Sequence alignment for CL0305

PF01981

Q7QK06_ANOGA/56-171EYKMVLVVRNDLKMGKGKIAAQCGHAAVGAYESG.........VRNTP..............................AA
PTH2_DICDI/95-210DCKQVLVIRTDLGMTKGKIIAQCCHASLGARQKA.........LKDSK.............................K.V
Q16ZN1_AEDAE/15-130PTKMVLVVRSDLGLRKGKIASQCAHAAVLCYNRS.........ASVNQ..............................AK
A7EIB5_SCLS1/115-232ECKMVLVVRTDLGMTKGKIAAQCSHATLACYKTM.........TRKDPN............................SSI
PTH2_HUMAN/64-179EYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQI.........QRRNP..............................EM
PTH2_CAEEL/200-316THKMVLVANMSLKMGTGKIAAQVGHATLGVYRQAM.......NSENGQ..............................NA
PTH_THEVO/2-117VVKLVVAVRKDLDMGKGKIAAQVAHAAVSCAIKA.........MKEKK..............................KI
Q5DB59_SCHJA/45-160KMKLVLIVRTDLKMGCGKIAAQCSHATLSCYEKL.........IDTNP..............................DI
Q1H5E3_ARATH/55-169DFKMVLVVRNDLKMGKGKIAAQCSHATLGLYKKL.........VRRAP..............................KA
Q6FXT4_CANGA/95-216EVRMALVIRQDLGMQKGKVAAQCAHAALSCFRLIATD...PNKMSYNP..............................EL
A7I6R2_METB6/8-120RYKQCLIVRNDIKMSCGKKCAQAAHASIGAF............ESADK..............................TL
A4S4B2_OSTLU/20-135EHKMALLVREDVAMGAGKLAAQAGHAAVGAAMAT.........RDRSP..............................ML
A2Y6L9_ORYSI/89-204ELKMVLVVRKDLKMRAGKIASQCAHAATGLYAEL.........MASNR..............................GL
A9A5U1_NITMS/10-124DIKQVIVVRTDLEMGKGKIAAQVGHACVLGAEHV.........RKSHP..............................EW
Q8SVU8_ENCCU/41-155EYGMNIIINKDYPMSKGKIISQICHGMSFVMCHL.........LKNDE..............................EL
PTH_STAMF/6-121EYKQVIIVRTDIKMSKGKLAVQVAHAAVSAAFEA.........YKKKR..............................EW
PTH_AERPE/5-124GYKQAIVVRRDLGMGRGKAAAQAAHASCEAVFLILE.....SGRPEWR..............................RW
Q296T5_DROPS/66-181NFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQKA.........VTRIP..............................RL
Q4DYZ8_TRYCC/56-200PLKMTLVVRKDLKMGTGKIAAQCAHAAVAVVEKVESRRQKGDTTTPTPRAAHDECVEA..........NEGAHWDEWVAW
Q4UI49_THEAN/73-188EYKLVLCVRTDLSMGKGKIAAQCGHASIGAYADS.........VKNNN..............................PY
Q4PDF3_USTMA/80-195ECKMILAVRMDIKMEKGKIAAQCGHATLAAYKLA.........KRLTP..............................KF
PTH_METBU/3-115EYKQCIIIRDDLKLSKGKLAVQVAHAAVSAA............EWASR..............................SD
A0RUY5_CENSY/21-135PIKQVVAVRTDLGMGKGKIAAQVGHACVMGAERV.........RRSHP..............................EW
Q177N9_AEDAE/59-174EYKMVLVVRNDLKMGKGKIAAQCGHAAVGAFEGA.........LKKTP..............................SV
A0B7H9_METTP/2-114VLKQCIVVREDLRLSTGKLAVQVAHASIMAM............ELARK..............................EI
A5KAM4_PLAVS/65-192DCKMVFCVRTDIKMNKGKICSQCCHACLSVYEKIMKR...NSRLKASESGK........................GTLTY
A1CWS4_NEOFI/89-205EVKLVLVVRTDLGMTKGKIAAQCSHATLACYKYL.........IAHNPQ............................SPI
PTH_METMP/1-116MYEQAIVIRNDLKMGKGKMAAQACHASIQAFLHA.........QKISS..............................SA
Q6C4E6_YARLI/84-199ELKMVLVVRTDLKMTKGKIAAQCAHAALACYRQS.........SDLKP..............................KT
PTH_ARCFU/2-114TLKQVIVVRDDLKLSRGKLAVQVAHAAIIGY............LKSDS..............................SL
PTH_PYRAE/2-119DVKMTIAIRGDLKISCGKAAAQAGHAAVECVLAAM.......GDAKWR..............................KW
A5DS61_LODEL/96-217EVRMSLIVRQDLKMGKGKAAAQCSHATLALYKKITN....PNSEAYNP..............................EM
Q582G7_TRYB2/52-206PLKMTLVVRRDLKMGTGKIAAQCAHAAVAVMEEVQSRRSDNGANCNDSCSTYGYSGNSDHYSPAASQMCGGSGADKWVSW
A2E781_TRIVA/74-189NSCAIFFINKSLKMRKGKISAQCGHASLGIFKKT.........AKVYP..............................KV
Q3IMF5_NATPD/3-115GMKQAIVARTDIDMGTGKLAAQVAHASLSAY............EDAGD..............................EA
Q75D12_ASHGO/87-208EVRMALVIRQDLGMTKGKIAAQCCHAALACYRLMAED...VTRVSYNR..............................DM
A2SRL9_METLZ/9-121KYKQCLILRSDLKLSCGKMCAQAAHASIGAY............EKASL..............................AD
PTH_METBF/3-115EYKQCIVTREDLKLSKGKFAVQVAHAAISAS............EWASK..............................ND
A8BYR9_GIAIC/60-174SMKLVILVRTDIKMTRGKACAQCSHAAVRACQVA.........HRYAP..............................QK
PTH_PYRHO/6-121KYKQVIVARADLKLSKGKLAAQVAHGAVTAAFEA.........YKKKR..............................EW
A0C4B0_PARTE/81-196RYKMVCVVRMDLKMGIGKIAAQTGHAVLGAYKQL.........LNDKH..............................DL
Q4T7T1_TETNG/50-165KFKVILVVRNNLKMGKGKEAAQYSHAAVSAYKQV.........QVRNS..............................SP
PTH_THEAC/2-117VKKMVIAVRKDLDMGKGKIAAQVAHAAVTCAIRS.........MKINR..............................DV
Q0W1J2_UNCMA/3-115EYKQCILVREDLKLPKGKMAVQVAHAAISAA............EWAKP..............................SV
Q9VG06_DROME/21-139STKLALVVRTDLKMSKGKTAAQCAHAAVMCYQSSV......QGTKLQN..............................AI
PTH2_SCHPO/90-205QTKMVLVVRTDLGMTKGKIAAQCAHAALACYKIA.........SAVDP..............................DL
A7S519_NEMVE/6-121EYKMILVVRQDLGMGKGKVAAQCCHAAVGLCRQL.........LKNNP..............................KV
Q2BB23_9BACI/7-113QIVQYYVINSDLKMSAGKAAAQAAHAAAISVLT..........YMEEP...............................L
Q4QIY6_LEIMA/88-221PVKMVLVVRKDLKMSNGKIAAQCAHAAVAIVEEILAF...KSTTTKSPRSGLNP..................VSALWVQW
A4VCS2_TETTS/101-221YYKMVFLVRMDLKMGTGKIAAQTGHAVLGAYQQLEE....RADEREVE..............................QI
PTH_SULTO/2-121ATKMVIVVRTDLDMGKGKIAAQVAHAAVSLVLDILN.....SSNSLWK..............................EW
Q5TVS0_ANOGA/23-144PMKMVLVVRSDLGLKKGKIASQCAHAAVLCCMRAASA...GCDAAGRG..............................KM
A3MY21_PYRCJ/19-136SVKMSIVVRRDLGMSCGKAAAQASHAAVECVLLAQ.......NSGKWR..............................RW
PTH_META3/1-116MYKQVIILRNDLKMGKGKLVAQGSHASLISFLNT.........QKNNP..............................SV
PTH_NANEQ/1-115MVKQVIVCRK.LDIGKGKLCAQVAHASLDAALKV.........YRNNK..............................EL
A7SR90_NEMVE/98-215PYKMAFVVNSELNMGVGKVAAQVGHAAVGLYRAL.........LQDQDD...........................LGHM
A1RY06_THEPD/3-118SLKQVIVLRRDLDMGKGKMVAQGCHASVSAVLET.........LKRNR..............................EI
PTH_SULSO/1-120MIKMVIVVRSDIKMGKGKIAAQVAHAAVTLVVSIIN.....SNNLRWK..............................EW
Q2GVN5_CHAGB/110-233ECKMVLVVRTDLGMTKGKIAAQCSHATLACYKAL.........TRAAQQAPG......................SAEGRI
A3CVC9_METMJ/8-120KWKQCLIVRADIKMSCGKKCAQIAHAAIGAY............EKADK..............................LA
A6CPG9_9BACI/5-119EVVQYFIVNKELNMSAGKIAAQTAHAATISTIDL.........LSDRSSFA........................NFRED
A3ZNP0_9PLAN/157-280IVKQVIVMRHDLGMRRGKQIAQGAHASLAFLAYRMFQ..GPVAIEDFG..............................PA
PTH_CALMQ/3-118EFKQSIVVRGDLRMSRGKLAVQVAHAAVSAVLEA.........LRNRG..............................DW
Q5KBR9_CRYNJ/89-204EMKLVLVVNDELKMTKGKIAAQAGHATLACAMTL.........KEANP..............................KL
Q9P5S6_NEUCS/118-241ECKLVLVVRTDLGMTKGKIAAQCSHATLACYKRL.........FSAAQLEPL......................SLSARL
Q2FLI4_METHJ/8-120KYKQCIIIRNDVKMSCGKKCAQAGHAAIGAY............EKSSL..............................TL
A2BKV8_HYPBU/6-125EYKQVIVVRADLKMSRGKLAAQAAHAAVEAVLEILD.....SGHPEWR..............................RW
Q6VZV0_CNPV/13-124TLKMVFIIRNDIKMSKGKMISLCAHGAIKAYIKA.........EEHCT..............................DY
V029_FOWPN/13-124MLKMVFVIRDDLKMTKGEIVSQCCHGAISAYEKS.........KKYSP..............................DY

PF09391

Q0B799_BURCM/3-135DTKVALIVRDDLAA--WQKLNVVAFLATGVAA..GAPDALGEPYEDAA--------------------------------
A6WUZ4_OCHA4/4-136DTKVAILVLHDLPV--WQKLNVTAFIATGISG..AVPHAMGDPYEDAA--------------------------------
Q0RN89_FRAAA/15-147TTKIAVLLRDDLLD--WQRLNVTAFLVSGIAA..SNPELVGEPYADAD--------------------------------
Q13WI2_BURXL/4-136DTKVAIIVLDDLAV--WQKLNVTAFLATGIAG..AAPEAMGEPYEDAA--------------------------------
Q12P64_SHEDO/9-143EKRFIAILNKKMDS--GRTLNVLGHISVGLADLLPAGEAHYVDYLDMD--------------------------------
Q03X34_LEUMM/2-135KMKCVVIVDPELPI--GLVANTASILGRSLGK..AHPEINGEDTYDKN--------------------------------
A9CKI6_AGRT5/3-135DTKIAVILRDDLAV--WQKLNVTAFLMSGIVA..QTGEIIGEPYRDGA--------------------------------
Q98CG5_RHILO/3-135DTKFAIVLREDLPV--WQKLNVTAFLTSGIVA..QFPDIIGDPYRDRS--------------------------------
Q2SFE1_HAHCH/8-142DLKCVIVIDANLPT--GPIANTAAVLALSLGK..AFPGLIGDSLPDNS--------------------------------
A5N5Q1_CLOK5/5-140NMKCIMIIDSQLPI--GVIANTSAILGVTLGK..HIPEQVGDDVMDAS--------------------------------
Q218I4_RHOPB/4-136DTKIAVVIRTDLEA--WQKLNVAAFLTSGIAA..AFPECVGEPYQDGS--------------------------------
A6WFS5_KINRD/22-154DTKTAVLVRDDLAT--WQRLNVAAFLASGITA..AHPDLVGEPYADAD--------------------------------
Q5LDE1_BACFN/10-145THKCVLVIDNAQPT--GIVANIASVLSMTLGC..RVSNIVSHDVYDKQ--------------------------------
Q2K6F9_RHIEC/3-135DTKIAIVLRNNLAG--WQKLNVTAFLSTGIAG..QYPEIIGEPYKDRA--------------------------------
Q18BF3_CLOD6/5-140NSKCVMVIDENLPM--GIISNTAAIMGITLGK..HAPETVGPDVIDKT--------------------------------
Q1RJ92_RICBR/4-137ENKLVIIVNKDIEI--GVAMNAVAHSSLAAGALLGKPTCFLQPNIDAS--------------------------------
A6ALF3_VIBHA/9-143QKRFVAVISKKVEV--GRAVNVLGHLSVSLANQLSDGDAIYTDYHDLD--------------------------------
A1R9D5_ARTAT/24-156DTKVVVVLADDLLP--WQELNVTAFLMSAIAT..SAPDLTGEPYQDRD--------------------------------
A0NMB0_9RHOB/3-135ETKFVVVVREDLAV--WQKLNVTAFLSTGVAA..AKPGIIGEPYSDAA--------------------------------
A1JPI8_YERE8/4-138QIRIAIIVNPELPV--GLIANTTSAVGIGLAA..KFPQLAGTALSDSA--------------------------------
Q5WS14_LEGPA/7-140KNKLVAVLNKHIEP--GKVMNALAHMCIGLGAVIGNEELRLTDYRDAD--------------------------------
A3UM68_VIBSP/9-143QKRFIAILSKKMDL--GRTLNVLGHLSIGLSNQLESDETCYVDYEDLD--------------------------------
A4EUC0_9RHOB/4-136ETKAAIVVREDLMM--WQKLNVTAFLTSGLVG..ADPDLIGARYQDAS--------------------------------
A0QVI8_MYCS2/4-136DTKIAVLLRDDLEG--WQRLNVCAFLASGIAA..AHPGTIGAPYADAD--------------------------------
A1WDY7_VEREI/7-141EMKFVAVVNRKHSL--ASILNALAHTAFGLSGKGVNPEHLL.DYSNSA--------------------------------
Q5E5X3_VIBF1/3-134NHKCVLVIDKALPQ--GLIANTAAVLTLSLGK..LHPELIGADNVNKN--------------------------------
Q65P03_BACLD/4-139ETKCALIIDESLPL--GLIANTAAILGAALGK..NKPDLIGETVTDGS--------------------------------
A5FTS6_ACICJ/4-136DTKVAILILNDLAV--WQKLNVTAFLATGIAA..AAPEAMGEPYEDAR--------------------------------
Q5E5N1_VIBF1/9-143QKRFVAILNKKMDL--GRTLNVLGHISVGLSDLLEQSDAEFVDYYDKD--------------------------------
A4YRZ8_BRASO/4-137DTKIALIIRNDLEA--WQKLNVAAFLASGIAA..ACPECIGAPYEDGS--------------------------------
Q9FCG2_STRCO/23-155DTKIAVLLREDLET--WQRLNVTAFLVSGLGK..QFPEVIGEPYEDAD--------------------------------
Q8XQV0_RALSO/3-135DTKIAIVVRDDLAT--WQKLNVTAFLMSGITG..ASPEIMGEAYRDAA--------------------------------
Q7NY82_CHRVO/3-135DIRCAIIIDPDLPP--GVIANTAAVLAMSLGK..RHPELVGQDLPDAR--------------------------------
Q08NF5_STIAD/6-138TTKIALIVREDLAG--WQKLNVTAFLASGITA..SAPEALGEPYEDAA--------------------------------
Q97K48_CLOAB/10-145EKKIVVTLAVNIPL--EVAFNVIGHLGISIGFYANDNFMGKSHIMDKS--------------------------------
A6TNG6_ALKMQ/2-136EKKCVIVIDSELPT--GLIANTAAVLALTLGN..RIKDIIGPNVIDGD--------------------------------

PF01981

Q7QK06_ANOGA/56-171IRKWQ.NGGQAKIALKVD..TEEAMMEIYRTAKAN---KLNCCLIRDAGRT------------QIE.PNTKTVLAVG-PA
PTH2_DICDI/95-210LRQWE.NFGCAKITLKAN..SKEELVDLRNKAKEL---GVVSYLVLDSGHT------------QIP.SGSATVLAVG-PA
Q16ZN1_AEDAE/15-130LNLWL.SEGQPKIVVKVE..SLEEMEEIARRARSK---HVVAEIVRDAGRT------------QVN.CGTETVLGLG-PD
A7EIB5_SCLS1/115-232LRRWE.REGQAKVALQVK..SEDELDTLQAQALSL---GVVAEQIADAGRT------------QIA.SGSHTVLGIG-PA
PTH2_HUMAN/64-179LKQWE.YCGQPKVVVKAP..DEETLIALLAHAKML---GLTVSLIQDAGRT------------QIA.PGSQTVLGIG-PG
PTH2_CAEEL/200-316IAAWT.RHGQVKIVVKGQ..STEQLMDLCKVAKDA---GCYYYLVQDAGYT------------QIP.AGSRTVLGI.-FG
PTH_THEVO/2-117FDEWM.DEGQKKIVVKVP..NVDEIYIIKKKADSM---GIINEVIQDRGYT------------QVE.PGTVTCIGLG-PD
Q5DB59_SCHJA/45-160LETWE.HQGQPKIVLRVG..SYDEMLKLSDKAKSL---GLVNSIIHDAGHT------------QVA.EGTATVLGIG-PG
Q1H5E3_ARATH/55-169LDCWE.ECAQPKVVVKIE..DEDEMLELQERAKSL---KLPTHITIDAGRT------------QIA.PNSRTVMAI.-LG
Q6FXT4_CANGA/95-216TKRWL.RHGQAKITLKCP..DKEKMDELYAMAISL---GVNAAVIHDAGRT------------QIA.AGSATVLGLG-PA
A7I6R2_METB6/8-120RKAWQ.AEGQKKVVLRAD..SERALFEIKVVAERS---GISTSLIQDAGMT------------EIP.PGTITALGLG-PA
A4S4B2_OSTLU/20-135MGRWE.CDGQKKVTLGVK..NLRVMNELLGEAKTA---RLTTFVVEDAGRT------------EVE.PGTVTVAAIG-PA
A2Y6L9_ORYSI/89-204LRQWE.QFGQAKIVLTCK..NQQEMNRIKETAEHR---GIPTFVVADAGRT------------QVQ.AGSKTVLAVG-PG
A9A5U1_NITMS/10-124YDQWW..GGQEKVVVKVS..GIKDLQEVKKHAIDL---NLPWSEVTDAGHT------------QIA.PGTTTCISIG-PA
Q8SVU8_ENCCU/41-155LSEWR.RNGEAKIVLKASGCEIQEMIKLARK...N---GVYHHKICDAGRT------------QVP.PGTNTVLMLG-PA
PTH_STAMF/6-121FLEWW.ATGQKKIVVKGG..SERDLLKYAEMAKKK---DLPVAIIRDAGLT------------ELP.PNTLTAVGIG-PG
PTH_AERPE/5-124LEMWR.LQGQAKVVLRVE..SLAELQEVYSKAVEE---GLPASFVRDAGKT------------QLE.PGTPTAAAVG-PA
Q296T5_DROPS/66-181LRAWE.NCGCAKIAVRVE..SEAELVAIKNAAERQ---QLNTCLIRDAGRT------------QIE.PNSKTVLAVG-PA
Q4DYZ8_TRYCC/56-200YDAWM.FAGGTKVVLQCE..SEEKLMDAFREAKQE---GLPHAVIRDAGRT------------QIA.PGSKTVLAVG-PA
Q4UI49_THEAN/73-188VYKWF.NDGQKKVVLKIN..DYDEMREIKKQAKLK---GVYTHVTVDAGRT------------QIP.SGSCTVIALG-PG
Q4PDF3_USTMA/80-195VKQWE.RRGQAKVAVKCP..DEEKMLELENKAGEL---GIAARSIIDAGRT------------QIA.PNTRTVLGLG-PA
PTH_METBU/3-115LENWK.EGGQKKVVLRVE..KLQDLFELKEKARRE---GLSTALITDAGLT------------EIA.PGTVTVLGIG-PA
A0RUY5_CENSY/21-135FELWW..PRQEKVVVRVR..GPVELEEIKKMAASL---GIPWSEVSDAGHT------------QVE.PGTITCISIG-PA
Q177N9_AEDAE/59-174LRKWQ.HTGQAKIAVKVE..CEQQMMEVYRTAKAN---NLNCCLIRDAGRT------------QIE.PNSKTVLAIG-PA
A0B7H9_METTP/2-114VEEWM.QEGMRKIVLRGR..DEEHLFQLRSEAESL---GIPAAIVRDAGLT------------EIP.PGTVTALGLG-PA
A5KAM4_PLAVS/65-192FDLWK.KTGQKKIVLKIS..SLDEMYEIERKAKME---NLITSIIIDAGRT------------QIE.PNTETVIAIE-PV
A1CWS4_NEOFI/89-205LRRWE.QQGQAKIALQTK..SEEELQLLQAQAMSL---GLCARVIQDAGRT------------QIA.SGSRTVLGV.-LG
PTH_METMP/1-116VSGWM.NEGQKKVVLKVN..SEKELLEIFKNVNIE---GLPCSLIRDAGRT------------QIE.PGSLTAVGIG-PE
Q6C4E6_YARLI/84-199TRSWV.RWGQAKVALQVK..SEAELFELKRQALER---GIIACVIRDAGRT------------QIA.AGSATVLGVG-PA
PTH_ARCFU/2-114RRKWL.DEGQKKVVLKVK..SLEELLGIKHKAESL---GLVTGLVQDAGLT------------EVP.PGTITAVVIG-PD
PTH_PYRAE/2-119LDQWL.EEGQKKIVLTAD..DAAHLYQLHERAKSL---GLPTAVVIDAGLT------------ELP.PGTPTAICVG-PA
A5DS61_LODEL/96-217VKRWEYGNGQAKITLQVP..DQEQMDMLFAKAMSL---GINATIIHDAGRT------------QIA.AGSATVLGLG-PA
Q582G7_TRYB2/52-206YDAWR.FAGSKKVALQCE..NEEQLMEAYRAARRE---GIPHAVIRDAGRT------------QIA.AGSKTVLAVG-PA
A2E781_TRIVA/74-189AAYWF.DNKFDKVFFNIN..DQQQMEQYAQKALDA---GYLFETIVDAGRT------------QIA.AGSHTILVVG-PI
Q3IMF5_NATPD/3-115RRAWK.SGGQKKIVLKGS..GESQLQQLADEARRE---RLPHALVRDAGHT------------QLE.PGTVTALAVG-PG
Q75D12_ASHGO/87-208VMRWL.QRGQAKITLKCP..DKETMDELFAKAMAL---GVNCHVVHDAGRT------------QIA.AGSATVLGLG-PA
A2SRL9_METLZ/9-121KKEWL.REGQKKVALKAP..SERALYELKVVAEMH---GVPVSLIVDAGYT------------EIP.PGTVTALGIG-PA
PTH_METBF/3-115LEKWK.EGGQKKIVLKVP..TLNDLYELKEKARRE---GLPTALIQDAGLT------------EIP.PGTVTVLGIG-PA
A8BYR9_GIAIC/60-174LRAWL.SQGQKKITLKV...TEQELSSLLDKLHQT---DIICGRIQDAGHT------------QVD.PGTVTVGFVG-PW
PTH_PYRHO/6-121FEAWF.REGQKKVVVKVE..SEEELFKLKAEAEKL---GLPNALIRDAGLT------------EIP.PGTVTVLAVG-PA
A0C4B0_PARTE/81-196LQKWE.GSGQAKVVVKCE..SQQELHNIEAAARQN---GLITYIVTDAGRT------------QVE.PGSQTVCAIG-PA
Q4T7T1_TETNG/50-165LKQQE.YCDQPKVVVKAP..DEDALMDLLNHAKEV---GLPVSLIQDTGRT------------QMA.PGSRTVLGIG-PG
PTH_THEAC/2-117FNEWY.DEGQRKIVVKVN..DLDEIMEIKRMADSM---GIVNEIVQDRGYT------------QVE.PGTITCIGLG-PD
Q0W1J2_UNCMA/3-115LEAWK.REGQKKIVLKVN..SVEELFRFKEEARRA---DIPTALIQDAGLT------------CVP.PGTITALGMG-PA
Q9VG06_DROME/21-139LQRWC.RLGQPKIVLRVD..NFEQLNSLERQAQES---NVVAALVRDAGRT------------QLE.SGTATVLGLG-PA
PTH2_SCHPO/90-205VRIWE.NAGQAKITLQAQ..TEETLELLQAQAMSL---GLCARVIHDAGRT------------QIA.SGSATVLGIG-PG
A7S519_NEMVE/6-121LRMWE.NAAQPKVVVKAP..DEDALVSLSKKARSL---GLETCLIRDAGRT------------QIA.PGSKTVLGVG-PG
Q2BB23_9BACI/7-113FKEWL.MSGQTKIMLSGR...EAELKKLEEKGYV.---.....TIKDAGRT------------EVA.PGSLTASALP-PM
Q4QIY6_LEIMA/88-221YDAWR.ASGCSKVALQCP..DEAAMMALAKHARQV---NLPHYVIRDAGRT------------QVA.PGSKTVVAVG-PG
A4VCS2_TETTS/101-221LDNWE.ECGCPKIVLKVD..SKDQLLELEKKAVDA---GLNTYVVCDAGKT------------QVE.PGSITVCAIG-PA
PTH_SULTO/2-121LYKWL.EEGQPKIVVKVP..SLDELNKRYEKAIEL---NLPTTIIQDAGKT------------QIE.PGTITCIGIG-PA
Q5TVS0_ANOGA/23-144LDAWL.RQGQPKIVLRVD..SLQELHLLTERAESS---GVIAEIVRDAGRT------------QVA.SGTETVLGLG-PD
A3MY21_PYRCJ/19-136LDQWL.GEGQKKIVLAVE..GVEALYELYNKAKSL---DLPTAVVVDAGLT------------ELP.PGTPTAMCVG-PA
PTH_META3/1-116AKEWL.NEGQKKVVLKVN..SEKELFEVFRDANID---GFSCCLIRDAGHT------------QIP.SGTATAVGIG-PD
PTH_NANEQ/1-115FDRWY.REGAKKVVLKVN..SLEELLDIAKKAMEK---GIVVSIIRDAGKT------------QVS.PGTIICIALG-PD
A7SR90_NEMVE/98-215LMSWE.DSGGMKVVLKGE..NTAHLLDMETQAKRL---QLPFYLVQDAGRT------------QIA.SGSVTVLGI.-FG
A1RY06_THEPD/3-118VERWV.EEGQRKIVVRVD..SEEELLSVYRKALEL---GLVAVLVEDKGLT------------QLP.PGTPTAVGIG-PA
PTH_SULSO/1-120LNEWL.HQGQPKIIVKVN..SLDEIISRAKKAETM---NLPFSIIEDAGKT------------QLE.PGTITCLGIG-PA
Q2GVN5_CHAGB/110-233LRAWE.GAGQAKIAVQVK..SEDDLLELMGKARSL---GVTARVIADQGRT------------QIA.AGSRTVLGVG-PA
A3CVC9_METMJ/8-120RKAWL.DEGQKKVVLKAS..AERQLFELKTIAERA---GIPASIIQDAGMT------------EIP.PGTVTALGLG-PA
A6CPG9_9BACI/5-119FIEWY.QAGMTKIVLRGK...QKDLEKLAEQGFY.---.....SIRDSGRT------------EIA.SGSLTVVALP-PM
A3ZNP0_9PLAN/157-280QQAWL.SGHFAKICCRVN..SEQELLDIYAAAQKA---RLEVHLITDSGRT------------EFHGQPTHTCLAIG-PD
PTH_CALMQ/3-118VNAWV.SGGQKKIVLVVD..SVEDLIRLKAKAESL---GLPTALIEDAGLT------------ELP.PGTVTALAIG-PG
Q5KBR9_CRYNJ/89-204FKAWQ.MQGQPKIALRGA..NTEEIETLAAQARSV---NLCARTIRDAGRT------------QVA.PGSKTIVGIG-PG
Q9P5S6_NEUCS/118-241LRQWE.RNGQAKIAVQTK..TEDEMLELMAKARSL---GVTAEVIQDAGRT------------QIA.SGSRTVLGVG-PA
Q2FLI4_METHJ/8-120KKAWM.NEGQKKVVLKAA..DQKTLFELKTLAESA---GIAAVLIQDAGMT------------EIP.PGTITALGLG-PA
A2BKV8_HYPBU/6-125LEEWR.RQGQKKVVVKVD..SEAELLRVYQEALRL---GLPTSLIADAGRT------------ELP.PGTRTAVAVG-PA
Q6VZV0_CNPV/13-124LKRWI.KTGQLKEAVRVE..KESKLLDIIDSAKAV---DINFCVIQDDETM------------KIN.....TVLVLG-PA
V029_FOWPN/13-124LKRWL.KNGQVKETVKVD..NENEMMDIRENATAI---GVNYYIVQNDKRQ------------KCN.....TVLVIG-PA

PF09391

Q0B799_BURCM/3-135GRRYGRMLGQPMLVFAS.--DLNGLQAAHRQALSR...ELTIVPYVHAMFSTGHDAANREVFRAGD-AENLDLVGLALHG
A6WUZ4_OCHA4/4-136GRKHTRLLGQPMLIFSA.--TPDVLQRAWQQSIQR...DLIRAPYVRAMFETGYDVANRAVFKAEN-ADAPDLVGLALYG
Q0RN89_FRAAA/15-147GHGYLPMFRQPVLVFAG.--SRETLTSSFARVAGR...GLAMSIFTSDLFATGNDRDNRAAVRAVP-RDALDLVGLALHG
Q13WI2_BURXL/4-136GRRHARLFGQPMMVYQA.--DNAGLLRAFRQGIER...ELTRAVYVRAMFSTGHDQANRDVFRAEP-ADAPDLVGLAVRG
Q12P64_SHEDO/9-143GELHPNLSHYPFIVLKAD--NSNKIRKVREDAVSR...GIKFTDFTHTMIEGGSSIQL.ETTAATP-EAELTYLGICVFG
Q03X34_LEUMM/2-135DQLYPGIVNIPIPILKA.--DSNKINEIHRQANQYE..EIEVISFVDVAQQVNNYEEYKAKLKQST-DEDLNFLGICLYG
A9CKI6_AGRT5/3-135GNVYNPLSIQPIVVMAT.--DQEALRKIHQRSLER...DITTSLYIEEMFATGHDAANRQVFSHFS-PDTAKVVGMALRA
Q98CG5_RHILO/3-135GNLYNPLSIQPVIVLSA.--DQATLAAIHRRALER...GVTTSLYVEEMFSTGFDAANRAVFAQFA-PEDAKVVGIALRA
Q2SFE1_HAHCH/8-142GHLRAGITTTPIPILRA.--DGARLRNLRGELKEHE.PQLTVIDLTSATMTTKSYEAYAEKLQSTP-VDELEYLGIALCG
A5N5Q1_CLOK5/5-140NQTHLGIISIPITILRG.--DKEILKNLRERLYKSEFGDLIVVDFSDVAQSCNIYSEYITKAAVTS-EQDHNYFGIAIYG
Q218I4_RHOPB/4-136DTPYLALIGQPILIYGG.--ERPALTRALERALAR...GVTPAIYTEDMFNTTHDEANRAAVRAVA-RGDLNLVGLAMRA
A6WFS5_KINRD/22-154GAAYLALLGRPVLVLEG.--DRDVLRTACTRAAGR...RLPVAVFTADMFTTGHDAANRAAVAAVA-GADLDLVGLALHG
Q5LDE1_BACFN/10-145GERHLGITQLPIPILGA.--SQEKIKELRNYFHSLEIEDLVLVDFSTIAQQSRTYDEYEREMYSAN-EDDLHYVGIGICA
Q2K6F9_RHIEC/3-135GNLYNPLSIQPIIVLSA.--DEATISTIHRRALER...EVTPSIFIEEMFATGHDAANRAVFAEYA-PGDAKVVGIALRA
Q18BF3_CLOD6/5-140GNSHLGIIDIPVPILKG.--NKEIIKDLRKKLYTLEFNDLTVVDFSDVAQSCNLYEEFTQKIASVP-EDELQYFGIAIYG
Q1RJ92_RICBR/4-137GNNWQ.ISGMPYIILRG.--KSSEIKKAIHLMRKN...LKLCIWHLQISMTGGTYLEQIENIAKKT-EEEHVYYAAVLFG
A6ALF3_VIBHA/9-143GNVHPNISHYPFIVLRSD--NSNNIRKLRQEALDK...SIPFSDFTHTMVEGGSEVQQ.QTTKNTL-EAELEYLGICLFG
A1R9D5_ARTAT/24-156GNGYLPMLRQPVLVLTA.--GQELLAAARERSLAR...EIPIALYTRDLFSTGHDEANRAAVAAVA-AQDLDLVGIALRG
A0NMB0_9RHOB/3-135ANVYHPMSVQPIIVLSA.--DAQTLGKIHQRTLDR...SVPASLYIEEMFTTGHDSANREVFARFG-PDDANVVGIAFHA
A1JPI8_YERE8/4-138GQEIDVSSKLPVPILQA.--NAAQMREVLLKALAAT.HERAIVPFPAFARSMHSFQAYEAAFPLRS-LADEQLDGLGLVG
Q5WS14_LEGPA/7-140GGAHPYISEIPFIILCE.--NSNKIRSLRQNALAK...NVLFNDFTDTM.TVGTYQEQIERTAQVK-ENDLIYYGIVLFG
A3UM68_VIBSP/9-143GNVHPNLSHYPFIVLKAD--NSNKLRKVREEAFSR...GIKFTDFTSSMIEGGSVEQQ.QRTKETK-EEDLEYLGVCLFG
A4EUC0_9RHOB/4-136GQSYRALLIQPVIVLVA.--DSAGLTKVLHRALSR...GADPAIYTQEMFATGHDLANRAAVQEFE-TGALNLVGVALRE
A0QVI8_MYCS2/4-136DTGYLAMFGQPVLVFEG.--SKETLHNAHHRALSR...GLSPSIFTAELFSTGNDRDNRAAVRAVG-RDDLDLVGLAVYA
A1WDY7_VEREI/7-141SGFLAKIDEYPFIILDAK--NSNQLQTLVSSVMSNQ..RIAYNVFTTSMIGTCAEAQL.KATREAL-NDGLDFVVVVLFG
Q5E5X3_VIBF1/3-134GEIHTGITSIPIPILAS.--SSHKIKEIRASLKE....EATLVDFSNVAQTTKNYQDYSDKLAATR-PEDIEYLGIAIYG
Q65P03_BACLD/4-139GIDHLGIVKIPIPILKG.--NAELLHQLSQKLLTDEFNDILTVDFTDVAQSIHTYEAYIEAFQSTA-ASDYRYFGIGICG
A5FTS6_ACICJ/4-136GRQHARLLGQPIMIFAA.--NTEVLQRAYGQAIER...NVIRAVYVRAMFSTGHDAANRAVFKAEP-ADVPDLVGLALRG
Q5E5N1_VIBF1/9-143KHHHPNISHYPFIVLKAP--NSNKIRTIREQALEL...GIQFTDFTHTMIEGGSIVQQ.QTTSETK-DEDFEYLGICLFG
A4YRZ8_BRASO/4-137ATSYHALIGQPILIYGAP--DNAALARALDRALTR...SVKPALYTEDMFKTTHDEANRAAVKAVA-RIDLNLVGLALRA
Q9FCG2_STRCO/23-155AVGYLPMFRQPVLVFEG.--TKETLTTAHARVLSR...ALPRALFTSDLFTTGNDRDNRAAVRAVA-TADLDLVGLAVYG
Q8XQV0_RALSO/3-135DNTYHSLCVQPVIVLSG.--DQETLKAVHRRALER...KVPHGLYIEDMFSTGHDAANRAVFAEHG-PDSARVVGIALRE
Q7NY82_CHRVO/3-135GQPRQGITTVPIPVLKG.--GADQLRALRAAASET...GLTLVELTSATRFTRSYQEYAAALAATP-EEMVEYQGLALCG
Q08NF5_STIAD/6-138GRRYSRMLGQPMLVFGA.--SRAQLQGAHRAALER...GLTAAVYVGAMFATGNDEANRTVFRAEN-PEDLDLVGLALRG
Q97K48_CLOAB/10-145GKPHIGISKYPVIITQA.--KQQKLRKAINEARESN..DILMVDFPRQMLITEHDDELVKSLGESL-EEDLEYLGAIFYG
A6TNG6_ALKMQ/2-136GNIHEGITTIPFPILKS.--KEVNIKELRN.IIGSEYPDLYLVDFSNAAQTTKNYDDYTHKIAQYT-TNELKYLGIAVYG

PF01981

Q7QK06_ANOGA/56-171PNVAVDSVTGHLKLL-
PTH2_DICDI/95-210PKEAVDAVTKHLKLY-
Q16ZN1_AEDAE/15-130SCDVIDSLAGHLKLL-
A7EIB5_SCLS1/115-232PKSVIDQITGTLKLL-
PTH2_HUMAN/64-179PADLIDKVTGHLKLY-
PTH2_CAEEL/200-316TVEQVDSVTGGLKLL-
PTH_THEVO/2-117YEVYLDDITGKYKLL-
Q5DB59_SCHJA/45-160LASEIDRVSGDLRLF-
Q1H5E3_ARATH/55-169PVEVVDEVTGGLKLL-
Q6FXT4_CANGA/95-216PKAVLDQITGELKLY-
A7I6R2_METB6/8-120RTEDLDKITGSLSLL-
A4S4B2_OSTLU/20-135AASDIDKITGHLRLY-
A2Y6L9_ORYSI/89-204RKADIDSVTGKLSLL-
A9A5U1_NITMS/10-124PENLIDRVTGDLKLL-
Q8SVU8_ENCCU/41-155LRPRLEVISGHLKLY-
PTH_STAMF/6-121PSRKIDEITGDLKLL-
PTH_AERPE/5-124PSRLVDRITGGLKLF-
Q296T5_DROPS/66-181AAVDIDRVTGHLKLL-
Q4DYZ8_TRYCC/56-200PIKLVDRVTGKFKLL-
Q4UI49_THEAN/73-188PEPILDKITGHLKLL-
Q4PDF3_USTMA/80-195PVSLMNQLTGHLKLL-
PTH_METBU/3-115RADYIDKVTGNLKLV-
A0RUY5_CENSY/21-135PESMVDRVTGDMKLL-
Q177N9_AEDAE/59-174PKQIIDTITGHLKLL-
A0B7H9_METTP/2-114PDDIMDRVTGRLSLL-
A5KAM4_PLAVS/65-192PDEVVNKITGQLKLL-
A1CWS4_NEOFI/89-205PKSVVDQVTGHLKLL-
PTH_METMP/1-116KEEKISKVKKDLKLL-
Q6C4E6_YARLI/84-199PKSEIDRVTGHLKLL-
PTH_ARCFU/2-114EERKIDKVTGNLPLL-
PTH_PYRAE/2-119PDELVDKVTGSLKLY-
A5DS61_LODEL/96-217PKRILDEVTGELKLY-
Q582G7_TRYB2/52-206PDSLVDRVTGHFKLL-
A2E781_TRIVA/74-189DKSNVAEFTKGLQQV-
Q3IMF5_NATPD/3-115EERLVDKVTGDLSLY-
Q75D12_ASHGO/87-208PKAVLDEITGELKLY-
A2SRL9_METLZ/9-121KAEIINKITGHLPLL-
PTH_METBF/3-115KEELIDKVTRNLKLV-
A8BYR9_GIAIC/60-174DEAELDKITGHLKLY-
PTH_PYRHO/6-121PEEIVDKVTGNLKLL-
A0C4B0_PARTE/81-196DCDLIDQVTGHLKLL-
Q4T7T1_TETNG/50-165PADLIDRVAGDLKLY-
PTH_THEAC/2-117EEEKLDKITGKYKLL-
Q0W1J2_UNCMA/3-115DSDRLDKIVGHLKLM-
Q9VG06_DROME/21-139PAEDLDKLVAHLKLL-
PTH2_SCHPO/90-205PVSVINEVTGSLKLF-
A7S519_NEMVE/6-121PLELVDQVTGHLKLY-
Q2BB23_9BACI/7-113DKEEAKMIVGHLRLY-
Q4QIY6_LEIMA/88-221PKSLVDEVTGQLKLL-
A4VCS2_TETTS/101-221RADIIDSITGHLKLL-
PTH_SULTO/2-121PVELVDKITGDLKLL-
Q5TVS0_ANOGA/23-144RTEAIDSLVGHLKLL-
A3MY21_PYRCJ/19-136PDELVDAVTGKLKLY-
PTH_META3/1-116KEEKLEKITGKLKLL-
PTH_NANEQ/1-115EDEKIDQITGNLKLY-
A7SR90_NEMVE/98-215ATEEVNKITGKLRLL-
A1RY06_THEPD/3-118DEEIIDKVTGHLKLL-
PTH_SULSO/1-120PENLVDSITGDLKLL-
Q2GVN5_CHAGB/110-233PKSLVDMVTGHLKLL-
A3CVC9_METMJ/8-120RSEDLDRITGDLSLL-
A6CPG9_9BACI/5-119PKSQAKEKVGHLSLF-
A3ZNP0_9PLAN/157-280EAQKIDAVTGHLQLL-
PTH_CALMQ/3-118PEELVNKVTGSLKLL-
Q5KBR9_CRYNJ/89-204PAKLINTITGKLKLL-
Q9P5S6_NEUCS/118-241PKSLVDEITGHLKLL-
Q2FLI4_METHJ/8-120KCEDLDKITGSLSLL-
A2BKV8_HYPBU/6-125PSPIVDRVTGKLKLL-
Q6VZV0_CNPV/13-124PSYLFDSITKSLKSF-
V029_FOWPN/13-124PNYMFESLTRSLKPL-

PF09391

Q0B799_BURCM/3-135PKKAVDKAVKGLALHA
A6WUZ4_OCHA4/4-136PKKDIDKAIKGTNLHP
Q0RN89_FRAAA/15-147PRNAVDKALKGARMHP
Q13WI2_BURXL/4-136PKKAVDKAVKGLSLHA
Q12P64_SHEDO/9-143DTSVLSEFTKKFSLYN
Q03X34_LEUMM/2-135SEKKVNHFSGSLPMLR
A9CKI6_AGRT5/3-135DRKIVDKITKGAKLHA
Q98CG5_RHILO/3-135EKKVVDKITKGARMQA
Q2SFE1_HAHCH/8-142PKKTVNKFTGNLGLLR
A5N5Q1_CLOK5/5-140NKKKVNKLTGSMPLLR
Q218I4_RHOPB/4-136DRKVIDKIVDGLKFHK
A6WFS5_KINRD/22-154PKNAVDKVLKGAHPHP
Q5LDE1_BACFN/10-145EKKAINKATGSLSLIR
Q2K6F9_RHIEC/3-135DKKIVDKITKGATMQH
Q18BF3_CLOD6/5-140NKKKVNKLTGSMPLLR
Q1RJ92_RICBR/4-137KWDTVSQITKKFSLYR
A6ALF3_VIBHA/9-143ETETLRELTKKFSLYR
A1R9D5_ARTAT/24-156PRNVVDRIVKGARMHA
A0NMB0_9RHOB/3-135DKKVADKVSKGAKMHA
A1JPI8_YERE8/4-138PEKWVRSLTGALKLLR
Q5WS14_LEGPA/7-140DWDVVTELTRKCSLWR
A3UM68_VIBSP/9-143DTDILREFTKKFSLYK
A4EUC0_9RHOB/4-136ERKLVDKITKGARMHP
A0QVI8_MYCS2/4-136GRNVVDKVLKGARMHP
A1WDY7_VEREI/7-141AREDVDPLTRKFSLTK
Q5E5X3_VIBF1/3-134TKKIINKHTGNLGLIR
Q65P03_BACLD/4-139DKKKVARLTGSLGLLR
A5FTS6_ACICJ/4-136LKKDVDKAVKGASLHA
Q5E5N1_VIBF1/9-143DTETIKGITKKFSLYK
A4YRZ8_BRASO/4-137ERKVVDKIVDGLKFHA
Q9FCG2_STRCO/23-155PKNAVDKVLKGARMHP
Q8XQV0_RALSO/3-135EKKIVDKITKGARMHP
Q7NY82_CHRVO/3-135PGKRVRQLTGSLGLLR
Q08NF5_STIAD/6-138DRKQIDKAVKGLALHK
Q97K48_CLOAB/10-145KSKYVDSITGKFSLWR
A6TNG6_ALKMQ/2-136DKKKINKLTGNLPLLR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window