Sequence alignment for CL0303

PF06831

FPG_MYCGE/140-225---------------------AGFDYR.........---.--..KI....-------------------------.....
FPG_LACLC/132-225---------------------IGPEPT.........---.--...Y.DED-------------------------FDE..
FPG_HAEIN/129-213---------------------LGPEPL.........---.--...S....-------------------------.....
FPG_MYCPN/135-227---------------------LALDPL.....DQEF---N--HQAI....-------------------------.....
FPG_ECOLI/129-219---------------------LGPEPL........S---D--DFNG....-------------------------.....
Y5760_STRCO/124-214---------------------LGPDLLGPDWDPER.---.--..AL....-------------------------.....
FPG_BACFI/134-226---------------------LGVEPF........S---E--QFTS....-------------------------.....
FPG_STRMU/132-222---------------------IGPEPN........A---K--DFKL....-------------------------.....
FPG_SYNY3/143-233---------------------LGP............---E--PFGA....-------------------------.....
Y3325_MYCBO/123-203---------------------LGPDLL.....ADDW---D--PQRA....-------------------------.....
FPG_SYNEN/137-229---------------------LAPEPL........S---E--AFTV....-------------------------.....
FPG_NEIMB/135-227---------------------LGPEPL........S---E--AFCA....-------------------------.....
END8_ECOLI/126-214---------------------VGPDVLDPN.....L---T--PEVV....-------------------------.....
FPG_MYCTU/144-234---------------------LARDPL.........---.--.....DP.-------------------------.....
FPG_THET8/122-214---------------------LGPEPL........S---E--AFAF....-------------------------.....
FPG_BACSU/134-224---------------------LGPEPD........A---E--EFTS....-------------------------.....
Y2491_MYCBO/126-218---------------------LGPDPL.....RSDA---N--PSSA....-------------------------.....
O93997_CANAX/191-306---------------------LGPDYSKPEVPPKES---E--PFVFGDPD-------------------------SDNHG
O80358_ARATH/146-238---------------------LGPDAL........L---E--PMTV....-------------------------.....

PF05833

C1KWC8_LISMC/4-447DAMFLKAMTEELAEH......GESGRIMKIHQPFSH...E--LVLYIR.K.NRENKR.LLISSHPSYARIQWT..DD.IP
A3Z5Y2_9SYNE/15-450DVTTVRAVVSDLRRC......LLPSRFEKAQQPDPH...S--LQLGFR.T.LTGMLW.LELSWQADLPRLVLI..PPPRR
Q05WQ7_9SYNE/10-434DFTTLRAVVNDLRGR......ILPSRFEKAQQADGQ...T--LQLGFR.T.LKGMVW.LELSWRADCPRLIQI..PAPPK
Q7U569_SYNPX/23-449DLTTLRAVLSDLRPK......LLPSRFEKAQQPDPA...T--LQLGFR.S.LQGMLW.LELSWQADAPRLVQI..PPAPR
A5GMV8_SYNPW/10-441DLTALKAVLKDLRDR......LVPSRFEKAQQPDAH...T--LQLGFR.T.LQGMVW.LELSWQAESARLVQV..NAPRR
Q0I869_SYNS3/10-447DLTSLKAVLADLRAR......LIPSRFEKAQQPDPQ...T--LQLGFR.T.LRGMIW.LELSWKAEVPRLVEI..SAPPK
Q7V657_PROMM/52-482DLSSLRAVLSELRKE......VLPSRFEKVQQPEPH...T--LQLGLR.T.LKGLVW.LELSWRADCPRLVKI..TPPPR
A5GRV1_SYNR3/5-448DTTTLRGVVHELNAE......LVPSRFEKAQQAESG...G--VQLAFR.T.LKQRLW.LTLNWQADCPRFHAI..EPPPR
Q46GV7_PROMT/10-438DLTTLKAVVFELSQE......IVPSRFETAQQIDSH...T--IQLGLR.T.LEKLTW.IEISWLPESPIIVSI..PPPKK
Q7VDB7_PROMA/10-439DITSLQAVLADLRKE......IVPSRLEKVQQSDNH...T--LQIGFR.T.LRDLIW.IEICWHADSARIVQI..DPPAK
Q8DHA1_THEEB/5-448DLTTLRAVCADLQH.......WLPARLETVYQRDRH...T--IALAVR.T.LKKQAW.LTLSWHPQAARIALE..PPPPR
Q31PG3_SYNE7/5-452DYTTLVAVCRELQTA......VVPARLEQVYQRDRF...S--LSLGLR.T.MSDRPW.LLLSWHPEAARLHLD..TPPPR
P73561_SYNY3/5-464DYTTLMAIVAELQGD......WLPARIEQIYQHDRH...G--LSLALR.T.LERRGW.LTLAWHPQGARICLD..PPPPQ
Q8YP27_NOSS1/5-452DFTTLTATCSELHAH......WLPSRLEQVYQRDRY...T--IAIALR.T.LDKRGW.LQISWHPQATHICIG..DPPPR
Q110R4_TRIEI/5-453DYTTLIASCSQLRSQ......WLPARLEHVIQRDRF...T--ISLALR.T.LKKRGW.LDISWHPQAARICIG..DPPPR
A0YTA6_LYNSP/5-455DYTTLIAACTELRQE......WLPARLEQVYQRDRF...T--ISLLLR.T.LKRKGW.LDIAWHPQAARMCIG..DPPPR
Q4C6V5_CROWT/5-452DVTTLTAICHDLQSH......WLPAKVEQVYQKDPY...T--ISIALR.T.LKKRSW.LTISWHPQAARLCIG..DPPPR
Q2JJS2_SYNJB/5-470DLTTLRAVLADLAQAKTGRDLVLPARVEWIQQTDLW...T--VVIGLR.T.LTARPC.LLLCWHPQAARLHLC..QPPPK
Q2JXM6_SYNJA/5-461DLTTLRAVLADLKGAEAGGDPLLPARVEWIQQTDLW...T--VVIGLR.T.LKARPC.LLLSWHPQAARVHLC..QAPPK
Q7NK58_GLOVI/5-445DFTALSAARAEIQSA......WIPARVEQIRQDDYQ...T--IKLQLK.T.FAAQRW.LVASCHPQAARLHMG..EASRG
A4S6P0_OSTLU/47-508DYTALVASVREINAL......STPVKIDACAQVDAH...S--MTLDAR.A.ADGRRS.VRVSWHPVTAHVAMS..ARGAK
Q2IMA8_ANADE/4-353TARELAQVVAELAP.......LAGAYVEAVRAHAER...A--LTLSLR.G.RAGDAL.LLLSAEPDVTRLHAA..RR.RP
A7H6P3_ANADF/4-347GAGEIEAVVRELAP.......LVGSRVDAVRVHAER...A--LTLELF.G.RAGPVL.LLLSAEPDVTRLHVT..RA.RP
Q9RWV6_DEIRA/9-409EGLMLNRVVEQLTAQ......LPARNLGWVF.PDET...T--AALLLDGP.DGQPLGNLVLGYRPPQPVLFLS..RERLR
A6TRX6_ALKMQ/4-463DGFSIAALTQEFQQI......LPINKIEKVYQPEKD...E--ITLLIR.S.QGTNYR.LLLTASSNFPRAQFT..ST.PK
A8MH76_ALKOO/4-463DGFVVAALTHELKSE......LCNGRIDKVYQPETD...E--IILTVR.S.NGKNHK.ILLSADSNYPKIHFT..TS.NK
Q8KWV4_CLODI/4-463DGLVIHSIVDELSSK......LTGGKIDKIHQPEDD...E--VIFNIR.N.NKENFR.LVLSASASNPRVYLT..SNYQK
A7VD88_9CLOT/17-469DGVVISNVVSDLKKK......LVDGRIYKIYQPEND...E--LNIIIK.N.NRENYR.LLLSADASLPLIYLL..QV.PK
A5KQ53_9FIRM/44-496DGIVVAGLVHELKQK......LTDGRIAKIAQPEAD...E--LLLTIK.S.PCGQHR.LLISANASLPLIYLT..DT.NK
A7B5I6_RUMGN/4-456DGIVVANLVHELKEQ......LLNGRIAKIAQPEAD...E--LLLTIK.S.PKGQRR.LSISASASLPLIYLT..DA.NK
A6BEG8_9FIRM/4-456DGITVAAVVQELEHT......LVGGRISKIAQPEND...E--LLLTIK.G.NEGQKR.LYISASASLPLIYLT..NE.NK
A5ZQ83_9FIRM/4-457DGITIAAMVQELHKN......LDNGRFNKIAQPESD...A--LMITGK.G.ANGQCR.LFISASPSLPLIYFT..GK.NK
A5Z6K1_9FIRM/4-456DGVTVAALVKEFNTT......LKDGRIYKIAQTESD...E--LMLTFK.A.DKSQYR.MLLSANASLPLIYFT..NN.NK
A3DCY8_CLOTH/4-460DGIVTKNIVSELSDI......LTGARIEKIYQPEPD...E--IIINLR.T.KGQNLK.LLLSANASYPRIHLT..DV.TK
B8I3G9_CLOCE/4-460DGIVTKCIVNELNDL......LSGGRIDKVFQPEND...E--IVMMIR.S.KGQNYR.LVASANASNPRLHLT..TL.QK
B0KA21_THEP3/4-455DGITLHAIIKELKEE......IIGGRIDKIYQPEKE...E--LIFIIR.N.KGKNYK.LLLSANANYPRIYLA..EE.NK
Q8R9S1_THETN/4-455DGVTLHAIVKELKKE......IEGGRIEKIYQPEKE...D--LIFTIR.S.KGKNYK.LLLSANANYPRIHLT..KE.DR
Q0SRX7_CLOPS/4-452DGIYLYNLINELKDS......LINSRIDKINQPEKD...E--IIINVR...GKENKK.LLISSSSKYPRLHFT..TI.SK
A6LTU3_CLOB8/4-455DGIYLYSLVNNLEKS......ILNSKIDKINQPEKD...E--IILTLR.K.DRQNIK.LLISASPRFARIHLT..NS.TK
A5N7G3_CLOK5/4-459DGIFIHSILQELKSK......LLGGKVEKVNQPEKD...E--IILTIR.N.EKTPYK.LLISSSSIYPKIHIT..DK.NK
A7FUW8_CLOB1/4-455DGIFLFSMINEMKTK......ILNGRVDKVTQPEKD...E--IVLSIK.N.NRKTYK.LLISSSAVYPKIHFT..DI.PK
A0Q075_CLONN/4-456DGIFLYSIIDELKNT......IINGKIDKVNQPEKD...E--IILNIR.K.GRLSFK.LLISSSSNYPRIHLT..DL.TK
Q97HA2_CLOAB/4-451DGIYIHSILHELKDK......LLGGRISKVNQPEKD...E--INLTIRTT.SNSNIK.LLISANPTYPKIHIT..DL.IK
Q894E2_CLOTE/7-456DGLFLYATLEELKDS......ILNSKIYKINQPEKD...E--IVFSLK.K.DKNSYK.LLISASTMYPRIHCT..DI.NK
B8CWR5_HALOH/4-456DGIMLAAIKKELTEE......LQGARVDKIYQPEAD...N--LTFTLR.Q.PGQNIN.LFISAGARNPRIHIT..SL.KF
Q0AXH0_SYNWW/4-462DGITIRALCQELNPL......LNGARIDKIFQPEKD...D--LVLSVRTV.KSGSLR.LMLSANSRWARLHID..SI.KK
A6CPS5_9BACI/4-444DGLFTKAMTEELGDR......LNGGRINKIHQPYKN...E--VILIVR.S.QGKNHK.LLLSAHPSYARAQLT..SQ.SY
Q2B781_9BACI/4-444DGLFTRAMAHELSDT......LQGGRINKIHQPFKN...E--IVLVIR.A.NGKNHK.LLLSAHPSYARAQLT..HE.AY
Q3ERD7_BACTI/4-446DGLFTRAITHEIENS......LYTGRISKIYQPSKY...E--ILLHIR.A.NGKNQK.LILSSHPTYARMHLT..NQ.NY
A8FD29_BACP2/4-445DGIFTYGMTNELQET......LTGGRISKIHQPYKH...E--LIFHIR.A.NGKNHK.LLLSAHPSYARVQLT..EQ.QY
Q65JT4_BACLD/4-446DGIFTYGMIEELNEA......IRGGRIAKIHQPFKH...E--LVFHIR.A.NGKNRK.LLLSAHPSYARVHLT..NE.TY
A7Z4I4_BACA2/4-444DGMFTYGMTHELNNR......IAGGRITRVHQPFKH...D--VIFHIR.A.NGKNHK.LLLSAHPSYSRVHMT..NQ.AY
A4IM38_GEOTN/4-445DGVFTYAIVGELQEA......LAGGRITKIHQPSAY...E--IVMLVR.A.RGHNHK.VMLSAHPTYARVHLT..NE.TY
Q9K9X8_BACHD/4-445DGLMTRAIVHELQET......ISAGRILKIYQPFKT...E--LLLTIR.A.QGANHQ.LLLSANANFARVHFT..KE.KY
Q5WFK0_BACSK/4-443DGMMTRAITHELQQ.......LVGGRINKIHQPFKT...E--LVFTVR.A.KGKTRA.LLASANAVFARLHLT..TE.KY
Q8ER31_OCEIH/4-445DGIVTRAITEELENK......IVRGKIAKIYQPTDS...E--IVMTVR.N.NSVNQT.LLFSIHPTYARFHVT..ND.NF
B1YIQ7_EXIS2/4-442DGLMTTRVVQELQP.......LVGARINKIHQPYAL...D--LIFSVR.A.ERKNVM.LLASANAMYARLHLT..SE.ST
A3I4D1_9BACI/31-467DGLFTYSITADLQQ.......LVTGRITKIHQPNAQ...E--VILHVR.A.NGKNHK.LLFSIHSSYARVHLT..EQ.SI
Q49WZ0_STAS1/4-442DGLFTRKMVESLQF.......LVDGRIHKINQPEND...T--LLVVIR.Q.NRKNHQ.LLLSIHPSFARMHLT..NK.KY
Q6GA05_STAAS/4-442DGLFTKKMVESLQF.......LTTGRVHKINQPDND...T--ILMVVR.Q.NRQNHQ.LLLSIHPNFSRLQLT..TK.KY
Q6Q296_STRSU/4-430DGFFLHHMTAELRAN......LEGGRIQKINQPFEQ...E--IVLNIR.S.NRQSHK.LLLSAHSVFGRVQLT..QS.DF
P95752_STRGN/4-427DGFFLHHMTEELRHE......LVGGRIQKINQPFEQ...E--LVLQIR.S.NRKSLK.LLLSAHSVFGRVQLT..DT.TF
Q04KW2_STRP2/4-428DGFFLHHIVEELRSE......LVNGRIQKINQPFEQ...E--LVLQIR.S.NRQSHR.LLLSAHPVFGRIQLT..QT.TF
Q1JH72_STRPD/18-441DGFFLHHLTNELKEN......LLYGRIQKVNQPFER...E--LVLTIR.N.HRKNYK.LLLSAHPVFGRLQIT..QA.DF
Q5M4J6_STRT2/4-429DGFFLHHMTAELREQ......VLYGRIQKVNQPFER...E--LVLTIR.N.NRQNYK.LLLSAHPVFGRIQTT..KA.EL
Q3K0R3_STRA1/4-427DGFFLHHLTNELQEQ......IEKGRIQKVNQPFDH...E--LVLTIR.N.NRRNYK.LLLSAHPVFGRIQTT..EA.NF
Q8DTA9_STRMU/4-427DGFFLHHLTKELQEQ......ILWGRIQKVNQPFEQ...E--LVLTIR.N.NRQNYK.LLLSAHPVFGRVQLT..KT.DF
Q02YL2_LACLS/4-417DGIFLHHMTAELQP.......LVGGRIQKINQPFDQ...E--LVLTIR.S.AGKSHK.LLLSAHPVFGRVQLT..KT.DF
Q835X0_ENTFA/4-442DGVFTHSMVHELTET......LVSGRISKIHQPYEN...E--VVLVIR.A.KGKNHK.LLLSAHPSYARIQLS..TI.TY
Q3XYE6_ENTFC/4-444DGVFTHAMVNELRET......LLSGRISKIHQPYEN...E--IVLVIR.S.RGKNHR.LLLSAHPSYARVQIT..QI.DY
Q039A5_LACC3/4-439DGIFTHAMANELNAT......LSGGRVAKIQQPYEN...E--VVITIR.A.GRKNHP.LLLSANPQYARVQIT..HI.PF
Q38X19_LACSS/4-442DGLMTHAVVNELNTT......LADGKITKIQQPYAN...E--VILTIR.A.NRKTYP.LLLSAHPSYARVQVT..RV.PY
Q1WTS3_LACS1/4-435DGLFTHAMIHELNQT......LQNGRVTKISQPYPN...E--VILTIR.A.NRTNYP.VLLSANPRYARFQIT..QI.PY
Q03S51_LACBA/4-442DGSFTHAMVHELNQT......IATGRVSKINQPYAN...E--VVLTVR.A.NGHNYP.ILLSANPTYARIQST..QI.PY
Q03FM0_PEDPA/4-444DGLFTHAMVKELVNT......LKTGRVAKIYQPYQG...E--LVLTIR.V.NRKNKA.LLLSSHPNYARAQIT..EQ.TL
A5VK20_LACRD/4-442DGLFTHAIVHELDQK......LTTGRVAKVSQPYPA...E--LIITIR.A.HRHNYP.LLISANPTYPRIQIT..EI.PY
Q03W77_LEUMM/4-442DGLFTHAIVHELNDL......ITGGRITKVHQPYPN...E--IVLVVR.N.NGQNYP.LLLSAHPSYARAQIT..RI.PY
A0NJF9_OENOE/4-422DGLFLHSMTKELNKE......LAGGRITKIAFPFPH...E--IILTVR.S.FRKNRK.LLLSAHPVMARAQIT..KV.DF
Q04AL3_LACDB/4-439DGLFIHSLLNELQDE......ITAGRLHKIYQPFNN...D--LVLVFR.K.DRKNKQ.LLISANPEYPRLYLS..KE.SF
Q5FJY7_LACAC/4-438DGLFIHSLLQDLTPT......LVDGRLSKIYQPFEQ...D--LILTFR.K.NRKNYQ.LLISANAQYPRMYLT..EQ.TI
Q74JC6_LACJO/4-439DGLFIHSLLQDLSPT......LVGGKLTKIYQPFEQ...D--LVLNFR.K.DRKNQR.LLISANAQNPRFYIT..ND.TI
A6P056_9FIRM/4-462DAICLSAVAEELRAA......VLGGKIDKIYQPVRD...E--IVMAVR.G.SRENVK.LLLSASPNHPRVQLT..RI.TR
A7VVS0_9CLOT/4-460DGAFLRHLKKEITDR......ALGARVDKIYQPNKE...E--LVFLLR.T.RQEAFK.LLLSARANSPRIHFT..QY.AP
A9AW28_HERA2/4-452DALVVAAIVAELQI.......LVGGKIQQVVLPNPD...S--VGFEVY.A.DGQRHQ.LLLSANPKFARMHTT..PTKLT
B9LDK5_CHLSY/4-467DALTLTAVVEELRAT......VLDGRIQRVVLVGPL...A--IGLEVY.R.QGRRHY.LLASADAQMARIHLI..SQRPT
A5UZA2_ROSS1/4-464DALTLAAVVDELRAT......LVGGRVQHVLLPGEL...S--VALEIY....AGRRYYLVLSAHPQFARVHLS..PVRIS
Q24TV3_DESHY/15-479DGITLHHLVQELAPQ......LAGARIDKITQPEKE...E--IHLQLR.S.QGQSYR.LLLNISATAARLHLS..QT.SK
Q67PS6_SYMTH/4-455DSKVMAAVVEELNQR......LLGGRISKIYQPEPD...E--LALLCY.A.NGENHR.LLLSAHPRHARVHLT..QI.EK
A4J565_DESRM/4-461DGLVMAAVAQELTSG......LVGGRVEKIQQPTTH...E--LILVIHTR.EKGKQR.LLISADARDARIHFT..QA.SH
Q2RK36_MOOTA/4-459DGLFLAAISAELSG.......LTGSRVDRIFQPEKE...T--VILHLR.K.GRDTRK.LLLCSLSDQARVHLT..TA.SF
O86955_THENE/4-433DGVLLYKVVQELKE.......IEGEHLKQIYQPTSV...D--YYFLFR.......SSTVRVCLKPDVSHISLA..EK.EK
Q9WYJ8_THEMA/4-433DGLLLHKAVRELKE.......LEGEHLRQIYQPTTV...D--YYFLFR.......SATVRVCLRPDVSHVAIA..EK.EE
A6LP32_THEM4/4-418DGFVMRRFIDYARKR......LIGSYIKNFY.FQKN...V--IYIAFQ.......DVDLKISLNPSYSYITF...EK.RN
A7HKC1_FERNB/4-444DGFVMRGTVEQIAKK......IVGFNLRNVY.LSKH...I--LYFSFD.......NGDLKVSLNPNFSYISF...VN.HF
A8F860_THELT/4-437DGFVLKRIVDELSS.......LEGAKLRQIYQYGKS...D--IYLYFQ.......NAVVRICLEPSLAHICYT..EK.ED
A9BHH2_PETMO/4-409DGLVLHKVLKEIKDN......IMGDRIKNIYQPIKS...Q--VLIQFS.......QNFVLLSLISPSYVILLS..QK..P
Q8RFL3_FUSNN/5-423DGISLSKIKEELKKG......LEGKRINRIFKNNEY...T--ISIHFG.......KIELLLSCIPSLPICYIT..KSKEQ
A4XM08_CALS8/4-456DGVVLSRLKKELTLE......LTEGKVERIYQPNQF...E--INLYIY.K.LGMTKK.LIISANPSLPKIYIT..EK.QK
Q0SNG5_BORAP/4-345NYVEINTLIKEIP........FTNSLIKKIIQPDYK...S--LILEIYNK.IENKKLKILISLNPSTTRFHIT..KK.KF
Q5DRG6_BORTU/4-340NYSEINILLKEVP........LKNSFLRKIKQPNHK...T--LIMELYNKETEKKNFNILISLDPKKTRIHKT..NK.KF
Q73MD0_TREDE/4-337NNKEIDLILEELK........LEGFFIQKIIQPSYT...A--LVFYLY....KDKPLTLFISLDAGACRLHST..RK.KI
Q3A4K7_PELCD/16-444DVFYIEAVVDQLQSL......VTGASVKKIHQPDAD...T--IILRLW...NGRRELRLRISATVGATGLYLT..ER.TW
Q18J82_HALWD/8-471TSVDIAALVTELRR.......YTGAKVDKTYRYGDD...L--LRFRMRDF.DRGR.LELLIEV.GTQKRIHTADPDH.VP
Q3IRW5_NATPD/8-460TSVDLAALVGELRD.......YTGAVVDKAYLYGDD...F--VRLKMRDY.DRGR.IELLIEV.GDPKRAHVAVPEH.VP
Q8TZ51_METKA/10-472TSFDVRATARELDSL......LEGALIDKIYQVGER...E--LKVKVHVP.GVGSHY.LVWEP...GMRVHLT..WR.PK
Q5JDJ5_PYRKO/6-451SSVDIRYIVRELQW.......LVGSRVDKVYHDGD....E--VRFKLR.T.KEGR.ADLILEA...GKRFHLT..SY.IK
Q8U137_PYRFU/6-450SSVDIKYITEELKDM......IVGSRVEKIYHEGN....E--IRFKLHKT.GVGR.VDLLIEA...GKRIHIT..TY.VK
O28241_ARCFU/5-423SSFDIKACVRELKE.......LEGGKVEKVYHHPPD...E--IRIRIY....AGRKVDLVIEA...GRRIHLT..KF.PK
Y1625_METJA/6-475TNVDVCCVVDELQN.......LINGRLDKAFLIDNEQNRE--LILKIHVP..EGGSRELVISI...GKYKYITLTNY.ER
A5ULA5_METS3/5-462SNVDIFTITDELNNL......LTGARVDKSFQPTKD...I--VVMRFHVA.GTGR.IDLVMEC...GKRIHTS..KY.PL
Q2NGY7_METST/2-454SNVDIHRMVNELNKE......LINTRIDKAYQPDVD...T--IRIKLRKA.GEGR.KDLVIQA...GVRIHLT..NY.PQ
O27929_METTH/8-458SNVDVFAVTSELNEM......LRGARVDKAYQPLRD...T--VIIRFHVP.GEGR.VDVVMQA...GVRIHRT..NY.PP
Q8TSZ2_METAC/6-492SSADVAAVVAELSAGP...RSIIDAKIGKIYQPASE...E--IRINLYVF.HQGR.DNLVIEA...GKRLHMT..KY.VR
A0B9D2_METTP/6-429SNVDVAAIVAELQTR......IAGGFFGKAYQSSGD...A--IWLTIQAR..EGR.LDIILEA...GRRAHVT..RK.ER

PF00416

RS18B_YEAST/16-144-------------------------RLLNTNVDGNI---K..IVYALT--------------------------------
RS13_SHIFL/3-108-------------------------RIAGINIPDHK---H..AVIALT--------------------------------
RS13_GEOSE/3-107-------------------------RIAGVDIPRDK---R..VVISLT--------------------------------
RS18_RAT/14-142-------------------------RVLNTNIDGRR---K..IAFAIT--------------------------------
RS13_MYCBO/3-109-------------------------RLVGVDLPRDK---R..MEVALT--------------------------------
RT13_ACACA/5-110-------------------------QNFNTFVSDNK---NKNIFSALK--------------------------------
RR13_ARATH/49-153-------------------------RVGGVEIPANK---R..IEYSLQ--------------------------------
RS13_SULAC/11-139-------------------------RLFGQDVDGTM---K..LPYALA--------------------------------
RS18_ARATH/14-142-------------------------RVLNTNVDGKQ---K..IMFALT--------------------------------
RT13_DAUCA/3-109-------------------------YISGARLVADK---Q..VRIALT--------------------------------
RS18_DROME/14-142-------------------------RIMNTNIDGKR---K..VGIAMT--------------------------------
RT13_PROWI/3-109-------------------------YIQNTHLNDKK---Q..IYQACA--------------------------------
RS13_MYCSP/3-106-------------------------RVLNIEIPNNK---K..ARISLT--------------------------------
RT13_MARPO/3-109-------------------------YILGTNLNSNK---Q..VKIALT--------------------------------
RS13_HALMA/25-152-------------------------RIGQTDLDGTK---S..VERALT--------------------------------

PF06831

FPG_MYCGE/140-225........FQKAQNS...K....R...-----------------------------------------------------
FPG_LACLC/132-225......KLFREKLRK...S....T...-----------------------------------------------------
FPG_HAEIN/129-213......DEFNAEYLF...K....KSRQ-----------------------------------------------------
FPG_MYCPN/135-227........FNKGHKS...N....K...-----------------------------------------------------
FPG_ECOLI/129-219......EYLHQKCAK...K....K...-----------------------------------------------------
Y5760_STRCO/124-214.........DNLRAD...P....P...-----------------------------------------------------
FPG_BACFI/134-226......ELLMNAFQK...T....N...-----------------------------------------------------
FPG_STRMU/132-222......KPFEEGLAK...S....H...-----------------------------------------------------
FPG_SYNY3/143-233......DFTAEYLYE...KLKSSR...-----------------------------------------------------
Y3325_MYCBO/123-203........AANLIVA...P....D...-----------------------------------------------------
FPG_SYNEN/137-229......AFLAARLAH...C....R...-----------------------------------------------------
FPG_NEIMB/135-227......DYLYARLKA...Q....K...-----------------------------------------------------
END8_ECOLI/126-214.........KERLLSPRFR....N...-----------------------------------------------------
FPG_MYCTU/144-234..RFDCDAVVKVLRR...K....H...-----------------------------------------------------
FPG_THET8/122-214......PGFFRGLKE...S....A...-----------------------------------------------------
FPG_BACSU/134-224......AYLKDRLAK...T....N...-----------------------------------------------------
Y2491_MYCBO/126-218.........WSRITK...S....R...-----------------------------------------------------
O93997_CANAX/191-306RARLSIDEFSALILS...K....K...-----------------------------------------------------
O80358_ARATH/146-238......DEFAESLAK...K....K...-----------------------------------------------------

PF05833

C1KWC8_LISMC/4-447ENPATPPMFCMLLRKYLEGAIIESITQ.LPNERILQFSIRGK................DDI.GENRFCD........LFV
A3Z5Y2_9SYNE/15-450..KGGGSTLAQQVQHSLRQLALVQIEQ.QGFERVVSFALATR...................PGDPIQRR........LVL
Q05WQ7_9SYNE/10-434..QGSGSTLAQQTQHSLRQLALVAIEQ.QDFERVVCFDFASR...................PGDPVQRR........LVL
Q7U569_SYNPX/23-449..QGAGSTLSQQIQHSLRQMALIELVQ.TGFERVVEFRMAPR...................PGDAVQRV........LVL
A5GMV8_SYNPW/10-441..HGGGSTLAQQVQHGLRQLALVEIEQ.HDFERVVLFHLAPR...................PGHSPIRT........LVL
Q0I869_SYNS3/10-447..QGAGSTLAQQIQHGLRQLALSELSQ.EGFERVVQFQLAPR...................PGQPPQRT........LVL
Q7V657_PROMM/52-482..LGSGSTLAQQIQHGLRQMALIELKQ.KGFDRVVECGLAHR...................PGEPIERT........LVL
A5GRV1_SYNR3/5-448..LGEGSTLAQQLQHGLKGLALVRLEQ.LPWERVVHLGFAPR...................PDAPEQRQ........LVL
Q46GV7_PROMT/10-438..YGEKSTLAKQIKHLLVNLALVDITQ.IGFERIVRFKFSSR...................PGKEIEKE........LIV
Q7VDB7_PROMA/10-439..ISGESTLCKQIKFGTKGMALIELKQ.NGFERIVEFGLAFR...................PNENFEKF........LVL
Q8DHA1_THEEB/5-448..QPDTFTFSQQLHAQLNRLALVRVGLINPWERVVVLEFAPR...................PQEATQWR........LYA
Q31PG3_SYNE7/5-452..DPDTFTLSQQLQAVLKGFALIDLHIPQPWERIVTLSFGDR...................PGDPPRFR........LLL
P73561_SYNY3/5-464..EPDTFTFSDQLRHQLKGLALISLKPLQPWERVIDLAIAKR...................PGDEPLYH........LFL
Q8YP27_NOSS1/5-452..TPDTFTFSQQLVHQLGGLALVAIEAIAPWERVIDLQFARR...................PGDAALYH........IYG
Q110R4_TRIEI/5-453..IPDTFTFSQQLKHQLNGLALIAIAEVSPWERVLDFQFAKR...................PGEKPLWH........LYV
A0YTA6_LYNSP/5-455..IPDTFTFSDQLRHQLSGLALVAIAEVSPWERVLDLQFAKR...................PGESPLWH........LYV
Q4C6V5_CROWT/5-452..TPDTFTFSDQLRHQLNGFALVNLKMISPWERVVNLQFAKR...................PGDETVWH........LYV
Q2JJS2_SYNJB/5-470..EPDGFQFSQFLQRHLKGLALTELALLEDWERVIDLRFAPR...................PGDPPYRH........LYL
Q2JXM6_SYNJA/5-461..EAEDLPFSQHLQRHLRGLALTELALLDEWERVIDFRFAPR...................PADPPQRH........LYL
Q7NK58_GLOVI/5-445..KGARFSFASTLHQYLGGRVLVHCVQ.PQWERIVRLGFARR...................PEQEPEVE........LHV
A4S6P0_OSTLU/47-508VEKGMNLSFGESANALLKGKVLLDARVGTAWERACRLRFGDR...................PGGEAEYE........LLC
Q2IMA8_ANADE/4-353PQPDAPYAVQAVLRRELEGARLAGLET.LPGDRVVALSFERA...................PARGGPVR........LVA
A7H6P3_ANADF/4-347PQPATPFPFQVLLRREIEGARLAAIET.LPGDRVVALALETP......................RGRLR........LVG
Q9RWV6_DEIRA/9-409GDPHNP..FQRLLATRVRG.ELLKIEQ.FKLDRVVALHFGPA................EGF.IDQPPAR........LLF
A6TRX6_ALKMQ/4-463ENPSVAPNFCMLLRKHIQGGRIVQIKQ.PDFERVIRFTIETY................DEL.KVACSRT........LII
A8MH76_ALKOO/4-463ENPSSPPNFCMVLRKHLMGGRIVDIVQ.PQFERIVKIIIESL................DEL.NILKSKE........LMI
Q8KWV4_CLODI/4-463ENPLKAPMFCMLLRKYIQGGNIVEISQ.IGFERIIKISVESL................DEL.KEKTVKN........IMI
A7VD88_9CLOT/17-469ENPMTAPNFCMLLRKHIGNGRIVDVCQ.PGFERIVEFTIEHL................DEM.GDLCRKK........LII
A5KQ53_9FIRM/44-496PSPITAPNFCMLLRKHISNSRITDISQ.PKLERIICFTIEHF................DEL.GDLCQKK........LIV
A7B5I6_RUMGN/4-456PSPMTAPNFCMLLRKHIANGRIVDIWQ.PKLERIIHFTIEHL................DEL.GDLCRKD........LIV
A6BEG8_9FIRM/4-456PSPMTAPGFCMLLRKHIGGGRITAVSQ.PSLERIIHLDIEHL................DEM.GDLCRKK........LII
A5ZQ83_9FIRM/4-457PNPLTAPNFCMLLRKHLSSARIGSISQ.PGLERVVEFELEHL................NEL.GDPCKKY........LIV
A5Z6K1_9FIRM/4-456PSPMTAPNFCMLLRKHINNGRIVSITQ.PGLERIVDFEIQHL................DEL.GDIKIKH........LII
A3DCY8_CLOTH/4-460ENPINPPVFCMLLRKHLSGGKITKIDF.HDFERVVTIHIETI................DEL.GDLTFKK........LVV
B8I3G9_CLOCE/4-460ENPAAPPVFCMLMRKHVAGGRLLNISF.HDYERIITLNIESV................NEL.GDLTVKR........LVV
B0KA21_THEP3/4-455ENPAEPPMFCMLLRKFLQSGRIIDIKQ.VEFDRIVKIDIETK................DEL.ENQTIKT........LII
Q8R9S1_THETN/4-455ENPLEPPMFCMLLRKHLQNGRIAEIRQ.VEFDRIVEIDIETK................DEL.QNQAIKT........LVV
Q0SRX7_CLOPS/4-452NNPLQPPVFCMVLRKYLTGGRIIDIYQ.QSTDRIVSIDIANK................DEM.GFHSVYT........LVV
A6LTU3_CLOB8/4-455ENPIKAPMYLMVLRKYILGGRITNVTQ.KDNDRILIIEIENR................DEL.GFDSLYS........LIV
A5N7G3_CLOK5/4-459KNPLQPPMFCMILRKYLNSSKLINISQ.LDTDRVIFLDFQSL................NEL.GFDNIYT........LVI
A7FUW8_CLOB1/4-455KNPMQPPMFCMVLRKYLNSSKIINIRQ.LDTDRIVLIDFESA................DEM.GFNSIYT........LII
A0Q075_CLONN/4-456PNPIKAPMFCMVLRKYISNAKIVDIHQ.INQDRIVVIDFEST................DEL.GFNSIYS........LII
Q97HA2_CLOAB/4-451TNPIKAPMFCMVLRKHLLNSRILKIDQ.IESDRIVIIDFETT................DEL.GFNSIYK........LYI
Q894E2_CLOTE/7-456KNPMTPPMFCMILRKYLSNSKITSIYQ.LQLDRVVFIDLQGK................DEL.GFEKTYT........LII
B8CWR5_HALOH/4-456KNPLTPPAFCMLLRKYLINGTIGEIKQ.PDFERILEITINKK................NNI......YR........LII
Q0AXH0_SYNWW/4-462PNPTKPPAFCMLLRKYLEGGKIQEIKQ.VDFERIIHIDIEAL................DDF.REWKIKR........LIC
A6CPS5_9BACI/4-444ENPSVPPMFCMLLRKHLEGYIIEDVYQ.KEVDRIIIFEIKGR................NEI.GDISYKQ........LII
Q2B781_9BACI/4-444ENPSEPPMFCMLLRKHLEGYILEDIRQ.VGLDRILILDVKGR................NEI.GDISYKQ........LIV
Q3ERD7_BACTI/4-446DSPAIPPMFCMLLRKHLEGGFIEKIEQ.IDLERIIQITVRSR................NEI.GDESLKT........LVI
A8FD29_BACP2/4-445DNPSEPPMFCMLLRKHLEGGFIERFEQ.IGFDRVIVLHVRSR................NEI.GDEQTRK........LYI
Q65JT4_BACLD/4-446DNPSTPPMFCMLLRKHLEGGFIDQVEQ.IGMDRMMVFHIRSR................NEI.GDTLTRK........LMV
A7Z4I4_BACA2/4-444ENPSEPPMFCMLLRKHIEGGFIEKIEQ.AGLDRIMIFRIKSR................NEI.GDETVRT........LYV
A4IM38_GEOTN/4-445DNPPEPPMFCMRLRKHLEGSIVEAIRQ.VEFDRIIVIDTKGR................DEL.GDVQTKQ........LII
Q9K9X8_BACHD/4-445ANPATPPMFCMLLRKHLEGAVIEEIKQ.IDLDRIIEITVKTR................DEI.GDTSYKT........LVI
Q5WFK0_BACSK/4-443DNPAEPPMFCMLLRKHLEGGIITSITQ.HGYDRIIVLKVANK................DEL.GDTTEKT........LIV
Q8ER31_OCEIH/4-445TNPKEPPMFCMILRKHLSGAIIEKIEQ.KSLERIVIFSIRTR................NEI.GDISYKQ........LII
B1YIQ7_EXIS2/4-442SNPSEPPMFCMMLRKHLEGGFIESIEQ.LGRDRVILMRVRSR................NEL.GDEEAKK........LYI
A3I4D1_9BACI/31-467ENPAEPPMFCMLLRKHLEGGFISSVKQ.LGFDRIIIVEIESK................NEI.GDPIVRQ........LHA
Q49WZ0_STAS1/4-442DNPFDPPMFARVFRKHIEGGIVKAVRQ.IGNDRRVEIDVQSK................DEI.GDTIYRT........IIL
Q6GA05_STAAS/4-442DNPFNPPMFARVFRKHLEGGIIKSIKQ.IGNDRRIEIEIKSK................DEI.GDTIYRT........VIL
Q6Q296_STRSU/4-430TNPKVPNTFTMILRKYLQGAIIEEIRQ.LDNDSILEFSVSNK................DEI.GDHIQAT........LIV
P95752_STRGN/4-427ENPAVPNTFIMVMRKYLQGAVIEAIQQ.VENDRILEISVSNK................NEI.GDSVAVT........LVI
Q04KW2_STRP2/4-428ENPAQPSTFIMVLRKYLQGALIESIEQ.VENDRIVEMTVSNK................NEI.GDHIQAT........LII
Q1JH72_STRPD/18-441QNPQVPNTFTMIMRKYLQGAVIEQLEQ.IDNDRIIEIKVSNK................NEI.GDAIQAT........LII
Q5M4J6_STRT2/4-429PNPQNPNTYTMIMRKYLQGAVIEDIQQ.LENDRVLEISVSNK................NEI.GDSVKVT........LVM
Q3K0R3_STRA1/4-427QNPQNPNTFTMIMRKYLQGAVIETIQQ.IENDRILEIVVSNK................NEI.GDHIKAT........LVV
Q8DTA9_STRMU/4-427QNPQSPNTFTMIMRKYLQGALIENIEQ.IENDRILEMSISNK................NEI.GDQIKVT........MII
Q02YL2_LACLS/4-417QNPQNPNNFVMILRKYLAGAFLEKIEQ.VENDRQIIFHISTK................DEI.GDSLKIA........LIA
Q835X0_ENTFA/4-442SNPETPPNFVMMLRKFLDGAILETIQQ.IENDRVIHFTFSKR................DEL.GDLQNIV........LIV
Q3XYE6_ENTFC/4-444QNPDNPPNFVMMLRKYLDGAILEDIEQ.IENDRVIHFHFAKR................NEL.GDLQNII........LIV
Q039A5_LACC3/4-439TNPDVPATFTMTLRKYFNAATLTAVHQ.VQNDRVLHFEFSTR................DEL.GDELGLR........LII
Q38X19_LACSS/4-442ANPATPPNFAMTLRKYLDGAILEQIEQ.VESDRILRLTFKSR................NEL.GDMQKLC........LIV
Q1WTS3_LACS1/4-435TNPAVPTNFTMMLRKYLEGAKLLEIKQ.LDNDRVVYFEFLTR................NEL.GDKLPLL........LSA
Q03S51_LACBA/4-442INPPTPTNFTMILRKYLQGAILKEITQ.VANDRVVHLHFTSR................NEL.GDQQELL........LII
Q03FM0_PEDPA/4-444TNPSTPSNFVMSLRKHLDGAILKDITQ.VENDRIINLHFAHR................NDI.GDEEDLI........LSV
A5VK20_LACRD/4-442KNPAVPTNFTMTMRKYLEGAIVNKIEQ.VDNDRIIKITFDTR................DEL.GDSQQLV........LVS
Q03W77_LEUMM/4-442ENPQTAPNFVMFLRRYLEGAKLQKIEQ.VENDRIINFYVNAR................NEL.GDIQEIR........LTL
A0NJF9_OENOE/4-422ENPITAPNFVMVLRRYLQGGKILAFRQ.IANDRILEILVANA................NEI.GDAVSYK........IVL
Q04AL3_LACDB/4-439SNPNVAPLFVMVLRKYLEGSVLQEISQ.VGLSRIVNFSFSNR................NEL.GDEIQLI........LSV
Q5FJY7_LACAC/4-438ANPDKAPIFVMVLRKYLEGSVLQSIEQ.IGVNRIINLHFSNR................NEL.GDQVKLV........LSV
Q74JC6_LACJO/4-439ANPDVAPTFVMVLRKYLEGSVLQKIEQ.IGVERIVNFHFSNR................NEL.GDEMQLI........LSV
A6P056_9FIRM/4-462ENPDTPPMFCMLLRKHLTGARILDITQ.PPVERLVEFRLECL................DEL.GDRVERR........LVL
A7VVS0_9CLOT/4-460ENPKVPPMLCMLLRKRLSGAKLVEVRQ.PGLERLLYLDFDAA................NEL.GDKVRLS........LVI
A9AW28_HERA2/4-452RDPNADSPLLLLLRKYVRGGRITKIES.APLERVISLSIAKMPIPRKEL..EPDDDDDDEVMLTPRYSE........LVL
B9LDK5_CHLSY/4-467RGVDGETPFLLLLRKYVLGGRIVNIEQ.PPYERVVVLSITKPTESRKQTFDPDELIADDDN.DDDLTADADHLLHCDLIV
A5UZA2_ROSS1/4-464RGTDATPPLLLLLRKYVNRGRITAIEQ.PDLERVLLLSIAKRPLLRNSD..DEPELDSDDEDRPDTTSPENETLRCELIV
Q24TV3_DESHY/15-479KNPASPPMFCMILRKHIEGGKILSLEQ.LGLERIVLLTVQNY................NEY.GDLATLH........LYL
Q67PS6_SYMTH/4-455RNPPTPPMFCMLMRKYVEGGRIVAIEQ.AGRDRICRIAIRNA................DEL.GNPVTYL........LVA
A4J565_DESRM/4-461VNPLSPPIFCMVLRKHLEGGRIRSVEQ.IGLERILQFTVDSR................DEL.GRPGEKH........LIC
Q2RK36_MOOTA/4-459TNPPTPPLFCMVLRKHLEGGILTAVEQ.PGLERVLKLHFNTT................DEL.GRQAPRL........LLI
O86955_THENE/4-433ASEKMPSSFMMLLRKELKGAKLLKVEQ.IGMDRSIRFVFEKL................DEIEGTVQRE.........LFV
Q9WYJ8_THEMA/4-433ASEKMPSSFTMLLRKELKGAKLLKVEQ.IGMDRTLRFSFEKF................DEIEGIVQKD.........LYI
A6LP32_THEM4/4-418ISNVVKHHFVDFLRSRVKGGRLKDIIT.FGFERTVKFVVEKV................DEI.GIAHEYE........MYV
A7HKC1_FERNB/4-444VEDPEKNNFVEFLRSRIRGAKVVDFSN.IQYERTVVLELKKI................DEI.GVVHNYV........LYF
A8F860_THELT/4-437FSDHRPSNFVLLLRTKLRNARVRKVCQ.VSLDRVMFFEFDKI................DEI.GNRHFYR........LYI
A9BHH2_PETMO/4-409NVPIQPANFSQFLRKKIRNGRVVNVEQ.LGLDRIGYFEIESY................DQETSTMRKYK........LFF
Q8RFL3_FUSNN/5-423PILDIASSIISNLRKNLMNAMLTDIEQ.LGFDRILAFHFSRI................NEL.GEIKKYK........IYF
A4XM08_CALS8/4-456KNPEVAPNFCMILRKNLLGAKITNIYQ.EGLERIVKIEFETK................NEL.GDIERKY........IIF
Q0SNG5_BORAP/4-345KKNTLKLRFSEFLKSKIQNGKIIKAFQ.MKNERIISLEILKK.......................DIII........LFI
Q5DRG6_BORTU/4-340ENTKPPLRFFEFLKSKVQNGKILEAYQ.IKNERIILIKVFKD......................KIIIF........IFI
Q73MD0_TREDE/4-337PKFDKPMRFMELLKSRIKGGKILKAEQ.LNEDRIIRLHIASG......................AGDFF........LYL
Q3A4K7_PELCD/16-444INPANPLRFCQLLRARLS..RLRSVRQ.LFGERIVVFTFDGQ.....................DDSTYQ........LIA
Q18J82_HALWD/8-471DAPERPPNFAMMLRNRLSGADLVNVEQ.FEFDRIMILSFERG......................EEMTR........IIV
Q3IRW5_NATPD/8-460DAPGRPPNFAMMLRNRIAGANFEGVEQ.YGFDRILTFRFERE......................DQTTL........IVA
Q8TZ51_METKA/10-472PSPDQPTSVSQALRNTLSGDRIERVTQ.LGFDRILRFDLRSG.........................RR........VHV
Q5JDJ5_PYRKO/6-451EAPKQPSSFTMLLRKHLGGGFIDAIEQ.HQFDRIVKIRIGNY..........................T........LIG
Q8U137_PYRFU/6-450ENL.QPTSFAMLLRKYLSGKFLEDIRQ.YEFDRVVILSFGEY..........................F........LIA
O28241_ARCFU/5-423QAPRFPSAFAMLLRKHLEGARIKKIEQ.YDFDRVVVIEFERF......................GEIRR........IVA
Y1625_METJA/6-475EKPKLPPSFAMLLRKYLKNAKLIKIEQ.VNFDRVVIFHFETR......................DGIYK........LVA
A5ULA5_METS3/5-462ENPINPPVFPMLLRKRIKGANVVSITQ.HNFDRIIEIKVKKD.......................KYYT........IVV
Q2NGY7_METST/2-454PNPTIPPNFPMLLRKHLSGGSITSIEQ.HNFDRIIKIKVQKK.......................EEYT........ILV
O27929_METTH/8-458QNPKVPPSFPMLLRKHLKGGVVREVRQ.HGFDRIVEITVEKD.......................QEYT........LMV
Q8TSZ2_METAC/6-492ASPTLPQAFPMLLRKYLMGGRIISVEQ.HDFDRIIKIGIERA......................GVRST........LIV
A0B9D2_METTP/6-429VVGRTPPQFPAMLRSRLSGGRIVSVEQ.HDFDRVMEICVERS......................DGRYR........LVV

PF00416

RS18B_YEAST/16-144--------------------------------------------------------------------------------
RS13_SHIFL/3-108--------------------------------------------------------------------------------
RS13_GEOSE/3-107--------------------------------------------------------------------------------
RS18_RAT/14-142--------------------------------------------------------------------------------
RS13_MYCBO/3-109--------------------------------------------------------------------------------
RT13_ACACA/5-110--------------------------------------------------------------------------------
RR13_ARATH/49-153--------------------------------------------------------------------------------
RS13_SULAC/11-139--------------------------------------------------------------------------------
RS18_ARATH/14-142--------------------------------------------------------------------------------
RT13_DAUCA/3-109--------------------------------------------------------------------------------
RS18_DROME/14-142--------------------------------------------------------------------------------
RT13_PROWI/3-109--------------------------------------------------------------------------------
RS13_MYCSP/3-106--------------------------------------------------------------------------------
RT13_MARPO/3-109--------------------------------------------------------------------------------
RS13_HALMA/25-152--------------------------------------------------------------------------------

PF06831

FPG_MYCGE/140-225--..K.VKTFILDQTV----------------------------------------------------------------
FPG_LACLC/132-225--..KKIKPYLLEQTL----------------------------------------------------------------
FPG_HAEIN/129-213--KSTALKTFLMDNAV----------------------------------------------------------------
FPG_MYCPN/135-227--..K.IKTFILDQTN----------------------------------------------------------------
FPG_ECOLI/129-219--..TAIKPWLMDNKL----------------------------------------------------------------
Y5760_STRCO/124-214--..RALGEALLDQRN----------------------------------------------------------------
FPG_BACFI/134-226--..RKIKVALLDQKT----------------------------------------------------------------
FPG_STRMU/132-222--..KVIKTLLLDQHL----------------------------------------------------------------
FPG_SYNY3/143-233--..RPLKNALLDQRL----------------------------------------------------------------
Y3325_MYCBO/123-203--..RPIAEALLDQRV----------------------------------------------------------------
FPG_SYNEN/137-229--..RSIKTALLDQSI----------------------------------------------------------------
FPG_NEIMB/135-227--..RAVKLALMDNAV----------------------------------------------------------------
END8_ECOLI/126-214--..RQFAGLLLDQAF----------------------------------------------------------------
FPG_MYCTU/144-234--..SELKRQLLDQRV----------------------------------------------------------------
FPG_THET8/122-214--..RPLKALLLDQRL----------------------------------------------------------------
FPG_BACSU/134-224--..RAVKTALLDQKT----------------------------------------------------------------
Y2491_MYCBO/126-218--..RPIGALLMDQTV----------------------------------------------------------------
O93997_CANAX/191-306--..KPIKSLLLDQAY----------------------------------------------------------------
O80358_ARATH/146-238--..ITIKPLLLDQGY----------------------------------------------------------------

PF05833

C1KWC8_LISMC/4-447EIMGRHSNITLVDRAK...NVIVDCIKHVSPAQNS.YRTLLPGATYVLPPATDKLHPF..EVTS.E.QILDR....LDF.
A3Z5Y2_9SYNE/15-450ELMGRHSNLMLLDPDQ....RIIAIGRQVRDHQSR.VRPISTGDLYVDPPGLQGQIPS..LEESFD.RWKQR....LTL.
Q05WQ7_9SYNE/10-434ELMGRHSNLLLLDERQ....RVIAIGRQVRDHQSR.VRPISTGDPYSPPPPLQGRPPD..EAESFE.RWKQR....LSL.
Q7U569_SYNPX/23-449ELMGRHSNLLLLGEQR....QVVALGRQVRDHQSR.VRPIGTGDAYLPPPPLQGQAPS..STEGFE.RWRER....LRL.
A5GMV8_SYNPW/10-441ELMGRHSNLLLLDEQK....RITAIGRQVRQHQSR.IRPLSSGDVYTPPPALQGLPPT..LDEPYE.QWQRR....LSL.
Q0I869_SYNS3/10-447ELMGRHSNLLLLDDRQ....RITAIARQVRMHQSR.VRPIGTGDVYSAPPALQGIAPR..LDEPEQ.RWRER....LEL.
Q7V657_PROMM/52-482ELMGRHSNLLLLDRQR....QVITLGRQVRNHQSR.VRPIGTADIYVAPPPMQGREPS..SKESLK.RWKDI....LCL.
A5GRV1_SYNR3/5-448ELMGRHSNLFLLDERQ....QVISSGRQVREHQSR.LRPISTGDSYSAPPPLQGAEPQ..VQESLE.RWRQR....LLL.
Q46GV7_PROMT/10-438ELMGRHSNILLLDRSG....KVITLGKQIKESQSR.LRPIGTGDIYTSPPPLKGLVPV..LSEPFN.SWKEN....ICL.
Q7VDB7_PROMA/10-439EIMGRHSNFLLLNESR....QVITLGKQVRKNQSR.LRPIGTGDKYVPPPPLNGQPPK..RSESFE.EWKSN....LSM.
Q8DHA1_THEEB/5-448EIMGKYSNVILVNAAG....EIVTAAHQVSPQQSR.LRPILTGQPYVPPPPLTAALPS..GEIPFE.QWQQQ....VSV.
Q31PG3_SYNE7/5-452EVMGKYSNLVLVNGDS....EIVTVAHQVSDRQSR.LRTVRTGEPYEWPPALTTPIPD..LDEPFD.RWCER....LQL.
P73561_SYNY3/5-464EVMGKYSNLILTDAQR....QIITVAHQVNSQQSR.VRTVQTGQPYQSPPALLATPPS..LTESFS.SWQER....VQL.
Q8YP27_NOSS1/5-452EIMGKYSNVILTDANN....LIITAAHQVSQQQSS.VRPILTGQPYEAPPKLTGTIPS..LQETQA.RWQER....VSL.
Q110R4_TRIEI/5-453EVMTKYSNVILTTVDN....LVITCARQINIQQSS.VRQIQTGQPYELPPSLTNSIPR..VSETQQ.HWQER....ISL.
A0YTA6_LYNSP/5-455EVMSKYSNVVLTGKDH....LIVTAAHQVSSQQSS.VRPIQTSQPYELPPSLTDPIPR..LNEPQE.QWQRR....VSL.
Q4C6V5_CROWT/5-452EIMGKYSNVILTDNKQ....QIVTVAHQVNANQST.VRTVQTGRSYELPPTLTGTFPK..SEESQE.RWQER....VSL.
Q2JJS2_SYNJB/5-470EVMGKHSNAILVDEAG....MILASGHGVSERQSR.IRPVQPGLPYEAPPALTDPIPQ..RSEPFS.CWQER....VAL.
Q2JXM6_SYNJA/5-461EVMGKYSNAILVDEGG....MILACGHGVSERQSR.VRPVQPGLLYEAPPALSDPIPQ..RAEPFS.QWQER....LAL.
Q7NK58_GLOVI/5-445EVMGKYSNIVLTDPSG....QILALAHSVSAAQSR.VRPLLLGEIYQSPPPLSGPIPN..PDEPFA.SWCAR....LSV.
A4S6P0_OSTLU/47-508EVMGRYSNAFLLDSKNN..DEVLACGYQVGEKQTS.VRRLAIGYAYEPPPSAPGIDPTTGVEGGVD.GWTAV....LRDV
Q2IMA8_ANADE/4-353ELTGRHGNLFLVDAAG....IIRAAAAR...NLSQ.RRDLAVGRPYQ.PPSLPPAGPG......................
A7H6P3_ANADF/4-347ELTGRHGNLFLLGDDG....IIRASAGR...NLSQ.RRKLVAGEPYVAPAPPPSPRVE......................
Q9RWV6_DEIRA/9-409EVTGRNANLLVMEEGEGFAGRITLAAREITGSRNR.FRTIRSGGPYTPPPPYDKFDPR..TMTPAD...AQT........
A6TRX6_ALKMQ/4-463EMMGRHSNIILINNEN...NKVIDSIKRVSLDISR.FRQVLPGLPYQLPPSQDKKNPV..TINTFE.EFKEA....LDS.
A8MH76_ALKOO/4-463EIMGKHSNIILVDSET...NKIIDSIKRVPFDVSR.YRQILPGLQYAMPPSQDKFDPQ..GISM.E.DFLSI....LKEK
Q8KWV4_CLODI/4-463EIMGRHSNIIITHGEE...NKIIDSIKRVPFSISR.VRQVLPGHDYSLPPEQNKLNPL..DDISKD.LFIKN....LEE.
A7VD88_9CLOT/17-469EIMGKHSNIIFTDADG....MIIDSIKHISHLVSS.VREVLPGKAYVYPPSGDKRPPY..DADR.D.YFIST....VYT.
A5KQ53_9FIRM/44-496EIMGKHSNIIFCSEDG....TIIDSIKHVSAQMSS.VREVLPGRKYFIPDTMHKKDPL..TTEW.K.EFSLS....VND.
A7B5I6_RUMGN/4-456EIMGKHSNIIFCTSDG....TIIDSIKHVSAQMSS.VREVLPGRDYFIPDTMEKADPL..TISE.A.EFHTL....LRA.
A6BEG8_9FIRM/4-456EIMGKHSNIIFCDLNG....RIIDSIKHVSAQMSS.VREVLPGRDYFIPDTMSKKNPM..TATQ.E.EFISA....ILA.
A5ZQ83_9FIRM/4-457ELMGKYSNIIFCDENR....MILDSIKHVSSHMSS.IREVLPGRDYFLPQTQEKYDPL..TIAE.K.DFRNV....VCK.
A5Z6K1_9FIRM/4-456ELMGKHSNIIFTDDNN....MIIDSIKHITSVMSS.VRQVLPGKPYFIPDTMDKHNPM..EATR.E.SFMET....VFS.
A3DCY8_CLOTH/4-460EIMGKHSNIILVN.NE...NKIIDSIKHVDSDISR.VREVMPARPYTLPPGQDKINPL..ELDIDL.LFSKA....KEQG
B8I3G9_CLOCE/4-460EIMGKYSNIILLN.SE...NKIIDSVKHVDSDISS.VREIMPARTYLLPPAQNKELPE..NTEVDK.IFNEE....NIKG
B0KA21_THEP3/4-455EIMGRHSNIILIDKAT...QTIIDSIKRVYSDMSK.VREVLPGRQYVYPPLQEKLNIN..NLSL.P.SFKEA....VNN.
Q8R9S1_THETN/4-455EIMGRHSNVILIDKAS...QTILDSIKRVYPDMSK.VREVLPGKKYTYPPLQQKLSLK..DLTY.E.SFKEA....LLR.
Q0SRX7_CLOPS/4-452EIMARHSNISLVRKRD...NKIMESIKHITANKNS.FRVLYPGVSYVFPPASEKLNPF..DFSK.E.DLKIE....LSK.
A6LTU3_CLOB8/4-455EIMGRHSNITLVRNRD...NKVMESIKHITADINS.YRVLYPGVNFIYPPSSTKLNPF..SITL.E.ELSTF....VNK.
A5N7G3_CLOK5/4-459EIMGKHSNITLIRKKD...TIIMDSIKHITPEINS.IRSLFPGIKYIFPPISNKLNPF..CYKR.E.EFKHV....LQK.
A7FUW8_CLOB1/4-455EIMGRHSNITLVRERD...NLIMDSIKHVTPEINS.VRNLYPSIEYIYPPASLKLNPF..NFSL.K.DFKDY....IKD.
A0Q075_CLONN/4-456EIMGRHSNMTLIRKRD...NIIMDSIKHITPDINT.YRSIYPGIEYVYPPKSPKLNPF..DFSY.D.MIENF....TKE.
Q97HA2_CLOAB/4-451EIMGRHSNISLVREHD...NTIMDCIKHITPEVNR.YRTLLPGCEFVLPPKSDKLNPF..NFEY.N.DLKDY....ISE.
Q894E2_CLOTE/7-456EIMGRHSNISLVEKSS...SIILDSIKHITPEINS.VRTLLPGLKFVLPPKSNKLNPL..DYTY.D.DLEKF....ILE.
B8CWR5_HALOH/4-456EIMGRHSNIILTD.DN...GYILDAIKRITKEVNT.KRELYPGIKYHYPPRQDKLNPL..KVTR.E.EFFKK....IPD.
Q0AXH0_SYNWW/4-462EFMGRHSNIILVNPEN...NLIIDAIKKYGHDRSS.HREVLPGKEYVSPPQQGKLNPL..QASY.E.DFVQL....MWKQ
A6CPS5_9BACI/4-444EIMGRHSNIIIVDKSR...NMILDSIKHIPPSINS.YRTVLPGQEYKFPPPQEKKNPL..EADR.D.DILRA....IDF.
Q2B781_9BACI/4-444EIMGRHSNIVLVDKGR...NMILDSIKHVSYALNS.HRAILPGQEYVKPPEQNKINPL..GLEE.E.DILRR....LDF.
Q3ERD7_BACTI/4-446EIMGRHSNIILLDTKT...NVILDSLKHVSLAVNR.HRTVYAGAEYVAPPAQHKINPL..QIETAD.DFIRP....LDF.
A8FD29_BACP2/4-445EIMGRHSNLILVEDDT...QQIIDGLKHLSPSVNS.YRTVLPGHEYLLPPAQQKLNPF..AVTK.D.DILKH....LRF.
Q65JT4_BACLD/4-446EIMGRHSNIVLTDGEK...DVIIDSLKHLSPAMNS.YRTVLPGYDYILPPAQNKLSPL..EAET.E.DILRH....LNF.
A7Z4I4_BACA2/4-444EIMGRHSNIILTDGE....GAIIDGLKHLSPSMNS.YRTVLPGYDYKLPPAQEKISPL..AADE.E.DVLRY....LSF.
A4IM38_GEOTN/4-445EVMGRHSNIILVDAST...NTIIDSLKHLPPSVNR.YRTVLPGHPYIAPPTHGKLNPL..EATE.E.TMLKK....IDF.
Q9K9X8_BACHD/4-445EIMGRHSNMILVDPKT...NVILDSIKHVSLAQSS.VRPVLPGQPYTRPPAQGKANPL..TATK.E.DILKK....LDW.
Q5WFK0_BACSK/4-443EIMGRHSNIILVDEKT...NTIIDSIKHVRFDQSS.YRLVGPGQPYKWPPEQNKLDPL..TATE.K.DVLFA....LDF.
Q8ER31_OCEIH/4-445ELMGKHSNLILIDQEK...GSIIDSLKHISYSQNR.HRSILPGQSYQSPPDQQKFHPL..ELSS.E.QFIQK....IDF.
B1YIQ7_EXIS2/4-442ELMGRHSNILLTDGQ....DKILDAIKHLPLSQNT.FRTIMPGLQYHLPPEQDKVDPL..TGDI.E.QTLHR....IDW.
A3I4D1_9BACI/31-467EIMGRHSNLLLIDKEQ...NKIVDSLKHLPPSVNS.FRTVLPGQPYLAPPTQNKWNPL..LVTE.E.ELATF....F...
Q49WZ0_STAS1/4-442EIMGKHSNLILVDDQR....KIIEGFKHLTPNTNQ.YRTVMPGFQYETPPTQNKINPF..EITG.N.KVIQY....IDF.
Q6GA05_STAAS/4-442EIMGKHSNLILVDENR....KIIEGFKHLTPNTNH.YRTVMPGFNYEAPPTQHKINPY..DITG.A.EVLKY....IDF.
Q6Q296_STRSU/4-430EIMGKHSNIILVDKSE...QKIIEAIKHVGFSQNS.YRTILPGSTYIRPPETHSLNPY..TVSD.E.KLFEI....LS..
P95752_STRGN/4-427EIMGKHSNIILLDKAS...GKIIEAIKHVGFSQNS.YRTILPGSTYVAPPQTGSLNPF..TVGD.E.KLFEI....LQ..
Q04KW2_STRP2/4-428EIMGKHSNILLVDKSS...HKILEVIKHVGFSQNS.YRTLLPGSTYIAPPSTESLNPF..TIKD.E.KLFEI....LQ..
Q1JH72_STRPD/18-441EIMGKHSNIILVDRAE...NKIIESIKHVGFSQNS.YRTILPGSTYIEPPKTAAVNPF..TITD.V.PLFEI....LQ..
Q5M4J6_STRT2/4-429EIMGKHSNIILIDKNE...NKIIESIKHVGFSQNS.YRTILPGSTYIAPPKTDARNPF..DISD.E.NLFEL....LQ..
Q3K0R3_STRA1/4-427EIMGKHSNIILIDKNE...HKIIESIKHVGFSQNS.YRTILPGSTYIAPPKTKAINPF..DISD.Q.TLFEL....LQ..
Q8DTA9_STRMU/4-427EIMGKHSNIILLDKNE...GKITESIKHIGFTQNS.YRTILPGSRYLAPPKIQAQNPF..TISD.E.TLFEI....LQ..
Q02YL2_LACLS/4-417EIMGKHSNIILLEKTS...QKIIESIKHIGFSQNQ.YRTILPGSTYIAPPASNATDPF..KATD.E.EIFDA........
Q835X0_ENTFA/4-442ELMGRHSTIVLVNQSS...GKILDAIKHIGMSQNS.YRSLLPGATYIEPPKPMGLNPL..TASK.E.EVFAL....LST.
Q3XYE6_ENTFC/4-444ELMGRHSTIVLVNRET...GKILDAIKHIGSSQNT.YRSLLPGVEYVAPPKQEVLNPF..SSEK.E.KIFQR....LS..
Q039A5_LACC3/4-439EMMGRHSNIFLVSERT...GKIIDLIRHVSADQNR.YRPLMPGAPYVEPPKQDKTDPF..HDPD.R.RYHAL....EREV
Q38X19_LACSS/4-442ELMGRHSNVILINLET...QKILDLIRHVGVSQNR.FRFLMPGADYVNPPAPTGLNAF..TTDLGTLDWLSY....YNE.
Q1WTS3_LACS1/4-435EIMGRYSNVILINQST...NKIIDTIKHVGMDQNR.YRTLLPGATYRQPPTQDKENPF..EQES.N.TFEEL....IQKY
Q03S51_LACBA/4-442EIMARHSNVILVDSAS...MKILDAIKHVGSDQNR.YRLLLPGAQYIMPPKQDLDDPF..QGPR.T.DLAAT....IREF
Q03FM0_PEDPA/4-444EIMGRRSNIVLHSSTT...GKIIDTIKHISSDQNR.YRMLVPGAQYLTPPAQDLLNPF..VADA.E.KMMEL....QNKY
A5VK20_LACRD/4-442EIMARHSNISLVNLKT...GKIIDTIKHVGSDQNR.VRLLLPGATFVMPPKQDKVNPY..L.PN.Q.VYSDL....VRQT
Q03W77_LEUMM/4-442EMMGRHSNLFLVRESD...ARILELIKHVPADQNR.VRSLIPGATYVLPPAQNLKNPFTAGLDGLAQMILDT........
A0NJF9_OENOE/4-422EIMGRHSNIFFLDSEN....KIIELIKHVPAFENR.VRILLPGAQYQRPPKQDLINPF..ESSE................
Q04AL3_LACDB/4-439ELMGRHSNVILYDKQS...GKIIDLLKRINPDENR.ARLLLPKAKYELPPLTPGINGF..TLTE.S.EFSSL....K...
Q5FJY7_LACAC/4-438ELMGRHSNVILYDQQN...GHIIDLLKRINPDENR.ARILLPKAKYELPPLKPGINGL..VVTE.N.QFKKL....S...
Q74JC6_LACJO/4-439ELMGRHSNVILYNADN...NKIIDLLKRINPDENR.ARLLLPHAPYELPPLLPGINGF..DLCA.D.NFNDL....K...
A6P056_9FIRM/4-462ELMGRSANLILLDSEG....RITDCVRRVEGDLATGKRQLLPGLFCHPPAPQDKRNPL..DLD..EGELEGL....IAAA
A7VVS0_9CLOT/4-460EIMGKYSNIILVDGQG....KIVDALKRVDEEMSS.QRLVQPGLAYELPPAQNKPCML..ECQP.E.EIVEA....IVHQ
A9AW28_HERA2/4-452EIIGHSSNIILVDDNG....LVLESIRHYNPQRSQ..RPIMPRGMYEAPPSQGKSDPLQATAEQIA............A.
B9LDK5_CHLSY/4-467EPQDRRSNIILVDDNN....IILDAIKRVSPRMSS..RVVLPRRVYELPPPPDKRDPLRASAAEIE.HLLGK........
A5UZA2_ROSS1/4-464EIMERRSNIVLVGDDN....VILAAARHVTPRMSR..RPVLPREPYELPPPQSRHDPRQTTAVEMRAAVPDG........
Q24TV3_DESHY/15-479EIMGKHSNLILVDPQS...GLILDGLKRYSHALSR.HREVLPGRLYLAPPSQGKADPL..ELEE...EWRTI....LFRD
Q67PS6_SYMTH/4-455EVMGKHSNLVLLNPQ....GRIIDAIRRITEEVNR.HRELLPGLPYIAPPPTGKLDPA..AATG.P.....V....LAQA
A4J565_DESRM/4-461EVMGKHSNILLVDPTT...NTILDGIHRYSHAVSR.YREVLPNRPYLSPPEQSKFDPR..KLTE.D.QFREI....LMSG
Q2RK36_MOOTA/4-459EIMGKHSNIILLNPEG....SIIDAARRYTHAVSR.HREVLPGRPYVPPPAQDKADPR..KLDD.E.AFTRL....LYEG
O86955_THENE/4-433EIMGMHSNMVLV..KD...GKIVDAHRRIVTRR....REILPGKDFSIFPS.GKTSVF..DLKELPGE............
Q9WYJ8_THEMA/4-433EIMGIHSNMILVRDR.....RIIDAHRRIVTKK....REILPGREFVIFPS.GKVSIF..ELRELPPE............
A6LP32_THEM4/4-418DIMGKHSNMILV..EN...GVILDAYRRV...KNR.FRNIYPGEIFVFYKS.DKINPY..NVSNIK.NIEKL........
A7HKC1_FERNB/4-444DIMGKHSNAIIV..EN...SEILEAFKRV...QTK.FRNIFPGEKFVLYPS.DKL.....TIDEID.SFDKLKSVFEGFY
A8F860_THELT/4-437EFFGSHCNVIFV..EN...DIIIDALRSV...LTV.SRRIQKGEIY.RSSN.EKLNPL..EVTYNDFSFDER........
A9BHH2_PETMO/4-409ELMGRNSNLILVNEDN....KVEESLKRVYDE....FRPIIPGVKYLPYYDDSQTNILKEDLENIE..............
Q8RFL3_FUSNN/5-423ECIGKLSNVIFTDEEN....KVLDTLKKLHISENF.DRTLFLGETYIRPKFDKKILPIDIKEDNFNRIIKNN........
A4XM08_CALS8/4-456EMMGRHSNIFLVD.SN...NRIIDAIKRMSFENSP..RTILPGAKYVLPPVLTKKNPL..EVTF.E.EFSSF....FEN.
Q0SNG5_BORAP/4-345KLWPSSPNIIATNQNF....KILDAYYRRPKIKET......TGEIFLK................................
Q5DRG6_BORTU/4-340KLWPSSPNIIATDANF....KILDAYYRKPRSKEI......TGEIFTK................................
Q73MD0_TREDE/4-337RLWSGAANIVLTDENN....LIIDAFYRRPKKGEI......SGGTWLTPEPQ........KIKKQDYCVREY........
Q3A4K7_PELCD/16-444ELYGRRPNIILCDADD....KIVDVLHRREGGSEH..QTYMKGAVWTRPEKVHKWALQ..DVADCS.EMAPV........
Q18J82_HALWD/8-471ELFGD.GNVAVVDSAG....EVIQSLETVRLK....SRTVAPGAQYEFPDS..RVNPLQVTYDRFISLMNES........
Q3IRW5_NATPD/8-460ELFGD.GNIAVLNEDH....EVIDCLDTVRLS....ARTVAPGAQYGYPDE..RFSPLDCSYAAFAAKMDES........
Q8TZ51_METKA/10-472ELLPK.GTLAVTDENN....VIERAFPARRFR....NRAVVPGEVYEPPEG..PPDPYELDRDAFLELLLEA........
Q5JDJ5_PYRKO/6-451ELFRR.GNIILVDSEN....KIVAALRYEEYK....DRAIKPKAEYKFPPA..RENPLEVSFERFLDLMREE........
Q8U137_PYRFU/6-450ELFGR.GNIIFVTKDW....EIIGALRYEEFK....DRAIKPKIKYVFPPS..RANPLKVSFEEFKEIILNS........
O28241_ARCFU/5-423ELFSK.GNVVLLNEEN....RVIMPL..........KHTIKVGELYRFPEQRERKDE.......................
Y1625_METJA/6-475ELFGD.GNIIFLNNED....TIIAPLRVERWS....TRNIVPKEKYKFPPQ.KPLNPYNLEFSIAYEVFKDY......FL
A5ULA5_METS3/5-462ELFDK.GNIILLDEDN....NIILPLKRKRFS....DRDISSKKEYQFPEE.RGIDPISISETELKELFASS........
Q2NGY7_METST/2-454ELFSK.GNIILLDKDN....NIISPLKHKTWH....DRKITAHEEYKYPPE.KGININNCRFEDLKTVINTS........
O27929_METTH/8-458ELFAK.GNIILLNQQR....EIILPLKRKTWS....DRRIASREIYEYPPS.RGINPLDHDPSELEDILMNS........
Q8TSZ2_METAC/6-492ELFAR.GNVLIVDSEN....KIILPMNPVTLK....DRRLRSGEIYELPEA..QLSPLEAKVSDLMEAFSKS........
A0B9D2_METTP/6-429ELFPK.GNMLLLDDEM....RIILPLRPMSFR....DRKLIAGEQYVYHAG..AEDPRSVSIERLEAILHSS........

PF00416

RS18B_YEAST/16-144--------------------------------------------------------------------------------
RS13_SHIFL/3-108--------------------------------------------------------------------------------
RS13_GEOSE/3-107--------------------------------------------------------------------------------
RS18_RAT/14-142--------------------------------------------------------------------------------
RS13_MYCBO/3-109--------------------------------------------------------------------------------
RT13_ACACA/5-110--------------------------------------------------------------------------------
RR13_ARATH/49-153--------------------------------------------------------------------------------
RS13_SULAC/11-139--------------------------------------------------------------------------------
RS18_ARATH/14-142--------------------------------------------------------------------------------
RT13_DAUCA/3-109--------------------------------------------------------------------------------
RS18_DROME/14-142--------------------------------------------------------------------------------
RT13_PROWI/3-109--------------------------------------------------------------------------------
RS13_MYCSP/3-106--------------------------------------------------------------------------------
RT13_MARPO/3-109--------------------------------------------------------------------------------
RS13_HALMA/25-152--------------------------------------------------------------------------------

PF06831

FPG_MYCGE/140-225--------------------ISGIGNIYADEIL----FASK----INPETMVDQLTIKEIEILCKNATKILAKAI-----
FPG_LACLC/132-225--------------------VAGLGNIYVDEVL----WLAK----IHPEKETNQLIESSIHLLHDSIIEILQKAI-----
FPG_HAEIN/129-213--------------------VVGVGNIYTNESL----FICG----IHPLKLAKNLTRNQCFSLVNTIKDVLRKAI-----
FPG_MYCPN/135-227--------------------ISGIGNIYADEIL----FASK----IHPETLAKNLNLSQYQLICQNATDILKKAV-----
FPG_ECOLI/129-219--------------------VVGVGNIYASESL----FAAG----IHPDRLASSLSLAECELLARVIKAVLLRSI-----
Y5760_STRCO/124-214--------------------LAGIGNVYKSELC----FLLG----VTPWLPVGELPADRAARLPTLAKKLLEAN.-----
FPG_BACFI/134-226--------------------VVGLGNIYVDEAL----FRAR----IHPERLAHSLSKEEMAVLHKAIVSTLEEAV-----
FPG_STRMU/132-222--------------------VAGLGNIYVDEVL----WAAK----VDPERLASQLKKSEIKRIHDETIRILQLAI-----
FPG_SYNY3/143-233--------------------VAGLGNIYADEVL----FFCG----FHPTMASNQVSLQDCELIHQQIQATLTAAI-----
Y3325_MYCBO/123-203--------------------LAGIGNVYCNELC----FVSG----VLPTAPVSAVADPR.............RLV-----
FPG_SYNEN/137-229--------------------VAGMGNIYADESL----FLSG----LHPTQSAHTLTPEQVQRLHGVICQVLREGI-----
FPG_NEIMB/135-227--------------------VVGVGNIYANESL----FRAG----ISPHRPANRLKKKECALLVETVKAVLQRAI-----
END8_ECOLI/126-214--------------------LAGLGNYLRVEIL----WQVG----LTGNHKAKDLNAAQLDA.......LAHALL-----
FPG_MYCTU/144-234--------------------VSGIGNIYADEAL----WRAK----VNGAHVAATLRCRRLGAVLHAAADVMREAL-----
FPG_THET8/122-214--------------------AAGVGNIYADEAL----FRAR----LSPFRPARSLTEEEARRLYRALREVLAEAV-----
FPG_BACSU/134-224--------------------VVGLGNIYVDEAL----FRAG----VHPETKANQLSDKTIKTLHAEIKNTLQEAI-----
Y2491_MYCBO/126-218--------------------IAGVGNVYRNELL----FRHR----IDPQRPGRGIGEPEFDAAWNDLVSLMKVGL-----
O93997_CANAX/191-306--------------------FAGVGNWVADEVL----FQAH----IHPNEIISSKIPKDLEYVHPVIKQLYDSLI-----
O80358_ARATH/146-238--------------------ISGIGNWIADEVL----YQAR----IHPLQTASSLSKEQCEALHTSIKEVIEKAV-----

PF05833

C1KWC8_LISMC/4-447........SAGRMDKQLVQNFAGFSPLLAREIV....FRAG............NLTADSLVAAFFEVIGLVNEHL.....
A3Z5Y2_9SYNE/15-450.......LP.IPLGKALRQTYQGISPSLSLQLA....HEERSPAEQLLSTPVEALHTPDWLALHARWQLWLQQLE.....
Q05WQ7_9SYNE/10-434.......LP.IPLSKALPQAYQGISPALSRQLA....GER.......VKRSVETLEASDWEQLHTQWQQWLQCLH.....
Q7U569_SYNPX/23-449.......LP.LPLRKALPQAYQGISPPLARQLA....GER.......LATSVEQLEQSAWCELHRHWQAWLACLE.....
A5GMV8_SYNPW/10-441.......LP.IPLGKALRETYQGISPALANQLTS.FPGSLDSQGRLLKEQLVSDISEPQWRRLHERWGCWLRHLN.....
Q0I869_SYNS3/10-447.......LP.LSLEKALRSAYQGISPVLAKHLA....GEHEDAARARLATSVHELSDQDWQVLHQRWQCWLKALE.....
Q7V657_PROMM/52-482.......VP.TKLRSALQQCYQGISPALALQLV....DDDAKKAHALLEVSVLEITDEQWQHLYHRWSRWLDCLE.....
A5GRV1_SYNR3/5-448.......LP.ESIGRALMGSYRGISPALRDQLL....QTAG....LDRHTPAADLSSAQWQQLFDSWQQWLSQLDS....
Q46GV7_PROMT/10-438.......VP.STFKNSLKDTYQGISPALTLQIVSSDYNESL....KIINKPVTSIELETWEAIYKRWKEWLLDLE.....
Q7VDB7_PROMA/10-439.......LP.KTLKEALKDCYQGISPSLSLQLASEEKESAE....EFLNLQVQALSQTDWKRLHYRWSKWLKDLE.....
Q8DHA1_THEEB/5-448.......IP.GRLRQQLLKAYRGLSPALVQQLL....ADAA....LPPECCTTDLSAEEWRRLFDHWQHWLECLE.....
Q31PG3_SYNE7/5-452.......VP.GRLDRQLIQCYRGLSSRLVQQLC....RQAD....LDPQQNTAAIAPAAWQQLYGAWQDWLRGLQ.....
P73561_SYNY3/5-464.......IP.GLLSKQLLKSYRGVSPMVVKNLL....GQAD....LDSQVSNQDLTDEQWQNIFIAWQNWLQRLE.....
Q8YP27_NOSS1/5-452.......VP.GAIKRQLLKSYSGLSAVLVESML....LVAN....IAPETTTDTLHPEDWQRLFARWQEWLHTLD.....
Q110R4_TRIEI/5-453.......VP.GSLSRNVIKNYRGLSKALVEPMI....KTAG....LDPQQLTNSLNNSDWEKLFQLWQKWLQALD.....
A0YTA6_LYNSP/5-455.......IP.GSLKRQLLKTYRGLSSALVIAMV....QAAG....LDPQCLTENLTEAEWTRLFECWCQWLEALE.....
Q4C6V5_CROWT/5-452.......IP.GSIKEQLLNSYRGLSPVVAASLI....KKAG....LKTEQSTENLTVAEWNELYKLWQVWLKSFQ.....
Q2JJS2_SYNJB/5-470.......IP.GPIGQRLLRCYRGLSRHLVEAMC....HQAG....IPPQTSTDHLSARDWQALFARWQDWLTRLE.....
Q2JXM6_SYNJA/5-461.......IP.GPIAQRLLRCYRGLSRHLAEAMC....LQAG....IPPQTPSNQLSPQEWQALFFWWQDWLARLE.....
Q7NK58_GLOVI/5-445.......VP.GPFAPTLFKAYRGVSQTLAQQML....AEAH....LPTKVHIAELAEIDWRRLWELWRQWLACLG.....
A4S6P0_OSTLU/47-508ARGRSGDMGEARLDECMVRAFRGVSPALAKALI....RGAG....VADGERVETASASDWVAVYDEFMRWIASVS.....
Q2IMA8_ANADE/4-353.................SDAGQG.........................................................
A7H6P3_ANADF/4-347................................................................................
Q9RWV6_DEIRA/9-409........LAGVPLSEWRGRVDGLGPMLSAELA....RRAE....MRPS....QAPGDDWERAYDALKSLVADPS.....
A6TRX6_ALKMQ/4-463.......QPEHSIQKSLFINFTGISPVIAREIC....YVSH....VEEGTPYITLKTEILRRIYVSFDTLVNQVN.....
A8MH76_ALKOO/4-463.......DQRTSLYKALYTSFHGISPLISREIC....FVSS....IDEDILLTNLSEDNLKSIYSSFLYLMNQIK.....
Q8KWV4_CLODI/4-463........LEGPIFKSIYSRFLGISPIIAKEIC....YRAG....VNQNAIIKDISDEQFDSLHKVFCNLFNDIN.....
A7VD88_9CLOT/17-469........KPVTVTKAIYSSVTGISPLIANELC....YRAG....IDGGQSTAALTDVQKEKLYQEFEKLFSDIN.....
A5KQ53_9FIRM/44-496........KPMSVAKALYTSFTGISPVTAEEIC....YLAG....IDSTLPAKEYSQDVLFHLYTQFTIYLSAIK.....
A7B5I6_RUMGN/4-456........KPMPVSKAIYTSFTGISPVTAEEIC....FLSS....IDSRLPASELSADVCVHFYNQFCIYLSAVR.....
A6BEG8_9FIRM/4-456........KPMPVSKAIYSSMTGISPVIAEEIC....YLAG....VDSSMTAHDLSEDVLTHLYRQFTYYMEDVR.....
A5ZQ83_9FIRM/4-457........KPCNIAKAIYTTLTGISPLIAEEIC....YRAS....IDGNDAAQSLDENASVHLYHTFKRLIEQVQ.....
A5Z6K1_9FIRM/4-456........NAMPVSKAIFTSYTGISPAIAESLC....FENK....LDSSMPANVLAHGDQNLIWMSFYQLINRIK.....
A3DCY8_CLOTH/4-460.......DP..RISKFFLNNIKGFSPLLCEEIC....HRAD....VDPRLPVSSLSEDTIQNLKKVLKEIISKIE.....
B8I3G9_CLOCE/4-460.......AK..HPEGLILNTVKGFSPYTCRDIC....ASAG....VPSKTPIGELNDSDKEKIKVALAKYIDKIK.....
B0KA21_THEP3/4-455.......YKSKKIEKTLVDILQGFSPTLAREVT....FRCN.....ISDRFVESIEDEQIENLYQNIKKIYEDVL.....
Q8R9S1_THETN/4-455.......QKTKKIEKALVEILQGFSTTLSSEVS....FQCS.....ISDSFVETLGEEKIEQIYQKVRDIYEKVY.....
Q0SRX7_CLOPS/4-452.......NNNELDEKIFSKLLTGVGKNLSLEMYSLFKSQFG..........DSYVFDDIFNFICNYFTNIFKDIQ.....
A6LTU3_CLOB8/4-455.......NSIVFDNKFYFNCFTGISNLLSNDLY....YNIT...........NHNNSPTISEIYENFNKFIYDL......
A5N7G3_CLOK5/4-459........MKFLDTKSFSKIFTGVSTSFSKELY....YMLS....ELKLSELDIFKESTITVLHGFCSKIFSEFK.....
A7FUW8_CLOB1/4-455.......NNVKLNKTMFSNIFTGVAMPFSKEIL....YRLE.......KENNLEITLENMDEIYVVTKNIFDSIK.....
A0Q075_CLONN/4-456.......NSLQLNDNIFSKIFTGVSKTLSSEIC....FRLK........NNSIDLSLSNLKEIVEVCKDLFKEIQ.....
Q97HA2_CLOAB/4-451.......KDITKNPNMFSKTFTGVSSTLSKELY....FNVE..............KLNSLEAAFDYLKTIFDKVK.....
Q894E2_CLOTE/7-456.......NNIKLNNTFVSKVFMGVGNQLSKEII....NSLN...........SELSLENLKDIHKEIELFFNKVT.....
B8CWR5_HALOH/4-456.......DFSQSSFKAIMYNFRGIGPNMAKEIV....YRSG....LDHKKPYGGLSPFERNKLWDGFNNIFRLVI.....
Q0AXH0_SYNWW/4-462.......GSNNTLANSFFQVFSGISPFSSGEFC....WSAG....LDPLLPVDQCGELEFSRLFHHSRTVLQNIE.....
A6CPS5_9BACI/4-444........NSGKLDKQIVGAFSGTSPLFAKEAV....HRAG....LANR...........NSLPDALLELLEPVK.....
Q2B781_9BACI/4-444........NAGKMDKQLVEQFAGISPLFAKEAV....KRAG....MSNR...........NTIPKAFLDLLGPVK.....
Q3ERD7_BACTI/4-446........LSGNMDKQLVGAFMGISPLFAKEVV....KKAG....MVNE...........KALSEAFFSIQTPLL.....
A8FD29_BACP2/4-445........QEGMIAKQIVDTFSGVSPLFAKEAV....HRAG....LVNQ...........ETIPNTLLDMFQLIR.....
Q65JT4_BACLD/4-446........QEGKLDRQIVDTFSGVSPLFAKEAV....FRAG....LANR...........ATLPNVLTEMFSEIK.....
A7Z4I4_BACA2/4-444........QEGRLDQQIVRHFSGVSPLFAKEAV....HRAG....LANK...........ITLPKTLIEMFHAVK.....
A4IM38_GEOTN/4-445........HAGKLAHQLVSAFSGISPLFANEAV....FRAG....LANR...........ATLPKSFVTLMNDVR.....
Q9K9X8_BACHD/4-445........NEGKLDRQLVRAFSGLSPIVAKEIV....FRAG....MANR...........DSLPAAFTTFMQDVA.....
Q5WFK0_BACSK/4-443........HGGKLDKQLVQSFAGLSPLIAAEIV....ARAK....LANR...........QTLPPAFVSTLAPLK.....
Q8ER31_OCEIH/4-445........NSGKIDQQMLQMLEGFSPLITKDLA....SSVA....LGTN...........EQYQSMFEEVQHRLA.....
B1YIQ7_EXIS2/4-442........NAGKIDRQLLGLFSGFSPQITAEIV....SRAG....LSNR...........TSLAEAIHSVLDELT.....
A3I4D1_9BACI/31-467........VETKNAKDVVTQFTGFSPLHAEELL....YRMT.................SASNRVQCFKEFIASFA.....
Q49WZ0_STAS1/4-442........NKGKIARQLLDHFEGFSPLITNEIV....NRKR....FMTN...........DTLPEAFDEVINEIN.....
Q6GA05_STAAS/4-442........NAGNIAKQLLNQFEGFSPLITNEIV....SRRQ....FMTS...........STLPEAFDEVMAETK.....
Q6Q296_STRSU/4-430........TQELSPKNLQQVFQGLGRDTASELA....NHLQ...................IDRLKNFRAFFDQAT.....
P95752_STRGN/4-427........TEEIEPKRLLQIFQGLGRDTATELS....GRLT...................TDRLKTFRAFFASPT.....
Q04KW2_STRP2/4-428........TQELTAKNLQSLFQGLGRDTANELE....RILV...................SEKLSAFRNFFNQET.....
Q1JH72_STRPD/18-441........TQELTVKSLQQHFQGLGRDTAKELA....ELLT...................TDKLKRFREFFARPT.....
Q5M4J6_STRT2/4-429........TEDLSAKNLQKLFQGLGRDTANELS....ALLE...................TDKLKNFRDFFNREV.....
Q3K0R3_STRA1/4-427........TNDLSPKNLQQLFQGLGRDTALELS....HCLK...................DNKLNDFRQFFSREY.....
Q8DTA9_STRMU/4-427........TEDLAANNLQKLFQGLGRDTAAELS....QRLK...................TDTFKNFKLFFDSPT.....
Q02YL2_LACLS/4-417...........LQTEQLQQKFQGIGRDSKIALT...........................GLSVKEFKEKLLTVK.....
Q835X0_ENTFA/4-442........APELNGRYLQQHFQGLGKDTADELS....ARLL................AQPNEKMAIWTEFWSSVT.....
Q3XYE6_ENTFC/4-444........QTELDPKAIQRQFQGIGFDIAQELT....KRLL................ERPNEKMVVWDEFFSAIS.....
Q039A5_LACC3/4-439.......TPALSRAALLQQHYQGLAKDSATELA....LRLN....................QGDAGWDGFFAALA.....
Q38X19_LACSS/4-442........DADEQIHWLQQQFQGMSRESALELQ....TRLM.................DHDNYLAVVTDFFKQFD.....
Q1WTS3_LACS1/4-435.......PNREVLADSLLKQYQGISRDNALALA....DKLH.................TSNNHVQAFNDFLAMTE.....
Q03S51_LACBA/4-442.......PNQEVLAQTLQHQYQGLGKDTAAALA....TALH.................ASGDAQKHFQAFFERFN.....
Q03FM0_PEDPA/4-444.......PNYEVLAQAIRTTFQGFGKETALELA....YEMV.................NAKDSLKTIQDYLAKFD.....
A5VK20_LACRD/4-442.......DDTVELSHQLQEHYQGFGKDSARELA....AELL.................QSDNLPATYQHFLKHFE.....
Q03W77_LEUMM/4-442........PLEEWPKYIQKTYQGFGRESAEALA....RAIN.................QAGDQLAHAREWLAHF......
A0NJF9_OENOE/4-422........FTSNDPRILADHYQGMSMVSAREAA.............................DAEYLTDWFKKFD.....
Q04AL3_LACDB/4-439........KDYPTPADLAKQMDGLDGDDRQELT....GYLE.......D...........DYSFSSLKTFYNQFS.....
Q5FJY7_LACAC/4-438........NEKSIP.DLVKSMDGLDRDDREELT....GYLE.......D...........DFSYSSFKTFFDQFN.....
Q74JC6_LACJO/4-439........EKYPEPADFVRQFNGLDGDDKKEFT....GYLE.......D...........DFSYSSLQTFFNQFN.....
A6P056_9FIRM/4-462.......PEEGAVDKWLLDTFNGLSPLICRELA....FQAA....GDSAVRFCQLGKKGKERLLERMNAFVNSVK.....
A7VVS0_9CLOT/4-460.......PKNQSLNKGILNALQGLSPVVCREIE....HQVG....RGQELFTRDLTQEQRERLRFFLERLFTTVR.....
A9AW28_HERA2/4-452........LGGDLAKALVTEYSGISPQTGREIA....WRAV......GATSVEITPELDFAQIAQLLRQLTSLSR.....
B9LDK5_CHLSY/4-467..........GEPVKALVNAYRGVSPQIAREVL....TRAC.......GSIPQAGLALPAYTIAARLREIFAEPP.....
A5UZA2_ROSS1/4-464.........QPDLARALVSAYRGLSPLAAREVV....YRVM......GRTIVPTGADLPWEALAGALRQLCQPPW.....
Q24TV3_DESHY/15-479.......GLSEKVVDLLVRHYAGISPELAREIM....TRSG....LAQTITLDQCGDIDLSRIFQAYTLLANPAH.....
Q67PS6_SYMTH/4-455.......DPDLPAWQAVLERVDGLGPLLSREAV....CRAG....APADAPLR...AVDPDRLAAAVRELADARD.....
A4J565_DESRM/4-461.......DIDLKVTDIFLQRIAGVGPLTCRELV....FRAG....LAVDYRLEHCGDYELTQLWQQIQYLGELLE.....
Q2RK36_MOOTA/4-459.......NWGDPLERLLVNRLAGVGPETAREII....HRAG....LPAGTTLEGCGAYEVNRLYQALGEVLAATG.....
O86955_THENE/4-433........SEKSVRNVLLSILEGFSPVSVEEVI....HRAG....YEPDVPWKDVERERIFEVLEEVKRELE........
Q9WYJ8_THEMA/4-433........SEKTIRNVLLSLLEGFSPVSVEELI....HRTG....YELDTPWKAVDQRKILEVLEEIKKELE........
A6LP32_THEM4/4-418.................YLEVQGFSKITVRELI....YRMQ....FLD..............FHKALKSILRDFE.....
A7HKC1_FERNB/4-444.......DKKKSLVEFIYTKFQGFSKVTAEEVL....YRSE.....LDNKSLSEVSLEDLKRVYEILISVKEELK.....
A8F860_THELT/4-437..........AKISQVLSQEFFGFSKYIIRELL....NRAN.....LQDKLACDLLTEERESLKHSFFSLINDFE.....
A9BHH2_PETMO/4-409..............NIDYDRLMGFSKKSIGFLKEIGIQRAV...................QDLKKPYLFYFKEGN.....
Q8RFL3_FUSNN/5-423..............LLLSSEIEGVGKFLNNIKS..............................FDDFKNILN........
A4XM08_CALS8/4-456........SNKSYENILIDNLSGISKQFVNEVM....LHAQ....VFKE...SVEKNKVIKRIFESLKELLYCIV.....
Q0SNG5_BORAP/4-345............................AKEIH.................ESNKMSDKKIMGLKEEYNN...........
Q5DRG6_BORTU/4-340............................AKEII.................ENNDITDKKEVKLKDGY.............
Q73MD0_TREDE/4-337................................................................................
Q3A4K7_PELCD/16-444.........DDALAAWLQRNIRPMTPVVARDLV....GRM.....LRKETAAEVLGSFARRWQEHDYSFQIAQLE.....
Q18J82_HALWD/8-471.........DTDIVRTLATQL.NLGGLYAEEVC....ARAG....IDKTTQITNTSDKIYRAIYTALESLGTQLQ.....
Q3IRW5_NATPD/8-460.........DSDLVRTLATQL.NFGGLYAEELC....RRAG....VEKTTDIDEATDDDYEALFGALERLREPIL.....
Q8TZ51_METKA/10-472.........DRDLVRTLAVDV.GLGGLYAEEVL....LRAGL..YERRESHASEFEEDELEELYETLRDLLEQIS.....
Q5JDJ5_PYRKO/6-451........PELELVRALARKL.NMGGMYAEEIS....LRAG....FEKTTPVKELSDEDLKRVYDEMIRTFNDEP.....
Q8U137_PYRFU/6-450........QGTEIVRALAKNF.SIGGLYSEETL....LRAK....IDKDRKVDELSEEELRLVYDTLLTVLNDEK.....
O28241_ARCFU/5-423.........DREVVRVLAMS..GLGGLYAEEVC....LRAG....IDKKKKYAELSEDERKKIDEEIERLMNFTP.....
Y1625_METJA/6-475......NNKGVECVRLISRVF.GIGGLYAEEIC....ERAE....IDKKK..RDLSEEEIKKLFEASKNLFDEIF.....
A5ULA5_METS3/5-462.........DKDLVRTLAMN..NLGSLYAEEII....KRANEFEEIDKHTPSADLSESQIANLNKAIHLLFDNLQ.....
Q2NGY7_METST/2-454.........DRDITRTLATN..GLGGLYAEEVI....SYTS....INKEKLAKELTDDEITQLNNAINELFNKIE.....
O27929_METTH/8-458.........GADLIRTLARN..GFGGLYAEEIV....LRAG....LDKNTPCSNLTPDDIRKIDAAIYETFKPLR.....
Q8TSZ2_METAC/6-492.........TADIVRTIATRF.NLGGVLAEEAC....VRAG....VDKAKPAKEATVEDAEGLRDALQDLFSPLFIGRAA
A0B9D2_METTP/6-429.........DADLVRTLVRNL.NMGGTYGEEVC....LRAG....VDKNTPATALSEEEIARVHSALRDVFDIR......

PF00416

RS18B_YEAST/16-144-------------------TIKGVGRRYSNLVC----KKAD----VDLHKRAGELTQEELERIVQIMQNPTHYKI-----
RS13_SHIFL/3-108-------------------SIYGVGKTRSKAIL----AAAG----IAEDVKISELSEGQIDTLRDEVAK......-----
RS13_GEOSE/3-107-------------------YIYGIGKPTA.QIL----KEAG----VSEDTRVRDLTEEELGRIREIVGR......-----
RS18_RAT/14-142-------------------AIKGVGRRYAHVVL----RKAD----IDLTKRAGELTEDEVERVITIMQNPRQYKI-----
RS13_MYCBO/3-109-------------------YIFGIGRTRSNEIL----AATG----IDRDLRTRDLTEEQLIHLRDYIEA......-----
RT13_ACACA/5-110-------------------DIHGVNLKKINKMG----LVMG----LDKFEKVSSMNFELFSLIKKQAIF......-----
RR13_ARATH/49-153-------------------YIHGIGRTRARQIL----VDLQ----MEN.KITKDMAEEELIILRDEVSK......-----
RS13_SULAC/11-139-------------------MIKGIGYNTAMIII----RKLN----LDKDKRLGEISDEDIKKIENLLNNKIIPES-----
RS18_ARATH/14-142-------------------SIKGIGRRLANIVC----KKAD----VDMNKRAGELSAAEIDNLMTIVANPRQFKI-----
RT13_DAUCA/3-109-------------------KMYGIGPKKAIQVC----YRLG----ISGNIKIKELTKYQIDQMEQMIGQ......-----
RS18_DROME/14-142-------------------AIKGVGRRYSNIVL----KKAD----VDLTKRAGECTEEEVDKVVTIISNPLQYKV-----
RT13_PROWI/3-109-------------------QIYGLGHHHCLQIC----DVLG----VSPETRLGMLSTGQHTLLAQIITQ......-----
RS13_MYCSP/3-106-------------------YIFGIGPTIAKQIL----ADAN----VDGEKRVKELTEEELTRIRDEAKK......-----
RT13_MARPO/3-109-------------------RIFGIGPKKAIQVC----DQLG----LSDTIKVNKLTKYQFDQILKIISQ......-----
RS13_HALMA/25-152-------------------ELNGIGHRAARIIA----QKAD----VDRRAVFGKLDDDVIERVVERVENFADDVP-----

PF06831

FPG_MYCGE/140-225--------------------------------------------------------------------------------
FPG_LACLC/132-225--------------------------------------------------------------------------------
FPG_HAEIN/129-213--------------------------------------------------------------------------------
FPG_MYCPN/135-227--------------------------------------------------------------------------------
FPG_ECOLI/129-219--------------------------------------------------------------------------------
Y5760_STRCO/124-214--------------------------------------------------------------------------------
FPG_BACFI/134-226--------------------------------------------------------------------------------
FPG_STRMU/132-222--------------------------------------------------------------------------------
FPG_SYNY3/143-233--------------------------------------------------------------------------------
Y3325_MYCBO/123-203--------------------------------------------------------------------------------
FPG_SYNEN/137-229--------------------------------------------------------------------------------
FPG_NEIMB/135-227--------------------------------------------------------------------------------
END8_ECOLI/126-214--------------------------------------------------------------------------------
FPG_MYCTU/144-234--------------------------------------------------------------------------------
FPG_THET8/122-214--------------------------------------------------------------------------------
FPG_BACSU/134-224--------------------------------------------------------------------------------
Y2491_MYCBO/126-218--------------------------------------------------------------------------------
O93997_CANAX/191-306--------------------------------------------------------------------------------
O80358_ARATH/146-238--------------------------------------------------------------------------------

PF05833

C1KWC8_LISMC/4-447...................G...HAAVP..NE.WRIQ...N.....KEDYYFF.P...LRH.V.DAET....TEFANLST
A3Z5Y2_9SYNE/15-450...................A...GSFRL.RFD........G.....PTPYRV...WAPDVDGEA........PEADCLSL
Q05WQ7_9SYNE/10-434...................D...NRFALRRTD..............GSTYQV...WGAGKDATSS.......GEDVPLSL
Q7U569_SYNPX/23-449...................T...EQFRL.FLD..............EEGYRV...WSSHPDQSGDAE.....GNEGNLAL
A5GMV8_SYNPW/10-441...................E...ETFSL.QLE..............DNGFRL...WNEAPVNA.........RDQGVLSL
Q0I869_SYNS3/10-447...................T...DSFEL.QFD........G.....PNSYRV...WNPSSASEGESLAD.LPEPGQPLSL
Q7V657_PROMM/52-482...................K...ERFTM.RFD........G.....PSSYRV...WDCDTSTSS........SFTDGLSL
A5GRV1_SYNR3/5-448..................QA...LQFAS............S.....GSGYRC...WGEPSPCQS........NTPLALNL
Q46GV7_PROMT/10-438...................N...SNYTI.NFE........G.....PTDYIV...WGKKESTA..........KNKKIGL
Q7VDB7_PROMA/10-439...................R...ENFCI.SFS........G.....PSAYRV...WKPNLSND.........DNYKKISL
Q8DHA1_THEEB/5-448...................R...GHFGP..QF........T.....ATGYRVIPPLGAQA............PSTLSIHE
Q31PG3_SYNE7/5-452..................AE...TAFQP..QL........Q.....ESGYRLL.PTGP..............DSANSVNA
P73561_SYNY3/5-464...................K...LDFLG..KS........L.....PQGYIVL.AETTVVNDV.KPTQEEGDRPLLPINK
Q8YP27_NOSS1/5-452...................S...GKFQP..AW........M.....ANGYTVM.GWGAV.............APVQDIQT
Q110R4_TRIEI/5-453...................K...LIFNP..GW........T.....STGYTVT.GWKAI.............ECVDSVGE
A0YTA6_LYNSP/5-455...................T...SNFQP..HF........T.....ETGYSVI.AWNNTPPK..........SAVETVQE
Q4C6V5_CROWT/5-452...................N...QNFQP..GY........T.....ENGYTVL.GWGII.............EPKINIQT
Q2JJS2_SYNJB/5-470...................T...GQFDP..AP........T.....PQGYTVL.GWASGAVPVSGTESL.QQPSRLNLHQ
Q2JXM6_SYNJA/5-461...................T...AQFKP..AL........T.....PQGYTVL.GWRGSGGD..........PSTPNLHQ
Q7NK58_GLOVI/5-445...................E...GSYRP..GW........T.....TGGYTVL.GWDLR.............APERSVHT
A4S6P0_OSTLU/47-508...................S...D......AD........S.....AGTLANA.TWCEEFGQF.........VAGGPIGA
Q2IMA8_ANADE/4-353..............................................APRFAPV.P.................GTPFPLSA
A7H6P3_ANADF/4-347..............................................RPRFTAE.P.................SGPFPLSA
Q9RWV6_DEIRA/9-409........................................................................VSEGTLSE
A6TRX6_ALKMQ/4-463...................M...KNFSP..QLYWNQET.EE.....YIDFTAL.P...FSHLN.HYAS....KPFESISH
A8MH76_ALKOO/4-463...................N...HNFSP..SVYLDEAS.GK.....YIDFNAI.E...ISHLR.YYTR....NSFESVNE
Q8KWV4_CLODI/4-463...................S...NKYSP..CIIIDKKV.DK.....VVDFSCI.N...LTLFS.DLSY....INKDSMSR
A7VD88_9CLOT/17-469...................T...ENYVP..NIVYDGY...V.....PVEFSSV.R...LSMYQ.DYQA....EDKDEISK
A5KQ53_9FIRM/44-496...................E...GRFEP..AIYYDKQ...E.....PKEFSAL.E...LTYLS.AYEK....RLFPSVCE
A7B5I6_RUMGN/4-456...................E...GQFSP..SVYYDGK...E.....PKEFASL.G...LEHLH.AYHR....ETFSSISH
A6BEG8_9FIRM/4-456...................Q...GNFHP..SIYYNGN...A.....PKEFSAL.P...VTHFN.EYTK....KEFFSISE
A5ZQ83_9FIRM/4-457...................E...EKFSP..NIIYHGE...E.....PVEYAVV.P...LTQYGPDYHS....ETFESVSE
A5Z6K1_9FIRM/4-456...................D...GNFTP..LIYEKNG...K.....PEDFGAV.P...LSIYG.DCTV....TNYESISL
A3DCY8_CLOTH/4-460...................N...SEFTP..CIIWNGDDRQK.....AVDFHSL.E...IKQ...YNTV....DFYPSISR
B8I3G9_CLOCE/4-460...................S...NNFSP..CIVYEDKSMLR.....PIDFYCF.E...PSK...EVFY....KSYELLST
B0KA21_THEP3/4-455...................S...LNLKP..CIAFQEN...E.....VIDFSCI.D...LSQ...YITK....TFFPTVNK
Q8R9S1_THETN/4-455...................N...LEVKP..CVVFLED...K.....VADFSCI.E...LTQ...YKKR....LLFDTVNE
Q0SRX7_CLOPS/4-452...................N..........IIFYKNE...K.....IIDFYFK.D...LSILD.NCTK....EVYDNSSE
A6LTU3_CLOB8/4-455...................N...QNISY..NMYTNKL..GI.....VKDFYSL.K...LNSLNEDYLS....ISYDDPNI
A5N7G3_CLOK5/4-459...................N...NEFYF..AYYTKDG...K.....MKDFYCS.K...LTYLK.DCME....VHYSTPSK
A7FUW8_CLOB1/4-455...................N...KEFCF..NCYLEKD...T.....VKDFYCV.N...LHSLY.NFKN....IDYENPSL
A0Q075_CLONN/4-456...................S...NKFEF..NCYTKNN...S.....FVGFYCL.N...LMSKE.DYKK....IQYDSSSK
Q97HA2_CLOAB/4-451...................N...NDFYF..ASYLTNG...Y.....VKDFYCL.R...LNYLE.GFSE....KTYATPSL
Q894E2_CLOTE/7-456...................Q...DNFSF..FITLEND...I.....FQDFFPI.D...LSSLE.QKDK....LHFSSPSK
B8CWR5_HALOH/4-456...................E...GKFKP..TIGIDNN..NN.....ICYFSAF.P...LEHNKDIKKD....LIFDNTAS
Q0AXH0_SYNWW/4-462...................Q...AKLHP..VAIYSNL...Q.....PLEFAPY.P..ILSLNESGYKS....LNFSSINE
A6CPS5_9BACI/4-444...................Q...GHYQP..T.LIQSN.........KETFYLL.D...LQHL..EGEH....IHYSSLSE
Q2B781_9BACI/4-444...................N...HEYTP....AITAG...Q.....KENFYLF.P...LEHT..GGSS....RTFETLSG
Q3ERD7_BACTI/4-446...................S...HAYTP..A.MITAN...G.....KEFFYLF.P...LTHL..QGEE....KTFSSVSE
A8FD29_BACP2/4-445...................M...HSFTP..Q.LTRKD...G.....KEYFYLL.E...LQHI..DGEM....KTFGSLSQ
Q65JT4_BACLD/4-446...................S...RRFQP..QLVTTED...G.....KEYFYLL.E...LTHI..KGDN....RPFHTLSE
A7Z4I4_BACA2/4-444...................D...CRFTP..N.ITTAG...G.....KEYFYLL.S...LTHV..NGEE....RTFHSLSE
A4IM38_GEOTN/4-445...................N...RRFAP..T.MYTNG...E.....KEWFYIL.P...LTHI..QAEG....KPFASASE
Q9K9X8_BACHD/4-445...................A...HRYEP..T.FIQGE...E.....KEQFSFL.P...LTHM..KGER....KTFASCSA
Q5WFK0_BACSK/4-443...................N...HEYTL..E.LVQG....E.....KDYFSVI.H...LSHK..NGER....HVFSSPSA
Q8ER31_OCEIH/4-445...................S...HEYIP..T..IYKN...G.....KEDFHVL.P...LTSKS.NAEN....ESFESVNQ
B1YIQ7_EXIS2/4-442...................G...PYYFQ..R...LAN...G.....KERFSPV.A...LHYGE.IVEE....KTFATSGD
A3I4D1_9BACI/31-467...................N...GGTSP..M.YVLAD...H.....KTYFSPI.E...LTHL..HGDM....TAYPNVHE
Q49WZ0_STAS1/4-442.........................HTP..TPVFHKNHETG.....KEDFYFM.K...LNQFYDDV......TEYDSLHD
Q6GA05_STAAS/4-442.........................LPP..TPIFHKNHETG.....KEDFYFI.K...LNQFNDDT......VTYDSLND
Q6Q296_STRSU/4-430..........................QP..SLT.............DKSYAAL.P...FANSPENQ......PHFESLSS
P95752_STRGN/4-427..........................QP..SLT.............EKSFSAL.L...FSDSK.........TQMSTLSE
Q04KW2_STRP2/4-428..........................KP..CLT.............ETSFSPV.P...FANQAG........EPFANLSD
Q1JH72_STRPD/18-441..........................QA..NLT.............TASFAPV.L...FSDSH.........ATFETLSE
Q5M4J6_STRT2/4-429..........................EP..NLT.............TKAFSAV.R...FSDSQDQ.......PEFETLSE
Q3K0R3_STRA1/4-427..........................YP..SLT.............EKSFSAV.Q...FSSSH.........ETFQSLGQ
Q8DTA9_STRMU/4-427..........................SP..TLT.............EKSFTAI.T...FSNSQ.........ETFGSLSD
Q02YL2_LACLS/4-417.......................PSIYP..................TDNFSSI.Q...LTDDF.........VSFDSLSE
Q835X0_ENTFA/4-442.......................EAVVP..TLTVTEK.........KEYFTPI.P...YQSLVGEQ......TTYATLSE
Q3XYE6_ENTFC/4-444.......................HQPIP..TFYETEN.........KDFFTPI.A...YQVLSEQASA...VTAYPTLSQ
Q039A5_LACC3/4-439........................TPVP..TITAQGK.........KAVFTAI.P...YVSLTGEQ......SQYPTLST
Q38X19_LACSS/4-442........................QAQP..TLTIGEK.........KSWFTAF.P...YQSLTGTQ......SHFETLSE
Q1WTS3_LACS1/4-435........................DPIP..TMN.............GNNFSIF.....TDNPNG........KKFTTLSE
Q03S51_LACBA/4-442........................APQP..TLTVTVN...N.....KTNFTAF.P...YPTSGTT.......ESHPTLSV
Q03FM0_PEDPA/4-444..........................QP..TGFIYDNKAG......KLTFAAVKP...QLDVNENDV.....HQYASLSE
A5VK20_LACRD/4-442........................NPEP..VLITHSN...G.....KTQFAVF.P...PLNIDGEL......QHFDSLSA
Q03W77_LEUMM/4-442.......................DHLAP..TLFTSKD...G.....SLSYSAF.D...WLQDSASQ......EEFPTLGT
A0NJF9_OENOE/4-422..........................QPQATLTKINE...K.....KSEFTAF.P...YKSVIGEK......TFFPLLSD
Q04AL3_LACDB/4-439...................S.......P..KAYVLVTPKHK.....RRIYPYL.P...YHLEM.TKES.....SSTNLNE
Q5FJY7_LACAC/4-438...................N.......P..RAFVLKTPRNK.....RKIFCYL.P...YHLDL.EKEN.....SNPDLNK
Q74JC6_LACJO/4-439...................R.......P..KGYVLQTIKHK.....DRVYTYL.P...YHLEL.NLIY.....SNDDVNK
A6P056_9FIRM/4-462...................N...KEFTP..YMILKEG...K.....PTDFSFL.P...ILQYGMTVEL....RRMESFGQ
A7VVS0_9CLOT/4-460...................D...TAGEP....YMVTKIKGK.....PMEFSFL.N...IVQYGTLASV....SRWEDFSS
A9AW28_HERA2/4-452.........................SEPTLARNADGT.........PIGIAAF...........NLQHQAHTETFPSMNE
B9LDK5_CHLSY/4-467..........................AP..HLVRNEQ...G.....PVAFAPYYP...SHLAGDGATI....TVMPGMSA
A5UZA2_ROSS1/4-464..........................TP..HIVIDDG...E.....PVAFAPY...........ELTHLPGARPCPSMSA
Q24TV3_DESHY/15-479...................T...PPLEP..TLYYQGAVKLTRPSPLPTAFTIL.P...FQQYQ.GLPA....QSFTTLAE
Q67PS6_SYMTH/4-455.........................WSP..RLLYDPQ..GR.....LKEFHVL.P...LRHWP.GRAE....DGFPSVSA
A4J565_DESRM/4-461...................K...GYFQP..TLLLDRR..EL.....PVDFSAI.D...LSHLKFFK......KETGSISH
Q2RK36_MOOTA/4-459...................P...AAWKP..EVILRPE..GE.....PLAFASF.E...LHQYQ.GLPR....EHPATPGA
O86955_THENE/4-433..........................IPGVFVYYEKG...H.....PVEISAF.RLTMLNLKE.........RYFERPSE
Q9WYJ8_THEMA/4-433..........................LPGVFVYYEAS...H.....PVEVSAF.RFTMLSLKE.........RYFEKPSE
A6LP32_THEM4/4-418...................K.....GCL..YVFYQNN...V.....PIEISAF.P...LNHIN.AIKK....KYCKELEN
A7HKC1_FERNB/4-444...................E.....GTL..RLYYEDE...K.....PKDISVI.R...LHQYR.DEKK......CSEFVK
A8F860_THELT/4-437...................R.....GKT..YV.YEFE...E.....KFLITTI.P...LKTLP.FKNL....SEHSNISN
A9BHH2_PETMO/4-409..............................................SYDFSAITPNNFK.............YEELKPSQ
Q8RFL3_FUSNN/5-423.......................SDVKA..KIYFRDK.........KIKLATVLDLNFKDYDEV........KEFSSYDE
A4XM08_CALS8/4-456...................E..KGEILP..TLYTDKG...N.....VVDFYVI.D...LKSYS.NFSK....RFFTSLNR
Q0SNG5_BORAP/4-345........................................................................ASHTSYSE
Q5DRG6_BORTU/4-340........................................................................NNEISYSE
Q73MD0_TREDE/4-337........................................................................DKTKTFNE
Q3A4K7_PELCD/16-444.........................GSPRLFVFCPS..........TLSLSSV...................RTFSSASE
Q18J82_HALWD/8-471...................S...GDFEP..RLYTDD..........DAVIDAT.PFPLEERKQQNLDV....TTYDSFNG
Q3IRW5_NATPD/8-460...................E...GRTDP..RLYEDD..........GQVVDAT.PLPLEEHTAEGYDA....TAFEHFNG
Q8TZ51_METKA/10-472......................EGDLRP..TLYRTTE.........RDYVDVT.PVPLERY.SDELEM....EEQDTFQR
Q5JDJ5_PYRKO/6-451..........................KP..NIVFKD..........GVMHDVV.PIELKIY..EGFEK....RYFPTFSE
Q8U137_PYRFU/6-450..........................KP..NIVYNKE.........GVMVDVV.PIDLQWY..REYTK....RYYESFSE
O28241_ARCFU/5-423..........................KP..QIILKD..........GDYLDVV.PMDLLYY..SNYEK....KYFESFND
Y1625_METJA/6-475.......................NNRKP..QIVLKD..........NEYFDVV.PIDLKKY..KGLEK....KYYNSFLE
A5ULA5_METS3/5-462......................EEHFKP..QIVKK...........DSKEDVV.AFDLVKY..DGFEK....TYFDNFNE
Q2NGY7_METST/2-454.......................TNPQP..QIILDEN.........DKNKDLV.PITLNKY..AQFKS....KSFETFNM
O27929_METTH/8-458......................ELDLKP..HII.............GDGEDVL.PIELRVY..SGRER....RYFESFND
Q8TSZ2_METAC/6-492GEGKGEAEAGVGTEPATGVEAEAPKLRP..QHVKKEINGK......IETFDVV.PFDLIRY..SEFEK....EYFDSFNT
A0B9D2_METTP/6-429........................EIRP..QIVYRD..........GEPFDVI.PFPLEVY..KGLEA....RSFERFSD

PF00416

RS18B_YEAST/16-144--------------------------------------------------------------------------------
RS13_SHIFL/3-108--------------------------------------------------------------------------------
RS13_GEOSE/3-107--------------------------------------------------------------------------------
RS18_RAT/14-142--------------------------------------------------------------------------------
RS13_MYCBO/3-109--------------------------------------------------------------------------------
RT13_ACACA/5-110--------------------------------------------------------------------------------
RR13_ARATH/49-153--------------------------------------------------------------------------------
RS13_SULAC/11-139--------------------------------------------------------------------------------
RS18_ARATH/14-142--------------------------------------------------------------------------------
RT13_DAUCA/3-109--------------------------------------------------------------------------------
RS18_DROME/14-142--------------------------------------------------------------------------------
RT13_PROWI/3-109--------------------------------------------------------------------------------
RS13_MYCSP/3-106--------------------------------------------------------------------------------
RT13_MARPO/3-109--------------------------------------------------------------------------------
RS13_HALMA/25-152--------------------------------------------------------------------------------

PF06831

FPG_MYCGE/140-225------------------V--MKGTTISS---------------------------------------------------
FPG_LACLC/132-225------------------K--LGGSSIRT---------------------------------------------------
FPG_HAEIN/129-213------------------.--.......I---------------------------------------------------
FPG_MYCPN/135-227------------------E--MKGTTIGT---------------------------------------------------
FPG_ECOLI/129-219------------------E--..QGGTTL---------------------------------------------------
Y5760_STRCO/124-214------------------.--.RDRPVRR---------------------------------------------------
FPG_BACFI/134-226------------------E--MGGSSIKS---------------------------------------------------
FPG_STRMU/132-222------------------E--..KGGSTI---------------------------------------------------
FPG_SYNY3/143-233------------------E--..AGGTSF---------------------------------------------------
Y3325_MYCBO/123-203------------------T--RARDMLWV---------------------------------------------------
FPG_SYNEN/137-229------------------A--AGGTTIRT---------------------------------------------------
FPG_NEIMB/135-227------------------E--TGGSTLRD---------------------------------------------------
END8_ECOLI/126-214------------------E--IPRFSYAT---------------------------------------------------
FPG_MYCTU/144-234------------------.--.AKGGTSF---------------------------------------------------
FPG_THET8/122-214------------------E--LGGSTLSD---------------------------------------------------
FPG_BACSU/134-224------------------.--.DAGGSTV---------------------------------------------------
Y2491_MYCBO/126-218------------------R--RGKIIVVR---------------------------------------------------
O93997_CANAX/191-306------------------Y--VCEEAVRV---------------------------------------------------
O80358_ARATH/146-238------------------E--VDADSSQF---------------------------------------------------

PF05833

C1KWC8_LISMC/4-447LLDHFYIGKARRDRVH..Q..FAHDLEKL...LSNELARSRLKIEKLENTLLETEKA.....DVYRIQGELLTANLHLM.
A3Z5Y2_9SYNE/15-450SLGLHYRHHNSQRRIE..R..QARELRLR...LEHWRQREQRQLEDQERRLHDTDQA.....QALQQEADGLLCHA....
Q05WQ7_9SYNE/10-434ALGHFYSDHLQGRELR..R..HSDELRQQ...LAAARQREQEQLQDQTNRLLATENA.....DALQQEADALLCHA....
Q7U569_SYNPX/23-449ALGHWYRARIDQRDLQ..R..ACDELRQR...LSRWRSKEDLALEDQRRRLAACADS.....TDLQQQADALLCLP....
A5GMV8_SYNPW/10-441RLGCYYQDHLSKRRLS..R..EISTLQQR...LQQCREREQAQRDEQTQRLKDTVGA.....ATLQSEADQLLCQP....
Q0I869_SYNS3/10-447RLGQYYATVLQHQELN..R..ATQDLQKQ...LKQLRTREEALLADQRAGLEETHGA.....DDLQQQGDSLLCQV....
Q7V657_PROMM/52-482TLGSYYRRHLETQSLN..Q..LAEDLQKR...LFQWRQREEQALGEQQGRLNETSQS.....NSLQQQADAMLCLP....
A5GRV1_SYNR3/5-448SLARYYGQGLRQAQCQ..Q..QRQRLEQH...LQQLVQREQRELQRQELLLARSGDE.....HLLQRQADLLLCRSDVS.
Q46GV7_PROMT/10-438SLSIYYSNKIVERKIN..S..IREKLKQD...LANSKGHEKRKLDVQELLIKNISEY.....TTMQNKAKSLLTLP....
Q7VDB7_PROMA/10-439SLGNYYKNNLEAKKLN..H..TYKRLSED...IIRIKANEEKSLKTQEELFSKISEI.....KSLQIQAENILCLN....
Q8DHA1_THEEB/5-448ILATYYQNQLQQQQTQ..Q..LQQQLHQS...LEAQRQKLIAKIEGFRERLAAAAGG.....DRQRYLADLLMAHAHLW.
Q31PG3_SYNE7/5-452VIATYYDRQLLSQQFQ..Q..LRQQLSQR...LQQQQQKLQQKQQDFQGRLLAAEDA.....DRWRQQGDLLMASLDQW.
P73561_SYNY3/5-464LVSEYYRRELGRENFQ..Q..LQHQIQQK...LNNLIAKLQQKADTFKQRLNAAANA.....QQYQRQADLLMAYLHQG.
Q8YP27_NOSS1/5-452LINEYYTKQLNQQLFA..Q..LRHQLTQK...LSNILGKLRNKAQTFSDRLQQSDRA.....DEYRQKADLLMAHLQNW.
Q110R4_TRIEI/5-453LLNHYYTQQLNQQEFT..Q..LHHQISQK...VNSITAKLQLKAQTFTQRLEQSDGA.....ELLRSQADLLMANLQEW.
A0YTA6_LYNSP/5-455LLNRYYTAELNQQEFK..Q..LRHQVSQK...LNNLLSKLRQKADGFIQRLKQSDDA.....DTYRAQADLLMASLHEW.
Q4C6V5_CROWT/5-452LIDNYYTKEINQEKFK..Q..LKHQLQQK...LKSCLKKLYNKANNFQQKMEQSSEA.....EEYRQKGDLLMAHSYQW.
Q2JJS2_SYNJB/5-470LLEGYYQAQLNREQFE..R..ERHRLLQR...VSTLLKKLYQRREQFEAMLADSTQA.....EASKQAADLLMAHLHLW.
Q2JXM6_SYNJA/5-461LLEAYYQAQLNRERFE..R..ERQRLGQK...LAALLKKLRQRQEHFERMLADSAQA.....EASKQAADLLMAHLHLW.
Q7NK58_GLOVI/5-445LLDRYYTAQLQADLLR..A..RRSRLQQI...LKATLAKAVKRRAALEQMLAGAAEG.....ERHKQMADLLMAYLHQGA
A4S6P0_OSTLU/47-508LFGAVYGEAGETDVFE..R..ERSRILQA...VRARLKKLASKDVGFRKQLEAASGH.....EEIQLLADALMAYSYNY.
Q2IMA8_ANADE/4-353AIEDAYLAREEERRLA..E..GRRRLREP...VRAALARAGRALAKLADEAARVPAA.....EADRRAADLLKTHLRAV.
A7H6P3_ANADF/4-347AVEARYAALVQERLVA..E..GRRRLREP...VRAGVARASRALEKLADEAARVPVA.....EADRRAADLLKANLRAV.
Q9RWV6_DEIRA/9-409GARE....AARQEKAG..A..LRKLLREP...LEKRVTLLENQLGDVTRAEEGVEIA.....AQDRAEADLLMAYAQTV.
A6TRX6_ALKMQ/4-463LLEGYYANRDQRERMK..Q..RSQGLRKS...VSIKLDRLYNKIQNLKKDYNKAQKS.....QNDKIIGDLITANLHQL.
A8MH76_ALKOO/4-463LLEGFYLQRASKERMK..Q..RTVDLRKS...VSLKLDRLYNKLNNLNKDLDNAHES.....EKYKLYGDLITANIYQV.
Q8KWV4_CLODI/4-463ILEDFYRTKDIKDRIN..Q..RSSDLKKS...ISVKLDRLYNKLKKQEEELSESENA.....DIYKIKGELITSYIYMV.
A7VD88_9CLOT/17-469VLDEYYFKKSKVTRIR..Q..KSADLRKI...ISTAIERTSKKYDLQLKQMKDTEDR.....EKYKVYGELINTYGYGV.
A5KQ53_9FIRM/44-496ILRTYYSERSLITRIR..Q..KSVDLRHI...VQTALERNRKKYDLQMRQLKDTENR.....DKYKVYGELINAYGYNV.
A7B5I6_RUMGN/4-456VLETYYATKNQITRIR..Q..KSADLRHI...VQTALERARKKYALQMRQLSDTEDR.....DKYKVYGELIHTYGYNL.
A6BEG8_9FIRM/4-456VLYTYYSTRNTLTRIH..Q..KSADLRHV...VQTALERNRKKYDLQSKQLKGTEKR.....DKYKVYGELINTYGYNL.
A5ZQ83_9FIRM/4-457MLETYYASKEILTRIR..Q..KSSDLRRI...VQTALERNRKKLILQQKQMKDTAKK.....DKYKVYGELINTYGYGL.
A5Z6K1_9FIRM/4-456LLEDFYSKKNLYTRMR..Q..KSSDLRRI...VSTALERDRKKYNIQLKQMKDTEKK.....DKYKVYGEILTAYGYSI.
A3DCY8_CLOTH/4-460VLDLFYTIKDTSERLA..Q..KKADLAKI...LNNCIDRCNKKISIHMDTLREVAER.....EKFKLYGELITANIYCI.
B8I3G9_CLOCE/4-460ALDQYYMLRDTNERLG..Q..KMGDVLKV...VKNGIERCQKKTTMFNEKLREVSER.....DKLQLYGELITANIYCI.
B0KA21_THEP3/4-455AACKFFSEKANIVNLQ..V..RSSDLRKI...INNNLEKLYNKLDKLQQELNEAKNA.....DTFRLYGELITANMHLL.
Q8R9S1_THETN/4-455AADKFFFEKIKSANFQ..M..KSSDLKKI...VQNILEKLYVKLNKLQEELAEADKA.....EIYKLYGELLTVNLHSI.
Q0SRX7_CLOPS/4-452LLDAFFANKDKQDRLH..A..KSADIQKL...VNTNIDRCLKKIKVLEKTLEECSKK.....EEFKIKGELLTSYIYSI.
A6LTU3_CLOB8/4-455LMDAFYEKKDKQDRLQ..N..KSTDLQKL...IHTNIDRCNKKLKILNETLSECDEK.....ESFRIKGDLLTSYIYSI.
A5N7G3_CLOK5/4-459LIDDFYYEKDKADRLN..S..KSSDMQKL...ININLERCNKKVKILMENLKDCKNK.....DTYRIQGELLTSNIYNI.
A7FUW8_CLOB1/4-455LIESFYFEKDKSDRLN..S..KSSDLQKL...INVNIERCEKKIKILEGNLKDCNER.....EKFQICGEILTANIYAL.
A0Q075_CLONN/4-456LLENFYYAKDKSDRLK..S..KSSDLQKI...VMNNINRCTKKDKILNNTLKKCEDK.....DIFKLYGELLTANIYAL.
Q97HA2_CLOAB/4-451LIQEFYFEKDKAERLK..N..RSSDLQKI...VNTNLERCRKKNEIYEDELNECANK.....DTYKIYGELLTSNIYTI.
Q894E2_CLOTE/7-456TLEYYYSEKDKRDRLN..N..KSHSLLKL...VNNNLDRCHKKMEILNDNLKKCEKA.....DKYRIYGELLTANIYSI.
B8CWR5_HALOH/4-456LFDYYYENKIKLAHIG..S..IKNSLIKV...VSNYLKKNRKKRNKLRKQLNESKRA.....DEYKKIGELIKANMYIL.
Q0AXH0_SYNWW/4-462ACDRYYNDSLKMIRLE..S..MKVNLSRN...IKIRLDKAYKKHFFQEGDLAKAYEK.....LKYKEWGEMLTAYAFKF.
A6CPS5_9BACI/4-444LLDRYFHQKAERDRVK..Q..QGNDLERL...IKNERDKNQSKILKLEKTLKDAENA.....DIFQLYGELLTANLYAV.
Q2B781_9BACI/4-444MLDRFYFGKAERDRVK..Q..QGNDLERF...IINEKEKNEKKIEKLEKTLEEARNA.....DQYQLSGELLTANLYMA.
Q3ERD7_BACTI/4-446LLDRFFFGKAERDRVK..Q..QAHDLERF...MQNEKNKNEKKLIKLEKTLQDAGKA.....DKYQLFGELLTANMYAL.
A8FD29_BACP2/4-445LLDRFYFGKAERDRVK..Q..QASDLERF...VVNEKKKNENKLKKLNRTLEESQNA.....HKYQLYGELLTANLYAI.
Q65JT4_BACLD/4-446LLDRYYFGKAERDRVK..Q..QAHDLERF...AANEKKKNENKIKKLKKTLEQSEHA.....QDYQLYGELLTANLYQL.
A7Z4I4_BACA2/4-444LLDRFYFGKAERDRVK..Q..QAQDLERF...VANERKKNANKIKKLEKTLDYSENA.....KEFQLYGELLTANLYML.
A4IM38_GEOTN/4-445LLDRFYFGKAERDRVK..Q..QAHDIERL...MANEKAKNEKKLLKLEQTLAEAKQA.....DMYRLYGELLTAHLYAV.
Q9K9X8_BACHD/4-445LLDRFYFQKADRDRVK..Q..QAHDLERF...LRNERDKNVNKIKKLEKTLDDAEKA.....KQYQKFGELVTANLHLV.
Q5WFK0_BACSK/4-443LLDRYYYGKAERDRVK..Q..QAFDLERL...LKNEYQKNKRKLKKLEQTLQQADEA.....DSYQKQGELLTANIHAV.
Q8ER31_OCEIH/4-445MLDTFYSGKAERDRVK..Q..QAKDLYRF...IKNEKQKNERKLKKHQQTVQKSEHA.....DEYQRLGELLTAHMHEV.
B1YIQ7_EXIS2/4-442VLDAFFHQKSNRDRVK..Q..QAADLERF...IKSEYDKNILKRTKLERDLAATEKM.....DELKHKGELLTTYLYQL.
A3I4D1_9BACI/31-467LLDRVFFARAERDRVK..Q..QAGDLERW...LQNEIDKLALKTKKLTKDYVRASKL.....DQFQLYGELLMANIYSF.
Q49WZ0_STAS1/4-442LLDRYYDARGERERVK..Q..RANDLVKF...VQQQLHKFQNKLNKLIDEQEGTKEK.....ELQQLYGELITANIYRI.
Q6GA05_STAAS/4-442LLDRFYDARGERERVK..Q..RANDLVRF...VQQQLHKYQNKLAKLIEEYEQSKNK.....DTEQLYGELITANIYRI.
Q6Q296_STRSU/4-430LLDFYYQDKAERDRVA..Q..QANELIKR...VASELEKNRKKLIKQEQGLADTETA.....ELVRQKGELLTTYLHQV.
P95752_STRGN/4-427LLDTFYKDKAERYRVN..Q..QASELIRR...VENELEKNRKKLGKQEDELLATEKA.....EEFRQKGELLTTFLHQV.
Q04KW2_STRP2/4-428LLDTYYKNKAERDRVK..Q..QASELIRR...VENELQKNRHKLKKQEKELLATDNA.....EEFRQKGELLTTFLHQV.
Q1JH72_STRPD/18-441MLDHFYQDKAERDRIN..Q..QASDLIHR...VQTELDKNRNKLSKQEAELLATENA.....ELFRQKGELLTTYLSLV.
Q5M4J6_STRT2/4-429LLDYYYLDKAARDRVA..Q..QASDLIHR...VQNELEKNKKKLVKQEKELAATENA.....EEFRQKGELLTTFLSMV.
Q3K0R3_STRA1/4-427LLDYYYQEKAEKDRIA..Q..QASDLIHR...VQSELEKNIKKLAKQQDELLATENA.....EEFRQKGELLTTYLSIV.
Q8DTA9_STRMU/4-427LLDYFYQDKAERDRIA..Q..QASDLIHR...IQNELEKNKKKLKKQEQELQDTDKA.....EEFRQKGELLTTYLNQV.
Q02YL2_LACLS/4-417MLDVYYADKAERDRVK..Q..VAASVIKK...IQNELKKNRDKLKKQERELLATDNA.....EIFRQKGELLNTFLNQV.
Q835X0_ENTFA/4-442LLDAFYSGKAEKDRVK..Q..QGGELIRK...IENELKRNQKKLKKLQQTLADTENA.....ENYRRDGELLTTFMAQV.
Q3XYE6_ENTFC/4-444LLDSYYHEKAEKDRAK..Q..QGGELIRK...IENELKRNKNKLKKREQTLKESENA.....ENYRRNGELLTTFLTQV.
Q039A5_LACC3/4-439MLDAYYEQKAEHDRVL..Q..QGGNLIHV...IKNVLDKDRKKQRKLQRTLEETEKA.....DDYRIRGEVLTTYLSQV.
Q38X19_LACSS/4-442LLDQYYLHKAQRDRVL..Q..QGGALIHF...IRNEIQKDEKKLKKLQKTLKAADSA.....DDYRIKGEILTTYLRQV.
Q1WTS3_LACS1/4-435MLDVFYHTKANRDRVQ..Q..QGGQLLHV...IRKNLQRNKKKLKKLSNELKATENA.....DEYRIKGEVLTTYLYQI.
Q03S51_LACBA/4-442LLDHYYEDKAERDRVQ..Q..QGSVLIRV...VRNELKKNRTKLKKLQRTLAETENA.....DDYRIKGEILTTYLNQV.
Q03FM0_PEDPA/4-444TLDQYYYEKVQRDRVQ..Q..RGHVLIRV...VRNELKKNRKKLKKLQQTMNQTKLA.....DTYRVKGEILTTYLHQI.
A5VK20_LACRD/4-442LLDAFYANKAEQDRSK..E..LAGQVLKV...LKNELKKDRRKVKKLQQQLQDAATA.....DQYRICGEILTTYLSKL.
Q03W77_LEUMM/4-442MLDAYYIGKAERERVN..Q..QAGTLVRV...VKNELKKNTAKRKKLLKTLEDAENA.....DELKVKGDLLITYPHLV.
A0NJF9_OENOE/4-422LLDAYYAQSANQSRVH..E..LSSQIDQI...VKNELHRNRRKLQNLNNDLIKTKGA.....DNYRIKGELLTTFQNKV.
Q04AL3_LACDB/4-439ALDEFYAYQANRDWVK..Q..RSQQVTRV...VTNETKKLQKKLKKLEKQLDSAENS.....ENLRVSGELLTAYLSQV.
Q5FJY7_LACAC/4-438GLDEFYEYQATRDWVK..Q..RASQVERV...VKNEQNKLSKKIKKLEKQLNLAENS.....EGYRIKGEILNANLGQV.
Q74JC6_LACJO/4-439TLDEFYRDQANREWVK..Q..KSKRIENI...VNNELKKLKKKIIKLRKQLDQAENS.....EEYRIKGELLNAYLHEV.
A6P056_9FIRM/4-462MLDKFYADRESAERVK..Q..KGQDLVKS...VTSARDRTARKLNNQRRELEATRDR.....ERLREWGDIITSNLHAM.
A7VVS0_9CLOT/4-460LLDEFYEERDRQDRMR..V..KAQDLLRL...LANASERLSRKINLQRGELARSEDR.....EHLRVCGDLINANLYRI.
A9AW28_HERA2/4-452ALATAFAELDQVTAHA..Q..RREALLER...VAEAQRRIKTKADQLRTQLARVEQL.....ERLRWEGEMIFGYIYAI.
B9LDK5_CHLSY/4-467ALEAFYTARQQPLGRD..Q..RRADLLNR...LRASREHIERQRDQIAAELARTAEL.....DRLRWEGEMIFAFLHQL.
A5UZA2_ROSS1/4-464ALDAYYATRERLTAHH..Q..RRDALRER...LNAMRERLERQRSALRAELERASDL.....ERLRWEGEMIFAFLHEL.
Q24TV3_DESHY/15-479AVESFYQSKASSNTLE..A..KRGSLRKI...IQEQLQHLNKKKGIYEDTLATAAKG.....LNYQRWGELLTANLYRL.
Q67PS6_SYMTH/4-455CLDAYFGRRAEEERFL..S..LRGSLARL...VRDEIARVRRKLHAQEESLAAAESA.....ETYRLQAELITANLWQI.
A4J565_DESRM/4-461VLDGYYRKIIELRQLE..S..FRHSLLQT...VRKEIGRLKKKISLYQKSLASAEKA.....DEYRIFGELLTANLYQI.
Q2RK36_MOOTA/4-459ACDYFYSLRREHQLLE..G..TRRSLEHV...LEKELKRCRKKEGLQAATVAEAAGA.....EEFRLAGELITANIYRI.
O86955_THENE/4-433GINEFVGWKEEKSTFE..N..TKNRLTRV...IMKRIEDLEDLEEKTYERDCRSRKSRGVQKDRRSHRSKPLEH......
Q9WYJ8_THEMA/4-433GINEFVRWKEEKSTFE..N..TKNRFIKV...VVNRIEDLEDLEEKLSRELSEAEKA.....ERYKKLGDLIVQNLWSI.
A6LP32_THEM4/4-418AISDFFGFVERNNILK..Q..LKKNLENI...IVKNVVKIENTLEKINRELQEIKDY.....EHYRKYGELLKAYFYQI.
A7HKC1_FERNB/4-444CVNEYFEYVEVKDKIT..E..KRNQLISV...VKSKIDHYENLLSELERELEECKDA.....DKYRKYGELIKAYSYQI.
A8F860_THELT/4-437AIDDIYKIVLLKKEVD..N..FKARLIKC...VQDKVKKSEKILNTLEEELLACRKA.....EEYHKYGELLK.YAQEK.
A9BHH2_PETMO/4-409ALLKVFQEKADQSRLL..E..IKRDLEKR...VKSEIDRLEKTKEQILQDLNEEKGL.....KDFEKRGELLQTYLYKI.
Q8RFL3_FUSNN/5-423MINFYIDYEHTTTSFM..L..LKNRLESL...LEKKLKKLNKTLSLIKKDIEDSKTM.....DSIKEEGDILASVLYNV.
A4XM08_CALS8/4-456CIDEYYSKKEEHTIFI..E..KKQYLQKI...IEQNLKKLSQRYEQNLQKIDEAKNA.....ELFKKYADLILANLYQL.
Q0SNG5_BORAP/4-345FLENYYESLSNQIKET..N..IKELLIEK...YKKELIVLEKRIESLKQQIKLIENI.....ENEREKGELILLNINKI.
Q5DRG6_BORTU/4-340FIENYYDNLEIKETQA..H..NIELLKQK...YEKEKINLEKKINSLEKQINSIEKI.....EDQRKKGEMILSNINKI.
Q73MD0_TREDE/4-337AVEEWYINNAPKVSKE..A..LLDEAENL...YGTKILKIEKALLKLKAKREEFLNA.....QSLKNAGDLLFSNLHLI.
Q3A4K7_PELCD/16-444AADCFFDDYAMPGRGE..E...RSRLEKV...VRKALARVEKRLQRLRQEAANTDDA.....DRYQQLGQLLMSNLFRV.
Q18J82_HALWD/8-471ALDVYFREVDRNPAAE.ESGQTRPDFAAEIAKKQRIIEQQEGAIDDFEQRAEAERSRAELLYANYELVNEIIETIQTAR.
Q3IRW5_NATPD/8-460AIDAYFHRLQAEAETETDTGDDKPDFESEIAKFERIIEQQQGAIEEYEKQAEVEQQKAELLYGNYDLVDEICSTVQSAR.
Q8TZ51_METKA/10-472ALDEYYVTKFLAEKER..E..VREEWEREKRRLERTIERQRSSIEQLRTKAEKLRGRANALYLNYNLVDGILSELRKAE.
Q5JDJ5_PYRKO/6-451ALDEYFGKITLEKAKI..E..QTKKLEEKKRGLMATLRKQEEMLKGFEKAMRENQEIGDLIYANYTLIERLLEEFRKAT.
Q8U137_PYRFU/6-450ALDEYFGKLTIEKARL..E..KTKQLEERRKALEISLRRIEEQIKGFEKEAMTNQEKGDALYAHYSIVNEILRVISSAL.
O28241_ARCFU/5-423ALDDYFSKKLAEMDEL..ESMKSEELEK....LKKRLEIQKESLRKFEDEAESFRKIGDAIYENYQMVEKIIEAFRAAR.
Y1625_METJA/6-475AVDDYFAKFLTKVVVK..K..EKSKIEKEIERQENILRRQLETLKKYKEDAEKNQIKGDLIYANYQIVEELLNAIRQAR.
A5ULA5_METS3/5-462ACDEFYSKKVNTDIKN..I..KEAAWNKKVNKFEKRLKLQEETLDNFHKTIETSQHKGEVIYSNYTTIENLVKVVNNAI.
Q2NGY7_METST/2-454AADEFYSKKIVSDIKN..K..EEKLWAKRIGKFEKRLKMQEETLEGFYKTIEDKQHKGDTIYAHYNEIQQIINVIHQAR.
O27929_METTH/8-458AADEFFSSIFREEIRR..A..HEEEWEREVDRFRKRLRIQRETLEKFKKTIEVSTRRGDLLYANYSLVEEVLATIRRAR.
Q8TSZ2_METAC/6-492ALDEFFGKKALEQVAE.VK..AAEKKEKTLGVYERRLLQQEESLAKFGKEIEKNNTLAEIVYANYQLIEELFSVLNGAR.
A0B9D2_METTP/6-429ALDEFFVAEPEMPKLS..A.............LERRLELQRAAIDELRAKETQLASMGDFIYQRYSEIDSILKAIAGAR.

PF00416

RS18B_YEAST/16-144--PAWFLNRQNDITDGKDYHTLANNVESK---LRDDLERLKK-----------------------------IRAHRGIRH
RS13_SHIFL/3-108--.................FVVEGDLRRE---ISMSIKRLMD-----------------------------LGCYRGLRH
RS13_GEOSE/3-107--.................LKVEGDLRRE---VSLNIKRLME-----------------------------IGCYRGLRH
RS18_RAT/14-142--PDWFLNRQKDVKDGKYSQVLANGLDNK---LREDLERLKK-----------------------------IRAHRGLRH
RS13_MYCBO/3-109--................NLKVEGDLRRE---VQADIRRKIE-----------------------------IGCYQGLRH
RT13_ACACA/5-110--...................FYNLEENK---IFNNVNKKKK-----------------------------IKNYTGMRH
RR13_ARATH/49-153--.................YMIEGDLRRF---NALAIKRLKE-----------------------------IQCYRGVRH
RS13_SULAC/11-139--PNWIYNRQKDYESGADMHLVTSDLIFY---VRNDIERERR-----------------------------SRSWRGVRH
RS18_ARATH/14-142--PDWFLNRQKDYKDGKYSQVVSNALDMK---LRDDLERLKK-----------------------------IRNHRGLRH
RT13_DAUCA/3-109--................DHVVHWELKRG---ERADIERFIS-----------------------------ISCYRGIRH
RS18_DROME/14-142--PNWFLNRQKDIIDGKYWQLTSSNLDSK---LRDDLERLKK-----------------------------IRSHRGLRH
RT13_PROWI/3-109--................NYDTGSDVRRF---TRQNIQRLVN-----------------------------IHSYRGYRH
RS13_MYCSP/3-106--.................YTTEGDLKRE---INLNIKRLME-----------------------------IKSYRVIRH
RT13_MARPO/3-109--................NYLVDSELKRV---IQRDIKRLIS-----------------------------IGCYRGFRH
RS13_HALMA/25-152--EWMTN.HQKDYFTGETTHETGNDLQLT---RRQDINRMKM-----------------------------IDSYRGVRH

PF06831

FPG_MYCGE/140-225-----------------------------------------------FS-------------------------------
FPG_LACLC/132-225-----------------------------------------------YS-------------------------------
FPG_HAEIN/129-213-----------------------------------------------QG-------------------------------
FPG_MYCPN/135-227-----------------------------------------------FT-------------------------------
FPG_ECOLI/129-219-----------------------------------------------KD-------------------------------
Y5760_STRCO/124-214-----------------------------------------------TT-------------------------------
FPG_BACFI/134-226-----------------------------------------------YV-------------------------------
FPG_STRMU/132-222-----------------------------------------------RS-------------------------------
FPG_SYNY3/143-233-----------------------------------------------SD-------------------------------
Y3325_MYCBO/123-203-----------------------------------------------NR-------------------------------
FPG_SYNEN/137-229-----------------------------------------------FM-------------------------------
FPG_NEIMB/135-227-----------------------------------------------FV-------------------------------
END8_ECOLI/126-214-----------------------------------------------RG-------------------------------
FPG_MYCTU/144-234-----------------------------------------------DS-------------------------------
FPG_THET8/122-214-----------------------------------------------QS-------------------------------
FPG_BACSU/134-224-----------------------------------------------RS-------------------------------
Y2491_MYCBO/126-218-----------------------------------------------PE-------------------------------
O93997_CANAX/191-306-----------------------------------------------EG-------------------------------
O80358_ARATH/146-238-----------------------------------------------PS-------------------------------

PF05833

C1KWC8_LISMC/4-447ERGMEE.ITVENFYDD..MK...........................KM....TIALDTRKTPSANAQSYFSRYQKLRNA
A3Z5Y2_9SYNE/15-450.........................................................SPSREQIDRAQKLYQRARKLRRA
Q05WQ7_9SYNE/10-434.........................................................NPSREQIDRSQTLYRRAKKLRRA
Q7U569_SYNPX/23-449.........................................................APNRDEVDLAQKLYRRARKLRRS
A5GMV8_SYNPW/10-441.........................................................DPDRDTITRAQKLYHQARRLRRA
Q0I869_SYNS3/10-447.........................................................SPNRETIDRAQKLYGRARKLRRA
Q7V657_PROMM/52-482.........................................................SPSKDLINQTQKLYRKAQKFRRS
A5GRV1_SYNR3/5-448SSGHHQ.LELQDPESN.Q.............................TL....VVRLNPQQTLVSQAQKLYQRARKLRRS
Q46GV7_PROMT/10-438.........................................................SPTKKQIIEAQSLFKEAKRKKRS
Q7VDB7_PROMA/10-439.........................................................NPTKKQVAQAQKLYNKVKKLKRS
Q8DHA1_THEEB/5-448QPGMTE.LIVTDFTT...QE...........................PL....TIALSPEKSAIQTAQELYRQHQKLKRA
Q31PG3_SYNE7/5-452QPGMES.LTLPDFET...GK...........................PQ....QLQLDPALNAVQNAQRFYRRHQKAKRS
P73561_SYNY3/5-464QPGLSS.ITLPDFDD...QS...........................PV....TISLQPDKTLIQNAQRLYKQQQKLNRA
Q8YP27_NOSS1/5-452QPGMKE.ISIPDFET...GE...........................PV....AIALLPDKNAVQNAQNLYKQHQKLKRA
Q110R4_TRIEI/5-453QPGMKN.ISLPDFET...GE...........................II....FIKLDPEKNAVQNAQSIYKKYQKLKRA
A0YTA6_LYNSP/5-455KPGMKS.MTLSDFET...GE...........................PI....KIPLNPEKNAVQNAQAYYKRHQKLKRA
Q4C6V5_CROWT/5-452EPGMNS.MTLKDFET...DK...........................PI....KIPLNPEKNAIQNAQNLYKKHQKLKRA
Q2JJS2_SYNJB/5-470RPGLHH.IELPDFAS...GQ...........................TV....KIPLDPEKNAILNAQAYYRKHRKQKRA
Q2JXM6_SYNJA/5-461RPGLSL.MELPDFFS...GQ...........................MV....KIPLDPEKNAVLNAQAYYRKHRKQKRA
Q7NK58_GLOVI/5-445EPGARR.VVLEDFES...GE...........................PV....TIPLDPTKDLVANAQAYYRLHRKAKRA
A4S6P0_OSTLU/47-508KPGSSE.LEGQDFTT...GE...........................TV....MFKVDPEKGPVGTAEALYKKTRKLRRT
Q2IMA8_ANADE/4-353RRGATE.VAVTEWTEE.GPR...........................EV....RVAVDPALTPQANLERYYRRYRRIVES
A7H6P3_ANADF/4-347KRGERE.VTLTEWTEE.GPR...........................EV....RVALDPALAPQANMERLYRRYRRIVES
Q9RWV6_DEIRA/9-409EPGAAS.ALLPSFDG...EG...........................EV....PVSLEPQLSAVQNAEKRYARARRRDEV
A6TRX6_ALKMQ/4-463KKGQKS.VEVVNFYDE.NQA...........................MI....TIPLDLRLSPAQNAQRHYKKYNKGKTA
A8MH76_ALKOO/4-463PKGEEE.VELINYYDE.NCS...........................SI....TISLDKRLSPAQNAQRYFKLYSKGKTA
Q8KWV4_CLODI/4-463EKGMES.IEVANFYDE.NCN...........................DV....TIELNKNLTPSENAQKYFKKYNKMKHA
A7VD88_9CLOT/17-469AQGAKS.FHALNYYT...NE...........................EI....EIPLDPTISVLENAKRYFAKYNKQKRT
A5KQ53_9FIRM/44-496PEGAKQ.MEALNYYT...NE...........................TV....TIPLDPTSTPQENAQRFFAKYNKQKRT
A7B5I6_RUMGN/4-456EPGAKV.LEALNYYN...NE...........................MV....KIPLDTTKTPLENAQRYFEKYNKQKRT
A6BEG8_9FIRM/4-456EPGSKE.LTALNYYT...NE...........................EI....TIPLDPTQTPGENAQRYFAKYNKQKRT
A5ZQ83_9FIRM/4-457EDGCKS.FKALNYYT...NE...........................EI....TIPMDPAMTPGENSKKYFDRYGKLKRT
A5Z6K1_9FIRM/4-456EPGTKK.FETENFYT...GE...........................PI....TIPLDETLSPIDNAKKFYDKYAKLKRT
A3DCY8_CLOTH/4-460PKNASK.VSLLNYYSE.NGE...........................YV....EVPLDENLLPQENAQRYFKKYAKAKAA
B8I3G9_CLOCE/4-460AEGAKS.ARVLNYYSA.NEE...........................YV....DIPLNEYKSAQDNAQKYFKKYSKAKST
B0KA21_THEP3/4-455KKGMES.FKTINYYT...GE...........................EI....EIPIDKKYSPSENAQRYFKKYSKLKNA
Q8R9S1_THETN/4-455KKGLEK.FGTINYYT...GE...........................EI....EIPLDKRLSPSQNAQMYYKKYNKLKNA
Q0SRX7_CLOPS/4-452KKGDKS.VDLLNYYSE.DEE...........................YL....TISLDENKTPSENIQFYFKKYNKLKKA
A6LTU3_CLOB8/4-455KKGDSE.CTLLNFYNENQEE...........................YI....TISLNKTKTPAENIQYYYKKYNKLKTS
A5N7G3_CLOK5/4-459HKGDSK.VKVQNYYSN.ILE...........................YI....TIKLDINKTPSENIQSYFKKYNKLKKT
A7FUW8_CLOB1/4-455KKGMDK.VNLLNYYT...NE...........................YM....DIKLDPNKNPSDNIQKYFKKYNKLKKT
A0Q075_CLONN/4-456KKGLSH.IELANYYSE.NYD...........................TV....KITLDENKTPSQNVQSYYKKYNKLKKS
Q97HA2_CLOAB/4-451KKGDKT.ATVLNYYSE.GNE...........................SI....TIKLDENKTPSENIQRYFKKYNKLKKT
Q894E2_CLOTE/7-456KQGDES.IDVVNYYSE.DSQ...........................VI....NIKLDPTKTPSTNIQNYFKRYSKLKKS
B8CWR5_HALOH/4-456TKGMKQ.AEVIDYFSP.GQE...........................KT....NIKLDPKLSPSENAQRYFKKYNKAKKG
Q0AXH0_SYNWW/4-462QKGDKT.AIIEDFYQ...GE...........................EV....EIPLDPRYTPIQNAQKYFKIYNKSRNA
A6CPS5_9BACI/4-444ERGMSE.IEVINYYDE.EGG...........................TV....KIALDTRKTPSENAQAYFSKYTKAKTA
Q2B781_9BACI/4-444EKGMKE.IEVINYYDE.NGA...........................TM....VIPLDPQKTPSENAQKYFTKYQKAKTA
Q3ERD7_BACTI/4-446KKGDKD.IEVVNYYDE.NSG...........................TV....KITLDPLKTPSDNAQRYFQKYQKAKNS
A8FD29_BACP2/4-445KKGDKE.ATVINYYDE.DGG...........................EI....TIPLKTNKTPSENAQAYFTKYQKAKNA
Q65JT4_BACLD/4-446KKGDKE.AKVINYYDE.NGG...........................EI....TIPLNPNKTPSENAQSYFTKYQKAKNS
A7Z4I4_BACA2/4-444KKGDKE.AEVINYYDE.ESK...........................TV....TIPLNPNKTPSENAQMYFTKYQKAKNS
A4IM38_GEOTN/4-445KRGMTE.IEVTNYYDE.RGG...........................TV....TILLDPQKSPSDNAQHYFQKYQKAKNS
Q9K9X8_BACHD/4-445KRGDAS.VDVLDYYEE.DAP...........................TI....TIPLDPQKQPSENAQAYFRKYTKAKNS
Q5WFK0_BACSK/4-443DRGASS.VDVIDYYDE.NGQ...........................TI....TIALDPQKSPAENAQSYFKRYQKAKTA
Q8ER31_OCEIH/4-445QLGDKQ.VEVIDYYDP.DQK...........................KV....LIKLNPQKSPSENAQSYFKTYAKLKKS
B1YIQ7_EXIS2/4-442ERGMKE.ATVVDYYDE.DGK...........................EI....TISLDPRFSPNENAQRYYKRYNKLKTA
A3I4D1_9BACI/31-467EKGVKE.VTVINYYSE.NSE...........................EI....TIPVSERKTPIENAQGYYTKYTKAKNA
Q49WZ0_STAS1/4-442KQGDKS.VTALNYYT...GE...........................EV....TIPLNPTKAPAVNAQNYYKQYNKLKTR
Q6GA05_STAAS/4-442KQGDKE.VTALNYYT...NE...........................EV....VIPLNPTKSPSANAQYYYKQYNRMKTR
Q6Q296_STRSU/4-430PNDQSS.VRLDNYYT...GK...........................EL....EIELDVALTPSQNAQRYFKKYQKLKEA
P95752_STRGN/4-427PNDQDQ.VELDNYYT...GE...........................KI....LITLDKALTPNQNAQRYFKRYQKLKEA
Q04KW2_STRP2/4-428PNDQDQ.VILDNYYT...NQ...........................PI....MIALDKALTPNQNAQRYFKRYQKLKEA
Q1JH72_STRPD/18-441PNNQDS.VILDNYYT...GE...........................KI....EIALDKALTPNQNAQRYFKKYQKLKEA
Q5M4J6_STRT2/4-429PNDKDS.VELDNYYT...GE...........................KI....TIPLNVALTPNQNAQRYFKKYQKLKEA
Q3K0R3_STRA1/4-427PNNQDI.VVLDNYYT...NQ...........................TI....EISLDRALTPNQNAQRYFKKYQKLKEA
Q8DTA9_STRMU/4-427PNNQDS.VELDNYYT...GQ...........................KV....SIPLNKALTPSQNAQRYFKKYQKLKEA
Q02YL2_LACLS/4-417PNDKTS.VTLENYYT...NE...........................PL....DIALNPALSPAQNAQRYFHRYQKLKQA
Q835X0_ENTFA/4-442PKGATE.VELPNYYEE..NA...........................PL....RISLNPALSPNQNAQKYFQKYQKLKNA
Q3XYE6_ENTFC/4-444PRGAKE.VVLPNYYEE..DR...........................PI....KIALDPALTPNQNAQKYFHRYQKLKNA
Q039A5_LACC3/4-439ERGMTS.IELPNFYDD..NR...........................PI....KITLSNQLTPSRNAQKYFAKYTKLRNA
Q38X19_LACSS/4-442ERGMTE.VTLPNFYDN..NE...........................PI....KITLSNQISPSKNAQKYFSKYQKLRNS
Q1WTS3_LACS1/4-435KRGMTK.ITLPNFYDN..NK...........................EI....TISLSNQLSPSQNAQKYFKKYQKLKNA
Q03S51_LACBA/4-442VRGETA.VTLPNFYDD..NR...........................PL....KITLSNQLSPNQNAQKYFKRYQKAKNA
Q03FM0_PEDPA/4-444ERGMTE.IELPNFYDE..NK...........................LI....KISLSNQLSPSKNAQKYFTKYQKEKNA
A5VK20_LACRD/4-442TPGMKE.IELPNFYDD..NK...........................PL....KIKLAPELSPSRNAQKYFTKYNKLKTS
Q03W77_LEUMM/4-442QKGMKS.VSIENYYDN..NN...........................LL....EIPLDPKLNGLKNAEKYFNRYRKLRTA
A0NJF9_OENOE/4-422IRGNNS.ISLNNYYD...GK...........................AI....EITLDPKISANANAQKYFTKYQKLKKS
Q04AL3_LACDB/4-439KPGMEK.IDLPNYYE..GNQ...........................PM....TIKLDPALSPQRNAQKYFKRYKKMRDS
Q5FJY7_LACAC/4-438KPGMTE.VSLPNYYE..NNK...........................PI....SIKLDPALSPARNAQKYFTRYKKLRDS
Q74JC6_LACJO/4-439KAGMTS.IDLPNYYE..NNK...........................PL....KIKLDPALSPARNAQKYFTRYQKLRNS
A6P056_9FIRM/4-462EKGMSL.LRAMNFYDP.ECR...........................EA....EIPLDPLLTPQQNAAKYYKDYNKAKTA
A7VVS0_9CLOT/4-460ERGSAF.ADLENFYDE..NR...........................LM....RVKLDPALNATQNAQKYYKEYRKAKTA
A9AW28_HERA2/4-452KPGQSE.LLLD....................................QG....VITLDPTLSAVENAQAKFREYDKAKGA
B9LDK5_CHLSY/4-467PPQATE.LVVE....................................GE....RIALDPKRSPVEQAQERFRAYEKAKSA
A5UZA2_ROSS1/4-464APGQDH.LEVD....................................GR....RIALDPRKSPVECAQDRFRAYEKAKGA
Q24TV3_DESHY/15-479ELGMKE.IVAEDYNEE.SLP...........................QV....TIPLDPQLTGIENSQRYYRLYNKAKAT
Q67PS6_SYMTH/4-455TKGMTE.VRVVNYYDP.EGS...........................EM....VIPLDPALSPSENAQAYYRRYQRARSG
A4J565_DESRM/4-461DQG.KE.ARVQNFYDP.AGT...........................ET....IIAMDSSLTPSQNAQEYFRKYLKAKNT
Q2RK36_MOOTA/4-459KKGQAS.LTAANFYDP.DGE...........................PV....TIELDPSRTPAENAQWYFNRYNKAKHA
O86955_THENE/4-433KGKSGE.VELTDWET...NE...........................KI....VVDVGK..DPAQTAQKLYNTYKKLQRK
Q9WYJ8_THEMA/4-433KGKSGE.VELTDWET...NE...........................KI....VVDVGK..DPAQTAQKFYNTYKKLQRK
A6LP32_THEM4/4-418PIGTKE.VELFDWEN...NE...........................NI....IVPLDPNKDAIENASSYFKKYNKLKTK
A7HKC1_FERNB/4-444NCGEEM.ASLYDWES...DS...........................HV....SVPLEKNLSPIENSVKYFNLYSKLKRK
A8F860_THELT/4-437KDLHKS.VNVMDYNT...GQ...........................MT....LVPLVDGKGVKESSQYYFALYKKLKEK
A9BHH2_PETMO/4-409KKGERY.STVTDWNT...GE...........................EV....TIEVDPLLSPTQNLEKLYKNIQRTKSR
Q8RFL3_FUSNN/5-423KRGMNS.IKAYDFYN...NK...........................EI....EIELNPLISPNENLDRIYKKYNKVKRG
A4XM08_CALS8/4-456KPTSEDFIEVIDYYSE.DLP...........................QI....KIPIEKDKDLKQNAERYYKLYNKLKKA
Q0SNG5_BORAP/4-345QKGLKE.IDLLNYKEE...............................KI....KISLNQSLSPKENALQYFKAYKKGKSS
Q5DRG6_BORTU/4-340KKGMDE.IILNNNNGE...............................QI....KIMLDKALLPKDNALKYFKEYKKNKNS
Q73MD0_TREDE/4-337KKGMKF.IELEDYTKNGA.............................KI....TITLEPLKTPQENANLYYEKYKKAVSG
Q3A4K7_PELCD/16-444SKGMAE.IEVENFFDEGG.............................VV....TIPLDPALSPSENADRLFNRSKKIRRG
Q18J82_HALWD/8-471AEDTSW.DEIRETFAMGAERGIDAAAAVVSV....DGAEAMVTIEIDDM....RVPVNVDVGVEKNADQRYTEAKRIEEK
Q3IRW5_NATPD/8-460EEGVPW.DEIETTFEEGAERGIDAAAAVVGV....DAAEGTVTIDLDDK....EIDLDPTMGVEKNADRLYQEAKRVRGK
Q8TZ51_METKA/10-472RKGYSL.DEIKRRIQEAKGSGIEEVERIADIDVENRRVILRLPGENGEV....TVPVPIDSDVHSTASKLFDRAKELERK
Q5JDJ5_PYRKO/6-451.ETLGW.DEFRRRIDEGKKTGNKVALMVKGI....DPKEKAVTIELDGK....KVKLYLEKSLGENAEIYYEKAKKFRHK
Q8U137_PYRFU/6-450.KQYGV.EEVKKRIEEGKKAGYPWAKMIID......VTDNKVTLNLDGI....KVSLDVEKSLEENAELYYERAKKAKKK
O28241_ARCFU/5-423.ERKSW.DEIKEIVARDEKLKKLVKAIKP........EKNAIVVKVGDF....DVELEIKKSIHENADLYYEKAKKAREK
Y1625_METJA/6-475.EKMDW.ARIKKIIRENKEHPILGLIENINEN..IGEIIIRLKSEVDDKVIEERVSLDIRKNAFENAESYYEKAKKLRNK
A5ULA5_METS3/5-462SKDYSY.KEIGKTLKEAKKNCLKEAEIFESI.....DKMGVLTLKLNET....SININPKLTIPENAEIYYEKAKKAKKK
Q2NGY7_METST/2-454.ENYSW.KEIGSIIKKSKKEGKIPELEMIES....IDKMGVINLKLDDT....HVQIDSNIGIPESTEKYYNKGKKAKRK
O27929_METTH/8-458.EKYSW.DEIKNIIADARKRGLPEASNITEI.....DRMGNITIFLDGE....PVRIDSKLGVPENAEVYYEKAKKAKRK
Q8TSZ2_METAC/6-492AKGYSW.DEIRSILKQAKKTVPAAQKITNID.....QKTGTVTVDLDGR....NVNLDIRKTVPQNAQEYYEKVKKFSKK
A0B9D2_METTP/6-429ERGLSY.TDIWERIQSSGKSAVKSLDYS...........GEMIVEIDGV....TLELNAGLTVPQNAGRYYERAKEAAKK

PF00416

RS18B_YEAST/16-144FWGLRV--------------------------------------------------------------------------
RS13_SHIFL/3-108RRGLPV--------------------------------------------------------------------------
RS13_GEOSE/3-107RRGLPV--------------------------------------------------------------------------
RS18_RAT/14-142FWGLRV--------------------------------------------------------------------------
RS13_MYCBO/3-109RRGMPV--------------------------------------------------------------------------
RT13_ACACA/5-110ILKLPV--------------------------------------------------------------------------
RR13_ARATH/49-153IQGLPC--------------------------------------------------------------------------
RS13_SULAC/11-139SLGLKV--------------------------------------------------------------------------
RS18_ARATH/14-142YWGLRV--------------------------------------------------------------------------
RT13_DAUCA/3-109QDGLPL--------------------------------------------------------------------------
RS18_DROME/14-142YWGLRV--------------------------------------------------------------------------
RT13_PROWI/3-109IQGLPV--------------------------------------------------------------------------
RS13_MYCSP/3-106RKDTCK--------------------------------------------------------------------------
RT13_MARPO/3-109NAGLPL--------------------------------------------------------------------------
RS13_HALMA/25-152KRGQKV--------------------------------------------------------------------------

PF06831

FPG_MYCGE/140-225------------------------------------------------------------------------------
FPG_LACLC/132-225------------------------------------------------------------------------------
FPG_HAEIN/129-213------------------------------------------------------------------------------
FPG_MYCPN/135-227------------------------------------------------------------------------------
FPG_ECOLI/129-219------------------------------------------------------------------------------
Y5760_STRCO/124-214------------------------------------------------------------------------------
FPG_BACFI/134-226------------------------------------------------------------------------------
FPG_STRMU/132-222------------------------------------------------------------------------------
FPG_SYNY3/143-233------------------------------------------------------------------------------
Y3325_MYCBO/123-203------------------------------------------------------------------------------
FPG_SYNEN/137-229------------------------------------------------------------------------------
FPG_NEIMB/135-227------------------------------------------------------------------------------
END8_ECOLI/126-214------------------------------------------------------------------------------
FPG_MYCTU/144-234------------------------------------------------------------------------------
FPG_THET8/122-214------------------------------------------------------------------------------
FPG_BACSU/134-224------------------------------------------------------------------------------
Y2491_MYCBO/126-218------------------------------------------------------------------------------
O93997_CANAX/191-306------------------------------------------------------------------------------
O80358_ARATH/146-238------------------------------------------------------------------------------

PF05833

C1KWC8_LISMC/4-447VEVVKEQIALTKEEITYLESVESQLE.............TS.GPQDVEEIRQELAEQGYLRY....KQKK.GSRKKAT
A3Z5Y2_9SYNE/15-450EPLLEERRRYHQQRLQLIEGSEAFLDNLLDAPSAAAGDGLDDTPERLQELRGEL..DELLMP....QRRRNRADERRH
Q05WQ7_9SYNE/10-434VPLLEERMRHHEQRLTLIDGSEAFLDDVLA....ADWDRSEERIRRLQELRLEA..QDLLAP....RQRR.RAHQSNM
Q7U569_SYNPX/23-449STVLEERILHHDSRLQLINGSEAFIDDLQA....AAWQPMAARLEALSDLRREL..DELLNP....VGRQERKQRQQQ
A5GMV8_SYNPW/10-441VPLIEERLKHHDQRLMLIEGSESFLEDLTQ....ADWDDPDERSLQLRNLQQEL..EELMAP....RQRR.RRSVAPT
Q0I869_SYNS3/10-447VPALEERLQHHQSRLVLLEGSESFLEELIG....ADWDGLKARTKSLLDLREEL..DDLLAP....KRLR.RRRRQGS
Q7V657_PROMM/52-482VPVLKTRIEHHQQRLQLIQGSEMFLEDLLG....TSWEGQRERSIRLQELRQEL..DELLIS....QSRN.RQKRGRR
A5GRV1_SYNR3/5-448VAAIEPRLRRHQQRLELLEASQVQLQL...........ADPGDADVLEALADDL..EPFLKT....KASQ.SKSSRRQ
Q46GV7_PROMT/10-438RESIVNRINFHKKKISDIQCCESFIDSFLY....EENEDNKNKLESIIELKEEV..EEYICI....KKNN.SKFKLKR
Q7VDB7_PROMA/10-439KAILMERISYHKERLSFANEIELFLEYIMN....NTKENKASKIEDILILKEDI..ENYLLL....KQQK.GTKKIKQ
Q8DHA1_THEEB/5-448QQHITPLLTAAEGELAYLDQVAATLA.............TATSLDVLEEIRAELIQQGYLIA....PDYYRPPTTPSP
Q31PG3_SYNE7/5-452RQAVLPLLAEVEAELRYLDSIATALAPLQ.......TAQTRADWLALQDIREELAQQGYWPY....KTDR.PRPTRSQ
P73561_SYNY3/5-464EAAILPLLAEVEQELAYLTQVETSVQALT.......EFDDLADWQTLTEIRDELAEQNYLAL....SHGR.PRRKEAE
Q8YP27_NOSS1/5-452RIAVEPLLQEVQAEIDYLEQVEAAISQID.......NYQTAEDLQALEEIRDELIGQKYLEE....LEYR.SRNNNET
Q110R4_TRIEI/5-453HTIVKPLLAEVQNEIHYLEQVEAFLSQLN.......NYRSPEDLQTLEEIREELIQQGILNA....PEHHQQNNRKDT
A0YTA6_LYNSP/5-455RIAVEPLLAEVQAEIDYLEQVEAAIAQIE.......TYQTPEDLQTLAEIRDELTQEGYFNT....PGYQ.NRSTTET
Q4C6V5_CROWT/5-452KGAVEPLLKEVQEEINYLEQVEDSLQQID.......NYNSPEDLQTLQEIKEELIQQNYLTS....RTQQ.TQNIPDE
Q2JJS2_SYNJB/5-470QDAIRPLQEALGQEILYLEQVEASLQQLE.......TYRDPQDLTTLKEIETELIEQRYLES....PTRN.SGTESLR
Q2JXM6_SYNJA/5-461QEAVQPLLEAVAQEIRYLEQVEATLQHLG.......TYRDPQDLAALREVETELIQQGYLES....PSRA.EGSRRAS
Q7NK58_GLOVI/5-445RQAVTPLLEQAREEVAYLEQVGATVEL..........LGESTDLEALLEVEEELVQQKYVEA.........KEKPATS
A4S6P0_OSTLU/47-508ADAVEPLIEQNASEIEYLEGVEFSILEVS.......EFKSRDDLLFIEEIGAEL.KGGGAKP....KTGK.QARKQEM
Q2IMA8_ANADE/4-353AARVEARAAEVRAREAALRALLGRID..............AAGAADLPRLEREARRLA.............AGPRPAA
A7H6P3_ANADF/4-347AERVAARTAGVRGREAALRSLLGEID..............SAPLEELPRLEREARRLGAG...........PRPQPQP
Q9RWV6_DEIRA/9-409YLRLAEREGSIRSELEAARERLHRLD.............HA.ELEQLEQLASDLE................REKPERS
A6TRX6_ALKMQ/4-463LLEVALQLEKTHGEINYLEQIMVSID.............QSMSLSDVEEIRQELIQTGYIKP....KAKV.KVKVNKQ
A8MH76_ALKOO/4-463LIQVNHQIEKTQEEIHYLEQILVSID.............QCTHLSDIEEIRAELEETGFIKK....RAVK.KGASSNQ
Q8KWV4_CLODI/4-463KVEISHQISLNKEEIDYLENIILSIE.............NCENLAELQDIKEELAKVGYIKT....QKKN.SKKDTIP
A7VD88_9CLOT/17-469YEALEKLIVETGHELEYLQSVQAFID.............MTLDENALAQVKEELMISGYIKG....RYGK.KGDKHTN
A5KQ53_9FIRM/44-496FEALTQLIRETKDEISYLESIQTSLD.............IAMTEDDLAAIKEELSETGYVRR....KTVR.KKIKLKN
A7B5I6_RUMGN/4-456FEALSALTEETKEDITYLESVSTALD.............IALSEEDLAEIKEELIHSGYMRR....KFTK.KKVKIKN
A6BEG8_9FIRM/4-456FEALTELIQETADDIQYLESISNALD.............IALSEADLAQIKEELMQSGYIRR....KHTK.KKVKLTS
A5ZQ83_9FIRM/4-457EEALTEQIADTEAEIEHLESISNALD.............IARAENDLSQIKEELTEYGYIKK....HYSN.KKGQKAQ
A5Z6K1_9FIRM/4-456GDALIDIIKTTKASIDYLETINVSID.............MATSEHDLKAIQQELVQTGYIKH....KKTN.NKKEKNL
A3DCY8_CLOTH/4-460YIHATQQLEEARGELSYLESVLHSLE.............NSNSFEDIDDIRQELAEQGYLPS....KKKR.PEKKNSK
B8I3G9_CLOCE/4-460HLNVTKQLAETLSELEYLQSVLTMLG.............NCNSRQEIDEIRQELIDQGYIRQ....SYKN.AKNKQDK
B0KA21_THEP3/4-455NKIIEKQISDTLEEITYLEGQLVNLE.............NCTLPSEIEEIKNELSEQGYIHK....QQKK.KISRQTL
Q8R9S1_THETN/4-455FNTIKKQISETLEEINYLEGQLINIE.............NSTTLEELEEIKNELIEEGYIHK....HQKK.KVASHSL
Q0SRX7_CLOPS/4-452EESALEQLAINEDELKYLNSVSSSIQ.............VADNYEDIDAIKNELIETGYIRF....RRNN.NGKKKEK
A6LTU3_CLOB8/4-455EEYAKVQLKKNDEEMKYLNSVLTNIL.............NAESYNEIDEIKNELIETGYIRF....RKNN.KNSKKVK
A5N7G3_CLOK5/4-459EKAAEEQLKIAKEEIEYLNSVFINIK.............NSDSYEHIEEIKRELMETGYIKF....KKST.NKKKIKA
A7FUW8_CLOB1/4-455EVAAKEQIELTCDELKYLNSVLTSIK.............NADSYDDIEEIKRELIETGYIKF....KKKN.NKKFKNT
A0Q075_CLONN/4-456EEAANEQLLQNEEELNYLYSVLTNIN.............NADNYDEIEEIKKELIETGYIKF....KKIY.KSKKSKT
Q97HA2_CLOAB/4-451EENAQIQIKNNNEEIEYLQSVLTNIE.............NSDTYSDIEDIRQELIDTEYIRF....SKKN.KQKKKDK
Q894E2_CLOTE/7-456KEYSLEQIKITEDEIIYLNSVLTNIK.............NTENYAGIEEIKKELMDARYLKF....KKNI.RKKETKS
B8CWR5_HALOH/4-456VKYIKRELRKLKHEERYLEQVMLNLE.............QAESREEIREIKEELGDEGYIKK....KNRI.NNRRKQQ
Q0AXH0_SYNWW/4-462IRHLKQLLASNQEEIDYLESIIVLIA.............QAETPEIVEEIREELEKQGYVKE....HTQR.ARKELLK
A6CPS5_9BACI/4-444IKIVQEQIEKAKEEIQYMEQLLQQLE.............SA.SPKDILEIREELAEEGYIKA....KNEK.KKKKINE
Q2B781_9BACI/4-444AGIVKEQIEKAKEEAAYFESLLQQVE.............AA.STKDIEEIREELAEGGYIRI....RQKK.QNKKSAN
Q3ERD7_BACTI/4-446VVIVEEQIEKTNEEILYFDSLLQQME.............AA.SSKDIEEIREELAEEGYVRN....RKKK.NTKKKPT
A8FD29_BACP2/4-445VEAVNEQIERTHEEIAYFDELIQQLS.............SA.SPKDLEEMREELVEGKYLRA....KQKR.NAKKKKT
Q65JT4_BACLD/4-446VEVVKEQIKLAEEEIAYFDQLIQQLS.............SA.SPKDITEIREELAEGKYLRA....KQQG.GQKKQKK
A7Z4I4_BACA2/4-444VEVVKQQIRLAEEEIAYFDQLIQQLS.............SA.STKDIHEIREELVEGKYLRP....KQQR.GQKKQKQ
A4IM38_GEOTN/4-445LAVVREQIERTKEDIAYCDTILSQLE.............TA.SPKDIEEIRDELIEQGYLRP....RAAK.GAKKRKP
Q9K9X8_BACHD/4-445VEVTKEQIEKAKIEIDYFERLIQQVE.............TA.SARDVEDIREELIEEGYLRR....KQKV.SKKRKET
Q5WFK0_BACSK/4-443RIEVMNQQEKTEQELAYLDSLLAQMA.............SA.SPRDIEEIREELIEGGYIKK....RQQG.KKKKKQL
Q8ER31_OCEIH/4-445RQVMQSEMKRTDLEIQYLDQLLQQLD.............VA.STDDIEEIREELREEGYLKK....QRQA.KKKKKPQ
B1YIQ7_EXIS2/4-442KIEVAKQLEKNQLEINYFESLLAQLD.............VA.SPEDIREMREELVEEGYVRE....RSKK.KKKPLIP
A3I4D1_9BACI/31-467LIMVQQQLEKTKEEITYFEMLAQQVQ.............QA.SPGDIEEIREELAEQGYLKL....RHSK.KKKKPVK
Q49WZ0_STAS1/4-442EHELHHQIDLTKENINYFESIEQQLA.............HI.SVNDIDDIRDELAEQGYMKQ....RKQS.KKKKKQT
Q6GA05_STAAS/4-442ERELQHQIQLTKDNIDYFSTIEQQLH.............HI.SVHDIDEIRDELAEQGFMKQ....RKNQ.TKKKKAQ
Q6Q296_STRSU/4-430VKHLTNLIEETKSTIVYLESVDTMLG.............QA.SLAEIDEIREELIETGYLKR....RHRE.KIHKRQK
P95752_STRGN/4-427VKHLTSLIEETRTTILYLESVETALA.............QA.SLTEIAEIREELIQTGFIRR....RQRE.KIQKRKK
Q04KW2_STRP2/4-428VKYLTDLIEETKATILYLESVETVLN.............QA.GLEEIAEIREELIQTGFIRR....RQRE.KIQKRKK
Q1JH72_STRPD/18-441VKHLSGLIADTKQSITYFESVDYNLS.............QA.SIDDIEDIREELYQAGFLKS....RQRD.KRHKRKK
Q5M4J6_STRT2/4-429VKHLTGLIEETKQTINYLESVEFSLS.............QA.NMDEIEDIREELVQAGFMRR....RSTD.KRQKRKK
Q3K0R3_STRA1/4-427VKHLKGIISDTKNTITYLESVETSLN.............HA.SMEDINDIREELVETGFIKR....RAHD.KQHKRKK
Q8DTA9_STRMU/4-427VKHLGSLISETKATIQYLESVDNALN.............QA.SLSEISEIREELVQTGFVKR....RHRE.KIQKRKK
Q02YL2_LACLS/4-417VKFLGEQIAKTKETIHYLESVESNLE.............NA.DVPEIADIREELIQTGYIKQ....KYRN.KKQKMLP
Q835X0_ENTFA/4-442VRVVKTQIQQTQQEISYLESVVAQLE.............IA.TPMDIEVIREELIEQGYLKR....KKNK.KQKQPKK
Q3XYE6_ENTFC/4-444VKLIGEQIQEAKDEIQYLESVLSQLE.............IA.GPMDIEAIKEELTSEGYLKK....KNLK.KQKRKKP
Q039A5_LACC3/4-439VAHVHQQMQENQEEIDYLEGIMAQID.............VA.SPKDLADIRLELQQQGYLRK....QKTN.KKGAKRQ
Q38X19_LACSS/4-442IAYVNDQMAKTEAELQYFYTIMAQIE.............IA.EPKDLEDIKAELQAEGYLKI....KKTG.AKKQKRY
Q1WTS3_LACS1/4-435VTFVNEQMELTKKEVAYLEEIQTQIE.............LA.TPADLDDIKTELQQEGYIKK....KQQK.SKRSSRV
Q03S51_LACBA/4-442VIYVNEQLEKTQADVDYFSNIMAQIE.............LA.APKDLVDIRLELQEGGYLRD....HDHQ.KKNKKQR
Q03FM0_PEDPA/4-444VKYVSEQIAKTESEINFLDNIETQID.............LA.KPEDLDDIKLELENEGYLK.....KQVN.PKKRIKP
A5VK20_LACRD/4-442VEYVKEQLKLTNDEIKYFENIENQIK.............LA.APADIQEIKLELQEQGYIKK....KKSG.KKQRKVK
Q03W77_LEUMM/4-442VDFVNEQIALTDAEIDYFNNIVAQLD.............VA.SPKDVEDIRLELTAEGYIRA....NKKN.KQKPKVS
A0NJF9_OENOE/4-422VKYLDEQIRLASKELDYFENIEEQLK.............NA.SPKDLDQIKIELLKEGYLKD....KKSD.KKPAKKR
Q04AL3_LACDB/4-439IKHVTEQIEITEENLRYLDSVQTEID.............NA.DPEDVEAIKEELINQGYLRA....EQKK.RQKPKLT
Q5FJY7_LACAC/4-438IKHVNEQIKIAKENLRYFDSIQTAID.............NA.DPQDIDQITDELINQGYIRK....QQKN.RRKKKIT
Q74JC6_LACJO/4-439IKHVNEQIKLANENLDYFDSIQTAID.............NA.DPQDIDAISDELINQGYLKE....QNHN.RHRKKKI
A6P056_9FIRM/4-462ERVLTEQIARGEGELEYLNSVLENIT.............LAEGERDLQEIRQELTDTGYLRR....QNKA.AKREKRV
A7VVS0_9CLOT/4-460QQVLGEQIAQAEQELLYVDSVFDCLS.............RAQSESELNEIRQELREEGYLKA.....VRD.KRKPPAP
A9AW28_HERA2/4-452LEDVPQLLEQTEAQAEYLQQTNDLLS.............LAESFAEIEQFERELIAGGWLRQ.......TIGKAKSKP
B9LDK5_CHLSY/4-467RAILPERLAEIEQRLAGIDQFIALAA.............VADDSNQIDQIAAEAEEAGYLRS....SATR.RPPVRSR
A5UZA2_ROSS1/4-464LAGVPERLRAVELRLAGLDETLALLE.............LAEGYDAIEAIAREAEAEGYLGP....ETGR.TRKRPDR
Q24TV3_DESHY/15-479IQKTTPLKDAVEEEITYLNSVLLSLE.............QATVPAELDEVHKELIEENYLSG....KHHG.KPLAGEG
Q67PS6_SYMTH/4-455LAAIQEQLARSRAELAYLEQVEVTLE.............QAESLPDLEEVRRELAAEGYLREGASRRGSE.PGRRQAA
A4J565_DESRM/4-461RNAVTQQLEQAESELNYLDAVDTALS.............QAMYQEDLKEIRSELEEQAYLKP....KIQQ.VKNRSQK
Q2RK36_MOOTA/4-459ARLAAAQLEQTKAEIAYLESIAQAVS.............MAATRDDLEEIRRELRQAGYLP.....EERD.KQKPGKK
O86955_THENE/4-433KEQVEKRLKEISQEKEYLYQLWQTVD.............DAEDLETLEGNRRGNERTRLLKE....KSEK.KRKEKTS
Q9WYJ8_THEMA/4-433KEQVEKRLEEIQREKEYLYQLWQTIE.............DAEDLETLEEIEEEMREFGLLKE....RKTK.KQKSKKT
A6LP32_THEM4/4-418LKGLLNRKKYLEKELNYLYQLWYTLE.............EVDDLNEVEDIKSEMEDVGILKV....RKRR.KNNVKSE
A7HKC1_FERNB/4-444AKGIEERKEILSKELSYLQQLQLTIE.............NAEGLEELFEIEDEMVENGLIKK....KVDK.KGKKKSE
A8F860_THELT/4-437SEILKARIKRETLFLNYAEQLMHTLE.............LAEDLETLQEIEQEMAQQGLIKE....KTVF.RKSKSKP
A9BHH2_PETMO/4-409VEHAKKRIKKVNNELEYFNQLFETIS.............SAEEIETLIEIKEEMKDIGLISE....NKKS.KRERKVK
Q8RFL3_FUSNN/5-423LTNAIRREKEIKEEINYVETTLLFIE.............NSADVASLREIEEELIKLNYIKS....LYNK.KKTKLKK
A4XM08_CALS8/4-456EEYAKAEISEIETELEFLYSLEALLE.............KSVEMEDLLSVEEELEKEGYIKI....QPDA.KKNEKKK
Q0SNG5_BORAP/4-345FNTIQNQLKDNLDKFNLIQSKITMLK..............VENFIPKEEYNQEETAI..............KKKEKTS
Q5DRG6_BORTU/4-340LKIIQEQLEYAKTQYNTLISKTAYID.............KTDCIIPTNEKT....................KKQKITK
Q73MD0_TREDE/4-337LEALEEDIISAEKEIEKLKEKIEKIK.............TEENPYLIQKIL...............QKEKIPVQQKAK
Q3A4K7_PELCD/16-444YIHVHRRIEESHAEKDWLEALMLNLS.............EVTSNEELAMVEEEMREFRLLPR....KADR.QKKRPVS
Q18J82_HALWD/8-471KEGALTAIENTREELNAVKQRRDAWD.............REDAKPDTED......................NADNTET
Q3IRW5_NATPD/8-460KEGAQAAIEDTREDLEDVKERRRQWE.............ADD..................................DE
Q8TZ51_METKA/10-472AERAQEVLREQERELEKLLEEGPPEV...................ELEELTVELTKR..............RKKDWYE
Q5JDJ5_PYRKO/6-451YEGALKAYEDTKRKLEEIEKLIEEEQ...............KKELNVKKLER...................RKRKWFE
Q8U137_PYRFU/6-450LEGAKIAYEETKRKLIELEKEIERES................KEINIKKITR...................KKKKWFE
O28241_ARCFU/5-423AEGVKRAIEATLREMERVEEKLEKKL....................VTSIKVR..................RKKEWYE
Y1625_METJA/6-475IEGIENAIELTKKKIEELKKKGEEEL................KEKESMQMKKKI.................RKERKWY
A5ULA5_METS3/5-462TKGATIAIENTKKQLEKIKAKKEVAM..................EHISVPKKRVK................KNLKWYE
Q2NGY7_METST/2-454IDGVNKAIENTKSEIKKLEDKKEVAI..................ELLRQKQEK..................REKRELK
O27929_METTH/8-458IKGVMTAIEKTEKEIERIEKKRDDAL..................RNIMVPRRRVK................RKLRWFE
Q8TSZ2_METAC/6-492RDGALKAIEETKKAMEKKAASKAAKA............................GRKLQAF..........RKKHWYD
A0B9D2_METTP/6-429AAGAEEALRRTEDLLQRGEERRRSPV.............................................LKRRHKP

PF00416

RS18B_YEAST/16-144------------------------------------------------------------------RGQH-TKTTGRR
RS13_SHIFL/3-108------------------------------------------------------------------RGQR-TKTNART
RS13_GEOSE/3-107------------------------------------------------------------------RGQN-TKNNART
RS18_RAT/14-142------------------------------------------------------------------RGQH-TKTTGRR
RS13_MYCBO/3-109------------------------------------------------------------------RGQR-TKTNART
RT13_ACACA/5-110------------------------------------------------------------------RGQR-THTNAKT
RR13_ARATH/49-153------------------------------------------------------------------RGQR-TKNNCRT
RS13_SULAC/11-139------------------------------------------------------------------RGQR-TRTTGRT
RS18_ARATH/14-142------------------------------------------------------------------RGQH-TKTTGRR
RT13_DAUCA/3-109------------------------------------------------------------------RGQR-THTNART
RS18_DROME/14-142------------------------------------------------------------------RGQH-TKTTGRR
RT13_PROWI/3-109------------------------------------------------------------------RGQR-SHGNART
RS13_MYCSP/3-106------------------------------------------------------------------R..S-TKKNART
RT13_MARPO/3-109------------------------------------------------------------------RGQR-THTNAKT
RS13_HALMA/25-152------------------------------------------------------------------RGQR-TKSTGRT

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window