Sequence alignment for CL0302

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------------------------------------------
C2XKX5_BACCE/12-239--------------------------------------------------------------------------------
B9BUU1_9BURK/13-199--------------------------------------------------------------------------------
B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C2SK71_BACCE/15-171--------------------------------------------------------------------------------
C3Q562_9BACE/31-198--------------------------------------------------------------------------------
D7W5E5_9FLAO/27-172--------------------------------------------------------------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UPR5_METVS/56-208--------------------------------------------------------------------------------
A9AA45_METM6/55-201--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------
A0A031WF12_PEPDI/78-183--------------------------------------------------------------------------------
B6G251_9FIRM/77-182--------------------------------------------------------------------------------
B0A6K5_9FIRM/76-181--------------------------------------------------------------------------------
C0CJH7_9FIRM/6-165--------------------------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387----------------------------------FDIAFIGM----PFDT...G.TSY.RPG------------------
Q6BJQ5_DEBHA/76-370----------------------------------YDIGIIGV----PFDT...A.TSY.RPG------------------
Q6BVQ4_DEBHA/136-428----------------------------------FDIGIVGA----TFDT...G.VSF.RPG------------------
Q6BWL4_DEBHA/179-480----------------------------------IDIAVVGA----PFDT...G.VSF.RPG------------------
A1RXI5_THEPD/26-288----------------------------------SAYVVVGA----PFDS...T.ATG.VPG------------------
SPEB_MOUSE/77-350----------------------------------LDAAFIGV----PLDT...G.TSN.RPG------------------
A4XKN0_CALS8/20-281----------------------------------SKVVLAGI----PMDF...T.VSF.KPG------------------
A4J1T2_DESRM/21-282----------------------------------SSVVLVGA----PMDF...T.VSF.RPG------------------
A1VQK9_POLNA/34-307----------------------------------LNAAFIGV----PLDI...G.TSN.RPG------------------
Q2K8A9_RHIEC/46-316----------------------------------IDIALFGI----PMDL...G.VTN.RSG------------------
B2JW15_BURP8/32-305----------------------------------FDIALAGV----PFDG...G.VTA.RPG------------------
Q982X2_RHILO/42-307----------------------------------ADAVVWGI----PFDA...A.VTN.RPG------------------
HUTG_BACHD/35-311----------------------------------DGFGLIGA----PLSK...S.SIS.HSG------------------
HUTG_RHOSR/40-314----------------------------------GACVLIGF----SSDEGVER.NKG.RRG------------------
ARGI1_HUMAN/6-305----------------------------------RTIGIIGA----PFSK.....GQP.RGG------------------
SPEB_CHRVO/44-311----------------------------------VDVAVSGI----PLDL...S.VTF.RSG------------------
ARGI_BACSU/3-292----------------------------------KTISVIGM----PMDL.....GQA.RRG------------------
Q97ZX8_SULSO/24-289----------------------------------SPFVIIGI----PMDI...T.SSY.RPG------------------
HUTG_VIBVY/45-328----------------------------------YGVALLGF----ACDAGVAR.NKG.RIG------------------
A9BRG6_DELAS/16-312----------------------------------RALRLIGV----PTDI.....GAS.RLG------------------
HUTG_AROAE/40-323----------------------------------PGIVLLGF----PCDLGVRR.NHG.RAG------------------
A1RB53_ARTAT/29-311----------------------------------ARVAILGV----ASSA.....GSP.HDG------------------
Q1J2W9_DEIGD/37-306----------------------------------ADVAVLGI----PYDI...A.LGF.RPG------------------
Q2JER0_FRASC/40-318----------------------------------PDVAVVGA----PFDI...S.TTH.RPG------------------
Q3J346_RHOS4/3-296----------------------------------KTCILIGA----PIDS.....GQR.RPG------------------
A9B324_HERA2/22-290----------------------------------SKVVVLPI----PFEA...T.VSY.GGG------------------
Q9YBG0_AERPE/29-298----------------------------------SLFSVIGV----PYDS...T.SSF.RPG------------------
Q1GI44_RUEST/34-307----------------------------------LDVAVLGV----PMDI...G.TSW.RSG------------------
Q9HJB2_THEAC/33-293----------------------------------SDYVIFGV----PFDN...T.SSY.RRG------------------
A0RXD6_CENSY/22-283----------------------------------AAAVVFGV----PFDS...T.HSY.RPG------------------
A8LLU9_DINSH/46-312----------------------------------VDVAVSGV----PFDL...S.VTN.RPG------------------
SPEB_BACHD/22-286----------------------------------SKAVIFGM----PMDW...T.VSF.RPS------------------
Q0W940_UNCMA/16-280----------------------------------AAFVIYGV----PFDN...T.SSF.RAG------------------
Q6MHV0_BDEBA/36-309----------------------------------YEVGIFGI----PYDG...G.VSY.RPG------------------
Q98MW3_RHILO/19-296----------------------------------PRAVIFGA----GHGSTYPG.KD..SSG------------------
A0LG67_SYNFM/34-297----------------------------------AGAVIIPV----PYDA...T.TTY.RAG------------------
HUTG_BACSU/35-311----------------------------------KGPALIGV----PLSK...S.SIS.HSG------------------
Q9K5Y7_BACHD/5-297----------------------------------QKVSIIGV----PMDL.....GQK.RRG------------------
Q164F4_ROSDO/46-312----------------------------------ADIAITGV----PFDQ...A.VTN.RPG------------------
Q164F5_ROSDO/34-308----------------------------------LDVAIVGI----PMDI...G.TSW.RSG------------------
Q15X44_PSEA6/42-323----------------------------------PHCCLIGL----ACDLGVKE.NKG.RVG------------------
Q11J67_CHESB/42-307----------------------------------ADAVVWGI----PFDA...A.VSN.RPG------------------
Q1AWJ4_RUBXD/5-295----------------------------------PPVAILGV----PMDL.....GQD.RRG------------------
Q5WL42_BACSK/7-290----------------------------------F..GIVGF----PWDG...G.ASLGRPG------------------
Q7UZH9_PROMP/24-288----------------------------------CSIGIFGV----NYDG...T.CSY.KSG------------------
Q6CLB8_KLULA/137-438----------------------------------MDIAIVGA----PFDT...S.VSY.RPG------------------
A0JT79_ARTS2/57-331----------------------------------ADITVVGV----PFDS...G.VSY.RPG------------------
Q2KVZ3_BORA1/13-287----------------------------------PGVCVLGI----PFDC...G.THPFRVG------------------
B2UBQ2_RALPJ/40-316----------------------------------NTVALAGF----ACDAGVAR.NHG.RTG------------------
Q165U0_ROSDO/35-314----------------------------------ADVAVLGA----PFDG...G.TQW.RAG------------------
B1YHV3_EXIS2/22-286----------------------------------AKGVLYGM----PMDW...T.VSF.RPG------------------
Q5WIT9_BACSK/27-306----------------------------------IDAVVYGI----PWEG...AVTWGDYTG------------------
A1C610_ASPCL/68-380----------------------------------YDIAVIGA----PFDT...A.VSY.RPG------------------
Q1AS11_RUBXD/33-307----------------------------------ADAAVVGA----PFDT...G.ATF.RVG------------------
Q28QX8_JANSC/39-314----------------------------------VDIGIFGL----PWDG...A.TSN.RPG------------------
A1WGI6_VEREI/22-320----------------------------------RPIALIGA----PTDI.....GAG.VRG------------------
A1WER7_VEREI/22-295----------------------------------LDVGFVGV----PLDL...G.TSH.RSG------------------
A1T3A2_MYCVP/88-364----------------------------------AEVAIFGV----PLDA...G.ATY.RPG------------------
A8LRL4_DINSH/4-296----------------------------------QKCILIGA----GMDC.....GKR.RRG------------------
A5V551_SPHWW/4-298----------------------------------RRIALVGA----PVAL.....GAS.RPG------------------
Q11NZ4_CYTH3/3-310----------------------------------KPDILVSV----PSDI.....GAQ.RMG------------------
Q5V4R8_HALMA/3-300----------------------------------EQVRVLGV----PMDL.....GAD.RRG------------------
SPEB_SERP5/33-298----------------------------------AEWVITGI----PFDM...A.TSG.RAG------------------
Q12BY7_POLSJ/72-342----------------------------------LDVALIGV----PMDL...G.VTN.RAG------------------
HUTG_VIBF1/45-345----------------------------------DGIMLLGF----ACDEGVIR.NKG.RKG------------------
Q3IVT5_RHOS4/32-308----------------------------------LDAAIVGL----PSDS...G.APF.RTG------------------
HUTG_GEOKA/44-315----------------------------------RAAAFIGF----ACDEGVRR.NQG.RQG------------------
SPEB_BLOFL/33-298----------------------------------NDWVITGV----PFDI...A.TSG.RSG------------------
A0ZFA2_NODSP/30-338----------------------------------ANLIVIPV----PWEV...T.VSY.GAG------------------
A4XT95_PSEMY/38-311----------------------------------LDAAFVGV----PLDI...G.TSL.RSG------------------
Q5WB32_BACSK/22-286----------------------------------ADAVIYGM----PMDW...T.VSF.RPG------------------
Q6C6P6_YARLI/9-306----------------------------------RKLSIVSA----PFSG.....GQP.KGG------------------
Q12UU8_METBU/17-282----------------------------------ASYVIFGV----PFDR...T.SSF.RAG------------------
Q213G1_RHOPB/11-309----------------------------------KRLAVLGA----AVDL.....GAS.QPG------------------
Q28PV5_JANSC/46-313----------------------------------VDVAVTGI----PFDQ...A.VTN.RPG------------------
A0QRD0_MYCS2/43-317----------------------------------HDIAVVGV----PFDS...G.VTY.RPG------------------
ARGI_NEUCR/47-354----------------------------------RDLGIVAV----GFSG.....GQC.KPG------------------
Q12LW8_SHEDO/33-299----------------------------------ANVVVIGL----PFDL...A.TTG.RSG------------------
Q2W8C1_MAGSA/22-290----------------------------------ATFCIAGI----PFDL...G.VTN.RSG------------------
Q6CIB4_KLULA/61-358----------------------------------FDIGVIGV----PFDT...A.VSF.RGG------------------
A1SLP1_NOCSJ/31-312----------------------------------ADVVVLGA----PFDG...G.TSH.RPG------------------
Q28VR8_JANSC/34-309----------------------------------ADVAILGA----PFDF...G.TQW.RPG------------------
Q0UYW2_PHANO/16-320----------------------------------HDLGVVAV----GFSG.....GQP.KPG------------------
Y309_METJA/21-281----------------------------------AEGVIFSI----PYDE...T.TSF.KPG------------------
Q9RZ04_DEIRA/29-298----------------------------------ADVAALGV----PFDI...A.LGF.RPG------------------
Q6CLS8_KLULA/13-315----------------------------------KKLGIVLA----PFSG.....GQP.KSG------------------
A2BIW8_HYPBU/25-300----------------------------------AEAVIVGV----PFDY...T.SSY.RPG------------------
Q21RM0_ALBFT/15-309----------------------------------GNISLIGV----PTDI.....GAG.MLG------------------
Q6L151_PICTO/19-280----------------------------------ARYVLFGV----PFDN...T.SSY.RRG------------------
Q4P4M4_USTMA/13-318----------------------------------KTVAIVGC----PFSG.....GQR.RKG------------------
A1B165_PARDP/30-308----------------------------------ADIAFLGI----PYGSAYTM.DEV.TND------------------
Q16AD8_ROSDO/4-296----------------------------------QKCILIGV----PMDC.....GKR.RQG------------------
Q3SMM1_THIDA/8-294----------------------------------RSIIVIGA----ASCA.....GAP.DPG------------------
Q5AK86_CANAL/12-313----------------------------------KKASIITA----PFSG.....GQP.KGG------------------
Q7VSA1_BORPE/8-302----------------------------------HGVSLIGA----PTDI.....GAG.QRG------------------
A0BHR2_PARTE/9-311----------------------------------NAVGLFGS----AVHE.....GQT.KTG------------------
Q4JAE9_SULAC/24-287----------------------------------SPFVIVGI----PLDI...T.SSF.RPG------------------
Q975R8_SULTO/24-287----------------------------------SPFVIIGL----PLDI...T.SSF.RPG------------------
Q1LGD2_RALME/2-296----------------------------------KPVTLIGA----PTDV.....GAS.IRG------------------
ARGI_AGRT5/19-313----------------------------------KTCQILGA----PVQS.....GAS.QPG------------------
Q1D421_MYXXD/27-337----------------------------------AHVILIPV----PFEA...T.TSY.GGG------------------
SPEB1_SCHPO/74-375----------------------------------FDIAFLGA----PFDT...G.TSY.RPG------------------
ARGI_YEAST/13-329----------------------------------RELSIVLA----PFSG.....GQG.KLG------------------
A9BN56_DELAS/71-341----------------------------------LQAALIGV----PMDL...G.ISN.RSG------------------
Q5A4M3_CANAL/50-340----------------------------------FDIGIIGV----PFDT...A.VSY.RPG------------------
A1RBR9_ARTAT/55-335----------------------------------YDIAIVGV----PFDG...G.TSF.RPG------------------
A1VTU0_POLNA/3-297----------------------------------QHIRLIGA----PTDV.....GAG.TRG------------------
Q0UMJ9_PHANO/68-378----------------------------------YDIAILGA----PFDT...A.VSY.RPG------------------
A1SM48_NOCSJ/41-314----------------------------------FDVAVVGV----PFDS...G.VTY.RPG------------------
Q1GI45_RUEST/67-333----------------------------------ADIAVTGI----PFDQ...A.VTN.RPG------------------
Q1IHQ4_KORVE/16-311----------------------------------KKIRVLGV----PLDL.....GQS.RRG------------------
Q6L2W0_PICTO/21-293----------------------------------PDIVITGV----PYDG...GIISH.RRG------------------
Q89H72_BRADU/11-308----------------------------------RRIALLGA----PIDM.....GAS.QRG------------------
Q489X2_COLP3/36-310----------------------------------LDIGIVGV----PLDI...G.ASN.RSG------------------
Q7V9I4_PROMA/29-293----------------------------------CNLGIYGV----NYDG...T.TSF.RPG------------------
SPEB1_SYNY3/26-297----------------------------------AAVVVVPI----PYEA...T.TSY.RKG------------------
Q6FP31_CANGA/10-317----------------------------------RQLSLVLA----PFSG.....GQG.KLG------------------
A5G414_GEOUR/41-319----------------------------------YDVIVAGV----PWEG...TVTWGTFSG------------------
Q3SVS2_NITWN/5-302----------------------------------RKVALLGV----PIDM.....GAS.QRG------------------
SPEB2_SCHPO/89-401----------------------------------FDIAIIGV----PFDT...A.VSH.RPG------------------
Q8XPR0_RALSO/29-309----------------------------------ADIAVLGM----PFGTPYSA.ADF.SND------------------
Q47TW8_THEFY/41-314----------------------------------TDIAVVGI----PFDS...G.VSY.RPG------------------
A9KQ98_CLOPH/18-281----------------------------------SEMVLFGA----PYDG...T.TSY.RPG------------------
A1BCD2_PARDP/35-312----------------------------------LDVAILGI----PWDG...G.TTN.RAG------------------
ARGI_ASHGO/93-395----------------------------------KKASLVMA----PFSG.....GQG.KSG------------------
A1B3P5_PARDP/3-295----------------------------------H.CILIGA----PVDE.....GQR.RPG------------------
Q1QTM4_CHRSD/39-312----------------------------------LDAAFVGI----PMDI...G.TSN.RPG------------------
Q6C732_YARLI/86-381----------------------------------FDIALVGA----PFDT...A.VTF.RSG------------------
A0LDK6_MAGSM/20-293----------------------------------ARVVILPL----PYEG...T.VSY.GTG------------------
Q47D78_DECAR/17-302----------------------------------SRIRIIGA----ASGL.....GAQ.DQA------------------
Q3JAG2_NITOC/2-290----------------------------------KIIRIIGV----ASGW.....GAL.DRR------------------
A3DDA1_CLOTH/24-286----------------------------------ASIVMAGV----PMDF...T.CSF.RPG------------------
A1CKP4_ASPCL/16-320----------------------------------NELGVVAV----GFNG.....GQC.KLG------------------
ARGI1_SCHPO/22-319----------------------------------NAVSIINM----PFSG.....GQP.KDG------------------
HUTG_PHOLL/44-316----------------------------------HYVALLGF----ECDEGVKR.NQG.RPG------------------
Q3IQJ3_NATPD/45-332----------------------------------ADAAVLGV----PYDG...A.VSN.RPG------------------
SPEB2_SYNY3/83-361----------------------------------YDVAIVGV----PHDS...G.TTY.RPG------------------
Q5LKZ4_RUEPO/42-315----------------------------------VQIGLVGV----PWDA...G.TTN.RPG------------------
Q2RHH4_MOOTA/26-287----------------------------------ARAVLAGI----PFDA...T.TSF.RPG------------------
Q17HI3_AEDAE/32-333----------------------------------EKIGIVGV----PFEK.....GQR.KKG------------------
A3CU48_METMJ/19-276----------------------------------ARYAVFGV----PYDG...T.TSF.RPG------------------
HUTG_HAHCH/40-316----------------------------------AGVALIGY----PCDLGVYI.NKG.RVG------------------
Q8RA93_THETN/28-290----------------------------------ADIVLVGV----PMDY...S.VSF.KPG------------------
Q8END5_OCEIH/29-310----------------------------------KDVLIYGV----PWEG...AVTWGDYTG------------------
Q5ANN8_CANAL/115-414----------------------------------IDIAIVGA----PFDT...G.TSY.RPG------------------
Q2LPR8_SYNAS/65-343----------------------------------RDVIFSGV----PWEG...TVTWGSFSG------------------
A1ST87_PSYIN/33-299----------------------------------ADIAVLGL----PFDL...A.TTG.RSG------------------
ARGI1_ARATH/63-338----------------------------------ASTSLLGV----PLGH...N.SSF.LQG------------------
A0R0G1_MYCS2/40-312----------------------------------ADVAVVGV----PFDS...A.VTY.RPG------------------
A1CFK4_ASPCL/83-374----------------------------------YDIAFLGA----PFDT...A.VTG.RPG------------------
B8I5M8_CLOCE/21-282----------------------------------SDIVIFGA----PYDG...T.TTF.RPG------------------
A1TIE4_ACIAC/8-305----------------------------------RPVTLIGV----PTDV.....GAA.RLG------------------
A1T9H7_MYCVP/46-324----------------------------------PDVAVVGA----PFDV...G.TTN.RPG------------------
Q97VA3_SULSO/30-299----------------------------------IKAAFLGI----PFDD...A.VTY.RPG------------------
Q4J720_SULAC/30-299----------------------------------VKAAFLGI----PFDD...A.VTY.RTG------------------
Q3J2B4_RHOS4/46-312----------------------------------VDLAITGV----AFDQ...A.VTN.RTG------------------
A1CGK0_ASPCL/61-357----------------------------------LDIAILGF----PYDT...S.TSY.RPG------------------
Q10Y47_TRIEI/24-296----------------------------------AKVVIVPI----PYEA...T.TTY.RRG------------------
A5G278_ACICJ/28-297----------------------------------AAHVVAGI----PLDV...G.VTN.RAG------------------
ARGI_SOYBN/71-346----------------------------------ATSTLLGV----PLGH...N.SSF.LEG------------------
O76895_DROME/30-333----------------------------------QSLGIIGV----PFAK.....GQA.KQG------------------
A1W2M6_ACISJ/2-298----------------------------------TTLTLIGA----PTDV.....GAS.VLG------------------
A8GC83_SERP5/32-305----------------------------------LDAAFVGI----PLDI...G.TSN.RSG------------------
Q1GHG8_RUEST/4-296----------------------------------RHCILVGA----PVDS.....GKR.RTG------------------
Q65P52_BACLD/4-300----------------------------------QQISMIGV----PMDL.....GQL.RRG------------------
Q67TJ0_SYMTH/28-290----------------------------------ARAVLWGI----GQDF...T.TSY.RPG------------------
A4XZN2_PSEMY/43-309----------------------------------VDLAISGV----PFDT...A.TTN.RPG------------------
A4YE21_METS5/29-295----------------------------------VEAVFIGI----PFDD...A.TTY.RPG------------------
Q6ANF4_DESPS/59-334----------------------------------IDFAVLGI----PFDT...A.TTY.KPG------------------
Q222F3_ALBFT/24-298----------------------------------QPFAVVGV----PFDG...A.VTH.RPG------------------
ARGI2_MOUSE/24-324----------------------------------HSVAIVGA----PFSR.....GQK.KLG------------------
Q315M1_DESAG/23-287----------------------------------ARFHIIPA----GYEA...S.VSY.GGG------------------
A7IL28_XANP2/50-316----------------------------------AEVVVWGV----PLDV...A.VSN.RPG------------------
Q18A84_PEPD6/21-285----------------------------------SNLIVFGV----GFDG...T.TSN.RPG------------------
Q5V6R7_HALMA/44-335----------------------------------VDIGILGA----PLDT...A.TTI.RPG------------------
Q5LRK8_RUEPO/33-325----------------------------------KTCILIGA----PVDS.....GKR.RTG------------------
Q9K8M2_BACHD/4-296----------------------------------KKIAVIGA----PMDL.....GQN.RRG------------------
Q3ABP1_CARHZ/20-281----------------------------------AAFVLFGI----PMDF...T.VSF.RPG------------------
A9CJC2_AGRT5/42-307----------------------------------VSTAIWGI----PFDA...A.TSN.RPG------------------
Q7U3K9_SYNPX/21-280----------------------------------CRVGLFGV----PYDG...T.TSF.RPG------------------
A1STQ5_PSYIN/47-343----------------------------------SGITLLGF----CCDEGVRR.NKG.RIG------------------
Q7VY32_BORPE/13-287----------------------------------ALACVLGI----PFDC...G.THPFRVG------------------
Q9CL61_PASMU/34-299----------------------------------AEWVITGV----PFDA...S.VSG.RAG------------------
A4IB49_LEIIN/14-315----------------------------------.KMSIVLA----PFSG.....GQP.HSG------------------
A5UXL8_ROSS1/34-305----------------------------------.DVAVVGL----PFDT...G.ATF.KVG------------------
A9WCM8_CHLAA/41-307----------------------------------AQVVILGC----PQDIGVLR.NRG.RPG------------------
B2FJ13_STRMK/7-298----------------------------------..VSLIGV----PTDV.....GAG.HRG------------------
B4EIP8_BURCJ/49-320----------------------------------.DACFVGV----PFDL...G.TSN.RTG------------------
B4ELX2_BURCJ/44-308----------------------------------.DVAISGV----PLDL...A.TTY.RSG------------------
B5GLC8_STRC2/31-301----------------------------------.DVVVIGA----PYDG...G.TSY.RPG------------------
B9A9C6_BOMMO/12-304----------------------------------.RVGVIGV----PFEK.....GQK.KYG------------------
C0ZIM2_BREBN/4-293----------------------------------.NMSIVGV----PMDL.....GAD.RRG------------------
D0J7J2_COMT2/7-302----------------------------------...TLIGL----PTDI.....GAS.RLG------------------
D5AV62_RHOCB/6-296----------------------------------...IILGA----PIQS.....GTH.QPG------------------
D5SKW9_STRC2/134-404----------------------------------.DVVVVGA----PYDG...G.TSY.RPG------------------
E3GWR7_METFV/23-279----------------------------------..FGLLGV----PFDS...T.STY.KPG------------------
E9CYX8_COCPS/18-317----------------------------------..LGVVAV----GFSD.....GQP.NQG------------------
F1QJZ3_DANRE/86-357----------------------------------.DAAFIGV----PIDT...G.TSN.RPG------------------
F6SZP1_XENTR/61-332----------------------------------.DAAFIGV----PLDT...G.TSN.RPG------------------
I9NPV5_COCIM/78-370----------------------------------.DIAILGA----PFDT...A.VTA.RPG------------------
K5X448_AGABU/13-305----------------------------------..AAIVGC----PFSG.....GQR.RTG------------------
SPEB_NEIMB/35-299----------------------------------ADWVITGV----PYDM...A.VSG.RSG------------------
Q05AR1_XENTR/27-324----------------------------------.SVAVIGA----PFSK.....GQK.RRG------------------
Q24ZK6_DESHY/5-295----------------------------------.KVRIIGV----PIDL.....GAD.RRG------------------
Q251M0_DESHY/26-286----------------------------------ADAVILGI----PMDY...T.VSF.RPG------------------
Q2FW91_STAA8/6-296----------------------------------.AIDIIGA----PSTF.....GQR.KLG------------------
Q2K3I8_RHIEC/7-299----------------------------------.SVTLIGA----PLEE.....GSG.RRG------------------
Q2K9W6_RHIEC/65-328----------------------------------.DVAVWGI----PFDA...A.TSN.RPG------------------
Q3IKA3_PSEHT/33-297----------------------------------ADVVVLGL----PFDM...A.TSG.RPG------------------
Q46IA1_PROMT/31-292----------------------------------..VSLLGV----PYDG...T.CCF.RPG------------------
Q4FL05_PELUB/40-312----------------------------------.DVAIVGI----PFDA...G.TSY.RAG------------------
Q5KIC1_CRYNJ/70-373----------------------------------.DIALLGV----PFDS...A.VSF.RPG------------------
Q5L3P6_GEOKA/3-294----------------------------------.PISIIGV----PMDL.....GQT.RRG------------------
HUTG_LEGPH/47-315----------------------------------.KTIFLGF----ASDTGIKR.NLG.RTG------------------
Q6LHE2_PHOPR/35-321----------------------------------..AVLFGV----ASDLSLGR.FRG.RLS------------------
Q6LWW9_METMP/19-277----------------------------------ADFVIFGI----PFDA...T.TSY.KPG------------------
Q6N0N3_RHOPA/14-309----------------------------------.RVALLGV----PIEI.....GAG.LRG------------------
Q6PH54_DANRE/25-322----------------------------------.SVAILGA----PFSK.....GQK.RRG------------------
Q72EZ7_DESVH/23-282----------------------------------.RFHVIPA----PFEA...S.VSY.GGG------------------
Q7T151_DANRE/27-322----------------------------------.SVGIIGA----PFSK.....GQQ.KDG------------------
Q7V3X2_PROMM/30-287----------------------------------.NVGLFGV----PYDG...T.SSF.RPG------------------
SPEB_BACAN/23-284----------------------------------.EVVIYGM----PMDW...T.VSY.RPG------------------
Q81VP0_BACAN/4-292----------------------------------.EISVIGV----PMDL.....GQM.RRG------------------
Q81Y48_BACAN/37-311----------------------------------..AALIGA----PLSK...P.SIS.HSG------------------
Q82VE5_NITEU/46-310----------------------------------.ELVISGI----PLDL...A.VSY.RSG------------------
HUTG_VIBPA/47-325----------------------------------..VSILGF----ATDAGVAR.NKG.RIG------------------
Q88KU3_PSEPK/34-298----------------------------------.DVVVSGV----PFDT...A.TSN.RPG------------------
Q8RG18_FUSNN/503-779----------------------------------...VLIGV----QTNL.....GVN.KTG------------------
Q8TJ04_METAC/18-281----------------------------------.RYVIFGV----PFDN...T.SSY.RAG------------------
Q8XMY7_CLOPE/21-278----------------------------------.SIVVFGA----PFDS...T.TSF.RPG------------------
Q92LN4_RHIME/3-295----------------------------------.TITLIGA----PIEE.....GSG.RRG------------------
Q92MV8_RHIME/71-339----------------------------------.QVAMIGV----PMDL...G.VTN.RPG------------------
Q92QR6_RHIME/44-306----------------------------------..AVVWGI----PFDA...A.TSN.RPG------------------
GPUA_PSEAE/36-307----------------------------------.QVGLIGV----PWDG...G.TTN.RAG------------------
Q9KLD2_VIBCH/33-297----------------------------------ADVVVLGV----PLDM...A.TSG.RPG------------------
HUTG_VIBCH/44-322----------------------------------.GVALIGF----ECDAGVER.NKG.RTG------------------
U5L6E1_9BACI/3-293----------------------------------.KLSIIGM----PMDL.....GQM.RRG------------------
U5LEA0_9BACI/39-314----------------------------------.NVIIYGA----PLSR...S.SIS.VSG------------------
W6RQZ8_9RHIZ/120-388----------------------------------.DVALIGV----PMDL...G.VTN.RAG------------------

PF00850

A0DIS2_PARTE/29-344H............F.SA.K..E.........HC.ENPQRTQSIDKTIQNYLSS......K.D....LKNKVEQ.......
A0LGT0_SYNFM/15-314H....................CTG....SN.HP.ESPERLEA....VYRGVEE......A.G....LFPRLTL.......
A1W7T1_ACISJ/25-356HAPEHEFFRGERI................P.CF.ENPTRAAY....VEAALTA......R.G.......HVL........
A2BL29_HYPBU/15-315H.....................EP...PYGSHP.ESPERLAI....ALESLAK......T.G....LYTLVHI.......
A3DNS7_STAMF/16-313H..........SPW.FE..............HP.ENPGRIKY....VIDGIKR......N.G....LTDYTR........
A3GH68_PICST/21-341S..........ERV..T..KICD......L.LP.SNKGRQS.....LISSLLS......AYG....LR.ERCYG......
A4S2N1_OSTLU/197-606H.................VSFKP........HQ.ESPERIVA....ILAELQR.............VIDRGELAMGE...
A4S898_OSTLU/22-313H..........ASY..SKPVMPR......G.HR.FPMTVFQR....VHDILREEG..VIARGQTNCFVPG..........
A4X4X7_SALTO/10-318D..........ENL..LSYNLGD........HP.LDPVRVEL....TVALARE......L.G....VLGRSGVR......
A4YNH4_BRASO/45-371HDPQFYLVRGVIK................R.TT.EQPERADR....L...LAG......L.K....AGNHEL........
A6QAF4_SULNB/14-302H....................DTG....TA.HP.ESRYRLEA....IEKAVA.........P....LKKRLID.......
A6R4B6_AJECN/49-360P..........DVE..P.HHFGS......S.HP.MKPWRLT.....LTKQIVM......AYG....M..HHAMD......
A6VSZ5_MARMS/14-305H....................DMG....ED.HP.ESPLRLGA....IQNRLIM......G.Q....LMDFLRR.......
A7SSG8_NEMVE/23-333N..........TLICSL.Y...............EVPDRIGR....PYEKHKE......Y.G....LL.DRCY.......
A7SUP8_NEMVE/23-330S..........EDS....VNLCD......K.LP.KVTGRAS.....LTSSLIE......AYG....LLKDRNIR......
A7TRW5_VANPO/9-404T..........SRF..Q.SQVAD......L.LP.CNKYKKSQ....LTYSLLV......SYG....LL.DGFDV......
A8ABS4_IGNH4/14-309H..................KTPP......G.HP.ESPERVKA....ILDLMKR........T....KLPNYVE.......
A8ZT95_DESOH/16-310H....................KTG....HA.HP.ESPSRLAS....IYRMVDR......H......FAGTVTT.......
A9A062_DESOH/259-573H..........VRE..R............G.YV.ESPVRVKS....ILKHLER......S.D....L..FSV........
A9B5I1_HERA2/14-309H....................DQ.....PE.HP.ENANRLRA....IHAMLAA......DYE....LQQHLTP.......
B0T7F0_CAUSK/32-328Q....................PD......R.HV.YDPEVVRR....FRNLVDV......S.G....LLKKLVD.......
B2JV93_BURP8/15-309H....................QPG....PH.HP.ESPKRLDT....VLKTLRS........P....EFAALAW.......
B4U8T2_HYDS0/14-304H....................DE.....PK.HP.ENANRLKV....ALEYIYK......S.D....IKNILSF.......
C5KDG6_PERM5/340-870H...............GRWVRSI......K.RVLQTRKRYIVP..DCKESLWDSCAWADSVS..................
E0TF48_PARBH/5-292Y..........SSD..FTIALPA......G.HR.FPAIKYQL....LKTALIEER..LLPAE...RLAPS..........
E2RU63_GIAIC/11-320N..........PLF..PTFYFGL......H.HP.MKPFRIA.....LVNELIL......AYG....L..DEHLN......
F2G2X2_ALTMD/14-319H....................DLG....KD.HP.ESPDRLFA....IDDQLLS......S.G....LDMVCEH.......
O67135_AQUAE/10-314L...........DY..GKYRYPK......N.HP.LKIPRVSL....LLRFLDA......M.N....LIDEKEL.......
HDA1_YEAST/69-395H..........AKIFTSYFEYID......P.HP.EDPRRIYR....IYKILAE......N.G....LINDPTLSGVDDL.
Q00U49_OSTTA/445-741H..........ADW..ARVDLPD......G.HR.FPMDKYQL....ARLALQNDD..TLRGKI.ELRAS...........
Q02CA3_SOLUE/14-311H....................LAG....RR.HP.ECPARFDA....VLDGLDR......A.G....LLAKMLR.......
Q0A6Z7_ALKEH/46-336W....................N.........YP.EHPGRLTA....IMDLLVR......E.P....VPGVTF........
Q0ARF0_MARMM/14-308H..................LVPP......G.HP.EHVGRYEA....VREALLALPGCDWREA..................
Q15WQ0_PSEA6/14-301H..........PIY..SQLDLPF......K.HR.FPIEKYQA....IYDKLIGLG..VPQGQ...FHQP...........
Q1CZX8_MYXXD/21-314H....................DPG....QG.HP.ESPSRLRR....ILGVLAS......T.P....VKGTVM........
HDA6_CAEEL/438-748H............F.DL.E..ED......N.HP.EKPARTRR....ILKTLRE......S.G....VL.EKCVD......
Q29CG7_DROPS/25-326S..........KSYAVRFHGLER......L.HP.FNAAKGKH....IHKALCAEL..SLVEGS..FYEP...........
Q2FQW8_METHJ/14-311H..........EQS...............SSHP.ERRERLSY....TLDQLEE......E.G....IFDLPQIR......
Q2IF50_ANADE/16-319H....................DPG....PG.HP.ERQARLEA....ALEALAA......DPA....LGPEVLE.......
Q2KBQ8_RHIEC/14-309H....................VTP....AG.HP.ERSDRIRA....INVALEH........P....NFERLER.......
Q2LVD3_SYNAS/15-311H....................LTG....PG.HP.ESPRRLEV....IYDMLED......R.D....MQGRFQD.......
Q2R9B1_ORYSJ/26-342D..........PGI..AHIKFSD......D.HV.MVPARVA.....MAHSLVG......VYG....M..LGDMR......
Q2S035_SALRD/7-313H..........DRY..LDYHFGP......Q.HP.FSPVRQEM....TMDLLAA......L.G....APLNPV........
Q2SC27_HAHCH/8-315S..........PHYDFRLPGLAA......L.HP.FDASKYSR....AWSVLREHFGEKLADIT..LQIN...........
Q30PJ4_SULDN/258-572H..........VQE..L............G.YV.EAPVRIPI....ILEALDK......T.G....L..FLR........
Q31EP6_THICR/49-347H....................DM.....SG.HP.ENAQRLVA....INNEMEK......Q.G....IWPQLTP.......
Q31HC2_THICR/13-304H....................SNG....WG.HP.ENAQRVVR....IEQALTD......A.R....LLSNTLH.......
Q38C74_TRYB2/21-323D............C..TLSALVP......Q.HA.MKPYRLL.....VTMELIA......SLG....L..KRFCR......
Q39UV4_GEOMG/11-315N...........DF..SRFSYGD......D.HP.FKIQRIIL....ARELMGM......L.G....LTELPGAC......
Q3AFN8_CARHZ/10-319S..........DDY..LSYRLAE......D.HP.LNPQRYAL....AVELMKI......A.E....VLKEEEI.......
Q4D762_TRYCC/47-388Y..........ACP..VFSHKKS......G.DA.MNTVSSD.....VFEWVLE......PLP....V.............
Q4FNF7_PELUB/14-306H....................NTG....DG.HP.EKIDRVTV....VIDNFKK......L.D....NK.NLIW.......
Q4KAJ1_PSEF5/12-340HHGTE.LKDGVLK................P.SF.EQPSRADT....VRDRVRH......V.G....LG.EII........
Q4MYQ3_THEPA/25-416H....................DDM...NQD.HV.ESHKRLSS....ILERLNE......A.K....ISLKFEHELPLT..
Q4P2D6_USTMA/326-751H..........AAYLEYLCNKAP......N.HP.PQSHRKPH....QTSPSKSIPEDSETYT..................
Q4QAJ4_LEIMA/91-404H..........SVT..A.IAYAE......G.HL.MRPSRVR.....ALHALVH......SLG....LDNAECMT......
Q4QI60_LEIMA/58-432H.................RSDMN......R.SP.ETPHRLQR....AIETLQG......CER....ALDV..........
HDA21_DICDI/1072-1486H..........LVP..D............D.HP.ESPKRLSS....VIKAIND......FSR....QSDRLII.......
Q59Q78_CANAL/56-379S..........EFA..T..KIVD......L.LP.SNKGRQS.....LVLGLIE......AYK....LI.DLCDG......
Q5AF34_CANAL/175-593H..........AFGRKWVTKSYL......S.TIFERPQRLLASCIGVASAVSMFPFYYKVIN....STKR..........
Q5K8L3_CRYNJ/64-492S..........PAL..Q..RLSD......D.LP.SNVGRSS.....MVHDLIR......SLD....LLDFEELKERFLKS
Q5KKR8_CRYNJ/28-368H..........DVG..N.YHFGL......G.HP.MKPHRIR.....MTHNLVV......NYG....LADDYEAMEEEGRR
Q60DG7_ORYSJ/34-350HDAGRGVFDSGRDP..GFLDVLD......Q.HP.ENADRVRN....MVSILRR........G....PIARFIS.......
Q6AJC0_DESPS/18-318H....................DTG...GGG.HP.EVPARLEV....ILKCLEE......S.P....LLPHLKF.......
Q6AKN4_DESPS/15-311H....................QIE...AAS.H..ESPNRLRE....LFPAVRK........R....YNGDLRI.......
Q6C3Y5_YARLI/54-352H..........PLA....SKVCS......G.RP.SNEGRAA.....LVDSLLVALQLHKSYK....LIPI..........
Q6CGA7_YARLI/254-648H..........TFGRSWMGKKYK......D.SLVERPERLKATSLGVGAAIANNPGKFEIEE....SVRQ..........
Q6FWB7_CANGA/8-383A..........SQF..Q.SQVVD......L.LP.CNKRQKSQ....LIYSMLE......SYG....LL.ECFDH......
Q741C0_MYCPA/14-307H....................RTA....PG.HP.ERPDRYRA....VAAALSR........P....GFDALVR.......
Q7PS30_ANOGA/118-424H............R.CL.W..DT......N.YP.ECPERYLR....VMERFTI......G.Q....LV.DRCQ.......
Q8EP92_OCEIH/11-321A...........DY..LKYHFHE......N.HP.FNQKRVLL....TKELLEA......H.Q....VLSNHDL.......
Q8I4I9_CAEEL/17-318H....................ECKYDSTMA....ECPKRMKL....IYERLQK......D.K....LLDGAVK.......
Q8IR37_DROME/555-861H............C.NL.N..DT......G.HP.EQPSRIQH....IHKMHDD......Y.G....LL.KQMK.......
HDA14_ARATH/75-387H....................NK.....ES.HP.ECSARVPA....IVNALEM......N.E....LTPKFRGSQI....
Q9K0J2_NEIMB/35-328H....................EPG....AN.HP.DSPDRILC....IEQALRR......A.G....IWQHLQT.......
Q9U266_CAEEL/18-319H..........DQP..W....PS......Y.HI.EVPRRLDA....ILERLNT......T.K....LLTDPRIE......
F5GX36_HUMAN/250-576............QC..T.CGSSS......S.HP.EHAGRIQS....IWSRLQE......T.G....LRGKCEC.......
F6Q3W9_MOUSE/101-401.....................DD......S.FP.ESPERLHA....IREQLIL......E.G....LLGRCVS.......
G4VAN3_SCHMA/13-356...................QLCC......S.SP.KFGDRYA.....LVMDLIN......AYK....LIPELSRVP.....
K3ZRV5_SETIT/229-519.....................PN......P.HP.ERPDRLRA....IAASLAA......A.G....IFPSKCA.......
Q22CW6_TETTS/24-319....................KQP......P.HP.ECPERIEK....IIENLKK......T.G....LWSQLDV.......
Q2G292_STAA8/18-322................Q.YRFHD......Q.HP.FNQMRLKL....TTELLLN......ANL....LSPEQI........
Q8F7M9_LEPIN/19-309.....................TI......P.HY.ENSDRLLA....CLNRLHQ......S.S....YFNSLFF.......
V6EZA3_9PROT/18-307......................D......Y.HP.ECADRLKA....VLAGLET.....EEFS....LLQRE.........
W7X9B2_TETTS/36-342.....................VR......Q.HV.ECPARLQS....IFNHLTT......Q.G....LLKSPLVH......

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------------------------------------------
C2XKX5_BACCE/12-239--------------------------------------------------------------------------------
B9BUU1_9BURK/13-199--------------------------------------------------------------------------------
B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C2SK71_BACCE/15-171--------------------------------------------------------------------------------
C3Q562_9BACE/31-198--------------------------------------------------------------------------------
D7W5E5_9FLAO/27-172--------------------------------------------------------------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UPR5_METVS/56-208--------------------------------------------------------------------------------
A9AA45_METM6/55-201--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------
A0A031WF12_PEPDI/78-183--------------------------------------------------------------------------------
B6G251_9FIRM/77-182--------------------------------------------------------------------------------
B0A6K5_9FIRM/76-181--------------------------------------------------------------------------------
C0CJH7_9FIRM/6-165--------------------------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387---------------------------------------------------------ARFGPSSLREGSRRIN.......
Q6BJQ5_DEBHA/76-370---------------------------------------------------------ARFGPRAIRSASQRQT.......
Q6BVQ4_DEBHA/136-428---------------------------------------------------------SRFGPLGIRMATKRMS.......
Q6BWL4_DEBHA/179-480---------------------------------------------------------ARFGPDSIRSASKRLGGVSPDRG
A1RXI5_THEPD/26-288---------------------------------------------------------QRFAPQRIREVSVELE.......
SPEB_MOUSE/77-350---------------------------------------------------------ARFGPCRIREESLMLG.......
A4XKN0_CALS8/20-281---------------------------------------------------------SRFGPSKIREVSVGLE.......
A4J1T2_DESRM/21-282---------------------------------------------------------TRQGPQSIRQVSIGLE.......
A1VQK9_POLNA/34-307---------------------------------------------------------ARFGPRQIRAESSLIR.......
Q2K8A9_RHIEC/46-316---------------------------------------------------------ARFGPRAVRNVDR.VG.......
B2JW15_BURP8/32-305---------------------------------------------------------ARFGPREIRNMSTMMR.......
Q982X2_RHILO/42-307---------------------------------------------------------ARFGPQAIRRASAILD.......
HUTG_BACHD/35-311---------------------------------------------------------ASFAPTVIRKCLHAFS.......
HUTG_RHOSR/40-314---------------------------------------------------------AARGPDALRGALSSMA.......
ARGI1_HUMAN/6-305---------------------------------------------------------VEEGPTVLRKA.....G.....L
SPEB_CHRVO/44-311---------------------------------------------------------ARMGPQAIRAASVQLA.......
ARGI_BACSU/3-292---------------------------------------------------------VDMGPSAIRYA.....H.....L
Q97ZX8_SULSO/24-289---------------------------------------------------------SRFAPSSIRESAQYIE.......
HUTG_VIBVY/45-328---------------------------------------------------------AKKSPDLIRRALANLA.......
A9BRG6_DELAS/16-312---------------------------------------------------------SAMGPDALRVA.....G.....L
HUTG_AROAE/40-323---------------------------------------------------------AAEGPAALRRTLANLA.......
A1RB53_ARTAT/29-311---------------------------------------------------------AENGPAFLRAASRRYTWG..YPD
Q1J2W9_DEIGD/37-306---------------------------------------------------------ARYAPRALREAS..........L
Q2JER0_FRASC/40-318---------------------------------------------------------ARFGPRAMRANAYNP........
Q3J346_RHOS4/3-296---------------------------------------------------------CLMGPAAYRVA.....G.....L
A9B324_HERA2/22-290---------------------------------------------------------TVNGPSAIIEASQQVE.......
Q9YBG0_AERPE/29-298---------------------------------------------------------QRFAPREIRRASIELE.......
Q1GI44_RUEST/34-307---------------------------------------------------------TRFGPKQIRAESAMIR.......
Q9HJB2_THEAC/33-293---------------------------------------------------------SKYAPDSIRSAYVNLE.......
A0RXD6_CENSY/22-283---------------------------------------------------------TRFGPDAIREAFNNIE.......
A8LLU9_DINSH/46-312---------------------------------------------------------CRLGPRAIREASSLQP.......
SPEB_BACHD/22-286---------------------------------------------------------SRFGPNRIREASLGLE.......
Q0W940_UNCMA/16-280---------------------------------------------------------SRWAPDEMRKMSYNFE.......
Q6MHV0_BDEBA/36-309---------------------------------------------------------GRFAPAKVREVSSLGR.......
Q98MW3_RHILO/19-296---------------------------------------------------------HALAADAIRAAS.QDD......A
A0LG67_SYNFM/34-297---------------------------------------------------------TREGPRAILAASRELE.......
HUTG_BACSU/35-311---------------------------------------------------------ASFAPGTIRQALKHSS.......
Q9K5Y7_BACHD/5-297---------------------------------------------------------VDMGPSAMRYA.....G.....L
Q164F4_ROSDO/46-312---------------------------------------------------------TRLGPRAIREASALQP.......
Q164F5_ROSDO/34-308---------------------------------------------------------TRFGPKEVRAESAMIR.......
Q15X44_PSEA6/42-323---------------------------------------------------------AKTGPNAIRSALANLP.......
Q11J67_CHESB/42-307---------------------------------------------------------ARFGPQAIRRASVIFD.......
Q1AWJ4_RUBXD/5-295---------------------------------------------------------VDMGPSAIRYA.....R.....L
Q5WL42_BACSK/7-290---------------------------------------------------------SRFAPEKIREAFAWFAN....RI
Q7UZH9_PROMP/24-288---------------------------------------------------------TRFGPNAIRLVSTCLE.......
Q6CLB8_KLULA/137-438---------------------------------------------------------ARFGPNGIRQGSRRLG.......
A0JT79_ARTS2/57-331---------------------------------------------------------ARFGANHVREASRLLR.......
Q2KVZ3_BORA1/13-287---------------------------------------------------------SRQGPDAIREQSRLLRPF..DLF
B2UBQ2_RALPJ/40-316---------------------------------------------------------AQAGPAAIRKMLANLP.......
Q165U0_ROSDO/35-314---------------------------------------------------------ARFGPRGVREASTLFS......F
B1YHV3_EXIS2/22-286---------------------------------------------------------SRFGPARIREVSLGLE.......
Q5WIT9_BACSK/27-306---------------------------------------------------------CELGPKVMRLCSARYSG....YL
A1C610_ASPCL/68-380---------------------------------------------------------ARFGPRAIRAASARQM.......
Q1AS11_RUBXD/33-307---------------------------------------------------------ARFGPEAIRSVSHLLR.......
Q28QX8_JANSC/39-314---------------------------------------------------------ARHGPRALRDASTMIR.......
A1WGI6_VEREI/22-320---------------------------------------------------------ASMGPEALRVA.....G.....L
A1WER7_VEREI/22-295---------------------------------------------------------TRFGPRQIRAESVLLR.......
A1T3A2_MYCVP/88-364---------------------------------------------------------TRFGPQGIRRSTNLFGT.....Y
A8LRL4_DINSH/4-296---------------------------------------------------------CLMGPDAYRTA.....G.....L
A5V551_SPHWW/4-298---------------------------------------------------------CAMGPEAMRIA.....G.....L
Q11NZ4_CYTH3/3-310---------------------------------------------------------TSLAVDALLVA.....D.....A
Q5V4R8_HALMA/3-300---------------------------------------------------------VDMGPSAIRYG.....G.....L
SPEB_SERP5/33-298---------------------------------------------------------GRHGPAAIRQVSTNLA.......
Q12BY7_POLSJ/72-342---------------------------------------------------------ARLGPRAVRNVER.IG.......
HUTG_VIBF1/45-345---------------------------------------------------------AYAAPQVIRRALANLA.......
Q3IVT5_RHOS4/32-308---------------------------------------------------------ARFAPNALRAMSVMLR.......
HUTG_GEOKA/44-315---------------------------------------------------------AKEAPAAVKAALARLP.......
SPEB_BLOFL/33-298---------------------------------------------------------SRFGPASIRKASINLA.......
A0ZFA2_NODSP/30-338---------------------------------------------------------TAKAPQQILDASIQLD.......
A4XT95_PSEMY/38-311---------------------------------------------------------TRFGPREIRAQSVMIR.......
Q5WB32_BACSK/22-286---------------------------------------------------------SRFGPARIREASLGLE.......
Q6C6P6_YARLI/9-306---------------------------------------------------------VDKGPEYLLGG.....G.....L
Q12UU8_METBU/17-282---------------------------------------------------------SRWAPDAIRSATANFE.......
Q213G1_RHOPB/11-309---------------------------------------------------------TLMGPAALRTA.....G.....L
Q28PV5_JANSC/46-313---------------------------------------------------------TRLGPRAIRAASALQP.......
A0QRD0_MYCS2/43-317---------------------------------------------------------ARFGPSAIREASRLLK.......
ARGI_NEUCR/47-354---------------------------------------------------------VDAAPSALIES.....G.....L
Q12LW8_SHEDO/33-299---------------------------------------------------------GRMGPEAIRRASVNLA.......
Q2W8C1_MAGSA/22-290---------------------------------------------------------AREGPQAVRRASRMLA.......
Q6CIB4_KLULA/61-358---------------------------------------------------------ARFGPQAIRKASQRQT.......
A1SLP1_NOCSJ/31-312---------------------------------------------------------TRFGPSAIRQTDYLPQ.......
Q28VR8_JANSC/34-309---------------------------------------------------------ARFGPRAIREASTLFA......F
Q0UYW2_PHANO/16-320---------------------------------------------------------VDAAPMALIEA.....G.....L
Y309_METJA/21-281---------------------------------------------------------AREGGNAIRTASWGLE.......
Q9RZ04_DEIRA/29-298---------------------------------------------------------ARFAPRALREAS..........L
Q6CLS8_KLULA/13-315---------------------------------------------------------VENGPKYLMKQ.....G.....L
A2BIW8_HYPBU/25-300---------------------------------------------------------SRFAPRAIREAAANIE.......
Q21RM0_ALBFT/15-309---------------------------------------------------------ARMGPEALRVA.....G.....L
Q6L151_PICTO/19-280---------------------------------------------------------SRLSPNYIRYAYNNLE.......
Q4P4M4_USTMA/13-318---------------------------------------------------------VDTGPVSLVQA.....G.....I
A1B165_PARDP/30-308---------------------------------------------------------QTRAPTAVRQAT.DRA......V
Q16AD8_ROSDO/4-296---------------------------------------------------------CLMGPDAYRTA.....G.....L
Q3SMM1_THIDA/8-294---------------------------------------------------------CAAGPDALHHY.....E.....V
Q5AK86_CANAL/12-313---------------------------------------------------------VELGPDYILKA.....G.....F
Q7VSA1_BORPE/8-302---------------------------------------------------------ASMGPEALRVA.....G.....L
A0BHR2_PARTE/9-311---------------------------------------------------------TELAPRALREG.....G.....L
Q4JAE9_SULAC/24-287---------------------------------------------------------SRFAPSVIREVAQYIE.......
Q975R8_SULTO/24-287---------------------------------------------------------SRFAPSTIREYAQFIE.......
Q1LGD2_RALME/2-296---------------------------------------------------------ASMGPEALRVA.....D.....I
ARGI_AGRT5/19-313---------------------------------------------------------CLMGPDAFRTA.....G.....L
Q1D421_MYXXD/27-337---------------------------------------------------------TSEGPTAVLEASRQVD.......
SPEB1_SCHPO/74-375---------------------------------------------------------ARFGPSGIREGSRRLN.......
ARGI_YEAST/13-329---------------------------------------------------------VEKGPKYMLKH.....G.....L
A9BN56_DELAS/71-341---------------------------------------------------------CRFGPRALRSIER.VG.......
Q5A4M3_CANAL/50-340---------------------------------------------------------ARFGPRAIRDASQRQN.......
A1RBR9_ARTAT/55-335---------------------------------------------------------ARFGPAAVREASRLLR.......
A1VTU0_POLNA/3-297---------------------------------------------------------ASMGPEAFRVA.....G.....L
Q0UMJ9_PHANO/68-378---------------------------------------------------------ARFGPRAIRAGSSRQT.......
A1SM48_NOCSJ/41-314---------------------------------------------------------ARFGPSHIRQGSRLLR.......
Q1GI45_RUEST/67-333---------------------------------------------------------TRLGPRAVREASALQS.......
Q1IHQ4_KORVE/16-311---------------------------------------------------------VDMGPSAVRVA.....G.....L
Q6L2W0_PICTO/21-293---------------------------------------------------------ARYGPERIREIMNSYS.......
Q89H72_BRADU/11-308---------------------------------------------------------TLMGPPALRTA.....G.....L
Q489X2_COLP3/36-310---------------------------------------------------------TRFGPRSVRNESVLVR.......
Q7V9I4_PROMA/29-293---------------------------------------------------------ARFGPSSIRQVSNGIE.......
SPEB1_SYNY3/26-297---------------------------------------------------------CEHGPEAVLEASDQLE.......
Q6FP31_CANGA/10-317---------------------------------------------------------VEKGPKYMLKH.....G.....L
A5G414_GEOUR/41-319---------------------------------------------------------CELSPKTIRHASARYGG....FL
Q3SVS2_NITWN/5-302---------------------------------------------------------TLMGPAALRTA.....G.....I
SPEB2_SCHPO/89-401---------------------------------------------------------ARFGPKGIRSASSRQM.......
Q8XPR0_RALSO/29-309---------------------------------------------------------QTNAPAAIRQAT.DRV......A
Q47TW8_THEFY/41-314---------------------------------------------------------ARFGPAAIREASRLLR.......
A9KQ98_CLOPH/18-281---------------------------------------------------------TRFASAAIRNESYGIE.......
A1BCD2_PARDP/35-312---------------------------------------------------------ARHGPREVRNQSSLMR.......
ARGI_ASHGO/93-395---------------------------------------------------------VEDGPKYLLKQ.....G.....L
A1B3P5_PARDP/3-295---------------------------------------------------------CLMGPAAYRVA.....G.....L
Q1QTM4_CHRSD/39-312---------------------------------------------------------TRLGPRQIRDESRMLR.......
Q6C732_YARLI/86-381---------------------------------------------------------ARFGPAGIRKGSRRMS.......
A0LDK6_MAGSM/20-293---------------------------------------------------------TSQGPRAILEASKQLE.......
Q47D78_DECAR/17-302---------------------------------------------------------CEDGPVAFHHS.....Q.....A
Q3JAG2_NITOC/2-290---------------------------------------------------------CEAGPEALRRR.....G.....L
A3DDA1_CLOTH/24-286---------------------------------------------------------TRFGPQKIREVSIGIE.......
A1CKP4_ASPCL/16-320---------------------------------------------------------VEAAPLALIEA.....G.....L
ARGI1_SCHPO/22-319---------------------------------------------------------AELAPEMIEAA.....G.....L
HUTG_PHOLL/44-316---------------------------------------------------------ANQGPDYLRQSLANMA.......
Q3IQJ3_NATPD/45-332---------------------------------------------------------ARFGPRAVRRASGWLA.......
SPEB2_SYNY3/83-361---------------------------------------------------------TRFGPQGIRRISALYTP.....Y
Q5LKZ4_RUEPO/42-315---------------------------------------------------------PRHGPRQLRDLSTMIR.......
Q2RHH4_MOOTA/26-287---------------------------------------------------------TRWGPRAIRSVSEVLE.......
Q17HI3_AEDAE/32-333---------------------------------------------------------VGLGPKAIREA.....G.....L
A3CU48_METMJ/19-276---------------------------------------------------------TRFGPRAIREVSFNFE.......
HUTG_HAHCH/40-316---------------------------------------------------------AANGPDEIIKALANLP.......
Q8RA93_THETN/28-290---------------------------------------------------------TRFGPSSIRQASYGLE.......
Q8END5_OCEIH/29-310---------------------------------------------------------CELGPKAIRLNSERYSG....YL
Q5ANN8_CANAL/115-414---------------------------------------------------------ARFGPESIRSNSRRLG.......
Q2LPR8_SYNAS/65-343---------------------------------------------------------CELAPRAIRHSAARYGG....FL
A1ST87_PSYIN/33-299---------------------------------------------------------ARMGPTAIRQASINLA.......
ARGI1_ARATH/63-338---------------------------------------------------------PAFAPPRIREAIWCGST....NS
A0R0G1_MYCS2/40-312---------------------------------------------------------ARFGPNAIRQASRLVR.......
A1CFK4_ASPCL/83-374---------------------------------------------------------ARFGPGGIRLGSRRL........
B8I5M8_CLOCE/21-282---------------------------------------------------------TRFAPSAMRIDSIGLE.......
A1TIE4_ACIAC/8-305---------------------------------------------------------AAMGPDALRVA.....Q.....L
A1T9H7_MYCVP/46-324---------------------------------------------------------ARFGPRAIRATAYEP........
Q97VA3_SULSO/30-299---------------------------------------------------------ARFGPMGIRQGSRLLR.......
Q4J720_SULAC/30-299---------------------------------------------------------ARFGPMAVRQGSRLLR.......
Q3J2B4_RHOS4/46-312---------------------------------------------------------TRFGPRAIREASTLQP.......
A1CGK0_ASPCL/61-357---------------------------------------------------------ARFGPRGIRAGSSREK.......
Q10Y47_TRIEI/24-296---------------------------------------------------------CVNGPAVLLNASQQLE.......
A5G278_ACICJ/28-297---------------------------------------------------------TRSGPAAIRVASRMLA.......
ARGI_SOYBN/71-346---------------------------------------------------------PAFAPPFIREGIWCGSA....NS
O76895_DROME/30-333---------------------------------------------------------VELAPDLLRQS.....S.....L
A1W2M6_ACISJ/2-298---------------------------------------------------------ASMGPDALRIA.....G.....I
A8GC83_SERP5/32-305---------------------------------------------------------TRYGPRQIRQESVMIR.......
Q1GHG8_RUEST/4-296---------------------------------------------------------CLMGPDAYRTA.....G.....L
Q65P52_BACLD/4-300---------------------------------------------------------VDMGPSAIRCA.....G.....V
Q67TJ0_SYMTH/28-290---------------------------------------------------------TRFGPGRIREASYGIE.......
A4XZN2_PSEMY/43-309---------------------------------------------------------SRFGPRAIRAASIQSA.......
A4YE21_METS5/29-295---------------------------------------------------------ARFGPMGIRDGSRLLR.......
Q6ANF4_DESPS/59-334---------------------------------------------------------CRFGPAGIRAASTILK.......
Q222F3_ALBFT/24-298---------------------------------------------------------ARFGPQEIRRASLMLC.......
ARGI2_MOUSE/24-324---------------------------------------------------------VEYGPAAIREA.....G.....L
Q315M1_DESAG/23-287---------------------------------------------------------TFRGPAAILAASRQLE.......
A7IL28_XANP2/50-316---------------------------------------------------------TRFGPRAIRAASTILD.......
Q18A84_PEPD6/21-285---------------------------------------------------------ARFASSSMRKEFYGLE.......
Q5V6R7_HALMA/44-335---------------------------------------------------------TRYGPRAVRAASTVPS.......
Q5LRK8_RUEPO/33-325---------------------------------------------------------CLMGPDSYRTA.....G.....L
Q9K8M2_BACHD/4-296---------------------------------------------------------VDMGPSALRYA.....G.....L
Q3ABP1_CARHZ/20-281---------------------------------------------------------ARMAPQHIRQVSFGLE.......
A9CJC2_AGRT5/42-307---------------------------------------------------------ARFGPQAIRRASAIFD.......
Q7U3K9_SYNPX/21-280---------------------------------------------------------TRFGPAAIREVSQGLE.......
A1STQ5_PSYIN/47-343---------------------------------------------------------AFHGPDLIRQALANSA.......
Q7VY32_BORPE/13-287---------------------------------------------------------ARQGPDAIREQSRLLRPY..DLA
Q9CL61_PASMU/34-299---------------------------------------------------------TRFGAEAIRRASVNLA.......
A4IB49_LEIIN/14-315---------------------------------------------------------VELGPDYLLKQGLQQD.......
A5UXL8_ROSS1/34-305---------------------------------------------------------ARFGPEAIRSASVLLR.......
A9WCM8_CHLAA/41-307---------------------------------------------------------AAQGPTAIRRCLYRLG.......
B2FJ13_STRMK/7-298---------------------------------------------------------ARLGPEALRVA....G......L
B4EIP8_BURCJ/49-320---------------------------------------------------------ARFGPRQIRTESVLLR.......
B4ELX2_BURCJ/44-308---------------------------------------------------------ARLGPAAIRAASVQLAE....LN
B5GLC8_STRC2/31-301---------------------------------------------------------ARFGPQAIRSESGLIH.......
B9A9C6_BOMMO/12-304---------------------------------------------------------VSIAPAAVRAA....G......L
C0ZIM2_BREBN/4-293---------------------------------------------------------VDMGPSAIRYAGVVAR.......
D0J7J2_COMT2/7-302---------------------------------------------------------AAMGPDALRVA..QLG.......
D5AV62_RHOCB/6-296---------------------------------------------------------CVMGPASLRTAGLIAS.......
D5SKW9_STRC2/134-404---------------------------------------------------------ARFAPRAIRHESSLIH.......
E3GWR7_METFV/23-279---------------------------------------------------------SRFGPLMIRQASYNFE.......
E9CYX8_COCPS/18-317---------------------------------------------------------V..DPSGLIEAGL.LDQ.....L
F1QJZ3_DANRE/86-357---------------------------------------------------------ARFGPRHIRAESAMIR.......
F6SZP1_XENTR/61-332---------------------------------------------------------ARFGPRHIRGESCMVR.......
I9NPV5_COCIM/78-370---------------------------------------------------------ARYGPGGIRRGSARMR.......
K5X448_AGABU/13-305---------------------------------------------------------VDQGPIRLVEAGLVEQ.......
SPEB_NEIMB/35-299---------------------------------------------------------ARFGPEAIRRASVNLA.......
Q05AR1_XENTR/27-324---------------------------------------------------------VEHGPAAIRSA....G......L
Q24ZK6_DESHY/5-295---------------------------------------------------------VDMGPSAIRYAGLHE........
Q251M0_DESHY/26-286---------------------------------------------------------TRLGPLSIRNVSIGIE.......
Q2FW91_STAA8/6-296---------------------------------------------------------VDLGPTAIRYAGLIS........
Q2K3I8_RHIEC/7-299---------------------------------------------------------AAMGPAALRIAGVDQT.......
Q2K9W6_RHIEC/65-328---------------------------------------------------------TRFGPQAIRRASAIFD.......
Q3IKA3_PSEHT/33-297---------------------------------------------------------ARLGPDAIRRASVHLA.......
Q46IA1_PROMT/31-292---------------------------------------------------------ARFGPSAIREDSYGIE.......
Q4FL05_PELUB/40-312---------------------------------------------------------ARFGPMSIRQASRHLR......T
Q5KIC1_CRYNJ/70-373---------------------------------------------------------ARFGPYALRSGSRRQR.......
Q5L3P6_GEOKA/3-294---------------------------------------------------------VDMGPSAMRYAGIIER.......
HUTG_LEGPH/47-315---------------------------------------------------------AKLGPDQIKTQLAKLP.......
Q6LHE2_PHOPR/35-321---------------------------------------------------------DSDGPESICRALKKEY.......
Q6LWW9_METMP/19-277---------------------------------------------------------ARFGPDEVRNASWGLET.....F
Q6N0N3_RHOPA/14-309---------------------------------------------------------TLMGPAALRTA..GIGR.....V
Q6PH54_DANRE/25-322---------------------------------------------------------VEHGPKAIRDAGLVE........
Q72EZ7_DESVH/23-282---------------------------------------------------------TGAGPDAILDASDQLE.......
Q7T151_DANRE/27-322---------------------------------------------------------VQEGADLIRAAGLVQK.......
Q7V3X2_PROMM/30-287---------------------------------------------------------SRFGPTAIRDVSNGLE.......
SPEB_BACAN/23-284---------------------------------------------------------SRFGPARIREVSIGLE.......
Q81VP0_BACAN/4-292---------------------------------------------------------VDMGPSAIRYAGVIER.......
Q81Y48_BACAN/37-311---------------------------------------------------------ASFAPKTIRSMLDAYS.......
Q82VE5_NITEU/46-310---------------------------------------------------------ARFGPLGIRQASAEVAS....LK
HUTG_VIBPA/47-325---------------------------------------------------------AKKAPDLIRRALANLA.......
Q88KU3_PSEPK/34-298---------------------------------------------------------ARFGPRAIRAASVQQA.......
Q8RG18_FUSNN/503-779---------------------------------------------------------TEFGPDDLIQAYP..D.......
Q8TJ04_METAC/18-281---------------------------------------------------------SRWAPDAMRQVSANFE.......
Q8XMY7_CLOPE/21-278---------------------------------------------------------TRFASQVMRGESWGLE.......
Q92LN4_RHIME/3-295---------------------------------------------------------AAMGPTALRIA..GIDT.....V
Q92MV8_RHIME/71-339---------------------------------------------------------SRFGPRALRAI.ERIG.......
Q92QR6_RHIME/44-306---------------------------------------------------------ARFGPQAIRRASAIFD.......
GPUA_PSEAE/36-307---------------------------------------------------------ARHGPREVRNLSSLMRKV..HHV
Q9KLD2_VIBCH/33-297---------------------------------------------------------ARMGPDAIRRASVNLA.......
HUTG_VIBCH/44-322---------------------------------------------------------AKHAPSLIKQALANLA.......
U5L6E1_9BACI/3-293---------------------------------------------------------VDMGPSAIRYAGVNER.......
U5LEA0_9BACI/39-314---------------------------------------------------------ASLYPDEFRKMWKGYA.......
W6RQZ8_9RHIZ/120-388---------------------------------------------------------ARLGPRAVRAI.ERVG.......

PF00850

A0DIS2_PARTE/29-344..........................................................LSQFEQCD.INHL.R....LVH
A0LGT0_SYNFM/15-314...........................................................IKASPAK.LKWI.E....AVH
A1W7T1_ACISJ/25-356............................................................HPPDVDCTEVL.A....KIH
A2BL29_HYPBU/15-315..........................................................QPAPRRGLERDRI.L....EVH
A3DNS7_STAMF/16-313...........................................................FVKHSYE.EKEV.LQVLNRVH
A3GH68_PICST/21-341..........................................................IIGEYRAS.RQEL.A....SYH
A4S2N1_OSTLU/197-606.......................................................LDKTCTFGAAE.PSDI.L....RAH
A4S898_OSTLU/22-313..............................................................RAPS.VDEL.C....RAH
A4X4X7_SALTO/10-318..........................................................LVEPKPVD.DELL.T....RVH
A4YNH4_BRASO/45-371...........................................................VAPIQFG.QEAR.A....RVH
A6QAF4_SULNB/14-302...........................................................VSPISVS.EKVL.E....LVH
A6R4B6_AJECN/49-360..........................................................LYKTREAT.YEEM.A....EFH
A6VSZ5_MARMS/14-305...........................................................LESDPAT.REQL.L....LAH
A7SSG8_NEMVE/23-333..........................................................KIPSRHAT.EEDL.L....CLH
A7SUP8_NEMVE/23-330..........................................................VIAPRKAT.ASEL.A....AFH
A7TRW5_VANPO/9-404..........................................................IIDDPCCN.KKDL.L....QFH
A8ABS4_IGNH4/14-309..........................................................VRSPVPID.EREL.E....LVH
A8ZT95_DESOH/16-310...........................................................MTPEPAT.LDQL.E....LVH
A9A062_DESOH/259-573...........................................................LPVRHFA.DDHI.T....AVH
A9B5I1_HERA2/14-309...........................................................LAPRHAT.AAEI.E....AVH
B0T7F0_CAUSK/32-328...........................................................IPARLAT.GLEI.G....RVH
B2JV93_BURP8/15-309...........................................................RDAPMGT.VEQV.Q....LIH
B4U8T2_HYDS0/14-304...........................................................EKPRKAT.VEEV.S....KIH
C5KDG6_PERM5/340-870..............................................................SPVTIPDVLVT....NIH
E0TF48_PARBH/5-292..............................................................PAAR.EGEI.K....VAH
E2RU63_GIAIC/11-320..........................................................YYTPRDAT.FQDM.A....LYH
F2G2X2_ALTMD/14-319...........................................................ADATPIA.EAYL.T....LAH
O67135_AQUAE/10-314...........................................................IKSRPAT.KEEL.L....LFH
HDA1_YEAST/69-395.....................................................GDLMLKIPVRAAT.SEEI.L....EVH
Q00U49_OSTTA/445-741..............................................................PLVD.IEDL.E....AAH
Q02CA3_SOLUE/14-311...........................................................VEARDAT.QEEL.T....LCH
Q0A6Z7_ALKEH/46-336...........................................................RTGRAAT.PAEL.G....RVH
Q0ARF0_MARMM/14-308..............................................................PTAA.MTDV.A....RFH
Q15WQ0_PSEA6/14-301..............................................................HALT.PSQL.N....RVY
Q1CZX8_MYXXD/21-314...........................................................TAPRSAT.EAEL.A....SVH
HDA6_CAEEL/438-748..........................................................RNCERIAT.NEEI.R....LVH
Q29CG7_DROPS/25-326..............................................................EELT.KHQL.R....RIH
Q2FQW8_METHJ/14-311..........................................................LLTPKPAM.RDDV.L....LVH
Q2IF50_ANADE/16-319..........................................................RVEAARAT.EQAL.L....RVH
Q2KBQ8_RHIEC/14-309...........................................................RQAPQAS.EDAV.L....LAH
Q2LVD3_SYNAS/15-311...........................................................VPAREAR.MDEL.H....LIH
Q2R9B1_ORYSJ/26-342..........................................................RLRTRPAT.EAEI.R....RFH
Q2S035_SALRD/7-313............................................................APSVAT.REEV.R....RVH
Q2SC27_HAHCH/8-315..............................................................DPAT.TESL.A....LAH
Q30PJ4_SULDN/258-572...........................................................IQPKHVS.DKLL.K....QVH
Q31EP6_THICR/49-347...........................................................VATRLAT.NEEL.L....LAH
Q31HC2_THICR/13-304...........................................................KSILPAT.EIDV.L....RVH
Q38C74_TRYB2/21-323..........................................................TVVPPPIG.IKEL.L....TYH
Q39UV4_GEOMG/11-315..........................................................IHDCPRAD.EASL.L....TFH
Q3AFN8_CARHZ/10-319...........................................................IPPRSAT.LKEL.Y....LVH
Q4D762_TRYCC/47-388................................................................VG.VEDM.T....AFH
Q4FNF7_PELUB/14-306...........................................................KKPSKFN.RSLL.E....ITH
Q4KAJ1_PSEF5/12-340............................................................GPRRFD.RACY.V....AAH
Q4MYQ3_THEPA/25-416......................................................GHLYHVQPREVP.RQIL.L....LCH
Q4P2D6_USTMA/326-751..............................................................SSDG.EGDD......AMH
Q4QAJ4_LEIMA/91-404..........................................................VCHARPAT.AEEM.G....AFH
Q4QI60_LEIMA/58-432..............................................................LPVELLAPF......TVH
HDA21_DICDI/1072-1486..........................................................KNDPEEIN.DKWI.L....TVH
Q59Q78_CANAL/56-379..........................................................TIDIYPAQ.TKDL.T....TYH
Q5AF34_CANAL/175-593..............................................................GSVF.SSHV.R....KIH
Q5K8L3_CRYNJ/64-492DNPEDEDGKSEDDDDNEADRNEVNNGDKQGADGEPQRRKPGSPTASPPHAQNKKATVVFPQPSLGT.KACL.L....KYH
Q5KKR8_CRYNJ/28-368KVNARMGMEND.............................EARWVNAEMRGSRAKRMQIFRPRRAT.KTDM.T....RFH
Q60DG7_ORYSJ/34-350..........................................................WHSGRPAH.AAEL.L....SFH
Q6AJC0_DESPS/18-318...........................................................VASRLAR.RASL.L....LAH
Q6AKN4_DESPS/15-311...........................................................ITPHEAN.TETI.E....KVH
Q6C3Y5_YARLI/54-352..............................................................TPAT.AAEL.Q....RYH
Q6CGA7_YARLI/254-648..............................................................ANLS.SEHV.T....AVH
Q6FWB7_CANGA/8-383..........................................................IIDVPSCQ.RKDL.E....KFH
Q741C0_MYCPA/14-307...........................................................ETAEPAE.LAAT.R....YVH
Q7PS30_ANOGA/118-424..........................................................FVAPRPAT.RAEL.L....TKH
Q8EP92_OCEIH/11-321...........................................................ISPRLAT.EEEL.L....LFH
Q8I4I9_CAEEL/17-318...........................................................IDAREAN.DSEI.R....LNH
Q8IR37_DROME/555-861..........................................................QLSPRAAT.TDEV.C....LAH
HDA14_ARATH/75-387........................................................LELANFKTAT.VEDI.A....NVH
Q9K0J2_NEIMB/35-328...........................................................IEAEEIS.DTRL.A....LVH
Q9U266_CAEEL/18-319..........................................................HIPRREAE.ESEI.L....AVH
F5GX36_HUMAN/250-576...........................................................IRGRKAT.LEEL.Q....TVH
F6Q3W9_MOUSE/101-401...........................................................FQARFAE.KEEL.M....LVH
G4VAN3_SCHMA/13-356.........................................................PLQWDSPSRMYEAV.T....AFH
K3ZRV5_SETIT/229-519..........................................................LVPPREIT.KEEL.L....MVH
Q22CW6_TETTS/24-319..........................................................INQVEPIQ.KDIL.N....KVH
Q2G292_STAA8/18-322...........................................................VQPRIAT.DDEL.M....LIH
Q8F7M9_LEPIN/19-309...........................................................PEMKKLP.NEFL.N....EIH
V6EZA3_9PROT/18-307............................................................EAPQAS.REHL.L....RAH
W7X9B2_TETTS/36-342.........................................................IVDKLKPAE.KSIV.K....YAH

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------------------------------------------
C2XKX5_BACCE/12-239--------------------------------------------------------------------------------
B9BUU1_9BURK/13-199--------------------------------------------------------------------------------
B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C2SK71_BACCE/15-171--------------------------------------------------------------------------------
C3Q562_9BACE/31-198--------------------------------------------------------------------------------
D7W5E5_9FLAO/27-172--------------------------------------------------------------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UPR5_METVS/56-208--------------------------------------------------------------------------------
A9AA45_METM6/55-201--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------
A0A031WF12_PEPDI/78-183--------------------------------------------------------------------------------
B6G251_9FIRM/77-182--------------------------------------------------------------------------------
B0A6K5_9FIRM/76-181--------------------------------------------------------------------------------
C0CJH7_9FIRM/6-165--------------------------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387TKYGAVNV------------------------------------------------------PLEIN.........PFKS
Q6BJQ5_DEBHA/76-370SLRG.YNQ------------------------------------------------------RADFN.........PYTS
Q6BVQ4_DEBHA/136-428SGSI.SPF------------------------------------------------------RKNFS..........LFK
Q6BWL4_DEBHA/179-480RGNPNTNM------------------------------------------------------TEINPY.......DPRSH
A1RXI5_THEPD/26-288T....FLP------------------------------------------------------DLQI...........DVE
SPEB_MOUSE/77-350A....VNP------------------------------------------------------STGAL..........PFQ
A4XKN0_CALS8/20-281E....YSV------------------------------------------------------YQDK...........NLF
A4J1T2_DESRM/21-282E....YSV------------------------------------------------------MLDR...........DLA
A1VQK9_POLNA/34-307P....YNM------------------------------------------------------ATGAA..........PFD
Q2K8A9_RHIEC/46-316P....YDH------------------------------------------------------VLRTA..........PTA
B2JW15_BURP8/32-305G....IHH------------------------------------------------------VTRFN..........PFD
Q982X2_RHILO/42-307NDPQ.YP.------------------------------------------------------F.SRD..........LFE
HUTG_BACHD/35-311T....YSV------------------------------------------------------EEDL...........DLA
HUTG_RHOSR/40-314........------------------------------------------------------LAE...............
ARGI1_HUMAN/6-305LEKLK.EQ------------------------------------------------------..E...............
SPEB_CHRVO/44-311ELKP.YP.------------------------------------------------------W.GFD..........PFE
ARGI_BACSU/3-292IERLS.DM------------------------------------------------------..G...............
Q97ZX8_SULSO/24-289F....YSI------------------------------------------------------RNDV...........DMG
HUTG_VIBVY/45-328........------------------------------------------------------WHS...............
A9BRG6_DELAS/16-312GPALR.QL------------------------------------------------------..G...............
HUTG_AROAE/40-323........------------------------------------------------------WHG...............
A1RB53_ARTAT/29-311GCLMNAET------------------------------------------------------RRT..............D
Q1J2W9_DEIGD/37-306RYVPPFTD------------------------------------------------------LSGRT..........RLA
Q2JER0_FRASC/40-318...GTYHL------------------------------------------------------DLGIE..........IFD
Q3J346_RHOS4/3-296GRALA.DL------------------------------------------------------..G...............
A9B324_HERA2/22-290F....YDR------------------------------------------------------EFDTE..........PAK
Q9YBG0_AERPE/29-298S....NGY------------------------------------------------------YVEG...........DID
Q1GI44_RUEST/34-307P....YNM------------------------------------------------------ATGAA..........PFD
Q9HJB2_THEAC/33-293S....FEF------------------------------------------------------SYRF...........DLL
A0RXD6_CENSY/22-283V....FHP------------------------------------------------------GLRA...........DLE
A8LLU9_DINSH/46-312FDPP.YG.------------------------------------------------------W.GFD..........PLS
SPEB_BACHD/22-286E....YSP------------------------------------------------------YMDK...........HLE
Q0W940_UNCMA/16-280T....YNP------------------------------------------------------DFGV...........DLT
Q6MHV0_BDEBA/36-309G....FHM------------------------------------------------------TRMEN..........FFE
Q98MW3_RHILO/19-296SLVEHWDF------------------------------------------------------DLGGPL........FNGK
A0LG67_SYNFM/34-297P....YDE------------------------------------------------------ETCT...........EAY
HUTG_BACSU/35-311A....YSA------------------------------------------------------ELGE...........HVV
Q9K5Y7_BACHD/5-297IEEIE.AL------------------------------------------------------..G...............
Q164F4_ROSDO/46-312YDPP.YG.------------------------------------------------------W.PFD..........VLS
Q164F5_ROSDO/34-308P....YNM------------------------------------------------------GTGAA..........PFD
Q15X44_PSEA6/42-323........------------------------------------------------------YQH...............
Q11J67_CHESB/42-307NDPQ.YP.------------------------------------------------------F.HLD..........LFD
Q1AWJ4_RUBXD/5-295QPALE.EL------------------------------------------------------..G...............
Q5WL42_BACSK/7-290E....NNQ------------------------------------------------------VYNVEKRK....TFTLPK
Q7UZH9_PROMP/24-288T....FCP------------------------------------------------------RLGK...........DLE
Q6CLB8_KLULA/137-438N.GISPV.------------------------------------------------------.RGFPGSKL.RKLDPYHS
A0JT79_ARTS2/57-331P....YNP------------------------------------------------------AWDVS..........PFE
Q2KVZ3_BORA1/13-287RRAGVENP------------------------------------------------------AQF...............
B2UBQ2_RALPJ/40-316........------------------------------------------------------ARA...............
Q165U0_ROSDO/35-314GHAGAYDH------------------------------------------------------EDDAT.........YLPA
B1YHV3_EXIS2/22-286E....YSP------------------------------------------------------YLDG...........DIA
Q5WIT9_BACSK/27-306PELDHIDV------------------------------------------------------FEH...............
A1C610_ASPCL/68-380A.GTSYNT------------------------------------------------------RAGIN.........PYSS
Q1AS11_RUBXD/33-307R....HNP------------------------------------------------------SLGVT..........LFD
Q28QX8_JANSC/39-314E....MNR------------------------------------------------------STGQL..........PFQ
A1WGI6_VEREI/22-320QAALQ.GH------------------------------------------------------..G...............
A1WER7_VEREI/22-295P....YQM------------------------------------------------------ATRAA..........PFD
A1T3A2_MYCVP/88-364NYESGVDL------------------------------------------------------REQ...............
A8LRL4_DINSH/4-296IDTLG.DL------------------------------------------------------..G...............
A5V551_SPHWW/4-298AEALA.EL------------------------------------------------------..G...............
Q11NZ4_CYTH3/3-310ERAQP...------------------------------------------------------..V...............
Q5V4R8_HALMA/3-300ADQLS.DI------------------------------------------------------..G...............
SPEB_SERP5/33-298WEGNRWP.------------------------------------------------------W.NFD..........LRD
Q12BY7_POLSJ/72-342P....YEH------------------------------------------------------ALGLA..........PVT
HUTG_VIBF1/45-345........------------------------------------------------------WHH...............
Q3IVT5_RHOS4/32-308P....INP------------------------------------------------------YRGHI.........NIFE
HUTG_GEOKA/44-315........------------------------------------------------------WHL.............PE
SPEB_BLOFL/33-298WENCRWP.------------------------------------------------------W.NFD..........IRQ
A0ZFA2_NODSP/30-338L....FDF------------------------------------------------------DHPD............GW
A4XT95_PSEMY/38-311P....YNM------------------------------------------------------ATGAA..........PFD
Q5WB32_BACSK/22-286E....YSP------------------------------------------------------YADK...........HLE
Q6C6P6_YARLI/9-306EKHLQ.SL------------------------------------------------------..D...............
Q12UU8_METBU/17-282S....YNS------------------------------------------------------FYDI...........DIS
Q213G1_RHOPB/11-309LPLLT.AL------------------------------------------------------..G...............
Q28PV5_JANSC/46-313FDPP.YG.------------------------------------------------------WDGYS..........PLE
A0QRD0_MYCS2/43-317P....YHP------------------------------------------------------ALDVS..........PFA
ARGI_NEUCR/47-354LTQLREEL------------------------------------------------------..G...............
Q12LW8_SHEDO/33-299WEDTRWP.------------------------------------------------------W.DFS..........LNQ
Q2W8C1_MAGSA/22-290D....GAN------------------------------------------------------PAGWS..........DPA
Q6CIB4_KLULA/61-358S.MRGFNF------------------------------------------------------RADIN.........PYQD
A1SLP1_NOCSJ/31-312DG.SRPHL------------------------------------------------------ALRVD..........ALR
Q28VR8_JANSC/34-309GHAGAYDH------------------------------------------------------EDDVT.........YLGP
Q0UYW2_PHANO/16-320IQQLEHDL------------------------------------------------------..E...............
Y309_METJA/21-281T....YSP------------------------------------------------------ILDR...........DLA
Q9RZ04_DEIRA/29-298RSVPPFTG------------------------------------------------------LDGKT..........RLQ
Q6CLS8_KLULA/13-315RSDIE.SL------------------------------------------------------..G...............
A2BIW8_HYPBU/25-300F....YSL------------------------------------------------------RANL...........DVE
Q21RM0_ALBFT/15-309AQALT.QL------------------------------------------------------..G...............
Q6L151_PICTO/19-280S....FEI------------------------------------------------------NYKY...........NIP
Q4P4M4_USTMA/13-318CQQLE.SL------------------------------------------------------..G...............
A1B165_PARDP/30-308RLLDRYDF------------------------------------------------------DIGGTL........YDGR
Q16AD8_ROSDO/4-296APAIR.DL------------------------------------------------------..G...............
Q3SMM1_THIDA/8-294FHDTP.LQ------------------------------------------------------..R...............
Q5AK86_CANAL/12-313QKQIE.SL------------------------------------------------------..G...............
Q7VSA1_BORPE/8-302VRLLE.RR------------------------------------------------------..G...............
A0BHR2_PARTE/9-311ISALY.NL------------------------------------------------------..G...............
Q4JAE9_SULAC/24-287F....YSM------------------------------------------------------RTGI...........DMG
Q975R8_SULTO/24-287F....YSI------------------------------------------------------RTGI...........DMG
Q1LGD2_RALME/2-296AGALV.RN------------------------------------------------------..G...............
ARGI_AGRT5/19-313TQVLT.EL------------------------------------------------------..G...............
Q1D421_MYXXD/27-337L....FDV------------------------------------------------------ETGR............PY
SPEB1_SCHPO/74-375L.YGGYNV------------------------------------------------------PMETN.........PFNN
ARGI_YEAST/13-329QTSIE.DL------------------------------------------------------..G...............
A9BN56_DELAS/71-341P....YNH------------------------------------------------------VLRSA..........PTR
Q5A4M3_CANAL/50-340N.LRGFNP------------------------------------------------------KALFD.........PYQS
A1RBR9_ARTAT/55-335P...GYHP------------------------------------------------------ELDVE..........PVY
A1VTU0_POLNA/3-297QPTLE.GH------------------------------------------------------..G...............
Q0UMJ9_PHANO/68-378S.FRGFNP------------------------------------------------------RANLN.........PYTS
A1SM48_NOCSJ/41-314P....YNP------------------------------------------------------ALDVS..........PFA
Q1GI45_RUEST/67-333PDAP.YG.------------------------------------------------------W.DIC..........PAS
Q1IHQ4_KORVE/16-311EAKLE.AL------------------------------------------------------..G...............
Q6L2W0_PICTO/21-293SYCT....------------------------------------------------------..DHN.........VDLN
Q89H72_BRADU/11-308ATLLE.SL------------------------------------------------------..D...............
Q489X2_COLP3/36-310P....YGM------------------------------------------------------YTKAA..........PFD
Q7V9I4_PROMA/29-293S....FCP------------------------------------------------------QLNL...........DLE
SPEB1_SYNY3/26-297A....YDE------------------------------------------------------ELGTS..........PCH
Q6FP31_CANGA/10-317QKDLE.EL------------------------------------------------------..G...............
A5G414_GEOUR/41-319PEY.ELDL------------------------------------------------------FDY...............
Q3SVS2_NITWN/5-302TPVLE.SL------------------------------------------------------..G...............
SPEB2_SCHPO/89-401A.IRGFNP------------------------------------------------------SLNVN.........PYES
Q8XPR0_RALSO/29-309RAPGHYDF------------------------------------------------------DIDGPL.......LQGRD
Q47TW8_THEFY/41-314P....YNP------------------------------------------------------GLDVS..........PFA
A9KQ98_CLOPH/18-281T....FSP------------------------------------------------------YQEK...........DLT
A1BCD2_PARDP/35-312R....VHH------------------------------------------------------VTGIA..........PYE
ARGI_ASHGO/93-395REGVE.GL------------------------------------------------------..G...............
A1B3P5_PARDP/3-295ASTLI.DL------------------------------------------------------..G...............
Q1QTM4_CHRSD/39-312P....YNM------------------------------------------------------ATRAA..........PFD
Q6C732_YARLI/86-381P.GQVSPY------------------------------------------------------REGFM.........LYDD
A0LDK6_MAGSM/20-293V....WDE------------------------------------------------------LHGRE..........ILP
Q47D78_DECAR/17-302WHELE.HH------------------------------------------------------..P...............
Q3JAG2_NITOC/2-290VAHLR.QQ------------------------------------------------------..G...............
A3DDA1_CLOTH/24-286E....YSV------------------------------------------------------YMDR...........DLT
A1CKP4_ASPCL/16-320LNQVRDDL------------------------------------------------------..G...............
ARGI1_SCHPO/22-319PEDLE.RL------------------------------------------------------..G...............
HUTG_PHOLL/44-316........------------------------------------------------------SHK..............G
Q3IQJ3_NATPD/45-332.....YLS------------------------------------------------------GYKGGLTNVRTEQQVSFS
SPEB2_SYNY3/83-361NFEMGVDL------------------------------------------------------REQ...............
Q5LKZ4_RUEPO/42-315A....GNP------------------------------------------------------ATGVN..........PFA
Q2RHH4_MOOTA/26-287E....YSP------------------------------------------------------YLQR...........ELT
Q17HI3_AEDAE/32-333IDSIQ.EI------------------------------------------------------STK...............
A3CU48_METMJ/19-276S....YDP------------------------------------------------------ATKI...........DFS
HUTG_HAHCH/40-316........------------------------------------------------------WRL...............
Q8RA93_THETN/28-290T....YSV------------------------------------------------------YLDR...........RLE
Q8END5_OCEIH/29-310PELNDIDV------------------------------------------------------LQH...............
Q5ANN8_CANAL/115-414S.AWKSTK------------------------------------------------------KRFNYPVN...PYDETTH
Q2LPR8_SYNAS/65-343PEY.ELDF------------------------------------------------------FDY...............
A1ST87_PSYIN/33-299WEGKRFP.------------------------------------------------------W.KFN..........LLK
ARGI1_ARATH/63-338ATEEGKEL------------------------------------------------------KDP...............
A0R0G1_MYCS2/40-312G....YNP------------------------------------------------------ELDIA..........PFQ
A1CFK4_ASPCL/83-374...GGWSI------------------------------------------------------YTGEN.........VLEG
B8I5M8_CLOCE/21-282T....YSP------------------------------------------------------YFDA...........DIS
A1TIE4_ACIAC/8-305GPALE.RL------------------------------------------------------..G...............
A1T9H7_MYCVP/46-324...GTYHM------------------------------------------------------DLGLE..........IFD
Q97VA3_SULSO/30-299P....YNQ------------------------------------------------------FLDTY..........PFD
Q4J720_SULAC/30-299P....YNQ------------------------------------------------------FLDTY..........PFD
Q3J2B4_RHOS4/46-312YDRP.FG.------------------------------------------------------W.GFD..........PLE
A1CGK0_ASPCL/61-357K.GRSYNT------------------------------------------------------VWGVD.........PFEE
Q10Y47_TRIEI/24-296C....YDE------------------------------------------------------ELDRE..........TGL
A5G278_ACICJ/28-297G....NHH------------------------------------------------------PHYRV..........MVD
ARGI_SOYBN/71-346TTEEGKDL------------------------------------------------------KDL...............
O76895_DROME/30-333RQVLQ.SS------------------------------------------------------HDG...............
A1W2M6_ACISJ/2-298ARAMQ.AR------------------------------------------------------..G...............
A8GC83_SERP5/32-305P....YNM------------------------------------------------------GTAAA..........PFE
Q1GHG8_RUEST/4-296AQALE.SL------------------------------------------------------..G...............
Q65P52_BACLD/4-300NERLE.CL------------------------------------------------------..C...............
Q67TJ0_SYMTH/28-290E....FSY------------------------------------------------------HSRM...........SLT
A4XZN2_PSEMY/43-309WARH.YP.------------------------------------------------------W.EFD..........PFD
A4YE21_METS5/29-295P....YNP------------------------------------------------------FQKVY..........PLD
Q6ANF4_DESPS/59-334S....YEE------------------------------------------------------VLDVD..........IFE
Q222F3_ALBFT/24-298D...GSHP------------------------------------------------------FFGVS..........PIG
ARGI2_MOUSE/24-324LKRLS.RL------------------------------------------------------..G...............
Q315M1_DESAG/23-287.....LWD------------------------------------------------------GLSD............PS
A7IL28_XANP2/50-316GDPF.YP.------------------------------------------------------F.GID..........PFE
Q18A84_PEPD6/21-285T....YSP------------------------------------------------------FLDL...........DLE
Q5V6R7_HALMA/44-335PPYEHFNI------------------------------------------------------ETGID..........PFD
Q5LRK8_RUEPO/33-325AEALA.DL------------------------------------------------------..G...............
Q9K8M2_BACHD/4-296IERLQ.SI------------------------------------------------------..G...............
Q3ABP1_CARHZ/20-281E....YDW------------------------------------------------------DLEK...........SLN
A9CJC2_AGRT5/42-307NDPQ.YP.------------------------------------------------------F.ARD..........LFA
Q7U3K9_SYNPX/21-280T....YCP------------------------------------------------------QLDL...........DLE
A1STQ5_PSYIN/47-343........------------------------------------------------------WHHQ...........TDS
Q7VY32_BORPE/13-287RRAGVDNP------------------------------------------------------VEF...............
Q9CL61_PASMU/34-299WEHCRFP.------------------------------------------------------W.DFD..........VRE
A4IB49_LEIIN/14-315MEKLGWNT------------------------------------------------------RLERVFD......GKAVE
A5UXL8_ROSS1/34-305P....YNP------------------------------------------------------ELDVH..........VFA
A9WCM8_CHLAA/41-307ITG....L------------------------------------------------------.................Q
B2FJ13_STRMK/7-298PEALE...------------------------------------------------------ARG...............
B4EIP8_BURCJ/49-320P....YNM------------------------------------------------------ATRAA..........PFD
B4ELX2_BURCJ/44-308PYPWGF..------------------------------------------------------..NP............FD
B5GLC8_STRC2/31-301G....VGI------------------------------------------------------DRGPG..........TFD
B9A9C6_BOMMO/12-304IDELK.EI------------------------------------------------------.................D
C0ZIM2_BREBN/4-293...LE...------------------------------------------------------KMG...............
D0J7J2_COMT2/7-302P.ALQ...------------------------------------------------------RLG...............
D5AV62_RHOCB/6-296L...T...------------------------------------------------------ALG...............
D5SKW9_STRC2/134-404G....VGI------------------------------------------------------DRGPG..........VFD
E3GWR7_METFV/23-279NYSLHYRK------------------------------------------------------KLD...............
E9CYX8_COCPS/18-317RDDLEYDI------------------------------------------------------RHD...............
F1QJZ3_DANRE/86-357A....YCG------------------------------------------------------WTRAA..........PYE
F6SZP1_XENTR/61-332R....YNI------------------------------------------------------STRAA..........PFE
I9NPV5_COCIM/78-370A.GSAWSV------------------------------------------------------YSGVN.........NLRS
K5X448_AGABU/13-305LKGLGWNV------------------------------------------------------VFD..............G
SPEB_NEIMB/35-299WEHRRFPW------------------------------------------------------TFDV............RE
Q05AR1_XENTR/27-324IDRLS.NL------------------------------------------------------..G...............
Q24ZK6_DESHY/5-295..RLK...------------------------------------------------------KLG...............
Q251M0_DESHY/26-286E....YSV------------------------------------------------------YLDK...........DLS
Q2FW91_STAA8/6-296..RLK.QL------------------------------------------------------..D...............
Q2K3I8_RHIEC/7-299LIDLGHDV------------------------------------------------------ADN..............G
Q2K9W6_RHIEC/65-328N.DAQYPF------------------------------------------------------NRDL............FA
Q3IKA3_PSEHT/33-297WEGTKYPW------------------------------------------------------TFPL............FE
Q46IA1_PROMT/31-292TYCPQL..------------------------------------------------------..DL...........DLE
Q4FL05_PELUB/40-312N....YHP------------------------------------------------------SYDVE..........PFK
Q5KIC1_CRYNJ/70-373P.DRGYNS------------------------------------------------------RLEVN.........PYSG
Q5L3P6_GEOKA/3-294...LE...------------------------------------------------------RLH...............
HUTG_LEGPH/47-315C....HNN------------------------------------------------------..................
Q6LHE2_PHOPR/35-321K.......------------------------------------------------------..G.............SP
Q6LWW9_METMP/19-277SPILKK..------------------------------------------------------..D.............LI
Q6N0N3_RHOPA/14-309LDQ.....------------------------------------------------------.LG...............
Q6PH54_DANRE/25-322..RL.SNL------------------------------------------------------..D...............
Q72EZ7_DESVH/23-282L.......------------------------------------------------------WDGLS..........IPA
Q7T151_DANRE/27-322L...K...------------------------------------------------------..G..............Q
Q7V3X2_PROMM/30-287TYCPQL..------------------------------------------------------..DL...........DLE
SPEB_BACAN/23-284E....YSP------------------------------------------------------YLDR...........ELE
Q81VP0_BACAN/4-292...IE.EI------------------------------------------------------..G...............
Q81Y48_BACAN/37-311TYAIT..E------------------------------------------------------EHD.............MK
Q82VE5_NITEU/46-310PYPWGF..------------------------------------------------------..DP............FE
HUTG_VIBPA/47-325W.......------------------------------------------------------.HK...............
Q88KU3_PSEPK/34-298W.ARHWPW------------------------------------------------------AFDP............FD
Q8RG18_FUSNN/503-779T.FDEMEL------------------------------------------------------..I.............SV
Q8TJ04_METAC/18-281SYNPTFDI------------------------------------------------------DLV...............
Q8XMY7_CLOPE/21-278S....YSP------------------------------------------------------YQDL...........DLY
Q92LN4_RHIME/3-295L......A------------------------------------------------------ELG...............
Q92MV8_RHIME/71-339P....YNH------------------------------------------------------VLGCA..........PVH
Q92QR6_RHIME/44-306N.DPQYPF------------------------------------------------------QRDL............FA
GPUA_PSEAE/36-307S.......------------------------------------------------------..RIA..........PYD
Q9KLD2_VIBCH/33-297WEGKKFPW------------------------------------------------------DFNL............FK
HUTG_VIBCH/44-322W.....H.------------------------------------------------------.HP...............
U5L6E1_9BACI/3-293L...K.SL------------------------------------------------------FE................
U5LEA0_9BACI/39-314A....YNL------------------------------------------------------DEDI...........DLT
W6RQZ8_9RHIZ/120-388P....YEH------------------------------------------------------VLRVA..........PMG

PF00850

A0DIS2_PARTE/29-344DEKYIDFV......................................................EGLFNAV..GNEQ.....
A0LGT0_SYNFM/15-314SPKHIMRF......................................................EEACLLE..MGE......
A1W7T1_ACISJ/25-356APRYLAFL......................................................ASAWQQW..VSLG.....
A2BL29_HYPBU/15-315DPAYVEKV......................................................EELAGRG..GGYI.....
A3DNS7_STAMF/16-313CRKYIEYI......................................................MKCRNNA..PCQI.....
A3GH68_PICST/21-341DENFVDFLLQDRL............................................RLDRTVTSL.AS..NHDTINDEI
A4S2N1_OSTLU/197-606DENYVRVL......................................................AELSDRV..GQTPIAFTP
A4S898_OSTLU/22-313DEDYVRDV......................................................RASALDA..KREREIGLP
A4X4X7_SALTO/10-318DPAYLEAV......................................................RNA...........PQDP
A4YNH4_BRASO/45-371SPEYLNFL......................................................EEAWDAW..AALS.....
A6QAF4_SULNB/14-302TPEHIETV......................................................REASQQN..RS.......
A6R4B6_AJECN/49-360SPEYLDFL......................................................QT...VI..PSDMENTAL
A6VSZ5_MARMS/14-305DEAYVDSI......................................................FARAPEE..GHVE.....
A7SSG8_NEMVE/23-333SKEHIDKM......................................................KSTQ.DM..KPRD.....
A7SUP8_NEMVE/23-330SSEYVNCM......................................................RRAAEAV..SDGSEECED
A7TRW5_VANPO/9-404SRDYIDLLLDPVYNRIIQYDDDESKWSQLHPYIRDWLDSHPEEVPTSGMIEKRAGLLEFYKKY...NRF..KKKRSISEA
A8ABS4_IGNH4/14-309DRDYVEYV......................................................KRVIEAG..GGYL.....
A8ZT95_DESOH/16-310TPGHVKKI......................................................LKTAEHK...........
A9A062_DESOH/259-573DKHFVRYL......................................................QAACASV..PENE.....
A9B5I1_HERA2/14-309VPSHLPTL......................................................QRMAQF...GDW......
B0T7F0_CAUSK/32-328TSDHINQI......................................................KIMSGFP..TGGE.....
B2JV93_BURP8/15-309RQDFIDEV......................................................AESAPSH..GYMP.....
B4U8T2_HYDS0/14-304DTYYIQEI......................................................YEFCKKG..GGY......
C5KDG6_PERM5/340-870SKRYLHDL......................................................VSIDNYL..QQQVELKDK
E0TF48_PARBH/5-292TESYIASL......................................................REGTIDP..RAMRRIGFP
E2RU63_GIAIC/11-320TPDYIRFL......................................................KNITPET..LSKFQDLA.
F2G2X2_ALTMD/14-319DPYYVKSV......................................................FEQAAQA..MFSDHEKTQ
O67135_AQUAE/10-314TEDYINTL......................................................MEAERCQ......CVPKG
HDA1_YEAST/69-395TKEHLEFI......................................................ESTE.KM..SREE.....
Q00U49_OSTTA/445-741CGEYVRKV......................................................LTRTLSE..QEVRTIGFP
Q02CA3_SOLUE/14-311TPDYLKTA......................................................RSDVAS.....G......
Q0A6Z7_ALKEH/46-336TLSYLETI......................................................YALRGKH..AW.......
Q0ARF0_MARMM/14-308SAAHVDRV......................................................LTACADA..PAGQWLALD
Q15WQ0_PSEA6/14-301SPDYVNDL......................................................TRGMLDP..KAMRRIGFP
Q1CZX8_MYXXD/21-314TPELLAYL......................................................QRINGHR..AQ.......
HDA6_CAEEL/438-748TKKMLEHL......................................................RTTETMK..DEEL.....
Q29CG7_DROPS/25-326TREYLRSL......................................................RWSLNVA..RIAEVSLMA
Q2FQW8_METHJ/14-311TKEYLHFL......................................................EEASVNG..AII......
Q2IF50_ANADE/16-319TPGHLARV......................................................RGHVEAA..ARTG.....
Q2KBQ8_RHIEC/14-309PEEHLKAV......................................................MREIPEEEDGINQ.....
Q2LVD3_SYNAS/15-311LPDYVNRV......................................................ASTARME..YSC......
Q2R9B1_ORYSJ/26-342SPEYVDLL......................................................RD...LT..PESYFNDAA
Q2S035_SALRD/7-313GEQFVEKV......................................................EAASDG.......TPP.P
Q2SC27_HAHCH/8-315SREYLASL......................................................SHSAAIS..RVVENSLLK
Q30PJ4_SULDN/258-572LGAYVDYL......................................................RRACEII..EPGK.....
Q31EP6_THICR/49-347TQSYIDEI......................................................EILSDSG..GGF......
Q31HC2_THICR/13-304SSPFWETL......................................................KKHLPEN..GFVK.....
Q38C74_TRYB2/21-323AEDYILNL...............................................................GLHSNRSWL
Q39UV4_GEOMG/11-315SPDYLQRL......................................................REFSDS.......D.EPR
Q3AFN8_CARHZ/10-319DPAYVEAV......................................................MNL.SK.......NPENV
Q4D762_TRYCC/47-388DRAYLNYL......................................................SIREALS..EVDERASTV
Q4FNF7_PELUB/14-306NSDYINFV......................................................EKSFPEK....G......
Q4KAJ1_PSEF5/12-340SERYVSFL......................................................ENAWSEW..TATG.....
Q4MYQ3_THEPA/25-416TEKYLDQV......................................................SFWTGQL..SKLN.....
Q4P2D6_USTMA/326-751....LSEV......................................................PEHLPQG..DLYLAGPSD
Q4QAJ4_LEIMA/91-404RSAYLECL......................................................RQAPVIC..GNPLDEMSL
Q4QI60_LEIMA/58-432..............................................................KDSSSGS..DLGRAVPLI
HDA21_DICDI/1072-1486SPEYLRLL......................................................EDLTEKL..DANEIRPLN
Q59Q78_CANAL/56-379DDEFVKHLMGPRT............................................FLDKNFNKIDKA..ETDLTN..I
Q5AF34_CANAL/175-593GRNWPKKL......................................................FELCLES..HEKLNNDEL
Q5K8L3_CRYNJ/64-492DRSYIERLLMAHT............................................DRDPNDPTHLPS..SPSSSASSP
Q5KKR8_CRYNJ/28-368TDEYIELL......................................................ES...VL..PENA..DAL
Q60DG7_ORYSJ/34-350SAEYIEEL......................................................VQANAVG..AKK......
Q6AJC0_DESPS/18-318EEDWLFRF......................................................EEAVLFG..KSH......
Q6AKN4_DESPS/15-311SNFYLSQI......................................................REHALKS..NPFS.....
Q6C3Y5_YARLI/54-352SLEYVSAV......................................................LKKGQSE..KTL......
Q6CGA7_YARLI/254-648GVEYINLL......................................................EKLCLES..KDKLEAGQL
Q6FWB7_CANGA/8-383SKDYLNVILDEQLNWNPQIDGNEDQLMELRKAW...NDITTSNEASKPDFKTYSELLHYYRDHIEVSEH..NKKRTALEA
Q741C0_MYCPA/14-307SNRYVDAP......................................................EAARPQH..GYVY.....
Q7PS30_ANOGA/118-424TAEQIELL......................................................AQTHGSQ..DEPE.....
Q8EP92_OCEIH/11-321HPNYMETV......................................................KRAGSG.......EITEE
Q8I4I9_CAEEL/17-318PQQLIDEI......................................................VSLNSTE..KCEE.....
Q8IR37_DROME/555-861TRAHVNTV......................................................RRLL.GR..EPKE.....
HDA14_ARATH/75-387DKAYVFGL......................................................EKAMDEA..SDSG.....
Q9K0J2_NEIMB/35-328SSKYLNRL......................................................ESCLPQK..GK.......
Q9U266_CAEEL/18-319TKRYVDDV......................................................KSTETMT..VEQQ.....
F5GX36_HUMAN/250-576SEAHTLLY......................................................GTNPLNR..QKLDSKKLL
F6Q3W9_MOUSE/101-401SLEYIDLM......................................................ETTQ.YM..NEGE...LR
G4VAN3_SCHMA/13-356STEYVDAL......................................................KKLQMLH..CEEKELTAD
K3ZRV5_SETIT/229-519TPDHIESV......................................................EQTKNML..YSYF.....
Q22CW6_TETTS/24-319RDSYVDLV......................................................EQMWPEG..CEKENMVL.
Q2G292_STAA8/18-322KYDYVEAI......................................................KHASHGI..ISEDEAKKY
Q8F7M9_LEPIN/19-309SQNHIQKI......................................................ENSKGKR..GYF......
V6EZA3_9PROT/18-307CPHHVDHV......................................................LSSVPEP..GEFF.....
W7X9B2_TETTS/36-342DDNYIEFI......................................................EGMWPEK..TKKKEIY..

PF12640

B5Z5P5_BACCE/12-235----------------------------------------------I---------------------------------
C2XKX5_BACCE/12-239----------------------------------------------I---------------------------------
B9BUU1_9BURK/13-199----------------------------------------------V---------------------------------
B4E7R4_BURCJ/13-201----------------------------------------------I---------------------------------
A8MKG9_ALKOO/16-197----------------------------------------------I---------------------------------
Q0YSC5_9CHLB/5-197----------------------------------------------V---------------------------------
Q12VI5_METBU/19-180----------------------------------------------L---------------------------------
Q1CZJ9_MYXXD/103-253----------------------------------------------A---------------------------------
Q6ARQ8_DESPS/48-185----------------------------------------------V---------------------------------
C2SK71_BACCE/15-171----------------------------------------------I---------------------------------
C3Q562_9BACE/31-198----------------------------------------------T---------------------------------
D7W5E5_9FLAO/27-172----------------------------------------------V---------------------------------
A3TZZ3_9RHOB/31-170----------------------------------------------V---------------------------------
C6C1I6_DESAD/28-165----------------------------------------------I---------------------------------
C5KCK7_PERM5/16-196----------------------------------------------V---------------------------------
B7FS57_PHATC/11-216----------------------------------------------V---------------------------------
C3XU32_BRAFL/3-238----------------------------------------------N---------------------------------
CE022_DANRE/15-248----------------------------------------------V---------------------------------
Q1RMV5_BOVIN/19-257----------------------------------------------V---------------------------------
A7UTP5_ANOGA/103-265----------------------------------------------I---------------------------------
B3M7P2_DROAN/118-284----------------------------------------------V---------------------------------
B4N4R0_DROWI/108-274----------------------------------------------V---------------------------------
A7SLH9_NEMVE/10-251----------------------------------------------V---------------------------------
B7PMV1_IXOSC/7-174----------------------------------------------V---------------------------------
A9VAD6_MONBE/67-213----------------------------------------------E---------------------------------
A6UPR5_METVS/56-208----------------------------------------------G---------------------------------
A9AA45_METM6/55-201----------------------------------------------G---------------------------------
A6UX51_META3/57-190----------------------------------------------G---------------------------------
D0MD43_RHOM4/57-211----------------------------------------------G---------------------------------
A0A031WF12_PEPDI/78-183----------------------------------------------I---------------------------------
B6G251_9FIRM/77-182----------------------------------------------V---------------------------------
B0A6K5_9FIRM/76-181----------------------------------------------V---------------------------------
C0CJH7_9FIRM/6-165----------------------------------------------V---------------------------------

PF00491

SPEB3_SCHPO/85-387WAKLV....................................DCGD.I........PVT......................
Q6BJQ5_DEBHA/76-370WAKVI....................................DCGD.M........PVT......................
Q6BVQ4_DEBHA/136-428DGKIV....................................DCGD.P........PMT......................
Q6BWL4_DEBHA/179-480NLSII....................................DCGD.V........PMT......................
A1RXI5_THEPD/26-288RLAVN....................................DAGD.L........PVL......................
SPEB_MOUSE/77-350SLRVA....................................DLGN.V........NVN......................
A4XKN0_CALS8/20-281NKAFC....................................DMGD.L........ELP......................
A4J1T2_DESRM/21-282DYAYY....................................DAGD.V........AIP......................
A1VQK9_POLNA/34-307ALQVA....................................DLGD.V........PIN......................
Q2K8A9_RHIEC/46-316HARVA....................................DVGD.V........PFK......................
B2JW15_BURP8/32-305ACRVA....................................DIGD.V........PFT......................
Q982X2_RHILO/42-307HLAVV....................................DYGD.C........LLD......................
HUTG_BACHD/35-311QLKLT....................................DLGD.I........TMH......................
HUTG_RHOSR/40-314PLRVY....................................DAGT.V........AVT......................
ARGI1_HUMAN/6-305.CDVK....................................DYGD.L........PFADIPND...............SP
SPEB_CHRVO/44-311DLAVV....................................DYGD.C........WFD......................
ARGI_BACSU/3-292.YTVE....................................DLGD.I........PINREKI................KN
Q97ZX8_SULSO/24-289EIGFN....................................DVGD.I........ILH......................
HUTG_VIBVY/45-328PHPLY....................................DLGT.V........VCD......................
A9BRG6_DELAS/16-312.CQVS....................................DIGN.L........AGPPNPQT...............PP
HUTG_AROAE/40-323EWPVY....................................DAGD.AGDVGASTHDAG......................
A1RB53_ARTAT/29-311FA.AV....................................DLGDIV.................................
Q1J2W9_DEIGD/37-306DVTFA....................................DAGD.V........VLP......................
Q2JER0_FRASC/40-318WLDVV....................................DAGD.A........HCP......................
Q3J346_RHOS4/3-296.HAVE....................................DRGD.V........ALGPLPEM..............TPP
A9B324_HERA2/22-290NWGVH....................................TLPS.V........EVN......................
Q9YBG0_AERPE/29-298RVPIA....................................DEGD.V........AAV......................
Q1GI44_RUEST/34-307ALNIA....................................DIGD.L........AIN......................
Q9HJB2_THEAC/33-293RARIS....................................DLGD.M........EE.......................
A0RXD6_CENSY/22-283EVRID....................................DLGN.A........KH.......................
A8LLU9_DINSH/46-312EFTVV....................................DYGD.L........AFD......................
SPEB_BACHD/22-286EVAYF....................................DAGD.M........LLP......................
Q0W940_UNCMA/16-280DVPIH....................................DMGN.C........DT.......................
Q6MHV0_BDEBA/36-309NLKVA....................................DIGD.C........PTV......................
Q98MW3_RHILO/19-296PASCV....................................DAGD.I........STI......................
A0LG67_SYNFM/34-297RHGIA....................................TLEE.L........PVV......................
HUTG_BACSU/35-311SELLY....................................DLGD.I........DIH......................
Q9K5Y7_BACHD/5-297.FEVK....................................DYGD.I........PINRPATS..............ETQ
Q164F4_ROSDO/46-312EFAII....................................DYGD.L........AFD......................
Q164F5_ROSDO/34-308SLQVA....................................DIGD.L........AIN......................
Q15X44_PSEA6/42-323NVSLL....................................DKGD.V........VAN......................
Q11J67_CHESB/42-307TLAVV....................................DYGD.C........LLD......................
Q1AWJ4_RUBXD/5-295.YRVS....................................DLGN.V........EVPIPEAA..............SGG
Q5WL42_BACSK/7-290N.ALT....................................DYGN.I........EIA......................
Q7UZH9_PROMP/24-288DFNYV....................................DFGS.L........EID......................
Q6CLB8_KLULA/137-438GYKIV....................................DCGD.I........PMT......................
A0JT79_ARTS2/57-331NVQVA....................................DAGD.M........AVN......................
Q2KVZ3_BORA1/13-287.LRAV....................................DAGNVV.................................
B2UBQ2_RALPJ/40-316GRVVV....................................DAGD.V........TCQ......................
Q165U0_ROSDO/35-314DVRIV....................................DMGD.A........DIV......................
B1YHV3_EXIS2/22-286DAKLF....................................DAGD.I........PLP......................
Q5WIT9_BACSK/27-306.IRLG....................................DAGD.V........DV.......................
A1C610_ASPCL/68-380WATVK....................................DCGD.I........PIT......................
Q1AS11_RUBXD/33-307HLSVI....................................DYGD.V........PVV......................
Q28QX8_JANSC/39-314AANIA....................................DLGD.V........AMS......................
A1WGI6_VEREI/22-320.LQSF....................................DRGN.L........SGPANPWQ...............AP
A1WER7_VEREI/22-295ALRVA....................................DLGD.V........AIN......................
A1T3A2_MYCVP/88-364.LNMV....................................DIGDVF.................................
A8LRL4_DINSH/4-296.WQTE....................................DRGN.L........PGPTWVAD...............TP
A5V551_SPHWW/4-298.HEVS....................................DHGD.V........APMRADDV...............SL
Q11NZ4_CYTH3/3-310.LKQF....................................SKKT.L........SSFPEKRGE.............TGP
Q5V4R8_HALMA/3-300.IDCI....................................DGGD.I........AVPRPEERDPD.........AGGLD
SPEB_SERP5/33-298RVNVV....................................DCGD.I........VFN......................
Q12BY7_POLSJ/72-342RLKMA....................................DVGD.V........PMR......................
HUTG_VIBF1/45-345QSDVY....................................DGGD.I........QCN......................
Q3IVT5_RHOS4/32-308VLRVA....................................DAGD.A........TCV......................
HUTG_GEOKA/44-315GVVVY....................................DAGD.V........VCI......................
SPEB_BLOFL/33-298KLKII....................................DCGD.L........IYK......................
A0ZFA2_NODSP/30-338KQGIFMMEIPQDICEKNEYYRTLAAKIIARLAQGEQLTATPDLTP.V........LTA......................
A4XT95_PSEMY/38-311SLNVA....................................DIGD.V........AIN......................
Q5WB32_BACSK/22-286EINYF....................................DAGD.I........PLP......................
Q6C6P6_YARLI/9-306.WDTK....................................FDGH.L........EFPVPESD...............ED
Q12UU8_METBU/17-282EIPAH....................................DAGN.F........EA.......................
Q213G1_RHOPB/11-309.FVVE....................................DHGDLL........PTPPIDDAD.............EAL
Q28PV5_JANSC/46-313ALAIA....................................DYGD.M........AFD......................
A0QRD0_MYCS2/43-317QAQVV....................................DAGD.L........GVN......................
ARGI_NEUCR/47-354.YRLH....................................GDDE.V........HLYTDLVPK............EDPP
Q12LW8_SHEDO/33-299CIKIV....................................DAGD.L........VFN......................
Q2W8C1_MAGSA/22-290QMSIA....................................DLGD.F........SLA......................
Q6CIB4_KLULA/61-358WASVV....................................DCGD.V........PVT......................
A1SLP1_NOCSJ/31-312DLRVV....................................DAGD.V........EMP......................
Q28VR8_JANSC/34-309GTKII....................................DMGD.A........DII......................
Q0UYW2_PHANO/16-320.MNVS....................................YDGT.V........HNYSELLPS............DDPD
Y309_METJA/21-281ELKYC....................................DLKD.L........DL.......................
Q9RZ04_DEIRA/29-298GVTFA....................................DAGD.V........ILP......................
Q6CLS8_KLULA/13-315.WETT....................................LEEP.L........KGRDFESGKN..........DETDV
A2BIW8_HYPBU/25-300NIGIS....................................DLGD.I........AV.......................
Q21RM0_ALBFT/15-309.LDVK....................................DCGN.L........HGPANPWL...............QA
Q6L151_PICTO/19-280DAGIC....................................DLGD.L........PV.......................
Q4P4M4_USTMA/13-318.WKVD....................................FTDH..........HSFDHINQGI..........DSDTD
A1B165_PARDP/30-308DVRAV....................................DCGD.V........TGD......................
Q16AD8_ROSDO/4-296.YVAE....................................DRGN.I........SPGAFTPD...............TH
Q3SMM1_THIDA/8-294.V..A....................................WDAI.L........RVPRM....................
Q5AK86_CANAL/12-313.WTTD....................................LKEP.L........EGTDYEKMKT...........NDKD
Q7VSA1_BORPE/8-302.LQVT....................................DRGN.L........QGAPNPWR...............PP
A0BHR2_PARTE/9-311.WEIN....................................DMGD.I........QGKNYRLH..............NVK
Q4JAE9_SULAC/24-287EIGFS....................................DVGD.I........VMH......................
Q975R8_SULTO/24-287EVGFN....................................DVGD.V........VMH......................
Q1LGD2_RALME/2-296.LDVT....................................DLGN.L........VGPGNPNL...............PP
ARGI_AGRT5/19-313.WAVT....................................DLGD.A........TPTVEPEL..............SHP
Q1D421_MYXXD/27-337ERGIAMLPEPQELRDWNTRAK...ERAQVVIEAGGIHSGEAALIQ.A........AQD......................
SPEB1_SCHPO/74-375WAKIV....................................DCGD.I........PLT......................
ARGI_YEAST/13-329.WSTE....................................LEPS.M........DEAQFVGKLKMEKDSTTGGSSVMID
A9BN56_DELAS/71-341ELRVA....................................DIGD.V........PLS......................
Q5A4M3_CANAL/50-340WARII....................................DCGD.I........PVT......................
A1RBR9_ARTAT/55-335EAQVV....................................DAGD.I........ACT......................
A1VTU0_POLNA/3-297.LRVT....................................DRGN.I........NGPANPWQ...............AP
Q0UMJ9_PHANO/68-378WASIV....................................DCGD.I........PVT......................
A1SM48_NOCSJ/41-314GVQVV....................................DAGD.I........AAN......................
Q1GI45_RUEST/67-333ELAIV....................................DYGD.L........AFD......................
Q1IHQ4_KORVE/16-311.HVVE....................................DGGN.V........SVPLAETK..............DPG
Q6L2W0_PICTO/21-293SLKIL....................................DAGN.I........DV.......................
Q89H72_BRADU/11-308.FEVV....................................DYGD.L........SVAEVRDLA.............DRP
Q489X2_COLP3/36-310SFQIA....................................DIGD.T........PIN......................
Q7V9I4_PROMA/29-293DINFT....................................DFGN.L........EIN......................
SPEB1_SYNY3/26-297DLGIY....................................TCAP.L........ADSN.....................
Q6FP31_CANGA/10-317.WGTE....................................IQSP.L........DEEEYVKKVKE.........NTQDQ
A5G414_GEOUR/41-319.LKIG....................................DIGD.V........PV.......................
Q3SVS2_NITWN/5-302.IDVL....................................DHGD.I........ALAGVAPAT.............DAI
SPEB2_SCHPO/89-401WAKIL....................................DCGD.I........PVS......................
Q8XPR0_RALSO/29-309DIRFV....................................DCGD.I........VPD......................
Q47TW8_THEFY/41-314EVQVA....................................DGGD.I........AVN......................
A9KQ98_CLOPH/18-281DYQIF....................................DGGD.L........ELP......................
A1BCD2_PARDP/35-312RLAVA....................................DIGD.L........VVQ......................
ARGI_ASHGO/93-395.WEIE....................................VQRP.L........DGHDFEERKQ..........RATEV
A1B3P5_PARDP/3-295.HTVE....................................DRGD.L........SPAPGRGQ..............ACA
Q1QTM4_CHRSD/39-312SLQVA....................................DIGD.V........PIN......................
Q6C732_YARLI/86-381WAKFV....................................DCGD.V........AMH......................
A0LDK6_MAGSM/20-293ELPTH....................................TLQP.P........SLE......................
Q47D78_DECAR/17-302.L.VD....................................WGKT.L........FAPDNDG................TS
Q3JAG2_NITOC/2-290.MPVS....................................WEIT.I........QPQES....................
A3DDA1_CLOTH/24-286QCSFF....................................DAGD.L........DLP......................
A1CKP4_ASPCL/16-320.YDVH....................................YDDT.V........HFYENLTPM............NDPD
ARGI1_SCHPO/22-319.YSVN....................................V....V........QNPKFKSRPL..........KEGPN
HUTG_PHOLL/44-316HDKLV....................................DLGS.I........RAN......................
Q3IQJ3_NATPD/45-332ALDIV....................................DCGD.V........PVF......................
SPEB2_SYNY3/83-361.ISLC....................................DVGDIF.................................
Q5LKZ4_RUEPO/42-315LVNCA....................................DLGD.V........APN......................
Q2RHH4_MOOTA/26-287GVPFY....................................DAGD.L........DLP......................
Q17HI3_AEDAE/32-333.LDIR....................................DYGD.I........QYEALNLQ..............GRL
A3CU48_METMJ/19-276EVPIT....................................DLGD.L........AV.......................
HUTG_HAHCH/40-316THPVY....................................DCGN.I.........QW......................
Q8RA93_THETN/28-290DKKIC....................................DLGD.L........VLP......................
Q8END5_OCEIH/29-310.YSFG....................................DLGD.V........DV.......................
Q5ANN8_CANAL/115-414NYSII....................................DCGD.V........AMT......................
Q2LPR8_SYNAS/65-343.LTVA....................................DAGD.V........SV.......................
A1ST87_PSYIN/33-299KTKII....................................DAGD.L........VYS......................
ARGI1_ARATH/63-338.RVLT....................................DVGD.V........PVQE.....................
A0R0G1_MYCS2/40-312VCQFA....................................DAGD.I........ACN......................
A1CFK4_ASPCL/83-374WAKIV....................................DCGD.A........PLT......................
B8I5M8_CLOCE/21-282DYKIH....................................DYGD.L........DLP......................
A1TIE4_ACIAC/8-305.LEVE....................................DLGN.L........HGPPNPRG..............ERT
A1T9H7_MYCVP/46-324WLEVV....................................DFGD.A........YCP......................
Q97VA3_SULSO/30-299KLNAC....................................DMGD.I........NVI......................
Q4J720_SULAC/30-299KLNAC....................................DLGD.V........NII......................
Q3J2B4_RHOS4/46-312ELTVV....................................DYGD.L........AFD......................
A1CGK0_ASPCL/61-357ELSIV....................................DCGD.I........PIT......................
Q10Y47_TRIEI/24-296EVGIY....................................THEP.I........ADTR.....................
A5G278_ACICJ/28-297DMDLA....................................DAGD.F........AIA......................
ARGI_SOYBN/71-346.RIMV....................................DVGD.I........PIQE.....................
O76895_DROME/30-333.LVIR....................................DYGN.L........QYAVDEPLLQ..........QQRVH
A1W2M6_ACISJ/2-298.FDVR....................................DQGN.L........AGPGNPQA...............EP
A8GC83_SERP5/32-305RLQVA....................................DLGD.I........AIN......................
Q1GHG8_RUEST/4-296.HTVE....................................DIGN.V........TPAPHAPD...............DG
Q65P52_BACLD/4-300.QDIE....................................DLGD.M........TIGQREDEKE..........GGEPA
Q67TJ0_SYMTH/28-290DKNFF....................................DLGD.V........AVV......................
A4XZN2_PSEMY/43-309VLACV....................................DYGD.C........HFD......................
A4YE21_METS5/29-295ELSAC....................................DGGD.V........DVI......................
Q6ANF4_DESPS/59-334ECSGV....................................DYGD.I........DII......................
Q222F3_ALBFT/24-298H..LG....................................DALD.M........RLP......................
ARGI2_MOUSE/24-324.CHLK....................................DFGD.L........SFTNVPQD..............DPY
Q315M1_DESAG/23-287RLGLF......................................TH.C........PVD......................
A7IL28_XANP2/50-316TLDVV....................................DGGD.C........VFD......................
Q18A84_PEPD6/21-285DYNIC....................................DYGD.L........EIS......................
Q5V6R7_HALMA/44-335TFSVA....................................DTGD.A........AVS......................
Q5LRK8_RUEPO/33-325.HRVE....................................DLGN.L........SPAEHAPE...............PS
Q9K8M2_BACHD/4-296.YHVD....................................DMGD.I........PIDRPGEV..............SEE
Q3ABP1_CARHZ/20-281DVNFY....................................DMGD.V........ALT......................
A9CJC2_AGRT5/42-307HMPTI....................................DYGD.C........LLD......................
Q7U3K9_SYNPX/21-280DLAYA....................................DLGA.V........DIP......................
A1STQ5_PSYIN/47-343GASFY....................................DGGN.V........FCH......................
Q7VY32_BORPE/13-287.LRLL....................................DLGNVA.................................
Q9CL61_PASMU/34-299RLKIV....................................DCGD.L........VYS......................
A4IB49_LEIIN/14-315ARKAS....................................DNGD.R........IGR......................
A5UXL8_ROSS1/34-305TLSCI....................................DYGD.A........PVA......................
A9WCM8_CHLAA/41-307HLTIC....................................DLGD.V........DTT......................
B2FJ13_STRMK/7-298.VDVR....................................DLGN.L........DGPRNPWT...............AP
B4EIP8_BURCJ/49-320SLQIA....................................DIGD.V........AIN......................
B4ELX2_BURCJ/44-308DLAVV....................................DYGD.C........WFD......................
B5GLC8_STRC2/31-301LINCV....................................DAGD.I........NLT......................
B9A9C6_BOMMO/12-304GLDVK....................................DFGD.I........ETSSCENN...............VN
C0ZIM2_BREBN/4-293.FNIE....................................DRGD.I........FVTRPHHFT............ETEN
D0J7J2_COMT2/7-302.VQVS....................................DLGN.L........SGPANPRGAR...........DAQG
D5AV62_RHOCB/6-296.WRIE....................................DQGD.L........SIGPQAAVAH...........ANPA
D5SKW9_STRC2/134-404RIDVV....................................DGGD.I........DLS......................
E3GWR7_METFV/23-279.VPII....................................DLGD.I........EVI......................
E9CYX8_COCPS/18-317.GQVH....................................T...............YAEFVPEHD.........PNHRG
F1QJZ3_DANRE/86-357SIKVA....................................DIGD.I........NVN......................
F6SZP1_XENTR/61-332SLMVA....................................DIGD.V........NVN......................
I9NPV5_COCIM/78-370WAKIV....................................DCGD.A........PLT......................
K5X448_AGABU/13-305HHQFE....................................EYNN.L........DDAP.....................
SPEB_NEIMB/35-299RLNII....................................DCGD.L........VFS......................
Q05AR1_XENTR/27-324.CNVC....................................DFGD.L........HFSQVPND..............ELY
Q24ZK6_DESHY/5-295.WEVE....................................DVGN.I........DVPIAETREI..........KDPLL
Q251M0_DESHY/26-286DYAYC....................................DCGD.L........SLP......................
Q2FW91_STAA8/6-296.LDVY....................................DKGD.I........KVPAVNIEKFH.........SEQKG
Q2K3I8_RHIEC/7-299DLGIV....................................PAMD.L........PNH......................
Q2K9W6_RHIEC/65-328DMAVI....................................DYGD.C........LLD......................
Q3IKA3_PSEHT/33-297HLKVA....................................DAGD.F........TYP......................
Q46IA1_PROMT/31-292DINFT....................................DIGS.L........DVP......................
Q4FL05_PELUB/40-312VQQVA....................................DAGD.I........TCN......................
Q5KIC1_CRYNJ/70-373DLSIL....................................DCGD.V........PVT......................
Q5L3P6_GEOKA/3-294.YDIE....................................DLGD.I........PIGKAERLH.............EQG
HUTG_LEGPH/47-315.KHYV....................................DLGN.V........VCE......................
Q6LHE2_PHOPR/35-321SFPLY....................................DAGI.I........DEL......................
Q6LWW9_METMP/19-277DVKIC....................................DKYN.L........LME......................
Q6N0N3_RHOPA/14-309.FAVE....................................DHGD.M........TRPALDGGN.............DPV
Q6PH54_DANRE/25-322.YPVH....................................DFGD.L........TFKHLEKDE............HFMH
Q72EZ7_DESVH/23-282AQGIH....................................THPP.V........DCT......................
Q7T151_DANRE/27-322GCVVK....................................DYGN.V........TFENLPNDE............SIGR
Q7V3X2_PROMM/30-287DLAFT....................................DLGA.L........EIP......................
SPEB_BACAN/23-284EVKYF....................................DAGD.I........PLP......................
Q81VP0_BACAN/4-292.YDVK....................................DMGD.I........CIEREKEVD............VNTS
Q81Y48_BACAN/37-311ESVLY....................................DCGD.I........TMH......................
Q82VE5_NITEU/46-310HLAVI....................................DSGD.C........FLD......................
HUTG_VIBPA/47-325DAPLY....................................DLGT.V........VCD......................
Q88KU3_PSEPK/34-298HLAVI....................................DYGD.C........PFD......................
Q8RG18_FUSNN/503-779ERQKE....................................DFND.K........KLK......................
Q8TJ04_METAC/18-281DLPIY....................................DAGN.L........ETS......................
Q8XMY7_CLOPE/21-278DFNIF....................................DGGE.I........ELP......................
Q92LN4_RHIME/3-295.HTVN....................................DEGD.L.......RP.LPARDL...............AN
Q92MV8_RHIME/71-339DLRVA....................................DIGD.V........PFR......................
Q92QR6_RHIME/44-306DMATI....................................DYGD.C........LLD......................
GPUA_PSEAE/36-307LVRVG....................................DLGD.A........PVN......................
Q9KLD2_VIBCH/33-297KINVI....................................DAGD.L........VFD......................
HUTG_VIBCH/44-322.IPIY....................................DLGN.I........RCE......................
U5L6E1_9BACI/3-293..HIH....................................DLGD.I........AIGRPEVE..............IDP
U5LEA0_9BACI/39-314SLTAA....................................DAGD.V........LMH......................
W6RQZ8_9RHIZ/120-388ELKVA....................................DVGD.V........PMR......................

PF00850

A0DIS2_PARTE/29-344LTK...............DVK....................YFDD.T---------------------------------
A0LGT0_SYNFM/15-314..................FD......................HPD.N---------------------------------
A1W7T1_ACISJ/25-356EGQDRVQPFPSVWPVRTLRSDIEPDNFI......AKLGLYSMDNG.S---------------------------------
A2BL29_HYPBU/15-315..........................................DPD.T---------------------------------
A3DNS7_STAMF/16-313..........................................DPD.T---------------------------------
A3GH68_PICST/21-341SISES..............QRY.................GLVHD..C---------------------------------
A4S2N1_OSTLU/197-606YCQNHNGVPEKLQKPAENSD..........................T---------------------------------
A4S898_OSTLU/22-313W..............................................---------------------------------
A4X4X7_SALTO/10-318FFTGFG...........LG.......................TPD.N---------------------------------
A4YNH4_BRASO/45-371DAGSEMIPNM..HPVRNAATYPTHIVG........RLGWHTTDTS.A---------------------------------
A6QAF4_SULNB/14-302...................I......................DSD.T---------------------------------
A6R4B6_AJECN/49-360NDRMA..............GFN..................FGDD..C---------------------------------
A6VSZ5_MARMS/14-305..................LE.......................PE.T---------------------------------
A7SSG8_NEMVE/23-333LFN...............LGE....................EYDS.I---------------------------------
A7SUP8_NEMVE/23-330LVE................FG...................LGYD..C---------------------------------
A7TRW5_VANPO/9-404.FSESESESESGSGSGSEANEYFQINNSRERQQDVYKKFNLEGD..C---------------------------------
A8ABS4_IGNH4/14-309..........................................DPD.T---------------------------------
A8ZT95_DESOH/16-310..................ITS....................MAPD.T---------------------------------
A9A062_DESOH/259-573SIYPYVFPIRNSTRPPKSLPMRAG..............YYCIDTF.T---------------------------------
A9B5I1_HERA2/14-309..................AD.......................AE.T---------------------------------
B0T7F0_CAUSK/32-328..........................................PGDDA---------------------------------
B2JV93_BURP8/15-309..................LD......................GGD.T---------------------------------
B4U8T2_HYDS0/14-304..................LD.......................PD.T---------------------------------
C5KDG6_PERM5/340-870PLEEIA...........DSELPVVDLCSKRCARLVGRALTLWPGE.C---------------------------------
E0TF48_PARBH/5-292W..............................................---------------------------------
E2RU63_GIAIC/11-320...................KRY.................NITED..C---------------------------------
F2G2X2_ALTMD/14-319YSERKDS........VAWLD.......................ED.T---------------------------------
O67135_AQUAE/10-314AREKYN...........IG.......................GYE.N---------------------------------
HDA1_YEAST/69-395LLK...............ETE....................KGDS.V---------------------------------
Q00U49_OSTTA/445-741M..............................................---------------------------------
Q02CA3_SOLUE/14-311RPY...............LS......................TGD.T---------------------------------
Q0A6Z7_ALKEH/46-336..................LD......................VDT.T---------------------------------
Q0ARF0_MARMM/14-308PD............................................T---------------------------------
Q15WQ0_PSEA6/14-301W..............................................---------------------------------
Q1CZX8_MYXXD/21-314..................ID.......................PD.T---------------------------------
HDA6_CAEEL/438-748MEE...............AEK....................EFNS.I---------------------------------
Q29CG7_DROPS/25-326FV.............................................---------------------------------
Q2FQW8_METHJ/14-311..........................................DAD.T---------------------------------
Q2IF50_ANADE/16-319M.................LDW....................LEPE.T---------------------------------
Q2KBQ8_RHIEC/14-309..................LE.......................AD.T---------------------------------
Q2LVD3_SYNAS/15-311..................LD.......................PD.T---------------------------------
Q2R9B1_ORYSJ/26-342LRQKA..............EDDHG..............IGGDDD..C---------------------------------
Q2S035_SALRD/7-313EARAFG...........LD.......................TGD.V---------------------------------
Q2SC27_HAHCH/8-315WL.............................................---------------------------------
Q30PJ4_SULDN/258-572SIYPIVFPLRNMARPPKDIELQVG..............YYALDTF.T---------------------------------
Q31EP6_THICR/49-347..................YEP....................YQGD.T---------------------------------
Q31HC2_THICR/13-304..................ID.......................ED.T---------------------------------
Q38C74_TRYB2/21-323WNTEV..............SKV.................TFSGD..C---------------------------------
Q39UV4_GEOMG/11-315ADFRYG...........LG.......................DLD.N---------------------------------
Q3AFN8_CARHZ/10-319NGSRFG...........LG.......................SED.N---------------------------------
Q4D762_TRYCC/47-388KRSRAEGIQPPVSRRSSAQTQPPLRVLPDLVPISTDEEYGLVNE..N---------------------------------
Q4FNF7_PELUB/14-306LSF...............LD.......................GD.T---------------------------------
Q4KAJ1_PSEF5/12-340RSHDALPLVW...PVRDLANQQVPEFID......GKLGFFAMDAG.S---------------------------------
Q4MYQ3_THEPA/25-416SSSKGKRAYTS.SKKFQSLYP....................LDVD.T---------------------------------
Q4P2D6_USTMA/326-751Q.............................................S---------------------------------
Q4QAJ4_LEIMA/91-404AFQKE..............FDVPF..............ASQDSD..C---------------------------------
Q4QI60_LEIMA/58-432SAANRSQWIPARLATYDEVCSFQDPQVYEHFLKSGAALADLKSDV.Y---------------------------------
HDA21_DICDI/1072-1486VNNDGASTGINQFSTSTPITTTGTATVTPGSTTSSTNGEQCEDGD.T---------------------------------
Q59Q78_CANAL/56-379VIEEN..............DLDEK..............YGLTFD..C---------------------------------
Q5AF34_CANAL/175-593EVPDD............WN.......................VGD.I---------------------------------
Q5K8L3_CRYNJ/64-492RPAKI..............ARTDP..............YNLSHD..N---------------------------------
Q5KKR8_CRYNJ/28-368TGNRS..............RGL..................TGSD..C---------------------------------
Q60DG7_ORYSJ/34-350...................L......................CEG.T---------------------------------
Q6AJC0_DESPS/18-318..................ID......................HLD.N---------------------------------
Q6AKN4_DESPS/15-311..................YD.......................QD.T---------------------------------
Q6C3Y5_YARLI/54-352...................DKM.................GLIHD..C---------------------------------
Q6CGA7_YARLI/254-648ELPPG............WP.......................EGD.I---------------------------------
Q6FWB7_CANGA/8-383ELSDVES........GDEVTRRSTL...........AKFNLLDD..C---------------------------------
Q741C0_MYCPA/14-307..................LD......................GGD.T---------------------------------
Q7PS30_ANOGA/118-424LER...............LSS....................HYDA.I---------------------------------
Q8EP92_OCEIH/11-321SALEYG...........IG.......................TED.T---------------------------------
Q8I4I9_CAEEL/17-318...................YC....................KDKEIL---------------------------------
Q8IR37_DROME/555-861LHD...............AAG....................IYNS.V---------------------------------
HDA14_ARATH/75-387LIFI..............EG......................SGP.T---------------------------------
Q9K0J2_NEIMB/35-328..................ISR....................LDND.T---------------------------------
Q9U266_CAEEL/18-319ES................FCT...................KYED..I---------------------------------
F5GX36_HUMAN/250-576GSL................ASVFVRLP........CGGVGVDSDT.I---------------------------------
F6Q3W9_MOUSE/101-401VLAET.....................................YDS.V---------------------------------
G4VAN3_SCHMA/13-356DELLM..............DSF..................SLNYD.C---------------------------------
K3ZRV5_SETIT/229-519..........................................TSD.T---------------------------------
Q22CW6_TETTS/24-319...........................................NG.C---------------------------------
Q2G292_STAA8/18-322GL.................N......................DEE.N---------------------------------
Q8F7M9_LEPIN/19-309..........................................DSD.T---------------------------------
V6EZA3_9PROT/18-307H...I.....................................DPD.T---------------------------------
W7X9B2_TETTS/36-342..........................................MLD.T---------------------------------

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------------------------------------------
C2XKX5_BACCE/12-239--------------------------------------------------------------------------------
B9BUU1_9BURK/13-199--------------------------------------------------------------------------------
B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C2SK71_BACCE/15-171--------------------------------------------------------------------------------
C3Q562_9BACE/31-198--------------------------------------------------------------------------------
D7W5E5_9FLAO/27-172--------------------------------------------------------------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UPR5_METVS/56-208--------------------------------------------------------------------------------
A9AA45_METM6/55-201--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------
A0A031WF12_PEPDI/78-183--------------------------------------------------------------------------------
B6G251_9FIRM/77-182--------------------------------------------------------------------------------
B0A6K5_9FIRM/76-181--------------------------------------------------------------------------------
C0CJH7_9FIRM/6-165--------------------------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387....T.YDILK.A...-----...MDQLESAYFQLI--------------------------------------------
Q6BJQ5_DEBHA/76-370...P..MDNSL.A...-----...FKQMNKGFEELI--------------------------------------------
Q6BVQ4_DEBHA/136-428...P..IDNRI.A...-----...LDQLYRAERAIL--------------------------------------------
Q6BWL4_DEBHA/179-480...P..FDNRI.A...-----...LNQLYRGQRSIH--------------------------------------------
A1RXI5_THEPD/26-288...T...SVEA.L...-----...IDILGGVAREVL--------------------------------------------
SPEB_MOUSE/77-350...L..YNLQD.S...-----...CLLIREAYQNVL--------------------------------------------
A4XKN0_CALS8/20-281...F..GNVGK.S...-----...IDIIYEFARKIF--------------------------------------------
A4J1T2_DESRM/21-282...F..GHVLE.S...-----...LERISKVVGNIV--------------------------------------------
A1VQK9_POLNA/34-307...T..YNLHK.S...-----...VEIIEQHYQPVI--------------------------------------------
Q2K8A9_RHIEC/46-316...SR.FDLAA.S...-----...HDDIEKFVGGLI--------------------------------------------
B2JW15_BURP8/32-305...DL.YHLER.A...-----...HDDIRRFFEPVF--------------------------------------------
Q982X2_RHILO/42-307...S..GNHQK.T...-----...PGTIEREAAKIL--------------------------------------------
HUTG_BACHD/35-311...V..TDIVG.S...-----...QARIEETMTKLL--------------------------------------------
HUTG_RHOSR/40-314.......DNR......-----...LEAGQMALGSVV--------------------------------------------
ARGI1_HUMAN/6-305FQIV...KNPRSVG..-----.KASEQLAGKVAEVK--------------------------------------------
SPEB_CHRVO/44-311...A..HNPLT.I...-----...KPSIIEHARTIL--------------------------------------------
ARGI_BACSU/3-292DEEL...KNLNSVL..-----.AGNEKLAQKVNKVI--------------------------------------------
Q97ZX8_SULSO/24-289...P..SNVEE.N...-----...LSRISSVISYFQ--------------------------------------------
HUTG_VIBVY/45-328.......DDL......-----...LESSQQHCAKII--------------------------------------------
A9BRG6_DELAS/16-312EQGL...RHLAPAR..-----.AWMDAVHQAVGQAL--------------------------------------------
HUTG_AROAE/40-323.......EQT......-----...LETMQGDYARRI--------------------------------------------
A1RB53_ARTAT/29-311.......PVGSSAQ..-----.EVADEIGSVVAD.L--------------------------------------------
Q1J2W9_DEIGD/37-306...S..LEPEL.A...-----...RERITQTARQVR--------------------------------------------
Q2JER0_FRASC/40-318...H..GLTEA.S...-----...HRNIRAKVARIA--------------------------------------------
Q3J346_RHOS4/3-296EGPV...HDLPETI..-----.GWTAALKTAV.EEA--------------------------------------------
A9B324_HERA2/22-290...D..QDPDS.A...-----...MQSIAQAVEATA--------------------------------------------
Q9YBG0_AERPE/29-298...P..GSTLL.T...-----...LERVARVVEDLA--------------------------------------------
Q1GI44_RUEST/34-307...T..FNLAE.S...-----...LRIIEDSYDAIL--------------------------------------------
Q9HJB2_THEAC/33-293...S..EDVEY.V...-----...VDQVDRVTKMVF--------------------------------------------
A0RXD6_CENSY/22-283...T..VSPDV.M...-----...VEMVGRITAELA--------------------------------------------
A8LLU9_DINSH/46-312...Y..GRAAG.F...-----...PAALEAHIRTIL--------------------------------------------
SPEB_BACHD/22-286...F..GNPQR.S...-----...LEMIESYVDKLL--------------------------------------------
Q0W940_UNCMA/16-280...Y..ASIED.T...-----...LLEVYQTSKQIV--------------------------------------------
Q6MHV0_BDEBA/36-309...P..IDQKQ.T...-----...YEKIEKFVGEVL--------------------------------------------
Q98MW3_RHILO/19-296...L..HDNAE.N...-----...RVRIEAKTREVL--------------------------------------------
A0LG67_SYNFM/34-297...V..SSPRD.M...-----...LDSVRVVGAQVL--------------------------------------------
HUTG_BACSU/35-311...V..TDIVK.S...-----...HHHIFQTMHALL--------------------------------------------
Q9K5Y7_BACHD/5-297EGPL...RNLDEVV..-----.KVSEELCKGVAAIE--------------------------------------------
Q164F4_ROSDO/46-312...Y..GNVAA.F...-----...PETLKAHISTIL--------------------------------------------
Q164F5_ROSDO/34-308...T..FSLAK.S...-----...LKIIEESYHAIL--------------------------------------------
Q15X44_PSEA6/42-323.......EC.......-----...LDSCQQNYATEV--------------------------------------------
Q11J67_CHESB/42-307...Y..GRHDL.T...-----...PAAIETEASKIL--------------------------------------------
Q1AWJ4_RUBXD/5-295DGKA...WRLRAVR..-----.EVCSAVSRRAREAV--------------------------------------------
Q5WL42_BACSK/7-290...A..YSTDQ.T...-----...FAQAEAKLKAVL--------------------------------------------
Q7UZH9_PROMP/24-288...K..NDSIS.V...-----...IKAVKSATDFIM--------------------------------------------
Q6CLB8_KLULA/137-438...P..FDNKL.A...-----...LNQLYRGQRALH--------------------------------------------
A0JT79_ARTS2/57-331...P..FNINE.A...-----...IETIQQNALDL.--------------------------------------------
Q2KVZ3_BORA1/13-287.......CWPGDPE..-----.RSYPVIETAVDRIL--------------------------------------------
B2UBQ2_RALPJ/40-316.......GDA......-----...LEDAQSELSGVL--------------------------------------------
Q165U0_ROSDO/35-314...H..TATEK.S...-----...HDNIETGVRAAL--------------------------------------------
B1YHV3_EXIS2/22-286...F..GNAQK.S...-----...LDMIEEYVDSLL--------------------------------------------
Q5WIT9_BACSK/27-306.......VPAD.VD..-----.ETMRRIERFAAEFW--------------------------------------------
A1C610_ASPCL/68-380...P..FDNGL.A...-----...ERQMYEAFLELG--------------------------------------------
Q1AS11_RUBXD/33-307...P..GYIEE.S...-----...YARIEEGLAPLH--------------------------------------------
Q28QX8_JANSC/39-314...P..VDQDE.A...-----...LRDAQAFVAALL--------------------------------------------
A1WGI6_VEREI/22-320VQGY...RHLPEVV..-----.QWNQRVFDAVSAEL--------------------------------------------
A1WER7_VEREI/22-295...P..YNLID.S...-----...IARIERAFDAIV--------------------------------------------
A1T3A2_MYCVP/88-364.......TIPGNLE..-----.KSFDQISQAMAHVV--------------------------------------------
A8LRL4_DINSH/4-296PGEL...HALSETI..-----.TWTRLLSEAA.QAA--------------------------------------------
A5V551_SPHWW/4-298EGHA...RHAAHIA..-----.GWARALDEAAYGLL--------------------------------------------
Q11NZ4_CYTH3/3-310YVQG...KYAKLLS..-----.ELNNNTAKEISAIV--------------------------------------------
Q5V4R8_HALMA/3-300SGRA...KFFRETK..-----.EVCEDVTTAVDATL--------------------------------------------
SPEB_SERP5/33-298...F..GDAQS.M...-----...SDNLQAHAEKLL--------------------------------------------
Q12BY7_POLSJ/72-342...SR.FSLDE.C...-----...HADIEACFNQVV--------------------------------------------
HUTG_VIBF1/45-345.......DGD......-----...LELAQKQLGIKI--------------------------------------------
Q3IVT5_RHOS4/32-308...P..GYEIE.S...-----...LAALERALDAVV--------------------------------------------
HUTG_GEOKA/44-315.......DER......-----...LEQSQTELGKAV--------------------------------------------
SPEB_BLOFL/33-298...S..GNVQD.F...-----...TNILQKHIENLL--------------------------------------------
A0ZFA2_NODSP/30-338...IN.QAGEQ.V...-----...NQWLFTQCQAAM--------------------------------------------
A4XT95_PSEMY/38-311...T..FNLLD.A...-----...VRIIEEAYDEIV--------------------------------------------
Q5WB32_BACSK/22-286...F..GNAAR.S...-----...LDIVEEYVDSLL--------------------------------------------
Q6C6P6_YARLI/9-306IGKM...KRPRYVA..-----.EASRRVYKAVSEAA--------------------------------------------
Q12UU8_METBU/17-282...G..ALVDD.V...-----...LDELYLDVINIV--------------------------------------------
Q213G1_RHOPB/11-309PANA...RQYRQIQ..-----.GWVRALSARAYTLA--------------------------------------------
Q28PV5_JANSC/46-313...Y..AHTAD.V...-----...PERIEAHIAGIL--------------------------------------------
A0QRD0_MYCS2/43-317...P..FNIDE.A...-----...VGQIRDGVTELL--------------------------------------------
ARGI_NEUCR/47-354HRNM...KNPRAVS..-----.NVTKRIAEQVHSHA--------------------------------------------
Q12LW8_SHEDO/33-299...C..GDQED.F...-----...TTRLEAFATRVL--------------------------------------------
Q2W8C1_MAGSA/22-290...L..GDIPR.S...-----...LEMIEQQAAGIG--------------------------------------------
Q6CIB4_KLULA/61-358...P..MDNCL.A...-----...LKMMTAAYENLL--------------------------------------------
A1SLP1_NOCSJ/31-312...P..GDITR.A...-----...LGNLEEAVYAVA--------------------------------------------
Q28VR8_JANSC/34-309...H..TQTEA.S...-----...HANIETGVRAAL--------------------------------------------
Q0UYW2_PHANO/16-320YRGM...KRPKFAS..-----.AVTQSVSAQVYAHA--------------------------------------------
Y309_METJA/21-281...Y..GSQEE.I...-----...FGTIHSVSREIL--------------------------------------------
Q9RZ04_DEIRA/29-298...S..LEPQL.A...-----...HDRITEAARQVR--------------------------------------------
Q6CLS8_KLULA/13-315YGIM...KRPNLVG..-----.EATKLIYESVKKVS--------------------------------------------
A2BIW8_HYPBU/25-300...S..SQPLE.T...-----...LQRIEQVTRELL--------------------------------------------
Q21RM0_ALBFT/15-309VNGF...RHLPQVV..-----.QWNQLLHEALYCEL--------------------------------------------
Q6L151_PICTO/19-280...Y..EDVEY.V...-----...LSEVETVTRTIF--------------------------------------------
Q4P4M4_USTMA/13-318IGNM...KLPRTVS..-----.AVTKEVAEVVESHA--------------------------------------------
A1B165_PARDP/30-308...P..VDPKA.H...-----...SRNAEEAVRKIL--------------------------------------------
Q16AD8_ROSDO/4-296DGRL...YALNETI..-----.AWTRSLKEAA.QVA--------------------------------------------
Q3SMM1_THIDA/8-294.PPQ...AALIAVS..-----.ALNRKLAEKVHGVL--------------------------------------------
Q5AK86_CANAL/12-313DFGV...KNSKIVS..-----.ESCQKIHDAVKGSL--------------------------------------------
Q7VSA1_BORPE/8-302ANGY...RHLNEVI..-----.GWNQLVHDAVSAEL--------------------------------------------
A0BHR2_PARTE/9-311SQQF...RNSQQIG..-----.VINGEINKKSFDIA--------------------------------------------
Q4JAE9_SULAC/24-287...P..SNVEE.N...-----...IKRIKDVVSYFS--------------------------------------------
Q975R8_SULTO/24-287...P..SDVEE.N...-----...IRRISDVTSYFA--------------------------------------------
Q1LGD2_RALME/2-296TDGV...RHLPEVV..-----.AWNRLVMDATYQAL--------------------------------------------
ARGI_AGRT5/19-313NSAV...KNLDALV..-----.GWTRSLSQKALEMA--------------------------------------------
Q1D421_MYXXD/27-337...VN.VLCDQ.M...-----...NEHVYRTTKHWL--------------------------------------------
SPEB1_SCHPO/74-375...S..YDNAV.A...-----...IKQIENGHFELL--------------------------------------------
ARGI_YEAST/13-329GVKA...KRADLVG..-----.EATKLVYNSVSKVV--------------------------------------------
A9BN56_DELAS/71-341...SR.YSLEQ.S...-----...HRDIESIFAKIH--------------------------------------------
Q5A4M3_CANAL/50-340...P..MDNSA.A...-----...YKQMSEAFKDLL--------------------------------------------
A1RBR9_ARTAT/55-335...P..YDITR.A...-----...VREIEEQALPL.--------------------------------------------
A1VTU0_POLNA/3-297VSGY...RHLAEVA..-----.AWNHAVHKEVHAAL--------------------------------------------
Q0UMJ9_PHANO/68-378...P..FDNAL.A...-----...LRQMSEAFLELG--------------------------------------------
A1SM48_NOCSJ/41-314...P..FSIED.G...-----...LEQIEAGVREL.--------------------------------------------
Q1GI45_RUEST/67-333...Y..ANVPA.F...-----...PDTLTDHIRGIL--------------------------------------------
Q1IHQ4_KORVE/16-311PHSA...KYLSEIA..-----.QTCQKHADLVLKAL--------------------------------------------
Q6L2W0_PICTO/21-293...N...FIDY.N...-----...IEKIKDDYYNII--------------------------------------------
Q89H72_BRADU/11-308PEKA...NHYREIQ..-----.RWTRVLSRRGYEIA--------------------------------------------
Q489X2_COLP3/36-310...T..FNLAD.S...-----...IRIIEAHYDTIM--------------------------------------------
Q7V9I4_PROMA/29-293...F..GAPEP.V...-----...IKKVKTASNFIY--------------------------------------------
SPEB1_SYNY3/26-297.KHPA.LAGDA.M...-----...VTEVCDGIAPFV--------------------------------------------
Q6FP31_CANGA/10-317FGII...KRPQLVG..-----.EATELIYKSVTDVL--------------------------------------------
A5G414_GEOUR/41-319.......NPND.EL..-----.ATMKNVYETMGKVY--------------------------------------------
Q3SVS2_NITWN/5-302PAKA...NNYRDIQ..-----.TWIRALSPRAYDLA--------------------------------------------
SPEB2_SCHPO/89-401...S..YDNQL.A...-----...VRQMTEGYIDLL--------------------------------------------
Q8XPR0_RALSO/29-309...L..AQPPGEH...-----...YARAEAAVRRLA--------------------------------------------
Q47TW8_THEFY/41-314...P..FAIKE.A...-----...IATVEASASEL.--------------------------------------------
A9KQ98_CLOPH/18-281...F..GDPVR.P...-----...LSLIEEFTANVL--------------------------------------------
A1BCD2_PARDP/35-312...P..IDLMA.A...-----...LRQIEDGIAQVC--------------------------------------------
ARGI_ASHGO/93-395VGRA...KNPTLVG..-----.EATHLIHDAVRAAA--------------------------------------------
A1B3P5_PARDP/3-295NPAV...HHLPEII..-----.AWTEALRASG.CSA--------------------------------------------
Q1QTM4_CHRSD/39-312...T..FDLKK.S...-----...IGIIENFYHELL--------------------------------------------
Q6C732_YARLI/86-381...P..LDNRY.A...-----...LNQLYRGMRAIH--------------------------------------------
A0LDK6_MAGSM/20-293...N..LNPEQ.V...-----...VQRIYATTLPHL--------------------------------------------
Q47D78_DECAR/17-302TTAR........IA..-----.ELCRHLADEVALTL--------------------------------------------
Q3JAG2_NITOC/2-290.QDD...NAVMAVQ..-----.ALSVELSQVAGNVV--------------------------------------------
A3DDA1_CLOTH/24-286...F..GDVDK.S...-----...LKLIGDVAEEIL--------------------------------------------
A1CKP4_ASPCL/16-320HRGM...KKPRGVS..-----.IATETISKQVYEHA--------------------------------------------
ARGI1_SCHPO/22-319QALM...KNPLYVS..-----.NVTRQVRNIVQQEL--------------------------------------------
HUTG_PHOLL/44-316.......PNQ......-----...LSEAQQALSDAV--------------------------------------------
Q3IQJ3_NATPD/45-332....P.MDRER.T...-----...ADSIAAHVATVT--------------------------------------------
SPEB2_SYNY3/83-361.......TIPANNE..-----.KSFDQISKGIAHIF--------------------------------------------
Q5LKZ4_RUEPO/42-315...P..IDIMD.C...-----...MDRISRFYAGLK--------------------------------------------
Q2RHH4_MOOTA/26-287...P..GRVEA.S...-----...LERMEAAADAIF--------------------------------------------
Q17HI3_AEDAE/32-333ATNM...KQLEHVA..-----.SCTKLLSQRVTRVL--------------------------------------------
A3CU48_METMJ/19-276...S..RLPEE.V...-----...AGQVADVAGDIV--------------------------------------------
HUTG_HAHCH/40-316.......EGE......-----...LEDAQAALATKV--------------------------------------------
Q8RA93_THETN/28-290...Y..GNIEK.S...-----...LRLIEEVAEKIV--------------------------------------------
Q8END5_OCEIH/29-310.......VPAD.SP..-----.ETMRRIEQFAKEVW--------------------------------------------
Q5ANN8_CANAL/115-414...P..FDNRI.A...-----...LNQLYRGHRSIS--------------------------------------------
Q2LPR8_SYNAS/65-343.......DPNS.PE..-----.KTMNNIYSSMDRIY--------------------------------------------
A1ST87_PSYIN/33-299...T..GDANA.F...-----...TQKVTAAATQLL--------------------------------------------
ARGI1_ARATH/63-338.IRDCGVDDDR.L...-----...MNVISESVKLVM--------------------------------------------
A0R0G1_MYCS2/40-312...P..FDIGQ.A...-----...VDQVTAELTAL.--------------------------------------------
A1CFK4_ASPCL/83-374...W..LDNTV.A...-----...LKQLDLAHKVIS--------------------------------------------
B8I5M8_CLOCE/21-282...F..GSPNK.A...-----...LHMISETSGFIF--------------------------------------------
A1TIE4_ACIAC/8-305AEGL...RNLAECE..-----.AWNRSTHDAVFGQL--------------------------------------------
A1T9H7_MYCVP/46-324...H..GQTEV.S...-----...HRNIRERVHAVA--------------------------------------------
Q97VA3_SULSO/30-299...P..GYIED.T...-----...MNAIQTSLYEII--------------------------------------------
Q4J720_SULAC/30-299...P..GYIED.T...-----...IKIIEKDVYDII--------------------------------------------
Q3J2B4_RHOS4/46-312...Y..ARTAE.F...-----...PARLTAHVAGIL--------------------------------------------
A1CGK0_ASPCL/61-357...P..FDAAH.A...-----...FKQMEQGYRQVL--------------------------------------------
Q10Y47_TRIEI/24-296.NGKK.ITPLD.M...-----...LKVTQETVEKLV--------------------------------------------
A5G278_ACICJ/28-297...L..GDLPG.S...-----...LALIEAQAAQIG--------------------------------------------
ARGI_SOYBN/71-346.MRDCGIGDER.L...-----...MKVVSDSVKLVM--------------------------------------------
O76895_DROME/30-333YHHI...RNYADFM..-----.ACNRALIEQVKLML--------------------------------------------
A1W2M6_ACISJ/2-298ASGF...RHLAEVA..-----.AWNRAVYEATHAAL--------------------------------------------
A8GC83_SERP5/32-305...P..YSLED.S...-----...VRRIELAYNGIL--------------------------------------------
Q1GHG8_RUEST/4-296TGKL...HEPNLTR..-----.AWTESLSEAA.EAA--------------------------------------------
Q65P52_BACLD/4-300SEEL...RNLKAIT..-----.KASVKLAETVDNIV--------------------------------------------
Q67TJ0_SYMTH/28-290...F..GDVQE.S...-----...LRRAEEVARRLF--------------------------------------------
A4XZN2_PSEMY/43-309...H..GTPQH.T...-----...PAAIEAHATRIL--------------------------------------------
A4YE21_METS5/29-295...P..GHIED.T...-----...MKRIEEVLVGRM--------------------------------------------
Q6ANF4_DESPS/59-334...P..GHLDE.S...-----...FERIEEGMSALL--------------------------------------------
Q222F3_ALBFT/24-298...NA.SPLAD.V...-----...RQQIQAQAA.AL--------------------------------------------
ARGI2_MOUSE/24-324NNLV...VYPRSVG..-----.LANQELAEVVSRAV--------------------------------------------
Q315M1_DESAG/23-287...CD.AETAE.V...-----...LMRIEASVQAAL--------------------------------------------
A7IL28_XANP2/50-316...Y..GLPAG.I...-----...PAAIAAQARAHY--------------------------------------------
Q18A84_PEPD6/21-285...V..GSTEQ.V...-----...LKEIYQETYKIV--------------------------------------------
Q5V6R7_HALMA/44-335...P..GDTRQ.S...-----...QLNIEDAVYEIS--------------------------------------------
Q5LRK8_RUEPO/33-325DTHL...HQPNRTI..-----.GWTNRLIRAA.EQA--------------------------------------------
Q9K8M2_BACHD/4-296KTNL...KNLGEVI..-----.KANELLCLHVEKAV--------------------------------------------
Q3ABP1_CARHZ/20-281...L..GRIEE.S...-----...FTSIRTVTKKVL--------------------------------------------
A9CJC2_AGRT5/42-307...Y..GNHWK.T...-----...PDTIEKEARRII--------------------------------------------
Q7U3K9_SYNPX/21-280...F..GAPEP.V...-----...VNAVQQATTAVL--------------------------------------------
A1STQ5_PSYIN/47-343.......QKN......-----...LEESQKALAKKV--------------------------------------------
Q7VY32_BORPE/13-287.......CVPGDPQ..-----.ASYPAIEQAVAQVL--------------------------------------------
Q9CL61_PASMU/34-299...F..GDNQN.F...-----...VEELEAHATALL--------------------------------------------
A4IB49_LEIIN/14-315...V...KRPR.LTA.-----.ECTEKIYKCVRRVA--------------------------------------------
A5UXL8_ROSS1/34-305...P..GFIHE.S...-----...HAAITATLRPLA--------------------------------------------
A9WCM8_CHLAA/41-307...G...DLET.I...-----...HARQQALVARII--------------------------------------------
B2FJ13_STRMK/7-298VEGY...RHLDEVV..-----.AWNHALMEASYAEL--------------------------------------------
B4EIP8_BURCJ/49-320...P..YNLHD.S...-----...IARIEAAYDAIL--------------------------------------------
B4ELX2_BURCJ/44-308...A...HNPLSI...-----...KPAIVEHTRAIL--------------------------------------------
B5GLC8_STRC2/31-301...P..FDMNI.A...-----...IDTAQSHLSGLL--------------------------------------------
B9A9C6_BOMMO/12-304VNNM...NH...LPLV-----SACNKNLSERVSHVL--------------------------------------------
C0ZIM2_BREBN/4-293HKYL...DE...VV..-----.EANEKLANVVSDIM--------------------------------------------
D0J7J2_COMT2/7-302LRNL........AEC.-----LSWNRIAHDAVLQVL--------------------------------------------
D5AV62_RHOCB/6-296VHHL...AE...TR..-----.AWIALLAARAEAAA--------------------------------------------
D5SKW9_STRC2/134-404...P...FSMDLA...-----...MDTATVALTRLL--------------------------------------------
E3GWR7_METFV/23-279...L..GDFKN.T...-----...CRNISEKVQEVL--------------------------------------------
E9CYX8_COCPS/18-317MKKP...RT...VS..-----.AATQQLSRQVYEHA--------------------------------------------
F1QJZ3_DANRE/86-357...L..FDLKD.T...-----...CKKIQEAYRKIV--------------------------------------------
F6SZP1_XENTR/61-332...L..YDLKD.S...-----...CRRIRETYQKIM--------------------------------------------
I9NPV5_COCIM/78-370...F..LDNTI.A...-----...LKQLDKAHKVVS--------------------------------------------
K5X448_AGABU/13-305.IGI..MKNPR.TVS.-----.QVNRSVAGVVMNHA--------------------------------------------
SPEB_NEIMB/35-299...F..GDSRD.F...-----...VEKMEAHAGKLL--------------------------------------------
Q05AR1_XENTR/27-324NSIV...KHPRTVG..-----.LACKVLAEEVSKAV--------------------------------------------
Q24ZK6_DESHY/5-295KYLP...EISE.V...-----...NQKLYPLVAQAI--------------------------------------------
Q251M0_DESHY/26-286...F..GNVEK.S...-----...LQVIEAAARQVV--------------------------------------------
Q2FW91_STAA8/6-296LRNY.....DE.II..-----.DVNQKLNKEVSASI--------------------------------------------
Q2K3I8_RHIEC/7-299...PK.AHNLR.IVG.-----.AFTRALESSVHDVA--------------------------------------------
Q2K9W6_RHIEC/65-328...Y..GNHQD.T...-----...PGAIERQANAIL--------------------------------------------
Q3IKA3_PSEHT/33-297...V..GDAEY.F...-----...TAQLEQAASKIL--------------------------------------------
Q46IA1_PROMT/31-292...L..GDAEL.T...-----...LDYISDATNILL--------------------------------------------
Q4FL05_PELUB/40-312...P..FNIDE.A...-----...IKQIEEGATELL--------------------------------------------
Q5KIC1_CRYNJ/70-373...P..FDPAT.A...-----...VKQINSAYRSLL--------------------------------------------
Q5L3P6_GEOKA/3-294DSRL...RNLKAVA..-----.EANEKLATAVDQVV--------------------------------------------
HUTG_LEGPH/47-315...N...DELELS...-----...QSQFAQIVHFCH--------------------------------------------
Q6LHE2_PHOPR/35-321.......DGLE.F...-----...NELQALQYQKIV--------------------------------------------
Q6LWW9_METMP/19-277.......GNQSEI...-----...INRAYSASKDIL--------------------------------------------
Q6N0N3_RHOPA/14-309PANA...NY...YSEV-----RSWVGAISARAYELA--------------------------------------------
Q6PH54_DANRE/25-322VPFP...RTVGRA...-----...NQLLSGAVSGAV--------------------------------------------
Q72EZ7_DESVH/23-282...G...DAEA.V...-----...LDRISRATRSVL--------------------------------------------
Q7T151_DANRE/27-322LKTP......RAVG..-----.RANELLSGAVQKIK--------------------------------------------
Q7V3X2_PROMM/30-287...C..GDPKP.V...-----...VEAVKKATQNVL--------------------------------------------
SPEB_BACAN/23-284...F...GNAQRS...-----...LDMIEEYVSKLL--------------------------------------------
Q81VP0_BACAN/4-292LRNL..TQ....VA..-----.TVCNELASKVDHII--------------------------------------------
Q81Y48_BACAN/37-311...V..TDIKE.S...-----...HNRIAKTVGHVT--------------------------------------------
Q82VE5_NITEU/46-310...V...HNPLTI...-----...HGAIVDHARHIL--------------------------------------------
HUTG_VIBPA/47-325.........DD.L...-----...LEESQSRCANLI--------------------------------------------
Q88KU3_PSEPK/34-298...S...GTPQSV...-----...PDSIEAHAEHIL--------------------------------------------
Q8RG18_FUSNN/503-779...F...KNTV.LD..-----..TCEKIAKRVNEAV--------------------------------------------
Q8TJ04_METAC/18-281...A...SVDE.T...-----...LRDLYEDVKGLL--------------------------------------------
Q8XMY7_CLOPE/21-278...F..GNSEG.A...-----...LALIEDFSTKVV--------------------------------------------
Q92LN4_RHIME/3-295HPGA...NNLQSVA..-----.AFARALDEAVHDTA--------------------------------------------
Q92MV8_RHIME/71-339...S..RYRLE.I...-----..SHEDIEKRISQIV--------------------------------------------
Q92QR6_RHIME/44-306...Y..GNHAR.T...-----...PQTIEREASKIL--------------------------------------------
GPUA_PSEAE/36-307...P..IDLLD.S...-----...LRRIEGFYRQVH--------------------------------------------
Q9KLD2_VIBCH/33-297...C..GDAED.F...-----...TYRLEAATSEIL--------------------------------------------
HUTG_VIBCH/44-322.......GDE......-----...LEQAQQECAQVI--------------------------------------------
U5L6E1_9BACI/3-293DTNL...RNLE.LIA.-----.DKTGQLAEKVDEVI--------------------------------------------
U5LEA0_9BACI/39-314...T..TDIPL.S...-----...HSRIQETACSLA--------------------------------------------
W6RQZ8_9RHIZ/120-388...SR.FGLAE.C...-----...HADIEACYRMIA--------------------------------------------

PF00850

A0DIS2_PARTE/29-344------YLCKTSAVTA.....RKCVQAVLEGVDKIL.....KA.....................................
A0LGT0_SYNFM/15-314------QMCRESYETA.....LLAVGGLLEAVRMVM.....EG.....................................
A1W7T1_ACISJ/25-356------PLAAGTWTAA.....KAGADAAASAAARLA.....AG.....................................
A2BL29_HYPBU/15-315------YVGKYTILAA.....HAYTASVLDAVDKLV.....EG.....................................
A3DNS7_STAMF/16-313------YFSETSYELA.....LETFDLSYNTGLSIG.....EQ.....................................
A3GH68_PICST/21-341------YIFPFIGEYV.....RAVGGSSIASAKTLIREASSSI.....................................
A4S2N1_OSTLU/197-606------FFSPGTLQAA.....LRAAGGVIHAVDRVL............................................
A4S898_OSTLU/22-313------..SDALVERT.....LMEVSGTMLTVDLAM............................................
A4X4X7_SALTO/10-318------PVFPRMHEAS.....ALVTGATVAAAEAVW.....RG.....................................
A4YNH4_BRASO/45-371------PIGPGTWAGA.....CAATDVAASAAQLLL.....DG.....................................
A6QAF4_SULNB/14-302------ICSEHSYEAA.....RKAVGAGIVAVDGIK.....KG.....................................
A6R4B6_AJECN/49-360------PVFDGLYNYC.....SHYAGGTLDAARKLC.....NN.....................................
A6VSZ5_MARMS/14-305------LMMPHTLDAA.....LYAAGSVIKAVDLVM.....TS.....................................
A7SSG8_NEMVE/23-333------YMSKDVYDCA.....LLSCGCTLAAVEHVA.....TN.....................................
A7SUP8_NEMVE/23-330------PPFEDMYDCV.....SMIAGATLLAADMLK.....TG.....................................
A7TRW5_VANPO/9-404------PLFSFLPLYC.....EVISGASLMLSDFIEK...SSS.....................................
A8ABS4_IGNH4/14-309------YASPTSWEPA.....LYAAGTVAYAAQRAV.....EG.....................................
A8ZT95_DESOH/16-310------PVSGHSYLAA.....WLAAGACMQGVDLLL.....SG.....................................
A9A062_DESOH/259-573------PLNRSAYAAA.....RHAVDCVLTGADDLL.....EG.....................................
A9B5I1_HERA2/14-309------YILPDSVEIA.....QLAAGGAIVATDAVL.....SG.....................................
B0T7F0_CAUSK/32-328------PVPYGAFEIA.....SLAAGGAIAAVDAVM.....SG.....................................
B2JV93_BURP8/15-309------VMSPGSWEAV.....MRCVGAACAGVDAVL.....AG.....................................
B4U8T2_HYDS0/14-304------YAYQHSYDAA.....MMVAGAILKAIEDIK.....DA.....................................
C5KDG6_PERM5/340-870------CMDPYTLKAA.....LLRCGMMRDALVAVL.....SG.....................................
E0TF48_PARBH/5-292------..SPHIHRRG.....QRTVGGALAAARRAL............................................
E2RU63_GIAIC/11-320------PVFSGLYDYC.....SMTVGASVNACAHLN.....HG.....................................
F2G2X2_ALTMD/14-319------GLMRHSLTAA.....LESAGAGCNAVDWVM.....DG.....................................
O67135_AQUAE/10-314------PVSYAMFTGS.....SLATGSTVQAIEEFL.....KG.....................................
HDA1_YEAST/69-395------YFNNDSYASA.....RLPCGGAIEACKAVV.....EG.....................................
Q00U49_OSTTA/445-741------..GEQNVTRS.....LASTGGTVACAREVL....AGF.....................................
Q02CA3_SOLUE/14-311------DITPNSWDVA.....VRASGGVLNAVDAVL.....TG.....................................
Q0A6Z7_ALKEH/46-336------AVCPGSVDAA.....EVAAGTAIAAVEAVV.....QG.....................................
Q0ARF0_MARMM/14-308------LVCDRSAAAA.....LGAVGAAVAAVNQVIA...DEG.....................................
Q15WQ0_PSEA6/14-301------..SEQLIARS.....LTAVGGTVLTSSLAL............................................
Q1CZX8_MYXXD/21-314------QVSPDSVDAA.....RLAAGASVQAVEAVM.....KG.....................................
HDA6_CAEEL/438-748------YLTRDTLKVA.....RKAVGAVLQSVDEIF.....EK.....................................
Q29CG7_DROPS/25-326------..PNKYLQQAYLRPMRFQAAGSILAGKLAL............................................
Q2FQW8_METHJ/14-311------YVPKGLIHDA.....LLAAGGAITGADAVL.....NQ.....................................
Q2IF50_ANADE/16-319------PVSAGSWRAA.....VAAAGAAIEAAERVA.....RG.....................................
Q2KBQ8_RHIEC/14-309------YASVKSLQAA.....LTGIGGAMAAVDDVF.....SG.....................................
Q2LVD3_SYNAS/15-311------DTSPGSYKAA.....LLAAGGLCEAISMVA.....SG.....................................
Q2R9B1_ORYSJ/26-342------PAFDRLWKYC.....RGYAGGSFAAARALV.....DG.....................................
Q2S035_SALRD/7-313------PVFENMDAAA.....RGLVGGTLHGARLIG.....DG.....................................
Q2SC27_HAHCH/8-315------..PSSLLQKGLLTPAKYAVAGTITAAHKAI......E.....................................
Q30PJ4_SULDN/258-572------PLNANAYKAA.....RGAVDCAVTAADAVI.....NG.....................................
Q31EP6_THICR/49-347------YLNASSFDAA.....KMAAGSNINLNLAIY.....DR.....................................
Q31HC2_THICR/13-304------SLSPGSLESA.....LAASGAMLTAIDAIM.....HR.....................................
Q38C74_TRYB2/21-323------PPVEGIVEYS.....LSTVSGSLMAAVLLN.....SG.....................................
Q39UV4_GEOMG/11-315------PVFKGFYDWA.....ILGVGGTMEAARLVT.....EE.....................................
Q3AFN8_CARHZ/10-319------PVFSGMHEAA.....ALVAGGSALGAELIY.....EG.....................................
Q4D762_TRYCC/47-388------MPFVGMWRTI.....QATVSGTLLAARLLA.....QP.....................................
Q4FNF7_PELUB/14-306------IVSPGSKDAT.....LDAVGSIITAIDGVQ.....NK.....................................
Q4KAJ1_PSEF5/12-340------PITATTWDAV.....RTSADIALTALALID.....EG.....................................
Q4MYQ3_THEPA/25-416------YMTPKSELVA.....NLAVGSLVELCNLIM.....KSTLSDTKTETQTVKTEPNSNPNSSQHTEQYLSQNPDGK
Q4P2D6_USTMA/326-751------GMDGGSAEAI.....RHAMGACCEAVDRVVSAAASTTMASPTLSPLREIKVQDS....................
Q4QAJ4_LEIMA/91-404------PLFPEVWALV.....SSQAGASLACAEALV.....RG.....................................
Q4QI60_LEIMA/58-432------CNEGTSSVAV.....RLSAGAVIDASVAAL.....RGVAAS.................................
HDA21_DICDI/1072-1486------FVSKLSLHAA.....KRSAGATCQAIDNVM.....KG.....................................
Q59Q78_CANAL/56-379------YPFPSLDLYV.....QLTAASSINAARKIVQQVKETK.....................................
Q5AF34_CANAL/175-593------YLTPKTINAI.....EGVIGTIESAVDSLF.....SKR....................................
Q5K8L3_CRYNJ/64-492------PVFPTLASYI.....SHVTAATSTACRLLA.....TD.....................................
Q5KKR8_CRYNJ/28-368------PAVEGIFEFS.....SISAGGSIGAAEKLN.....EG.....................................
Q60DG7_ORYSJ/34-350------FLNPGSWGAA.....LLAAGTTLSAMKHIL.....DG.....................................
Q6AJC0_DESPS/18-318------QIGYHTYQVA.....ALAAGAGLKGIDLLE.....AG.....................................
Q6AKN4_DESPS/15-311------YLMQQSLATA.....QLAAGGCLEIADQIM.....NG.....................................
Q6C3Y5_YARLI/54-352------PIFPGLDAYV.....KLVAGSTLSCARQLM.....SG.....................................
Q6CGA7_YARLI/254-648------YLSPETLTAL.....KGVVGAVERGVDALY.....DSDVSETLQKLS...........................
Q6FWB7_CANGA/8-383------PIFPYLPLYC.....YVSTGATLSLAQYIL....EGS.....................................
Q741C0_MYCPA/14-307------MMEPSTWETA.....LRGVGATLQAVDRVL.....AG.....................................
Q7PS30_ANOGA/118-424------FIHPTSYETS.....VLAVGSTIQLVESVW.....SG.....................................
Q8EP92_OCEIH/11-321------PAFFQMHEAA.....SYLVGGTLAAVDAVL.....NN.....................................
Q8I4I9_CAEEL/17-318------WTCENTNEAA.....RVAIGGSIELVKAAM.....EG.....................................
Q8IR37_DROME/555-861------YLHPRTFDCA.....TLAAGLVLQAVDSVL.....RG.....................................
HDA14_ARATH/75-387------YATSTTFQDS.....LIAAGAGMALVDSVI.....AA.....................................
Q9K0J2_NEIMB/35-328------AISTGSLSAA.....RFAAGSAVQAVDMVM.....NR.....................................
Q9U266_CAEEL/18-319------YVNSATWHRA.....KLAAGASIDLMTSVM.....AA.....................................
F5GX36_HUMAN/250-576------WNEVHSAGAA.....RLAVGCVVELVFKVA.....TG.....................................
F6Q3W9_MOUSE/101-401------YLHPNSYSCA.....CLATGSVLRLVDALM.....GA.....................................
G4VAN3_SCHMA/13-356------PGFPSVFDYS.....LAAVQGSLAAASALI.....CR.....................................
K3ZRV5_SETIT/229-519------YANGHSACAA.....KLAAGLCADLASLIV.....SG.....................................
Q22CW6_TETTS/24-319------YYNKYTGQSA.....FLSSGAVIQSIDLIK.....SK.....................................
Q2G292_STAA8/18-322------GQFKHMHRHS.....ATIVGGALTLADLIM.....SG.....................................
Q8F7M9_LEPIN/19-309------PFTEKSWISA.....YSAANSGIILSEFLI.....SG.....................................
V6EZA3_9PROT/18-307------ILSYQSGDAA.....LRSAGAGCAAVDAVA.....TK.....................................
W7X9B2_TETTS/36-342------YFNQSSKDAA.....YLGVGGVIESVDRII.....SK.....................................

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------------------------------------------
C2XKX5_BACCE/12-239--------------------------------------------------------------------------------
B9BUU1_9BURK/13-199--------------------------------------------------------------------------------
B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C2SK71_BACCE/15-171--------------------------------------------------------------------------------
C3Q562_9BACE/31-198--------------------------------------------------------------------------------
D7W5E5_9FLAO/27-172--------------------------------------------------------------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UPR5_METVS/56-208--------------------------------------------------------------------------------
A9AA45_METM6/55-201--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------
A0A031WF12_PEPDI/78-183--------------------------------------------------------------------------------
B6G251_9FIRM/77-182--------------------------------------------------------------------------------
B0A6K5_9FIRM/76-181--------------------------------------------------------------------------------
C0CJH7_9FIRM/6-165--------------------------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387-------------------------A..RKPSSFTDH....DGFAKNDTVLP-----RV.....................
Q6BJQ5_DEBHA/76-370-------------------------A..RRNSK............NSTVTPP-----RY.....................
Q6BVQ4_DEBHA/136-428-------------------------K..T.....................KP-----TTPSLS.............KVSR
Q6BWL4_DEBHA/179-480-------------------------K..HTS.................GNKP-----KI.....................
A1RXI5_THEPD/26-288-------------------------S..S.....................GK-----GL.....................
SPEB_MOUSE/77-350-------------------------A..A.....................GC-----IP.....................
A4XKN0_CALS8/20-281-------------------------G..D.....................DK-----TP.....................
A4J1T2_DESRM/21-282-------------------------Q..D.....................DK-----FP.....................
A1VQK9_POLNA/34-307-------------------------D..S.....................GC-----IP.....................
Q2K8A9_RHIEC/46-316-------------------------G..A.....................GV-----VP.....................
B2JW15_BURP8/32-305-------------------------R..A.....................GK-----LA.....................
Q982X2_RHILO/42-307-------------------------K..S.....................GA-----FL.....................
HUTG_BACHD/35-311-------------------------E..N.....................EQ-----NWQ....................
HUTG_RHOSR/40-314-------------------------A..ATL.................DAGQ-----FP.....................
ARGI1_HUMAN/6-305-------------------------K..N.....................GR-----IS.....................
SPEB_CHRVO/44-311-------------------------A..S.....................GA-----KM.....................
ARGI_BACSU/3-292-------------------------E..E.....................KK-----FP.....................
Q97ZX8_SULSO/24-289-------------------------E..S.....................GK-----IT.....................
HUTG_VIBVY/45-328-------------------------A..EVL.................PCVP-----.V.....................
A9BRG6_DELAS/16-312-------------------------D..D.....................GE-----LP.....................
HUTG_AROAE/40-323-------------------------T..ALL.................EAGH-----VP.....................
A1RB53_ARTAT/29-311-------------------------D..S.....................RS-----VP.....................
Q1J2W9_DEIGD/37-306-------------------------K..R.....................AR-----LP.....................
Q2JER0_FRASC/40-318-------------------------G..L.....................GT-----IP.....................
Q3J346_RHOS4/3-296-------------------------L..G.....................DG-----FP.....................
A9B324_HERA2/22-290-------------------------R..L.....................GK-----LV.....................
Q9YBG0_AERPE/29-298-------------------------R..E.....................GK-----VP.....................
Q1GI44_RUEST/34-307-------------------------G..S.....................GV-----LP.....................
Q9HJB2_THEAC/33-293-------------------------S..D.....................GK-----IP.....................
A0RXD6_CENSY/22-283-------------------------G..G.....................GR-----QV.....................
A8LLU9_DINSH/46-312-------------------------A..A.....................GA-----AP.....................
SPEB_BACHD/22-286-------------------------A..D.....................QK-----MP.....................
Q0W940_UNCMA/16-280-------------------------D..A.....................GK-----IP.....................
Q6MHV0_BDEBA/36-309-------------------------S..H.....................NK-----RF.....................
Q98MW3_RHILO/19-296-------------------------A..L.....................PA-----VP.....................
A0LG67_SYNFM/34-297-------------------------R..S.....................GK-----LP.....................
HUTG_BACSU/35-311-------------------------S..D.....................HP-----DWV....................
Q9K5Y7_BACHD/5-297-------------------------A..E.....................HS-----FP.....................
Q164F4_ROSDO/46-312-------------------------A..A.....................DV-----PT.....................
Q164F5_ROSDO/34-308-------------------------N..Y.....................DA-----MP.....................
Q15X44_PSEA6/42-323-------------------------S..KAL.................KQNC-----FV.....................
Q11J67_CHESB/42-307-------------------------E..S.....................GA-----FL.....................
Q1AWJ4_RUBXD/5-295-------------------------A..R.....................GA-----LP.....................
Q5WL42_BACSK/7-290-------------------------A..D.....................HA-----FP.....................
Q7UZH9_PROMP/24-288-------------------------S..S.....................KL-----TP.....................
Q6CLB8_KLULA/137-438-------------------------N..H......................S-----SLVHKE.............QPPK
A0JT79_ARTS2/57-331-------------------------...T.....................AG-----GSK....................
Q2KVZ3_BORA1/13-287-------------------------E..A.....................GA-----IP.....................
B2UBQ2_RALPJ/40-316-------------------------H..DLL.................DRGA-----FP.....................
Q165U0_ROSDO/35-314-------------------------R..A.....................GA-----LP.....................
B1YHV3_EXIS2/22-286-------------------------T..A.....................GK-----FP.....................
Q5WIT9_BACSK/27-306-------------------------K..K.....................GT-----FL.....................
A1C610_ASPCL/68-380-------------------------V..R.....................PA-----ATPADSRYGTK....GISAGRAK
Q1AS11_RUBXD/33-307-------------------------E..A.....................GV-----FP.....................
Q28QX8_JANSC/39-314-------------------------G..Q.....................DI-----RP.....................
A1WGI6_VEREI/22-320-------------------------R..L.....................GH-----LP.....................
A1WER7_VEREI/22-295-------------------------A..A.....................GC-----RP.....................
A1T3A2_MYCVP/88-364-------------------------Q..K.....................GV-----MP.....................
A8LRL4_DINSH/4-296-------------------------I..G.....................QG-----FP.....................
A5V551_SPHWW/4-298-------------------------K..D.....................GR-----LP.....................
Q11NZ4_CYTH3/3-310-------------------------K..K......................Q-----YP.....................
Q5V4R8_HALMA/3-300-------------------------R..E.....................GR-----FP.....................
SPEB_SERP5/33-298-------------------------A..A.....................GK-----RM.....................
Q12BY7_POLSJ/72-342-------------------------N..A.....................GV-----IP.....................
HUTG_VIBF1/45-345-------------------------K..SAL.................ANRH-----QV.....................
Q3IVT5_RHOS4/32-308-------------------------E..A.....................GA-----VP.....................
HUTG_GEOKA/44-315-------------------------A..RLL.................KNGM-----AS.....................
SPEB_BLOFL/33-298-------------------------R..F.....................RK-----KI.....................
A0ZFA2_NODSP/30-338-------------------------N..Q.....................GK-----RV.....................
A4XT95_PSEMY/38-311-------------------------E..Y.....................GI-----KP.....................
Q5WB32_BACSK/22-286-------------------------A..D.....................GK-----FP.....................
Q6C6P6_YARLI/9-306-------------------------V..S.....................GR-----FV.....................
Q12UU8_METBU/17-282-------------------------D..D.....................GK-----LP.....................
Q213G1_RHOPB/11-309-------------------------Q..S.....................GA-----IP.....................
Q28PV5_JANSC/46-313-------------------------G..A.....................GA-----AV.....................
A0QRD0_MYCS2/43-317-------------------------D..R.....................PD-----QR.....................
ARGI_NEUCR/47-354-------------------------K..E.....................GR-----LV.....................
Q12LW8_SHEDO/33-299-------------------------D..A.....................DK-----GL.....................
Q2W8C1_MAGSA/22-290-------------------------H..L.......................-----.......................
Q6CIB4_KLULA/61-358-------------------------S..H.....................ES-----QTSDNN.............LPPR
A1SLP1_NOCSJ/31-312-------------------------R..S.....................GA-----VP.....................
Q28VR8_JANSC/34-309-------------------------A..A.....................GA-----IP.....................
Q0UYW2_PHANO/16-320-------------------------V..S.....................GK-----MV.....................
Y309_METJA/21-281-------------------------K..E.....................NK-----KI.....................
Q9RZ04_DEIRA/29-298-------------------------G..R.....................CR-----VP.....................
Q6CLS8_KLULA/13-315-------------------------N..E.....................GR-----LA.....................
A2BIW8_HYPBU/25-300-------------------------ENMQ.....................DK-----LL.....................
Q21RM0_ALBFT/15-309-------------------------Q..A.....................RR-----LP.....................
Q6L151_PICTO/19-280-------------------------N..D.....................KK-----VP.....................
Q4P4M4_USTMA/13-318-------------------------K..Q.....................GK-----LP.....................
A1B165_PARDP/30-308-------------------------A..A.....................GA-----LP.....................
Q16AD8_ROSDO/4-296-------------------------M..A.....................DG-----FP.....................
Q3SMM1_THIDA/8-294-------------------------D..E.....................GN-----FP.....................
Q5AK86_CANAL/12-313-------------------------A..E.....................GK-----LP.....................
Q7VSA1_BORPE/8-302-------------------------R..Q.....................ER-----LP.....................
A0BHR2_PARTE/9-311-------------------------K..Q.....................NK-----FM.....................
Q4JAE9_SULAC/24-287-------------------------E..K.....................GK-----IV.....................
Q975R8_SULTO/24-287-------------------------E..K.....................GK-----II.....................
Q1LGD2_RALME/2-296-------------------------A..T.....................GQ-----LP.....................
ARGI_AGRT5/19-313-------------------------R..S.....................CD-----LP.....................
Q1D421_MYXXD/27-337-------------------------D..Q.....................GK-----RV.....................
SPEB1_SCHPO/74-375-------------------------T..R.....................KP-----TSYSEKDGYA.....LDGSVLPR
ARGI_YEAST/13-329-------------------------Q..A.....................NR-----FP.....................
A9BN56_DELAS/71-341-------------------------A..A.....................GV-----IP.....................
Q5A4M3_CANAL/50-340-------------------------N..R.....................KS-----SNNTEI..............PPR
A1RBR9_ARTAT/55-335-------------------------...I.....................SG-----GNGLSE..............DKR
A1VTU0_POLNA/3-297-------------------------S..E.....................GE-----MP.....................
Q0UMJ9_PHANO/68-378-------------------------K..R.....................A.-----.PTEKSADSG.....VGYFKRPK
A1SM48_NOCSJ/41-314-------------------------...S.....................AD-----GRN....................
Q1GI45_RUEST/67-333-------------------------A..T.....................DT-----AS.....................
Q1IHQ4_KORVE/16-311-------------------------E..E.....................GR-----VP.....................
Q6L2W0_PICTO/21-293-------------------------KKYN......................S-----RF.....................
Q89H72_BRADU/11-308-------------------------K..T.....................GA-----LP.....................
Q489X2_COLP3/36-310-------------------------A..S.....................NI-----KP.....................
Q7V9I4_PROMA/29-293-------------------------S..L.....................GM-----KP.....................
SPEB1_SYNY3/26-297-------------------------E..D.....................GK-----FV.....................
Q6FP31_CANGA/10-317-------------------------S..R.....................DR-----FP.....................
A5G414_GEOUR/41-319-------------------------E..N.....................HS-----IP.....................
Q3SVS2_NITWN/5-302-------------------------R..S.....................GA-----IP.....................
SPEB2_SCHPO/89-401-------------------------S..R.....................KA-----TASPASNNLKTAGLAKDGIFHPR
Q8XPR0_RALSO/29-309-------------------------N..A.....................GA-----LP.....................
Q47TW8_THEFY/41-314-------------------------...L.....................SQ-----GTR....................
A9KQ98_CLOPH/18-281-------------------------K..D.....................GK-----FP.....................
A1BCD2_PARDP/35-312-------------------------A..K.....................GA-----LP.....................
ARGI_ASHGO/93-395-------------------------H..A.....................GR-----LP.....................
A1B3P5_PARDP/3-295-------------------------M..E.....................EG-----MP.....................
Q1QTM4_CHRSD/39-312-------------------------S..H.....................DA-----VP.....................
Q6C732_YARLI/86-381-------------------------N..H.....................TT-----STLNAT.............HIPR
A0LDK6_MAGSM/20-293-------------------------Q..A.....................GR-----MV.....................
Q47D78_DECAR/17-302-------------------------R..A.....................DE-----FP.....................
Q3JAG2_NITOC/2-290-------------------------A..R.....................GE-----PF.....................
A3DDA1_CLOTH/24-286-------------------------S..D.....................NK-----FP.....................
A1CKP4_ASPCL/16-320-------------------------K..D.....................GK-----FV.....................
ARGI1_SCHPO/22-319-------------------------E..K.....................QR-----IA.....................
HUTG_PHOLL/44-316-------------------------T..QCQ.................CQNV-----RT.....................
Q3IQJ3_NATPD/45-332-------------------------A..R.....................GT-----MP.....................
SPEB2_SYNY3/83-361-------------------------S..S.....................GA-----FP.....................
Q5LKZ4_RUEPO/42-315-------------------------S..S.....................GI-----LP.....................
Q2RHH4_MOOTA/26-287-------------------------A..A.....................AR-----IP.....................
Q17HI3_AEDAE/32-333-------------------------N..E.....................DR-----LC.....................
A3CU48_METMJ/19-276-------------------------R..D.....................NK-----VP.....................
HUTG_HAHCH/40-316-------------------------F..KQL.................QAGH-----SP.....................
Q8RA93_THETN/28-290-------------------------K..D.....................GK-----KG.....................
Q8END5_OCEIH/29-310-------------------------K..T.....................GK-----FP.....................
Q5ANN8_CANAL/115-414-------------------------K..H.......................-----P.GNVN.............QHPK
Q2LPR8_SYNAS/65-343-------------------------G..K.....................GS-----IP.....................
A1ST87_PSYIN/33-299-------------------------A..S.....................GK-----AI.....................
ARGI1_ARATH/63-338-------------------------EEEP......................L-----RP.....................
A0R0G1_MYCS2/40-312-------------------------...L.....................SK-----GTR....................
A1CFK4_ASPCL/83-374-------------------------S..R.....................QT-----NSTTNG.............SVPR
B8I5M8_CLOCE/21-282-------------------------K..Q.....................GK-----KP.....................
A1TIE4_ACIAC/8-305-------------------------Q..A.....................GR-----LP.....................
A1T9H7_MYCVP/46-324-------------------------D..R.....................GI-----VP.....................
Q97VA3_SULSO/30-299-------------------------S..S.....................KN-----LV.....................
Q4J720_SULAC/30-299-------------------------S..S.....................KK-----LV.....................
Q3J2B4_RHOS4/46-312-------------------------A..A.....................GA-----GA.....................
A1CGK0_ASPCL/61-357-------------------------Y..H.....................ET-----N.VTEGW............KHPR
Q10Y47_TRIEI/24-296-------------------------S..D.....................GK-----FV.....................
A5G278_ACICJ/28-297-------------------------H..L.......................-----.......................
ARGI_SOYBN/71-346-------------------------EEDP......................L-----RP.....................
O76895_DROME/30-333-------------------------V..E.....................NT-----QF.....................
A1W2M6_ACISJ/2-298-------------------------Q..A.....................GQ-----LP.....................
A8GC83_SERP5/32-305-------------------------A..H.....................GC-----IP.....................
Q1GHG8_RUEST/4-296-------------------------M..A.....................RG-----MP.....................
Q65P52_BACLD/4-300-------------------------A..S.....................GA-----FP.....................
Q67TJ0_SYMTH/28-290-------------------------A..D.....................GK-----LS.....................
A4XZN2_PSEMY/43-309-------------------------E..A.....................GA-----AM.....................
A4YE21_METS5/29-295-------------------------R..N.....................ST-----L......................
Q6ANF4_DESPS/59-334-------------------------K..N.....................DI-----IP.....................
Q222F3_ALBFT/24-298-------------------------M..A.....................GH-----HC.....................
ARGI2_MOUSE/24-324-------------------------S..G.....................GY-----SC.....................
Q315M1_DESAG/23-287-------------------------D..AAP.................ENPP-----VP.....................
A7IL28_XANP2/50-316-------------------------A..R.....................GA-----HL.....................
Q18A84_PEPD6/21-285-------------------------R..D.....................SK-----VP.....................
Q5V6R7_HALMA/44-335-------------------------E..Q......................A-----TP.....................
Q5LRK8_RUEPO/33-325-------------------------M..P.....................RG-----LP.....................
Q9K8M2_BACHD/4-296-------------------------A..N.....................GY-----FP.....................
Q3ABP1_CARHZ/20-281-------------------------S..D.....................GK-----IP.....................
A9CJC2_AGRT5/42-307-------------------------S..K.....................TD-----YL.....................
Q7U3K9_SYNPX/21-280-------------------------D..L.....................GL-----KP.....................
A1STQ5_PSYIN/47-343-------------------------T..NAL.................NQDH-----KV.....................
Q7VY32_BORPE/13-287-------------------------Q..A.....................GA-----IP.....................
Q9CL61_PASMU/34-299-------------------------K..A.....................GK-----RC.....................
A4IB49_LEIIN/14-315-------------------------E..Q.....................GR-----FP.....................
A5UXL8_ROSS1/34-305-------------------------E..A.....................RV-----VT.....................
A9WCM8_CHLAA/41-307-------------------------A..D.....................GK-----LL.....................
B2FJ13_STRMK/7-298-------------------------Q..A.....................GR-----MP.....................
B4EIP8_BURCJ/49-320-------------------------E..H.....................DC-----KP.....................
B4ELX2_BURCJ/44-308-------------------------R..S.....................GA-----KM.....................
B5GLC8_STRC2/31-301-------------------------K..A.....................NA-----AF.....................
B9A9C6_BOMMO/12-304-------------------------K..D.....................GR-----IA.....................
C0ZIM2_BREBN/4-293-------------------------T..A.....................GR-----FP.....................
D0J7J2_COMT2/7-302-------------------------Q..Q.....................HR-----LP.....................
D5AV62_RHOCB/6-296-------------------------A..Q.....................SD-----LP.....................
D5SKW9_STRC2/134-404-------------------------E..R.....................ND-----AF.....................
E3GWR7_METFV/23-279-------------------------K..K.....................GM-----IP.....................
E9CYX8_COCPS/18-317-------------------------R..E.....................GR-----LV.....................
F1QJZ3_DANRE/86-357-------------------------A..T.....................GC-----IP.....................
F6SZP1_XENTR/61-332-------------------------A..A.....................GC-----IP.....................
I9NPV5_COCIM/78-370-------------------------S..RIANT............TDVSSVP-----RI.....................
K5X448_AGABU/13-305-------------------------K..N.....................GM-----LP.....................
SPEB_NEIMB/35-299-------------------------S..S.....................GK-----RC.....................
Q05AR1_XENTR/27-324-------------------------G..A.....................GH-----TC.....................
Q24ZK6_DESHY/5-295-------------------------K..E.....................EV-----IP.....................
Q251M0_DESHY/26-286-------------------------E..D.....................GK-----FP.....................
Q2FW91_STAA8/6-296-------------------------E..N.....................NR-----FP.....................
Q2K3I8_RHIEC/7-299-------------------------A..A.....................GR-----FP.....................
Q2K9W6_RHIEC/65-328-------------------------D..S.....................GA-----FL.....................
Q3IKA3_PSEHT/33-297-------------------------S..Q.....................GK-----TL.....................
Q46IA1_PROMT/31-292-------------------------K..N.....................NL-----KP.....................
Q4FL05_PELUB/40-312-------------------------D..K.....................VG-----GI.....................
Q5KIC1_CRYNJ/70-373-------------------------H..HPVVSPEKMQNLNMQRGLDGKIHP-----RI.....................
Q5L3P6_GEOKA/3-294-------------------------Q..R.....................GR-----FP.....................
HUTG_LEGPH/47-315-------------------------E..N.....................GH-----QI.....................
Q6LHE2_PHOPR/35-321-------------------------D..FF..................DKGH-----FP.....................
Q6LWW9_METMP/19-277-------------------------E..A.....................KK-----IP.....................
Q6N0N3_RHOPA/14-309-------------------------R..S.....................GA-----VP.....................
Q6PH54_DANRE/25-322-------------------------G..A.....................GH-----TC.....................
Q72EZ7_DESVH/23-282-------------------------D..A.....................GG-----TP.....................
Q7T151_DANRE/27-322-------------------------S..D.....................GN-----TC.....................
Q7V3X2_PROMM/30-287-------------------------K..M.....................GL-----RP.....................
SPEB_BACAN/23-284-------------------------D..A.....................GK-----FP.....................
Q81VP0_BACAN/4-292-------------------------E..E.....................GR-----FP.....................
Q81Y48_BACAN/37-311-------------------------K..VN...................PNM-----IP.....................
Q82VE5_NITEU/46-310-------------------------A..S.....................GA-----RM.....................
HUTG_VIBPA/47-325-------------------------S..EA..................LPHT-----PT.....................
Q88KU3_PSEPK/34-298-------------------------Q..A.....................GC-----AM.....................
Q8RG18_FUSNN/503-779-------------------------I..D.....................GY-----RP.....................
Q8TJ04_METAC/18-281-------------------------N..D.....................GK-----LP.....................
Q8XMY7_CLOPE/21-278-------------------------E..D.....................GK-----IP.....................
Q92LN4_RHIME/3-295-------------------------R..K.....................GH-----FP.....................
Q92MV8_RHIME/71-339-------------------------D..A.....................GV-----LP.....................
Q92QR6_RHIME/44-306-------------------------K..S.....................GA-----YL.....................
GPUA_PSEAE/36-307-------------------------A..A.....................GT-----LP.....................
Q9KLD2_VIBCH/33-297-------------------------K..S.....................GK-----TM.....................
HUTG_VIBCH/44-322-------------------------Q..QA..................LPHA-----RA.....................
U5L6E1_9BACI/3-293-------------------------K..G.....................GS-----FP.....................
U5LEA0_9BACI/39-314-------------------------K..GF...................PES-----VS.....................
W6RQZ8_9RHIZ/120-388-------------------------A..T.....................GV-----IP.....................

PF00850

A0DIS2_PARTE/29-344.....................EW..R------------------------NG.....FC---------------------
A0LGT0_SYNFM/15-314.....................II..D------------------------NA.....FC---------------------
A1W7T1_ACISJ/25-356.....................E...R------------------------AA.....FC---------------------
A2BL29_HYPBU/15-315.....................DC..N------------------------IA.....IV---------------------
A3DNS7_STAMF/16-313.........................E------------------------RI.....FL---------------------
A3GH68_PICST/21-341.........................Q------------------------NV.....V.---------------------
A4S2N1_OSTLU/197-606.....................DGKNR------------------------SA.....FV---------------------
A4S898_OSTLU/22-313.........................K------------------------VG.....LC---------------------
A4X4X7_SALTO/10-318.....................TA..R------------------------RA.....VN---------------------
A4YNH4_BRASO/45-371.....................E...D------------------------AV.....YA---------------------
A6QAF4_SULNB/14-302.....................EF..E------------------------RA.....FC---------------------
A6R4B6_AJECN/49-360.........................Q------------------------SE.....IA---------------------
A6VSZ5_MARMS/14-305.....................EM..D------------------------NA.....FC---------------------
A7SSG8_NEMVE/23-333.....................KS..S------------------------KH.....SI---------------------
A7SUP8_NEMVE/23-330.........................Q------------------------AK.....VA---------------------
A7TRW5_VANPO/9-404.........................Q------------------------RT.....IA---------------------
A8ABS4_IGNH4/14-309.....................DH..W------------------------LA.....FA---------------------
A8ZT95_DESOH/16-310.....................AC..R------------------------AF.....FS---------------------
A9A062_DESOH/259-573.....................R...Y------------------------LA.....YA---------------------
A9B5I1_HERA2/14-309.....................RH..A------------------------NS.....FA---------------------
B0T7F0_CAUSK/32-328.....................EV..D------------------------NA.....YA---------------------
B2JV93_BURP8/15-309.....................EA..R------------------------NV.....FC---------------------
B4U8T2_HYDS0/14-304.....................KQ..E------------------------AA.....FC---------------------
C5KDG6_PERM5/340-870.....................SV..P------------------------TA.....FV---------------------
E0TF48_PARBH/5-292.........................K------------------------EG.....LS---------------------
E2RU63_GIAIC/11-320.........................M------------------------CD.....VA---------------------
F2G2X2_ALTMD/14-319.....................ED..R------------------------QA.....FC---------------------
O67135_AQUAE/10-314.....................N....------------------------VA.....FN---------------------
HDA1_YEAST/69-395.....................RV..K------------------------NS.....LA---------------------
Q00U49_OSTTA/445-741.........................G------------------------AR.....AA---------------------
Q02CA3_SOLUE/14-311.....................AA..R------------------------NA.....FC---------------------
Q0A6Z7_ALKEH/46-336.....................DA..E------------------------AA.....FA---------------------
Q0ARF0_MARMM/14-308.........................G------------------------AA.....FV---------------------
Q15WQ0_PSEA6/14-301.........................E------------------------HG.....KA---------------------
Q1CZX8_MYXXD/21-314.....................EA..R------------------------NG.....FA---------------------
HDA6_CAEEL/438-748.....................DAGQR------------------------NA.....LV---------------------
Q29CG7_DROPS/25-326.........................D------------------------YG.....WA---------------------
Q2FQW8_METHJ/14-311.....................EV..R------------------------NS.....FV---------------------
Q2IF50_ANADE/16-319.....................EA..R------------------------AA.....FA---------------------
Q2KBQ8_RHIEC/14-309.....................AA..D------------------------NV.....FV---------------------
Q2LVD3_SYNAS/15-311.....................KL..D------------------------NA.....FA---------------------
Q2R9B1_ORYSJ/26-342.........................A------------------------SD.....IA---------------------
Q2S035_SALRD/7-313.....................DA..T------------------------RV.....LQ---------------------
Q2SC27_HAHCH/8-315.........................E------------------------EA.....IV---------------------
Q30PJ4_SULDN/258-572.....................T...H------------------------IA.....YA---------------------
Q31EP6_THICR/49-347.....................KI..D------------------------HG.....FA---------------------
Q31HC2_THICR/13-304.....................EA..K------------------------QA.....FC---------------------
Q38C74_TRYB2/21-323.........................A------------------------VD.....TA---------------------
Q39UV4_GEOMG/11-315.....................GY..D------------------------IA.....FT---------------------
Q3AFN8_CARHZ/10-319.....................EA..D------------------------HV.....FN---------------------
Q4D762_TRYCC/47-388.........................G------------------------RF.....AA---------------------
Q4FNF7_PELUB/14-306.....................DF..K------------------------NA.....FC---------------------
Q4KAJ1_PSEF5/12-340.....................Q...D------------------------SA.....FA---------------------
Q4MYQ3_THEPA/25-416GEENDSDPYGSDSGLNLLYPTRI..R------------------------KG.....FA---------------------
Q4P2D6_USTMA/326-751....THLNVTESLASNDDNETAPAAK------------------------RA.....FV---------------------
Q4QAJ4_LEIMA/91-404.........................D------------------------AT.....VA---------------------
Q4QI60_LEIMA/58-432................RSGTASSAAG------------------------CVHPLVSFC---------------------
HDA21_DICDI/1072-1486.....................NV..T------------------------SA.....FV---------------------
Q59Q78_CANAL/56-379.........................D------------------------QI.....IA---------------------
Q5AF34_CANAL/175-593....................KKENHN------------------------LA.....FV---------------------
Q5K8L3_CRYNJ/64-492.........................K------------------------AD.....WA---------------------
Q5KKR8_CRYNJ/28-368.........................I------------------------AD.....IA---------------------
Q60DG7_ORYSJ/34-350.....................HA..K------------------------IA.....YA---------------------
Q6AJC0_DESPS/18-318.....................DA..R------------------------QI.....FC---------------------
Q6AKN4_DESPS/15-311.....................EI..D------------------------HG.....FA---------------------
Q6C3Y5_YARLI/54-352.........................Q------------------------HQ.....LC---------------------
Q6CGA7_YARLI/254-648...........IGDTPPPEGKTSTFS------------------------QA.....FV---------------------
Q6FWB7_CANGA/8-383.........................E------------------------RT.....IA---------------------
Q741C0_MYCPA/14-307.....................DV..Q------------------------NA.....FV---------------------
Q7PS30_ANOGA/118-424.....................TV..Q------------------------NG.....MA---------------------
Q8EP92_OCEIH/11-321.....................NY..T------------------------HA.....LN---------------------
Q8I4I9_CAEEL/17-318.....................KI..H------------------------NG.....FA---------------------
Q8IR37_DROME/555-861.....................ES..R------------------------SG.....IC---------------------
HDA14_ARATH/75-387.....................SR..N------------------------SVDPPIGFA---------------------
Q9K0J2_NEIMB/35-328.....................KA..W------------------------HA.....FC---------------------
Q9U266_CAEEL/18-319.....................K...R------------------------PG.....IA---------------------
F5GX36_HUMAN/250-576.....................EL..K------------------------NG.....FA---------------------
F6Q3W9_MOUSE/101-401.....................EI..R------------------------NG.....MA---------------------
G4VAN3_SCHMA/13-356.........................H------------------------CE.....VV---------------------
K3ZRV5_SETIT/229-519.....................RV..H------------------------NG.....FA---------------------
Q22CW6_TETTS/24-319.....................SW..H------------------------TA.....FC---------------------
Q2G292_STAA8/18-322.....................KV..L------------------------NG.....CH---------------------
Q8F7M9_LEPIN/19-309.....................TI..K------------------------NG.....FS---------------------
V6EZA3_9PROT/18-307.....................QA..R------------------------NA.....FC---------------------
W7X9B2_TETTS/36-342.....................QW..K------------------------NA.....FC---------------------

PF12640

B5Z5P5_BACCE/12-235-YI------VEDHHHV----------------------------------------------------------------
C2XKX5_BACCE/12-239-YI------VEEHHHV----------------------------------------------------------------
B9BUU1_9BURK/13-199-YI------VESHHHV----------------------------------------------------------------
B4E7R4_BURCJ/13-201-FV------VESHHHV----------------------------------------------------------------
A8MKG9_ALKOO/16-197-YI------VENHHEV----------------------------------------------------------------
Q0YSC5_9CHLB/5-197-II------VENHHEV----------------------------------------------------------------
Q12VI5_METBU/19-180-YF------IIDHAAA----------------------------------------------------------------
Q1CZJ9_MYXXD/103-253-YV------FDPHRLA----------------------------------------------------------------
Q6ARQ8_DESPS/48-185-WL------MDDHKWA----------------------------------------------------------------
C2SK71_BACCE/15-171-FV------SCEHNWA----------------------------------------------------------------
C3Q562_9BACE/31-198-YI------MDNHLAA----------------------------------------------------------------
D7W5E5_9FLAO/27-172-YV------MDNHLCA----------------------------------------------------------------
A3TZZ3_9RHOB/31-170-YV------MDNHRAA----------------------------------------------------------------
C6C1I6_DESAD/28-165-FI------MDNHRAA----------------------------------------------------------------
C5KCK7_PERM5/16-196-VI------VDSHTEG----------------------------------------------------------------
B7FS57_PHATC/11-216-VV------VESHQHA----------------------------------------------------------------
C3XU32_BRAFL/3-238-QI------V...LQA----------------------------------------------------------------
CE022_DANRE/15-248-WI------VEDHHEV----------------------------------------------------------------
Q1RMV5_BOVIN/19-257-WV------VEDHQEV----------------------------------------------------------------
A7UTP5_ANOGA/103-265-FV------VEDHHEV----------------------------------------------------------------
B3M7P2_DROAN/118-284-FI------VDYHNDV----------------------------------------------------------------
B4N4R0_DROWI/108-274-FI------VDYHNDV----------------------------------------------------------------
A7SLH9_NEMVE/10-251-KI------CENHDEV----------------------------------------------------------------
B7PMV1_IXOSC/7-174-YV------VEPHHHA----------------------------------------------------------------
A9VAD6_MONBE/67-213-RE------RERERES----------------------------------------------------------------
A6UPR5_METVS/56-208-RI------VKKHHEA----------------------------------------------------------------
A9AA45_METM6/55-201-RI------VKKHHKA----------------------------------------------------------------
A6UX51_META3/57-190-RI------VKKHHEA----------------------------------------------------------------
D0MD43_RHOM4/57-211-LI------VDEHHEI----------------------------------------------------------------
A0A031WF12_PEPDI/78-183-YV------FDNHNHA----------------------------------------------------------------
B6G251_9FIRM/77-182-YI------FDNHNHS----------------------------------------------------------------
B0A6K5_9FIRM/76-181-YI------FDNHNHA----------------------------------------------------------------
C0CJH7_9FIRM/6-165-YI------MEEHHEA----------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387.LS------LGGDHTI----------------------------------------------------------------
Q6BJQ5_DEBHA/76-370.IA------LGGDHSV----------------------------------------------------------------
Q6BVQ4_DEBHA/136-428ILT------LGGDHTV----------------------------------------------------------------
Q6BWL4_DEBHA/179-480.IT------MGGDHTV----------------------------------------------------------------
A1RXI5_THEPD/26-288.IM------LGGDHFS----------------------------------------------------------------
SPEB_MOUSE/77-350.LT------LGGDQTI----------------------------------------------------------------
A4XKN0_CALS8/20-281.IF------LGGEHLI----------------------------------------------------------------
A4J1T2_DESRM/21-282.LV------LGGEHLV----------------------------------------------------------------
A1VQK9_POLNA/34-307.LT------LGGDHTI----------------------------------------------------------------
Q2K8A9_RHIEC/46-316.LA------VGGDHSV----------------------------------------------------------------
B2JW15_BURP8/32-305.LT------AGGDHSI----------------------------------------------------------------
Q982X2_RHILO/42-307.LT------LGGDHFV----------------------------------------------------------------
HUTG_BACHD/35-311PIV------LGGDHSI----------------------------------------------------------------
HUTG_RHOSR/40-314.VV------LGGGHEV----------------------------------------------------------------
ARGI1_HUMAN/6-305.LV------LGGDHSL----------------------------------------------------------------
SPEB_CHRVO/44-311.LT------FGGDHYV----------------------------------------------------------------
ARGI_BACSU/3-292.LV------LGGDHSI----------------------------------------------------------------
Q97ZX8_SULSO/24-289.IS------IGGEHTI----------------------------------------------------------------
HUTG_VIBVY/45-328.IT------LGGGHEV----------------------------------------------------------------
A9BRG6_DELAS/16-312.LM------LGGDHSL----------------------------------------------------------------
HUTG_AROAE/40-323.IG------LGGGHEI----------------------------------------------------------------
A1RB53_ARTAT/29-311.CV------IGGDHSI----------------------------------------------------------------
Q1J2W9_DEIGD/37-306.VF------LGGDHSV----------------------------------------------------------------
Q2JER0_FRASC/40-318.LV------IGGDHSI----------------------------------------------------------------
Q3J346_RHOS4/3-296.IV------MGGDHSL----------------------------------------------------------------
A9B324_HERA2/22-290.CV------LGGEHSV----------------------------------------------------------------
Q9YBG0_AERPE/29-298.VV------LGGEHLV----------------------------------------------------------------
Q1GI44_RUEST/34-307.FA------MGGDHSI----------------------------------------------------------------
Q9HJB2_THEAC/33-293.IM------LGGEHSI----------------------------------------------------------------
A0RXD6_CENSY/22-283.II------LGGEHSI----------------------------------------------------------------
A8LLU9_DINSH/46-312.LT------MGGDHYI----------------------------------------------------------------
SPEB_BACHD/22-286.IG------LGGEHLV----------------------------------------------------------------
Q0W940_UNCMA/16-280.IM------MGGEHSL----------------------------------------------------------------
Q6MHV0_BDEBA/36-309.LA------VGGDHST----------------------------------------------------------------
Q98MW3_RHILO/19-296.IL------LGGDDSV----------------------------------------------------------------
A0LG67_SYNFM/34-297.VL------LGGEHLL----------------------------------------------------------------
HUTG_BACSU/35-311PLI------LGGDNSI----------------------------------------------------------------
Q9K5Y7_BACHD/5-297.LI------LGGDHSI----------------------------------------------------------------
Q164F4_ROSDO/46-312.VT------LGGDHYV----------------------------------------------------------------
Q164F5_ROSDO/34-308.LA------IGGDHSI----------------------------------------------------------------
Q15X44_PSEA6/42-323.IG------LGGGHEI----------------------------------------------------------------
Q11J67_CHESB/42-307.VT------LGGDHFV----------------------------------------------------------------
Q1AWJ4_RUBXD/5-295.VF------LGGDHSI----------------------------------------------------------------
Q5WL42_BACSK/7-290.FV------LGGDHSI----------------------------------------------------------------
Q7UZH9_PROMP/24-288.IM------LGGEHSI----------------------------------------------------------------
Q6CLB8_KLULA/137-438LIT------LGGDHTI----------------------------------------------------------------
A0JT79_ARTS2/57-331LVT------LGGDHTI----------------------------------------------------------------
Q2KVZ3_BORA1/13-287.VT------MGGDGAV----------------------------------------------------------------
B2UBQ2_RALPJ/40-316.IA------LGGGHEI----------------------------------------------------------------
Q165U0_ROSDO/35-314.VV------IGGDHSI----------------------------------------------------------------
B1YHV3_EXIS2/22-286.LG------MGGEHLV----------------------------------------------------------------
Q5WIT9_BACSK/27-306.IG------LGGDHGV----------------------------------------------------------------
A1C610_ASPCL/68-380LVT------LGGDHSV----------------------------------------------------------------
Q1AS11_RUBXD/33-307.VV------LGGDHSI----------------------------------------------------------------
Q28QX8_JANSC/39-314.FM------VGGDHLC----------------------------------------------------------------
A1WGI6_VEREI/22-320.IL------LGGDHCL----------------------------------------------------------------
A1WER7_VEREI/22-295.IT------LGGDHTI----------------------------------------------------------------
A1T3A2_MYCVP/88-364.IV------LGGDHSI----------------------------------------------------------------
A8LRL4_DINSH/4-296.IF------LGGDHAL----------------------------------------------------------------
A5V551_SPHWW/4-298.IF------MGGDHAL----------------------------------------------------------------
Q11NZ4_CYTH3/3-310.LV------ISGDHSN----------------------------------------------------------------
Q5V4R8_HALMA/3-300.LV------LGGDHSI----------------------------------------------------------------
SPEB_SERP5/33-298.LS------FGGDHFV----------------------------------------------------------------
Q12BY7_POLSJ/72-342.LA------VGGDHSI----------------------------------------------------------------
HUTG_VIBF1/45-345.IV------LGGGHEV----------------------------------------------------------------
Q3IVT5_RHOS4/32-308.FG------IGGDHSV----------------------------------------------------------------
HUTG_GEOKA/44-315.IV------IGGGHET----------------------------------------------------------------
SPEB_BLOFL/33-298.LL------LGGDHYI----------------------------------------------------------------
A0ZFA2_NODSP/30-338.AV------IGGDHSV----------------------------------------------------------------
A4XT95_PSEMY/38-311.LT------LGGDHTI----------------------------------------------------------------
Q5WB32_BACSK/22-286.LG------LGGEHLL----------------------------------------------------------------
Q6C6P6_YARLI/9-306.LT------IGGDHSI----------------------------------------------------------------
Q12UU8_METBU/17-282.IM------IGGEHSL----------------------------------------------------------------
Q213G1_RHOPB/11-309.IF------LGGDHTL----------------------------------------------------------------
Q28PV5_JANSC/46-313.IT------LGGDHSI----------------------------------------------------------------
A0QRD0_MYCS2/43-317VVL------LGGDHTI----------------------------------------------------------------
ARGI_NEUCR/47-354.LT------LGGDHSI----------------------------------------------------------------
Q12LW8_SHEDO/33-299.LS------FGGDHFV----------------------------------------------------------------
Q2W8C1_MAGSA/22-290.LA------VGGDHTI----------------------------------------------------------------
Q6CIB4_KLULA/61-358FVT------LGGDHSI----------------------------------------------------------------
A1SLP1_NOCSJ/31-312.LV------LGGDHSI----------------------------------------------------------------
Q28VR8_JANSC/34-309.VT------LGGDHSI----------------------------------------------------------------
Q0UYW2_PHANO/16-320.LT------LGGDHSI----------------------------------------------------------------
Y309_METJA/21-281.IV------FGGEHSI----------------------------------------------------------------
Q9RZ04_DEIRA/29-298.VF------LGGDHSV----------------------------------------------------------------
Q6CLS8_KLULA/13-315.VT------LGGDHSI----------------------------------------------------------------
A2BIW8_HYPBU/25-300.IV------LGGEHTI----------------------------------------------------------------
Q21RM0_ALBFT/15-309.IM------LGGDHCL----------------------------------------------------------------
Q6L151_PICTO/19-280.IM------LGGEHSI----------------------------------------------------------------
Q4P4M4_USTMA/13-318.LT------LGGDHSL----------------------------------------------------------------
A1B165_PARDP/30-308.LI------IGGDHGI----------------------------------------------------------------
Q16AD8_ROSDO/4-296.IF------MGGDHAL----------------------------------------------------------------
Q3SMM1_THIDA/8-294.LV------VGGDHSC----------------------------------------------------------------
Q5AK86_CANAL/12-313.IT------IGGDHSI----------------------------------------------------------------
Q7VSA1_BORPE/8-302.IL------LGGDHSL----------------------------------------------------------------
A0BHR2_PARTE/9-311.LN------IGGDHSV----------------------------------------------------------------
Q4JAE9_SULAC/24-287.VS------IGGEHSI----------------------------------------------------------------
Q975R8_SULTO/24-287.IG------IGGEHSV----------------------------------------------------------------
Q1LGD2_RALME/2-296.LL------MGGDHCL----------------------------------------------------------------
ARGI_AGRT5/19-313.VF------LGGDHSM----------------------------------------------------------------
Q1D421_MYXXD/27-337.AA------VGGDHSI----------------------------------------------------------------
SPEB1_SCHPO/74-375VIT------LGGDHTI----------------------------------------------------------------
ARGI_YEAST/13-329.LT------LGGDHSI----------------------------------------------------------------
A9BN56_DELAS/71-341.LS------AGGDHSI----------------------------------------------------------------
Q5A4M3_CANAL/50-340YIA------LGGDHSV----------------------------------------------------------------
A1RBR9_ARTAT/55-335LIS------IGGDHTI----------------------------------------------------------------
A1VTU0_POLNA/3-297.ML------LGGDHCL----------------------------------------------------------------
Q0UMJ9_PHANO/68-378LLT------LGGDHSI----------------------------------------------------------------
A1SM48_NOCSJ/41-314VVL------LGGDHTV----------------------------------------------------------------
Q1GI45_RUEST/67-333.VA------IGGDHYV----------------------------------------------------------------
Q1IHQ4_KORVE/16-311.LA------LGGDHSM----------------------------------------------------------------
Q6L2W0_PICTO/21-293.IA------MGGDHSI----------------------------------------------------------------
Q89H72_BRADU/11-308.IF------LGGDHTL----------------------------------------------------------------
Q489X2_COLP3/36-310.VT------VGGDHTI----------------------------------------------------------------
Q7V9I4_PROMA/29-293.LL------IGGEHSI----------------------------------------------------------------
SPEB1_SYNY3/26-297.VA------IGGEHAI----------------------------------------------------------------
Q6FP31_CANGA/10-317.VT------LGGDHSI----------------------------------------------------------------
A5G414_GEOUR/41-319.FV------LGGDHSF----------------------------------------------------------------
Q3SVS2_NITWN/5-302.IF------LGGDHSL----------------------------------------------------------------
SPEB2_SCHPO/89-401LIT------LGGDHSI----------------------------------------------------------------
Q8XPR0_RALSO/29-309.IV------LGGDHGI----------------------------------------------------------------
Q47TW8_THEFY/41-314LVT------LGGDHTI----------------------------------------------------------------
A9KQ98_CLOPH/18-281.LM------IGGEHLV----------------------------------------------------------------
A1BCD2_PARDP/35-312.LS------VGGDHLT----------------------------------------------------------------
ARGI_ASHGO/93-395.VT------LGGDHSI----------------------------------------------------------------
A1B3P5_PARDP/3-295.IF------LGGDHAL----------------------------------------------------------------
Q1QTM4_CHRSD/39-312.LT------LGGDHTL----------------------------------------------------------------
Q6C732_YARLI/86-381AIL------MGGDHTT----------------------------------------------------------------
A0LDK6_MAGSM/20-293.VG------LGGEHSV----------------------------------------------------------------
Q47D78_DECAR/17-302.VV------IGGDHSI----------------------------------------------------------------
Q3JAG2_NITOC/2-290.IV------LGGDHSC----------------------------------------------------------------
A3DDA1_CLOTH/24-286.LF------IGGEHLI----------------------------------------------------------------
A1CKP4_ASPCL/16-320.LT------LGGDHSI----------------------------------------------------------------
ARGI1_SCHPO/22-319.VN------IGGDHSL----------------------------------------------------------------
HUTG_PHOLL/44-316.LV------LGGGHET----------------------------------------------------------------
Q3IQJ3_NATPD/45-332.VV------IGGDHYC----------------------------------------------------------------
SPEB2_SYNY3/83-361.II------LGGDHSI----------------------------------------------------------------
Q5LKZ4_RUEPO/42-315.VT------AGGDHLT----------------------------------------------------------------
Q2RHH4_MOOTA/26-287.FF------MGGEHLV----------------------------------------------------------------
Q17HI3_AEDAE/32-333.LT------LGGDHAI----------------------------------------------------------------
A3CU48_METMJ/19-276.VM------LGGEHTA----------------------------------------------------------------
HUTG_HAHCH/40-316.IV------LGGGHDV----------------------------------------------------------------
Q8RA93_THETN/28-290.IF------LGGEHLI----------------------------------------------------------------
Q8END5_OCEIH/29-310.IA------FGGDHGI----------------------------------------------------------------
Q5ANN8_CANAL/115-414IIT------LGGDHTI----------------------------------------------------------------
Q2LPR8_SYNAS/65-343.VT------VGGDHSI----------------------------------------------------------------
A1ST87_PSYIN/33-299.LS------LGGDHFV----------------------------------------------------------------
ARGI1_ARATH/63-338.LV------LGGDHSI----------------------------------------------------------------
A0R0G1_MYCS2/40-312AVV------LGGDHSV----------------------------------------------------------------
A1CFK4_ASPCL/83-374IIT------LGGDHTT----------------------------------------------------------------
B8I5M8_CLOCE/21-282.LM------IGGEHLV----------------------------------------------------------------
A1TIE4_ACIAC/8-305.VM------LGGDHNL----------------------------------------------------------------
A1T9H7_MYCVP/46-324.VI------LGGDHSI----------------------------------------------------------------
Q97VA3_SULSO/30-299PFI------AGGDHSI----------------------------------------------------------------
Q4J720_SULAC/30-299PFI------AGGDHSI----------------------------------------------------------------
Q3J2B4_RHOS4/46-312.LT------LGGDHSI----------------------------------------------------------------
A1CGK0_ASPCL/61-357IIS------LGGDHSI----------------------------------------------------------------
Q10Y47_TRIEI/24-296.IA------IGGEHSI----------------------------------------------------------------
A5G278_ACICJ/28-297.VA------LGGEHGI----------------------------------------------------------------
ARGI_SOYBN/71-346.LI------LGGDPSI----------------------------------------------------------------
O76895_DROME/30-333.LA------IGGDHAI----------------------------------------------------------------
A1W2M6_ACISJ/2-298.LL------MGGDHCL----------------------------------------------------------------
A8GC83_SERP5/32-305.LT------LGGDHTL----------------------------------------------------------------
Q1GHG8_RUEST/4-296.IF------LGGDHAL----------------------------------------------------------------
Q65P52_BACLD/4-300.LV------LGGDHSI----------------------------------------------------------------
Q67TJ0_SYMTH/28-290.LM------MGGEHLV----------------------------------------------------------------
A4XZN2_PSEMY/43-309.LT------LGGDHFI----------------------------------------------------------------
A4YE21_METS5/29-295.FI------AGGDHSI----------------------------------------------------------------
Q6ANF4_DESPS/59-334.VV------MGGDHSI----------------------------------------------------------------
Q222F3_ALBFT/24-298.VF------LGGDHSV----------------------------------------------------------------
ARGI2_MOUSE/24-324.VT------MGGDHSL----------------------------------------------------------------
Q315M1_DESAG/23-287.VL------LGGEHTV----------------------------------------------------------------
A7IL28_XANP2/50-316.MT------LGGDHFL----------------------------------------------------------------
Q18A84_PEPD6/21-285.FM------IGGEHLV----------------------------------------------------------------
Q5V6R7_HALMA/44-335.IV------IGGDHSI----------------------------------------------------------------
Q5LRK8_RUEPO/33-325.IF------LGGDHAL----------------------------------------------------------------
Q9K8M2_BACHD/4-296.LV------LGGDHSI----------------------------------------------------------------
Q3ABP1_CARHZ/20-281.LI------IGGEHLI----------------------------------------------------------------
A9CJC2_AGRT5/42-307.LT------LGGDHFI----------------------------------------------------------------
Q7U3K9_SYNPX/21-280.LM------LGGEHSI----------------------------------------------------------------
A1STQ5_PSYIN/47-343.IV------LGGGHEI----------------------------------------------------------------
Q7VY32_BORPE/13-287.IT------MGGDGAV----------------------------------------------------------------
Q9CL61_PASMU/34-299.LT------FGGDHFI----------------------------------------------------------------
A4IB49_LEIIN/14-315.LT------IGGDHSI----------------------------------------------------------------
A5UXL8_ROSS1/34-305.LS------LGGDHSV----------------------------------------------------------------
A9WCM8_CHLAA/41-307.IS------LGGGNDI----------------------------------------------------------------
B2FJ13_STRMK/7-298.IM------LGGDHCL----------------------------------------------------------------
B4EIP8_BURCJ/49-320.IT------LGGDHTI----------------------------------------------------------------
B4ELX2_BURCJ/44-308.LT------LGGDHYI----------------------------------------------------------------
B5GLC8_STRC2/31-301.LM------IGGDHSL----------------------------------------------------------------
B9A9C6_BOMMO/12-304.VT------VGGDHSI----------------------------------------------------------------
C0ZIM2_BREBN/4-293.LV------LGGDHSI----------------------------------------------------------------
D0J7J2_COMT2/7-302.IL------LGGDHTL----------------------------------------------------------------
D5AV62_RHOCB/6-296.VF------LGGDHSM----------------------------------------------------------------
D5SKW9_STRC2/134-404.LM------LGGDHSL----------------------------------------------------------------
E3GWR7_METFV/23-279.IV------LGGEHSI----------------------------------------------------------------
E9CYX8_COCPS/18-317.LT------LGGDHSI----------------------------------------------------------------
F1QJZ3_DANRE/86-357.LT------LGGDHTI----------------------------------------------------------------
F6SZP1_XENTR/61-332.LT------LGGDHTI----------------------------------------------------------------
I9NPV5_COCIM/78-370.IT------LGGDHTT----------------------------------------------------------------
K5X448_AGABU/13-305.VT------LGGDHSL----------------------------------------------------------------
SPEB_NEIMB/35-299.LS------LGGDHFI----------------------------------------------------------------
Q05AR1_XENTR/27-324.VT------LGGDHSL----------------------------------------------------------------
Q24ZK6_DESHY/5-295.LI------IGGDHSL----------------------------------------------------------------
Q251M0_DESHY/26-286.IF------LGGEHLV----------------------------------------------------------------
Q2FW91_STAA8/6-296.LV------LGGDHSI----------------------------------------------------------------
Q2K3I8_RHIEC/7-299.LI------LGGDHSL----------------------------------------------------------------
Q2K9W6_RHIEC/65-328.LT------LGGDHYV----------------------------------------------------------------
Q3IKA3_PSEHT/33-297.LG------LGGDHFV----------------------------------------------------------------
Q46IA1_PROMT/31-292.LI------IGGEHSI----------------------------------------------------------------
Q4FL05_PELUB/40-312.IS------LGGDHTI----------------------------------------------------------------
Q5KIC1_CRYNJ/70-373.IT------LGGDHTI----------------------------------------------------------------
Q5L3P6_GEOKA/3-294.LV------LGGDHSI----------------------------------------------------------------
HUTG_LEGPH/47-315.CA------FGGGHEI----------------------------------------------------------------
Q6LHE2_PHOPR/35-321.VI------LGGGHEI----------------------------------------------------------------
Q6LWW9_METMP/19-277.VM------IGGEHSV----------------------------------------------------------------
Q6N0N3_RHOPA/14-309.LF------MGGDHSL----------------------------------------------------------------
Q6PH54_DANRE/25-322.IM------LGGDHSL----------------------------------------------------------------
Q72EZ7_DESVH/23-282.VL------LGGEHTV----------------------------------------------------------------
Q7T151_DANRE/27-322.VM------LGGDHSL----------------------------------------------------------------
Q7V3X2_PROMM/30-287.LM------LGGEHSI----------------------------------------------------------------
SPEB_BACAN/23-284.LG------LGGEHLV----------------------------------------------------------------
Q81VP0_BACAN/4-292.LV------LGGDHSI----------------------------------------------------------------
Q81Y48_BACAN/37-311.IV------LGGDHSI----------------------------------------------------------------
Q82VE5_NITEU/46-310.LT------FGGDHSI----------------------------------------------------------------
HUTG_VIBPA/47-325.IV------LGGGHEI----------------------------------------------------------------
Q88KU3_PSEPK/34-298.LT------LGGDHFI----------------------------------------------------------------
Q8RG18_FUSNN/503-779.IL------VGGDHSI----------------------------------------------------------------
Q8TJ04_METAC/18-281.IM------LGGEHSL----------------------------------------------------------------
Q8XMY7_CLOPE/21-278.AM------IGGEHLV----------------------------------------------------------------
Q92LN4_RHIME/3-295.II------LGGDHAL----------------------------------------------------------------
Q92MV8_RHIME/71-339.LS------VGGDHSI----------------------------------------------------------------
Q92QR6_RHIME/44-306.LT------LGGDHFV----------------------------------------------------------------
GPUA_PSEAE/36-307.LS------VGGDHLV----------------------------------------------------------------
Q9KLD2_VIBCH/33-297.LA------LGGDHFI----------------------------------------------------------------
HUTG_VIBCH/44-322.IV------LGGGHEI----------------------------------------------------------------
U5L6E1_9BACI/3-293.LV------LGGDHSI----------------------------------------------------------------
U5LEA0_9BACI/39-314.CL------IGGDHSV----------------------------------------------------------------
W6RQZ8_9RHIZ/120-388.LS------VGGDHSI----------------------------------------------------------------

PF00850

A0DIS2_PARTE/29-344-SV......RPPGHHSGH............................................K.................
A0LGT0_SYNFM/15-314-AV......RPPGHHA.E............................................M.................
A1W7T1_ACISJ/25-356-ST......RPPGHHAGP..............................................................
A2BL29_HYPBU/15-315-LG......RPPGHHAGR............................................R.................
A3DNS7_STAMF/16-313-IM......RPPGHHAGK............................................C.................
A3GH68_PICST/21-341-VN.....WYGGRHHC.T............................................K.................
A4S2N1_OSTLU/197-606-CC......RPPGHHAGI............................................N.................
A4S898_OSTLU/22-313-VN.....TAGGTHHA.H............................................R.................
A4X4X7_SALTO/10-318-VA.......GGLHHA.M............................................P.................
A4YNH4_BRASO/45-371-LC......RPPGHHAYR..............................................................
A6QAF4_SULNB/14-302-AV......RPPGHHA.R............................................P.................
A6R4B6_AJECN/49-360-IN.....WSGGLHHA.K............................................K.................
A6VSZ5_MARMS/14-305-AI......RPPGHHA.E............................................Y.................
A7SSG8_NEMVE/23-333-HINQLFFLRPPGHHA.D............................................A.................
A7SUP8_NEMVE/23-330-VN.....WQGGWHHA.Q............................................R.................
A7TRW5_VANPO/9-404-IN.....WDGGRHHA.I............................................K.................
A8ABS4_IGNH4/14-309-AV......RPPGHHARR..............................................................
A8ZT95_DESOH/16-310-LV......RPPGHHA.L............................................P.................
A9A062_DESOH/259-573-LV......RPPGHHA.E............................................T.................
A9B5I1_HERA2/14-309-LV......RPPGHHA.T............................................A.................
B0T7F0_CAUSK/32-328-LL......RPAGHHSRP..............................................................
B2JV93_BURP8/15-309-AT......RPCGHHA.E............................................P.................
B4U8T2_HYDS0/14-304-LV......RPPGHHA.E............................................Y.................
C5KDG6_PERM5/340-870-LA......RPACHHVPYRVKSEDIHIEDDMPELNVVVESPAIKFMNSPQNKGARTAEGVSIAGICEGCREQADNDYMLN
E0TF48_PARBH/5-292-GQ.....LAGGTHHA.H............................................A.................
E2RU63_GIAIC/11-320-LN.....WMGGFHHA.K............................................A.................
F2G2X2_ALTMD/14-319-AT......RPPGHHA.T............................................Y.................
O67135_AQUAE/10-314-PA.......GGMHHA.F............................................K.................
HDA1_YEAST/69-395-VV......RPPGHHA.E............................................P.................
Q00U49_OSTTA/445-741-AQ.....LAGGTHHA.Y............................................R.................
Q02CA3_SOLUE/14-311-AV......RPPGHHA.N............................................A.................
Q0A6Z7_ALKEH/46-336-LV......RPPGHHA.E............................................A.................
Q0ARF0_MARMM/14-308-LA......RPPGHHAEP..............................................................
Q15WQ0_PSEA6/14-301-LN.....LTGGYHHA.F............................................A.................
Q1CZX8_MYXXD/21-314-LV......RPPGHHA.E............................................P.................
HDA6_CAEEL/438-748-IV......RPPGHHA.S............................................A.................
Q29CG7_DROPS/25-326-IN.....LGGGFHHC.C............................................S.................
Q2FQW8_METHJ/14-311-LS......RPPGHHAGR..............................................................
Q2IF50_ANADE/16-319-LV......RPPGHHA.W............................................A.................
Q2KBQ8_RHIEC/14-309-AA......RPPGHHA.E............................................K.................
Q2LVD3_SYNAS/15-311-LV......RPPGHHA.E............................................A.................
Q2R9B1_ORYSJ/26-342-IN.....WSGGMHHA.S............................................A.................
Q2S035_SALRD/7-313-FG.......GGLHHA.H............................................R.................
Q2SC27_HAHCH/8-315-FN.....LGGGFHHA.F............................................R.................
Q30PJ4_SULDN/258-572-LV......RPPGHHA.E............................................R.................
Q31EP6_THICR/49-347-LL......RPPGHHA.L............................................Q.................
Q31HC2_THICR/13-304-NI......RPPGHHA.E............................................R.................
Q38C74_TRYB2/21-323-IH.....WGGGMHHA.K............................................C.................
Q39UV4_GEOMG/11-315-MA.......GGWHHA.H............................................R.................
Q3AFN8_CARHZ/10-319-IA.......GGLHHA.L............................................R.................
Q4D762_TRYCC/47-388-IH.....WFGGRHHA.K............................................Q.................
Q4FNF7_PELUB/14-306-AV......RPPGHHA.E............................................K.................
Q4KAJ1_PSEF5/12-340-LC......RPPGHHAAR..............................................................
Q4MYQ3_THEPA/25-416-LV......RPPGHHA.T............................................P.................
Q4P2D6_USTMA/326-751-LS......RPPGHHCSG..............................................................
Q4QAJ4_LEIMA/91-404-MN.....WAGGMHHA.A............................................A.................
Q4QI60_LEIMA/58-432-LV......RPPGHHC.T............................................A.................
HDA21_DICDI/1072-1486-AA......RPPGHHAGR............................................D.................
Q59Q78_CANAL/56-379-VN.....WYGGRHHC.H............................................K.................
Q5AF34_CANAL/175-593-VI......RPPGHHS.H............................................A.................
Q5K8L3_CRYNJ/64-492-VC.....WDGGRHHA.K............................................R.................
Q5KKR8_CRYNJ/28-368-IN.....WAGGLHHA.K............................................K.................
Q60DG7_ORYSJ/34-350-LV......RPPGHHA.Q............................................P.................
Q6AJC0_DESPS/18-318-VI......RPPGHHA.E............................................K.................
Q6AKN4_DESPS/15-311-LI......RPPGHHA.E............................................P.................
Q6C3Y5_YARLI/54-352-IN.....WYGGRHHG.K............................................R.................
Q6CGA7_YARLI/254-648-NI......RPPGHHC.H............................................A.................
Q6FWB7_CANGA/8-383-IN.....WDGGRHHS.M............................................K.................
Q741C0_MYCPA/14-307-AC......RPPGHHA.E............................................T.................
Q7PS30_ANOGA/118-424-IL......RPPGHHA.M............................................T.................
Q8EP92_OCEIH/11-321-LG.......GGLHHG.F............................................R.................
Q8I4I9_CAEEL/17-318-MV......RPPGHHSYG..............................................................
Q8IR37_DROME/555-861-NV......RPPGHHA.E............................................Q.................
HDA14_ARATH/75-387-LI......RPPGHHA.V............................................P.................
Q9K0J2_NEIMB/35-328-AA......RPPGHHA.G............................................S.................
Q9U266_CAEEL/18-319-FI......RPPGHHA.M............................................P.................
F5GX36_HUMAN/250-576-VV......RPPGHHA.E............................................E.................
F6Q3W9_MOUSE/101-401-VI......RPPGHHA.Q............................................H.................
G4VAN3_SCHMA/13-356-IN.....WGGGWHHA.K............................................R.................
K3ZRV5_SETIT/229-519-MV......RPPGHHA.G............................................V.................
Q22CW6_TETTS/24-319-CV......RPPGHHSGA............................................S.................
Q2G292_STAA8/18-322-L.......GGGLHHA.Q............................................P.................
Q8F7M9_LEPIN/19-309-LL......RPPGHHA.E............................................H.................
V6EZA3_9PROT/18-307-AV......RPPGHHA.E............................................R.................
W7X9B2_TETTS/36-342-II......RPPGHHSGE............................................S.................

PF12640

B5Z5P5_BACCE/12-235--------------------------------------------------------------------------------
C2XKX5_BACCE/12-239--------------------------------------------------------------------------------
B9BUU1_9BURK/13-199--------------------------------------------------------------------------------
B4E7R4_BURCJ/13-201--------------------------------------------------------------------------------
A8MKG9_ALKOO/16-197--------------------------------------------------------------------------------
Q0YSC5_9CHLB/5-197--------------------------------------------------------------------------------
Q12VI5_METBU/19-180--------------------------------------------------------------------------------
Q1CZJ9_MYXXD/103-253--------------------------------------------------------------------------------
Q6ARQ8_DESPS/48-185--------------------------------------------------------------------------------
C2SK71_BACCE/15-171--------------------------------------------------------------------------------
C3Q562_9BACE/31-198--------------------------------------------------------------------------------
D7W5E5_9FLAO/27-172--------------------------------------------------------------------------------
A3TZZ3_9RHOB/31-170--------------------------------------------------------------------------------
C6C1I6_DESAD/28-165--------------------------------------------------------------------------------
C5KCK7_PERM5/16-196--------------------------------------------------------------------------------
B7FS57_PHATC/11-216--------------------------------------------------------------------------------
C3XU32_BRAFL/3-238--------------------------------------------------------------------------------
CE022_DANRE/15-248--------------------------------------------------------------------------------
Q1RMV5_BOVIN/19-257--------------------------------------------------------------------------------
A7UTP5_ANOGA/103-265--------------------------------------------------------------------------------
B3M7P2_DROAN/118-284--------------------------------------------------------------------------------
B4N4R0_DROWI/108-274--------------------------------------------------------------------------------
A7SLH9_NEMVE/10-251--------------------------------------------------------------------------------
B7PMV1_IXOSC/7-174--------------------------------------------------------------------------------
A9VAD6_MONBE/67-213--------------------------------------------------------------------------------
A6UPR5_METVS/56-208--------------------------------------------------------------------------------
A9AA45_METM6/55-201--------------------------------------------------------------------------------
A6UX51_META3/57-190--------------------------------------------------------------------------------
D0MD43_RHOM4/57-211--------------------------------------------------------------------------------
A0A031WF12_PEPDI/78-183--------------------------------------------------------------------------------
B6G251_9FIRM/77-182--------------------------------------------------------------------------------
B0A6K5_9FIRM/76-181--------------------------------------------------------------------------------
C0CJH7_9FIRM/6-165--------------------------------------------------------------------------------

PF00491

SPEB3_SCHPO/85-387--------------------------------------------------------------------------------
Q6BJQ5_DEBHA/76-370--------------------------------------------------------------------------------
Q6BVQ4_DEBHA/136-428--------------------------------------------------------------------------------
Q6BWL4_DEBHA/179-480--------------------------------------------------------------------------------
A1RXI5_THEPD/26-288--------------------------------------------------------------------------------
SPEB_MOUSE/77-350--------------------------------------------------------------------------------
A4XKN0_CALS8/20-281--------------------------------------------------------------------------------
A4J1T2_DESRM/21-282--------------------------------------------------------------------------------
A1VQK9_POLNA/34-307--------------------------------------------------------------------------------
Q2K8A9_RHIEC/46-316--------------------------------------------------------------------------------
B2JW15_BURP8/32-305--------------------------------------------------------------------------------
Q982X2_RHILO/42-307--------------------------------------------------------------------------------
HUTG_BACHD/35-311--------------------------------------------------------------------------------
HUTG_RHOSR/40-314--------------------------------------------------------------------------------
ARGI1_HUMAN/6-305--------------------------------------------------------------------------------
SPEB_CHRVO/44-311--------------------------------------------------------------------------------
ARGI_BACSU/3-292--------------------------------------------------------------------------------
Q97ZX8_SULSO/24-289--------------------------------------------------------------------------------
HUTG_VIBVY/45-328--------------------------------------------------------------------------------
A9BRG6_DELAS/16-312--------------------------------------------------------------------------------
HUTG_AROAE/40-323--------------------------------------------------------------------------------
A1RB53_ARTAT/29-311--------------------------------------------------------------------------------
Q1J2W9_DEIGD/37-306--------------------------------------------------------------------------------
Q2JER0_FRASC/40-318--------------------------------------------------------------------------------
Q3J346_RHOS4/3-296--------------------------------------------------------------------------------
A9B324_HERA2/22-290--------------------------------------------------------------------------------
Q9YBG0_AERPE/29-298--------------------------------------------------------------------------------
Q1GI44_RUEST/34-307--------------------------------------------------------------------------------
Q9HJB2_THEAC/33-293--------------------------------------------------------------------------------
A0RXD6_CENSY/22-283--------------------------------------------------------------------------------
A8LLU9_DINSH/46-312--------------------------------------------------------------------------------
SPEB_BACHD/22-286--------------------------------------------------------------------------------
Q0W940_UNCMA/16-280--------------------------------------------------------------------------------
Q6MHV0_BDEBA/36-309--------------------------------------------------------------------------------
Q98MW3_RHILO/19-296--------------------------------------------------------------------------------
A0LG67_SYNFM/34-297--------------------------------------------------------------------------------
HUTG_BACSU/35-311--------------------------------------------------------------------------------
Q9K5Y7_BACHD/5-297--------------------------------------------------------------------------------
Q164F4_ROSDO/46-312--------------------------------------------------------------------------------
Q164F5_ROSDO/34-308--------------------------------------------------------------------------------
Q15X44_PSEA6/42-323--------------------------------------------------------------------------------
Q11J67_CHESB/42-307--------------------------------------------------------------------------------
Q1AWJ4_RUBXD/5-295--------------------------------------------------------------------------------
Q5WL42_BACSK/7-290--------------------------------------------------------------------------------
Q7UZH9_PROMP/24-288--------------------------------------------------------------------------------
Q6CLB8_KLULA/137-438--------------------------------------------------------------------------------
A0JT79_ARTS2/57-331--------------------------------------------------------------------------------
Q2KVZ3_BORA1/13-287--------------------------------------------------------------------------------
B2UBQ2_RALPJ/40-316--------------------------------------------------------------------------------
Q165U0_ROSDO/35-314--------------------------------------------------------------------------------
B1YHV3_EXIS2/22-286--------------------------------------------------------------------------------
Q5WIT9_BACSK/27-306--------------------------------------------------------------------------------
A1C610_ASPCL/68-380--------------------------------------------------------------------------------
Q1AS11_RUBXD/33-307--------------------------------------------------------------------------------
Q28QX8_JANSC/39-314--------------------------------------------------------------------------------
A1WGI6_VEREI/22-320--------------------------------------------------------------------------------
A1WER7_VEREI/22-295--------------------------------------------------------------------------------
A1T3A2_MYCVP/88-364--------------------------------------------------------------------------------
A8LRL4_DINSH/4-296--------------------------------------------------------------------------------
A5V551_SPHWW/4-298--------------------------------------------------------------------------------
Q11NZ4_CYTH3/3-310--------------------------------------------------------------------------------
Q5V4R8_HALMA/3-300--------------------------------------------------------------------------------
SPEB_SERP5/33-298--------------------------------------------------------------------------------
Q12BY7_POLSJ/72-342--------------------------------------------------------------------------------
HUTG_VIBF1/45-345--------------------------------------------------------------------------------
Q3IVT5_RHOS4/32-308--------------------------------------------------------------------------------
HUTG_GEOKA/44-315--------------------------------------------------------------------------------
SPEB_BLOFL/33-298--------------------------------------------------------------------------------
A0ZFA2_NODSP/30-338--------------------------------------------------------------------------------
A4XT95_PSEMY/38-311--------------------------------------------------------------------------------
Q5WB32_BACSK/22-286--------------------------------------------------------------------------------
Q6C6P6_YARLI/9-306--------------------------------------------------------------------------------
Q12UU8_METBU/17-282--------------------------------------------------------------------------------
Q213G1_RHOPB/11-309--------------------------------------------------------------------------------
Q28PV5_JANSC/46-313--------------------------------------------------------------------------------
A0QRD0_MYCS2/43-317--------------------------------------------------------------------------------
ARGI_NEUCR/47-354--------------------------------------------------------------------------------
Q12LW8_SHEDO/33-299--------------------------------------------------------------------------------
Q2W8C1_MAGSA/22-290--------------------------------------------------------------------------------
Q6CIB4_KLULA/61-358--------------------------------------------------------------------------------
A1SLP1_NOCSJ/31-312--------------------------------------------------------------------------------
Q28VR8_JANSC/34-309--------------------------------------------------------------------------------
Q0UYW2_PHANO/16-320--------------------------------------------------------------------------------
Y309_METJA/21-281--------------------------------------------------------------------------------
Q9RZ04_DEIRA/29-298--------------------------------------------------------------------------------
Q6CLS8_KLULA/13-315--------------------------------------------------------------------------------
A2BIW8_HYPBU/25-300--------------------------------------------------------------------------------
Q21RM0_ALBFT/15-309--------------------------------------------------------------------------------
Q6L151_PICTO/19-280--------------------------------------------------------------------------------
Q4P4M4_USTMA/13-318--------------------------------------------------------------------------------
A1B165_PARDP/30-308--------------------------------------------------------------------------------
Q16AD8_ROSDO/4-296--------------------------------------------------------------------------------
Q3SMM1_THIDA/8-294--------------------------------------------------------------------------------
Q5AK86_CANAL/12-313--------------------------------------------------------------------------------
Q7VSA1_BORPE/8-302--------------------------------------------------------------------------------
A0BHR2_PARTE/9-311--------------------------------------------------------------------------------
Q4JAE9_SULAC/24-287--------------------------------------------------------------------------------
Q975R8_SULTO/24-287--------------------------------------------------------------------------------
Q1LGD2_RALME/2-296--------------------------------------------------------------------------------
ARGI_AGRT5/19-313--------------------------------------------------------------------------------
Q1D421_MYXXD/27-337--------------------------------------------------------------------------------
SPEB1_SCHPO/74-375--------------------------------------------------------------------------------
ARGI_YEAST/13-329--------------------------------------------------------------------------------
A9BN56_DELAS/71-341--------------------------------------------------------------------------------
Q5A4M3_CANAL/50-340--------------------------------------------------------------------------------
A1RBR9_ARTAT/55-335--------------------------------------------------------------------------------
A1VTU0_POLNA/3-297--------------------------------------------------------------------------------
Q0UMJ9_PHANO/68-378--------------------------------------------------------------------------------
A1SM48_NOCSJ/41-314--------------------------------------------------------------------------------
Q1GI45_RUEST/67-333--------------------------------------------------------------------------------
Q1IHQ4_KORVE/16-311--------------------------------------------------------------------------------
Q6L2W0_PICTO/21-293--------------------------------------------------------------------------------
Q89H72_BRADU/11-308--------------------------------------------------------------------------------
Q489X2_COLP3/36-310--------------------------------------------------------------------------------
Q7V9I4_PROMA/29-293--------------------------------------------------------------------------------
SPEB1_SYNY3/26-297--------------------------------------------------------------------------------
Q6FP31_CANGA/10-317--------------------------------------------------------------------------------
A5G414_GEOUR/41-319--------------------------------------------------------------------------------
Q3SVS2_NITWN/5-302--------------------------------------------------------------------------------
SPEB2_SCHPO/89-401--------------------------------------------------------------------------------
Q8XPR0_RALSO/29-309--------------------------------------------------------------------------------
Q47TW8_THEFY/41-314--------------------------------------------------------------------------------
A9KQ98_CLOPH/18-281--------------------------------------------------------------------------------
A1BCD2_PARDP/35-312--------------------------------------------------------------------------------
ARGI_ASHGO/93-395--------------------------------------------------------------------------------
A1B3P5_PARDP/3-295--------------------------------------------------------------------------------
Q1QTM4_CHRSD/39-312--------------------------------------------------------------------------------
Q6C732_YARLI/86-381--------------------------------------------------------------------------------
A0LDK6_MAGSM/20-293--------------------------------------------------------------------------------
Q47D78_DECAR/17-302--------------------------------------------------------------------------------
Q3JAG2_NITOC/2-290--------------------------------------------------------------------------------
A3DDA1_CLOTH/24-286--------------------------------------------------------------------------------
A1CKP4_ASPCL/16-320--------------------------------------------------------------------------------
ARGI1_SCHPO/22-319--------------------------------------------------------------------------------
HUTG_PHOLL/44-316--------------------------------------------------------------------------------
Q3IQJ3_NATPD/45-332--------------------------------------------------------------------------------
SPEB2_SYNY3/83-361--------------------------------------------------------------------------------
Q5LKZ4_RUEPO/42-315--------------------------------------------------------------------------------
Q2RHH4_MOOTA/26-287--------------------------------------------------------------------------------
Q17HI3_AEDAE/32-333--------------------------------------------------------------------------------
A3CU48_METMJ/19-276--------------------------------------------------------------------------------
HUTG_HAHCH/40-316--------------------------------------------------------------------------------
Q8RA93_THETN/28-290--------------------------------------------------------------------------------
Q8END5_OCEIH/29-310--------------------------------------------------------------------------------
Q5ANN8_CANAL/115-414--------------------------------------------------------------------------------
Q2LPR8_SYNAS/65-343--------------------------------------------------------------------------------
A1ST87_PSYIN/33-299--------------------------------------------------------------------------------
ARGI1_ARATH/63-338--------------------------------------------------------------------------------
A0R0G1_MYCS2/40-312--------------------------------------------------------------------------------
A1CFK4_ASPCL/83-374--------------------------------------------------------------------------------
B8I5M8_CLOCE/21-282--------------------------------------------------------------------------------
A1TIE4_ACIAC/8-305--------------------------------------------------------------------------------
A1T9H7_MYCVP/46-324--------------------------------------------------------------------------------
Q97VA3_SULSO/30-299--------------------------------------------------------------------------------
Q4J720_SULAC/30-299--------------------------------------------------------------------------------
Q3J2B4_RHOS4/46-312--------------------------------------------------------------------------------
A1CGK0_ASPCL/61-357--------------------------------------------------------------------------------
Q10Y47_TRIEI/24-296--------------------------------------------------------------------------------
A5G278_ACICJ/28-297--------------------------------------------------------------------------------
ARGI_SOYBN/71-346--------------------------------------------------------------------------------
O76895_DROME/30-333--------------------------------------------------------------------------------
A1W2M6_ACISJ/2-298--------------------------------------------------------------------------------
A8GC83_SERP5/32-305--------------------------------------------------------------------------------
Q1GHG8_RUEST/4-296--------------------------------------------------------------------------------
Q65P52_BACLD/4-300--------------------------------------------------------------------------------
Q67TJ0_SYMTH/28-290--------------------------------------------------------------------------------
A4XZN2_PSEMY/43-309--------------------------------------------------------------------------------
A4YE21_METS5/29-295--------------------------------------------------------------------------------
Q6ANF4_DESPS/59-334--------------------------------------------------------------------------------
Q222F3_ALBFT/24-298--------------------------------------------------------------------------------
ARGI2_MOUSE/24-324--------------------------------------------------------------------------------
Q315M1_DESAG/23-287--------------------------------------------------------------------------------
A7IL28_XANP2/50-316--------------------------------------------------------------------------------
Q18A84_PEPD6/21-285--------------------------------------------------------------------------------
Q5V6R7_HALMA/44-335--------------------------------------------------------------------------------
Q5LRK8_RUEPO/33-325--------------------------------------------------------------------------------
Q9K8M2_BACHD/4-296--------------------------------------------------------------------------------
Q3ABP1_CARHZ/20-281--------------------------------------------------------------------------------
A9CJC2_AGRT5/42-307--------------------------------------------------------------------------------
Q7U3K9_SYNPX/21-280--------------------------------------------------------------------------------
A1STQ5_PSYIN/47-343--------------------------------------------------------------------------------
Q7VY32_BORPE/13-287--------------------------------------------------------------------------------
Q9CL61_PASMU/34-299--------------------------------------------------------------------------------
A4IB49_LEIIN/14-315--------------------------------------------------------------------------------
A5UXL8_ROSS1/34-305--------------------------------------------------------------------------------
A9WCM8_CHLAA/41-307--------------------------------------------------------------------------------
B2FJ13_STRMK/7-298--------------------------------------------------------------------------------
B4EIP8_BURCJ/49-320--------------------------------------------------------------------------------
B4ELX2_BURCJ/44-308--------------------------------------------------------------------------------
B5GLC8_STRC2/31-301--------------------------------------------------------------------------------
B9A9C6_BOMMO/12-304--------------------------------------------------------------------------------
C0ZIM2_BREBN/4-293--------------------------------------------------------------------------------
D0J7J2_COMT2/7-302--------------------------------------------------------------------------------
D5AV62_RHOCB/6-296--------------------------------------------------------------------------------
D5SKW9_STRC2/134-404--------------------------------------------------------------------------------
E3GWR7_METFV/23-279--------------------------------------------------------------------------------
E9CYX8_COCPS/18-317--------------------------------------------------------------------------------
F1QJZ3_DANRE/86-357--------------------------------------------------------------------------------
F6SZP1_XENTR/61-332--------------------------------------------------------------------------------
I9NPV5_COCIM/78-370--------------------------------------------------------------------------------
K5X448_AGABU/13-305--------------------------------------------------------------------------------
SPEB_NEIMB/35-299--------------------------------------------------------------------------------
Q05AR1_XENTR/27-324--------------------------------------------------------------------------------
Q24ZK6_DESHY/5-295--------------------------------------------------------------------------------
Q251M0_DESHY/26-286--------------------------------------------------------------------------------
Q2FW91_STAA8/6-296--------------------------------------------------------------------------------
Q2K3I8_RHIEC/7-299--------------------------------------------------------------------------------
Q2K9W6_RHIEC/65-328--------------------------------------------------------------------------------
Q3IKA3_PSEHT/33-297--------------------------------------------------------------------------------
Q46IA1_PROMT/31-292--------------------------------------------------------------------------------
Q4FL05_PELUB/40-312--------------------------------------------------------------------------------
Q5KIC1_CRYNJ/70-373--------------------------------------------------------------------------------
Q5L3P6_GEOKA/3-294--------------------------------------------------------------------------------
HUTG_LEGPH/47-315--------------------------------------------------------------------------------
Q6LHE2_PHOPR/35-321--------------------------------------------------------------------------------
Q6LWW9_METMP/19-277--------------------------------------------------------------------------------
Q6N0N3_RHOPA/14-309--------------------------------------------------------------------------------
Q6PH54_DANRE/25-322--------------------------------------------------------------------------------
Q72EZ7_DESVH/23-282--------------------------------------------------------------------------------
Q7T151_DANRE/27-322--------------------------------------------------------------------------------
Q7V3X2_PROMM/30-287--------------------------------------------------------------------------------
SPEB_BACAN/23-284--------------------------------------------------------------------------------
Q81VP0_BACAN/4-292--------------------------------------------------------------------------------
Q81Y48_BACAN/37-311--------------------------------------------------------------------------------
Q82VE5_NITEU/46-310--------------------------------------------------------------------------------
HUTG_VIBPA/47-325--------------------------------------------------------------------------------
Q88KU3_PSEPK/34-298--------------------------------------------------------------------------------
Q8RG18_FUSNN/503-779--------------------------------------------------------------------------------
Q8TJ04_METAC/18-281--------------------------------------------------------------------------------
Q8XMY7_CLOPE/21-278--------------------------------------------------------------------------------
Q92LN4_RHIME/3-295--------------------------------------------------------------------------------
Q92MV8_RHIME/71-339--------------------------------------------------------------------------------
Q92QR6_RHIME/44-306--------------------------------------------------------------------------------
GPUA_PSEAE/36-307--------------------------------------------------------------------------------
Q9KLD2_VIBCH/33-297--------------------------------------------------------------------------------
HUTG_VIBCH/44-322--------------------------------------------------------------------------------
U5L6E1_9BACI/3-293--------------------------------------------------------------------------------
U5LEA0_9BACI/39-314--------------------------------------------------------------------------------
W6RQZ8_9RHIZ/120-388--------------------------------------------------------------------------------

PF00850

A0DIS2_PARTE/29-344................................................................................
A0LGT0_SYNFM/15-314................................................................................
A1W7T1_ACISJ/25-356................................................................................
A2BL29_HYPBU/15-315................................................................................
A3DNS7_STAMF/16-313................................................................................
A3GH68_PICST/21-341................................................................................
A4S2N1_OSTLU/197-606................................................................................
A4S898_OSTLU/22-313................................................................................
A4X4X7_SALTO/10-318................................................................................
A4YNH4_BRASO/45-371................................................................................
A6QAF4_SULNB/14-302................................................................................
A6R4B6_AJECN/49-360................................................................................
A6VSZ5_MARMS/14-305................................................................................
A7SSG8_NEMVE/23-333................................................................................
A7SUP8_NEMVE/23-330................................................................................
A7TRW5_VANPO/9-404................................................................................
A8ABS4_IGNH4/14-309................................................................................
A8ZT95_DESOH/16-310................................................................................
A9A062_DESOH/259-573................................................................................
A9B5I1_HERA2/14-309................................................................................
B0T7F0_CAUSK/32-328................................................................................
B2JV93_BURP8/15-309................................................................................
B4U8T2_HYDS0/14-304................................................................................
C5KDG6_PERM5/340-870CDREGCSKSWHVYCLPDPLPKSILKRPEFMSRNWYCPACLEAPGLIKPQEADEMRAFVASLVENSVDESVIPGMNLASSE
E0TF48_PARBH/5-292................................................................................
E2RU63_GIAIC/11-320................................................................................
F2G2X2_ALTMD/14-319................................................................................
O67135_AQUAE/10-314................................................................................
HDA1_YEAST/69-395................................................................................
Q00U49_OSTTA/445-741................................................................................
Q02CA3_SOLUE/14-311................................................................................
Q0A6Z7_ALKEH/46-336................................................................................
Q0ARF0_MARMM/14-308................................................................................
Q15WQ0_PSEA6/14-301................................................................................
Q1CZX8_MYXXD/21-314................................................................................
HDA6_CAEEL/438-748................................................................................
Q29CG7_DROPS/25-326................................................................................
Q2FQW8_METHJ/14-311................................................................................
Q2IF50_ANADE/16-319................................................................................
Q2KBQ8_RHIEC/14-309................................................................................
Q2LVD3_SYNAS/15-311................................................................................
Q2R9B1_ORYSJ/26-342................................................................................
Q2S035_SALRD/7-313................................................................................
Q2SC27_HAHCH/8-315................................................................................
Q30PJ4_SULDN/258-572................................................................................
Q31EP6_THICR/49-347................................................................................
Q31HC2_THICR/13-304................................................................................
Q38C74_TRYB2/21-323................................................................................
Q39UV4_GEOMG/11-315................................................................................
Q3AFN8_CARHZ/10-319................................................................................
Q4D762_TRYCC/47-388................................................................................
Q4FNF7_PELUB/14-306................................................................................
Q4KAJ1_PSEF5/12-340................................................................................
Q4MYQ3_THEPA/25-416................................................................................
Q4P2D6_USTMA/326-751................................................................................
Q4QAJ4_LEIMA/91-404................................................................................
Q4QI60_LEIMA/58-432................................................................................
HDA21_DICDI/1072-1486................................................................................
Q59Q78_CANAL/56-379................................................................................
Q5AF34_CANAL/175-593................................................................................
Q5K8L3_CRYNJ/64-492................................................................................
Q5KKR8_CRYNJ/28-368................................................................................
Q60DG7_ORYSJ/34-350................................................................................
Q6AJC0_DESPS/18-318................................................................................
Q6AKN4_DESPS/15-311................................................................................
Q6C3Y5_YARLI/54-352................................................................................
Q6CGA7_YARLI/254-648................................................................................
Q6FWB7_CANGA/8-383................................................................................
Q741C0_MYCPA/14-307................................................................................
Q7PS30_ANOGA/118-424................................................................................
Q8EP92_OCEIH/11-321................................................................................
Q8I4I9_CAEEL/17-318................................................................................
Q8IR37_DROME/555-861................................................................................
HDA14_ARATH/75-387................................................................................
Q9K0J2_NEIMB/35-328................................................................................
Q9U266_CAEEL/18-319................................................................................
F5GX36_HUMAN/250-576................................................................................
F6Q3W9_MOUSE/101-401................................................................................
G4VAN3_SCHMA/13-356................................................................................
K3ZRV5_SETIT/229-519................................................................................
Q22CW6_TETTS/24-319................................................................................
Q2G292_STAA8/18-322................................................................................
Q8F7M9_LEPIN/19-309................................................................................
V6EZA3_9PROT/18-307................................................................................
W7X9B2_TETTS/36-342................................................................................

PF12640

B5Z5P5_BACCE/12-235------------------------------------LEPWAIYR---ERN....----------------.AA-------
C2XKX5_BACCE/12-239------------------------------------LEPWAIYR---ERN....----------------.TA-------
B9BUU1_9BURK/13-199------------------------------------LQSWGEVR---RALS...----------------.AA-------
B4E7R4_BURCJ/13-201------------------------------------LRGWAEVR---RSQPSS.----------------.PP-------
A8MKG9_ALKOO/16-197------------------------------------II