGD-I--------PLP-------------------------F---GNA-----QRS------LDMIEEY
Q81VP0_BACAN/4-292----------DMGD-I--------CIEREKEVD------------VNTSLRNL--TQ---------VA---TVCNELASK
Q81Y48_BACAN/37-311----------DCGD-I--------TMH-------------------------V--TDIK-----E-S------HNRIAKT
Q82VE5_NITEU/46-310----------DSGD-C--------FLD-------------------------V---HNP-----LTI------HGAIVDH
HUTG_VIBPA/47-325----------DLGT-V--------VCD-------------------------------D-----D-L------LEESQSR
Q88KU3_PSEPK/34-298----------DYGD-C--------PFD-------------------------S---GTP-----QSV------PDSIEAH
Q8RG18_FUSNN/503-779----------DFND-K--------KLK-------------------------F---KNT-----V-LD----TCEKIAKR
Q8TJ04_METAC/18-281----------DAGN-L--------ETS-------------------------A---SVD-----E-T------LRDLYED
Q8XMY7_CLOPE/21-278----------DGGE-I--------ELP-------------------------F--GNSE-----G-A------LALIEDF
Q92LN4_RHIME/3-295----------DEGD-L-------RP-LPARDL---------------ANHPGA---NNL-----QSVA---AFARALDEA
Q92MV8_RHIME/71-339----------DIGD-V--------PFR-------------------------S--RYRL-----E-I-----SHEDIEKR
Q92QR6_RHIME/44-306----------DYGD-C--------LLD-------------------------Y--GNHA-----R-T------PQTIERE
GPUA_PSEAE/36-307----------DLGD-A--------PVN-------------------------P--IDLL-----D-S------LRRIEGF
Q9KLD2_VIBCH/33-297----------DAGD-L--------VFD-------------------------C--GDAE-----D-F------TYRLEAA
HUTG_VIBCH/44-322----------DLGN-I--------RCE-----------------------------GDE--------------LEQAQQE
U5L6E1_9BACI/3-293----------DLGD-I--------AIGRPEVE--------------IDPDTNL---RNL-----E-LIA--DKTGQLAEK
U5LEA0_9BACI/39-314----------DAGD-V--------LMH-------------------------T--TDIP-----L-S------HSRIQET

PF00850

Q5K8L3_CRYNJ/30-447---RTD-PYNLSHD-N--------PVF-------------------------PTLASYI-----SHV------TAATSTA
HDAC4_HUMAN/675-992-LPCGG-VGVDSDT-I--------WNE-------------------------VHSAGAA-----RLA------VGCVVEL
A0DIS2_PARTE/35-343---K------YFDD-T--------YLC-------------------------KTSAVTA-----RKC------VQAVLEG
A0LGT0_SYNFM/21-313---D-------HPD-N--------QMC-------------------------RESYETA-----LLA------VGGLLEA
A1W7T1_ACISJ/39-355IAKLG--LYSMDNG-S--------PLA-------------------------AGTWTAA-----KAG------ADAAASA
A2BL29_HYPBU/22-314-----------DPD-T--------YVG-------------------------KYTILAA-----HAY------TASVLDA
A3DNS7_STAMF/22-312-----------DPD-T--------YFS-------------------------ETSYELA-----LET------FDLSYNT
A3GH68_PICST/31-340--YG-----LVHD--C--------YIF-------------------------PFIGEYV-----RAV------GGSSIAS
A4S2N1_OSTLU/203-605ENSD-----------T--------FFS-------------------------PGTLQAA-----LRA------AGGVIHA
A4S898_OSTLU/34-312--------------------------S-------------------------DALVERT-----LME------VSGTMLT
A4X4X7_SALTO/21-317---G-------TPD-N--------PVF-------------------------PRMHEAS-----ALV------TGATVAA
A4YNH4_BRASO/59-370GRLGW---HTTDTS-A--------PIG-------------------------PGTWAGA-----CAA------TDVAASA
A6QAF4_SULNB/20-301---I-------DSD-T--------ICS-------------------------EHSYEAA-----RKA------VGAGIVA
A6R4B6_AJECN/60-359---N-----FGDD--C--------PVF-------------------------DGLYNYC-----SHY------AGGTLDA
A6VSZ5_MARMS/20-304---E--------PE-T--------LMM-------------------------PHTLDAA-----LYA------AGSVIKA
A7SSG8_NEMVE/31-332---E------EYDS-I--------YMS-------------------------KDVYDCA-----LLS------CGCTLAA
A7SUP8_NEMVE/33-329---G-----LGYD--C--------PPF-------------------------EDMYDCV-----SMI------AGATLLA
A7TRW5_VANPO/20-403QQDVYKKFNLEGD--C--------PLF-------------------------SFLPLYC-----EVI------SGASLML
A8ABS4_IGNH4/20-308-----------DPD-T--------YAS-------------------------PTSWEPA-----LYA------AGTVAYA
A8ZT95_DESOH/22-309---S------MAPD-T--------PVS-------------------------GHSYLAA-----WLA------AGACMQG
A9A062_DESOH/265-572RAGY----YCIDTF-T--------PLN-------------------------RSAYAAA-----RHA------VDCVLTG
A9B5I1_HERA2/19-308---D--------AE-T--------YIL-------------------------PDSVEIA-----QLA------AGGAIVA
B0T7F0_CAUSK/36-327-----------PGDDA--------PVP-------------------------YGAFEIA-----SLA------AGGAIAA
B2JV93_PARP8/21-308---D-------GGD-T--------VMS-------------------------PGSWEAV-----MRC------VGAACAG
B4U8T2_HYDS0/19-303---D--------PD-T--------YAY-------------------------QHSYDAA-----MMV------AGAILKA
C5KDG6_PERM5/349-869ARLVGRALTLWPGE-C--------CMD-------------------------PYTLKAA-----LLR------CGMMRDA
E0TF48_PARBH/17-291--------------------------S-------------------------PHIHRRG-----QRT------VGGALAA
E2RU63_GIAIC/23-319--YN-----ITED--C--------PVF-------------------------SGLYDYC-----SMT------VGASVNA
O67135_AQUAE/21-313---G-------GYE-N--------PVS-------------------------YAMFTGS-----SLA------TGSTVQA
HDA1_YEAST/83-394---E------KGDS-V--------YFN-------------------------NDSYASA-----RLP------CGGAIEA
Q02CA3_SOLUE/20-310---S-------TGD-T--------DIT-------------------------PNSWDVA-----VRA------SGGVLNA
Q0A6Z7_ALKEH/48-335---D-------VDT-T--------AVC-------------------------PGSVDAA-----EVA------AGTAIAA
Q0ARF0_MARMM/20-307---------------T--------LVC-------------------------DRSAAAA-----LGA------VGAAVAA
Q15WQ0_PSEA6/26-300--------------------------S-------------------------EQLIARS-----LTA------VGGTVLT
Q1CZX8_MYXXD/27-313---D--------PD-T--------QVS-------------------------PDSVDAA-----RLA------AGASVQA
HDA6_CAEEL/446-747---K------EFNS-I--------YLT-------------------------RDTLKVA-----RKA------VGAVLQS
Q29CG7_DROPS/39-325--------------------------P-------------------------NKYLQQAYLRPMRFQ------AAGSILA
Q2FQW8_METHJ/20-310-----------DAD-T--------YVP-------------------------KGLIHDA-----LLA------AGGAITG
Q2IF50_ANADE/22-318---W------LEPE-T--------PVS-------------------------AGSWRAA-----VAA------AGAAIEA
Q2KBQ8_RHIEC/20-308---E--------AD-T--------YAS-------------------------VKSLQAA-----LTG------IGGAMAA
Q2LVD3_SYNAS/21-310---D--------PD-T--------DTS-------------------------PGSYKAA-----LLA------AGGLCEA
Q2R9B1_ORYSJ/38-341-HGI----GGDDD--C--------PAF-------------------------DRLWKYC-----RGY------AGGSFAA
Q2S035_SALRD/19-312---D-------TGD-V--------PVF-------------------------ENMDAAA-----RGL------VGGTLHG
Q2SC27_HAHCH/22-314--------------------------P-------------------------SSLLQKGLLTPAKYA------VAGTITA
Q30PJ4_SULDN/264-571QVGY----YALDTF-T--------PLN-------------------------ANAYKAA-----RGA------VDCAVTA
Q31EP6_HYDCU/54-346---P------YQGD-T--------YLN-------------------------ASSFDAA-----KMA------AGSNINL
Q31HC2_HYDCU/19-303---D--------ED-T--------SLS-------------------------PGSLESA-----LAA------SGAMLTA
Q38C74_TRYB2/31-322--VT-----FSGD--C--------PPV-------------------------EGIVEYS-----LST------VSGSLMA
Q39UV4_GEOMG/22-314---G-------DLD-N--------PVF-------------------------KGFYDWA-----ILG------VGGTMEA
Q3AFN8_CARHZ/22-318---G-------SED-N--------PVF-------------------------SGMHEAA-----ALV------AGGSALG
Q4D762_TRYCC/59-387PISTDEEYGLVNE--N--------MPF-------------------------VGMWRTI-----QAT------VSGTLLA
Q4FNF7_PELUB/20-305---D--------GD-T--------IVS-------------------------PGSKDAT-----LDA------VGSIITA
Q4KAJ1_PSEF5/25-339DGKLG--FFAMDAG-S--------PIT-------------------------ATTWDAV-----RTS------ADIALTA
Q4MYQ3_THEPA/32-415SLYP------LDVD-T--------YMT-------------------------PKSELVA-----NLA------VGSLVEL
Q4QAJ4_LEIMA/102-403-PFA----SQDSD--C--------PLF-------------------------PEVWALV-----SSQ------AGASLAC
Q4QI60_LEIMA/65-431LKSGAALADLKSDV-Y--------CNE-------------------------GTSSVAV-----RLS------AGAVIDA
HDA21_DICDI/1078-1485TTSSTNGEQCEDGD-T--------FVS-------------------------KLSLHAA-----KRS------AGATCQA
Q5KKR8_CRYNJ/39-367---L-----TGSD--C--------PAV-------------------------EGIFEFS-----SIS------AGGSIGA
Q60DG7_ORYSJ/56-349---L-------CEG-T--------FLN-------------------------PGSWGAA-----LLA------AGTTLSA
Q6AJC0_DESPS/25-317---D-------HLD-N--------QIG-------------------------YHTYQVA-----ALA------AGAGLKG
Q6AKN4_DESPS/22-310---D--------QD-T--------YLM-------------------------QQSLATA-----QLA------AGGCLEI
Q6C3Y5_YARLI/64-351--MG-----LIHD--C--------PIF-------------------------PGLDAYV-----KLV------AGSTLSC
Q6CGA7_YARLI/268-647---P-------EGD-I--------YLS-------------------------PETLTAL-----KGV------VGAVERG
Q6FWB7_CANGA/19-382TLAKF---NLLDD--C--------PIF-------------------------PYLPLYC-----YVS------TGATLSL
Q741C0_MYCPA/20-306---D-------GGD-T--------MME-------------------------PSTWETA-----LRG------VGATLQA
Q7PS30_ANOGA/126-423---S------HYDA-I--------FIH-------------------------PTSYETS-----VLA------VGSTIQL
Q8EP92_OCEIH/22-320---G-------TED-T--------PAF-------------------------FQMHEAA-----SYL------VGGTLAA
Q8I4I9_CAEEL/27-317---C------KDKEIL--------WTC-------------------------ENTNEAA-----RVA------IGGSIEL
Q8IR37_DROME/563-860---G------IYNS-V--------YLH-------------------------PRTFDCA-----TLA------AGLVLQA
HDA14_ARATH/80-386---G-------SGP-T--------YAT-------------------------STTFQDS-----LIA------AGAGMAL
Q9K0J2_NEIMB/41-327---R------LDND-T--------AIS-------------------------TGSLSAA-----RFA------AGSAVQA
Q9U266_CAEEL/26-318---T-----KYED--I--------YVN-------------------------SATWHRA-----KLA------AGASIDL
G4VAN3_SCHMA/18-356---F-----SLNYD-C--------PGF-------------------------PSVFDYS-----LAA------VQGSLAA
K3ZRV5_SETIT/232-519-----------TSD-T--------YAN-------------------------GHSACAA-----KLA------AGLCADL
Q22CW6_TETTS/28-319------------NG-C--------YYN-------------------------KYTGQSA-----FLS------SGAVIQS
Q2G292_STAA8/25-322---N-------DEE-N--------GQF-------------------------KHMHRHS-----ATI------VGGALTL
Q8F7M9_LEPIN/22-309-----------DSD-T--------PFT-------------------------EKSWISA-----YSA------ANSGIIL
V6EZA3_9PROT/20-307-----------DPD-T--------ILS-------------------------YQSGDAA-----LRS------AGAGCAA
W7X9B2_TETTS/39-342-----------MLD-T--------YFN-------------------------QSSKDAA-----YLG------VGGVIES

PF12640

B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------

PF00491

E7F8R4_DANRE/27-322VQKIK---------------------------------------------------------------------S--D--
SPEB3_SCHPO/85-387YFQLI---------------------------------------------------------------------A--RKP
Q6BJQ5_DEBHA/76-370FEELI---------------------------------------------------------------------A--RRN
Q6BVQ4_DEBHA/136-428ERAIL---------------------------------------------------------------------K--T--
Q6BWL4_DEBHA/179-480QRSIH---------------------------------------------------------------------K--HTS
A1RXI5_THEPD/26-288AREVL---------------------------------------------------------------------S--S--
SPEB_MOUSE/77-350YQNVL---------------------------------------------------------------------A--A--
A4XKN0_CALS8/20-281ARKIF---------------------------------------------------------------------G--D--
A4J1T2_DESRM/21-282VGNIV---------------------------------------------------------------------Q--D--
A1VQK9_POLNA/34-307YQPVI---------------------------------------------------------------------D--S--
Q2K8A9_RHIEC/46-316VGGLI---------------------------------------------------------------------G--A--
B2JW15_PARP8/32-305FEPVF---------------------------------------------------------------------R--A--
Q982X2_RHILO/42-307AAKIL---------------------------------------------------------------------K--S--
HUTG_BACHD/35-311MTKLL---------------------------------------------------------------------E--N--
HUTG_RHOJR/40-314LGSVV---------------------------------------------------------------------A--ATL
ARGI1_HUMAN/6-305VAEVK---------------------------------------------------------------------K--N--
SPEB_CHRVO/44-311ARTIL---------------------------------------------------------------------A--S--
ARGI_BACSU/3-292VNKVI---------------------------------------------------------------------E--E--
Q97ZX8_SULSO/24-289ISYFQ---------------------------------------------------------------------E--S--
HUTG_VIBVY/45-328CAKII---------------------------------------------------------------------A--EVL
A9BRG6_DELAS/16-312VGQAL---------------------------------------------------------------------D--D--
HUTG_AROAE/40-323YARRI---------------------------------------------------------------------T--ALL
A1RB53_PAEAT/29-311VAD-L---------------------------------------------------------------------D--S--
Q1J2W9_DEIGD/37-306ARQVR---------------------------------------------------------------------K--R--
Q2JER0_FRACC/40-318VARIA---------------------------------------------------------------------G--L--
Q3J346_RHOS4/3-296V-EEA---------------------------------------------------------------------L--G--
A9B324_HERA2/22-290VEATA---------------------------------------------------------------------R--L--
Q9YBG0_AERPE/29-298VEDLA---------------------------------------------------------------------R--E--
Q1GI44_RUEST/34-307YDAIL---------------------------------------------------------------------G--S--
Q9HJB2_THEAC/33-293TKMVF---------------------------------------------------------------------S--D--
A0RXD6_CENSY/22-283TAELA---------------------------------------------------------------------G--G--
A8LLU9_DINSH/46-312IRTIL---------------------------------------------------------------------A--A--
SPEB_BACHD/22-286VDKLL---------------------------------------------------------------------A--D--
Q0W940_METAR/16-280SKQIV---------------------------------------------------------------------D--A--
Q6MHV0_BDEBA/36-309VGEVL---------------------------------------------------------------------S--H--
Q98MW3_RHILO/19-296TREVL---------------------------------------------------------------------A--L--
A0LG67_SYNFM/34-297GAQVL---------------------------------------------------------------------R--S--
HUTG_BACSU/35-311MHALL---------------------------------------------------------------------S--D--
Q9K5Y7_BACHD/5-297VAAIE---------------------------------------------------------------------A--E--
Q164F4_ROSDO/46-312ISTIL---------------------------------------------------------------------A--A--
Q164F5_ROSDO/34-308YHAIL---------------------------------------------------------------------N--Y--
Q15X44_PSEA6/42-323YATEV---------------------------------------------------------------------S--KAL
Q11J67_CHESB/42-307ASKIL---------------------------------------------------------------------E--S--
Q1AWJ4_RUBXD/5-295AREAV---------------------------------------------------------------------A--R--
Q5WL42_BACSK/7-290LKAVL---------------------------------------------------------------------A--D--
Q7UZH9_PROMP/24-288TDFIM---------------------------------------------------------------------S--S--
Q6CLB8_KLULA/137-438QRALH---------------------------------------------------------------------N--H--
A0JT79_ARTS2/57-331ALDL-------------------------------------------------------------------------T--
Q2KVZ3_BORA1/13-287VDRIL---------------------------------------------------------------------E--A--
B2UBQ2_RALPJ/40-316LSGVL---------------------------------------------------------------------H--DLL
Q165U0_ROSDO/35-314VRAAL---------------------------------------------------------------------R--A--
B1YHV3_EXIS2/22-286VDSLL---------------------------------------------------------------------T--A--
Q5WIT9_BACSK/27-306AAEFW---------------------------------------------------------------------K--K--
A1C610_ASPCL/68-380FLELG---------------------------------------------------------------------V--R--
Q1AS11_RUBXD/33-307LAPLH---------------------------------------------------------------------E--A--
Q28QX8_JANSC/39-314VAALL---------------------------------------------------------------------G--Q--
A1WGI6_VEREI/22-320VSAEL---------------------------------------------------------------------R--L--
A1WER7_VEREI/22-295FDAIV---------------------------------------------------------------------A--A--
A1T3A2_MYCVP/88-364MAHVV---------------------------------------------------------------------Q--K--
A8LRL4_DINSH/4-296A-QAA---------------------------------------------------------------------I--G--
A5V551_SPHWW/4-298AYGLL---------------------------------------------------------------------K--D--
Q11NZ4_CYTH3/3-310ISAIV---------------------------------------------------------------------K--K--
Q5V4R8_HALMA/3-300VDATL---------------------------------------------------------------------R--E--
Q12BY7_POLSJ/72-342FNQVV---------------------------------------------------------------------N--A--
HUTG_VIBF1/45-345LGIKI---------------------------------------------------------------------K--SAL
Q3IVT5_RHOS4/32-308LDAVV---------------------------------------------------------------------E--A--
HUTG_GEOKA/44-315LGKAV---------------------------------------------------------------------A--RLL
SPEB_BLOFL/33-298IENLL---------------------------------------------------------------------R--F--
A0ZFA2_NODSP/30-338CQAAM---------------------------------------------------------------------N--Q--
A4XT95_PSEMY/38-311YDEIV---------------------------------------------------------------------E--Y--
Q5WB32_BACSK/22-286VDSLL---------------------------------------------------------------------A--D--
Q6C6P6_YARLI/9-306VSEAA---------------------------------------------------------------------V--S--
Q12UU8_METBU/17-282VINIV---------------------------------------------------------------------D--D--
Q213G1_RHOPB/11-309AYTLA---------------------------------------------------------------------Q--S--
Q28PV5_JANSC/46-313IAGIL---------------------------------------------------------------------G--A--
A0QRD0_MYCS2/43-317VTELL---------------------------------------------------------------------D--R--
ARGI_NEUCR/47-354VHSHA---------------------------------------------------------------------K--E--
Q12LW8_SHEDO/33-299ATRVL---------------------------------------------------------------------D--A--
Q2W8C1_MAGSA/22-290AAGIG---------------------------------------------------------------------H--L--
GBU1_KLULA/61-358YENLL---------------------------------------------------------------------S--H--
A1SLP1_NOCSJ/31-312VYAVA---------------------------------------------------------------------R--S--
Q28VR8_JANSC/34-309VRAAL---------------------------------------------------------------------A--A--
Q0UYW2_PHANO/16-320VYAHA---------------------------------------------------------------------V--S--
Y309_METJA/21-281SREIL---------------------------------------------------------------------K--E--
Q9RZ04_DEIRA/29-298ARQVR---------------------------------------------------------------------G--R--
ARGI_KLULA/13-315VKKVS---------------------------------------------------------------------N--E--
A2BIW8_HYPBU/25-300TRELL---------------------------------------------------------------------ENMQ--
Q21RM0_RHOFT/15-309LYCEL---------------------------------------------------------------------Q--A--
Q6L151_PICTO/19-280TRTIF---------------------------------------------------------------------N--D--
A0A0D1DTD8_USTMA/13-318VESHA---------------------------------------------------------------------K--Q--
A1B165_PARDP/30-308VRKIL---------------------------------------------------------------------A--A--
Q16AD8_ROSDO/4-296A-QVA---------------------------------------------------------------------M--A--
Q3SMM1_THIDA/8-294VHGVL---------------------------------------------------------------------D--E--
A0A1D8PP00_CANAL/12-313VKGSL---------------------------------------------------------------------A--E--
Q7VSA1_BORPE/8-302VSAEL---------------------------------------------------------------------R--Q--
A0BHR2_PARTE/9-311SFDIA---------------------------------------------------------------------K--Q--
Q4JAE9_SULAC/24-287VSYFS---------------------------------------------------------------------E--K--
Q975R8_SULTO/24-287TSYFA---------------------------------------------------------------------E--K--
Q1LGD2_CUPMC/2-296TYQAL---------------------------------------------------------------------A--T--
ARGI_AGRFC/19-313ALEMA---------------------------------------------------------------------R--S--
Q1D421_MYXXD/27-337TKHWL---------------------------------------------------------------------D--Q--
SPEB1_SCHPO/74-375HFELL---------------------------------------------------------------------T--R--
ARGI_YEAST/13-329VSKVV---------------------------------------------------------------------Q--A--
A9BN56_DELAS/71-341FAKIH---------------------------------------------------------------------A--A--
A0A1D8PPP3_CANAL/50-340FKDLL---------------------------------------------------------------------N--R--
A1RBR9_PAEAT/55-335ALPL-------------------------------------------------------------------------I--
A1VTU0_POLNA/3-297VHAAL---------------------------------------------------------------------S--E--
Q0UMJ9_PHANO/68-378FLELG---------------------------------------------------------------------K--R--
A1SM48_NOCSJ/41-314VREL-------------------------------------------------------------------------S--
Q1GI45_RUEST/67-333IRGIL---------------------------------------------------------------------A--T--
Q1IHQ4_KORVE/16-311VLKAL---------------------------------------------------------------------E--E--
Q6L2W0_PICTO/21-293YYNII---------------------------------------------------------------------KKYN--
Q89H72_BRADU/11-308GYEIA---------------------------------------------------------------------K--T--
Q489X2_COLP3/36-310YDTIM---------------------------------------------------------------------A--S--
Q7V9I4_PROMA/29-293SNFIY---------------------------------------------------------------------S--L--
SPEB1_SYNY3/26-297IAPFV---------------------------------------------------------------------E--D--
Q6FP31_CANGA/10-317VTDVL---------------------------------------------------------------------S--R--
A5G414_GEOUR/41-319MGKVY---------------------------------------------------------------------E--N--
Q3SVS2_NITWN/5-302AYDLA---------------------------------------------------------------------R--S--
SPEB2_SCHPO/89-401YIDLL---------------------------------------------------------------------S--R--
Q8XPR0_RALSO/29-309VRRLA---------------------------------------------------------------------N--A--
Q47TW8_THEFY/41-314ASEL-------------------------------------------------------------------------L--
A9KQ98_LACP7/18-281TANVL---------------------------------------------------------------------K--D--
A1BCD2_PARDP/35-312IAQVC---------------------------------------------------------------------A--K--
ARGI_ASHGO/93-395VRAAA---------------------------------------------------------------------H--A--
A1B3P5_PARDP/3-295G-CSA---------------------------------------------------------------------M--E--
Q1QTM4_CHRSD/39-312YHELL---------------------------------------------------------------------S--H--
Q6C732_YARLI/86-381MRAIH---------------------------------------------------------------------N--H--
A0LDK6_MAGMM/20-293TLPHL---------------------------------------------------------------------Q--A--
Q47D78_DECAR/17-302VALTL---------------------------------------------------------------------R--A--
Q3JAG2_NITOC/2-290AGNVV---------------------------------------------------------------------A--R--
A3DDA1_CLOTH/24-286AEEIL---------------------------------------------------------------------S--D--
A1CKP4_ASPCL/16-320VYEHA---------------------------------------------------------------------K--D--
ARGI1_SCHPO/22-319VQQEL---------------------------------------------------------------------E--K--
HUTG_PHOLL/44-316LSDAV---------------------------------------------------------------------T--QCQ
A0A1U7EWX2_NATPD/45-332VATVT---------------------------------------------------------------------A--R--
SPEB2_SYNY3/83-361IAHIF---------------------------------------------------------------------S--S--
Q5LKZ4_RUEPO/42-315YAGLK---------------------------------------------------------------------S--S--
Q2RHH4_MOOTA/26-287ADAIF---------------------------------------------------------------------A--A--
Q17HI3_AEDAE/32-333VTRVL---------------------------------------------------------------------N--E--
A3CU48_METMJ/19-276AGDIV---------------------------------------------------------------------R--D--
HUTG_HAHCH/40-316LATKV---------------------------------------------------------------------F--KQL
Q8RA93_CALS4/28-290AEKIV---------------------------------------------------------------------K--D--
Q8END5_OCEIH/29-310AKEVW---------------------------------------------------------------------K--T--
Q5ANN8_CANAL/115-414HRSIS---------------------------------------------------------------------K--H--
Q2LPR8_SYNAS/65-343MDRIY---------------------------------------------------------------------G--K--
A1ST87_PSYIN/33-299ATQLL---------------------------------------------------------------------A--S--
ARGI1_ARATH/63-338VKLVM---------------------------------------------------------------------EEEP--
A0R0G1_MYCS2/40-312LTAL-------------------------------------------------------------------------L--
A1CFK4_ASPCL/83-374HKVIS---------------------------------------------------------------------S--R--
B8I5M8_CLOCE/21-282SGFIF---------------------------------------------------------------------K--Q--
A1TIE4_ACIAC/8-305VFGQL---------------------------------------------------------------------Q--A--
A1T9H7_MYCVP/46-324VHAVA---------------------------------------------------------------------D--R--
Q97VA3_SULSO/30-299LYEII---------------------------------------------------------------------S--S--
Q4J720_SULAC/30-299VYDII---------------------------------------------------------------------S--S--
Q3J2B4_RHOS4/46-312VAGIL---------------------------------------------------------------------A--A--
A1CGK0_ASPCL/61-357YRQVL---------------------------------------------------------------------Y--H--
Q10Y47_TRIEI/24-296VEKLV---------------------------------------------------------------------S--D--
A5G278_ACICJ/28-297AAQIG---------------------------------------------------------------------H--L--
ARGI_SOYBN/71-346VKLVM---------------------------------------------------------------------EEDP--
O76895_DROME/30-333VKLML---------------------------------------------------------------------V--E--
A1W2M6_ACISJ/2-298THAAL---------------------------------------------------------------------Q--A--
Q1GHG8_RUEST/4-296A-EAA---------------------------------------------------------------------M--A--
Q65P52_BACLD/4-300VDNIV---------------------------------------------------------------------A--S--
Q67TJ0_SYMTH/28-290ARRLF---------------------------------------------------------------------A--D--
A4XZN2_PSEMY/43-309ATRIL---------------------------------------------------------------------E--A--
A4YE21_METS5/29-295LVGRM---------------------------------------------------------------------R--N--
Q6ANF4_DESPS/59-334MSALL---------------------------------------------------------------------K--N--
Q222F3_RHOFT/24-298AA-AL---------------------------------------------------------------------M--A--
ARGI2_MOUSE/24-324VSRAV---------------------------------------------------------------------S--G--
Q315M1_DESAG/23-287VQAAL---------------------------------------------------------------------D--AAP
A7IL28_XANP2/50-316ARAHY---------------------------------------------------------------------A--R--
Q18A84_PEPD6/21-285TYKIV---------------------------------------------------------------------R--D--
Q5V6R7_HALMA/44-335VYEIS---------------------------------------------------------------------E--Q--
Q5LRK8_RUEPO/33-325A-EQA---------------------------------------------------------------------M--P--
Q9K8M2_BACHD/4-296VEKAV---------------------------------------------------------------------A--N--
Q3ABP1_CARHZ/20-281TKKVL---------------------------------------------------------------------S--D--
A9CJC2_AGRFC/42-307ARRII---------------------------------------------------------------------S--K--
Q7U3K9_SYNPX/21-280TTAVL---------------------------------------------------------------------D--L--
A1STQ5_PSYIN/47-343LAKKV---------------------------------------------------------------------T--NAL
Q7VY32_BORPE/13-287VAQVL---------------------------------------------------------------------Q--A--
Q9CL61_PASMU/34-299ATALL---------------------------------------------------------------------K--A--
A4IB49_LEIIN/14-315VRRVA---------------------------------------------------------------------E--Q--
A5UXL8_ROSS1/34-305LRPLA---------------------------------------------------------------------E--A--
A9WCM8_CHLAA/41-307VARII---------------------------------------------------------------------A--D--
B4EIP8_BURCJ/49-320YDAIL---------------------------------------------------------------------E--H--
B4ELX2_BURCJ/44-308TRAIL---------------------------------------------------------------------R--S--
B5GLC8_STRC2/31-301LSGLL---------------------------------------------------------------------K--A--
B9A9C6_BOMMO/12-304VSHVL---------------------------------------------------------------------K--D--
C0ZIM2_BREBN/4-293VSDIM---------------------------------------------------------------------T--A--
D0J7J2_COMT2/7-302VLQVL---------------------------------------------------------------------Q--Q--
D5AV62_RHOCB/6-296AEAAA---------------------------------------------------------------------A--Q--
D5SKW9_STRC2/134-404LTRLL---------------------------------------------------------------------E--R--
E3GWR7_METFV/23-279VQEVL---------------------------------------------------------------------K--K--
E9CYX8_COCPS/18-317VYEHA---------------------------------------------------------------------R--E--
F1QJZ3_DANRE/86-357YRKIV---------------------------------------------------------------------A--T--
F6SZP1_XENTR/61-332YQKIM---------------------------------------------------------------------A--A--
A0A0D8JTR5_COCIM/78-370HKVVS---------------------------------------------------------------------S--RIA
K5X448_AGABU/13-305VMNHA---------------------------------------------------------------------K--N--
SPEB_NEIMB/35-299AGKLL---------------------------------------------------------------------S--S--
Q05AR1_XENTR/27-324VSKAV---------------------------------------------------------------------G--A--
Q24ZK6_DESHY/5-295VAQAI---------------------------------------------------------------------K--E--
Q251M0_DESHY/26-286ARQVV---------------------------------------------------------------------E--D--
Q2FW91_STAA8/6-296VSASI---------------------------------------------------------------------E--N--
Q2K3I8_RHIEC/7-299VHDVA---------------------------------------------------------------------A--A--
Q2K9W6_RHIEC/65-328ANAIL---------------------------------------------------------------------D--S--
Q3IKA3_PSEHT/33-297ASKIL---------------------------------------------------------------------S--Q--
Q46IA1_PROMT/31-292TNILL---------------------------------------------------------------------K--N--
Q4FL05_PELUB/40-312ATELL---------------------------------------------------------------------D--K--
Q5KIC1_CRYNJ/70-373YRSLL---------------------------------------------------------------------H--HPV
Q5L3P6_GEOKA/3-294VDQVV---------------------------------------------------------------------Q--R--
HUTG_LEGPH/47-315VHFCH---------------------------------------------------------------------E--N--
Q6LHE2_PHOPR/35-321YQKIV---------------------------------------------------------------------D--FF-
Q6LWW9_METMP/19-277SKDIL---------------------------------------------------------------------E--A--
Q6N0N3_RHOPA/14-309AYELA---------------------------------------------------------------------R--S--
Q6PH54_DANRE/25-322VSGAV---------------------------------------------------------------------G--A--
Q72EZ7_DESVH/23-282TRSVL---------------------------------------------------------------------D--A--
Q7V3X2_PROMM/30-287TQNVL---------------------------------------------------------------------K--M--
SPEB_BACAN/23-284VSKLL---------------------------------------------------------------------D--A--
Q81VP0_BACAN/4-292VDHII---------------------------------------------------------------------E--E--
Q81Y48_BACAN/37-311VGHVT---------------------------------------------------------------------K--VN-
Q82VE5_NITEU/46-310ARHIL---------------------------------------------------------------------A--S--
HUTG_VIBPA/47-325CANLI---------------------------------------------------------------------S--EA-
Q88KU3_PSEPK/34-298AEHIL---------------------------------------------------------------------Q--A--
Q8RG18_FUSNN/503-779VNEAV---------------------------------------------------------------------I--D--
Q8TJ04_METAC/18-281VKGLL---------------------------------------------------------------------N--D--
Q8XMY7_CLOPE/21-278STKVV---------------------------------------------------------------------E--D--
Q92LN4_RHIME/3-295VHDTA---------------------------------------------------------------------R--K--
Q92MV8_RHIME/71-339ISQIV---------------------------------------------------------------------D--A--
Q92QR6_RHIME/44-306ASKIL---------------------------------------------------------------------K--S--
GPUA_PSEAE/36-307YRQVH---------------------------------------------------------------------A--A--
Q9KLD2_VIBCH/33-297TSEIL---------------------------------------------------------------------K--S--
HUTG_VIBCH/44-322CAQVI---------------------------------------------------------------------Q--QA-
U5L6E1_9BACI/3-293VDEVI---------------------------------------------------------------------K--G--
U5LEA0_9BACI/39-314ACSLA---------------------------------------------------------------------K--GF-

PF00850

Q5K8L3_CRYNJ/30-447CRLLA-----TD--------------------------------------------------------------K-----
HDAC4_HUMAN/675-992VFKVA-----TG----------------------------------------------------------EL--K-----
A0DIS2_PARTE/35-343VDKIL-----KA----------------------------------------------------------EW--R-----
A0LGT0_SYNFM/21-313VRMVM-----EG----------------------------------------------------------II--D-----
A1W7T1_ACISJ/39-355AARLA-----AG----------------------------------------------------------E---R-----
A2BL29_HYPBU/22-314VDKLV-----EG----------------------------------------------------------DC--N-----
A3DNS7_STAMF/22-312GLSIG-----EQ--------------------------------------------------------------E-----
A3GH68_PICST/31-340AKTLIREASSSI--------------------------------------------------------------Q-----
A4S2N1_OSTLU/203-605VDRVL-----------------------------------------------------------------DGKNR-----
A4S898_OSTLU/34-312VDLAM---------------------------------------------------------------------K-----
A4X4X7_SALTO/21-317AEAVW-----RG----------------------------------------------------------TA--R-----
A4YNH4_BRASO/59-370AQLLL-----DG----------------------------------------------------------E---D-----
A6QAF4_SULNB/20-301VDGIK-----KG----------------------------------------------------------EF--E-----
A6R4B6_AJECN/60-359ARKLC-----NN--------------------------------------------------------------Q-----
A6VSZ5_MARMS/20-304VDLVM-----TS----------------------------------------------------------EM--D-----
A7SSG8_NEMVE/31-332VEHVA-----TN----------------------------------------------------------KS--S-----
A7SUP8_NEMVE/33-329ADMLK-----TG--------------------------------------------------------------Q-----
A7TRW5_VANPO/20-403SDFIEK---SSS--------------------------------------------------------------Q-----
A8ABS4_IGNH4/20-308AQRAV-----EG----------------------------------------------------------DH--W-----
A8ZT95_DESOH/22-309VDLLL-----SG----------------------------------------------------------AC--R-----
A9A062_DESOH/265-572ADDLL-----EG----------------------------------------------------------R---Y-----
A9B5I1_HERA2/19-308TDAVL-----SG----------------------------------------------------------RH--A-----
B0T7F0_CAUSK/36-327VDAVM-----SG----------------------------------------------------------EV--D-----
B2JV93_PARP8/21-308VDAVL-----AG----------------------------------------------------------EA--R-----
B4U8T2_HYDS0/19-303IEDIK-----DA----------------------------------------------------------KQ--E-----
C5KDG6_PERM5/349-869LVAVL-----SG----------------------------------------------------------SV--P-----
E0TF48_PARBH/17-291ARRAL---------------------------------------------------------------------K-----
E2RU63_GIAIC/23-319CAHLN-----HG--------------------------------------------------------------M-----
O67135_AQUAE/21-313IEEFL-----KG----------------------------------------------------------N---------
HDA1_YEAST/83-394CKAVV-----EG----------------------------------------------------------RV--K-----
Q02CA3_SOLUE/20-310VDAVL-----TG----------------------------------------------------------AA--R-----
Q0A6Z7_ALKEH/48-335VEAVV-----QG----------------------------------------------------------DA--E-----
Q0ARF0_MARMM/20-307VNQVIA---DEG--------------------------------------------------------------G-----
Q15WQ0_PSEA6/26-300SSLAL---------------------------------------------------------------------E-----
Q1CZX8_MYXXD/27-313VEAVM-----KG----------------------------------------------------------EA--R-----
HDA6_CAEEL/446-747VDEIF-----EK----------------------------------------------------------DAGQR-----
Q29CG7_DROPS/39-325GKLAL---------------------------------------------------------------------D-----
Q2FQW8_METHJ/20-310ADAVL-----NQ----------------------------------------------------------EV--R-----
Q2IF50_ANADE/22-318AERVA-----RG----------------------------------------------------------EA--R-----
Q2KBQ8_RHIEC/20-308VDDVF-----SG----------------------------------------------------------AA--D-----
Q2LVD3_SYNAS/21-310ISMVA-----SG----------------------------------------------------------KL--D-----
Q2R9B1_ORYSJ/38-341ARALV-----DG--------------------------------------------------------------A-----
Q2S035_SALRD/19-312ARLIG-----DG----------------------------------------------------------DA--T-----
Q2SC27_HAHCH/22-314AHKAI------E--------------------------------------------------------------E-----
Q30PJ4_SULDN/264-571ADAVI-----NG----------------------------------------------------------T---H-----
Q31EP6_HYDCU/54-346NLAIY-----DR----------------------------------------------------------KI--D-----
Q31HC2_HYDCU/19-303IDAIM-----HR----------------------------------------------------------EA--K-----
Q38C74_TRYB2/31-322AVLLN-----SG--------------------------------------------------------------A-----
Q39UV4_GEOMG/22-314ARLVT-----EE----------------------------------------------------------GY--D-----
Q3AFN8_CARHZ/22-318AELIY-----EG----------------------------------------------------------EA--D-----
Q4D762_TRYCC/59-387ARLLA-----QP--------------------------------------------------------------G-----
Q4FNF7_PELUB/20-305IDGVQ-----NK----------------------------------------------------------DF--K-----
Q4KAJ1_PSEF5/25-339LALID-----EG----------------------------------------------------------Q---D-----
Q4MYQ3_THEPA/32-415CNLIM-----KSTLSDTKTETQTVKTEPNSNPNSSQHTEQYLSQNPDGKGEENDSDPYGSDSGLNLLYPTRI--R-----
Q4QAJ4_LEIMA/102-403AEALV-----RG--------------------------------------------------------------D-----
Q4QI60_LEIMA/65-431SVAAL-----RGVAAS-------------------------------------------------RSGTASSAAG-----
HDA21_DICDI/1078-1485IDNVM-----KG----------------------------------------------------------NV--T-----
Q5KKR8_CRYNJ/39-367AEKLN-----EG--------------------------------------------------------------I-----
Q60DG7_ORYSJ/56-349MKHIL-----DG----------------------------------------------------------HA--K-----
Q6AJC0_DESPS/25-317IDLLE-----AG----------------------------------------------------------DA--R-----
Q6AKN4_DESPS/22-310ADQIM-----NG----------------------------------------------------------EI--D-----
Q6C3Y5_YARLI/64-351ARQLM-----SG--------------------------------------------------------------Q-----
Q6CGA7_YARLI/268-647VDALY-----DSDVSETLQKLS--------------------------------------IGDTPPPEGKTSTFS-----
Q6FWB7_CANGA/19-382AQYIL----EGS--------------------------------------------------------------E-----
Q741C0_MYCPA/20-306VDRVL-----AG----------------------------------------------------------DV--Q-----
Q7PS30_ANOGA/126-423VESVW-----SG----------------------------------------------------------TV--Q-----
Q8EP92_OCEIH/22-320VDAVL-----NN----------------------------------------------------------NY--T-----
Q8I4I9_CAEEL/27-317VKAAM-----EG----------------------------------------------------------KI--H-----
Q8IR37_DROME/563-860VDSVL-----RG----------------------------------------------------------ES--R-----
HDA14_ARATH/80-386VDSVI-----AA----------------------------------------------------------SR--N-----
Q9K0J2_NEIMB/41-327VDMVM-----NR----------------------------------------------------------KA--W-----
Q9U266_CAEEL/26-318MTSVM-----AA----------------------------------------------------------K---R-----
G4VAN3_SCHMA/18-356ASALI-----CR--------------------------------------------------------------H-----
K3ZRV5_SETIT/232-519ASLIV-----SG----------------------------------------------------------RV--H-----
Q22CW6_TETTS/28-319IDLIK-----SK----------------------------------------------------------SW--H-----
Q2G292_STAA8/25-322ADLIM-----SG----------------------------------------------------------KV--L-----
Q8F7M9_LEPIN/22-309SEFLI-----SG----------------------------------------------------------TI--K-----
V6EZA3_9PROT/20-307VDAVA-----TK----------------------------------------------------------QA--R-----
W7X9B2_TETTS/39-342VDRII-----SK----------------------------------------------------------QW--K-----

PF12640

B4E7R4_BURCJ/13-201--------------------------------------------------FV------VESHHHV---------------
A8MKG9_ALKOO/16-197--------------------------------------------------YI------VENHHEV---------------
Q12VI5_METBU/19-180--------------------------------------------------YF------IIDHAAA---------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------YV------FDPHRLA---------------
Q6ARQ8_DESPS/48-185--------------------------------------------------WL------MDDHKWA---------------
C6C1I6_DESAD/28-165--------------------------------------------------FI------MDNHRAA---------------
C5KCK7_PERM5/16-196--------------------------------------------------VI------VDSHTEG---------------
B7FS57_PHATC/11-216--------------------------------------------------VV------VESHQHA---------------
C3XU32_BRAFL/3-238--------------------------------------------------QI------V---LQA---------------
CE022_DANRE/15-248--------------------------------------------------WI------VEDHHEV---------------
Q1RMV5_BOVIN/19-257--------------------------------------------------WV------VEDHQEV---------------
A7UTP5_ANOGA/103-265--------------------------------------------------FV------VEDHHEV---------------
B3M7P2_DROAN/118-284--------------------------------------------------FI------VDYHNDV---------------
B4N4R0_DROWI/108-274--------------------------------------------------FI------VDYHNDV---------------
A7SLH9_NEMVE/10-251--------------------------------------------------KI------CENHDEV---------------
B7PMV1_IXOSC/7-174--------------------------------------------------YV------VEPHHHA---------------
A9VAD6_MONBE/67-213--------------------------------------------------RE------RERERES---------------
A6UX51_META3/57-190--------------------------------------------------RI------VKKHHEA---------------
D0MD43_RHOM4/57-211--------------------------------------------------LI------VDEHHEI---------------

PF00491

E7F8R4_DANRE/27-322-------------------GN-----TC----------------------VM------LGGDHSL---------------
SPEB3_SCHPO/85-387SSFTDH----DGFAKNDTVLP-----RV----------------------LS------LGGDHTI---------------
Q6BJQ5_DEBHA/76-370SK------------NSTVTPP-----RY----------------------IA------LGGDHSV---------------
Q6BVQ4_DEBHA/136-428-------------------KP-----TTPSLS-------------KVSRILT------LGGDHTV---------------
Q6BWL4_DEBHA/179-480-----------------GNKP-----KI----------------------IT------MGGDHTV---------------
A1RXI5_THEPD/26-288-------------------GK-----GL----------------------IM------LGGDHFS---------------
SPEB_MOUSE/77-350-------------------GC-----IP----------------------LT------LGGDQTI---------------
A4XKN0_CALS8/20-281-------------------DK-----TP----------------------IF------LGGEHLI---------------
A4J1T2_DESRM/21-282-------------------DK-----FP----------------------LV------LGGEHLV---------------
A1VQK9_POLNA/34-307-------------------GC-----IP----------------------LT------LGGDHTI---------------
Q2K8A9_RHIEC/46-316-------------------GV-----VP----------------------LA------VGGDHSV---------------
B2JW15_PARP8/32-305-------------------GK-----LA----------------------LT------AGGDHSI---------------
Q982X2_RHILO/42-307-------------------GA-----FL----------------------LT------LGGDHFV---------------
HUTG_BACHD/35-311-------------------EQ-----NWQ--------------------PIV------LGGDHSI---------------
HUTG_RHOJR/40-314-----------------DAGQ-----FP----------------------VV------LGGGHEV---------------
ARGI1_HUMAN/6-305-------------------GR-----IS----------------------LV------LGGDHSL---------------
SPEB_CHRVO/44-311-------------------GA-----KM----------------------LT------FGGDHYV---------------
ARGI_BACSU/3-292-------------------KK-----FP----------------------LV------LGGDHSI---------------
Q97ZX8_SULSO/24-289-------------------GK-----IT----------------------IS------IGGEHTI---------------
HUTG_VIBVY/45-328-----------------PCVP------V----------------------IT------LGGGHEV---------------
A9BRG6_DELAS/16-312-------------------GE-----LP----------------------LM------LGGDHSL---------------
HUTG_AROAE/40-323-----------------EAGH-----VP----------------------IG------LGGGHEI---------------
A1RB53_PAEAT/29-311-------------------RS-----VP----------------------CV------IGGDHSI---------------
Q1J2W9_DEIGD/37-306-------------------AR-----LP----------------------VF------LGGDHSV---------------
Q2JER0_FRACC/40-318-------------------GT-----IP----------------------LV------IGGDHSI---------------
Q3J346_RHOS4/3-296-------------------DG-----FP----------------------IV------MGGDHSL---------------
A9B324_HERA2/22-290-------------------GK-----LV----------------------CV------LGGEHSV---------------
Q9YBG0_AERPE/29-298-------------------GK-----VP----------------------VV------LGGEHLV---------------
Q1GI44_RUEST/34-307-------------------GV-----LP----------------------FA------MGGDHSI---------------
Q9HJB2_THEAC/33-293-------------------GK-----IP----------------------IM------LGGEHSI---------------
A0RXD6_CENSY/22-283-------------------GR-----QV----------------------II------LGGEHSI---------------
A8LLU9_DINSH/46-312-------------------GA-----AP----------------------LT------MGGDHYI---------------
SPEB_BACHD/22-286-------------------QK-----MP----------------------IG------LGGEHLV---------------
Q0W940_METAR/16-280-------------------GK-----IP----------------------IM------MGGEHSL---------------
Q6MHV0_BDEBA/36-309-------------------NK-----RF----------------------LA------VGGDHST---------------
Q98MW3_RHILO/19-296-------------------PA-----VP----------------------IL------LGGDDSV---------------
A0LG67_SYNFM/34-297-------------------GK-----LP----------------------VL------LGGEHLL---------------
HUTG_BACSU/35-311-------------------HP-----DWV--------------------PLI------LGGDNSI---------------
Q9K5Y7_BACHD/5-297-------------------HS-----FP----------------------LI------LGGDHSI---------------
Q164F4_ROSDO/46-312-------------------DV-----PT----------------------VT------LGGDHYV---------------
Q164F5_ROSDO/34-308-------------------DA-----MP----------------------LA------IGGDHSI---------------
Q15X44_PSEA6/42-323-----------------KQNC-----FV----------------------IG------LGGGHEI---------------
Q11J67_CHESB/42-307-------------------GA-----FL----------------------VT------LGGDHFV---------------
Q1AWJ4_RUBXD/5-295-------------------GA-----LP----------------------VF------LGGDHSI---------------
Q5WL42_BACSK/7-290-------------------HA-----FP----------------------FV------LGGDHSI---------------
Q7UZH9_PROMP/24-288-------------------KL-----TP----------------------IM------LGGEHSI---------------
Q6CLB8_KLULA/137-438--------------------S-----SLVHKE-------------QPPKLIT------LGGDHTI---------------
A0JT79_ARTS2/57-331-------------------AG-----GSK--------------------LVT------LGGDHTI---------------
Q2KVZ3_BORA1/13-287-------------------GA-----IP----------------------VT------MGGDGAV---------------
B2UBQ2_RALPJ/40-316-----------------DRGA-----FP----------------------IA------LGGGHEI---------------
Q165U0_ROSDO/35-314-------------------GA-----LP----------------------VV------IGGDHSI---------------
B1YHV3_EXIS2/22-286-------------------GK-----FP----------------------LG------MGGEHLV---------------
Q5WIT9_BACSK/27-306-------------------GT-----FL----------------------IG------LGGDHGV---------------
A1C610_ASPCL/68-380-------------------PA-----ATPADSRYGTK----GISAGRAKLVT------LGGDHSV---------------
Q1AS11_RUBXD/33-307-------------------GV-----FP----------------------VV------LGGDHSI---------------
Q28QX8_JANSC/39-314-------------------DI-----RP----------------------FM------VGGDHLC---------------
A1WGI6_VEREI/22-320-------------------GH-----LP----------------------IL------LGGDHCL---------------
A1WER7_VEREI/22-295-------------------GC-----RP----------------------IT------LGGDHTI---------------
A1T3A2_MYCVP/88-364-------------------GV-----MP----------------------IV------LGGDHSI---------------
A8LRL4_DINSH/4-296-------------------QG-----FP----------------------IF------LGGDHAL---------------
A5V551_SPHWW/4-298-------------------GR-----LP----------------------IF------MGGDHAL---------------
Q11NZ4_CYTH3/3-310--------------------Q-----YP----------------------LV------ISGDHSN---------------
Q5V4R8_HALMA/3-300-------------------GR-----FP----------------------LV------LGGDHSI---------------
Q12BY7_POLSJ/72-342-------------------GV-----IP----------------------LA------VGGDHSI---------------
HUTG_VIBF1/45-345-----------------ANRH-----QV----------------------IV------LGGGHEV---------------
Q3IVT5_RHOS4/32-308-------------------GA-----VP----------------------FG------IGGDHSV---------------
HUTG_GEOKA/44-315-----------------KNGM-----AS----------------------IV------IGGGHET---------------
SPEB_BLOFL/33-298-------------------RK-----KI----------------------LL------LGGDHYI---------------
A0ZFA2_NODSP/30-338-------------------GK-----RV----------------------AV------IGGDHSV---------------
A4XT95_PSEMY/38-311-------------------GI-----KP----------------------LT------LGGDHTI---------------
Q5WB32_BACSK/22-286-------------------GK-----FP----------------------LG------LGGEHLL---------------
Q6C6P6_YARLI/9-306-------------------GR-----FV----------------------LT------IGGDHSI---------------
Q12UU8_METBU/17-282-------------------GK-----LP----------------------IM------IGGEHSL---------------
Q213G1_RHOPB/11-309-------------------GA-----IP----------------------IF------LGGDHTL---------------
Q28PV5_JANSC/46-313-------------------GA-----AV----------------------IT------LGGDHSI---------------
A0QRD0_MYCS2/43-317-------------------PD-----QR---------------------VVL------LGGDHTI---------------
ARGI_NEUCR/47-354-------------------GR-----LV----------------------LT------LGGDHSI---------------
Q12LW8_SHEDO/33-299-------------------DK-----GL----------------------LS------FGGDHFV---------------
Q2W8C1_MAGSA/22-290--------------------------------------------------LA------VGGDHTI---------------
GBU1_KLULA/61-358-------------------ES-----QTSDNN-------------LPPRFVT------LGGDHSI---------------
A1SLP1_NOCSJ/31-312-------------------GA-----VP----------------------LV------LGGDHSI---------------
Q28VR8_JANSC/34-309-------------------GA-----IP----------------------VT------LGGDHSI---------------
Q0UYW2_PHANO/16-320-------------------GK-----MV----------------------LT------LGGDHSI---------------
Y309_METJA/21-281-------------------NK-----KI----------------------IV------FGGEHSI---------------
Q9RZ04_DEIRA/29-298-------------------CR-----VP----------------------VF------LGGDHSV---------------
ARGI_KLULA/13-315-------------------GR-----LA----------------------VT------LGGDHSI---------------
A2BIW8_HYPBU/25-300-------------------DK-----LL----------------------IV------LGGEHTI---------------
Q21RM0_RHOFT/15-309-------------------RR-----LP----------------------IM------LGGDHCL---------------
Q6L151_PICTO/19-280-------------------KK-----VP----------------------IM------LGGEHSI---------------
A0A0D1DTD8_USTMA/13-318-------------------GK-----LP----------------------LT------LGGDHSL---------------
A1B165_PARDP/30-308-------------------GA-----LP----------------------LI------IGGDHGI---------------
Q16AD8_ROSDO/4-296-------------------DG-----FP----------------------IF------MGGDHAL---------------
Q3SMM1_THIDA/8-294-------------------GN-----FP----------------------LV------VGGDHSC---------------
A0A1D8PP00_CANAL/12-313-------------------GK-----LP----------------------IT------IGGDHSI---------------
Q7VSA1_BORPE/8-302-------------------ER-----LP----------------------IL------LGGDHSL---------------
A0BHR2_PARTE/9-311-------------------NK-----FM----------------------LN------IGGDHSV---------------
Q4JAE9_SULAC/24-287-------------------GK-----IV----------------------VS------IGGEHSI---------------
Q975R8_SULTO/24-287-------------------GK-----II----------------------IG------IGGEHSV---------------
Q1LGD2_CUPMC/2-296-------------------GQ-----LP----------------------LL------MGGDHCL---------------
ARGI_AGRFC/19-313-------------------CD-----LP----------------------VF------LGGDHSM---------------
Q1D421_MYXXD/27-337-------------------GK-----RV----------------------AA------VGGDHSI---------------
SPEB1_SCHPO/74-375-------------------KP-----TSYSEKDGYA-----LDGSVLPRVIT------LGGDHTI---------------
ARGI_YEAST/13-329-------------------NR-----FP----------------------LT------LGGDHSI---------------
A9BN56_DELAS/71-341-------------------GV-----IP----------------------LS------AGGDHSI---------------
A0A1D8PPP3_CANAL/50-340-------------------KS-----SNNTEI--------------PPRYIA------LGGDHSV---------------
A1RBR9_PAEAT/55-335-------------------SG-----GNGLSE--------------DKRLIS------IGGDHTI---------------
A1VTU0_POLNA/3-297-------------------GE-----MP----------------------ML------LGGDHCL---------------
Q0UMJ9_PHANO/68-378-------------------A-------PTEKSADSG-----VGYFKRPKLLT------LGGDHSI---------------
A1SM48_NOCSJ/41-314-------------------AD-----GRN--------------------VVL------LGGDHTV---------------
Q1GI45_RUEST/67-333-------------------DT-----AS----------------------VA------IGGDHYV---------------
Q1IHQ4_KORVE/16-311-------------------GR-----VP----------------------LA------LGGDHSM---------------
Q6L2W0_PICTO/21-293--------------------S-----RF----------------------IA------MGGDHSI---------------
Q89H72_BRADU/11-308-------------------GA-----LP----------------------IF------LGGDHTL---------------
Q489X2_COLP3/36-310-------------------NI-----KP----------------------VT------VGGDHTI---------------
Q7V9I4_PROMA/29-293-------------------GM-----KP----------------------LL------IGGEHSI---------------
SPEB1_SYNY3/26-297-------------------GK-----FV----------------------VA------IGGEHAI---------------
Q6FP31_CANGA/10-317-------------------DR-----FP----------------------VT------LGGDHSI---------------
A5G414_GEOUR/41-319-------------------HS-----IP----------------------FV------LGGDHSF---------------
Q3SVS2_NITWN/5-302-------------------GA-----IP----------------------IF------LGGDHSL---------------
SPEB2_SCHPO/89-401-------------------KA-----TASPASNNLKTAGLAKDGIFHPRLIT------LGGDHSI---------------
Q8XPR0_RALSO/29-309-------------------GA-----LP----------------------IV------LGGDHGI---------------
Q47TW8_THEFY/41-314-------------------SQ-----GTR--------------------LVT------LGGDHTI---------------
A9KQ98_LACP7/18-281-------------------GK-----FP----------------------LM------IGGEHLV---------------
A1BCD2_PARDP/35-312-------------------GA-----LP----------------------LS------VGGDHLT---------------
ARGI_ASHGO/93-395-------------------GR-----LP----------------------VT------LGGDHSI---------------
A1B3P5_PARDP/3-295-------------------EG-----MP----------------------IF------LGGDHAL---------------
Q1QTM4_CHRSD/39-312-------------------DA-----VP----------------------LT------LGGDHTL---------------
Q6C732_YARLI/86-381-------------------TT-----STLNAT-------------HIPRAIL------MGGDHTT---------------
A0LDK6_MAGMM/20-293-------------------GR-----MV----------------------VG------LGGEHSV---------------
Q47D78_DECAR/17-302-------------------DE-----FP----------------------VV------IGGDHSI---------------
Q3JAG2_NITOC/2-290-------------------GE-----PF----------------------IV------LGGDHSC---------------
A3DDA1_CLOTH/24-286-------------------NK-----FP----------------------LF------IGGEHLI---------------
A1CKP4_ASPCL/16-320-------------------GK-----FV----------------------LT------LGGDHSI---------------
ARGI1_SCHPO/22-319-------------------QR-----IA----------------------VN------IGGDHSL---------------
HUTG_PHOLL/44-316-----------------CQNV-----RT----------------------LV------LGGGHET---------------
A0A1U7EWX2_NATPD/45-332-------------------GT-----MP----------------------VV------IGGDHYC---------------
SPEB2_SYNY3/83-361-------------------GA-----FP----------------------II------LGGDHSI---------------
Q5LKZ4_RUEPO/42-315-------------------GI-----LP----------------------VT------AGGDHLT---------------
Q2RHH4_MOOTA/26-287-------------------AR-----IP----------------------FF------MGGEHLV---------------
Q17HI3_AEDAE/32-333-------------------DR-----LC----------------------LT------LGGDHAI---------------
A3CU48_METMJ/19-276-------------------NK-----VP----------------------VM------LGGEHTA---------------
HUTG_HAHCH/40-316-----------------QAGH-----SP----------------------IV------LGGGHDV---------------
Q8RA93_CALS4/28-290-------------------GK-----KG----------------------IF------LGGEHLI---------------
Q8END5_OCEIH/29-310-------------------GK-----FP----------------------IA------FGGDHGI---------------
Q5ANN8_CANAL/115-414--------------------------P-GNVN-------------QHPKIIT------LGGDHTI---------------
Q2LPR8_SYNAS/65-343-------------------GS-----IP----------------------VT------VGGDHSI---------------
A1ST87_PSYIN/33-299-------------------GK-----AI----------------------LS------LGGDHFV---------------
ARGI1_ARATH/63-338--------------------L-----RP----------------------LV------LGGDHSI---------------
A0R0G1_MYCS2/40-312-------------------SK-----GTR--------------------AVV------LGGDHSV---------------
A1CFK4_ASPCL/83-374-------------------QT-----NSTTNG-------------SVPRIIT------LGGDHTT---------------
B8I5M8_CLOCE/21-282-------------------GK-----KP----------------------LM------IGGEHLV---------------
A1TIE4_ACIAC/8-305-------------------GR-----LP----------------------VM------LGGDHNL---------------
A1T9H7_MYCVP/46-324-------------------GI-----VP----------------------VI------LGGDHSI---------------
Q97VA3_SULSO/30-299-------------------KN-----LV---------------------PFI------AGGDHSI---------------
Q4J720_SULAC/30-299-------------------KK-----LV---------------------PFI------AGGDHSI---------------
Q3J2B4_RHOS4/46-312-------------------GA-----GA----------------------LT------LGGDHSI---------------
A1CGK0_ASPCL/61-357-------------------ET-----N-VTEGW------------KHPRIIS------LGGDHSI---------------
Q10Y47_TRIEI/24-296-------------------GK-----FV----------------------IA------IGGEHSI---------------
A5G278_ACICJ/28-297--------------------------------------------------VA------LGGEHGI---------------
ARGI_SOYBN/71-346--------------------L-----RP----------------------LI------LGGDPSI---------------
O76895_DROME/30-333-------------------NT-----QF----------------------LA------IGGDHAI---------------
A1W2M6_ACISJ/2-298-------------------GQ-----LP----------------------LL------MGGDHCL---------------
Q1GHG8_RUEST/4-296-------------------RG-----MP----------------------IF------LGGDHAL---------------
Q65P52_BACLD/4-300-------------------GA-----FP----------------------LV------LGGDHSI---------------
Q67TJ0_SYMTH/28-290-------------------GK-----LS----------------------LM------MGGEHLV---------------
A4XZN2_PSEMY/43-309-------------------GA-----AM----------------------LT------LGGDHFI---------------
A4YE21_METS5/29-295-------------------ST-----L-----------------------FI------AGGDHSI---------------
Q6ANF4_DESPS/59-334-------------------DI-----IP----------------------VV------MGGDHSI---------------
Q222F3_RHOFT/24-298-------------------GH-----HC----------------------VF------LGGDHSV---------------
ARGI2_MOUSE/24-324-------------------GY-----SC----------------------VT------MGGDHSL---------------
Q315M1_DESAG/23-287-----------------ENPP-----VP----------------------VL------LGGEHTV---------------
A7IL28_XANP2/50-316-------------------GA-----HL----------------------MT------LGGDHFL---------------
Q18A84_PEPD6/21-285-------------------SK-----VP----------------------FM------IGGEHLV---------------
Q5V6R7_HALMA/44-335--------------------A-----TP----------------------IV------IGGDHSI---------------
Q5LRK8_RUEPO/33-325-------------------RG-----LP----------------------IF------LGGDHAL---------------
Q9K8M2_BACHD/4-296-------------------GY-----FP----------------------LV------LGGDHSI---------------
Q3ABP1_CARHZ/20-281-------------------GK-----IP----------------------LI------IGGEHLI---------------
A9CJC2_AGRFC/42-307-------------------TD-----YL----------------------LT------LGGDHFI---------------
Q7U3K9_SYNPX/21-280-------------------GL-----KP----------------------LM------LGGEHSI---------------
A1STQ5_PSYIN/47-343-----------------NQDH-----KV----------------------IV------LGGGHEI---------------
Q7VY32_BORPE/13-287-------------------GA-----IP----------------------IT------MGGDGAV---------------
Q9CL61_PASMU/34-299-------------------GK-----RC----------------------LT------FGGDHFI---------------
A4IB49_LEIIN/14-315-------------------GR-----FP----------------------LT------IGGDHSI---------------
A5UXL8_ROSS1/34-305-------------------RV-----VT----------------------LS------LGGDHSV---------------
A9WCM8_CHLAA/41-307-------------------GK-----LL----------------------IS------LGGGNDI---------------
B4EIP8_BURCJ/49-320-------------------DC-----KP----------------------IT------LGGDHTI---------------
B4ELX2_BURCJ/44-308-------------------GA-----KM----------------------LT------LGGDHYI---------------
B5GLC8_STRC2/31-301-------------------NA-----AF----------------------LM------IGGDHSL---------------
B9A9C6_BOMMO/12-304-------------------GR-----IA----------------------VT------VGGDHSI---------------
C0ZIM2_BREBN/4-293-------------------GR-----FP----------------------LV------LGGDHSI---------------
D0J7J2_COMT2/7-302-------------------HR-----LP----------------------IL------LGGDHTL---------------
D5AV62_RHOCB/6-296-------------------SD-----LP----------------------VF------LGGDHSM---------------
D5SKW9_STRC2/134-404-------------------ND-----AF----------------------LM------LGGDHSL---------------
E3GWR7_METFV/23-279-------------------GM-----IP----------------------IV------LGGEHSI---------------
E9CYX8_COCPS/18-317-------------------GR-----LV----------------------LT------LGGDHSI---------------
F1QJZ3_DANRE/86-357-------------------GC-----IP----------------------LT------LGGDHTI---------------
F6SZP1_XENTR/61-332-------------------GC-----IP----------------------LT------LGGDHTI---------------
A0A0D8JTR5_COCIM/78-370NT------------TDVSSVP-----RI----------------------IT------LGGDHTT---------------
K5X448_AGABU/13-305-------------------GM-----LP----------------------VT------LGGDHSL---------------
SPEB_NEIMB/35-299-------------------GK-----RC----------------------LS------LGGDHFI---------------
Q05AR1_XENTR/27-324-------------------GH-----TC----------------------VT------LGGDHSL---------------
Q24ZK6_DESHY/5-295-------------------EV-----IP----------------------LI------IGGDHSL---------------
Q251M0_DESHY/26-286-------------------GK-----FP----------------------IF------LGGEHLV---------------
Q2FW91_STAA8/6-296-------------------NR-----FP----------------------LV------LGGDHSI---------------
Q2K3I8_RHIEC/7-299-------------------GR-----FP----------------------LI------LGGDHSL---------------
Q2K9W6_RHIEC/65-328-------------------GA-----FL----------------------LT------LGGDHYV---------------
Q3IKA3_PSEHT/33-297-------------------GK-----TL----------------------LG------LGGDHFV---------------
Q46IA1_PROMT/31-292-------------------NL-----KP----------------------LI------IGGEHSI---------------
Q4FL05_PELUB/40-312-------------------VG-----GI----------------------IS------LGGDHTI---------------
Q5KIC1_CRYNJ/70-373VSPEKMQNLNMQRGLDGKIHP-----RI----------------------IT------LGGDHTI---------------
Q5L3P6_GEOKA/3-294-------------------GR-----FP----------------------LV------LGGDHSI---------------
HUTG_LEGPH/47-315-------------------GH-----QI----------------------CA------FGGGHEI---------------
Q6LHE2_PHOPR/35-321-----------------DKGH-----FP----------------------VI------LGGGHEI---------------
Q6LWW9_METMP/19-277-------------------KK-----IP----------------------VM------IGGEHSV---------------
Q6N0N3_RHOPA/14-309-------------------GA-----VP----------------------LF------MGGDHSL---------------
Q6PH54_DANRE/25-322-------------------GH-----TC----------------------IM------LGGDHSL---------------
Q72EZ7_DESVH/23-282-------------------GG-----TP----------------------VL------LGGEHTV---------------
Q7V3X2_PROMM/30-287-------------------GL-----RP----------------------LM------LGGEHSI---------------
SPEB_BACAN/23-284-------------------GK-----FP----------------------LG------LGGEHLV---------------
Q81VP0_BACAN/4-292-------------------GR-----FP----------------------LV------LGGDHSI---------------
Q81Y48_BACAN/37-311------------------PNM-----IP----------------------IV------LGGDHSI---------------
Q82VE5_NITEU/46-310-------------------GA-----RM----------------------LT------FGGDHSI---------------
HUTG_VIBPA/47-325-----------------LPHT-----PT----------------------IV------LGGGHEI---------------
Q88KU3_PSEPK/34-298-------------------GC-----AM----------------------LT------LGGDHFI---------------
Q8RG18_FUSNN/503-779-------------------GY-----RP----------------------IL------VGGDHSI---------------
Q8TJ04_METAC/18-281-------------------GK-----LP----------------------IM------LGGEHSL---------------
Q8XMY7_CLOPE/21-278-------------------GK-----IP----------------------AM------IGGEHLV---------------
Q92LN4_RHIME/3-295-------------------GH-----FP----------------------II------LGGDHAL---------------
Q92MV8_RHIME/71-339-------------------GV-----LP----------------------LS------VGGDHSI---------------
Q92QR6_RHIME/44-306-------------------GA-----YL----------------------LT------LGGDHFV---------------
GPUA_PSEAE/36-307-------------------GT-----LP----------------------LS------VGGDHLV---------------
Q9KLD2_VIBCH/33-297-------------------GK-----TM----------------------LA------LGGDHFI---------------
HUTG_VIBCH/44-322-----------------LPHA-----RA----------------------IV------LGGGHEI---------------
U5L6E1_9BACI/3-293-------------------GS-----FP----------------------LV------LGGDHSI---------------
U5LEA0_9BACI/39-314------------------PES-----VS----------------------CL------IGGDHSV---------------

PF00850

Q5K8L3_CRYNJ/30-447-------------------AD-----WA----------------------VC-----WDGGRHHA-K-------------
HDAC4_HUMAN/675-992-------------------NG-----FA----------------------VV------RPPGHHA-E-------------
A0DIS2_PARTE/35-343-------------------NG-----FC----------------------SV------RPPGHHSGH-------------
A0LGT0_SYNFM/21-313-------------------NA-----FC----------------------AV------RPPGHHA-E-------------
A1W7T1_ACISJ/39-355-------------------AA-----FC----------------------ST------RPPGHHAGP-------------
A2BL29_HYPBU/22-314-------------------IA-----IV----------------------LG------RPPGHHAGR-------------
A3DNS7_STAMF/22-312-------------------RI-----FL----------------------IM------RPPGHHAGK-------------
A3GH68_PICST/31-340-------------------NV-----V-----------------------VN-----WYGGRHHC-T-------------
A4S2N1_OSTLU/203-605-------------------SA-----FV----------------------CC------RPPGHHAGI-------------
A4S898_OSTLU/34-312-------------------VG-----LC----------------------VN-----TAGGTHHA-H-------------
A4X4X7_SALTO/21-317-------------------RA-----VN----------------------VA-------GGLHHA-M-------------
A4YNH4_BRASO/59-370-------------------AV-----YA----------------------LC------RPPGHHAYR-------------
A6QAF4_SULNB/20-301-------------------RA-----FC----------------------AV------RPPGHHA-R-------------
A6R4B6_AJECN/60-359-------------------SE-----IA----------------------IN-----WSGGLHHA-K-------------
A6VSZ5_MARMS/20-304-------------------NA-----FC----------------------AI------RPPGHHA-E-------------
A7SSG8_NEMVE/31-332-------------------KH-----SI----------------------HINQLFFLRPPGHHA-D-------------
A7SUP8_NEMVE/33-329-------------------AK-----VA----------------------VN-----WQGGWHHA-Q-------------
A7TRW5_VANPO/20-403-------------------RT-----IA----------------------IN-----WDGGRHHA-I-------------
A8ABS4_IGNH4/20-308-------------------LA-----FA----------------------AV------RPPGHHARR-------------
A8ZT95_DESOH/22-309-------------------AF-----FS----------------------LV------RPPGHHA-L-------------
A9A062_DESOH/265-572-------------------LA-----YA----------------------LV------RPPGHHA-E-------------
A9B5I1_HERA2/19-308-------------------NS-----FA----------------------LV------RPPGHHA-T-------------
B0T7F0_CAUSK/36-327-------------------NA-----YA----------------------LL------RPAGHHSRP-------------
B2JV93_PARP8/21-308-------------------NV-----FC----------------------AT------RPCGHHA-E-------------
B4U8T2_HYDS0/19-303-------------------AA-----FC----------------------LV------RPPGHHA-E-------------
C5KDG6_PERM5/349-869-------------------TA-----FV----------------------LA------RPACHHVPYRVKSEDIHIEDDM
E0TF48_PARBH/17-291-------------------EG-----LS----------------------GQ-----LAGGTHHA-H-------------
E2RU63_GIAIC/23-319-------------------CD-----VA----------------------LN-----WMGGFHHA-K-------------
O67135_AQUAE/21-313-------------------VA-----FN----------------------PA-------GGMHHA-F-------------
HDA1_YEAST/83-394-------------------NS-----LA----------------------VV------RPPGHHA-E-------------
Q02CA3_SOLUE/20-310-------------------NA-----FC----------------------AV------RPPGHHA-N-------------
Q0A6Z7_ALKEH/48-335-------------------AA-----FA----------------------LV------RPPGHHA-E-------------
Q0ARF0_MARMM/20-307-------------------AA-----FV----------------------LA------RPPGHHAEP-------------
Q15WQ0_PSEA6/26-300-------------------HG-----KA----------------------LN-----LTGGYHHA-F-------------
Q1CZX8_MYXXD/27-313-------------------NG-----FA----------------------LV------RPPGHHA-E-------------
HDA6_CAEEL/446-747-------------------NA-----LV----------------------IV------RPPGHHA-S-------------
Q29CG7_DROPS/39-325-------------------YG-----WA----------------------IN-----LGGGFHHC-C-------------
Q2FQW8_METHJ/20-310-------------------NS-----FV----------------------LS------RPPGHHAGR-------------
Q2IF50_ANADE/22-318-------------------AA-----FA----------------------LV------RPPGHHA-W-------------
Q2KBQ8_RHIEC/20-308-------------------NV-----FV----------------------AA------RPPGHHA-E-------------
Q2LVD3_SYNAS/21-310-------------------NA-----FA----------------------LV------RPPGHHA-E-------------
Q2R9B1_ORYSJ/38-341-------------------SD-----IA----------------------IN-----WSGGMHHA-S-------------
Q2S035_SALRD/19-312-------------------RV-----LQ----------------------FG-------GGLHHA-H-------------
Q2SC27_HAHCH/22-314-------------------EA-----IV----------------------FN-----LGGGFHHA-F-------------
Q30PJ4_SULDN/264-571-------------------IA-----YA----------------------LV------RPPGHHA-E-------------
Q31EP6_HYDCU/54-346-------------------HG-----FA----------------------LL------RPPGHHA-L-------------
Q31HC2_HYDCU/19-303-------------------QA-----FC----------------------NI------RPPGHHA-E-------------
Q38C74_TRYB2/31-322-------------------VD-----TA----------------------IH-----WGGGMHHA-K-------------
Q39UV4_GEOMG/22-314-------------------IA-----FT----------------------MA-------GGWHHA-H-------------
Q3AFN8_CARHZ/22-318-------------------HV-----FN----------------------IA-------GGLHHA-L-------------
Q4D762_TRYCC/59-387-------------------RF-----AA----------------------IH-----WFGGRHHA-K-------------
Q4FNF7_PELUB/20-305-------------------NA-----FC----------------------AV------RPPGHHA-E-------------
Q4KAJ1_PSEF5/25-339-------------------SA-----FA----------------------LC------RPPGHHAAR-------------
Q4MYQ3_THEPA/32-415-------------------KG-----FA----------------------LV------RPPGHHA-T-------------
Q4QAJ4_LEIMA/102-403-------------------AT-----VA----------------------MN-----WAGGMHHA-A-------------
Q4QI60_LEIMA/65-431-------------------CVHPLVSFC----------------------LV------RPPGHHC-T-------------
HDA21_DICDI/1078-1485-------------------SA-----FV----------------------AA------RPPGHHAGR-------------
Q5KKR8_CRYNJ/39-367-------------------AD-----IA----------------------IN-----WAGGLHHA-K-------------
Q60DG7_ORYSJ/56-349-------------------IA-----YA----------------------LV------RPPGHHA-Q-------------
Q6AJC0_DESPS/25-317-------------------QI-----FC----------------------VI------RPPGHHA-E-------------
Q6AKN4_DESPS/22-310-------------------HG-----FA----------------------LI------RPPGHHA-E-------------
Q6C3Y5_YARLI/64-351-------------------HQ-----LC----------------------IN-----WYGGRHHG-K-------------
Q6CGA7_YARLI/268-647-------------------QA-----FV----------------------NI------RPPGHHC-H-------------
Q6FWB7_CANGA/19-382-------------------RT-----IA----------------------IN-----WDGGRHHS-M-------------
Q741C0_MYCPA/20-306-------------------NA-----FV----------------------AC------RPPGHHA-E-------------
Q7PS30_ANOGA/126-423-------------------NG-----MA----------------------IL------RPPGHHA-M-------------
Q8EP92_OCEIH/22-320-------------------HA-----LN----------------------LG-------GGLHHG-F-------------
Q8I4I9_CAEEL/27-317-------------------NG-----FA----------------------MV------RPPGHHSYG-------------
Q8IR37_DROME/563-860-------------------SG-----IC----------------------NV------RPPGHHA-E-------------
HDA14_ARATH/80-386-------------------SVDPPIGFA----------------------LI------RPPGHHA-V-------------
Q9K0J2_NEIMB/41-327-------------------HA-----FC----------------------AA------RPPGHHA-G-------------
Q9U266_CAEEL/26-318-------------------PG-----IA----------------------FI------RPPGHHA-M-------------
G4VAN3_SCHMA/18-356-------------------CE-----VV----------------------IN-----WGGGWHHA-K-------------
K3ZRV5_SETIT/232-519-------------------NG-----FA----------------------MV------RPPGHHA-G-------------
Q22CW6_TETTS/28-319-------------------TA-----FC----------------------CV------RPPGHHSGA-------------
Q2G292_STAA8/25-322-------------------NG-----CH----------------------L-------GGGLHHA-Q-------------
Q8F7M9_LEPIN/22-309-------------------NG-----FS----------------------LL------RPPGHHA-E-------------
V6EZA3_9PROT/20-307-------------------NA-----FC----------------------AV------RPPGHHA-E-------------
W7X9B2_TETTS/39-342-------------------NA-----FC----------------------II------RPPGHHSGE-------------

PF12640

B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------

PF00491

E7F8R4_DANRE/27-322--------------------------------------------------------------------------------
SPEB3_SCHPO/85-387--------------------------------------------------------------------------------
Q6BJQ5_DEBHA/76-370--------------------------------------------------------------------------------
Q6BVQ4_DEBHA/136-428--------------------------------------------------------------------------------
Q6BWL4_DEBHA/179-480--------------------------------------------------------------------------------
A1RXI5_THEPD/26-288--------------------------------------------------------------------------------
SPEB_MOUSE/77-350--------------------------------------------------------------------------------
A4XKN0_CALS8/20-281--------------------------------------------------------------------------------
A4J1T2_DESRM/21-282--------------------------------------------------------------------------------
A1VQK9_POLNA/34-307--------------------------------------------------------------------------------
Q2K8A9_RHIEC/46-316--------------------------------------------------------------------------------
B2JW15_PARP8/32-305--------------------------------------------------------------------------------
Q982X2_RHILO/42-307--------------------------------------------------------------------------------
HUTG_BACHD/35-311--------------------------------------------------------------------------------
HUTG_RHOJR/40-314--------------------------------------------------------------------------------
ARGI1_HUMAN/6-305--------------------------------------------------------------------------------
SPEB_CHRVO/44-311--------------------------------------------------------------------------------
ARGI_BACSU/3-292--------------------------------------------------------------------------------
Q97ZX8_SULSO/24-289--------------------------------------------------------------------------------
HUTG_VIBVY/45-328--------------------------------------------------------------------------------
A9BRG6_DELAS/16-312--------------------------------------------------------------------------------
HUTG_AROAE/40-323--------------------------------------------------------------------------------
A1RB53_PAEAT/29-311--------------------------------------------------------------------------------
Q1J2W9_DEIGD/37-306--------------------------------------------------------------------------------
Q2JER0_FRACC/40-318--------------------------------------------------------------------------------
Q3J346_RHOS4/3-296--------------------------------------------------------------------------------
A9B324_HERA2/22-290--------------------------------------------------------------------------------
Q9YBG0_AERPE/29-298--------------------------------------------------------------------------------
Q1GI44_RUEST/34-307--------------------------------------------------------------------------------
Q9HJB2_THEAC/33-293--------------------------------------------------------------------------------
A0RXD6_CENSY/22-283--------------------------------------------------------------------------------
A8LLU9_DINSH/46-312--------------------------------------------------------------------------------
SPEB_BACHD/22-286--------------------------------------------------------------------------------
Q0W940_METAR/16-280--------------------------------------------------------------------------------
Q6MHV0_BDEBA/36-309--------------------------------------------------------------------------------
Q98MW3_RHILO/19-296--------------------------------------------------------------------------------
A0LG67_SYNFM/34-297--------------------------------------------------------------------------------
HUTG_BACSU/35-311--------------------------------------------------------------------------------
Q9K5Y7_BACHD/5-297--------------------------------------------------------------------------------
Q164F4_ROSDO/46-312--------------------------------------------------------------------------------
Q164F5_ROSDO/34-308--------------------------------------------------------------------------------
Q15X44_PSEA6/42-323--------------------------------------------------------------------------------
Q11J67_CHESB/42-307--------------------------------------------------------------------------------
Q1AWJ4_RUBXD/5-295--------------------------------------------------------------------------------
Q5WL42_BACSK/7-290--------------------------------------------------------------------------------
Q7UZH9_PROMP/24-288--------------------------------------------------------------------------------
Q6CLB8_KLULA/137-438--------------------------------------------------------------------------------
A0JT79_ARTS2/57-331--------------------------------------------------------------------------------
Q2KVZ3_BORA1/13-287--------------------------------------------------------------------------------
B2UBQ2_RALPJ/40-316--------------------------------------------------------------------------------
Q165U0_ROSDO/35-314--------------------------------------------------------------------------------
B1YHV3_EXIS2/22-286--------------------------------------------------------------------------------
Q5WIT9_BACSK/27-306--------------------------------------------------------------------------------
A1C610_ASPCL/68-380--------------------------------------------------------------------------------
Q1AS11_RUBXD/33-307--------------------------------------------------------------------------------
Q28QX8_JANSC/39-314--------------------------------------------------------------------------------
A1WGI6_VEREI/22-320--------------------------------------------------------------------------------
A1WER7_VEREI/22-295--------------------------------------------------------------------------------
A1T3A2_MYCVP/88-364--------------------------------------------------------------------------------
A8LRL4_DINSH/4-296--------------------------------------------------------------------------------
A5V551_SPHWW/4-298--------------------------------------------------------------------------------
Q11NZ4_CYTH3/3-310--------------------------------------------------------------------------------
Q5V4R8_HALMA/3-300--------------------------------------------------------------------------------
Q12BY7_POLSJ/72-342--------------------------------------------------------------------------------
HUTG_VIBF1/45-345--------------------------------------------------------------------------------
Q3IVT5_RHOS4/32-308--------------------------------------------------------------------------------
HUTG_GEOKA/44-315--------------------------------------------------------------------------------
SPEB_BLOFL/33-298--------------------------------------------------------------------------------
A0ZFA2_NODSP/30-338--------------------------------------------------------------------------------
A4XT95_PSEMY/38-311--------------------------------------------------------------------------------
Q5WB32_BACSK/22-286--------------------------------------------------------------------------------
Q6C6P6_YARLI/9-306--------------------------------------------------------------------------------
Q12UU8_METBU/17-282--------------------------------------------------------------------------------
Q213G1_RHOPB/11-309--------------------------------------------------------------------------------
Q28PV5_JANSC/46-313--------------------------------------------------------------------------------
A0QRD0_MYCS2/43-317--------------------------------------------------------------------------------
ARGI_NEUCR/47-354--------------------------------------------------------------------------------
Q12LW8_SHEDO/33-299--------------------------------------------------------------------------------
Q2W8C1_MAGSA/22-290--------------------------------------------------------------------------------
GBU1_KLULA/61-358--------------------------------------------------------------------------------
A1SLP1_NOCSJ/31-312--------------------------------------------------------------------------------
Q28VR8_JANSC/34-309--------------------------------------------------------------------------------
Q0UYW2_PHANO/16-320--------------------------------------------------------------------------------
Y309_METJA/21-281--------------------------------------------------------------------------------
Q9RZ04_DEIRA/29-298--------------------------------------------------------------------------------
ARGI_KLULA/13-315--------------------------------------------------------------------------------
A2BIW8_HYPBU/25-300--------------------------------------------------------------------------------
Q21RM0_RHOFT/15-309--------------------------------------------------------------------------------
Q6L151_PICTO/19-280--------------------------------------------------------------------------------
A0A0D1DTD8_USTMA/13-318--------------------------------------------------------------------------------
A1B165_PARDP/30-308--------------------------------------------------------------------------------
Q16AD8_ROSDO/4-296--------------------------------------------------------------------------------
Q3SMM1_THIDA/8-294--------------------------------------------------------------------------------
A0A1D8PP00_CANAL/12-313--------------------------------------------------------------------------------
Q7VSA1_BORPE/8-302--------------------------------------------------------------------------------
A0BHR2_PARTE/9-311--------------------------------------------------------------------------------
Q4JAE9_SULAC/24-287--------------------------------------------------------------------------------
Q975R8_SULTO/24-287--------------------------------------------------------------------------------
Q1LGD2_CUPMC/2-296--------------------------------------------------------------------------------
ARGI_AGRFC/19-313--------------------------------------------------------------------------------
Q1D421_MYXXD/27-337--------------------------------------------------------------------------------
SPEB1_SCHPO/74-375--------------------------------------------------------------------------------
ARGI_YEAST/13-329--------------------------------------------------------------------------------
A9BN56_DELAS/71-341--------------------------------------------------------------------------------
A0A1D8PPP3_CANAL/50-340--------------------------------------------------------------------------------
A1RBR9_PAEAT/55-335--------------------------------------------------------------------------------
A1VTU0_POLNA/3-297--------------------------------------------------------------------------------
Q0UMJ9_PHANO/68-378--------------------------------------------------------------------------------
A1SM48_NOCSJ/41-314--------------------------------------------------------------------------------
Q1GI45_RUEST/67-333--------------------------------------------------------------------------------
Q1IHQ4_KORVE/16-311--------------------------------------------------------------------------------
Q6L2W0_PICTO/21-293--------------------------------------------------------------------------------
Q89H72_BRADU/11-308--------------------------------------------------------------------------------
Q489X2_COLP3/36-310--------------------------------------------------------------------------------
Q7V9I4_PROMA/29-293--------------------------------------------------------------------------------
SPEB1_SYNY3/26-297--------------------------------------------------------------------------------
Q6FP31_CANGA/10-317--------------------------------------------------------------------------------
A5G414_GEOUR/41-319--------------------------------------------------------------------------------
Q3SVS2_NITWN/5-302--------------------------------------------------------------------------------
SPEB2_SCHPO/89-401--------------------------------------------------------------------------------
Q8XPR0_RALSO/29-309--------------------------------------------------------------------------------
Q47TW8_THEFY/41-314--------------------------------------------------------------------------------
A9KQ98_LACP7/18-281--------------------------------------------------------------------------------
A1BCD2_PARDP/35-312--------------------------------------------------------------------------------
ARGI_ASHGO/93-395--------------------------------------------------------------------------------
A1B3P5_PARDP/3-295--------------------------------------------------------------------------------
Q1QTM4_CHRSD/39-312--------------------------------------------------------------------------------
Q6C732_YARLI/86-381--------------------------------------------------------------------------------
A0LDK6_MAGMM/20-293--------------------------------------------------------------------------------
Q47D78_DECAR/17-302--------------------------------------------------------------------------------
Q3JAG2_NITOC/2-290--------------------------------------------------------------------------------
A3DDA1_CLOTH/24-286--------------------------------------------------------------------------------
A1CKP4_ASPCL/16-320--------------------------------------------------------------------------------
ARGI1_SCHPO/22-319--------------------------------------------------------------------------------
HUTG_PHOLL/44-316--------------------------------------------------------------------------------
A0A1U7EWX2_NATPD/45-332--------------------------------------------------------------------------------
SPEB2_SYNY3/83-361--------------------------------------------------------------------------------
Q5LKZ4_RUEPO/42-315--------------------------------------------------------------------------------
Q2RHH4_MOOTA/26-287--------------------------------------------------------------------------------
Q17HI3_AEDAE/32-333--------------------------------------------------------------------------------
A3CU48_METMJ/19-276--------------------------------------------------------------------------------
HUTG_HAHCH/40-316--------------------------------------------------------------------------------
Q8RA93_CALS4/28-290--------------------------------------------------------------------------------
Q8END5_OCEIH/29-310--------------------------------------------------------------------------------
Q5ANN8_CANAL/115-414--------------------------------------------------------------------------------
Q2LPR8_SYNAS/65-343--------------------------------------------------------------------------------
A1ST87_PSYIN/33-299--------------------------------------------------------------------------------
ARGI1_ARATH/63-338--------------------------------------------------------------------------------
A0R0G1_MYCS2/40-312--------------------------------------------------------------------------------
A1CFK4_ASPCL/83-374--------------------------------------------------------------------------------
B8I5M8_CLOCE/21-282--------------------------------------------------------------------------------
A1TIE4_ACIAC/8-305--------------------------------------------------------------------------------
A1T9H7_MYCVP/46-324--------------------------------------------------------------------------------
Q97VA3_SULSO/30-299--------------------------------------------------------------------------------
Q4J720_SULAC/30-299--------------------------------------------------------------------------------
Q3J2B4_RHOS4/46-312--------------------------------------------------------------------------------
A1CGK0_ASPCL/61-357--------------------------------------------------------------------------------
Q10Y47_TRIEI/24-296--------------------------------------------------------------------------------
A5G278_ACICJ/28-297--------------------------------------------------------------------------------
ARGI_SOYBN/71-346--------------------------------------------------------------------------------
O76895_DROME/30-333--------------------------------------------------------------------------------
A1W2M6_ACISJ/2-298--------------------------------------------------------------------------------
Q1GHG8_RUEST/4-296--------------------------------------------------------------------------------
Q65P52_BACLD/4-300--------------------------------------------------------------------------------
Q67TJ0_SYMTH/28-290--------------------------------------------------------------------------------
A4XZN2_PSEMY/43-309--------------------------------------------------------------------------------
A4YE21_METS5/29-295--------------------------------------------------------------------------------
Q6ANF4_DESPS/59-334--------------------------------------------------------------------------------
Q222F3_RHOFT/24-298--------------------------------------------------------------------------------
ARGI2_MOUSE/24-324--------------------------------------------------------------------------------
Q315M1_DESAG/23-287--------------------------------------------------------------------------------
A7IL28_XANP2/50-316--------------------------------------------------------------------------------
Q18A84_PEPD6/21-285--------------------------------------------------------------------------------
Q5V6R7_HALMA/44-335--------------------------------------------------------------------------------
Q5LRK8_RUEPO/33-325--------------------------------------------------------------------------------
Q9K8M2_BACHD/4-296--------------------------------------------------------------------------------
Q3ABP1_CARHZ/20-281--------------------------------------------------------------------------------
A9CJC2_AGRFC/42-307--------------------------------------------------------------------------------
Q7U3K9_SYNPX/21-280--------------------------------------------------------------------------------
A1STQ5_PSYIN/47-343--------------------------------------------------------------------------------
Q7VY32_BORPE/13-287--------------------------------------------------------------------------------
Q9CL61_PASMU/34-299--------------------------------------------------------------------------------
A4IB49_LEIIN/14-315--------------------------------------------------------------------------------
A5UXL8_ROSS1/34-305--------------------------------------------------------------------------------
A9WCM8_CHLAA/41-307--------------------------------------------------------------------------------
B4EIP8_BURCJ/49-320--------------------------------------------------------------------------------
B4ELX2_BURCJ/44-308--------------------------------------------------------------------------------
B5GLC8_STRC2/31-301--------------------------------------------------------------------------------
B9A9C6_BOMMO/12-304--------------------------------------------------------------------------------
C0ZIM2_BREBN/4-293--------------------------------------------------------------------------------
D0J7J2_COMT2/7-302--------------------------------------------------------------------------------
D5AV62_RHOCB/6-296--------------------------------------------------------------------------------
D5SKW9_STRC2/134-404--------------------------------------------------------------------------------
E3GWR7_METFV/23-279--------------------------------------------------------------------------------
E9CYX8_COCPS/18-317--------------------------------------------------------------------------------
F1QJZ3_DANRE/86-357--------------------------------------------------------------------------------
F6SZP1_XENTR/61-332--------------------------------------------------------------------------------
A0A0D8JTR5_COCIM/78-370--------------------------------------------------------------------------------
K5X448_AGABU/13-305--------------------------------------------------------------------------------
SPEB_NEIMB/35-299--------------------------------------------------------------------------------
Q05AR1_XENTR/27-324--------------------------------------------------------------------------------
Q24ZK6_DESHY/5-295--------------------------------------------------------------------------------
Q251M0_DESHY/26-286--------------------------------------------------------------------------------
Q2FW91_STAA8/6-296--------------------------------------------------------------------------------
Q2K3I8_RHIEC/7-299--------------------------------------------------------------------------------
Q2K9W6_RHIEC/65-328--------------------------------------------------------------------------------
Q3IKA3_PSEHT/33-297--------------------------------------------------------------------------------
Q46IA1_PROMT/31-292--------------------------------------------------------------------------------
Q4FL05_PELUB/40-312--------------------------------------------------------------------------------
Q5KIC1_CRYNJ/70-373--------------------------------------------------------------------------------
Q5L3P6_GEOKA/3-294--------------------------------------------------------------------------------
HUTG_LEGPH/47-315--------------------------------------------------------------------------------
Q6LHE2_PHOPR/35-321--------------------------------------------------------------------------------
Q6LWW9_METMP/19-277--------------------------------------------------------------------------------
Q6N0N3_RHOPA/14-309--------------------------------------------------------------------------------
Q6PH54_DANRE/25-322--------------------------------------------------------------------------------
Q72EZ7_DESVH/23-282--------------------------------------------------------------------------------
Q7V3X2_PROMM/30-287--------------------------------------------------------------------------------
SPEB_BACAN/23-284--------------------------------------------------------------------------------
Q81VP0_BACAN/4-292--------------------------------------------------------------------------------
Q81Y48_BACAN/37-311--------------------------------------------------------------------------------
Q82VE5_NITEU/46-310--------------------------------------------------------------------------------
HUTG_VIBPA/47-325--------------------------------------------------------------------------------
Q88KU3_PSEPK/34-298--------------------------------------------------------------------------------
Q8RG18_FUSNN/503-779--------------------------------------------------------------------------------
Q8TJ04_METAC/18-281--------------------------------------------------------------------------------
Q8XMY7_CLOPE/21-278--------------------------------------------------------------------------------
Q92LN4_RHIME/3-295--------------------------------------------------------------------------------
Q92MV8_RHIME/71-339--------------------------------------------------------------------------------
Q92QR6_RHIME/44-306--------------------------------------------------------------------------------
GPUA_PSEAE/36-307--------------------------------------------------------------------------------
Q9KLD2_VIBCH/33-297--------------------------------------------------------------------------------
HUTG_VIBCH/44-322--------------------------------------------------------------------------------
U5L6E1_9BACI/3-293--------------------------------------------------------------------------------
U5LEA0_9BACI/39-314--------------------------------------------------------------------------------

PF00850

Q5K8L3_CRYNJ/30-447-------------------------------R------------------------------------------------
HDAC4_HUMAN/675-992-------------------------------E------------------------------------------------
A0DIS2_PARTE/35-343-------------------------------K------------------------------------------------
A0LGT0_SYNFM/21-313-------------------------------M------------------------------------------------
A1W7T1_ACISJ/39-355--------------------------------------------------------------------------------
A2BL29_HYPBU/22-314-------------------------------R------------------------------------------------
A3DNS7_STAMF/22-312-------------------------------C------------------------------------------------
A3GH68_PICST/31-340-------------------------------K------------------------------------------------
A4S2N1_OSTLU/203-605-------------------------------N------------------------------------------------
A4S898_OSTLU/34-312-------------------------------R------------------------------------------------
A4X4X7_SALTO/21-317-------------------------------P------------------------------------------------
A4YNH4_BRASO/59-370--------------------------------------------------------------------------------
A6QAF4_SULNB/20-301-------------------------------P------------------------------------------------
A6R4B6_AJECN/60-359-------------------------------K------------------------------------------------
A6VSZ5_MARMS/20-304-------------------------------Y------------------------------------------------
A7SSG8_NEMVE/31-332-------------------------------A------------------------------------------------
A7SUP8_NEMVE/33-329-------------------------------R------------------------------------------------
A7TRW5_VANPO/20-403-------------------------------K------------------------------------------------
A8ABS4_IGNH4/20-308--------------------------------------------------------------------------------
A8ZT95_DESOH/22-309-------------------------------P------------------------------------------------
A9A062_DESOH/265-572-------------------------------T------------------------------------------------
A9B5I1_HERA2/19-308-------------------------------A------------------------------------------------
B0T7F0_CAUSK/36-327--------------------------------------------------------------------------------
B2JV93_PARP8/21-308-------------------------------P------------------------------------------------
B4U8T2_HYDS0/19-303-------------------------------Y------------------------------------------------
C5KDG6_PERM5/349-869PELNVVVESPAIKFMNSPQNKGARTAEGVSIAGICEGCREQADNDYMLNCDREGCSKSWHVYCLPDPLPKSILKRPEFMS
E0TF48_PARBH/17-291-------------------------------A------------------------------------------------
E2RU63_GIAIC/23-319-------------------------------A------------------------------------------------
O67135_AQUAE/21-313-------------------------------K------------------------------------------------
HDA1_YEAST/83-394-------------------------------P------------------------------------------------
Q02CA3_SOLUE/20-310-------------------------------A------------------------------------------------
Q0A6Z7_ALKEH/48-335-------------------------------A------------------------------------------------
Q0ARF0_MARMM/20-307--------------------------------------------------------------------------------
Q15WQ0_PSEA6/26-300-------------------------------A------------------------------------------------
Q1CZX8_MYXXD/27-313-------------------------------P------------------------------------------------
HDA6_CAEEL/446-747-------------------------------A------------------------------------------------
Q29CG7_DROPS/39-325-------------------------------S------------------------------------------------
Q2FQW8_METHJ/20-310--------------------------------------------------------------------------------
Q2IF50_ANADE/22-318-------------------------------A------------------------------------------------
Q2KBQ8_RHIEC/20-308-------------------------------K------------------------------------------------
Q2LVD3_SYNAS/21-310-------------------------------A------------------------------------------------
Q2R9B1_ORYSJ/38-341-------------------------------A------------------------------------------------
Q2S035_SALRD/19-312-------------------------------R------------------------------------------------
Q2SC27_HAHCH/22-314-------------------------------R------------------------------------------------
Q30PJ4_SULDN/264-571-------------------------------R------------------------------------------------
Q31EP6_HYDCU/54-346-------------------------------Q------------------------------------------------
Q31HC2_HYDCU/19-303-------------------------------R------------------------------------------------
Q38C74_TRYB2/31-322-------------------------------C------------------------------------------------
Q39UV4_GEOMG/22-314-------------------------------R------------------------------------------------
Q3AFN8_CARHZ/22-318-------------------------------R------------------------------------------------
Q4D762_TRYCC/59-387-------------------------------Q------------------------------------------------
Q4FNF7_PELUB/20-305-------------------------------K------------------------------------------------
Q4KAJ1_PSEF5/25-339--------------------------------------------------------------------------------
Q4MYQ3_THEPA/32-415-------------------------------P------------------------------------------------
Q4QAJ4_LEIMA/102-403-------------------------------A------------------------------------------------
Q4QI60_LEIMA/65-431-------------------------------A------------------------------------------------
HDA21_DICDI/1078-1485-------------------------------D------------------------------------------------
Q5KKR8_CRYNJ/39-367-------------------------------K------------------------------------------------
Q60DG7_ORYSJ/56-349-------------------------------P------------------------------------------------
Q6AJC0_DESPS/25-317-------------------------------K------------------------------------------------
Q6AKN4_DESPS/22-310-------------------------------P------------------------------------------------
Q6C3Y5_YARLI/64-351-------------------------------R------------------------------------------------
Q6CGA7_YARLI/268-647-------------------------------A------------------------------------------------
Q6FWB7_CANGA/19-382-------------------------------K------------------------------------------------
Q741C0_MYCPA/20-306-------------------------------T------------------------------------------------
Q7PS30_ANOGA/126-423-------------------------------T------------------------------------------------
Q8EP92_OCEIH/22-320-------------------------------R------------------------------------------------
Q8I4I9_CAEEL/27-317--------------------------------------------------------------------------------
Q8IR37_DROME/563-860-------------------------------Q------------------------------------------------
HDA14_ARATH/80-386-------------------------------P------------------------------------------------
Q9K0J2_NEIMB/41-327-------------------------------S------------------------------------------------
Q9U266_CAEEL/26-318-------------------------------P------------------------------------------------
G4VAN3_SCHMA/18-356-------------------------------R------------------------------------------------
K3ZRV5_SETIT/232-519-------------------------------V------------------------------------------------
Q22CW6_TETTS/28-319-------------------------------S------------------------------------------------
Q2G292_STAA8/25-322-------------------------------P------------------------------------------------
Q8F7M9_LEPIN/22-309-------------------------------H------------------------------------------------
V6EZA3_9PROT/20-307-------------------------------R------------------------------------------------
W7X9B2_TETTS/39-342-------------------------------S------------------------------------------------

PF12640

B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------

PF00491

E7F8R4_DANRE/27-322--------------------------------------------------------------------------------
SPEB3_SCHPO/85-387--------------------------------------------------------------------------------
Q6BJQ5_DEBHA/76-370--------------------------------------------------------------------------------
Q6BVQ4_DEBHA/136-428--------------------------------------------------------------------------------
Q6BWL4_DEBHA/179-480--------------------------------------------------------------------------------
A1RXI5_THEPD/26-288--------------------------------------------------------------------------------
SPEB_MOUSE/77-350--------------------------------------------------------------------------------
A4XKN0_CALS8/20-281--------------------------------------------------------------------------------
A4J1T2_DESRM/21-282--------------------------------------------------------------------------------
A1VQK9_POLNA/34-307--------------------------------------------------------------------------------
Q2K8A9_RHIEC/46-316--------------------------------------------------------------------------------
B2JW15_PARP8/32-305--------------------------------------------------------------------------------
Q982X2_RHILO/42-307--------------------------------------------------------------------------------
HUTG_BACHD/35-311--------------------------------------------------------------------------------
HUTG_RHOJR/40-314--------------------------------------------------------------------------------
ARGI1_HUMAN/6-305--------------------------------------------------------------------------------
SPEB_CHRVO/44-311--------------------------------------------------------------------------------
ARGI_BACSU/3-292--------------------------------------------------------------------------------
Q97ZX8_SULSO/24-289--------------------------------------------------------------------------------
HUTG_VIBVY/45-328--------------------------------------------------------------------------------
A9BRG6_DELAS/16-312--------------------------------------------------------------------------------
HUTG_AROAE/40-323--------------------------------------------------------------------------------
A1RB53_PAEAT/29-311--------------------------------------------------------------------------------
Q1J2W9_DEIGD/37-306--------------------------------------------------------------------------------
Q2JER0_FRACC/40-318--------------------------------------------------------------------------------
Q3J346_RHOS4/3-296--------------------------------------------------------------------------------
A9B324_HERA2/22-290--------------------------------------------------------------------------------
Q9YBG0_AERPE/29-298--------------------------------------------------------------------------------
Q1GI44_RUEST/34-307--------------------------------------------------------------------------------
Q9HJB2_THEAC/33-293--------------------------------------------------------------------------------
A0RXD6_CENSY/22-283--------------------------------------------------------------------------------
A8LLU9_DINSH/46-312--------------------------------------------------------------------------------
SPEB_BACHD/22-286--------------------------------------------------------------------------------
Q0W940_METAR/16-280--------------------------------------------------------------------------------
Q6MHV0_BDEBA/36-309--------------------------------------------------------------------------------
Q98MW3_RHILO/19-296--------------------------------------------------------------------------------
A0LG67_SYNFM/34-297--------------------------------------------------------------------------------
HUTG_BACSU/35-311--------------------------------------------------------------------------------
Q9K5Y7_BACHD/5-297--------------------------------------------------------------------------------
Q164F4_ROSDO/46-312--------------------------------------------------------------------------------
Q164F5_ROSDO/34-308--------------------------------------------------------------------------------
Q15X44_PSEA6/42-323--------------------------------------------------------------------------------
Q11J67_CHESB/42-307--------------------------------------------------------------------------------
Q1AWJ4_RUBXD/5-295--------------------------------------------------------------------------------
Q5WL42_BACSK/7-290--------------------------------------------------------------------------------
Q7UZH9_PROMP/24-288--------------------------------------------------------------------------------
Q6CLB8_KLULA/137-438--------------------------------------------------------------------------------
A0JT79_ARTS2/57-331--------------------------------------------------------------------------------
Q2KVZ3_BORA1/13-287--------------------------------------------------------------------------------
B2UBQ2_RALPJ/40-316--------------------------------------------------------------------------------
Q165U0_ROSDO/35-314--------------------------------------------------------------------------------
B1YHV3_EXIS2/22-286--------------------------------------------------------------------------------
Q5WIT9_BACSK/27-306--------------------------------------------------------------------------------
A1C610_ASPCL/68-380--------------------------------------------------------------------------------
Q1AS11_RUBXD/33-307--------------------------------------------------------------------------------
Q28QX8_JANSC/39-314--------------------------------------------------------------------------------
A1WGI6_VEREI/22-320--------------------------------------------------------------------------------
A1WER7_VEREI/22-295--------------------------------------------------------------------------------
A1T3A2_MYCVP/88-364--------------------------------------------------------------------------------
A8LRL4_DINSH/4-296--------------------------------------------------------------------------------
A5V551_SPHWW/4-298--------------------------------------------------------------------------------
Q11NZ4_CYTH3/3-310--------------------------------------------------------------------------------
Q5V4R8_HALMA/3-300--------------------------------------------------------------------------------
Q12BY7_POLSJ/72-342--------------------------------------------------------------------------------
HUTG_VIBF1/45-345--------------------------------------------------------------------------------
Q3IVT5_RHOS4/32-308--------------------------------------------------------------------------------
HUTG_GEOKA/44-315--------------------------------------------------------------------------------
SPEB_BLOFL/33-298--------------------------------------------------------------------------------
A0ZFA2_NODSP/30-338--------------------------------------------------------------------------------
A4XT95_PSEMY/38-311--------------------------------------------------------------------------------
Q5WB32_BACSK/22-286--------------------------------------------------------------------------------
Q6C6P6_YARLI/9-306--------------------------------------------------------------------------------
Q12UU8_METBU/17-282--------------------------------------------------------------------------------
Q213G1_RHOPB/11-309--------------------------------------------------------------------------------
Q28PV5_JANSC/46-313--------------------------------------------------------------------------------
A0QRD0_MYCS2/43-317--------------------------------------------------------------------------------
ARGI_NEUCR/47-354--------------------------------------------------------------------------------
Q12LW8_SHEDO/33-299--------------------------------------------------------------------------------
Q2W8C1_MAGSA/22-290--------------------------------------------------------------------------------
GBU1_KLULA/61-358--------------------------------------------------------------------------------
A1SLP1_NOCSJ/31-312--------------------------------------------------------------------------------
Q28VR8_JANSC/34-309--------------------------------------------------------------------------------
Q0UYW2_PHANO/16-320--------------------------------------------------------------------------------
Y309_METJA/21-281--------------------------------------------------------------------------------
Q9RZ04_DEIRA/29-298--------------------------------------------------------------------------------
ARGI_KLULA/13-315--------------------------------------------------------------------------------
A2BIW8_HYPBU/25-300--------------------------------------------------------------------------------
Q21RM0_RHOFT/15-309--------------------------------------------------------------------------------
Q6L151_PICTO/19-280--------------------------------------------------------------------------------
A0A0D1DTD8_USTMA/13-318--------------------------------------------------------------------------------
A1B165_PARDP/30-308--------------------------------------------------------------------------------
Q16AD8_ROSDO/4-296--------------------------------------------------------------------------------
Q3SMM1_THIDA/8-294--------------------------------------------------------------------------------
A0A1D8PP00_CANAL/12-313--------------------------------------------------------------------------------
Q7VSA1_BORPE/8-302--------------------------------------------------------------------------------
A0BHR2_PARTE/9-311--------------------------------------------------------------------------------
Q4JAE9_SULAC/24-287--------------------------------------------------------------------------------
Q975R8_SULTO/24-287--------------------------------------------------------------------------------
Q1LGD2_CUPMC/2-296--------------------------------------------------------------------------------
ARGI_AGRFC/19-313--------------------------------------------------------------------------------
Q1D421_MYXXD/27-337--------------------------------------------------------------------------------
SPEB1_SCHPO/74-375--------------------------------------------------------------------------------
ARGI_YEAST/13-329--------------------------------------------------------------------------------
A9BN56_DELAS/71-341--------------------------------------------------------------------------------
A0A1D8PPP3_CANAL/50-340--------------------------------------------------------------------------------
A1RBR9_PAEAT/55-335--------------------------------------------------------------------------------
A1VTU0_POLNA/3-297--------------------------------------------------------------------------------
Q0UMJ9_PHANO/68-378--------------------------------------------------------------------------------
A1SM48_NOCSJ/41-314--------------------------------------------------------------------------------
Q1GI45_RUEST/67-333--------------------------------------------------------------------------------
Q1IHQ4_KORVE/16-311--------------------------------------------------------------------------------
Q6L2W0_PICTO/21-293--------------------------------------------------------------------------------
Q89H72_BRADU/11-308--------------------------------------------------------------------------------
Q489X2_COLP3/36-310--------------------------------------------------------------------------------
Q7V9I4_PROMA/29-293--------------------------------------------------------------------------------
SPEB1_SYNY3/26-297--------------------------------------------------------------------------------
Q6FP31_CANGA/10-317--------------------------------------------------------------------------------
A5G414_GEOUR/41-319--------------------------------------------------------------------------------
Q3SVS2_NITWN/5-302--------------------------------------------------------------------------------
SPEB2_SCHPO/89-401--------------------------------------------------------------------------------
Q8XPR0_RALSO/29-309--------------------------------------------------------------------------------
Q47TW8_THEFY/41-314--------------------------------------------------------------------------------
A9KQ98_LACP7/18-281--------------------------------------------------------------------------------
A1BCD2_PARDP/35-312--------------------------------------------------------------------------------
ARGI_ASHGO/93-395--------------------------------------------------------------------------------
A1B3P5_PARDP/3-295--------------------------------------------------------------------------------
Q1QTM4_CHRSD/39-312--------------------------------------------------------------------------------
Q6C732_YARLI/86-381--------------------------------------------------------------------------------
A0LDK6_MAGMM/20-293--------------------------------------------------------------------------------
Q47D78_DECAR/17-302--------------------------------------------------------------------------------
Q3JAG2_NITOC/2-290--------------------------------------------------------------------------------
A3DDA1_CLOTH/24-286--------------------------------------------------------------------------------
A1CKP4_ASPCL/16-320--------------------------------------------------------------------------------
ARGI1_SCHPO/22-319--------------------------------------------------------------------------------
HUTG_PHOLL/44-316--------------------------------------------------------------------------------
A0A1U7EWX2_NATPD/45-332--------------------------------------------------------------------------------
SPEB2_SYNY3/83-361--------------------------------------------------------------------------------
Q5LKZ4_RUEPO/42-315--------------------------------------------------------------------------------
Q2RHH4_MOOTA/26-287--------------------------------------------------------------------------------
Q17HI3_AEDAE/32-333--------------------------------------------------------------------------------
A3CU48_METMJ/19-276--------------------------------------------------------------------------------
HUTG_HAHCH/40-316--------------------------------------------------------------------------------
Q8RA93_CALS4/28-290--------------------------------------------------------------------------------
Q8END5_OCEIH/29-310--------------------------------------------------------------------------------
Q5ANN8_CANAL/115-414--------------------------------------------------------------------------------
Q2LPR8_SYNAS/65-343--------------------------------------------------------------------------------
A1ST87_PSYIN/33-299--------------------------------------------------------------------------------
ARGI1_ARATH/63-338--------------------------------------------------------------------------------
A0R0G1_MYCS2/40-312--------------------------------------------------------------------------------
A1CFK4_ASPCL/83-374--------------------------------------------------------------------------------
B8I5M8_CLOCE/21-282--------------------------------------------------------------------------------
A1TIE4_ACIAC/8-305--------------------------------------------------------------------------------
A1T9H7_MYCVP/46-324--------------------------------------------------------------------------------
Q97VA3_SULSO/30-299--------------------------------------------------------------------------------
Q4J720_SULAC/30-299--------------------------------------------------------------------------------
Q3J2B4_RHOS4/46-312--------------------------------------------------------------------------------
A1CGK0_ASPCL/61-357--------------------------------------------------------------------------------
Q10Y47_TRIEI/24-296--------------------------------------------------------------------------------
A5G278_ACICJ/28-297--------------------------------------------------------------------------------
ARGI_SOYBN/71-346--------------------------------------------------------------------------------
O76895_DROME/30-333--------------------------------------------------------------------------------
A1W2M6_ACISJ/2-298--------------------------------------------------------------------------------
Q1GHG8_RUEST/4-296--------------------------------------------------------------------------------
Q65P52_BACLD/4-300--------------------------------------------------------------------------------
Q67TJ0_SYMTH/28-290--------------------------------------------------------------------------------
A4XZN2_PSEMY/43-309--------------------------------------------------------------------------------
A4YE21_METS5/29-295--------------------------------------------------------------------------------
Q6ANF4_DESPS/59-334--------------------------------------------------------------------------------
Q222F3_RHOFT/24-298--------------------------------------------------------------------------------
ARGI2_MOUSE/24-324--------------------------------------------------------------------------------
Q315M1_DESAG/23-287--------------------------------------------------------------------------------
A7IL28_XANP2/50-316--------------------------------------------------------------------------------
Q18A84_PEPD6/21-285--------------------------------------------------------------------------------
Q5V6R7_HALMA/44-335--------------------------------------------------------------------------------
Q5LRK8_RUEPO/33-325--------------------------------------------------------------------------------
Q9K8M2_BACHD/4-296--------------------------------------------------------------------------------
Q3ABP1_CARHZ/20-281--------------------------------------------------------------------------------
A9CJC2_AGRFC/42-307--------------------------------------------------------------------------------
Q7U3K9_SYNPX/21-280--------------------------------------------------------------------------------
A1STQ5_PSYIN/47-343--------------------------------------------------------------------------------
Q7VY32_BORPE/13-287--------------------------------------------------------------------------------
Q9CL61_PASMU/34-299--------------------------------------------------------------------------------
A4IB49_LEIIN/14-315--------------------------------------------------------------------------------
A5UXL8_ROSS1/34-305--------------------------------------------------------------------------------
A9WCM8_CHLAA/41-307--------------------------------------------------------------------------------
B4EIP8_BURCJ/49-320--------------------------------------------------------------------------------
B4ELX2_BURCJ/44-308--------------------------------------------------------------------------------
B5GLC8_STRC2/31-301--------------------------------------------------------------------------------
B9A9C6_BOMMO/12-304--------------------------------------------------------------------------------
C0ZIM2_BREBN/4-293--------------------------------------------------------------------------------
D0J7J2_COMT2/7-302--------------------------------------------------------------------------------
D5AV62_RHOCB/6-296--------------------------------------------------------------------------------
D5SKW9_STRC2/134-404--------------------------------------------------------------------------------
E3GWR7_METFV/23-279--------------------------------------------------------------------------------
E9CYX8_COCPS/18-317--------------------------------------------------------------------------------
F1QJZ3_DANRE/86-357--------------------------------------------------------------------------------
F6SZP1_XENTR/61-332--------------------------------------------------------------------------------
A0A0D8JTR5_COCIM/78-370--------------------------------------------------------------------------------
K5X448_AGABU/13-305--------------------------------------------------------------------------------
SPEB_NEIMB/35-299--------------------------------------------------------------------------------
Q05AR1_XENTR/27-324--------------------------------------------------------------------------------
Q24ZK6_DESHY/5-295--------------------------------------------------------------------------------
Q251M0_DESHY/26-286--------------------------------------------------------------------------------
Q2FW91_STAA8/6-296--------------------------------------------------------------------------------
Q2K3I8_RHIEC/7-299--------------------------------------------------------------------------------
Q2K9W6_RHIEC/65-328--------------------------------------------------------------------------------
Q3IKA3_PSEHT/33-297--------------------------------------------------------------------------------
Q46IA1_PROMT/31-292--------------------------------------------------------------------------------
Q4FL05_PELUB/40-312--------------------------------------------------------------------------------
Q5KIC1_CRYNJ/70-373--------------------------------------------------------------------------------
Q5L3P6_GEOKA/3-294--------------------------------------------------------------------------------
HUTG_LEGPH/47-315--------------------------------------------------------------------------------
Q6LHE2_PHOPR/35-321--------------------------------------------------------------------------------
Q6LWW9_METMP/19-277--------------------------------------------------------------------------------
Q6N0N3_RHOPA/14-309--------------------------------------------------------------------------------
Q6PH54_DANRE/25-322--------------------------------------------------------------------------------
Q72EZ7_DESVH/23-282--------------------------------------------------------------------------------
Q7V3X2_PROMM/30-287--------------------------------------------------------------------------------
SPEB_BACAN/23-284--------------------------------------------------------------------------------
Q81VP0_BACAN/4-292--------------------------------------------------------------------------------
Q81Y48_BACAN/37-311--------------------------------------------------------------------------------
Q82VE5_NITEU/46-310--------------------------------------------------------------------------------
HUTG_VIBPA/47-325--------------------------------------------------------------------------------
Q88KU3_PSEPK/34-298--------------------------------------------------------------------------------
Q8RG18_FUSNN/503-779--------------------------------------------------------------------------------
Q8TJ04_METAC/18-281--------------------------------------------------------------------------------
Q8XMY7_CLOPE/21-278--------------------------------------------------------------------------------
Q92LN4_RHIME/3-295--------------------------------------------------------------------------------
Q92MV8_RHIME/71-339--------------------------------------------------------------------------------
Q92QR6_RHIME/44-306--------------------------------------------------------------------------------
GPUA_PSEAE/36-307--------------------------------------------------------------------------------
Q9KLD2_VIBCH/33-297--------------------------------------------------------------------------------
HUTG_VIBCH/44-322--------------------------------------------------------------------------------
U5L6E1_9BACI/3-293--------------------------------------------------------------------------------
U5LEA0_9BACI/39-314--------------------------------------------------------------------------------

PF00850

Q5K8L3_CRYNJ/30-447----------------------------------------------------------------KE------------AG
HDAC4_HUMAN/675-992----------------------------------------------------------------ST------------PM
A0DIS2_PARTE/35-343----------------------------------------------------------------NK------------PN
A0LGT0_SYNFM/21-313----------------------------------------------------------------NR------------AL
A1W7T1_ACISJ/39-355----------------------------------------------------------------DF------------MG
A2BL29_HYPBU/22-314----------------------------------------------------------------GV------------AM
A3DNS7_STAMF/22-312----------------------------------------------------------------GK------------AF
A3GH68_PICST/31-340----------------------------------------------------------------SR------------AA
A4S2N1_OSTLU/203-605----------------------------------------------------------------GA------------TE
A4S898_OSTLU/34-312----------------------------------------------------------------DR------------GS
A4X4X7_SALTO/21-317----------------------------------------------------------------AR------------AA
A4YNH4_BRASO/59-370----------------------------------------------------------------DI------------AS
A6QAF4_SULNB/20-301----------------------------------------------------------------EH------------AM
A6R4B6_AJECN/60-359----------------------------------------------------------------SE------------AS
A6VSZ5_MARMS/20-304----------------------------------------------------------------DK------------AM
A7SSG8_NEMVE/31-332----------------------------------------------------------------DS------------AM
A7SUP8_NEMVE/33-329----------------------------------------------------------------DE------------AA
A7TRW5_VANPO/20-403----------------------------------------------------------------NK------------AS
A8ABS4_IGNH4/20-308----------------------------------------------------------------SE------------GR
A8ZT95_DESOH/22-309----------------------------------------------------------------DR------------AT
A9A062_DESOH/265-572----------------------------------------------------------------SM------------FG
A9B5I1_HERA2/19-308----------------------------------------------------------------DQ------------AM
B0T7F0_CAUSK/36-327----------------------------------------------------------------DR------------SM
B2JV93_PARP8/21-308----------------------------------------------------------------SK------------AM
B4U8T2_HYDS0/19-303----------------------------------------------------------------AK------------AM
C5KDG6_PERM5/349-869RNWYCPACLEAPGLIKPQEADEMRAFVASLVENSVDESVIPGMNLASSELDDDAVDSDIAQSDMSENAPLMGSAMNIKPG
E0TF48_PARBH/17-291----------------------------------------------------------------EA------------GS
E2RU63_GIAIC/23-319----------------------------------------------------------------SE------------AS
O67135_AQUAE/21-313----------------------------------------------------------------SR------------AN
HDA1_YEAST/83-394----------------------------------------------------------------QA------------AG
Q02CA3_SOLUE/20-310----------------------------------------------------------------AR------------GM
Q0A6Z7_ALKEH/48-335----------------------------------------------------------------VR------------AR
Q0ARF0_MARMM/20-307----------------------------------------------------------------DR------------PM
Q15WQ0_PSEA6/26-300----------------------------------------------------------------NF------------GS
Q1CZX8_MYXXD/27-313----------------------------------------------------------------DK------------AM
HDA6_CAEEL/446-747----------------------------------------------------------------SK------------SS
Q29CG7_DROPS/39-325----------------------------------------------------------------NR------------GG
Q2FQW8_METHJ/20-310----------------------------------------------------------------SH------------GA
Q2IF50_ANADE/22-318----------------------------------------------------------------DR------------AG
Q2KBQ8_RHIEC/20-308----------------------------------------------------------------TT------------AM
Q2LVD3_SYNAS/21-310----------------------------------------------------------------DR------------SK
Q2R9B1_ORYSJ/38-341----------------------------------------------------------------CK------------AT
Q2S035_SALRD/19-312----------------------------------------------------------------AR------------AS
Q2SC27_HAHCH/22-314----------------------------------------------------------------DH------------GE
Q30PJ4_SULDN/264-571----------------------------------------------------------------RT------------LG
Q31EP6_HYDCU/54-346----------------------------------------------------------------NK------------AM
Q31HC2_HYDCU/19-303----------------------------------------------------------------NR------------PM
Q38C74_TRYB2/31-322----------------------------------------------------------------GE------------CS
Q39UV4_GEOMG/22-314----------------------------------------------------------------SK------------AS
Q3AFN8_CARHZ/22-318----------------------------------------------------------------DA------------AS
Q4D762_TRYCC/59-387----------------------------------------------------------------RT------------AG
Q4FNF7_PELUB/20-305----------------------------------------------------------------NK------------AM
Q4KAJ1_PSEF5/25-339----------------------------------------------------------------EY------------MG
Q4MYQ3_THEPA/32-415----------------------------------------------------------------DK------------MM
Q4QAJ4_LEIMA/102-403----------------------------------------------------------------AH------------AS
Q4QI60_LEIMA/65-431----------------------------------------------------------------SQ------------PS
HDA21_DICDI/1078-1485----------------------------------------------------------------GL------------TS
Q5KKR8_CRYNJ/39-367----------------------------------------------------------------TE------------AS
Q60DG7_ORYSJ/56-349----------------------------------------------------------------DR------------AD
Q6AJC0_DESPS/25-317----------------------------------------------------------------GK------------PF
Q6AKN4_DESPS/22-310----------------------------------------------------------------GR------------GM
Q6C3Y5_YARLI/64-351----------------------------------------------------------------SA------------AS
Q6CGA7_YARLI/268-647----------------------------------------------------------------CD------------PS
Q6FWB7_CANGA/19-382----------------------------------------------------------------TK------------AS
Q741C0_MYCPA/20-306----------------------------------------------------------------ER------------AM
Q7PS30_ANOGA/126-423----------------------------------------------------------------AE------------YN
Q8EP92_OCEIH/22-320----------------------------------------------------------------SR------------AS
Q8I4I9_CAEEL/27-317----------------------------------------------------------------KV------------AQ
Q8IR37_DROME/563-860----------------------------------------------------------------DH------------PH
HDA14_ARATH/80-386----------------------------------------------------------------KG------------PM
Q9K0J2_NEIMB/41-327----------------------------------------------------------------GK------------AG
Q9U266_CAEEL/26-318----------------------------------------------------------------DE------------GC
G4VAN3_SCHMA/18-356----------------------------------------------------------------SE------------AS
K3ZRV5_SETIT/232-519----------------------------------------------------------------KQ------------AM
Q22CW6_TETTS/28-319----------------------------------------------------------------QQ------------CS
Q2G292_STAA8/25-322----------------------------------------------------------------GR------------AS
Q8F7M9_LEPIN/22-309----------------------------------------------------------------NR------------IM
V6EZA3_9PROT/20-307----------------------------------------------------------------DA------------AM
W7X9B2_TETTS/39-342----------------------------------------------------------------KV------------CT

PF12640

B4E7R4_BURCJ/13-201-----LRGWAEVR---RSQPSS------------------------P---P-PALLTLDHHTDLEEPFDDHRFYATHQRM
A8MKG9_ALKOO/16-197-----IIPWSEYA---SHNE--------------------------T---A-PVLLTFDHHMDTRSAFYRYSREVAGLE-
Q12VI5_METBU/19-180-----LIAWIKAF---NEGIIS------------------------R---D-ATLFHLDKHTDF----------------
Q1CZJ9_MYXXD/103-253-----LPAWACAL---GDTE--------------------------G---P-ALLVTLDRHLDTVMPR------------
Q6ARQ8_DESPS/48-185-----FWAWISYI---DRVKTS------------------------L---P-LSLYHIDYHWD-----------------
C6C1I6_DESAD/28-165-----FWCWMESL---KKG---------------------------E---N-LNIFHVDRHFDALFSAQDYSHFPH----
C5KCK7_PERM5/16-196-----LPAVHMAV---RRGWIPG----------------------DQ---Q-LQVLHVDAHPDLAASKAIESEDI-----
B7FS57_PHATC/11-216-----LEHIHFML---RRKKIF------------------------S---D-WSMLHFDAHPDLAVPHPIVPAIACFQPH
C3XU32_BRAFL/3-238-----LYYIYRAI---GSHHLPL-----------------------H---G-VTMVHLDSHPDMLIPW------------
CE022_DANRE/15-248-----VQHIYRAI---GSRHIPM-----------------------K---G-IKMVHLDSHPDLLIPV------------
Q1RMV5_BOVIN/19-257-----LPFIYRAI---GSKHLPA-----------------------S---N-ISFVHFDSHPDLLIPV------------
A7UTP5_ANOGA/103-265-----LTFLYRCL---GSKHLPL-----------------------Q---G-NRIVHFDSHPDMCIPK------------
B3M7P2_DROAN/118-284-----LEFIYRCL---GTRHLPL-----------------------E---G-NTLVHFDSHPDMVIPR------------
B4N4R0_DROWI/108-274-----MEFIYRCL---GTRHLPL-----------------------E---N-NLLVHFDSHPDLVIAR------------
A7SLH9_NEMVE/10-251-----LFHIYRAI---AGRYLPY-----------------------S---G-TTLIHFDSHPDMTIPP------------
B7PMV1_IXOSC/7-174-----LHHIYRAI---GRKKLPF-----------------------S---K-VLMVHFDAHPDLVLPP------------
A9VAD6_MONBE/67-213-----LRERERE----------------------------------R---D-NVIVHVDAHPDLGLPE------------
A6UX51_META3/57-190-----FYFWNELI---NNNKLK------------------------T---P-FEVVHVDAHADLGMG-------------
D0MD43_RHOM4/57-211-----FFDWRRRI---QEGLLQ------------------------P---P-FEVVHIDAHADLGFG-------------

PF00491

E7F8R4_DANRE/27-322-----AIGSISGH---AAY--------------------------RH---E-LSVLWVDAHADINTPL------------
SPEB3_SCHPO/85-387-----VLPILRAL---HRVY-------------------------GQ---P-ISVIHFDSHLDTWAPGLI-------GDG
Q6BJQ5_DEBHA/76-370-----LLPHLRAL---HEVY-------------------------GK-----INILHFDAHLDTWGPDKYP-----SFWH
Q6BVQ4_DEBHA/136-428-----TLSCLRAV---YEKW-------------------------GK-----VAVIHFDSHLDTIDPYQMN------ENV
Q6BWL4_DEBHA/179-480-----TLMALKSA---YEHY-------------------------GA-----LSVLHFDSHIDTWDPKKLG------GGI
A1RXI5_THEPD/26-288-----SFPVLVEA---AGNV-------------------------DE-----LGVLVFDAHLDLRDEY------------
SPEB_MOUSE/77-350-----TYPILQAV---AKE--------------------------HG---P-VGLVHVGAHTNTTDKP------------
A4XKN0_CALS8/20-281-----SFPLIKAA---KEIY-------------------------GD-----LVVLHFDAHADMRDDY------------
A4J1T2_DESRM/21-282-----SLPVIEQV---VKKH-------------------------PG-----LKVLHFDAHADLRQDY------------
A1VQK9_POLNA/34-307-----VLPILRAL---CRR--------------------------HG---P-VALVHVDAHADVNDDM------------
Q2K8A9_RHIEC/46-316-----GLPILRAV---GR---------------------------DR---P-VGMIHIDAHCDTGGSF------------
B2JW15_PARP8/32-305-----TYPIFQAL---AP---------------------------RE---P-VALVHIDAHTDTWDS-------------
Q982X2_RHILO/42-307-----TWPLLKAH---AAIH-------------------------G----P-LALVQFDAHQDTWE--------------
HUTG_BACHD/35-311-----SFPSIKAF---ASA--------------------------KG---T-IGVIQFDAHHDLRNLE------------
HUTG_RHOJR/40-314-----AYGTYLGL---AQAAVR---------------TP------KR---R-IGILN