Sequence alignment for CL0316

PF10129

A1R109_ARTAT/441-826-------------RDAR.ID-----MLRGLAI-----------------------VFVVV-NHV....GINSV-------
A0K1D5_ARTS2/295-678-------------RDSR.VD-----LMRGLAI-----------------------LFVVV-NHV....GMTSL-------
A2SCM7_METPP/4-366-------------RLWE.ID-----ALRGLML-----------------------VLMTL-THL.....PTRY-------
A1TNJ8_ACIAC/18-379-------------RRWE.ID-----AVRGLML-----------------------VLMTV-THL.....PTRL-------
Q1D6T0_MYXXD/55-417-------------RRPE.LD-----SLRGILL-----------------------VLMTL-THL.....PTRL-------
Q11B97_CHESB/2-386-------------RRLDILD-----GMRGYFL-----------------------VFMML-NHLA...FTGGY-------
Q7CT44_AGRFC/2-385-------------KRFDLID-----GMRGYFL-----------------------VFMLI-NHLV...FAGGF-------
B2JS58_BURP8/58-406-------------RLIE.LD-----FFRGLVL-----------------------LFIVV-DHI.....GGSI-------
Q13NS3_BURXL/7-355-------------RLIE.LD-----FFRGLVL-----------------------LIIVV-DHI.....GGSI-------
Q1LDM8_RALME/9-370-------------RRTE.VD-----LIRGIAL-----------------------LFIVV-DHV.....NGSV-------
A1B1M7_PARDP/3-363-------------RIVA.LD-----MLRGYAL-----------------------VCIML-DHM.....PIGV-------
Q5FTQ3_GLUOX/17-367-------------RDHR.VD-----ALRGIAL-----------------------LMMLV-DHV.....PDDL-------
Q89UF3_BRADU/67-422-------------HDAR.LY-----LTLGIAN-----------------------WSVFV-DHI.....PNNV-------
Q89KT4_BRADU/82-438-------------RDVR.LD-----LFRGLAN-----------------------WLIFL-GHI.....PNSV-------
A4YU73_BRASO/12-368-------------RDLR.LD-----LFRGIAN-----------------------WAIFL-DHI.....PDNV-------
Q6N6S8_RHOPA/12-368-------------RDLR.LD-----LFRGVAN-----------------------WAIYL-DHI.....PNNV-------
Q1QFJ8_NITHX/39-395-------------RDHR.LD-----LFRGIAN-----------------------WAIFL-DHI.....PNNV-------
Q89VE5_BRADU/37-393-------------RELR.LD-----LFRGLAL-----------------------WLIFI-DHL.....PSSL-------
Q6N0J3_RHOPA/44-400-------------RELR.LD-----LFRGLAL-----------------------WLIFI-DHL.....PANV-------
Q3SWD7_NITWN/36-392-------------RELR.LD-----LLRGFAL-----------------------WLIFI-DHL.....PQNL-------
Q89CC1_BRADU/15-372-------------RDLR.LD-----LFRGIGL-----------------------WMIFL-DHI.....PHDV-------
A4YYN0_BRASO/36-389-------------RDLR.ID-----ACRGLAL-----------------------WFIFV-DHV.....PDNS-------
Q89EQ8_BRADU/32-383-------------RDLR.ID-----ACRGIAL-----------------------WWIFL-DHV.....PNNI-------
Q87XJ3_PSESM/5-366-------------RDHR.ID-----FFRGLAL-----------------------IFIFW-DHV.....PDNP-------
Q0BVC0_GRABC/14-370-------------RDLR.ID-----FFRGVAL-----------------------WMIFV-DHM.....PGNV-------
A5G015_ACICJ/9-360-------------RDLR.VD-----FFRGIAL-----------------------FCIFL-DHI.....PHDT-------
B0U809_METS4/3-358-------------RDPNAID-----FWRGLAL-----------------------ITIFI-NHI.....PGNV-------
Q2K344_RHIEC/23-378-------------RDTR.LD-----VLRGLAL-----------------------IMIFI-NHV.....PGQI-------
Q2YRC8_BRUA2/6-358-------------RDTR.ID-----VFRALAL-----------------------LTIFI-NHV.....PGTI-------
Q983D5_RHILO/37-389-------------RDTR.ID-----VLRALAL-----------------------IVIFI-DHV.....PGTA-------
Q3J1N1_RHOS4/11-372-------------RDKR.LD-----FFRGLAL-----------------------VMIFI-NHV.....PGTV-------
Q11DW2_CHESB/11-364-------------RDHR.ID-----AFRGIAL-----------------------LMIFV-NHV.....PGNA-------
Q1GGF0_RUEST/47-428-------------RDPR.LD-----FYRGIAM-----------------------FIILC-AHI.....PGNR-------
Q169P8_ROSDO/29-397-------------RDPR.LD-----FFRGIVM-----------------------FIILI-AHT.....PGNW-------
Q0BQN1_GRABC/63-424-------------RDLR.ID-----FFRGVSL-----------------------FIILI-DHI.....RNNS-------
B0RH46_CLAMS/492-873-------------RDRR.LD-----LFRGWTI-----------------------VAVVI-THI....EVASP-------
B4EL00_BURCJ/18-366-------------RLIE.ID-----FFRGLVL-----------------------LMIVV-DHI.....GASV-------
B4ELU9_BURCJ/9-352-------------RYAE.LD-----FFRGLVL-----------------------LVIVV-DHI.....GGSI-------
E3FIJ7_STIAD/5-384-------------...EVLD-----GLRGYFL-----------------------VFMVL-NHLT..FSGGYL-------
Q13QD3_BURXL/18-362-------------..IE.VD-----FFRGVVL-----------------------IVIVL-DHI.....PGST-------
Q5LPG0_RUEPO/27-401-------------RDLR.LD-----FFRGIAM-----------------------FIILV-AHI.....PFNP-------
Q63IA9_BURPS/14-358-------------RSIE.VD-----FFRGVVL-----------------------LTIVV-DHI.....GASV-------
Q6NAS6_RHOPA/6-361-------------RDLR.LD-----FLRGVGQ-----------------------WMIFV-DHI.....PYNF-------
Q92L11_RHIME/23-374-------------RDTR.LD-----VFRALCL-----------------------LTIFV-NHV.....PGQY-------
Q9KQQ7_VIBCH/3-361-------------RIPA.LD-----SIRGLLL-----------------------VLITF-NHLIWYSGGTTI-------

PF01757

A8DMZ1_STALU/12-334-------------RKE--LI.....YLRAMLC-----------------------IIIII.THTLT...QYMR-------
Q035D4_LACC3/20-369-------------LYE--ID.....LMRLIFI-----------------------AGVLL.NHTTT...AFQH-------
A8G974_SERP5/5-314-------------INK--SN.....YLKGIAI-----------------------ILMLI.HHLFA...YPSR-------
Q11WN8_CYTH3/14-339-------------FYF--LE.....LMRTLAA-----------------------LYVVG.VHIHQ...IVDF-------
A7LV98_BACO1/4-296-------------NLY--IDRDTSSVIKGVLI-----------------------ILIVI.GHNKV...LCST-------
Q97ER7_CLOAB/6-334-------------SLE--MD.....VIKGLGI-----------------------IAIVI.GHTES...PLLR-------
A0A025FGD2_ECOLX/9-357-------------EYF--LD.....SIRAWLM-----------------------LLGIP.FHISL...IYSS-------
Q07PA2_RHOP5/14-375-------------LHA--LD.....AVRGFAL-----------------------LLGIV.YHAAVSFMPFAA-------
Q30BE9_ENTFL/7-326-------------YSG--ID.....YFRFIAA-----------------------LLIVA.IHTSP...LSSF-------
A1HPJ5_9FIRM/6-350-------------VTA--IE.....YIRGISM-----------------------LGVVG.IHTGA...YSLT-------
A0A0D1E273_USTMA/127-516-------------LDY--AD.....GLRGIAM-----------------------IMVFN.GHFVDNTFVQTH-------
A7LV97_BACO1/24-312-------------RHS--LN........YLAF-----------------------FNSWT.GHGIS...GFVE-------
Q1QWT8_CHRSD/4-315-------------NVS--LD.....VLKLTLA-----------------------VIVVI.SHAGV...LWGY-------
Q2T7M4_BURTA/6-373-------------NLG--LE.....GLRGLAC-----------------------MAVMI.GHFSY...IFSP-------
A4B9D7_9GAMM/5-375-------------IAG--LD.....GLRAIAC-----------------------LMVVA.HHVLP...RLPQ-------
Q5LBM3_BACFN/8-315-------------DIS--ID.....ILKCIAA-----------------------IMITN.SHMDI...LYGD-------
M6C4Z5_LEPBO/44-373-------------SKS--VD.....FIRGLAI-----------------------TGIVF.IHVNS...YYQY-------
A5ZUV3_9FIRM/6-346-------------KIW--LD.....VVRATAI-----------------------LCVVL.CHSVE...AFYH-------
B2JGA6_BURP8/53-400-------------VAA--LD.....AGRALAI-----------------------VGVIL.VHLAL...FMPA-------
Q9XAP7_STRCO/24-348-------------DRY--FD.....TLRALAL-----------------------VRVVA.YHAFGWPWA...-------
Q07KV2_RHOP5/17-343-------------ENA--IQ.....WLRAIAA-----------------------IEVVV.WHSDL...LTKH-------
Q484G4_COLP3/18-372-------------LYF--LD.....WIRILAF-----------------------AFLVF.YHSAL...MFVD-------
A0DGZ8_PARTE/156-556-------------LAI--FN.....GVRAIAF-----------------------MMVVY.GHSSL...LIIQ-------
A7A7L5_BIFAD/6-324-------------NSS--IE.....LLRIIAM-----------------------FMILM.HHFIV...HNGY-------
A3JPT3_9RHOB/10-350-------------MVW--LD.....ALRLIAG-----------------------ISMVG.LHGSTDANGQPF-------
A5EMI0_BRASB/26-386-------------NAA--LD.....HARTFLT-----------------------LVVLL.HHAVI...PYTY-------
A4FKM9_SACEN/20-347-------------KIS--WD.....VVRAGCV-----------------------MLVML.YHATF...LGVF-------
A7V903_BACUN/5-297-------------VKE--ID.....YLKCIFI-----------------------TLMII.FHLVY...IGDK-------
Q8IG66_CAEEL/330-720-------------VKL--VN.....LFRVCSS-----------------------FWVIF.SHTCL...FSLH-------
Q7UES3_RHOBA/12-486-------------RHD--LD.....ALRGIAM-----------------------LLGIF.LHAAI...AYSP-------
Q1WRZ8_LACS1/4-332-------------ITW--ID.....ISRAIGM-----------------------LTIII.AHSLN...SYTG-------
Q8PXP5_METMA/13-333-------------FYR--LN.....ILDGFAI-----------------------VFIVI.FHALG...GLKT-------
Q6AH04_LEIXX/3-320-------------ILG--VD.....LARGVAL-----------------------LAVFI.AHTAP...LTRD-------
Q5CVD7_CRYPI/23-437-------------LHY--LD.....WLKTLAV-----------------------WLVVF.VHVIYYLNLLNI-------
A0LT35_ACIC1/10-359-------------DPY--VD.....LVRAIAI-----------------------TLVVI.GHWLL...SNVT-------
Q8KJJ2_RHILI/23-344-------------DLS--FD.....FAKGILI-----------------------TLVII.GHLLQ...YLIY-------
Q17BV3_AEDAE/212-599-------------VGC--LS.....GLRALAT-----------------------IALFCALRLIP...MGFQ-------
A7F3R9_SCLS1/8-361-------------VKW--VD.....GLRGIAS-----------------------LLVVS.THIAR...AFDS-------
Q144E0_BURXL/4-320-------------EER--IR.....GGQAVSI-----------------------VAIVC.AEAIR...RVVD-------
Q83YQ9_STRGN/5-307-------------NTT--LH.....AVKALAC-----------------------FSIVS.LHFLL...PGEF-------
Q07P25_RHOP5/21-323-------------QVW--MD.....LARGIGV-----------------------ILVVY.GHVLG...GLVR-------
Q8DSB8_STRMU/14-327-------------NAG--ID.....FLRIFAM-----------------------FMIVV.THVLG...KGGI-------
A0LP70_SYNFM/14-366-------------LTW--PD.....MMKGISI-----------------------LWIVF.FHFFH...AYNN-------
A8H1P8_SHEPA/43-369-------------LNS--IN.....HFRGIAI-----------------------IFIVM.AHCYR...PAGW-------
A6E8A8_9SPHI/14-335-------------ILW--ID.....YAKFIAI-----------------------FFVIF.AHQTL...SKSW-------
A5VFE0_SPHWW/65-420-------------YRD--VD.....MLRGYAA-----------------------LAVAL.YHFLL...AYVP-------
A5LX53_STREE/8-323-------------INW--ID.....FGKGFAI-----------------------FSVLV.GHVLM...GLYE-------
Q8P802_XANCP/22-341-------------EWQ--ID.....VAKALAI-----------------------ILVAL.GHASG...MAPA-------
Q2HGI8_CHAGB/115-578-------------TAY--LD.....GMRGLAA-----------------------LIVFF.CHFLYTSFAIAP-------
A6BII1_9FIRM/11-365-------------FGY--ID.....LLETIAI-----------------------ICIVF.YHGAI...GNAN-------
Q9CHP8_LACLA/4-320-------------NSS--ID.....LMKSCAI-----------------------FFVIS.VHFLL...NSGF-------
A5N097_CLOK5/9-357-------------RYD--LD.....WIRAIVV-----------------------ISIIF.YHVCD...MFIL-------
Q8FTN8_COREF/16-398-------------LPS--LT.....GARWLAA-----------------------VAVFV.LHALV...FLNV-------
A7AZT9_RUMGN/12-318-------------WYN--FT..........LC-----------------------ILVVC.IHAQN...MHIF-------
Q2NRT0_SODGM/9-399-------------FIG--LE.....WLRFLLG-----------------------CYVMI.YHTAH...HYPQ-------
A4CKW1_ROBBH/7-342-------------LYF--ID.....AMRAWAI-----------------------LMMLQ.GHFID...GLLD-------
A6FAM6_9GAMM/8-349-------------KVD--SN.....ILKGLGI-----------------------LMIAI..HNFM...HRFP-------
R7EJB8_9BACE/14-354-------------YEI--LD.....GLRGVAA-----------------------VMVII.FHLFE...AHAG-------
A4YYF7_BRASO/15-345-------------LLG--LE.....LLRFLAT-----------------------ISVLL.WHYPHFAYVADT-------
Q1D0W9_MYXXD/39-356-------------HPG--LD.....CARGLAV-----------------------MAMVI.GHTLD...AVLS-------
Q16PV5_AEDAE/243-647-------------FAF--VE.....SVRVISV-----------------------FFITA.VHVLM...AFGA-------
Q82ET0_STRAW/57-398-------------DRA--VD.....TLRAFAI-----------------------LGVVL.GHWLV...TALV-------
Q4JZS0_STREE/5-327-------------YDN--LD.....GLRVISC-----------------------LGIIA.MHIKA...NADY-------
Q7MGC8_VIBVY/15-336-------------IAS--LE.....LGRIIAM-----------------------LAIIG.LHCQM...ALTY-------
A6KZK8_BACV8/9-367-------------IGW--ID.....LLRVTAC-----------------------FLVVF.AHCCD...PFVA-------
A4CUQ6_SYNPV/6-368-------------LLY--LD.....QIKAVIV-----------------------GLVIA.LHVPV...AFFP-------
A0A0G2MNM2_SALPT/5-319-------------INW--ID.....NLRGIAC-----------------------LMVVM.IHTTT...WYIT-------
A6P1P2_9FIRM/9-341-------------LAY--AD.....LLRVLSI-----------------------AAVVV.IHVVS...LWIY-------
A5FYP6_ACICJ/4-317-------------RAD--ID.....RAKGLAI-----------------------SLVVF.GHIVA...RQDP-------
Q7MQA5_VIBVY/5-328-------------VQF--FD.....LLRCVAA-----------------------VAVIA.IHVLA...PYRH-------
Q5ZXE9_LEGPH/10-336-------------RKD--ID.....ALRGVAV-----------------------LLVIF.DHLHI...NLV.-------
A7V3H1_BACUN/5-305-------------IEW--ID.....LCKIITM-----------------------IIVCY.DHTIQ...SIAP-------
Q64YD4_BACFR/4-349-------------IVF--LD.....YVRVFAC-----------------------FLVMI.VHSSE...NFYG-------
A5UMZ7_METS3/7-344-------------IRY--VD.....QLRAVSI-----------------------LFLIA.INVAM...VFKY-------
A3YY52_9SYNE/16-323-------------NQA--ID.....LMRATCI-----------------------LWIVGFWHLLG...YAES-------
A4AIT9_9ACTN/563-845-------------IEV--PI.....VLRAVAI-----------------------VLIVA.THSDF.......-------
A5N224_CLOK5/8-329-------------VLE--MD.....VIRAASI-----------------------VAVIV.LHVSA...TVLY-------
E0TI88_PARBH/15-315-------------EEG--VD.....AGRLLAA-----------------------IGVIA.IHVGA...YDEL-------
A0A072ZP69_PSEAI/5-324-------------WIQ--MD.....VTRGVGI-----------------------LIIVF.GHSWF...VASS-------
A0E2L0_PARTE/17-375-------------MFS--LN.....LLKILAM-----------------------LSISM.SHYGI...LIGQ-------
Q8A5U1_BACTN/9-318-------------IDF--VD.....LTKGVCI-----------------------ILVVM.AHIGG...AFDQ-------
Q2C1R6_9GAMM/10-345-------------YDY--LD.....NIKWVLT-----------------------ILVIL.HHCAS...TAGL-------
A7A7B8_BIFAD/5-363-------------VVG--YD.....IIKSMAM-----------------------FFVVM.LHYSFYTRFYSS-------
Q4JYU7_STREE/6-318-------------NIN--LD.....LLKVLAC-----------------------VGVVL.LHTTM...GGFK-------
A9VR59_BACWK/5-346-------------APE--FK.....VLQSIAF-----------------------LAVVLQSSLLY...TMNQ-------
A7VGI1_9CLOT/6-345-------------NGA--LD.....FWKFVFC-----------------------LVILV.FHVGE...VYGG-------
Q1QR03_NITHX/14-320-------------VDW--VD.....YAKGICI-----------------------IMVVM.MHSVQ...GVEK-------
A5ZDF6_9BACE/13-326-------------IAW--LD.....NVKMFAM-----------------------LCVIL.GHVMT...IVIK-------
Q16FE1_AEDAE/161-554-------------FQY--IE.....GVRVLTC-----------------------LTIVF.MHTRY...EPLM-------
Q7CTZ0_AGRFC/8-329-------------SSR--IN.....LMRILLI-----------------------SGIVF.VHVPH...DAET-------
Q8G7P7_BIFLO/17-373-------------DVN--YD.....LLRVVAM-----------------------CLVIG.VHVIN...NYMP-------
A1R1G8_ARTAT/18-357-------------DPA--ID.....LVRFICL-----------------------LLVVA.AHCMM...VSPV-------
A0QPG5_MYCS2/9-326-------------NNA--LN.....ALRLLLA-----------------------VGVIL.WHSWP...LSGH-------
A5EXU9_DICNV/19-351-------------QYE--ID.....IARGFAI-----------------------IFMVW.VHVME...EMDS-------
A6LGX6_PARD8/9-311-------------YGA--LD.....AMRILAA-----------------------FSVVC.IHYQI...VPGS-------
Q11WP3_CYTH3/4-324-------------RIG--PG.....YFRYFLC-----------------------IVVVL.FHSTN...YI..-------
A6KYR5_BACV8/6-309-------------HSG--LE.....CLRIISI-----------------------ILIVS.MHILG...NTFH-------
Q0CZ95_ASPTN/77-482-------------TAY--LD.....GLRGFAA-----------------------LLVYWAHHQLW...AHDG-------
A0T1U4_VIBCL/8-303-------------NFK--ID.....LLRSVGL-----------------------LLIIL.AHVLPPEIIF..-------
A3I592_9BACI/6-352-------------IDE--LN.....ITRALAI-----------------------LAVLL.IHSTS...TPVT-------
A1TDU0_MYCVP/22-361-------------DRA--ID.....VIRIVAL-----------------------VGVVV.GHTVM...ATSI-------

PF07786

A1HQT7_9FIRM/5-214-------------RIWE-ID-----ALRGLAI-----------------------VLMVV-FHLVV---DLKD-------
A2SQB7_METLZ/5-231-------------RYFE-LD-----AARGIAL-----------------------ILMIL-YHILF---CLYF-------
A9CIY2_AGRFC/15-234-------------RIGG-LD-----TLRGLAL-----------------------LAMAS-YHFTW---NLEY-------
Q28R74_JANSC/28-249-------------RIPA-LD-----IARTGAL-----------------------AAMVL-FHFVF---DLEM-------
Q8PXM0_METMA/7-237-------------RFWE-ID-----CLRGLAI-----------------------ILMLA-YHFLY---DLDF-------
A4EC93_9ACTN/4-221-------------RITI-FD-----TVRGFTM-----------------------ISMAG-FHACY---DLAY-------
Q8U2K3_PYRFU/23-240-------------RFWE-ID-----FARGIAL-----------------------TMMLI-SNFVT---DLQF-------
A7I8Y9_METB6/6-231-------------RYPE-ID-----LLRGIAL-----------------------LMMIL-FHTLF---DLAF-------
A6G0Y4_9DELT/12-237-------------RVEI-ID-----IGRGVAV-----------------------VLMIM-VHTMW---LYAD-------
A3CVR7_METMJ/5-231-------------RYWE-ID-----LARGVAV-----------------------VTMIV-FHSAF---DLNF-------
Q11IW8_CHESB/30-251-------------RIEL-ID-----IARGVAL-----------------------VAMAI-YHFTW---DLDF-------
A1TRD1_ACIAC/21-249-------------RADS-VD-----ALRGVAM-----------------------VWMTI-FHFCF---DLSH-------
A2SGN2_METPP/12-230-------------RHAR-LD-----ALRGLAI-----------------------VWMAV-FHFCF---DLAH-------
A2STU6_METLZ/14-241-------------RYWE-ID-----AIRGFSL-----------------------LAMIA-FHTVF---LLGV-------
Q2K839_RHIEC/16-243-------------RIGL-LD-----TARGIAL-----------------------IAMAS-YHFTW---DMEF-------
Q251W2_DESHY/5-221-------------RFPI-ID-----SLRTLAL-----------------------ALMIT-YHLIY---DLDQ-------
A0NYA1_LABAI/5-227-------------RLAV-LD-----LARGLAV-----------------------VAMAI-YHFSW---DLSW-------
Q21VS3_RHOFT/16-244-------------RFDA-VD-----ALRGLAM-----------------------VWMTF-FHFSF---DLNQ-------
Q0FKK0_PELBH/7-221-------------RVGW-ID-----LARVAAL-----------------------AGMVV-FHFAR---DLEI-------
Q2YRW9_BRUA2/16-233-------------RLGR-ID-----IAHGIAL-----------------------IAMAI-YHFGW---DLEF-------
A2STU5_METLZ/19-252-------------RYWE-ID-----AVRGLAL-----------------------FGMLY-FHFLA---CLVM-------
Q6SHI3_9BACT/5-214-------------RDSA-LD-----LMRGLAI-----------------------IMMIA-FHFIY---DLNS-------
Q0G6B2_9RHIZ/53-275-------------RIDT-ID-----VARAIAL-----------------------IAMAI-YHFAW---DLDN-------
A3YBL4_9GAMM/14-227-------------RSSS-LD-----LYRGLAV-----------------------LLMII-FHLCW---DLRE-------
A4FZP9_METM5/5-227-------------RYLE-ID-----FFRGIAI-----------------------ILMVI-SNFVT---DLKY-------
Q11N89_CHESB/6-227-------------RVVA-ID-----VARGLAI-----------------------AGVVL-FHIVW---DLEF-------
A4J1M2_DESRM/9-218-------------RLWE-LD-----FLRGVAI-----------------------LLMVF-FHLMY---DLHE-------
Q6SGH9_9BACT/9-218-------------RDQA-LD-----LMRGIAI-----------------------IMMIM-FHLIY---DLNE-------
A1VNB1_POLNA/5-231-------------RFDS-LD-----ALRGIAI-----------------------VWMTA-YHFCF---DLNH-------
A3DGD5_CLOTH/11-220-------------RIWE-ID-----VLRGILV-----------------------IIMVV-LHILF---DLEF-------
Q98KU6_RHILO/16-237-------------RIIA-ID-----IVRGIAL-----------------------LAMAS-YHFTW---DLEF-------
A6VZM7_MARMS/12-224-------------RSAF-LD-----VYRGSAV-----------------------LLMII-FHFCW---DLLN-------
A1W6I8_ACISJ/12-240-------------RHDR-LD-----ALRGFAM-----------------------VWMTA-FHFCF---DLSH-------
Q6M0I2_METMP/11-233-------------RFLE-ID-----FFRGLAI-----------------------IMMVI-SNFVT---DLKY-------
O26882_METTH/9-227-------------RFGE-VD-----ALRGAAV-----------------------LMMIV-YHTLF---DLDF-------
Q92KE6_RHIME/23-246-------------RMVL-LD-----ALRGLAL-----------------------VAMAL-YHFVW---DLEF-------
B1ZHM9_METPB/15-237-------------RIDA-LD-----LARGAAL-----------------------AAMAT-YHGLW---DLGF-------
Q2Y4H0_9ARCH/17-243-------------RFWE-ID-----FLRGIAI-----------------------IMMIT-FHLLY---DVNY-------
O29726_ARCFU/2-207-------------RYPE-ID-----IARGAAV-----------------------ILMLL-FHSFF---DAHY-------
Q12ZG6_METBU/7-234-------------RKWE-ID-----LLRGIAI-----------------------TLMVF-FHLLY---DLYY-------
A4BIP8_9GAMM/6-220-------------RLIL-ID-----QFRGIAV-----------------------ILMAI-FHFCY---DLSV-------
Q8THP4_METAC/31-261-------------RYWE-ID-----CLRGFAV-----------------------ILMLG-YHFLY---DLDF-------
Q46DC7_METBF/7-237-------------RFWE-ID-----CLRGLAV-----------------------LLMLL-YHFLY---DLDF-------
Q2FN30_METHJ/7-229-------------RYPQ-LD-----ACRGIAV-----------------------LMMIW-FHFFV---DLAF-------
Q1YI63_MOBAS/15-237-------------RIDI-ID-----IARAVAL-----------------------FAMVI-YHFTW---DLEF-------
Q1B004_RUBXD/18-243-------------RYWD-VD-----AARGVAM-----------------------GMVVL-YHLVF---DLDN-------
A6FRV3_9RHOB/4-228-------------RIMV-LD-----ALRAIAL-----------------------IGMVV-FHFVF---DLEL-------
Q1YJ44_MOBAS/24-246-------------RYVF-VD-----VWRGLAI-----------------------IGVVI-YHFGW---DLSF-------
Q26I67_FLABB/5-236-------------RLFF-ID-----AVRAFAI-----------------------IMMLQ-GHFID---TLLA-------

PF05857

A6TIJ3_KLEP7/24-240-------------GQ---TD-----MIKTVAL-----------------------VLMVT-DHTG.---..LL-------
Q5NWL3_AROAE/9-222-------------GS---LE-----ALKWIAL-----------------------LLMTG-DHVN.---.KYL-------
Q88AH9_PSESM/14-243-------------KA---LD-----LLKWLAM-----------------------LSMVL-DHLR.---...Y-------
A6M0I9_CLOB8/13-266-------------FS---GF-----SLKIIAL-----------------------VLMTM-DHMH.---.EFL-------
C1DKH3_AZOVD/14-243-------------AA---LD-----LLKWLAF-----------------------ASMLL-DHLR.---...L-------
A4XUI8_PSEMY/4-231-------------TS---LD-----LVKWLAM-----------------------LTMVI-DHLR.---..YL-------
A4XH28_CALS8/24-230-------------SK---SN-----LLKLIAA-----------------------ASMLI-DHIG.---..YL-------
A1WDN4_ACISJ/11-221-------------..---VE-----ALKWLAL-----------------------ALMTG-DHVN.---.KYL-------
C4YYW6_9RICK/13-242-------------..---QD-----LLKTLAI-----------------------IAMII-DHVG.---..LY-------
Q326X1_SHIDS/32-247-------------.Q---RD-----IIKTVAL-----------------------VLMVL-DHIN.---..LI-------
Q8P901_XANCP/6-212-------------..---RE-----LVKWLAL-----------------------LFMTG-DHTL.---.KIL-------
R5K8R7_9CLOT/9-229-------------.S---GA-----QLKYIAF-----------------------ASMLI-DHVNK---TFFI-------
R5KLN1_9CLOT/10-244-------------.T---SN-----QLKLLAC-----------------------IFMLC-DHVG.---..LV-------
R5QZC4_9FIRM/5-243-------------IS---GS-----TLKILAM-----------------------IFMVI-DHFG.---..QV-------

PF16401

H1Y6N2_9SPHI/12-268-------------RANS-LD-----ALRGTAI-----------------------LLMVLSGSIAFGGILPGW-------
G8TDM1_NIAKG/23-280-------------RNKS-LD-----ALRGFAI-----------------------LAMVLSSSIAF.CILPAW-------
F0SC25_PSESL/7-264-------------RDSS-LD-----SLRGIAI-----------------------ILMVLSGSIAF.SILPGW-------
R6N358_9BACE/4-263-------------RALA-LD-----ALRGYAI-----------------------ITMVLSATIIS.SILPGW-------

PF04235

Q8EH35_SHEON/199-352-------------------------LYRQGIF-----------------------E.QGF-NRNTL--------------
YXAH_BACSU/242-392-------------------------AAKSRYL-----------------------H.EPE-KHRKG--------------
A5VFY1_SPHWW/226-385-------------------------LYRIGLF-----------------------D.SRF-EERRL--------------
B0T5F0_CAUSK/216-381-------------------------LGRSGFF-----------------------E.TPQ-RYVTA--------------
Q5LBX3_BACFN/231-393-------------------------IGRKQLF-----------------------V.ASE-ATIRF--------------
A8FJB9_BACP2/218-375-------------------------MMRAGVF-----------------------Y.ANE-RGQSL--------------
Q8ZNL6_SALTY/215-375-------------------------LMRSGWL-----------------------K..GQ-YSLRH--------------
Q5Z0S5_NOCFA/200-354-------------------------AAQRYRL-----------------------LERAV-ERPAW--------------
Q5LAR8_BACFN/229-391-------------------------VGRKGLF-----------------------L.YSE-QNEQH--------------
A5FKP1_FLAJ1/222-380-------------------------LQKIDFF-----------------------D.RLN-EMKKR--------------
A6LH60_PARD8/231-393-------------------------IGRRKLF-----------------------I.SSE-ENSRF--------------
Q2NUE2_SODGM/217-377-------------------------LMRNGWL-----------------------A..GR-REPEH--------------
Q5L251_GEOKA/223-378-------------------------AADQRWL-----------------------E.ADR-HSPAK--------------
B9LP38_HALLT/238-398-------------------------LYRWGVL-----------------------T..GE-RSSAL--------------
Q5WBU3_BACSK/218-382-------------------------AGRKGLL-----------------------N.ESP-KNKPF--------------
Q5LDG8_BACFN/245-405-------------------------IGRKQIY-----------------------A.DLE-ANRVL--------------
Q2N5U1_ERYLH/237-397-------------------------LWRNGLF-----------------------K..GE-WRTFR--------------
Q1D273_MYXXD/254-423-------------------------AGRLLLL-----------------------Q.DVE-RHRAL--------------
Q0RI89_FRAAA/226-396-------------------------AARRRIL-----------------------E.DPA-AHRPL--------------
Q1GR12_SPHAL/244-406-------------------------LFKSHML-----------------------T..GE-WEAAR--------------
A3HTP0_9BACT/227-391-------------------------FGKNQYH-----------------------K.DLK-SLVKL--------------
Q0C162_HYPNA/232-392-------------------------AVKAGVI-----------------------D.QPK-ARIWV--------------
Q9X356_BACAN/222-381-------------------------AGKKNIF-----------------------K.RIP-GLIKK--------------
A8FH56_BACP2/222-385-------------------------FVKMAFF-----------------------K.NME-AKKTI--------------
Q5WCD3_BACSK/239-403-------------------------MGKAGMF-----------------------H.DVK-ANVTR--------------
A4GA59_HERAR/238-403-------------------------SVRLGWL-----------------------T.QPA-RHITF--------------
YRKO_BACSU/224-387-------------------------FVKMEFF-----------------------K.DME-AKKPI--------------
Q47SA7_THEFY/269-436-------------------------AARRRIL-----------------------E.EPG-NHLRL--------------
Q21P05_SACD2/237-402-------------------------FGRFGFF-----------------------H.TIS-QHKRT--------------
A4FQ93_SACEN/204-361-------------------------LMRAGVF-----------------------G.DDQ-RGRRL--------------
Q3IC82_PSEHT/208-361-------------------------LYKQQVF-----------------------A.SGL-SAKQL--------------
Q2NDD6_ERYLH/264-425-------------------------LYQFGFF-----------------------S..GG-LDPGK--------------
Q9HNH9_HALSA/232-393-------------------------LFHTGVT-----------------------T..ND-RSRAF--------------
Q9KFW4_BACHD/1-165-------------------------MARKHLL-----------------------T.EAH-LHRKQ--------------
Q8ERW4_OCEIH/226-381-------------------------AARKKWF-----------------------H.HPE-KYQQK--------------
Q7N6K6_PHOLL/210-370-------------------------LMRNGWL-----------------------K..GE-FSVSH--------------
A4ARZ9_MARSH/230-396-------------------------AGRIGFF-----------------------K.TLN-EHKTL--------------
B1YLL9_EXIS2/215-367-------------------------LMERFTV-----------------------R...P-PATRT--------------
A6L2L4_BACV8/234-394-------------------------IGRKGLF-----------------------L...K-EHLKV--------------
A1WTH2_HALHL/248-410-------------------------AYKNGFL-----------------------T..GA-WSSRA--------------
A1S3E3_SHEAM/216-369-------------------------LYRSHFF-----------------------N.EGL-TDAAR--------------
Q9AA92_CAUCR/270-432-------------------------LFKTGFL-----------------------T..GK-AKTWV--------------
Q0ARL9_MARMM/225-387-------------------------LFKSGFL-----------------------S..AS-WGSVR--------------
Q07YN3_SHEFN/228-381-------------------------LYKRNIF-----------------------V.DGL-DNKTL--------------
A8F9F5_BACP2/224-375-------------------------IGKKGHL-----------------------T..EE-DRGMA--------------
A6L9Q0_PARD8/227-389-------------------------LGRKGLF-----------------------V.DPE-KHRTF--------------
B0T422_CAUSK/230-391-------------------------LYKLGVL-----------------------T..GK-ASTGL--------------
A6WB03_KINRD/147-299-------------------------LVRCGAI-----------------------A.RLE-SSPRA--------------
Q47R13_THEFY/238-395-------------------------LLRAGAF-----------------------H.PDV-SGRRL--------------
A8MJB9_ALKOO/219-378-------------------------VGKKDVF-----------------------S.RIE-ELAGI--------------
A6TNH6_ALKMQ/249-412-------------------------CGKLNIF-----------------------N.KLD-ESDTF--------------
Q1D7M3_MYXXD/255-425-------------------------AGRRGIF-----------------------Q.DVP-SHLGF--------------
Q6NJJ5_CORDI/212-362-------------------------WARRGVL-----------------------A.DVH-QHRTE--------------
A5UQH7_ROSS1/237-401-------------------------FGKRQIF-----------------------Q.RLN-EKPAS--------------
A7MLK3_CROS8/215-375-------------------------LMRSGWL-----------------------R..GE-FSLRH--------------
Q9KE13_BACHD/42-195-------------------------VHRKGWI-----------------------A.NAA-EHKAI--------------
A8GC25_SERP5/223-383-------------------------LMRSGWL-----------------------R..GT-YSPGY--------------
Q8A424_BACTN/229-391-------------------------IGRSNAF-----------------------L.YSE-KNIKI--------------
Q9KFA2_BACHD/226-379-------------------------FMRAGAF-----------------------S.PDQ-HGKRI--------------
Q9KEU3_BACHD/250-400-------------------------FAKARIL-----------------------H.DPD-KHQRI--------------
A4FQT6_SACEN/171-324-------------------------AVRCGLV-----------------------E.TLD-HRTRQ--------------
A6TBN7_KLEP7/215-375-------------------------LMRSGWL-----------------------K..GQ-FSLRH--------------
Q4KHM8_PSEF5/226-387-------------------------AGRNKLL-----------------------V.APY-AFEPH--------------
A4F774_SACEN/171-329-------------------------LVTGFAL-----------------------A..QL-GLPNA--------------
Q9K7D7_BACHD/224-377-------------------------AAKRKWF-----------------------V.HPA-QEQGR--------------
A6KYE7_BACV8/229-390-------------------------IGRKQLF-----------------------V.TSE-KHTRF--------------
Q2G3S1_NOVAD/241-402-------------------------LLRSGFF-----------------------T...T-WPKRS--------------
Q1IVW5_DEIGD/222-381-------------------------AQRFGLL-----------------------T.RPQ-AHLPL--------------
A4AN58_MARSH/230-392-------------------------LGKKKLF-----------------------V.DSE-KSNKF--------------
Q9RS74_DEIRA/223-382-------------------------AARAEVL-----------------------T.RPE-RFGWL--------------
A3HYS5_9BACT/265-426-------------------------LFRWGFL-----------------------T..GE-KPASQ--------------
Q6D3N4_PECAS/227-387-------------------------LMRSGWL-----------------------K..GE-FSTAH--------------
A5FKP0_FLAJ1/222-380-------------------------LQKLNFF-----------------------N.RLI-ELKKL--------------
A6LGL5_PARD8/234-396-------------------------VGRIRLF-----------------------Q.RMD-EFRSR--------------
Q3IPY1_NATPD/256-418-------------------------LYKYGII-----------------------S..NR-RASRF--------------
Q5YUW9_NOCFA/233-388-------------------------LFRAGVF-----------------------R.PEG-..ARI--------------
Q9K6N5_BACHD/237-398-------------------------VAKTERY-----------------------R.NLQ-QQKPF--------------
Q8EL60_OCEIH/225-388-------------------------LAKKQLL-----------------------T.KPE-LHLQS--------------
A9WKI7_CHLAA/242-404-------------------------.GKRRLV-----------------------Q.HLY-EQPAV--------------
B0RFW7_CLAMS/254-423-------------------------LGRRRVL-----------------------E.DPA-AHLPL--------------
B1HN91_LYSSC/223-376-------------------------.SKWRLV-----------------------E.RAK-ELKWL--------------
B1HPE9_LYSSC/165-337-------------------------AGQYRLF-----------------------E.NIS-VHRKK--------------
B1HRQ0_LYSSC/190-342-------------------------.AKAGWI-----------------------G.HIG-AHIQK--------------
B1HW32_LYSSC/220-369-------------------------FMRNEVF-----------------------S.PTS-KGYQA--------------
B1HYB2_LYSSC/222-372-------------------------LAKKQAF-----------------------V.KMD-EEVKW--------------
E3FDU1_STIAD/253-420-------------------------AGRHRLL-----------------------Q.EPE-RHQPL--------------
E3FTX2_STIAD/250-412-------------------------...RRLL-----------------------P.DPL-AHRML--------------
Q74VB6_YERPE/216-374-------------------------LMRCGWL-----------------------R..GK-FSLRH--------------
Q7VYP4_BORPE/228-388-------------------------LGRRHAL-----------------------A.DPL-AHPRL--------------
Q812K5_BACCR/224-376-------------------------.GKKGWL-----------------------F.EVS-KHIPA--------------
Q81SQ3_BACAN/217-376-------------------------AGKKDIF-----------------------R.RTK-ELDPK--------------
Q8NMY9_CORGL/70-221-------------------------LVRYGVV-----------------------D.RAE-NAPRA--------------
Q8P7N0_XANCP/245-401-------------------------.VRSGAI-----------------------A.APE-RFVRL--------------
Q9PFK6_XYLFA/262-418-------------------------.VRSGAI-----------------------L.QPE-RYRRL--------------
R5USE5_9BACE/227-387-------------------------IGRKQLF-----------------------V.TTE-SHLKF--------------
R6X5K4_9PORP/228-389-------------------------MGRRQLF-----------------------A.NLS-EHRVF--------------
U5L4L4_9BACI/226-379-------------------------AARRRAF-----------------------H.EIG-RNKSR--------------
U5L6C6_9BACI/232-386-------------------------AAKLKLL-----------------------E.KLA-NFQKR--------------

PF07779

U1HPB3_ENDPU/212-693...FDKTCCNVQ.PPINLEQ-----QVLIFVA.......................TLTIL-YAFYSASKRKML.......
Q6CDI8_YARLI/311-778..PFSDTCCIHYKQPRTMGQ-----VLLLGVI.......................CAILP-IIYLGQRYTRSDYYPRFVR
Q9W4P0_DROME/351-846MNYNDGTCCSSS.EPYTTLQ-----IVAYALFGV............CMALV....CGMCL-RRWVLHLRGQTL.......
F6X8U0_XENTR/294-776VNPIDGSCCQPT.PSLTIIQ-----KLAACFFIF................A....MIAFV-SVTIVQRNKHRR.......
K1QBI1_CRAGI/299-786MNHNDGTCCRVP.DSITSIQ-----IITAAFFLV............CLLSA....IAMFL-YRRRIRRNGSKA.......
B7Q496_IXOSC/303-799MNYNDGTCCSSS.EPVTMLQ-----IITFSAFGV............ISILA....LAMIV-HRHLQLRRARAF.......
T1INP0_STRMM/300-790MNYNDGTCCSRA.EPITTLQ-----IISLSSLGILYDFIARKIVFFSVLVA....FLMIL-HKRKLKKNVRRS.......
H2Z694_CIOSA/175-652..TVDGTCCKKP.DPVTVVQ-----IILATFGSL............WFVYH....FCFVV-VNLVQKHVQRPS.......
D6WF47_TRICA/333-815MNFNDGTCCSST.ETYTTLQ-----IVTFAILGI............CASIA....IVMLC-TRLIMKWRGRPI.......
W5MY98_LEPOC/349-830LKPIDGSCCHPR.PPLNIVQ-----KLTAGVFAS................A....IMSFL-VLNLLCYSKHRR.......
G3NTP4_GASAC/295-774LRPIDGSCCQTF.ASPNLLQ-----KLSACIFAG................S....AAALL-VFHLLGRNRHRR.......
E9GCH2_DAPPU/313-803MDFNDGTCCRSP.ESATTLQ-----IVTFTILLTLMEAEDDEMAKKDVVVANGHSTVVVA-EGFDEKATTAHR.......
A0A0D2WR15_CAPO3/466-972....DVTCCAPY.PALTGLQ-----YVFFAV........................VLFAL-VCWLGGSYAARH.......
L2GH03_COLGN/240-722....QVTCCAPY.PSLSRVQ-----VLLLGLS.......................ILALP-ILFLDRRQDAFP.......
E0VHC9_PEDHC/297-768MNFQDGSCCSSA.EQYTSLQ-----IITFFVLFI............CFLLA....VLAKF-IETFKKSKNKTE.......
F6XMQ8_CIOIN/290-767.HATDGTCCRKP.DPLTIVQ-----IIMAVLG...............FILL....GILLA-VGIRIQRIGKPT.......
H2QUY3_PANTR/295-776LKPVDGSCCQPR.PPVTLIQ-----KLAACFFTL................S....IIGYL-IFYIIHRNAHRK.......
T1G7I3_HELRO/252-726MNFDDGSCCTSP.ENPTTVQ-----IAMAAFFAT............SLAAA....VLIAT-CRRLNGRSNKNN.......
Q17CG6_AEDAE/303-783MNYNDGTCCSSA.ESYTIIQ-----VVTYATLGV............CLAIA....CAMIV-RRWLLKLRGVNI.......
H3A7E5_LATCH/298-779LRPNDASCCLPK.PSFTVIQ-----KLTACFFGI................S....IIGFL-IFSYLFRNNHKK.......
A0A088A578_APIME/294-775MNFDDGSCCSYP.EPATILQ-----LLSLSILAL.....................CIIIG-GGMWLYRKFCYY.......
S8EFZ6_FOMPI/324-771TFPMDRTCCRRY.PWPSALH-----SLVLAVA.......................VFWGP-ACVLLARRVAPP.......
X1WW08_ACYPI/313-776MNFNDGTCCSST.EPYTSLQ-----SYMLVFFII............CIFIG.....ILMA-VRYRQNRLSKNE.......

PF10129

A1R109_ARTAT/441-826--FQ.LLSQ----------------------ET----------------------------------LGVV-SGAELFVM
A0K1D5_ARTS2/295-678--FQ.LFTQ----------------------ET----------------------------------IGFV-SGAELFVL
A2SCM7_METPP/4-366--AD..PLG----------------------QP----------------------------------FGYV-SAAEGFVL
A1TNJ8_ACIAC/18-379--TM..PLG----------------------QP----------------------------------FGFV-SAAEGFVL
Q1D6T0_MYXXD/55-417--NT..ISN----------------------QP----------------------------------FGFV-SAAEGFVF
Q11B97_CHESB/2-386--LLVKFNH----------------------SE----------------------------------LGYV-QDAQGFVF
Q7CT44_AGRFC/2-385--WLVEINH----------------------RQ----------------------------------FAFV-EDAQGFVF
B2JS58_BURP8/58-406--LS.RATL----------------------HA----------------------------------YALC-DAAEVFVF
Q13NS3_BURXL/7-355--LS.RVTL----------------------HA----------------------------------YALC-DAAEVFVF
Q1LDM8_RALME/9-370--LA.DYTI----------------------RN----------------------------------FTLF-DAAEVFVF
A1B1M7_PARDP/3-363--LR.KLTL----------------------TN----------------------------------FAVF-DAAELFVL
Q5FTQ3_GLUOX/17-367--LN.RITI----------------------RN----------------------------------FGFA-DAAEIFVM
Q89UF3_BRADU/67-422--VN.LLTL----------------------RN----------------------------------FGFS-GAADLFVF
Q89KT4_BRADU/82-438--LV.WFTT----------------------RN----------------------------------YGFS-DGADLFVL
A4YU73_BRASO/12-368--VN.WITT----------------------RN----------------------------------YGFS-DAADLFVF
Q6N6S8_RHOPA/12-368--VN.WITT----------------------RN----------------------------------WGFS-DAADLFVF
Q1QFJ8_NITHX/39-395--VA.WITI----------------------RN----------------------------------YGFS-DAAELFIF
Q89VE5_BRADU/37-393--LT.WFTI----------------------RN----------------------------------YGFS-DATEIFIF
Q6N0J3_RHOPA/44-400--LT.WFTL----------------------RN----------------------------------YGFS-DATEIFIF
Q3SWD7_NITWN/36-392--LT.WLTI----------------------RN----------------------------------YGFS-DATEIFIF
Q89CC1_BRADU/15-372--VA.WLTL----------------------RN----------------------------------YGFS-DAAEFFVF
A4YYN0_BRASO/36-389--LA.WLTL----------------------RN----------------------------------YGFS-DTSEVFVF
Q89EQ8_BRADU/32-383--GS.WLTL----------------------RN----------------------------------YGFS-DAAEVFMF
Q87XJ3_PSESM/5-366--LA.QLTV----------------------RN----------------------------------FGFS-DAAEIFVF
Q0BVC0_GRABC/14-370--LG.ELTL----------------------KN----------------------------------IALS-DAMEVFVM
A5G015_ACICJ/9-360--LA.RFTV----------------------RN----------------------------------LALN-DATEIFIL
B0U809_METS4/3-358--FE.SFTY----------------------SQ----------------------------------YGTS-DAAELFVF
Q2K344_RHIEC/23-378--FE.YVTT----------------------KN----------------------------------FGFS-DAAEAFVL
Q2YRC8_BRUA2/6-358--YE.HFTH----------------------KN----------------------------------LGFS-DSAEAFVL
Q983D5_RHILO/37-389--FE.ALTY----------------------KN----------------------------------FGFS-DAAEAFVL
Q3J1N1_RHOS4/11-372--WE.NFTS----------------------RN----------------------------------FGFS-DAAEGFVL
Q11DW2_CHESB/11-364--FE.NLTS----------------------RN----------------------------------FGFS-DAAEAFVL
Q1GGF0_RUEST/47-428--WT.GWIP----------------------AR----------------------------------FGFS-DATEIFVF
Q169P8_ROSDO/29-397--LT.LWIP----------------------AR----------------------------------FGFS-DATEVFVF
Q0BQN1_GRABC/63-424--FS.HLMP----------------------AS----------------------------------FGFS-DAACIFFF
B0RH46_CLAMS/492-873--YS.YVTI----------------------NA----------------------------------IGAI-TGAEMFVL
B4EL00_BURCJ/18-366--LS.RVTL----------------------HA----------------------------------FALC-DAAEVFVF
B4ELU9_BURCJ/9-352--LS.RVTL----------------------HA----------------------------------YALC-DAAEVFVF
E3FIJ7_STIAD/5-384--LV.KLNH----------------------GE----------------------------------LGYV-QDAPGFVF
Q13QD3_BURXL/18-362--LS.HLML----------------------HA----------------------------------YALC-DSAEVFVF
Q5LPG0_RUEPO/27-401--WA.GWIP----------------------AR----------------------------------FGFS-DATEIFVF
Q63IA9_BURPS/14-358--LS.RVTL----------------------HA----------------------------------FALC-DAAEVFVF
Q6NAS6_RHOPA/6-361--LN.WFTL----------------------RN----------------------------------YGFC-DAAEFFVY
Q92L11_RHIME/23-374--LE.YLTH----------------------KN----------------------------------FGFS-DSAEAFVL
Q9KQQ7_VIBCH/3-361--LQ.MITH----------------------EP----------------------------------VGVF-GAAEGFIF

PF01757

A8DMZ1_STALU/12-334--GIDGDDL----------------------RQLKVIYYA..........................QNIFI-FGTPCFII
Q035D4_LACC3/20-369--QTSSGLI----------------------STGFLATH............................LMIH-FTRMGFMF
A8G974_SERP5/5-314--ISPDIPV----------------------YHMVNSIDIEM......................FVGLFGK-ICVSMFLF
Q11WN8_CYTH3/14-339--GKIGSML----------------------F...................................AFGQ-EAVMIFFV
A7LV98_BACO1/4-296--DNKGAD.----------------------....................................YLYL-FHVICFFI
Q97ER7_CLOAB/6-334--.......----------------------....................................FVYS-YHVVLFFF
A0A025FGD2_ECOLX/9-357--HTWHVNS----------------------AEPSLWLTLF........................NDFIHS-FRMQVFFV
Q07PA2_RHOP5/14-375--GFWVIVD----------------------SHPSRVLAAF........................IFVSHT-FRMTTFFV
Q30BE9_ENTFL/7-326--SETGNFI----------------------FTR.................................IVSR-VAVPFFFM
A1HPJ5_9FIRM/6-350--NPEVNVH----------------------LFALME..............................IFTR-FSVPIFFF
A0A0D1E273_USTMA/127-516--PGTIQNG----------------------TPVGL...............................LRSP-IGLVLFYM
A7LV97_BACO1/24-312--DGVS...----------------------....................................LLTE-IAVPYFFI
Q1QWT8_CHRSD/4-315--SDLGYQL----------------------TVQ.................................GLFR-IVVPIFMM
Q2T7M4_BURTA/6-373--YLASLFR----------------------PVPFLIQPSALERWIS.............IPPLTLAYSAD-AAVCVFFV
A4B9D7_9GAMM/5-375--NDSLLSE----------------------MVQTFG..............................IMAQ-AGVSVFFV
Q5LBM3_BACFN/8-315--YSYLA..----------------------....................................TGGA-IGDALFFF
M6C4Z5_LEPBO/44-373--FGPGENA----------------------SLLTLALS............................NLFR-FGVPAFVL
A5ZUV3_9FIRM/6-346--PVLLGQL----------------------QVSFPLWNIEN......................LLFTIGR-IGVPLFLA
B2JGA6_BURP8/53-400--LPAWLQA----------------------LA..................................DMGQ-YGVQLFFV
Q9XAP7_STRCO/24-348--.......----------------------....................................GLVL-PSMGIMFG
Q07KV2_RHOP5/17-343--FAVAAIQ----------------------SAPLYK..............................PFGG-IGVEIFFI
Q484G4_COLP3/18-372--WGFHIES----------------------GYNSTFLKTI........................MILSSK-WRLDILFL
A0DGZ8_PARTE/156-556--ATFQTEL----------------------LVALQSQRAI........................ITVDML-YSVDIFFW
A7A7L5_BIFAD/6-324--DVLKLPL----------------------GPERIFFQLV........................MQGGGK-VGVVIFFS
A3JPT3_9RHOB/10-350--PDASPPE----------------------RLGPLVFRM...........................IIYT-ARTELFLI
A5EMI0_BRASB/26-386--FGHTDPT----------------------SFIGFDGIV..........................LATDS-FFMAMFFF
A4FKM9_SACEN/20-347--LHPELES----------------------RELV................................FPYQ-VGASLLLL
A7V903_BACUN/5-297--YPYAKQ.----------------------....................................IVYT-FHMSAFLI
Q8IG66_CAEEL/330-720--FTDTIRS----------------------VARKGESVVGWR.....................NFMMNSS-LAVDTFLF
Q7UES3_RHOBA/12-486--DAGRGWP----------------------IQDSQSSQITSL.....................FIAMVHG-FRMPLFFL
Q1WRZ8_LACS1/4-332--NYFSN..----------------------....................................ILFA-VNVPIFFV
Q8PXP5_METMA/13-333--SDAIFIS----------------------K...................................YLVV-FGLSLFTF
Q6AH04_LEIXX/3-320--SPFPLKL----------------------LN..................................FSDH-FAMPLFAV
Q5CVD7_CRYPI/23-437--GITRSEK----------------------EIVRQMIV............................FFSE-FGMPIFFY
A0LT35_ACIC1/10-359--YHGRTFS----------------------AEDAITGVSFG......................PWLTLLF-QVVPLFFF
Q8KJJ2_RHILI/23-344--QGTDAFW----------------------LSPYFK..............................SIYM-FHMPLFMA
Q17BV3_AEDAE/212-599--PFTNRNE----------------------FTESFNTPWSV.......................ALRVLM-LYADVYLV
A7F3R9_SCLS1/8-361--DLFLPSS----------------------GEGLRPRFLQLPL...................LRVLVQGR-IGVTIFSL
Q144E0_BURXL/4-320--AGFLQDG----------------------HVARLMKILL.........................YAAST-LGYPTLFF
Q83YQ9_STRGN/5-307--GVFYQ..----------------------....................................IVAR-FAVPFFMM
Q07P25_RHOP5/21-323--ADIFPGE----------------------ALAQWMDY............................TLYT-FHMPLFFF
Q8DSB8_STRMU/14-327--RSTVKEN----------------------FDLYYFVTWG........................IQVSAY-SAVNCYAL
A0LP70_SYNFM/14-366--GRFPWLL----------------------GFGNFSAWLAEQHSGSILGTI...SAALEGIAAVVFERGS-QAVGVFIV
A8H1P8_SHEPA/43-369--EIETFAD----------------------KAWF................................NLMM-NGTVFFVF
A6E8A8_9SPHI/14-335--FN.....----------------------....................................FISG-FDLPLFFF
A5VFE0_SPHWW/65-420--PGRAPVA----------------------MDQAGLIAERPF....................LLAIVNGH-FMVAIFFV
A5LX53_STREE/8-323--SNIFSIA----------------------NDVLLLLIT...........................QIYI-FHIPVFFA
Q8P802_XANCP/22-341--YKL....----------------------....................................FAYS-FHVPLFFV
Q2HGI8_CHAGB/115-578--GYGAGSV----------------------TTAATTTPTGNHNDSNNPKPANHHYHLPLLPFIRLLFSGP-PMVCVFFI
A6BII1_9FIRM/11-365--ILSGKMT----------------------GYVNYFIQ............................TLVA-VAVPLFFV
Q9CHP8_LACLA/4-320--YDMTIHS----------------------TLAIFWIGI..........................RTILI-TCVPLFLV
A5N097_CLOK5/9-357--NNNIIIF----------------------ARANTELIFCKY.....................MQMFLAR-WHMVILFL
Q8FTN8_COREF/16-398--YPFQKSD----------------------LFATIHSFIP.........................MQLGS-AGVTFFFI
A7AZT9_RUMGN/12-318--IEPVAWI----------------------NHAIWFLVE...........................RIAC-LAVPGFFM
Q2NRT0_SODGM/9-399--FKAVFGL----------------------SELT................................SMGF-FATSAFFA
A4CKW1_ROBBH/7-342--PLFRDPS----------------------NPAYATWL............................YFRG-ITAPVFFT
A6FAM6_9GAMM/8-349--TPSENEM----------------------EFTSGKVLNLFDILFTEP.........AGIIRALFSYFGH-FGVQIFIF
R7EJB8_9BACE/14-354--GSHLTQI----------------------I...................................NHGY-LAVDFFFM
A4YYF7_BRASO/15-345--PVGLVRG----------------------ELPFYRVLFP........................FYELGE-YGVVIFWC
Q1D0W9_MYXXD/39-356--PVVRADV----------------------WVQHYW..............................TCRG-ITAPLFLM
Q16PV5_AEDAE/243-647--SPMENPQ----------------------ALETFFRNPVMR.....................MASAIFP-FLVHTFFT
Q82ET0_STRAW/57-398--ADGGTLH----------------------TASPLQHMPWL......................APISWVF-QTLAVFFL
Q4JZS0_STREE/5-327--QIYGWIF----------------------EVFV................................PSLT-LLVYLFLL
Q7MGC8_VIBVY/15-336--WQIDDIP----------------------WVGYLLN.............................QLAR-FAVPLFFL
A6KZK8_BACV8/9-367--RFDTDRP----------------------TFLQGCALG...........................SAVR-CCVPLFVM
A4CUQ6_SYNPV/6-368--TGWSGVR----------------------IPIEGIVGEGFIGF................FNWYIYAINS-FIMPMMFL
A0A0G2MNM2_SALPT/5-319--NAHSVSP----------------------LNWDIANVL..........................NSASR-VSVPLFFM
A6P1P2_9FIRM/9-341--DVPVGSG----------------------AWDIYNVYD...........................SLVR-WCVPVFVM
A5FYP6_ACICJ/4-317--AHVLWYP----------------------ALRR................................AVYG-FHMPFFFY
Q7MQA5_VIBVY/5-328--ELGVIPF----------------------DQWVTAVGI..........................NGISR-WAVPVFIL
Q5ZXE9_LEGPH/10-336--.......----------------------....................................PAGF-LGVDVFFV
A7V3H1_BACUN/5-305--DEALKNS----------------------FFI.................................GTIS-FHMPLFMI
Q64YD4_BACFR/4-349--AAGSTDM----------------------AGPQSYLASEVDRL................WVAVYDGFSR-MAVPLFMI
A5UMZ7_METS3/7-344--KSVGNLQ----------------------EYVVF...............................TTFG-FGVPIFLM
A3YY52_9SYNE/16-323--IDGYKND----------------------VTY.................................RVTV-VVLGLFVF
A4AIT9_9ACTN/563-845--.......----------------------....................................FFVQ-GGSHLLLV
A5N224_CLOK5/8-329--RCRPYST----------------------TYDITFFLN...........................QLSR-FSVPAFIV
E0TI88_PARBH/15-315--PYGAGEL----------------------IR..................................AFCR-WCVPFFFI
A0A072ZP69_PSEAI/5-324--PTVLYP.----------------------....................................LLSP-FILPLFFF
A0E2L0_PARTE/17-375--NDRQSII----------------------NSNFMIIM............................INSL-YAVDIFFL
Q8A5U1_BACTN/9-318--LDKHS..----------------------....................................MLSC-FRMPLYFF
Q2C1R6_9GAMM/10-345--DPIGYNL----------------------PHVKESMQYQYGIL.................STFLGINQS-FFMSLFFF
A7A7B8_BIFAD/5-363--GLAGTAV----------------------T...................................VLCV-VCVPLFFA
Q4JYU7_STREE/6-318--ETGSWNL----------------------LAYLY...............................YLGT-YSIPLFFM
A9VR59_BACWK/5-346--GNVLLEQ----------------------SLIMGMLF............................NLAK-FSAPAFIF
A7VGI1_9CLOT/6-345--KHGYLL.----------------------....................................EWGR-YAVEMFFI
Q1QR03_NITHX/14-320--AVGQDGF----------------------MHLVVE..............................FAKP-FRMPDFFL
A5ZDF6_9BACE/13-326--TNVDLSG----------------------KIIEH...............................FIVA-FNMPLFVI
Q16FE1_AEDAE/161-554--LPTSHPD----------------------KLKLSLLGKL........................GNVMTP-TTVQIFFT
Q7CTZ0_AGRFC/8-329--SPFLGLY----------------------GFFDWLRVFL........................GDALFR-IGVPCLSA
Q8G7P7_BIFLO/17-373--VKMTLAG----------------------SAETVRSVLF.........................AL.FM-VCNPLFIM
A1R1G8_ARTAT/18-357--LQKDGTV----------------------VTVNVLMEQSWF.....................TPVAWGL-MIVPLFFV
A0QPG5_MYCS2/9-326--GVTYKPL----------------------EQ..................................LLEQ-VWVDGFFA
A5EXU9_DICNV/19-351--FGSTIPH----------------------ILVEYV..............................LSEP-FAAPVFLT
A6LGX6_PARD8/9-311--MISRYTE----------------------....................................VAAR-FAVPLFFM
Q11WP3_CYTH3/4-324--.......----------------------....................................ALGE-WAVHVFFI
A6KYR5_BACV8/6-309--TSNWLNK----------------------EFILFIN.............................TLGN-TGVTLFIL
Q0CZ95_ASPTN/77-482--VGVGKAF----------------------ELAYGYDNKYYFACL..............PGVRTIFAGGH-FAVSVFFV
A0T1U4_VIBCL/8-303--.......----------------------....................................RIRS-FDVPLMIF
A3I592_9BACI/6-352--ALSIESR----------------------LYSIYVFLN...........................IFPK-FAVPVFIF
A1TDU0_MYCVP/22-361--IRDDVFI----------------------WTNLLTASPVF......................QALTWLF-QIMPLFFF

PF07786

A1HQT7_9FIRM/5-214--FYGAKLE----------------------YL.SGFWF----------------------------WVGR.SSAVLFML
A2SQB7_METLZ/5-231--FGTGLVP----------------------WF..DPYT----------------------------MSGA.PIAFLFIV
A9CIY2_AGRFC/15-234--FGYLEPG----------------------TATTGLWK----------------------------LYAR.GIASSFLF
Q28R74_JANSC/28-249--FGHVPRG----------------------TATTGIWR----------------------------ALAV.ATAGSFLC
Q8PXM0_METMA/7-237--FGLADIE----------------------LR.SGTFF----------------------------YTGR.GAAFLFIL
A4EC93_9ACTN/4-221--LYDWDMP----------------------WFTQTVFQ----------------------------DIWRASISWVFLF
Q8U2K3_PYRFU/23-240--FLGYSEY----------------------KT...FWK----------------------------VFAY.ATASLFVS
A7I8Y9_METB6/6-231--FRIAPVD----------------------VS.DGFWR----------------------------YFAY.ATASLFLL
A6G0Y4_9DELT/12-237--VETQAGS----------------------ALGVALHV----------------------------VGKG...TAGFLV
A3CVR7_METMJ/5-231--FGVLPLN----------------------VS.GGFLR----------------------------TLAY.LTASTFIF
Q11IW8_CHESB/30-251--FGYVEPG----------------------MSITGAWK----------------------------FFAR.SIACSFLF
A1TRD1_ACIAC/21-249--FGYWPQD----------------------FRGDPFWT----------------------------LQRT.AIVSLFLF
A2SGN2_METPP/12-230--FRLIGAN----------------------FHADPFWL----------------------------HQRT.GIVSLFLF
A2STU6_METLZ/14-241--FHIINVD----------------------VW.LGLGV----------------------------YLP..LGTSVFVI
Q2K839_RHIEC/16-243--MGYLAPG----------------------TAETGWLK----------------------------IYAR.AIATTFLF
Q251W2_DESHY/5-221--WTGLAVD----------------------VD.ALFWF----------------------------SIGK.TAALLFIF
A0NYA1_LABAI/5-227--FAYVDWP----------------------VAQGTGWR----------------------------IFAA.SIAGSFLF
Q21VS3_RHOFT/16-244--FGYIKQD----------------------FYHAPLWT----------------------------WQRT.LIVSLFLF
Q0FKK0_PELBH/7-221--FGLVPHG----------------------LTMSGGWA----------------------------LFAR.LVAGSFVF
Q2YRW9_BRUA2/16-233--FGYMAPA----------------------TTAQGGWK----------------------------LFAR.CIASSFLF
A2STU5_METLZ/19-252--FHILQ.E----------------------TR.EFLYY----------------------------YSPIVIVSAAFVF
Q6SHI3_9BACT/5-214--FGFTEVP----------------------LFTHWAGI----------------------------TWRC.LIVFLFLS
Q0G6B2_9RHIZ/53-275--FGYVTRG----------------------MATSGGWM----------------------------VFAR.CIASSFLF
A3YBL4_9GAMM/14-227--FDYIDYS----------------------LR.DPFWV----------------------------GFRS.LIISLFMS
A4FZP9_METM5/5-227--FLGYSEN----------------------LL...FWS----------------------------IFAL.YVASIFIF
Q11N89_CHESB/6-227--TGIIN.G----------------------VARHPVWL----------------------------AFGR.SLAGTFMF
A4J1M2_DESRM/9-218--FYNLPIH----------------------YQ.EGFIF----------------------------LTGK.ASATLFIL
Q6SGH9_9BACT/9-218--FGYTNIP----------------------LSNFWLTS----------------------------YWRY.LIVFLFLN
A1VNB1_POLNA/5-231--FGYLQQN----------------------FYTDPFWT----------------------------WQRS.TIVSLFLF
A3DGD5_CLOTH/11-220--VYNIPIG----------------------YG.TGFID----------------------------KIRI.VVATLFIM
Q98KU6_RHILO/16-237--FGYTDPG----------------------LTAFGWWK----------------------------IYAR.CIASTFLF
A6VZM7_MARMS/12-224--FGFLEYS----------------------IY.DPFWV----------------------------YFRS.LILTLFLT
A1W6I8_ACISJ/12-240--FGYWPQD----------------------FRADPLWT----------------------------VQRT.LIVSLFLG
Q6M0I2_METMP/11-233--FLGYSDY----------------------LL...FWS----------------------------FFAL.FVASSFVF
O26882_METTH/9-227--LGVLDLD----------------------MG.SPVIW----------------------------FTGR.LTAFLFIF
Q92KE6_RHIME/23-246--FGYVAAG----------------------TAGTGGWR----------------------------MFAR.LIASSFLF
B1ZHM9_METPB/15-237--LQLTPQN----------------------LALTPPGR----------------------------VAAH.LIAGSFLL
Q2Y4H0_9ARCH/17-243--FGGYNLN----------------------LH.SGFWL----------------------------YFGR.ATATIFIL
O29726_ARCFU/2-207--FGKIELS----------------------...GDFWY----------------------------YFPR.FIGGMFIF
Q12ZG6_METBU/7-234--FGYYDND----------------------IR.TGEVF----------------------------LIGR.AAAFLFIF
A4BIP8_9GAMM/6-220--FGFLTFE----------------------MN.GGFFT----------------------------WFRF.LIVTLFFT
Q8THP4_METAC/31-261--FGLSDVD----------------------LK.SGTLL----------------------------YIGR.GAAFLFIL
Q46DC7_METBF/7-237--FKLADIQ----------------------LR.SGVIL----------------------------YAGR.FSALLFIL
Q2FN30_METHJ/7-229--LGLPGPD----------------------PF.SGLLR----------------------------IFGM.LTTISFIG
Q1YI63_MOBAS/15-237--FNYVERG----------------------LTGHGGWR----------------------------IFAR.AIASSFLF
Q1B004_RUBXD/18-243--FGGYPIA----------------------ST.SGFWA----------------------------AFAD.ASAFVFVF
A6FRV3_9RHOB/4-228--FGLLPQG----------------------TAGSWGWS----------------------------NFAK.LVAGSFIC
Q1YJ44_MOBAS/24-246--FGYVSPS----------------------LMFSIPVT----------------------------IFAR.SLAGSFMF
Q26I67_FLABB/5-236--PEYRDTD----------------------STIFQIWS----------------------------YFRG.ITAPTFFT

PF05857

A6TIJ3_KLEP7/24-240--LAGNNEV......................MR----------------------------------LLGR-GCFPLFGL
Q5NWL3_AROAE/9-222--FNATLPV......................LF----------------------------------EVGR-VALPLFIF
Q88AH9_PSESM/14-243--VGWSIDF......................LY----------------------------------VPGR-FAFPWFCL
A6M0I9_CLOB8/13-266--ASTGIPI.....................WFN----------------------------------WIGR-LSAPLFFF
C1DKH3_AZOVD/14-243--VWPQRIW......................LY----------------------------------VPGR-LAFPFFCL
A4XUI8_PSEMY/4-231--WPEATAW......................LF----------------------------------VVGR-FAFPLFCL
A4XH28_CALS8/24-230--YFPNRVL......................FR----------------------------------IVGR-IAFPIFAF
A1WDN4_ACISJ/11-221--FNATLPV......................LF----------------------------------EAGR-VALPLFVF
C4YYW6_9RICK/13-242--LYPELTI......................MR----------------------------------IIGR-TAMPVFCF
Q326X1_SHIDS/32-247--FQLKQEW......................MF----------------------------------LAGR-GAFPLFAL
Q8P901_XANCP/6-212--HLGYMPV......................IA----------------------------------ELGR-VAFPLFAL
R5K8R7_9CLOT/9-229--YFNSKALIVM................SELFD----------------------------------ILGR-IAFPIFIS
R5KLN1_9CLOT/10-244--LMNNNWI......................MR----------------------------------AVGR-LAFPIFAF
R5QZC4_9FIRM/5-243--VLKNGIILHAPYSMFTDEQFDMLMSTVNICH----------------------------------ILGR-IAFPVFCF

PF16401

H1Y6N2_9SPHI/12-268--MYHAQVP----------------------PPAHQFKPDLPGI-----------------------TWVD-LVFPFFLF
G8TDM1_NIAKG/23-280--MYHAQTP----------------------PPGHVYTPELPGI-----------------------TWVD-LVFPFFLF
F0SC25_PSESL/7-264--MYHAQVP----------------------PPGHKFMPEIPGI-----------------------TWVD-LVFPFFLF
R6N358_9BACE/4-263--MSHAQTP----------------------PPDHIFNPEIPGI-----------------------TWVD-LVFPFFLF

PF04235

Q8EH35_SHEON/199-352------------------------------------------------------------------------LKLALASL
YXAH_BACSU/242-392------------------------------------------------------------------------LKRLWMAG
A5VFY1_SPHWW/226-385------------------------------------------------------------------------WQMVRIG.
B0T5F0_CAUSK/216-381------------------------------------------------------------------------RRLVLAAS
Q5LBX3_BACFN/231-393------------------------------------------------------------------------WVKALIWS
A8FJB9_BACP2/218-375------------------------------------------------------------------------RKRLFRVG
Q8ZNL6_SALTY/215-375------------------------------------------------------------------------YRRTGALL
Q5Z0S5_NOCFA/200-354------------------------------------------------------------------------LVAVFLLA
Q5LAR8_BACFN/229-391------------------------------------------------------------------------WLKALGIS
A5FKP1_FLAJ1/222-380------------------------------------------------------------------------LLYVLVIS
A6LH60_PARD8/231-393------------------------------------------------------------------------WIKTLIIT
Q2NUE2_SODGM/217-377------------------------------------------------------------------------YRRMALWL
Q5L251_GEOKA/223-378------------------------------------------------------------------------LRRLMRWA
B9LP38_HALLT/238-398------------------------------------------------------------------------YRRLVALG
Q5WBU3_BACSK/218-382------------------------------------------------------------------------LKKAAVYG
Q5LDG8_BACFN/245-405------------------------------------------------------------------------LKKTVTYG
Q2N5U1_ERYLH/237-397------------------------------------------------------------------------LQRLAAIC
Q1D273_MYXXD/254-423------------------------------------------------------------------------LRRILGWG
Q0RI89_FRAAA/226-396------------------------------------------------------------------------LRRVACAG
Q1GR12_SPHAL/244-406------------------------------------------------------------------------YRKWAIAC
A3HTP0_9BACT/227-391------------------------------------------------------------------------IKKPVIIT
Q0C162_HYPNA/232-392------------------------------------------------------------------------LSRWVF..
Q9X356_BACAN/222-381------------------------------------------------------------------------IRFLQWSS
A8FH56_BACP2/222-385------------------------------------------------------------------------WNRIWLI.
Q5WCD3_BACSK/239-403------------------------------------------------------------------------WKRLCWIG
A4GA59_HERAR/238-403------------------------------------------------------------------------WRRVQWTG
YRKO_BACSU/224-387------------------------------------------------------------------------WKRIWII.
Q47SA7_THEFY/269-436------------------------------------------------------------------------LRITAAVG
Q21P05_SACD2/237-402------------------------------------------------------------------------LKRSLGYA
A4FQ93_SACEN/204-361------------------------------------------------------------------------RARLMAIG
Q3IC82_PSEHT/208-361------------------------------------------------------------------------ILVISSAL
Q2NDD6_ERYLH/264-425------------------------------------------------------------------------MKRWGWIG
Q9HNH9_HALSA/232-393------------------------------------------------------------------------YRRLVAVG
Q9KFW4_BACHD/1-165------------------------------------------------------------------------LRRMAVVG
Q8ERW4_OCEIH/226-381------------------------------------------------------------------------LTVIWFIS
Q7N6K6_PHOLL/210-370------------------------------------------------------------------------YRNVALVL
A4ARZ9_MARSH/230-396------------------------------------------------------------------------LKKILIGS
B1YLL9_EXIS2/215-367------------------------------------------------------------------------IRLVFGAS
A6L2L4_BACV8/234-394------------------------------------------------------------------------WNKVLASS
A1WTH2_HALHL/248-410------------------------------------------------------------------------YARVVGYG
A1S3E3_SHEAM/216-369------------------------------------------------------------------------IRLLLLAL
Q9AA92_CAUCR/270-432------------------------------------------------------------------------YLLLIALG
Q0ARL9_MARMM/225-387------------------------------------------------------------------------YGILALIT
Q07YN3_SHEFN/228-381------------------------------------------------------------------------WQCVFWAI
A8F9F5_BACP2/224-375------------------------------------------------------------------------YRRGWVWM
A6L9Q0_PARD8/227-389------------------------------------------------------------------------WTRTFVIG
B0T422_CAUSK/230-391------------------------------------------------------------------------YQGLIGAG
A6WB03_KINRD/147-299------------------------------------------------------------------------VAVLLALS
Q47R13_THEFY/238-395------------------------------------------------------------------------RVRLACWG
A8MJB9_ALKOO/219-378------------------------------------------------------------------------LRKMQIVS
A6TNH6_ALKMQ/249-412------------------------------------------------------------------------IKKGWKIT
Q1D7M3_MYXXD/255-425------------------------------------------------------------------------FRRLLGWG
Q6NJJ5_CORDI/212-362------------------------------------------------------------------------LYIWSGIA
A5UQH7_ROSS1/237-401------------------------------------------------------------------------ERRLPAGS
A7MLK3_CROS8/215-375------------------------------------------------------------------------YRRTGFGL
Q9KE13_BACHD/42-195------------------------------------------------------------------------FKRMLWIG
A8GC25_SERP5/223-383------------------------------------------------------------------------YRRQAAWL
Q8A424_BACTN/229-391------------------------------------------------------------------------WIKVFIIA
Q9KFA2_BACHD/226-379------------------------------------------------------------------------RRKLLAVG
Q9KEU3_BACHD/250-400------------------------------------------------------------------------HRILWIIG
A4FQT6_SACEN/171-324------------------------------------------------------------------------LGVVFGIS
A6TBN7_KLEP7/215-375------------------------------------------------------------------------YRRTGALL
Q4KHM8_PSEF5/226-387------------------------------------------------------------------------LARLLRIS
A4F774_SACEN/171-329------------------------------------------------------------------------LDRLGPH.
Q9K7D7_BACHD/224-377------------------------------------------------------------------------YRKGLLF.
A6KYE7_BACV8/229-390------------------------------------------------------------------------WVKALIIS
Q2G3S1_NOVAD/241-402------------------------------------------------------------------------LGWIAAIG
Q1IVW5_DEIGD/222-381------------------------------------------------------------------------LRRLAVWG
A4AN58_MARSH/230-392------------------------------------------------------------------------WKRTLIIG
Q9RS74_DEIRA/223-382------------------------------------------------------------------------FRRLTVFA
A3HYS5_9BACT/265-426------------------------------------------------------------------------YWLMVLIG
Q6D3N4_PECAS/227-387------------------------------------------------------------------------YRNVALWL
A5FKP0_FLAJ1/222-380------------------------------------------------------------------------LQYVCIIS
A6LGL5_PARD8/234-396------------------------------------------------------------------------LNYGALVA
Q3IPY1_NATPD/256-418------------------------------------------------------------------------YRRLLVAG
Q5YUW9_NOCFA/233-388------------------------------------------------------------------------RKRLMLLG
Q9K6N5_BACHD/237-398------------------------------------------------------------------------LKKVWLTS
Q8EL60_OCEIH/225-388------------------------------------------------------------------------LKLLSVVG
A9WKI7_CHLAA/242-404------------------------------------------------------------------------QRRLPFGG
B0RFW7_CLAMS/254-423------------------------------------------------------------------------LRTLALVG
B1HN91_LYSSC/223-376------------------------------------------------------------------------WLALALAG
B1HPE9_LYSSC/165-337------------------------------------------------------------------------IMLVTIVM
B1HRQ0_LYSSC/190-342------------------------------------------------------------------------IKWLLFVT
B1HW32_LYSSC/220-369------------------------------------------------------------------------RQKLFTIG
B1HYB2_LYSSC/222-372------------------------------------------------------------------------YKLGALL.
E3FDU1_STIAD/253-420------------------------------------------------------------------------LRRLLGWG
E3FTX2_STIAD/250-412------------------------------------------------------------------------LIRVLKGG
Q74VB6_YERPE/216-374------------------------------------------------------------------------YRRLALFL
Q7VYP4_BORPE/228-388------------------------------------------------------------------------LRAVLAVG
Q812K5_BACCR/224-376------------------------------------------------------------------------VKKIWFAT
Q81SQ3_BACAN/217-376------------------------------------------------------------------------LKKWQIIM
Q8NMY9_CORGL/70-221------------------------------------------------------------------------MGVFFAVS
Q8P7N0_XANCP/245-401------------------------------------------------------------------------FGWLRYGV
Q9PFK6_XYLFA/262-418------------------------------------------------------------------------FAWLRWGA
R5USE5_9BACE/227-387------------------------------------------------------------------------WVKALIIA
R6X5K4_9PORP/228-389------------------------------------------------------------------------WMRTLVIG
U5L4L4_9BACI/226-379------------------------------------------------------------------------YLLWGGIL
U5L6C6_9BACI/232-386------------------------------------------------------------------------AAIMFAVF

PF07779

U1HPB3_ENDPU/212-693..NQPATTLLAVN.......................GITAAVGIIAMAVVYCFVADRTLIFDKVQKVSSQRTFLQM.ITI
Q6CDI8_YARLI/311-778YVSWPVPSIQDE........................TLLTACVVIAASLAYSFFCDRTQFFGKSSKQFEASEFWVL.ILL
Q9W4P0_DROME/351-846..YVPLQQQQSYDGGRAGGGSPSN..ALSALITDYGTPMVALSLLGLILAYFYLCDRTNFFMKENKYYSEFSFWIP.VGY
F6X8U0_XENTR/294-776..NKQCDDIESGEEKKPATATPAA........SSLEILLFSLSKLGLIMAYFYFCDRANLFMKENKFYTHSSFFIP.IIY
K1QBI1_CRAGI/299-786..RAADNGIRNGRSYVTSTEKTWP........DTLYEIMLCLAKLGLIMAYTFLCDRTNFFMKENKYYTHVNFLLP.FAY
B7Q496_IXOSC/303-799..RA..DDVQCLVNGEFSLHRPAIIFGKLSLFYDLTCFNFSTLQLGLIMGYFFLCDRTNFFMKENKYYTHLNFFLP.VAY
T1INP0_STRMM/300-790..QTVNCINNSSVETKS.................WYELTTSLARLGIIMGYFFLCDRTNFFMKENKYYTHLNFFLP.FAY
H2Z694_CIOSA/175-652..PGTEEENKKNNIRTT.................IVELVSAAAKMSLILLYFYICDRTDVFMKANKHYTNTRFFLP.LLY
D6WF47_TRICA/333-815..HEYSQLPDNAHQPPATPGS.............YYNLFTSLAKMALIMSYFFLCDRTNFFMKENKYYSEFSFWLP.IGY
W5MY98_LEPOC/349-830..SRHVTDLENAEEKRPAAATSMA.........SLKVPFQSVCKLGLIMVYFYLCDRADIFMKEQKFYTHSTFFIP.LIY
G3NTP4_GASAC/295-774..LVP.PDVESLEEKKPATAAAPP.........GLTAPLQALCRMGLIMSYFYLCDRADVFMKEQKFYTHSTFFIP.LIY
E9GCH2_DAPPU/313-803..KAAVEDVESSSR......................VVVTALGKLGLIMAYFYLCDRTTFFMKENKYYSHLNFWVP.VGY
A0A0D2WR15_CAPO3/466-972..HTGGAVASGAESAFGATARARH....MLSSPNLLSVAMPVAQLGLVLVFAFLCDRTHIFPKERKIYTHFDLIAS.IGV
L2GH03_COLGN/240-722..SARTSQVMDS..........................LLAAATLVAIAVYCLLADRTHLLIKHDKHFDVPDFILPVIGL
E0VHC9_PEDHC/297-768..KSTHHQSE........................FTIIFSALAKLALIMTYFYICDRTNFFMKETKTFSQSAFWIP.IVY
F6XMQ8_CIOIN/290-767..PTNEDEVAKNKDSIHNI...............IAELTYAAAKMSLILFYFYICDRTDVFMKSNKHYTNTRFFLP.LLY
H2QUY3_PANTR/295-776..NKPCTDLESGEEKKNIINTPVS.........SLEILLQSFCKLGLIMAYFYMCDRANLFMKENKFYTHSSFFIP.IIY
T1G7I3_HELRO/252-726..KNNNKTNNNNNNQSKNMDCP..............TLISCIAKLGLILLYFFICDRTTFFMKENKYYTHVNFFLP.FTY
Q17CG6_AEDAE/303-783..YVPLSQTSTGVTPAAANSQ...............SPIIALASLAIIMAYFYLCDRTNFFMKENKYYSEFSFWIP.VGY
H3A7E5_LATCH/298-779..SKPCTDVESGEEK.PTTATPAP........ANTEILLQSLCKLGLIMAYFYLCDRANLFMKEHKFYTNSTFFVP.LIF
A0A088A578_APIME/294-775..RTEISYLRVDMENTEEANNSETIQIEQPEVQDFYTLMTSLALLSIILSYFYLCDRTNFFMKENKYYSEFSFWLP.LGY
S8EFZ6_FOMPI/324-771..TSGQPYIGDQE..........................MPAVVMSVAAALIYLADRTDFWLKEQKQFSPWVFTFL.SLL
X1WW08_ACYPI/313-776..PS...............................YVVMISLAKLGLIMIYFYICDRTNFFMKENKYYSDASFWLP.VGY

PF10129

A1R109_ARTAT/441-826--LS--GVVLGMVY.G------------------------PRI.ATELGDVV----------DGTTKRAWKLYFTALAVV
A0K1D5_ARTS2/295-678--LS--GLVLGMVY.G------------------------PKA.QDNIGEVA----------QKTGRRAGKLYVTALAVV
A2SCM7_METPP/4-366--LS--GYMAGMVY.T------------------------ARERRDGEAVMR----------EAFLRRALKIYACQAALL
A1TNJ8_ACIAC/18-379--LS--AYMAGMVY.G------------------------RTAARRGIPAMR----------QAFLRRATKIYACQAATL
Q1D6T0_MYXXD/55-417--LS--AFLVGVVY.A------------------------NKIEAADPNVLW----------RSLWQRALKVYGYHVALL
Q11B97_CHESB/2-386--LS--GLLVGMVY.A------------------------RRMLKEGYAAGA----------RKVRKRALEIYRYAAGCI
Q7CT44_AGRFC/2-385--LS--GLLIGMVY.A------------------------RKMMKYGYDAGK----------QMIWNRAMELYRYAMGLV
B2JS58_BURP8/58-406--LG--GFATATAY.A------------------------SLAKRHTEADAR----------NRFFKRSLELYRAFLVTA
Q13NS3_BURXL/7-355--LG--GFATATAY.A------------------------ALAERRNETIAR----------SRFLRRSLEIYRAFLVTA
Q1LDM8_RALME/9-370--LA--GYSAGAAY.L------------------------AMEARQGASAAS----------KRLHRRSWEIYKAFVLTG
A1B1M7_PARDP/3-363--LS--GFLVGMVW.I------------------------KVEAREGRPAAQ----------IRFLRRAAQVWLALIAGA
Q5FTQ3_GLUOX/17-367--LA--GYASYLAY.G------------------------RLIDRQGWKTGI----------HRIFGRCVRLYLYQTGMT
Q89UF3_BRADU/67-422--VV--GYGVAIIH.G------------------------RMALERGYVVAA----------TRIFRRVWRLYAAYVVLF
Q89KT4_BRADU/82-438--IS--GYTATFVF.G------------------------TMMMERGFVIGA----------TRLLRRVWQLYVAHLLLF
A4YU73_BRASO/12-368--IS--GYTASFVY.A------------------------RMMIDRGFIVGA----------TRLFKRVWQLYVAHIVLF
Q6N6S8_RHOPA/12-368--IS--GYTASFVY.A------------------------KMMLERGFIVGG----------TRLTKRVWQLYVAHIVLF
Q1QFJ8_NITHX/39-395--MS--GYMTSLVC.T------------------------NIMRRRGFVAGM----------SWLMKRVWQLYVAHIFLF
Q89VE5_BRADU/37-393--IS--GYTAAFVY.G------------------------RAMLESGVVIAT----------ARIMRRVWQIYVAHVFLF
Q6N0J3_RHOPA/44-400--IS--GYTAAFVY.G------------------------KAMTELGFVVAA----------ARILKRVWQIYVAHVFLF
Q3SWD7_NITWN/36-392--IS--GYTAALVY.G------------------------RAMRERGFIVAA----------ARILRRVWQIYVAHIVLF
Q89CC1_BRADU/15-372--IS--GYLVGWIY.G------------------------PIIAGGWFLAAL----------KRLWRRAAEMYVAHIMLF
A4YYN0_BRASO/36-389--IS--GYTCMLAY.G------------------------GAVEAQGWVTTA----------VRALRRAWEIYAAFLVLL
Q89EQ8_BRADU/32-383--LS--GLTCALSY.G------------------------KARQSGGWTGVI----------GRTLWRSWDIYVAFLLLT
Q87XJ3_PSESM/5-366--LA--GYASILAY.G------------------------RIARRDGMLVAG----------VRILRRTWVLYVVHIFLL
Q0BVC0_GRABC/14-370--LA--GYGAGLAY.G------------------------KAMDRSGWLYAA----------AECARRAWTLYIAHIFLF
A5G015_ACICJ/9-360--LA--GFAAALVY.G------------------------RKMDRAGPLSAS----------ADMLKRAWTLYIAHIFLF
B0U809_METS4/3-358--LA--GWSIGIAIRG------------------------RSGALEPAGRTL----------LRLLSRMVEVYRAQIVIT
Q2K344_RHIEC/23-378--IS--GIAVGLAY.G------------------------SRFEPGGRIKTA----------IKAARRAFTLYLAHMITT
Q2YRC8_BRUA2/6-358--IS--GMAVALAY.G------------------------SKFVSGNRLVLS----------LKMWRRASVLYITHIMTT
Q983D5_RHILO/37-389--IS--GISVALAY.G------------------------TKFRPGGRLLAT----------LKMWRRAGVLYVAHIVTT
Q3J1N1_RHOS4/11-372--MS--GIAAGLAY.S------------------------KGFWTPT.WAAA----------RKIWRRAWTLYLVHLLTT
Q11DW2_CHESB/11-364--MS--GIAVGLAY.A------------------------RPFRAGEYLKGC----------LSVWRRAGTLYVAHMVCT
Q1GGF0_RUEST/47-428--CS--GMASAIAF.G------------------------GSFQRHGWWLGT----------ARVAYRCWQVFWAHIGLF
Q169P8_ROSDO/29-397--CS--GMASAIAF.G------------------------AVFRDQGLLMGA----------ARVAFRCWQVYWAHIALF
Q0BQN1_GRABC/63-424--VS--GASCAYAF.G------------------------SVYRRAGWALGT----------ARVSLRVWQIYAAQLGLV
B0RH46_CLAMS/492-873--LS--GLVLGMVY.P------------------------MAVKKFGEMKAL----------VSILRRAFKQYIVAIAVV
B4EL00_BURCJ/18-366--LG--GFATASAY.G------------------------AIAERHGARAAQ----------RRFVRRAMQIYRAFLATS
B4ELU9_BURCJ/9-352--LG--GFATAIAY.N------------------------SLAERHDEAAAR----------QRFIRRAFEIYRAFLVTA
E3FIJ7_STIAD/5-384--LS--GLLMGQVY.G------------------------ARMKKHGYKAGA----------SKIYHRVFELYRYTAGCL
Q13QD3_BURXL/18-362--LG--GYASAAAY.T------------------------TVLAKRGESAAK----------MRFVRRCWEIYRAYLLTA
Q5LPG0_RUEPO/27-401--CS--GMASAIAF.G------------------------GAFLKRGWWMGT----------ARIAFRIWQVYWAHIGLF
Q63IA9_BURPS/14-358--LG--GFATASAF.L------------------------SVSARHGAGAAR----------RRFMRRAAQIYRAFLATS
Q6NAS6_RHOPA/6-361--IS--GYSIGFAY.G------------------------PAVRAGEMVAAT----------KRLWTRAAQLYVAHIFLF
Q92L11_RHIME/23-374--IS--GLSVGAAY.S------------------------GKFLAGGRLALT----------LKIWRRALALYVAHIMTS
Q9KQQ7_VIBCH/3-361--MS--GLLAGMVY.S------------------------RR..EYTDRQAA----------GKVWHRAFIIYKYHIAGL

PF01757

A8DMZ1_STALU/12-334--LS..QLLT.................................TLNYASLRI----------TYLTSRFKYII....LPY
Q035D4_LACC3/20-369--MT..GLVLT..............................MVYYRRQRNWP----------LFYKKRFTTVG....VPY
A8G974_SERP5/5-314--LSGYGFSL....................................KKEVSF----------KYIWGKLKNLY....ISY
Q11WN8_CYTH3/14-339--LS..GFVIYY.............................SAENKKTLTIP----------QYFKARFLRIYPVFILAC
A7LV98_BACO1/4-296--LP...FFY......................................DIKK----------EITVKRLCDIVVRNWIPY
Q97ER7_CLOAB/6-334--IS..GYFY.................................KDKYTHKPI----------TLIKKRIKTLY....IPF
A0A025FGD2_ECOLX/9-357--IS..GYFSY................................MLFLRYPLK----------KWWKVRVERVG....IPM
Q07PA2_RHOP5/14-375--VA..GFFAH................................LSFHRLGAT----------EFIYDRLKRIA....LPL
Q30BE9_ENTFL/7-326--TS..GFFL......................................ISRY----------TCNAEKLEAFIKKTTLIY
A1HPJ5_9FIRM/6-350--VSAFGLFVH...............................HNLEERFDYT----------GFMQRRLRTVL....VPY
A0A0D1E273_USTMA/127-516--LS..GRLNATSYF......................RNKALGRPIIWSVVP----------EAMVRRALRLL....IVG
A7LV97_BACO1/24-312--IS..GFFFF..............................RISYYEKNNYF----------KMLKKKAKTLL....IPF
Q1QWT8_CHRSD/4-315--VS..GYFFI................................SVIRSRSLM----------TWLKKVV........AMY
Q2T7M4_BURTA/6-373--IS..GYVLTT............................KFFTTEELPALQ----------SAAAKRYIRLGLPSFASI
A4B9D7_9GAMM/5-375--LS..GFLLSLPF........................WRAAYQAQPLPDLK----------IYLMRRFARIMPGFYVVL
Q5LBM3_BACFN/8-315--CS..GYTL.................................FLGRDMDFF----------NWYKRRINRIY....PTV
M6C4Z5_LEPBO/44-373--SS..GIFL....................................KFTNWT----------DYWKPKIFSLL....IPY
A5ZUV3_9FIRM/6-346--TT..GALM.................................LPRDYPDVS----------AFYKKSLFPLF....LTT
B2JGA6_BURP8/53-400--ISAATIMLTLEE........................ETKRFGNDRVLIAR----------RFYVKRFFRIAPLYYLAI
Q9XAP7_STRCO/24-348--LG..GTLM.................................ARSLRRPAA----------TVFRNRLRRLL....PPF
Q07KV2_RHOP5/17-343--VS..GYLMC...............................LIRPHYRSAA----------SFMYGRLMRIVPMYWIFT
Q484G4_COLP3/18-372--VS..GVAIS................................YMITKMPLK----------SFTWQRIVKLY....LPL
A0DGZ8_PARTE/156-556--LG..GFFMAFVMCE.....................TKRAKALGKNPASLF----------LVILHRLLRIWPCYIICI
A7A7L5_BIFAD/6-324--IS..AWFF......................................LDKE----------QTIKSNLKRVWI.MEREL
A3JPT3_9RHOB/10-350--IS..IFLLL..............................MALERRPRGYF----------ETLKEQARRLL....IPF
A5EMI0_BRASB/26-386--LS..GLFVW................................SGLAHKSTL----------QHLRDRLLRLG....LPF
A4FKM9_SACEN/20-347--IS..GYFAC................................VTIGRGPVL----------RYWWGRVARLL....PPF
A7V903_BACUN/5-297--IS..GYLA....................................NNRKDA----------RSFLRKFLWIF....IPY
Q8IG66_CAEEL/330-720--LS..ACVASYSIRKK...................ILFRGSSSNFSIIKCL----------ALLGHRCLRLLPALSLYL
Q7UES3_RHOBA/12-486--LS..GFFTM................................MLYRRRGMS----------KLIEHRILRIA....IPF
Q1WRZ8_LACS1/4-332--LS..GYLH....................................KDKSYS----------KIITGGFFNLL....LPY
Q8PXP5_METMA/13-333--SA..GFKFGFN...........................HSDELEEKDFLK----------KYFIKRFVRLY....KPY
Q6AH04_LEIXX/3-320--TV..GVSAG..............................LASRRALADGR----------GMSRSRFRYGFAIRGLLL
Q5CVD7_CRYPI/23-437--VSGRASFL...................................SSTPSLG----------VLLRKKILRLA....LPL
A0LT35_ACIC1/10-359--VG..GYANALS...........................WSRRRAERYSWL----------GWVRQRMRRLL....VPT
Q8KJJ2_RHILI/23-344--IS..GYLSS................................GAILRKSFT----------QGVGERAMQLL....LPM
Q17BV3_AEDAE/212-599--IS..GFLAAYHM.........................VGEYQQKQKVAWF----------RRIVGRYLRLT....LPL
A7F3R9_SCLS1/8-361--VT..GYVCALKPIR.....................QCRAGNQTACFSTIS----------RSAFRRVPRLV....LPT
Q144E0_BURXL/4-320--LF..GLST.................................VACLQRSRV----------HLLKSVALTVL....YPY
Q83YQ9_STRGN/5-307--LS..GYFS.....................................FNISR----------EKVKYRLKQMLLLTIASL
Q07P25_RHOP5/21-323--LT..GLNV.................................EHSLRRGAK----------PFLASKGWTIA....YPY
Q8DSB8_STRMU/14-327--IS..GYVG.......................................VDS----------PYRYSKCLSLW....LQV
A0LP70_SYNFM/14-366--LS..GFGLAYS...........................LAGSGGRPGGWN----------SWYRRRLLRLFPIYWLAH
A8H1P8_SHEPA/43-369--IS..GFLFH...............................HVFYHRWDYK----------KYMKSKTKFVF....LPY
A6E8A8_9SPHI/14-335--LS..GYLF.................................SFKKYENYK----------AFLKARVRQLL....IPY
A5VFE0_SPHWW/65-420--LS..SFVLTK............................GLVSGTPRSRAL----------AAMAKRLPRLLPLTLIGT
A5LX53_STREE/8-323--LS..GYFFR................................PVSDMKEFW----------HYAKKKTIILG....IPY
Q8P802_XANCP/22-341--LS..GWVG.................................ERFGRRAFG----------RKTVGKLARTLLIPYVSF
Q2HGI8_CHAGB/115-578--IS..GYALSLRPLTHAAT............TTTTTTTTPTTTQTAHTALT----------SLIFRRAPRLF....LPA
A6BII1_9FIRM/11-365--VN..GFLL...................................FGRGFNL----------KKHIRKTIRVA....AIA
Q9CHP8_LACLA/4-320--AT..GFLM....................................NRKELS----------AQYVLGIVPVI....ISY
A5N097_CLOK5/9-357--IS..GMALF................................YSLKQRSAG----------SIIKTRVSKIL....IPM
Q8FTN8_COREF/16-398--LS..GFLIYW............................SNSELRGMRNTL----------YYCQRRITKIYPMHLIAL
A7AZT9_RUMGN/12-318--CS..GYLFY................................RNLTWKKVT----------EKLKQRVFSLV....IPF
Q2NRT0_SODGM/9-399--LS..GFLLAHV...........................YVRGRRLREPAS----------NFWRKRLFNLYPIHIVAL
A4CKW1_ROBBH/7-342--VS..GFIFTY............................LLLRTPRNQPDN----------PRIRKGIRRGLQLVAIGY
A6FAM6_9GAMM/8-349--LSAYGLMKK..............................YAKNENKLLYI----------KFIIERVVKIYPMFLLAI
R7EJB8_9BACE/14-354--LS..GFVIGY............................AYDDRWNRMTVG----------TFFKRRIIRLHPMVIMGS
A4YYF7_BRASO/15-345--IS..GFIFFLK..........................YSALIPNGAVDGW----------TFFINRLSRLYPLHLATL
Q1D0W9_MYXXD/39-356--VA..GWAVV..............................AALGSKPTAAR----------DTYGKRVRRALLLIFLGY
Q16PV5_AEDAE/243-647--VG..GVLLAVHFL......................DFIESGPRFRWQYFI----------MGIINRYMRLFPLYFIMW
Q82ET0_STRAW/57-398--VG..GHVATKG...........................YASARARGTTYG----------RWLRSRLARLFKPVAAVL
Q4JZS0_STREE/5-327--ISGFGMFCGY............................YERFKEGKIDLN----------NFYKKRYKKI.....IPF
Q7MGC8_VIBVY/15-336--IS..GYLIQ..............................PKLTSAPFVTL----------GNYAKPLLKIWLVWSALS
A6KZK8_BACV8/9-367--MT..GVLL..................................FPVRNGMS----------EFYKKRIGRIV....VPL
A4CUQ6_SYNPV/6-368--IS..GYFVP................................RSVHKKGVV----------QYLKNRLIRLG....IPF
A0A0G2MNM2_SALPT/5-319--IS..GYLF......................................FGER----------CAQPRHFLRIA....LCL
A6P1P2_9FIRM/9-341--LS..GMFLL................................DPKKSLTLP----------KLFFHHILRIF....VAL
A5FYP6_ACICJ/4-317--LS..GLVTWL............................AGHAGTPPAGWP----------GLIRARARRLL....IPF
Q7MQA5_VIBVY/5-328--IT..GALML................................SDTRPFDLP----------YYARRRLGKVL....IPF
Q5ZXE9_LEGPH/10-336--IS..GFLITQI..........................IFRNTKTQTFSLI----------KFYLNRMRRILPALMLVL
A7V3H1_BACUN/5-305--LS..GYFIN...............................PKRMRTDKIT----------TSCFSKFKHLM....VPA
Q64YD4_BACFR/4-349--VS..AFLLA................................PMKEEQTTW----------QFYRQRFLRII....PPF
A5UMZ7_METS3/7-344--LL..GLLM.................................LDRDYSDIE----------TFIKTDFVRIF....IPF
A3YY52_9SYNE/16-323--IS..GHLIG..............................RSRITNAAEVW----------RFYQRRMVRIY....PPY
A4AIT9_9ACTN/563-845--IA..GYNLAR............................FQLANRSDRRRT----------RAILAGVASIA....IPA
A5N224_CLOK5/8-329--VSGMGLTI.................................NYKKDSSYS----------EFIVKRFLKIV....PQY
E0TI88_PARBH/15-315--AS..GYFL...................................VGRDGEL----------RISLKGLSRLV....RIF
A0A072ZP69_PSEAI/5-324--IS..GVFF...................................RTEQPFG----------EMALRKADALL....KPF
A0E2L0_PARTE/17-375--IS..GFILGKKL........................LTNPNLLLSPIQSM----------LMILDRIMRIYPLYWILL
Q8A5U1_BACTN/9-318--IS..GIFF...................................KPYEGLY----------GFIIRKTNKLI....IPF
Q2C1R6_9GAMM/10-345--IS..AYFVI................................PSFERKGTR----------TFMLDKLKRLG....IPT
A7A7B8_BIFAD/5-363--VN..GALL...................................LPRKMDE----------AKHYRKTLNIV....IVV
Q4JYU7_STREE/6-318--IN..GYLL..................................LGKREITY----------LYILQKVKWIL....ITV
A9VR59_BACWK/5-346--IV..GFHLI...............................RLYTKQLVYR----------EYIYEKAAHLL....IPY
A7VGI1_9CLOT/6-345--VS..GYFMCVSAAK.....................AEERHTGISLGKETF----------GFALHKIRRILPAYLYCY
Q1QR03_NITHX/14-320--IS..GLFL.................................PLVINRDWR----------TYLDRKVVHFA....YFY
A5ZDF6_9BACE/13-326--IS..GYSNLN............................TFNKITKWRELI----------DFVKKSVIRIL....LPV
Q16FE1_AEDAE/161-554--MS..GLLMAVNFL......................SEAKKQPGFEWQFLR----------NKVVNRLIRFLPVYVLWI
Q7CTZ0_AGRFC/8-329--IS..GYLLF...............................RRGMSGFDYP----------ATIRSKSKTVL....LPF
Q8G7P7_BIFLO/17-373--VS..GRFNLTCDAGRLGSTRSSGNLPGSGSDARAGGGAGQADPSSLAPYV----------RYYYKRFISLI....VPY
A1R1G8_ARTAT/18-357--LG..GVTGLQS...........................WRRLRAHGGTGF----------DFAQLRLLRLV....RPA
A0QPG5_MYCS2/9-326--IS..GFLIT...............................SSWLRNPRLR----------DYATARVLRIFPGLWVCL
A5EXU9_DICNV/19-351--TLGVGLVY....................................SRHTSP----------KALLDRGINIL....VLG
A6LGX6_PARD8/9-311--IT..GFFL.................................QTVIDKGRF----------KGYMQKIAILTVGTNVLY
Q11WP3_CYTH3/4-324--LS..GYWVVKM..........................YKEKYILFKYPVS----------SFLSSRLLRLLPVFYINV
A6KYR5_BACV8/6-309--IS..GYFG.........................................I----------RFNTHKFFKML....VVV
Q0CZ95_ASPTN/77-482--LS..GYVLSMKPLG.....................CIQDGDYAELGRSLS----------SAVFRRWFRLY....IPV
A0T1U4_VIBCL/8-303--IS..GVSFT................................LSYKHIPYF----------AYLYKRILRLL....CPV
A3I592_9BACI/6-352--LS..GFVLFYN...........................YIQKDFTKTLIV----------RFYKKRVTQIL....IPY
A1TDU0_MYCVP/22-361--A...GVAAS..............................VQSWRPGASWG----------NWLMRRCTRLYRPVFYYL

PF07786

A1HQT7_9FIRM/5-214--LS--GVSTV--------------------------------LG.................RRPLRRGMAVF----AWG
A2SQB7_METLZ/5-231--IA--GISLV--------------------------------LSTGRETSP......VKAAKKLVIRSLYLL----CIA
A9CIY2_AGRFC/15-234--LA--GFSLF--------------------------------LAHGRGLNW..........QSFGKRFAMVA----GAA
Q28R74_JANSC/28-249--LA--GMGLW--------------------------------LAHGTGIRW..........PAFWRRFAKVA----GAA
Q8PXM0_METMA/7-237--IS--GTALS--------------------------------ISRSRALRSRSSGKPAENFTRYLERGLRLF----SMG
A4EC93_9ACTN/4-221--IA--GWMCT--------------------------------LS.................RNNIKRAAKYA----LAA
Q8U2K3_PYRFU/23-240--IS--GLSLW--------------------------------ISHSRGREI..........KRDIMRFVKLF----GLG
A7I8Y9_METB6/6-231--IV--GVSLS--------------------------------VSHARAARR...LQGRALVQKFLLRGGGIF----CCG
A6G0Y4_9DELT/12-237--IM--GFSFM--------------------------------VARDQSA............TRAARRGLVIL----GAG
A3CVR7_METMJ/5-231--LV--GLSFT--------------------------------ISYARAARR...LDGRGLALKYVRRGLTIF----GYG
Q11IW8_CHESB/30-251--LV--GFSLY--------------------------------LAHGHRFRA..........RPFLKRLGMIA----AAA
A1TRD1_ACIAC/21-249--CA--GMGQA--------------------------------LAWQQGVGW..........GRFGRRWVRIA----ACA
A2SGN2_METPP/12-230--CA--GLGQA--------------------------------VALHAGQGG..........ARFWRRWAQIA----GCA
A2STU6_METLZ/14-241--IS--GTSLI--------------------------------LRHGRMLDK....PRRAYYMAILKRGIEIM----LIG
Q2K839_RHIEC/16-243--IV--GISLA--------------------------------LSSTPTIRW..........SSFWKRFGTIA----AAA
Q251W2_DESHY/5-221--LS--GLSSG--------------------------------FS.................KHPLKNGLRVL----FFG
A0NYA1_LABAI/5-227--LA--GISLD--------------------------------FAHHTGIRW..........QAFWRRLGVIV----AAA
Q21VS3_RHOFT/16-244--CA--GLGQA--------------------------------IAVAQGQRW..........PRFWRRWAQIL----GCA
Q0FKK0_PELBH/7-221--LS--GMSLV--------------------------------LAHGAGLRW..........GAWRRRFLMIV----GAA
Q2YRW9_BRUA2/16-233--LV--GFSLV--------------------------------LAHGRGIRW..........RPMAKRLLQII----AAA
A2STU5_METLZ/19-252--IA--GVAIV--------------------------------LRYNRMLGR....PLDAYYRDIAVKALVLF----FIA
Q6SHI3_9BACT/5-214--AV--GISLV--------------------------------IAHSKQLNL..........RKFLKRLIYLG----IAA
Q0G6B2_9RHIZ/53-275--LV--GFSLI--------------------------------LAHAKGIRW..........RPFGIRLAQII----ASA
A3YBL4_9GAMM/14-227--AL--GWSCY--------------------------------LSCRNGFQW..........PSILKRKFKLF----LAA
A4FZP9_METM5/5-227--IS--GVSFN--------------------------------ISFSKKVVS.....NNLNYKHYFIRFLKLF----AVS
Q11N89_CHESB/6-227--LV--GVSLV--------------------------------LAHRETIHV..........RAFTRRLFSIT----AYA
A4J1M2_DESRM/9-218--LA--GVSCS--------------------------------LS.................KSNLKRGRNLL----FIA
Q6SGH9_9BACT/9-218--AV--GISLV--------------------------------IAYGKSFNL..........NKFIKRLALLG----LAA
A1VNB1_POLNA/5-231--TA--GLGQS--------------------------------VAVQQGQAW..........PRFWRRWAQVA----GSA
A3DGD5_CLOTH/11-220--VS--GISTA--------------------------------FS.................KNSFKRGVVVL----SAA
Q98KU6_RHILO/16-237--LV--GVSLY--------------------------------LAHGQQIRW..........NGFWKRFAMVA----GAA
A6VZM7_MARMS/12-224--AI--GWSAY--------------------------------IALGKSNN...........SSFWKRDIKLL----ISA
A1W6I8_ACISJ/12-240--CA--GLGQA--------------------------------VAWQRQVGW..........ARFARRWSQIT----ACA
Q6M0I2_METMP/11-233--IS--GVSFN--------------------------------VSFSKKVAS.....QNLTYKSYFNRFLKLS----VIA
O26882_METTH/9-227--LV--GVSLS--------------------------------LSHSR........RGVTSRRHYIIRGLKIF----LWG
Q92KE6_RHIME/23-246--LA--GYSLV--------------------------------LGQLPKLRP..........RAFAIRFAKIA----GAA
B1ZHM9_METPB/15-237--LV--GIGLV--------------------------------LANGGGVRW..........RPFLWRLARIG----GAA
Q2Y4H0_9ARCH/17-243--LV--GISLT--------------------------------LSYSRAKKK....QKKKLYLKYLKRGVKIF----SWG
O29726_ARCFU/2-207--IS--GYTLS--------------------------------VV.............KPDFSRLKRKVLKLA----ALS
Q12ZG6_METBU/7-234--VA--GISLT--------------------------------LSFSKQLEM...EQTKPKFIKYVKRGSKIF----LWG
A4BIP8_9GAMM/6-220--SV--GAGLY--------------------------------LAHYPTIRW..........RKFWWREAKIA----AGA
Q8THP4_METAC/31-261--IS--GTALS--------------------------------ISRSRALASEALGKSEENFSKYLKRGLRLL----SMG
Q46DC7_METBF/7-237--IS--GVALS--------------------------------ISHSRALNQESAGNGAENFSKYLKRGIKLY----LMG
Q2FN30_METHJ/7-229--IA--GISAH--------------------------------LKAEKTPGM......MNQFSTFFKRGGELL----LIG
Q1YI63_MOBAS/15-237--LV--GVSLV--------------------------------LANGRGIRW..........QPVGKRLLQVV----AGA
Q1B004_RUBXD/18-243--LA--GLSLT--------------------------------LSYRRAARP........TFGKYLRRGLRIF----AYG
A6FRV3_9RHOB/4-228--LA--GVSLV--------------------------------VAHAETVRW..........RAFAKRFVKLV----LAA
Q1YJ44_MOBAS/24-246--LV--GVGLV--------------------------------LAHFRYTHW..........QKFLTRLAKIV----VAA
Q26I67_FLABB/5-236--IS--GIIFT--------------------------------YLLMKSKKK...GQAPERIRKGLLRGLLLI----AIG

PF05857

A6TIJ3_KLEP7/24-240--AW--GMNLA--------------------------------R......HA----------EIRQSQLNSLW----GWA
Q5NWL3_AROAE/9-222--VL--AYNLA--------------------------------RPD..VMAR----------GTYGRTMKRLG----LFG
Q88AH9_PSESM/14-243--AI--AVNLS--------------------------------RRSAALVAP----------RVQWRYLGWLL----AFA
A6M0I9_CLOB8/13-266--TM--AEGFF--------------------------------Y.......T----------GNRKTYVKRLY----LFS
C1DKH3_AZOVD/14-243--IL--AVNLA--------------------------------RPRPEALRR----------AALARYCGWLL----AFA
A4XUI8_PSEMY/4-231--GI--AANVS--------------------------------RSHPGDLYS----------ENNFRYLSWIL----AFS
A4XH28_CALS8/24-230--QV--AAGFK--------------------------------F.......T----------SNPKRYLKRLF----IFA
A1WDN4_ACISJ/11-221--VL--AYNLA--------------------------------RPG..TLER----------GVYGRTMSRLA----VFG
C4YYW6_9RICK/13-242--FA--GYNF.--------------------------------.........----------..HDKPKTHII----IFG
Q326X1_SHIDS/32-247--VW--GLNLS--------------------------------R......HA----------HIRQPAINRLW----GWG
Q8P901_XANCP/6-212--VF--AYNLA--------------------------------Q......PG----------ADVAKLIKRLF----LWG
R5K8R7_9CLOT/9-229--LL--VEGYF--------------------------------K.......T----------RNRWRYLGTLL----VFG
R5KLN1_9CLOT/10-244--LL--VEGYR--------------------------------H.......T----------SDIRKYFIRLF----LFT
R5QZC4_9FIRM/5-243--LL--VEGFF--------------------------------H.......T----------HNLKKYILNLG----IFA

PF16401

H1Y6N2_9SPHI/12-268--AM--GAAIP--------------------------------LALVKKSA.----------VQPLWKTLLQIAQRYVLL
G8TDM1_NIAKG/23-280--SM--GAAIP--------------------------------LALHKKVKE----------GSGTAMVLYTAIRRFAGL
F0SC25_PSESL/7-264--SM--GAAIP--------------------------------LAMKKKIE.----------NSSSLNIFISIVKRFVLL
R6N358_9BACE/4-263--AM--GAAFP--------------------------------FSIGRHAEK----------GRSKLLLSYDAIKRGIQL

PF04235

Q8EH35_SHEON/199-352..VL----------------------------------------------------------STMDTLLGLT........
YXAH_BACSU/242-392..LV----------------------------------------------------------IGIGAQVLYS........
A5VFY1_SPHWW/226-385..YP----------------------------------------------------------VGLALRLIHA........
B0T5F0_CAUSK/216-381..LL----------------------------------------------------------LYAGLTLWQAPL......
Q5LBX3_BACFN/231-393..AV----------------------------------------------------------LFGPLYQLKV........
A8FJB9_BACP2/218-375..LW----------------------------------------------------------VGLPLNALVF........
Q8ZNL6_SALTY/215-375..VA----------------------------------------------------------LGLMINLPAV........
Q5Z0S5_NOCFA/200-354..VP----------------------------------------------------------AAVAAAVWQW........
Q5LAR8_BACFN/229-391..LI----------------------------------------------------------CFFPLYGLNN........
A5FKP1_FLAJ1/222-380..LV----------------------------------------------------------IAVIMGIIFY........
A6LH60_PARD8/231-393..AI----------------------------------------------------------AFGPLYQLKV........
Q2NUE2_SODGM/217-377..IP----------------------------------------------------------AGLIINLPAV........
Q5L251_GEOKA/223-378..LC----------------------------------------------------------FGLALKTIPY........
B9LP38_HALLT/238-398...V----------------------------------------------------------VGLAITVAGV........
Q5WBU3_BACSK/218-382..LS----------------------------------------------------------ISLIGALPHA........
Q5LDG8_BACFN/245-405..FL----------------------------------------------------------LGLPLSVLYA........
Q2N5U1_ERYLH/237-397..AL----------------------------------------------------------ASLPMLFLLA........
Q1D273_MYXXD/254-423..LS----------------------------------------------------------VGLVLNGGGLLLF.....
Q0RI89_FRAAA/226-396..LG----------------------------------------------------------VAIVGALPYA........
Q1GR12_SPHAL/244-406..FA----------------------------------------------------------IAVPPLVGLA........
A3HTP0_9BACT/227-391..MV----------------------------------------------------------ISNLYRVIFIF.......
Q0C162_HYPNA/232-392..LP----------------------------------------------------------AGLVGSLWGA........
Q9X356_BACAN/222-381..LC----------------------------------------------------------ISCLLSCPII........
A8FH56_BACP2/222-385..CT----------------------------------------------------------IAFLITQSST........
Q5WCD3_BACSK/239-403..FL----------------------------------------------------------AGFPLTLLEVS.......
A4GA59_HERAR/238-403..FA----------------------------------------------------------LGIPFNLAWATM......
YRKO_BACSU/224-387..ST----------------------------------------------------------IAFLITQSSI........
Q47SA7_THEFY/269-436..IP----------------------------------------------------------LGWLTGLLHA........
Q21P05_SACD2/237-402..IA----------------------------------------------------------STVICIALMAG.......
A4FQ93_SACEN/204-361..FG----------------------------------------------------------VGAPLNLLT.........
Q3IC82_PSEHT/208-361..LF----------------------------------------------------------TSLRLTTEQY........
Q2NDD6_ERYLH/264-425..LI----------------------------------------------------------VGGAISLWIA........
Q9HNH9_HALSA/232-393..GT----------------------------------------------------------VGLAVTAAGV........
Q9KFW4_BACHD/1-165..IS----------------------------------------------------------IALVGGLPLA........
Q8ERW4_OCEIH/226-381..FI----------------------------------------------------------GFIVLKLGPY........
Q7N6K6_PHOLL/210-370..IP----------------------------------------------------------LSIAVQIFSV........
A4ARZ9_MARSH/230-396..II----------------------------------------------------------LFVVSIALTALI......
B1YLL9_EXIS2/215-367..LL----------------------------------------------------------LSLPLLYPIV........
A6L2L4_BACV8/234-394..LV----------------------------------------------------------AFFPLYGLGN........
A1WTH2_HALHL/248-410..LG----------------------------------------------------------IGVPMSIVGI........
A1S3E3_SHEAM/216-369..LL----------------------------------------------------------GAVDLTLYFS........
Q9AA92_CAUCR/270-432...G----------------------------------------------------------AGLAWTGWES........
Q0ARL9_MARMM/225-387..VP----------------------------------------------------------VGWWLCHTST........
Q07YN3_SHEFN/228-381..TL----------------------------------------------------------ASLDSILSLS........
A8F9F5_BACP2/224-375..IV----------------------------------------------------------VGLALKCATF........
A6L9Q0_PARD8/227-389..VV----------------------------------------------------------CFIPLYYLSL........
B0T422_CAUSK/230-391..LG----------------------------------------------------------ALVLAGMAET........
A6WB03_KINRD/147-299..AA----------------------------------------------------------VAVPTVLAQA........
Q47R13_THEFY/238-395..LG----------------------------------------------------------VGLPLNLAT.........
A8MJB9_ALKOO/219-378..LI----------------------------------------------------------VSVLCFIPMV........
A6TNH6_ALKMQ/249-412..GA----------------------------------------------------------VGLSTTIICI........
Q1D7M3_MYXXD/255-425..LV----------------------------------------------------------AAVVGSVPGVVVTV....
Q6NJJ5_CORDI/212-362..IA----------------------------------------------------------IIIGIGIPWG........
A5UQH7_ROSS1/237-401VCLA----------------------------------------------------------VGLIANLALA........
A7MLK3_CROS8/215-375..VA----------------------------------------------------------LGVLINLPAI........
Q9KE13_BACHD/42-195..LL----------------------------------------------------------IGFPIKIATV........
A8GC25_SERP5/223-383..IP----------------------------------------------------------LSLLIQLPAV........
Q8A424_BACTN/229-391..VT----------------------------------------------------------AFFPIYGLIN........
Q9KFA2_BACHD/226-379..MY----------------------------------------------------------VGIPLNLLIF........
Q9KEU3_BACHD/250-400..FI----------------------------------------------------------IGIGGNLLAA........
A4FQT6_SACEN/171-324.VVP----------------------------------------------------------AGIGVWIQVI........
A6TBN7_KLEP7/215-375..VA----------------------------------------------------------AGMAVNLPAI........
Q4KHM8_PSEF5/226-387..LP----------------------------------------------------------LGLGGALLYG........
A4F774_SACEN/171-329..LL----------------------------------------------------------TAFVLAAAGS........
Q9K7D7_BACHD/224-377..IP----------------------------------------------------------VGVTLKALPL........
A6KYE7_BACV8/229-390..AI----------------------------------------------------------SFAPLFQLKE........
Q2G3S1_NOVAD/241-402..IL----------------------------------------------------------GGAAASVAAL........
Q1IVW5_DEIGD/222-381..LA----------------------------------------------------------VGLPLGVLLA........
A4AN58_MARSH/230-392..AT----------------------------------------------------------VFIPLFLLEK........
Q9RS74_DEIRA/223-382..LP----------------------------------------------------------LGLLLGAVLA........
A3HYS5_9BACT/265-426..YA----------------------------------------------------------VGLAINYYEM........
Q6D3N4_PECAS/227-387..IP----------------------------------------------------------LGVAINSIGV........
A5FKP0_FLAJ1/222-380..FL----------------------------------------------------------CAVVIGIGFN........
A6LGL5_PARD8/234-396..LV----------------------------------------------------------LIGLLYLLKP........
Q3IPY1_NATPD/256-418..GT----------------------------------------------------------AGLALILTGV........
Q5YUW9_NOCFA/233-388...A----------------------------------------------------------VAAPVDLAAG........
Q9K6N5_BACHD/237-398..LA----------------------------------------------------------IGLPFNLLFF........
Q8EL60_OCEIH/225-388..LT----------------------------------------------------------ISLLGALPLS........
A9WKI7_CHLAA/242-404MCLA----------------------------------------------------------IGLVANLALA........
B0RFW7_CLAMS/254-423..MP----------------------------------------------------------VSVLGALPLV........
B1HN91_LYSSC/223-376..LI----------------------------------------------------------IGITIKSLPI........
B1HPE9_LYSSC/165-337..FC----------------------------------------------------------VSIVSWLYQWHYVPTANV
B1HRQ0_LYSSC/190-342..GP----------------------------------------------------------FFIGFSLWIW........
B1HW32_LYSSC/220-369..VF----------------------------------------------------------IGIPLNLLIF........
B1HYB2_LYSSC/222-372..VP----------------------------------------------------------IGLACKSISF........
E3FDU1_STIAD/253-420..LL----------------------------------------------------------VGGVSNGATFLV......
E3FTX2_STIAD/250-412..LG----------------------------------------------------------LGLAGSALNAW.......
Q74VB6_YERPE/216-374..IS----------------------------------------------------------LSLVIQIPGV........
Q7VYP4_BORPE/228-388..LP----------------------------------------------------------LGAAGAAVYA........
Q812K5_BACCR/224-376..GL----------------------------------------------------------FSFTIKILAM........
Q81SQ3_BACAN/217-376..FV----------------------------------------------------------LTLPFWFFMV........
Q8NMY9_CORGL/70-221..AA----------------------------------------------------------IAIPTLIIQA........
Q8P7N0_XANCP/245-401..LP----------------------------------------------------------LGLALMLVSYR.......
Q9PFK6_XYLFA/262-418..WP----------------------------------------------------------LGLTAMLLSVH.......
R5USE5_9BACE/227-387..AI----------------------------------------------------------SFAPLYSLKE........
R6X5K4_9PORP/228-389..AV----------------------------------------------------------CFVPLYFITA........
U5L4L4_9BACI/226-379..AG----------------------------------------------------------AGILLKASPL........
U5L6C6_9BACI/232-386..FA----------------------------------------------------------AGLLIKLVPY........

PF07779

U1HPB3_ENDPU/212-693--VMLGGVLTVRKPGDTSAETSAKPTRATLG---------QKFLSRDQTDEW----------KGWMQFVILIYHYTGMSN
Q6CDI8_YARLI/311-778--FLVATGYSFEPQNDNS.............---------..FLNRHQTEEW----------KGWMQIIILIYHITGASK
Q9W4P0_DROME/351-846--VFALGLFFTED.SRFT.............---------.KVLNRDQTDEL----------RGWILLVVLIYYMTGAQR
F6X8U0_XENTR/294-776--ILVLGVFYNEN.TKEA.............---------.KLLNREQTDEW----------KGWMQLVILIYHISGASS
K1QBI1_CRAGI/299-786--LMILGFFFTEN.TDQT.............---------.KVLHRDQTDEW----------KGWMQLVIMIYHLTGASK
B7Q496_IXOSC/303-799--VFALGLFFTEE.TQHT.............---------.QVLHRDQTNEW----------KGWMQLIILIYHTTGASQ
T1INP0_STRMM/300-790--VFALGLFFTEE.TQLT.............---------.KVLHRDQTNEW----------KGWMQLVILIYHMTGASQ
H2Z694_CIOSA/175-652--IVFLGVFGIDA.AEKP.............---------.VFLNRNQTDEW----------KGWMQLIILIYHMTGASV
D6WF47_TRICA/333-815--VTVLGLFFTED.SKYT.............---------.KVLHRDQLNEW----------KGWMQLVILVYHITGASR
W5MY98_LEPOC/349-830--IFVLGVFYTEN.GKET.............---------.KVLNREQTDEW----------KGWMQLVILIYHISGASA
G3NTP4_GASAC/295-774--IFVLGVFYNEN.TKES.............---------.KLLNREQTDEW----------KGWMQLVILIYHVSGASA
E9GCH2_DAPPU/313-803--VFALGLFFNEE.SRST.............---------.KVLHRDQTDEW----------KGWMQLVILIYHMTGASQ
A0A0D2WR15_CAPO3/466-972--MFVAGWCTLTHVKTAP.............---------.TFLSRDQTDEW----------KGWMQIVFLIYHFLGGSS
L2GH03_COLGN/240-722--VILAGL......SLRSRPPVLSSAKGLAT---------TSFLSREQTDEW----------KGWMQAFILLYNYHAASE
E0VHC9_PEDHC/297-768--ILCVGLFFTED.SGNS.............---------.KVLHRNQTDEW----------KGWMQLVLLIYHWTGAQK
F6XMQ8_CIOIN/290-767--IVFLGIFGIDS.TKQP.............---------.VFLNRDQTDEW----------KGWMQLVILIYHVTGASV
H2QUY3_PANTR/295-776--ILVLGVFYNEN.TKET.............---------.KVLNREQTDEW----------KGWMQLVILIYHISGAST
T1G7I3_HELRO/252-726--LMILGLFFTES.TKQV.............---------.QVLNRCQTDEW----------KGWMQIVILIYHLTGASK
Q17CG6_AEDAE/303-783--VFVLGLFFTED.SKFT.............---------.KVLHRDQTDEL----------KGWMQLVILIYYMTGASH
H3A7E5_LATCH/298-779--ILMLGVFCNEN.AKES.............---------.KLLNRDQTDEW----------KGWMQLVILLYHISGASS
A0A088A578_APIME/294-775--ILALGLFFTEDRERGP.............---------.RTLNREQTDEW----------KGLMQAVVLIYHVTGAKN
S8EFZ6_FOMPI/324-771--SLAAGLSTMRQADKDL.............---------.GFLNREQTDEW----------KGWMQIAILIYHYTGASK
X1WW08_ACYPI/313-776--VFVLGLFFTEE.SRYT.............---------.KVLHRDQTDEW----------KGWMQLIILIYNLTGASI

PF10129

A1R109_ARTAT/441-826LIVYGLSLLPFI.....NAAAVTTFTDQGTGGAGRAAAGTTYDLYAGMEGLL----------------------------
A0K1D5_ARTS2/295-678VLVFALSLIPAF.....NSDVLTSFTDQGTGGAGRSGAGRTYDLYTGMQGLL----------------------------
A2SCM7_METPP/4-366LFLFTVIALIGVLA...RQDAITNL......................ISFYF----------------------------
A1TNJ8_ACIAC/18-379LFLFTVITFIGIRV...DEPAIKGL......................LTFYL----------------------------
Q1D6T0_MYXXD/55-417AFAFAVIGTLGMAT...HRPAIHNL......................LGFFH----------------------------
Q11B97_CHESB/2-386FAVVILGLILS......KSSTYWEP.....................WLWKLA----------------------------
Q7CT44_AGRFC/2-385IAVLFFRMVIP......HAPYIWYN.....................WLGMTS----------------------------
B2JS58_BURP8/58-406VLMLVVSAVMSAFSI..DAPNMATT.....................DLDDMM----------------------------
Q13NS3_BURXL/7-355ALMLLVSAALTALSI..DGPNLATT.....................DLDDLL----------------------------
Q1LDM8_RALME/9-370VLMLLFGFLLAMCKV..PAPAVRAT.....................EAPAFM----------------------------
A1B1M7_PARDP/3-363ILLALFSALLFKLQM..NHTAVWFQ.....................YARWIV----------------------------
Q5FTQ3_GLUOX/17-367LVFVWTVRQWR......HYQPLPEY.....................TIEPQL----------------------------
Q89UF3_BRADU/67-422VIYIDTIAYVASQSM..APEIIHEY.....................NISGIL----------------------------
Q89KT4_BRADU/82-438FVYLTAVHYLAHRFD..DLHLMDQF.....................NVAPLM----------------------------
A4YU73_BRASO/12-368VIYIVAISYLATRFG..VSEIIDEF.....................NVAGLV----------------------------
Q6N6S8_RHOPA/12-368VIYIVAIGYVAQRFS..DPEIINEF.....................NVAGLV----------------------------
Q1QFJ8_NITHX/39-395VLYAAMIGHIAQSYD..NPALINEF.....................NIAGLV----------------------------
Q89VE5_BRADU/37-393TIFLAEISYVATSFE..NPLYTEEM.....................GIMDFL----------------------------
Q6N0J3_RHOPA/44-400TIFLAEISYVATSFQ..NPLYSEEM.....................GILDFL----------------------------
Q3SWD7_NITWN/36-392TIFLAEISYVASSSE..NPLYTEEM.....................GILDFL----------------------------
Q89CC1_BRADU/15-372LLFTAQIARTARRFD..NPMYEHEF.....................NVFNFL----------------------------
A4YYN0_BRASO/36-389LAYAALVWVIGG.....GSRFVDET.....................NTGFLF----------------------------
Q89EQ8_BRADU/32-383LACAIVVHLAG......GGPLADKS.....................NTRILL----------------------------
Q87XJ3_PSESM/5-366TLLMGIVFVANNHVE..TRDMVQQM.....................GLEYFV----------------------------
Q0BVC0_GRABC/14-370VVFAAQVTYAAQFMD..RTDYLDEI.....................NLDVLG----------------------------
A5G015_ACICJ/9-360VLFAAQVALAAIWFA..RPQYISGV.....................GIDHLV----------------------------
B0U809_METS4/3-358ALALAMLAAAALLLD..NPLLLEWH.....................NAGPVF----------------------------
Q2K344_RHIEC/23-378FMTLALFICGAWLFH..RPGLLVEI.....................NILAVL----------------------------
Q2YRC8_BRUA2/6-358MATIAIFAAAAIFLK..RSELLTQI.....................NIAPLI----------------------------
Q983D5_RHILO/37-389MVVIALFCTVAVLTR..RPELLKLI.....................NIEPLM----------------------------
Q3J1N1_RHOS4/11-372FWAIAISAAFALWFA..APDLLHQN.....................QVWILF----------------------------
Q11DW2_CHESB/11-364AIAIGILAAGVVFLD..TIDVLARV.....................NFTPLL----------------------------
Q1GGF0_RUEST/47-428FFVAMSMAALDLYGG.FEKSYIGSL.....................NLRPFF----------------------------
Q169P8_ROSDO/29-397FAIAGTMVFLNSTEL.FERDYVGQL.....................NLYPFF----------------------------
Q0BQN1_GRABC/63-424MAVAALPGLLAHVTGHRHYNFVELF.....................ELYHLY----------------------------
B0RH46_CLAMS/492-873VIVFALSFVPFL.....DTDVITTFTDRGTGADGKVTTGQVYDLYPNGARLL----------------------------
B4EL00_BURCJ/18-366TLMLVVSVVLDHYGI..DAPNLALD.....................DVSVML----------------------------
B4ELU9_BURCJ/9-352GLMLLITAALNAFAI..DGPNMPTN.....................DLDGLL----------------------------
E3FIJ7_STIAD/5-384LAIIALGFLLT......ESSVYWEP.....................WLWQLA----------------------------
Q13QD3_BURXL/18-362VLTLLSGAALAALNL..NRPMIDLT.....................GWPPFA----------------------------
Q5LPG0_RUEPO/27-401FFTAMSMAALDLSGL.FEKSYVDGL.....................NLQHFF----------------------------
Q63IA9_BURPS/14-358TLMLVVSAVLDHYGI..DAPNMALD.....................DISVLL----------------------------
Q6NAS6_RHOPA/6-361LFFTAQISRAARRFD..NPMYKDEF.....................NVAQFL----------------------------
Q92L11_RHIME/23-374VVTLAIFAGGALYFG..RQELIGEI.....................NIRPIV----------------------------
Q9KQQ7_VIBCH/3-361FIAMLWFWLGSHYFA..EQVTVFGG.....................SFSNLP----------------------------

PF01757

A8DMZ1_STALU/12-334LCVGCFYCYSESRKL--GDPFWHQF---------------------WQNVVL............................
Q035D4_LACC3/20-369VLWNTLLLAGSVLLG--VGGFTIAN---------------------FWPDYL............................
A8G974_SERP5/5-314WIVLFIFVPIGIIFF--PGERYSLS---------------------PSLFLE............................
Q11WN8_CYTH3/14-339LLTYVAKSFISDEWL--DFQWISFL---------------------ENICMLQDFS........................
A7LV98_BACO1/4-296FWICIACYVISSVVN--HEFNWDWS---------------------HVWAFVN...........................
Q97ER7_CLOAB/6-334IAYELIFLVLHNFFI--KFNVYHFK---------------------YYSMGDFISS........................
A0A025FGD2_ECOLX/9-357LTAIPLLTLPQFIML--QYVKGKAE---------------------SWPGLSL...........................
Q07PA2_RHOP5/14-375AAGLPILLIVFVPIF--TAAAVIKN---------------------GGQLPAP...........................
Q30BE9_ENTFL/7-326GVAILLYIPINVYNG--YFKMDNLL---------------------PNIIKD............................
A1HPJ5_9FIRM/6-350IVWSLLYMLHYTLVS--GDTQPWTP---------------------PLIYEY............................
A0A0D1E273_USTMA/127-516AVWLVIQKVECGTHA--FDQTVIAE---------------------GWLQSGNLGYPQWCNVNFNNPSPFPR........
A7LV97_BACO1/24-312IFWNIVGGGILCLYN--RAQVGDSI---------------------VNCVQQ............................
Q1QWT8_CHRSD/4-315VFWMLVYAYFWIDVP--ALTPYELL---------------------KVLRVA............................
Q2T7M4_BURTA/6-373FLAWILWRSGAIYTA--HASEIGVA---------------------GWVSSWYAGPFTFS....................
A4B9D7_9GAMM/5-375LLSFGLSITVFGSEL--NMESLMRL---------------------ATGLTFLN..........................
Q5LBM3_BACFN/8-315FTWALIAAVFFDQRY--DMPEI...---------------------..................................
M6C4Z5_LEPBO/44-373LGVSFLAACIKLQSL--PSITEYLN---------------------GILFGS............................
A5ZUV3_9FIRM/6-346EIWIFFNYIFCCVIE--HQTFNISR---------------------LLLEML............................
B2JGA6_BURP8/53-400AVYSFGNYLAAHFNT--QITAPHDV---------------------SDVLANFLF.........................
Q9XAP7_STRCO/24-348WCWGLFVVGAMLARG--WMPGWQIV---------------------YWVVPLG...........................
Q07KV2_RHOP5/17-343TLVVVAYAINPNWKL--GGSDYGVE---------------------TLTKSY............................
Q484G4_COLP3/18-372LFAIAIVVAPQSYYE--AIQKGVFE---------------------GNFWQFWSSHY.......................
A0DGZ8_PARTE/156-556MINSYILPYLGGGPR--WWSAMNYT---------------------DCAAGAFRNL........................
A7A7L5_BIFAD/6-324LFWSLILVAFYLVFD--RTDLGMKL---------------------MVKSIA............................
A3JPT3_9RHOB/10-350AFWTVFYALYSLIKA--YSYGYQDA---------------------IFNDLQSV..........................
A5EMI0_BRASB/26-386VIAALTVIPLAYYAI--ELRANPEA---------------------TFAAFW............................
A4FKM9_SACEN/20-347LAAVVLIYAVMRLFP--VDGWFDPG---------------------WGDLLANLL.........................
A7V903_BACUN/5-297ACMEAAYTVMSHFLP--VRESVDAI---------------------TPTVLL............................
Q8IG66_CAEEL/330-720LFMGLVYNHLADGPF--WNANGMFG---------------------TECNVTTIWP........................
Q7UES3_RHOBA/12-486VIGMSTIIPSIWIVA--GHIQANPS---------------------ANVTVFDETDLLIPGVQDDLAAVEKALAAGADVN
Q1WRZ8_LACS1/4-332IFTSFIMIMLTAVSL--HFHPIYLG---------------------RIADSTRYAALAAL....................
Q8PXP5_METMA/13-333IGYSLLISVPLFFVT--YISVYYLN---------------------LDYKGLNIFWED......................
Q6AH04_LEIXX/3-320IALGILVGLFGAQVY--PILHYCGA---------------------VCLLLL............................
Q5CVD7_CRYPI/23-437ISGYFILLPITHYVA--NGRRPCTY---------------------TLDGAPANFH........................
A0LT35_ACIC1/10-359GGYAAAIVAVVVLCR--LLGVSAAN---------------------TALAAW............................
Q8KJJ2_RHILI/23-344LFWCTLIWTLKSAVI--FPTKSLTD---------------------TLLDLS............................
Q17BV3_AEDAE/212-599IPVLIFYSVVWEHLG--SGPQWGDV---------------------VVKNANLCKHNFW.....................
A7F3R9_SCLS1/8-361TIATTIIWFLCQFGI--YKIAKRSD---------------------SWWIEATSPDITPYFGD.................
Q144E0_BURXL/4-320LLWSILQTGVQWFVA--EYRDYSLQ---------------------QMGPTR............................
Q83YQ9_STRGN/5-307IFYSIVHFIDLVLSG--ELAEKMAT---------------------IDQSDFANF.........................
Q07P25_RHOP5/21-323VLWSLIQGSIIMLLA--RDVNIPIT---------------------AHDLAA............................
Q8DSB8_STRMU/14-327FFYTLLFILFFTFLQ--KPITYHDW---------------------IQAFFP............................
A0LP70_SYNFM/14-366LIYLVSPFMDRQDPI--DFRFVLSV---------------------LGDRFY............................
A8H1P8_SHEPA/43-369LLLSLPWIVWHLTVG--TDPMMHQA---------------------LANITAPA..........................
A6E8A8_9SPHI/14-335LILNLVTYVLWLIFF--KDFDPYYY---------------------TKEPLYKQFI........................
A5VFE0_SPHWW/65-420LLPFLLFAAGLLPTQ--EAAQVSGS---------------------EWLDRSGGIKYWAPWPE.................
A5LX53_STREE/8-323VFYSIIHFCLQKVAG--ASVRVPTT---------------------IFNLLN............................
Q8P802_XANCP/22-341FLVAYGYWILSAVLN--GTSQSWAG---------------------HPWWHPFV..........................
Q2HGI8_CHAGB/115-578FASTLLITLLVASGV--YERTRAVA---------------------ADPALLRNVREPHVGFDVTDNDGGGGGGGG....
A6BII1_9FIRM/11-365IIWGVITIIFLMFIR--GEYLSAKE---------------------FLLTFW............................
Q9CHP8_LACLA/4-320IGISLLVWGVLSLVG--KGSDFSTA---------------------INGIFD............................
A5N097_CLOK5/9-357VLGCVFLNPITSYLY--GLSIGRKQ---------------------SFIEQIKLYFT.......................
Q8FTN8_COREF/16-398GMFLLASAKITASGV--QWVLDFAD---------------------LKFWLPNALL........................
A7AZT9_RUMGN/12-318LIWNFLYYILHFVAR--RIPYFGQL---------------------FDTAVPFSL.........................
Q2NRT0_SODGM/9-399LSSMLVVTLMQWLAI--PPEGPGAT---------------------IRFVVYDTNEVLGQTHPELFRHY...........
A4CKW1_ROBBH/7-342LLRTNLFGLLQGQIY--PSFYLVDV---------------------LHCIGV............................
A6FAM6_9GAMM/8-349VSYFVFMFTFNVVYN--GMGFAEWF---------------------VPLSKPLILKL.......................
R7EJB8_9BACE/14-354IVGAAFFYFQESPCF--PPIENTSI---------------------GTMLLVMLLGCTLL....................
A4YYF7_BRASO/15-345LLVAGLQAIYVAQHG--FAFVYQSN---------------------DLGHFLAQLF........................
Q1D0W9_MYXXD/39-356LVHWPGWSTVIQMGL--TERMLTKV---------------------LVFD..............................
Q16PV5_AEDAE/243-647LYQVSWFDRMGSGAT--GHSLVGVE---------------------MQLCKENGWSN.......................
Q82ET0_STRAW/57-398TLWTLAVGGLLAAGA--DFGTVHTL---------------------VKLALS............................
Q4JZS0_STREE/5-327FAFLIFIDILVERSF--SHLIEGFT---------------------EATLVF............................
Q7MGC8_VIBVY/15-336LLMPFNFQVVAEHGY--LAERQGYW---------------------GYLAQT............................
A6KZK8_BACV8/9-367IFWSVMLPVLYFIYL--NYITTTDN---------------------PTIDMSAFTLEM......................
A4CUQ6_SYNPV/6-368IFGLFIVNNISLLIG--RLSPSSPL---------------------EFLSLS............................
A0A0G2MNM2_SALPT/5-319IFYSVVALAYISLFT--SINVELSL---------------------KNVLQK............................
A6P1P2_9FIRM/9-341VVWGAVYAIVDFGRV--NGAFTWAG---------------------IRSALY............................
A5FYP6_ACICJ/4-317AVMAFAITAGKLAAA--RFIHVDNP---------------------PQGLLGGL..........................
Q7MQA5_VIBVY/5-328LFWSLFYALLSGLSA--SGFDSSKV---------------------TEVLSN............................
Q5ZXE9_LEGPH/10-336LVSSVMSYFLLLVPD--LKNYSTSL---------------------LATILSSSNIYFW.....................
A7V3H1_BACUN/5-305FSWYIIQCCLFREIP--EVKAS...---------------------..................................
Q64YD4_BACFR/4-349FIFMILYSTLPMLWG--QINGETSL---------------------TDLSRI............................
A5UMZ7_METS3/7-344LIWNTLLALLMTASA--GKLSFSFS---------------------CVVYFM............................
A3YY52_9SYNE/16-323LAALLLFDLCGLLKP--GQFIGAAL---------------------LSASFS............................
A4AIT9_9ACTN/563-845ITWIGIVTLLGTAYA--ATTVFLVN---------------------NFVGSA............................
A5N224_CLOK5/8-329VLWCILYVLIITKNF--NIYSDLSD---------------------MVYGNV............................
E0TI88_PARBH/15-315ALSCVLFLPLHFLRY--VETPIEGV---------------------GVEFLL............................
A0A072ZP69_PSEAI/5-324FVTMLGYVILRDLLR--GQPLLPDI---------------------GGVLYA............................
A0E2L0_PARTE/17-375IIYIILPKLFTNVGY--TENCMDNI---------------------AYVSTL............................
Q8A5U1_BACTN/9-318IFFYVSAFLLKYIVW--KIAPETFH---------------------LPVSWREL..........................
Q2C1R6_9GAMM/10-345LITLFLILPSGSIES--FVSNIKGF---------------------FLTGNI............................
A7A7B8_BIFAD/5-363TIWRLLAAAFFVFVD--GSHPVTLK---------------------DLVLFL............................
Q4JYU7_STREE/6-318SSWSFIVWLFKRDFT--TNPIKKIV---------------------GSLIQR............................
A9VR59_BACWK/5-346FFWSILYLLTTNDVI--TLQGGIKS---------------------LLLGTA............................
A7VGI1_9CLOT/6-345ALGLCVWFVEVGRYV--YLKEGIIG---------------------LFIAIVKMIPN.......................
Q1QR03_NITHX/14-320LLWTAIQFGFKAPHF--AAEVGWPG---------------------VIHLYL............................
A5ZDF6_9BACE/13-326VTFCVIGLTPNFI..--........---------------------..................................
Q16FE1_AEDAE/161-554LFTGSVYGILSSGPM--AYHTLKAH---------------------SLPCRNLWWAN.......................
Q7CTZ0_AGRFC/8-329LLWNGALFAVVLLVQ--LFDVGVGY---------------------FPDLWNASPR........................
Q8G7P7_BIFLO/17-373LLYAGGMGFVAYLVI--DHRSVGGA---------------------VSGTLF............................
A1R1G8_ARTAT/18-357MAVLAVMWGGLWVAL--LLGVHPAV---------------------IQLMTA............................
A0QPG5_MYCS2/9-326LIIAFVMAPIGVLLQ--GGSVSGLM---------------------SSYAPIEYVLNNAVLN..................
A5EXU9_DICNV/19-351FLLNIVRFSLPIIWD--ASLLNEPF---------------------PYVAVI............................
A6LGX6_PARD8/9-311LILGFLYGTLDALSI--KDVCLQLL---------------------GVPVWG............................
Q11WP3_CYTH3/4-324ILMIAVICFVKQQSL--HEYIRVLN---------------------PDVPFVLSH.........................
A6KYR5_BACV8/6-309WFYSIVSYLIETIWL--HTPHTWTG---------------------LASSLL............................
Q0CZ95_ASPTN/77-482ICTTICYMTVLHLFK--IRTVTELQ---------------------GSYLSELWNWYAEF....................
A0T1U4_VIBCL/8-303WIFLTVFFIIYHERS--YSTFDNIL---------------------KSYTLI............................
A3I592_9BACI/6-352LFFSVFYYAAMQFYV--THDFSLTW---------------------HALFSVE...........................
A1TDU0_MYCVP/22-361AFWAVALVVLRLLLP--VHVYEPVA---------------------GISVQL............................

PF07786

A1HQT7_9FIRM/5-214MVLTAITY....I..--YNP.QTYI-------------------------------------------------------
A2SQB7_METLZ/5-231AVITIVTW....I..--VYP.EETV-------------------------------------------------------
A9CIY2_AGRFC/15-234LLITVATY....F..--AFP.DSFI-------------------------------------------------------
Q28R74_JANSC/28-249GLVSIGTY....I..--AFP.HAFV-------------------------------------------------------
Q8PXM0_METMA/7-237LVITVITW....I..--FFP.GQYI-------------------------------------------------------
A4EC93_9ACTN/4-221LVVWLATT....L..--VSV.DDSV-------------------------------------------------------
Q8U2K3_PYRFU/23-240VLITLTTH....I..--VLD.KGTI-------------------------------------------------------
A7I8Y9_METB6/6-231LLVTVATW....W..--YLQ.EGYV-------------------------------------------------------
A6G0Y4_9DELT/12-237YLMNALKFVVPGLLG--LLP.DAFI-------------------------------------------------------
A3CVR7_METMJ/5-231LIITAVTR....L..--LLP.NVYI-------------------------------------------------------
Q11IW8_CHESB/30-251VAITAATY....I..--LFP.DSFI-------------------------------------------------------
A1TRD1_ACIAC/21-249VLVSAGSY....L..--MFP.RSYI-------------------------------------------------------
A2SGN2_METPP/12-230LLVSAGSA....L..--MFP.RSWI-------------------------------------------------------
A2STU6_METLZ/14-241LGVSVIASLLILV..--FINDGRYV-------------------------------------------------------
Q2K839_RHIEC/16-243AVISIATR....V..--AMP.DTWI-------------------------------------------------------
Q251W2_DESHY/5-221MIITLVTY....V..--TFP.EQYV-------------------------------------------------------
A0NYA1_LABAI/5-227AAVSAVTY....F..--TFG.DTFV-------------------------------------------------------
Q21VS3_RHOFT/16-244LLVTVGSW....W..--MFP.QSYI-------------------------------------------------------
Q0FKK0_PELBH/7-221GLVSLATY....A..--AFP.QRFV-------------------------------------------------------
Q2YRW9_BRUA2/16-233AAISAVTW....Y..--MTP.DSFI-------------------------------------------------------
A2STU5_METLZ/19-252MCITALTWLASVV..--IFHDDVFV-------------------------------------------------------
Q6SHI3_9BACT/5-214LLVSAGTF....V..--MFP.NGWV-------------------------------------------------------
Q0G6B2_9RHIZ/53-275LAITVVTM....V..--VTP.DSFV-------------------------------------------------------
A3YBL4_9GAMM/14-227GGISLATY....L..--AFP.QNWI-------------------------------------------------------
A4FZP9_METM5/5-227VLITIITS....R..--FLT.SGTI-------------------------------------------------------
Q11N89_CHESB/6-227MVITLVTW....F..--VFP.ESFI-------------------------------------------------------
A4J1M2_DESRM/9-218ILLTIITM....I..--AVP.GSNI-------------------------------------------------------
Q6SGH9_9BACT/9-218LLVSVGTY....I..--MFP.DAWV-------------------------------------------------------
A1VNB1_POLNA/5-231LLVSAGSY....A..--MYP.QSFI-------------------------------------------------------
A3DGD5_CLOTH/11-220LLISFVTF....I..--VGR.EYFI-------------------------------------------------------
Q98KU6_RHILO/16-237IAISVVTR....I..--ATP.DGFI-------------------------------------------------------
A6VZM7_MARMS/12-224TAISLATY....L..--TIP.NQWI-------------------------------------------------------
A1W6I8_ACISJ/12-240LLVTVGSF....L..--MFP.RSFI-------------------------------------------------------
Q6M0I2_METMP/11-233VVITAVTA....Y..--FLT.SGTI-------------------------------------------------------
O26882_METTH/9-227MVITAATW....I..--YPH.NGFI-------------------------------------------------------
Q92KE6_RHIME/23-246ALISIGTW....F..--AFP.QSFI-------------------------------------------------------
B1ZHM9_METPB/15-237LLITAATR....I..--AFP.QSYI-------------------------------------------------------
Q2Y4H0_9ARCH/17-243LLITLATW....L..--FLR.AGFV-------------------------------------------------------
O29726_ARCFU/2-207LAITAVTL....V..--FVP.EKTV-------------------------------------------------------
Q12ZG6_METBU/7-234MAITAGSY....I..--FLR.EGII-------------------------------------------------------
A4BIP8_9GAMM/6-220LIISISTL....L..--MYP.RSWV-------------------------------------------------------
Q8THP4_METAC/31-261MIITGITW....I..--FFP.GQYI-------------------------------------------------------
Q46DC7_METBF/7-237LLLTGITW....I..--FLP.EEYI-------------------------------------------------------
Q2FN30_METHJ/7-229MGITIVTW....W..--VMDGEGYV-------------------------------------------------------
Q1YI63_MOBAS/15-237LAITVATY....F..--ATP.NSFV-------------------------------------------------------
Q1B004_RUBXD/18-243MLITLAFR.......--LVD.YGYV-------------------------------------------------------
A6FRV3_9RHOB/4-228LAVSVATY....A..--MMP.GQFV-------------------------------------------------------
Q1YJ44_MOBAS/24-246AAISVVTY....G..--AFP.TSFI-------------------------------------------------------
Q26I67_FLABB/5-236YGLRAPVFEWITG..--TFR.TYFL-------------------------------------------------------

PF05857

A6TIJ3_KLEP7/24-240LVAQVSFMLIGY...--.....PWY-------------------------------------------------------
Q5NWL3_AROAE/9-222AVASVPFIALGG...--..LAFGWW-------------------------------------------------------
Q88AH9_PSESM/14-243ALSEIPYRLFMA...--.....DAT-------------------------------------------------------
A6M0I9_CLOB8/13-266IVMSLGKFISWKISV--DDPSYFPV-------------------------------------------------------
C1DKH3_AZOVD/14-243LLSEWPYRLLVD...--.....APD-------------------------------------------------------
A4XUI8_PSEMY/4-231LISEMPYRALSE...--.....MSN-------------------------------------------------------
A4XH28_CALS8/24-230LVSQIPFSLMTG...--.....DPY-------------------------------------------------------
A1WDN4_ACISJ/11-221ALASVPFVALGG...--..LYAGWW-------------------------------------------------------
C4YYW6_9RICK/13-242VLLQIYTTVLFK...--.....QFL-------------------------------------------------------
Q326X1_SHIDS/32-247IIAQFAYYLAGF...--.....PWY-------------------------------------------------------
Q8P901_XANCP/6-212LVATPIAAIAFN...--.....RAL-------------------------------------------------------
R5K8R7_9CLOT/9-229IISEVPFDMCTS...--.NVFFEPN-------------------------------------------------------
R5KLN1_9CLOT/10-244LISEVPFDLAST...--.GQVFDLQ-------------------------------------------------------
R5QZC4_9FIRM/5-243LISEPVYDLACA...--.GTLFSLG-------------------------------------------------------

PF16401

H1Y6N2_9SPHI/12-268AFFSVFTMHARSWVM--SAAPGLAD-------------------------------------------------------
G8TDM1_NIAKG/23-280VFFALFTMHARS..M--SKEPESWH-------------------------------------------------------
F0SC25_PSESL/7-264TFFALFTMHARAWVL--SSEPGLKE-------------------------------------------------------
R6N358_9BACE/4-263TFFAIFIQHFYPYVL--SSPQDLRS-------------------------------------------------------

PF04235

Q8EH35_SHEON/199-352...........QNPM--LVMFSDII-------------------------------------------------------
YXAH_BACSU/242-392...............--.VTDKEIC-------------------------------------------------------
A5VFY1_SPHWW/226-385......VLVFHNDGA--PTVVSGIV-------------------------------------------------------
B0T5F0_CAUSK/216-381..LAAAPAGGGKAMG--RQSLQWIL-------------------------------------------------------
Q5LBX3_BACFN/231-393....QLMDAGQPDMI--RQTVGVVM-------------------------------------------------------
A8FJB9_BACP2/218-375.............VP--NELVEFVV-------------------------------------------------------
Q8ZNL6_SALTY/215-375...ILQWRLDWAYRW--CAFLLQAP-------------------------------------------------------
Q5Z0S5_NOCFA/200-354...........RTPY--LELWSSPS-------------------------------------------------------
Q5LAR8_BACFN/229-391....MLPEFITRNAI--RVPLQLII-------------------------------------------------------
A5FKP1_FLAJ1/222-380.........SAIERK--AGFLQFFH-------------------------------------------------------
A6LH60_PARD8/231-393....LLMDTADSAIV--RQTAGVVL-------------------------------------------------------
Q2NUE2_SODGM/217-377...VAQWQLGWDYRW--CGFLLQMP-------------------------------------------------------
Q5L251_GEOKA/223-378...........WAAA--NDLTMYIQ-------------------------------------------------------
B9LP38_HALLT/238-398....VYIEANDWSAG--AALYWRQF-------------------------------------------------------
Q5WBU3_BACSK/218-382...LYSNQLIELPPA--LVGLTFSL-------------------------------------------------------
Q5LDG8_BACFN/245-405.......WSAVNGHP--FGTTAHTA-------------------------------------------------------
Q2N5U1_ERYLH/237-397...NWVAESGFPGVL--AGSVALVF-------------------------------------------------------
Q1D273_MYXXD/254-423RLRKAGVLEWDPKGP--WMMIVNGF-------------------------------------------------------
Q0RI89_FRAAA/226-396...FVSAGIAHVDAG--TVHRMSWL-------------------------------------------------------
Q1GR12_SPHAL/244-406...LYQMRTGYDAVS--VFGSTIAL-------------------------------------------------------
A3HTP0_9BACT/227-391...LLPDWGIYRNEF--LRPVFFKL-------------------------------------------------------
Q0C162_HYPNA/232-392...RLLLDADAMISG--QFMLGNAV-------------------------------------------------------
Q9X356_BACAN/222-381......YYFIKMDVY--YSKDVQLW-------------------------------------------------------
A8FH56_BACP2/222-385...IIVAINPFENTL--WVSIATAL-------------------------------------------------------
Q5WCD3_BACSK/239-403...IRYNLIDINPVF--TQGLAEGI-------------------------------------------------------
A4GA59_HERAR/238-403..VVAEAIDPLHPSL--YSFLLYAW-------------------------------------------------------
YRKO_BACSU/224-387...LLDMFNLSENML--WKDISSVL-------------------------------------------------------
Q47SA7_THEFY/269-436...LDHVGILSLSAE--ESVAVASI-------------------------------------------------------
Q21P05_SACD2/237-402..TFVLVGEPQFNTW--LETLALTF-------------------------------------------------------
A4FQ93_SACEN/204-361............AFG--GEQWFMVD-------------------------------------------------------
Q3IC82_PSEHT/208-361...........SSGV--FYALQELI-------------------------------------------------------
Q2NDD6_ERYLH/264-425...LWVREGGFTYYG--TQAAMVGF-------------------------------------------------------
Q9HNH9_HALSA/232-393....WYITAADWAAS--AGLLWGQF-------------------------------------------------------
Q9KFW4_BACHD/1-165...IVGAHSWELSPI--ATGLIQAI-------------------------------------------------------
Q8ERW4_OCEIH/226-381...........LFGN--PSWFSYVQ-------------------------------------------------------
Q7N6K6_PHOLL/210-370...VFQYIHNWDYFW--SGIVGYIL-------------------------------------------------------
A4ARZ9_MARSH/230-396..FMQMGENPSFSTW--PAMLGLTA-------------------------------------------------------
B1YLL9_EXIS2/215-367.......QIHQGRFP--DGLANYFF-------------------------------------------------------
A6L2L4_BACV8/234-394....MLPDFITNKSI--LTPLSLII-------------------------------------------------------
A1WTH2_HALHL/248-410...AYREWRDWELLS--GFFFSTQL-------------------------------------------------------
A1S3E3_SHEAM/216-369...........ESRA--LVNLAEIT-------------------------------------------------------
Q9AA92_CAUCR/270-432...SMKLATDFAEPQ--ATGRYNMA-------------------------------------------------------
Q0ARL9_MARMM/225-387....TTMIVGEFSTQ--AMADGNAL-------------------------------------------------------
Q07YN3_SHEFN/228-381...........GNQM--LESMSDLL-------------------------------------------------------
A8F9F5_BACP2/224-375..............I--DAPWSEFV-------------------------------------------------------
A6L9Q0_PARD8/227-389....SLPGLLERTEE--LRPMSTIV-------------------------------------------------------
B0T422_CAUSK/230-391....IYVLLPSHDWT--IRGVARWL-------------------------------------------------------
A6WB03_KINRD/147-299............SDL--AASGFSIV-------------------------------------------------------
Q47R13_THEFY/238-395............ALG--GAELFLLD-------------------------------------------------------
A8MJB9_ALKOO/219-378......KLYLESSTY--RQLDQYFF-------------------------------------------------------
A6TNH6_ALKMQ/249-412...IFGYFYLPSLMV--SSLVFGLF-------------------------------------------------------
Q1D7M3_MYXXD/255-425LMQKKVLTPETMPVW--LPLVLAPL-------------------------------------------------------
Q6NJJ5_CORDI/212-362.............LT--QSHTLTVL-------------------------------------------------------
A5UQH7_ROSS1/237-401....WQMRVTDLSSP--LAGLWSIL-------------------------------------------------------
A7MLK3_CROS8/215-375...VVQWHLGWDYRW--CAFLLQAP-------------------------------------------------------
Q9KE13_BACHD/42-195.............LS--PANLETIQ-------------------------------------------------------
A8GC25_SERP5/223-383...ALQWHLHWDYRW--SGFLLQVP-------------------------------------------------------
Q8A424_BACTN/229-391....ILPDFISREAL--LVPSVLLC-------------------------------------------------------
Q9KFA2_BACHD/226-379.............VP--GGIFDLSV-------------------------------------------------------
Q9KEU3_BACHD/250-400...............--.LSNQQLY-------------------------------------------------------
A4FQT6_SACEN/171-324.............SK--QEPTFFLI-------------------------------------------------------
A6TBN7_KLEP7/215-375...FAQWYLAWDYRW--CAFLLQAP-------------------------------------------------------
Q4KHM8_PSEF5/226-387.....YWAAYAPGGG--LEVLGYGV-------------------------------------------------------
A4F774_SACEN/171-329....VAALLWQEQDP--LSAGFTPS-------------------------------------------------------
Q9K7D7_BACHD/224-377............LFS--GIPVLGVL-------------------------------------------------------
A6KYE7_BACV8/229-390.....LIMASDSELI--RQTAGTAF-------------------------------------------------------
Q2G3S1_NOVAD/241-402...SWLAAHGWPPRA--MFGAIESG-------------------------------------------------------
Q1IVW5_DEIGD/222-381......WLNTQSTFA--AGLLAIPV-------------------------------------------------------
A4AN58_MARSH/230-392....NFAELTDVKIH--AQTLLKVV-------------------------------------------------------
Q9RS74_DEIRA/223-382......FLNTRSDLT--AGLLAIPV-------------------------------------------------------
A3HYS5_9BACT/265-426....QTILDANFSIL--SFKQADIT-------------------------------------------------------
Q6D3N4_PECAS/227-387...VGQWLVGWEYRW--SGLLLQIP-------------------------------------------------------
A5FKP0_FLAJ1/222-380.........IAIIYK--AGFLKFFH-------------------------------------------------------
A6LGL5_PARD8/234-396...YIPAASWREVSI--NAWMGATT-------------------------------------------------------
Q3IPY1_NATPD/256-418...WYREAVGWETAP--VVLLAHQF-------------------------------------------------------
Q5YUW9_NOCFA/233-388............VFV--GGDVIFLT-------------------------------------------------------
Q9K6N5_BACHD/237-398.....YSSTQSELFL--SMLAYGIG-------------------------------------------------------
Q8EL60_OCEIH/225-388....FIGSVWQPSFF--VSGLLFGL-------------------------------------------------------
A9WKI7_CHLAA/242-404....WLVMYGNLDSI--LVGLLQQL-------------------------------------------------------
B0RFW7_CLAMS/254-423...LAAVGAIAADPV--ALYLLGVL-------------------------------------------------------
B1HN91_LYSSC/223-376...........MLTR--TYLLDYLK-------------------------------------------------------
B1HPE9_LYSSC/165-337NINHLSKIQLEEHIT--NMEQFALI-------------------------------------------------------
B1HRQ0_LYSSC/190-342..........FASQA--DDQQLQSI-------------------------------------------------------
B1HW32_LYSSC/220-369.............IP--GGLFDLPV-------------------------------------------------------
B1HYB2_LYSSC/222-372..............I--ESNFSSIL-------------------------------------------------------
E3FDU1_STIAD/253-420.GQLTNAGHIPQGAP--WMFFLPTV-------------------------------------------------------
E3FTX2_STIAD/250-412..LEARLGSAVLLTP--AGLLQTAA-------------------------------------------------------
Q74VB6_YERPE/216-374...ALQVYVGWDYRW--AGFLLQVP-------------------------------------------------------
Q7VYP4_BORPE/228-388.....WSGLPGQPLG--IDLIGLGA-------------------------------------------------------
Q812K5_BACCR/224-376............FIK--HPVLIMLQ-------------------------------------------------------
Q81SQ3_BACAN/217-376......RYFLSTSSY--EPLYMQGL-------------------------------------------------------
Q8NMY9_CORGL/70-221............RDI--TSSGFSIV-------------------------------------------------------
Q8P7N0_XANCP/245-401...LEPWMDPARLDP--RLSLAFAL-------------------------------------------------------
Q9PFK6_XYLFA/262-418...LASWQDVTRVDP--RAFSAFAL-------------------------------------------------------
R5USE5_9BACE/227-387.....QIMQSDNSLI--QQTVGTAF-------------------------------------------------------
R6X5K4_9PORP/228-389....SLPDMISNKAM--LTPMNTVV-------------------------------------------------------
U5L4L4_9BACI/226-379............MVQ--ETGWTGVL-------------------------------------------------------
U5L6C6_9BACI/232-386...........MGPD--NLATEYFQ-------------------------------------------------------

PF07779

U1HPB3_ENDPU/212-693VLWVYQIIRLLVASYLFMTGYGHTI-------------------------------------------------------
Q6CDI8_YARLI/311-778ILPIYKFVRVLVAAYLFMTGFGHAT-------------------------------------------------------
Q9W4P0_DROME/351-846VLPIHMHIKLLISGYFFLTGYTHFT-------------------------------------------------------
F6X8U0_XENTR/294-776FLPVYMHVRVLVAAYLFQTGYGHFS-------------------------------------------------------
K1QBI1_CRAGI/299-786VLPIYMHIRVLVSAYLFLTGYGHFS-------------------------------------------------------
B7Q496_IXOSC/303-799VLPIYMHVRVLVTSYLFLTGYGHFT-------------------------------------------------------
T1INP0_STRMM/300-790VLPIYMNIRVLVSAYLFLSGYGHFS-------------------------------------------------------
H2Z694_CIOSA/175-652NVPIYMHIRLLVSMYLFMTGYGHFS-------------------------------------------------------
D6WF47_TRICA/333-815ILPINMHIKVLISAYLFLLGYEQFC-------------------------------------------------------
W5MY98_LEPOC/349-830FIPVYMHVRVLVAAYLFQTGYGHFS-------------------------------------------------------
G3NTP4_GASAC/295-774FLPVYMHVRVLVAAYLFQTGYGHFS-------------------------------------------------------
E9GCH2_DAPPU/313-803VIPLYMQMRVLVSSYLFLTGFGHLS-------------------------------------------------------
A0A0D2WR15_CAPO3/466-972VLPLYMLVRVFVASYLFLTGFGHFT-------------------------------------------------------
L2GH03_COLGN/240-722SLAMYKVHKFLVATYIFLSCYGHTS-------------------------------------------------------
E0VHC9_PEDHC/297-768VLPIFLLSRVIISAYVFLSGYGHFF-------------------------------------------------------
F6XMQ8_CIOIN/290-767NVPIYMHVRLLVAMYLFMTGYGHFS-------------------------------------------------------
H2QUY3_PANTR/295-776FLPVYMHIRVLVAAYLFQTGYGHFS-------------------------------------------------------
T1G7I3_HELRO/252-726VLSIYMHIRVMVSAYLFLSAYGHFV-------------------------------------------------------
Q17CG6_AEDAE/303-783VLPIYMHIKVLISGYLFLSGYSHFT-------------------------------------------------------
H3A7E5_LATCH/298-779FLPVYMHVRVLVAAYLFQTGYGHFS-------------------------------------------------------
A0A088A578_APIME/294-775VLPIYMYLRLINSAYLFLSGYGHFC-------------------------------------------------------
S8EFZ6_FOMPI/324-771ISGIYNVIRVLVAAYLFMTGYGHTT-------------------------------------------------------
X1WW08_ACYPI/313-776KTSIANHVQILISAYLFLTGYGHFY-------------------------------------------------------

PF10129

A1R109_ARTAT/441-826--------------------------------------------------------------------------------
A0K1D5_ARTS2/295-678--------------------------------------------------------------------------------
A2SCM7_METPP/4-366--------------------------------------------------------------------------------
A1TNJ8_ACIAC/18-379--------------------------------------------------------------------------------
Q1D6T0_MYXXD/55-417--------------------------------------------------------------------------------
Q11B97_CHESB/2-386--------------------------------------------------------------------------------
Q7CT44_AGRFC/2-385--------------------------------------------------------------------------------
B2JS58_BURP8/58-406--------------------------------------------------------------------------------
Q13NS3_BURXL/7-355--------------------------------------------------------------------------------
Q1LDM8_RALME/9-370--------------------------------------------------------------------------------
A1B1M7_PARDP/3-363--------------------------------------------------------------------------------
Q5FTQ3_GLUOX/17-367--------------------------------------------------------------------------------
Q89UF3_BRADU/67-422--------------------------------------------------------------------------------
Q89KT4_BRADU/82-438--------------------------------------------------------------------------------
A4YU73_BRASO/12-368--------------------------------------------------------------------------------
Q6N6S8_RHOPA/12-368--------------------------------------------------------------------------------
Q1QFJ8_NITHX/39-395--------------------------------------------------------------------------------
Q89VE5_BRADU/37-393--------------------------------------------------------------------------------
Q6N0J3_RHOPA/44-400--------------------------------------------------------------------------------
Q3SWD7_NITWN/36-392--------------------------------------------------------------------------------
Q89CC1_BRADU/15-372--------------------------------------------------------------------------------
A4YYN0_BRASO/36-389--------------------------------------------------------------------------------
Q89EQ8_BRADU/32-383--------------------------------------------------------------------------------
Q87XJ3_PSESM/5-366--------------------------------------------------------------------------------
Q0BVC0_GRABC/14-370--------------------------------------------------------------------------------
A5G015_ACICJ/9-360--------------------------------------------------------------------------------
B0U809_METS4/3-358--------------------------------------------------------------------------------
Q2K344_RHIEC/23-378--------------------------------------------------------------------------------
Q2YRC8_BRUA2/6-358--------------------------------------------------------------------------------
Q983D5_RHILO/37-389--------------------------------------------------------------------------------
Q3J1N1_RHOS4/11-372--------------------------------------------------------------------------------
Q11DW2_CHESB/11-364--------------------------------------------------------------------------------
Q1GGF0_RUEST/47-428--------------------------------------------------------------------------------
Q169P8_ROSDO/29-397--------------------------------------------------------------------------------
Q0BQN1_GRABC/63-424--------------------------------------------------------------------------------
B0RH46_CLAMS/492-873--------------------------------------------------------------------------------
B4EL00_BURCJ/18-366--------------------------------------------------------------------------------
B4ELU9_BURCJ/9-352--------------------------------------------------------------------------------
E3FIJ7_STIAD/5-384--------------------------------------------------------------------------------
Q13QD3_BURXL/18-362--------------------------------------------------------------------------------
Q5LPG0_RUEPO/27-401--------------------------------------------------------------------------------
Q63IA9_BURPS/14-358--------------------------------------------------------------------------------
Q6NAS6_RHOPA/6-361--------------------------------------------------------------------------------
Q92L11_RHIME/23-374--------------------------------------------------------------------------------
Q9KQQ7_VIBCH/3-361--------------------------------------------------------------------------------

PF01757

A8DMZ1_STALU/12-334................................................................................
Q035D4_LACC3/20-369................................................................................
A8G974_SERP5/5-314................................................................................
Q11WN8_CYTH3/14-339................................................................................
A7LV98_BACO1/4-296................................................................................
Q97ER7_CLOAB/6-334................................................................................
A0A025FGD2_ECOLX/9-357................................................................................
Q07PA2_RHOP5/14-375................................................................................
Q30BE9_ENTFL/7-326................................................................................
A1HPJ5_9FIRM/6-350................................................................................
A0A0D1E273_USTMA/127-516................................................................................
A7LV97_BACO1/24-312................................................................................
Q1QWT8_CHRSD/4-315................................................................................
Q2T7M4_BURTA/6-373................................................................................
A4B9D7_9GAMM/5-375................................................................................
Q5LBM3_BACFN/8-315................................................................................
M6C4Z5_LEPBO/44-373................................................................................
A5ZUV3_9FIRM/6-346................................................................................
B2JGA6_BURP8/53-400................................................................................
Q9XAP7_STRCO/24-348................................................................................
Q07KV2_RHOP5/17-343................................................................................
Q484G4_COLP3/18-372................................................................................
A0DGZ8_PARTE/156-556................................................................................
A7A7L5_BIFAD/6-324................................................................................
A3JPT3_9RHOB/10-350................................................................................
A5EMI0_BRASB/26-386................................................................................
A4FKM9_SACEN/20-347................................................................................
A7V903_BACUN/5-297................................................................................
Q8IG66_CAEEL/330-720................................................................................
Q7UES3_RHOBA/12-486QRSEQGDSPFLVAAFLGRDDIAEVLLDHDADPELGNHKGERPIDVMRAPWGTTEFVAGLLQIEVDREDVESGREKIAAMM
Q1WRZ8_LACS1/4-332................................................................................
Q8PXP5_METMA/13-333................................................................................
Q6AH04_LEIXX/3-320................................................................................
Q5CVD7_CRYPI/23-437................................................................................
A0LT35_ACIC1/10-359................................................................................
Q8KJJ2_RHILI/23-344................................................................................
Q17BV3_AEDAE/212-599................................................................................
A7F3R9_SCLS1/8-361................................................................................
Q144E0_BURXL/4-320................................................................................
Q83YQ9_STRGN/5-307................................................................................
Q07P25_RHOP5/21-323................................................................................
Q8DSB8_STRMU/14-327................................................................................
A0LP70_SYNFM/14-366................................................................................
A8H1P8_SHEPA/43-369................................................................................
A6E8A8_9SPHI/14-335................................................................................
A5VFE0_SPHWW/65-420................................................................................
A5LX53_STREE/8-323................................................................................
Q8P802_XANCP/22-341................................................................................
Q2HGI8_CHAGB/115-578................................................................................
A6BII1_9FIRM/11-365................................................................................
Q9CHP8_LACLA/4-320................................................................................
A5N097_CLOK5/9-357................................................................................
Q8FTN8_COREF/16-398................................................................................
A7AZT9_RUMGN/12-318................................................................................
Q2NRT0_SODGM/9-399................................................................................
A4CKW1_ROBBH/7-342................................................................................
A6FAM6_9GAMM/8-349................................................................................
R7EJB8_9BACE/14-354................................................................................
A4YYF7_BRASO/15-345................................................................................
Q1D0W9_MYXXD/39-356................................................................................
Q16PV5_AEDAE/243-647................................................................................
Q82ET0_STRAW/57-398................................................................................
Q4JZS0_STREE/5-327................................................................................
Q7MGC8_VIBVY/15-336................................................................................
A6KZK8_BACV8/9-367................................................................................
A4CUQ6_SYNPV/6-368................................................................................
A0A0G2MNM2_SALPT/5-319................................................................................
A6P1P2_9FIRM/9-341................................................................................
A5FYP6_ACICJ/4-317................................................................................
Q7MQA5_VIBVY/5-328................................................................................
Q5ZXE9_LEGPH/10-336................................................................................
A7V3H1_BACUN/5-305................................................................................
Q64YD4_BACFR/4-349................................................................................
A5UMZ7_METS3/7-344................................................................................
A3YY52_9SYNE/16-323................................................................................
A4AIT9_9ACTN/563-845................................................................................
A5N224_CLOK5/8-329................................................................................
E0TI88_PARBH/15-315................................................................................
A0A072ZP69_PSEAI/5-324................................................................................
A0E2L0_PARTE/17-375................................................................................
Q8A5U1_BACTN/9-318................................................................................
Q2C1R6_9GAMM/10-345................................................................................
A7A7B8_BIFAD/5-363................................................................................
Q4JYU7_STREE/6-318................................................................................
A9VR59_BACWK/5-346................................................................................
A7VGI1_9CLOT/6-345................................................................................
Q1QR03_NITHX/14-320................................................................................
A5ZDF6_9BACE/13-326................................................................................
Q16FE1_AEDAE/161-554................................................................................
Q7CTZ0_AGRFC/8-329................................................................................
Q8G7P7_BIFLO/17-373................................................................................
A1R1G8_ARTAT/18-357................................................................................
A0QPG5_MYCS2/9-326................................................................................
A5EXU9_DICNV/19-351................................................................................
A6LGX6_PARD8/9-311................................................................................
Q11WP3_CYTH3/4-324................................................................................
A6KYR5_BACV8/6-309................................................................................
Q0CZ95_ASPTN/77-482................................................................................
A0T1U4_VIBCL/8-303................................................................................
A3I592_9BACI/6-352................................................................................
A1TDU0_MYCVP/22-361................................................................................

PF07786

A1HQT7_9FIRM/5-214--------------------------------------------------------------------------------
A2SQB7_METLZ/5-231--------------------------------------------------------------------------------
A9CIY2_AGRFC/15-234--------------------------------------------------------------------------------
Q28R74_JANSC/28-249--------------------------------------------------------------------------------
Q8PXM0_METMA/7-237--------------------------------------------------------------------------------
A4EC93_9ACTN/4-221--------------------------------------------------------------------------------
Q8U2K3_PYRFU/23-240--------------------------------------------------------------------------------
A7I8Y9_METB6/6-231--------------------------------------------------------------------------------
A6G0Y4_9DELT/12-237--------------------------------------------------------------------------------
A3CVR7_METMJ/5-231--------------------------------------------------------------------------------
Q11IW8_CHESB/30-251--------------------------------------------------------------------------------
A1TRD1_ACIAC/21-249--------------------------------------------------------------------------------
A2SGN2_METPP/12-230--------------------------------------------------------------------------------
A2STU6_METLZ/14-241--------------------------------------------------------------------------------
Q2K839_RHIEC/16-243--------------------------------------------------------------------------------
Q251W2_DESHY/5-221--------------------------------------------------------------------------------
A0NYA1_LABAI/5-227--------------------------------------------------------------------------------
Q21VS3_RHOFT/16-244--------------------------------------------------------------------------------
Q0FKK0_PELBH/7-221--------------------------------------------------------------------------------
Q2YRW9_BRUA2/16-233--------------------------------------------------------------------------------
A2STU5_METLZ/19-252--------------------------------------------------------------------------------
Q6SHI3_9BACT/5-214--------------------------------------------------------------------------------
Q0G6B2_9RHIZ/53-275--------------------------------------------------------------------------------
A3YBL4_9GAMM/14-227--------------------------------------------------------------------------------
A4FZP9_METM5/5-227--------------------------------------------------------------------------------
Q11N89_CHESB/6-227--------------------------------------------------------------------------------
A4J1M2_DESRM/9-218--------------------------------------------------------------------------------
Q6SGH9_9BACT/9-218--------------------------------------------------------------------------------
A1VNB1_POLNA/5-231--------------------------------------------------------------------------------
A3DGD5_CLOTH/11-220--------------------------------------------------------------------------------
Q98KU6_RHILO/16-237--------------------------------------------------------------------------------
A6VZM7_MARMS/12-224--------------------------------------------------------------------------------
A1W6I8_ACISJ/12-240--------------------------------------------------------------------------------
Q6M0I2_METMP/11-233--------------------------------------------------------------------------------
O26882_METTH/9-227--------------------------------------------------------------------------------
Q92KE6_RHIME/23-246--------------------------------------------------------------------------------
B1ZHM9_METPB/15-237--------------------------------------------------------------------------------
Q2Y4H0_9ARCH/17-243--------------------------------------------------------------------------------
O29726_ARCFU/2-207--------------------------------------------------------------------------------
Q12ZG6_METBU/7-234--------------------------------------------------------------------------------
A4BIP8_9GAMM/6-220--------------------------------------------------------------------------------
Q8THP4_METAC/31-261--------------------------------------------------------------------------------
Q46DC7_METBF/7-237--------------------------------------------------------------------------------
Q2FN30_METHJ/7-229--------------------------------------------------------------------------------
Q1YI63_MOBAS/15-237--------------------------------------------------------------------------------
Q1B004_RUBXD/18-243--------------------------------------------------------------------------------
A6FRV3_9RHOB/4-228--------------------------------------------------------------------------------
Q1YJ44_MOBAS/24-246--------------------------------------------------------------------------------
Q26I67_FLABB/5-236--------------------------------------------------------------------------------

PF05857

A6TIJ3_KLEP7/24-240--------------------------------------------------------------------------------
Q5NWL3_AROAE/9-222--------------------------------------------------------------------------------
Q88AH9_PSESM/14-243--------------------------------------------------------------------------------
A6M0I9_CLOB8/13-266--------------------------------------------------------------------------------
C1DKH3_AZOVD/14-243--------------------------------------------------------------------------------
A4XUI8_PSEMY/4-231--------------------------------------------------------------------------------
A4XH28_CALS8/24-230--------------------------------------------------------------------------------
A1WDN4_ACISJ/11-221--------------------------------------------------------------------------------
C4YYW6_9RICK/13-242--------------------------------------------------------------------------------
Q326X1_SHIDS/32-247--------------------------------------------------------------------------------
Q8P901_XANCP/6-212--------------------------------------------------------------------------------
R5K8R7_9CLOT/9-229--------------------------------------------------------------------------------
R5KLN1_9CLOT/10-244--------------------------------------------------------------------------------
R5QZC4_9FIRM/5-243--------------------------------------------------------------------------------

PF16401

H1Y6N2_9SPHI/12-268--------------------------------------------------------------------------------
G8TDM1_NIAKG/23-280--------------------------------------------------------------------------------
F0SC25_PSESL/7-264--------------------------------------------------------------------------------
R6N358_9BACE/4-263--------------------------------------------------------------------------------

PF04235

Q8EH35_SHEON/199-352--------------------------------------------------------------------------------
YXAH_BACSU/242-392--------------------------------------------------------------------------------
A5VFY1_SPHWW/226-385--------------------------------------------------------------------------------
B0T5F0_CAUSK/216-381--------------------------------------------------------------------------------
Q5LBX3_BACFN/231-393--------------------------------------------------------------------------------
A8FJB9_BACP2/218-375--------------------------------------------------------------------------------
Q8ZNL6_SALTY/215-375--------------------------------------------------------------------------------
Q5Z0S5_NOCFA/200-354--------------------------------------------------------------------------------
Q5LAR8_BACFN/229-391--------------------------------------------------------------------------------
A5FKP1_FLAJ1/222-380--------------------------------------------------------------------------------
A6LH60_PARD8/231-393--------------------------------------------------------------------------------
Q2NUE2_SODGM/217-377--------------------------------------------------------------------------------
Q5L251_GEOKA/223-378--------------------------------------------------------------------------------
B9LP38_HALLT/238-398--------------------------------------------------------------------------------
Q5WBU3_BACSK/218-382--------------------------------------------------------------------------------
Q5LDG8_BACFN/245-405--------------------------------------------------------------------------------
Q2N5U1_ERYLH/237-397--------------------------------------------------------------------------------
Q1D273_MYXXD/254-423--------------------------------------------------------------------------------
Q0RI89_FRAAA/226-396--------------------------------------------------------------------------------
Q1GR12_SPHAL/244-406--------------------------------------------------------------------------------
A3HTP0_9BACT/227-391--------------------------------------------------------------------------------
Q0C162_HYPNA/232-392--------------------------------------------------------------------------------
Q9X356_BACAN/222-381--------------------------------------------------------------------------------
A8FH56_BACP2/222-385--------------------------------------------------------------------------------
Q5WCD3_BACSK/239-403--------------------------------------------------------------------------------
A4GA59_HERAR/238-403--------------------------------------------------------------------------------
YRKO_BACSU/224-387--------------------------------------------------------------------------------
Q47SA7_THEFY/269-436--------------------------------------------------------------------------------
Q21P05_SACD2/237-402--------------------------------------------------------------------------------
A4FQ93_SACEN/204-361--------------------------------------------------------------------------------
Q3IC82_PSEHT/208-361--------------------------------------------------------------------------------
Q2NDD6_ERYLH/264-425--------------------------------------------------------------------------------
Q9HNH9_HALSA/232-393--------------------------------------------------------------------------------
Q9KFW4_BACHD/1-165--------------------------------------------------------------------------------
Q8ERW4_OCEIH/226-381--------------------------------------------------------------------------------
Q7N6K6_PHOLL/210-370--------------------------------------------------------------------------------
A4ARZ9_MARSH/230-396--------------------------------------------------------------------------------
B1YLL9_EXIS2/215-367--------------------------------------------------------------------------------
A6L2L4_BACV8/234-394--------------------------------------------------------------------------------
A1WTH2_HALHL/248-410--------------------------------------------------------------------------------
A1S3E3_SHEAM/216-369--------------------------------------------------------------------------------
Q9AA92_CAUCR/270-432--------------------------------------------------------------------------------
Q0ARL9_MARMM/225-387--------------------------------------------------------------------------------
Q07YN3_SHEFN/228-381--------------------------------------------------------------------------------
A8F9F5_BACP2/224-375--------------------------------------------------------------------------------
A6L9Q0_PARD8/227-389--------------------------------------------------------------------------------
B0T422_CAUSK/230-391--------------------------------------------------------------------------------
A6WB03_KINRD/147-299--------------------------------------------------------------------------------
Q47R13_THEFY/238-395--------------------------------------------------------------------------------
A8MJB9_ALKOO/219-378--------------------------------------------------------------------------------
A6TNH6_ALKMQ/249-412--------------------------------------------------------------------------------
Q1D7M3_MYXXD/255-425--------------------------------------------------------------------------------
Q6NJJ5_CORDI/212-362--------------------------------------------------------------------------------
A5UQH7_ROSS1/237-401--------------------------------------------------------------------------------
A7MLK3_CROS8/215-375--------------------------------------------------------------------------------
Q9KE13_BACHD/42-195--------------------------------------------------------------------------------
A8GC25_SERP5/223-383--------------------------------------------------------------------------------
Q8A424_BACTN/229-391--------------------------------------------------------------------------------
Q9KFA2_BACHD/226-379--------------------------------------------------------------------------------
Q9KEU3_BACHD/250-400--------------------------------------------------------------------------------
A4FQT6_SACEN/171-324--------------------------------------------------------------------------------
A6TBN7_KLEP7/215-375--------------------------------------------------------------------------------
Q4KHM8_PSEF5/226-387--------------------------------------------------------------------------------
A4F774_SACEN/171-329--------------------------------------------------------------------------------
Q9K7D7_BACHD/224-377--------------------------------------------------------------------------------
A6KYE7_BACV8/229-390--------------------------------------------------------------------------------
Q2G3S1_NOVAD/241-402--------------------------------------------------------------------------------
Q1IVW5_DEIGD/222-381--------------------------------------------------------------------------------
A4AN58_MARSH/230-392--------------------------------------------------------------------------------
Q9RS74_DEIRA/223-382--------------------------------------------------------------------------------
A3HYS5_9BACT/265-426--------------------------------------------------------------------------------
Q6D3N4_PECAS/227-387--------------------------------------------------------------------------------
A5FKP0_FLAJ1/222-380--------------------------------------------------------------------------------
A6LGL5_PARD8/234-396--------------------------------------------------------------------------------
Q3IPY1_NATPD/256-418--------------------------------------------------------------------------------
Q5YUW9_NOCFA/233-388--------------------------------------------------------------------------------
Q9K6N5_BACHD/237-398--------------------------------------------------------------------------------
Q8EL60_OCEIH/225-388--------------------------------------------------------------------------------
A9WKI7_CHLAA/242-404--------------------------------------------------------------------------------
B0RFW7_CLAMS/254-423--------------------------------------------------------------------------------
B1HN91_LYSSC/223-376--------------------------------------------------------------------------------
B1HPE9_LYSSC/165-337--------------------------------------------------------------------------------
B1HRQ0_LYSSC/190-342--------------------------------------------------------------------------------
B1HW32_LYSSC/220-369--------------------------------------------------------------------------------
B1HYB2_LYSSC/222-372--------------------------------------------------------------------------------
E3FDU1_STIAD/253-420--------------------------------------------------------------------------------
E3FTX2_STIAD/250-412--------------------------------------------------------------------------------
Q74VB6_YERPE/216-374--------------------------------------------------------------------------------
Q7VYP4_BORPE/228-388--------------------------------------------------------------------------------
Q812K5_BACCR/224-376--------------------------------------------------------------------------------
Q81SQ3_BACAN/217-376--------------------------------------------------------------------------------
Q8NMY9_CORGL/70-221--------------------------------------------------------------------------------
Q8P7N0_XANCP/245-401--------------------------------------------------------------------------------
Q9PFK6_XYLFA/262-418--------------------------------------------------------------------------------
R5USE5_9BACE/227-387--------------------------------------------------------------------------------
R6X5K4_9PORP/228-389--------------------------------------------------------------------------------
U5L4L4_9BACI/226-379--------------------------------------------------------------------------------
U5L6C6_9BACI/232-386--------------------------------------------------------------------------------

PF07779

U1HPB3_ENDPU/212-693--------------------------------------------------------------------------------
Q6CDI8_YARLI/311-778--------------------------------------------------------------------------------
Q9W4P0_DROME/351-846--------------------------------------------------------------------------------
F6X8U0_XENTR/294-776--------------------------------------------------------------------------------
K1QBI1_CRAGI/299-786--------------------------------------------------------------------------------
B7Q496_IXOSC/303-799--------------------------------------------------------------------------------
T1INP0_STRMM/300-790--------------------------------------------------------------------------------
H2Z694_CIOSA/175-652--------------------------------------------------------------------------------
D6WF47_TRICA/333-815--------------------------------------------------------------------------------
W5MY98_LEPOC/349-830--------------------------------------------------------------------------------
G3NTP4_GASAC/295-774--------------------------------------------------------------------------------
E9GCH2_DAPPU/313-803--------------------------------------------------------------------------------
A0A0D2WR15_CAPO3/466-972--------------------------------------------------------------------------------
L2GH03_COLGN/240-722--------------------------------------------------------------------------------
E0VHC9_PEDHC/297-768--------------------------------------------------------------------------------
F6XMQ8_CIOIN/290-767--------------------------------------------------------------------------------
H2QUY3_PANTR/295-776--------------------------------------------------------------------------------
T1G7I3_HELRO/252-726--------------------------------------------------------------------------------
Q17CG6_AEDAE/303-783--------------------------------------------------------------------------------
H3A7E5_LATCH/298-779--------------------------------------------------------------------------------
A0A088A578_APIME/294-775--------------------------------------------------------------------------------
S8EFZ6_FOMPI/324-771--------------------------------------------------------------------------------
X1WW08_ACYPI/313-776--------------------------------------------------------------------------------

PF10129

A1R109_ARTAT/441-826--------------------QFPVPQGLIPALLLLQVG------------------PWQFN--------IMGL-Y-----
A0K1D5_ARTS2/295-678--------------------QFPVSGAVIPAVLLLQFG------------------PWQFN--------VMGL-Y-----
A2SCM7_METPP/4-366--------------------EQPVT..AFFSGLLLIYS------------------PPLLD--------ILPL-Y-----
A1TNJ8_ACIAC/18-379--------------------AKPLE..ALVGGLLLVYE------------------PPLLD--------ILPI-Y-----
Q1D6T0_MYXXD/55-417--------------------EDPFT..ALWSSLFLLYC------------------PPLLD--------ILPL-Y-----
Q11B97_CHESB/2-386--------------------SHDPF..YAIASLLLLYQ------------------PTYMD--------ILPQ-Y-----
Q7CT44_AGRFC/2-385--------------------FDDPL..RLAAIATFLFQ------------------PTFMD--------ILPQ-Y-----
B2JS58_BURP8/58-406--------------------DTPTA..VLRDILLFRRQ------------------PYLAS--------VLPM-Y-----
Q13NS3_BURXL/7-355--------------------DTPLA..ALRDILLFRRQ------------------PYLAS--------VLPM-Y-----
Q1LDM8_RALME/9-370--------------------AQPIE..TLFQVIGLARQ------------------PFVSD--------VLPM-Y-----
A1B1M7_PARDP/3-363--------------------EHPIG..YVATVALMWMQ------------------PNLLD--------VLAL-Y-----
Q5FTQ3_GLUOX/17-367--------------------AHGYS..GLWRILTFDAL------------------PSYLN--------ILPL-Y-----
Q89UF3_BRADU/67-422--------------------EHPLR..ILVRGLVLQEE------------------PLNLD--------LLQL-M-----
Q89KT4_BRADU/82-438--------------------DFPVE..TLSQGLVLKFK------------------PLNLD--------VLPL-Y-----
A4YU73_BRASO/12-368--------------------DHASD..TLAQGLILKFK------------------PVNLD--------VLPL-Y-----
Q6N6S8_RHOPA/12-368--------------------ANPIE..TLRQGLLLKFK------------------PVNLD--------VLPL-Y-----
Q1QFJ8_NITHX/39-395--------------------SNPFD..VLTQGLLLRFK------------------PLNMD--------VLPL-Y-----
Q89VE5_BRADU/37-393--------------------KQPDV..TIVQALLLRFR------------------PVNMD--------VLPL-Y-----
Q6N0J3_RHOPA/44-400--------------------KQPDV..TIVQALLLRFR------------------PVNMD--------VLPL-Y-----
Q3SWD7_NITWN/36-392--------------------KQPDV..TIVQALLLKFR------------------PVNMD--------VLPL-Y-----
Q89CC1_BRADU/15-372--------------------SHPDE..LIGQAIVLKYK------------------PVNLD--------VLPL-Y-----
A4YYN0_BRASO/36-389--------------------REPGP..TLVHVALLQFA------------------PVNTD--------ILLT-F-----
Q89EQ8_BRADU/32-383--------------------DQPGV..TLAHAAILQYR------------------PVNTD--------ILPL-F-----
Q87XJ3_PSESM/5-366--------------------GNPQQ..ALADELLLRFK------------------PNLTD--------PLPL-Y-----
Q0BVC0_GRABC/14-370--------------------ADPYG..ALLHVLLLHYQ------------------PAYMN--------ILPV-Y-----
A5G015_ACICJ/9-360--------------------AKPLS..AIIEAVPLLYQ------------------PAYLN--------VLPL-Y-----
B0U809_METS4/3-358--------------------TDPVQ..TTLGWVTLLHQ------------------LGFFN--------ILPL-Y-----
Q2K344_RHIEC/23-378--------------------MNLKE..GIPALLLLGHQ------------------IGYNN--------ILPM-Y-----
Q2YRC8_BRUA2/6-358--------------------KKPVE..GLFGLVTLGHQ------------------LGYNN--------ILSM-Y-----
Q983D5_RHILO/37-389--------------------KNTPE..VLVGIVTLGHQ------------------LGYNN--------ILPV-Y-----
Q3J1N1_RHOS4/11-372--------------------QKPLG..FLIGVPALTHQ------------------LGYTN--------ILPL-Y-----
Q11DW2_CHESB/11-364--------------------EQPLR..TMVGLPLLTHQ------------------LGYLN--------ILPM-Y-----
Q1GGF0_RUEST/47-428--------------------NDPAE..QIVGIFTLTYV------------------PNYFD--------ILPM-Y-----
Q169P8_ROSDO/29-397--------------------NRPEE..NLLGLLTLTYV------------------PNYFD--------ILPM-Y-----
Q0BQN1_GRABC/63-424--------------------DDPVQ..AFRGIVMLSYV------------------PGYLD--------VLPV-Y-----
B0RH46_CLAMS/492-873--------------------DYPPPWYAIRDLLLLRMG------------------PWVFN--------IMGL-F-----
B4EL00_BURCJ/18-366--------------------ASPLT..GAAELLTFQRQ------------------PYLAS--------VLPM-Y-----
B4ELU9_BURCJ/9-352--------------------HKPLA..ALRDILLFRRQ------------------PYLAS--------VLPM-Y-----
E3FIJ7_STIAD/5-384--------------------RNDWG..FALAAAALLYQ------------------PTYMD--------ILPQ-Y-----
Q13QD3_BURXL/18-362--------------------VQPLR..EALDIMLLRRQ------------------PYLSS--------VLPM-Y-----
Q5LPG0_RUEPO/27-401--------------------GDPMP..QMLGLFTLTYI------------------PNYFD--------ILPM-Y-----
Q63IA9_BURPS/14-358--------------------ASPLT..VLVELLTFKRQ------------------PYLAS--------VLPM-Y-----
Q6NAS6_RHOPA/6-361--------------------ENPDV..MIQQALLLKYK------------------PVNLD--------VLPL-Y-----
Q92L11_RHIME/23-374--------------------EQTEQ..GIVAMVLLGHQ------------------LGYNN--------ILSM-Y-----
Q9KQQ7_VIBCH/3-361--------------------TMPFM..TMLMSFLLLNK------------------PAYLE--------ILPL-Y-----

PF01757

A8DMZ1_STALU/12-334.........................--...........------------------GYWY.....--GYFILI-I.....
Q035D4_LACC3/20-369.........................--..SALLHGDQF------------------YLY......--..YVLV-T.....
A8G974_SERP5/5-314.........................--NLMGIKSTYNS------------------EWW......--..FFKL-Y.....
Q11WN8_CYTH3/14-339.....................TGKP--GVWIQPFMGNT------------------PLW......--..SLSY-E.....
A7LV98_BACO1/4-296.......................GT--QTPLLKNFGFI------------------FPW......--..FLPT-Y.....
Q97ER7_CLOAB/6-334....................AAKIL--TFHEIQSEVLG------------------QFW......--..FIKV-L.....
A0A025FGD2_ECOLX/9-357.......................YD--KYNTLAWELIS------------------HLW......--..FLLV-L.....
Q07PA2_RHOP5/14-375.......................PP--PAAILSKLSLA------------------HLW......--..FLYV-L.....
Q30BE9_ENTFL/7-326.........................--...IVFDGTLY------------------HLW......--..YLPA-S.....
A1HPJ5_9FIRM/6-350.........................--...LLFGLASY------------------QLY......--..FLVL-L.....
A0A0D1E273_USTMA/127-516....DWQISTSLGDIVVGLLRLGTN--RDYLQQLLNTS------------------MLW......--..SIVP-Q.....
A7LV97_BACO1/24-312.........................--...LFMSNWYG------------------PLW......--..YVRD-L.....
Q1QWT8_CHRSD/4-315.........................--......VMGYH------------------HLW......--..FLSA-L.....
Q2T7M4_BURTA/6-373................DVFTDGLAG--APLFSRTALNP------------------ALW......--..TIQV-E.....
A4B9D7_9GAMM/5-375......................SFH--PVTLFPVDING------------------PLWSIGFEV--VSYLFL-F.....
Q5LBM3_BACFN/8-315.........................--.......LIKG------------------GGW......--..FVSC-I.....
M6C4Z5_LEPBO/44-373.........................--........WCA------------------PYY......--..FVPL-L.....
A5ZUV3_9FIRM/6-346.........................--...FLKSSSLS------------------HMW......--..YMPV-I.....
B2JGA6_BURP8/53-400......................IHA--WLPGAVNTVVP------------------GGW......--..SIGV-E.....
Q9XAP7_STRCO/24-348.......................DP--PGSAWGEQAWE------------------ILW......--..YLRT-Y.....
Q07KV2_RHOP5/17-343........................L--VLPQSGYPILG------------------VGW......--..SLEY-E.....
Q484G4_COLP3/18-372...................FTFAWD--KRMNAPFPTYN------------------HMW......--..YVLY-L.....
A0DGZ8_PARTE/156-556.....................LFID--NFFHDWDLCFG------------------WGW......--..YLTS-D.....
A7A7L5_BIFAD/6-324.........................--......PLSMG------------------LWW......--..YATA-Y.....
A3JPT3_9RHOB/10-350......................SAW--LGYFVLGDVKY------------------HMH......--..FIQT-L.....
A5EMI0_BRASB/26-386........................W--KTVTVGPWPSG------------------PIW......--..FIWV-L.....
A4FKM9_SACEN/20-347.....................MLWN--WHPQDHPFIDG------------------SHW......--..TVPL-Q.....
A7V903_BACUN/5-297.........................--..DKIFLHPMG------------------PYW......--..YLHT-L.....
Q8IG66_CAEEL/330-720.....................HFAF--VSNFFPSTCVP------------------WLW......--..YISL-D.....
Q7UES3_RHOBA/12-486GETLSGPSSGMATDGGANAVDWKGL--MFLLFEFPATG------------------HLW......--..FLWF-LCFLVT
Q1WRZ8_LACS1/4-332................YGAGTPINN--LLGKFFIPAIG------------------AIW......--..FLLA-M.....
Q8PXP5_METMA/13-333..................LTYYKLF--YFILGENFICG------------------HLW......--..YLIT-L.....
Q6AH04_LEIXX/3-320.........................--.....PFLFVR------------------ARW......--..LAVA-A.....
Q5CVD7_CRYPI/23-437....................LYYFM--YVKDFKCHGFE------------------WLW......--..FLAL-L.....
A0LT35_ACIC1/10-359.........................--.......GVAF------------------HLW......--..FLSV-Y.....
Q8KJJ2_RHILI/23-344.........................--......TEVIG------------------TYW......--..FIWA-A.....
Q17BV3_AEDAE/212-599..................NNILFVQ--NWYPVEESCAP------------------HTF......--..QLAV-E.....
A7F3R9_SCLS1/8-361..............AVKSLLYHLIT--TWTRGWNIYDG------------------NQW......--..TLLP-L.....
Q144E0_BURXL/4-320.........................--....LAWAPVG------------------QFW......--..FLYA-L.....
Q83YQ9_STRGN/5-307.....................FFFN--SPRDLIGPAAT------------------PTW......--..YLLA-I.....
Q07P25_RHOP5/21-323.........................--....IWYQPIG------------------QFW......--..FLYA-L.....
Q8DSB8_STRMU/14-327.........................--.......IITG------------------QYW......--..YVTA-Y.....
A0LP70_SYNFM/14-366.........................--PAETVFYYLVP------------------AWW......--..FFGL-L.....
A8H1P8_SHEPA/43-369......................QAA--SWYVITGRTLT------------------AYW......--..YIPM-G.....
A6E8A8_9SPHI/14-335....................GIFYG--NGIQGYLIHSI------------------ASW......--..FIIC-L.....
A5VFE0_SPHWW/65-420.............PGLTGAAKDALH--LFASGVSQYNS------------------ALW......--..TMKY-E.....
A5LX53_STREE/8-323.........................--....IYKFPLG------------------VSW......--..YLYT-L.....
Q8P802_XANCP/22-341......................GLL--WANGSSLYVLP------------------ALW......--..FLPA-L.....
Q2HGI8_CHAGB/115-578.GSVFALAVWAWAGEMARFVHVWDW--REFGGSTVLDV------------------HLW......--..TVPV-E.....
A6BII1_9FIRM/11-365.........................--...QTRPNWTS------------------HLW......--..FLGE-L.....
Q9CHP8_LACLA/4-320.........................--......YSTDS------------------YSW......--..YVEM-Y.....
A5N097_CLOK5/9-357....................SVSRN--MEAMTTGFGPM------------------HLW......--..FLLY-L.....
Q8FTN8_COREF/16-398....................IHTWN--PDWASLSGMNV------------------PSW......--..SLAA-E.....
A7AZT9_RUMGN/12-318......................QEF--INAVFCYKYNP------------------VFW......--..FMLY-L.....
Q2NRT0_SODGM/9-399.......MDNVQLAFNSVLQLLMLQ--AWNPYFLTFNA------------------PLW......--..SLSA-L.....
A4CKW1_ROBBH/7-342.........................--...........------------------.........--..ALLL-I.....
A6FAM6_9GAMM/8-349....................SLLYN--FYPNQGLSIVG------------------PWW......--..FLSF-I.....
R7EJB8_9BACE/14-354.................PLPLKFDI--RGWTEMHPLNG------------------PAW......--..SLYY-E.....
A4YYF7_BRASO/15-345.....................MASD--WLPPTGVSFNG------------------PIW......--..SVSI-E.....
Q1D0W9_MYXXD/39-356.........................--...........------------------.........--..ALQC-I.....
Q16PV5_AEDAE/243-647....................FLFVN--NYYKFDKGCMQ------------------QTW......--..YLAA-D.....
Q82ET0_STRAW/57-398.........................--...........------------------PLW......--..FLLV-F.....
Q4JZS0_STREE/5-327........................G--LLPNNQPDVIG------------------VSW......--..TIGV-I.....
Q7MGC8_VIBVY/15-336.........................--PLNSLLEGGLV------------------HLW......--..FLPA-L.....
A6KZK8_BACV8/9-367...................TITKIW--TFIFNFNYDTT------------------PLW......--..YLYM-L.....
A4CUQ6_SYNPV/6-368.........................--...DIPFNRIG------------------VLW......--..FLLV-L.....
A0A0G2MNM2_SALPT/5-319.........................--.......PVFY------------------HLW......--..FFFA-I.....
A6P1P2_9FIRM/9-341.........................--..TALLGNTHY------------------HLW......--..FLYI-I.....
A5FYP6_ACICJ/4-317.......................AD--TIWHPLASPAY------------------SLW......--..YLAV-L.....
Q7MQA5_VIBVY/5-328.........................--...SPEHATYY------------------HLG......--..FFYY-F.....
Q5ZXE9_LEGPH/10-336..................KFINIGY--FSTDATIQQLL------------------HTW......--..SLGV-E.....
A7V3H1_BACUN/5-305.........................--.........LE------------------SYW......--..FLSC-L.....
Q64YD4_BACFR/4-349.........................--..FLNFPTLAG------------------HLW......--..FMYP-L.....
A5UMZ7_METS3/7-344.........................--......SKFMT------------------QHW......--..YAWM-L.....
A3YY52_9SYNE/16-323.........................--......LEPPL------------------TLW......--..YISM-I.....
A4AIT9_9ACTN/563-845.........................--.....EWTSQW------------------RYW......--..FLEA-LLWSML
A5N224_CLOK5/8-329.........................--.........FY------------------HFY......--..FVPL-I.....
E0TI88_PARBH/15-315.........................--......LGTNY------------------HLW......--..FLSS-L.....
A0A072ZP69_PSEAI/5-324.........................--...SVDTLPWQ------------------ALW......--..YLPH-F.....
A0E2L0_PARTE/17-375........................T--HNIFNKFGCFE------------------WSW......--..YIAV-EIQTLI
Q8A5U1_BACTN/9-318......................LFV--FHGHDLIKFNP------------------PIW......--..FLLA-L.....
Q2C1R6_9GAMM/10-345.........................--........NLG------------------VTW......--..FCWT-L.....
A7A7B8_BIFAD/5-363.........................--LGGGFGDYPTG------------------YFW......--..FMNA-L.....
Q4JYU7_STREE/6-318.........................--.......GYFF------------------QFW......--..FFGA-L.....
A9VR59_BACWK/5-346.........................--.........AP------------------HLW......--..YVIM-M.....
A7VGI1_9CLOT/6-345....................FLLLS--MSGVQGTQVVM------------------ITW......--..YISA-M.....
Q1QR03_NITHX/14-320.........................--...MSFIDPFG------------------TLW......--..FIYL-L.....
A5ZDF6_9BACE/13-326.........................--.........FS------------------PFW......--..FLNM-I.....
Q16FE1_AEDAE/161-554....................LVFVN--NLPIQDNFCMI------------------HAW......--..YLGA-D.....
Q7CTZ0_AGRFC/8-329....................EIISH--GTALEELPVNV------------------PLY......--..FLRD-L.....
Q8G7P7_BIFLO/17-373.........................--..DLFSGYDDS------------------VYW......--..FVFM-L.....
A1R1G8_ARTAT/18-357.........................--.......GAAM------------------PLW......--..FLAA-Y.....
A0QPG5_MYCS2/9-326...............VYYAGINGTP--QGIPWPGVWNG------------------SLW......--..TLVF-E.....
A5EXU9_DICNV/19-351.........................--...........------------------.TW......--..QISV-D.....
A6LGX6_PARD8/9-311.........................--..........G------------------IVW......--..YLFT-L.....
Q11WP3_CYTH3/4-324......................IFI--LGLCTTGMIIP------------------PSW......--..SLDI-E.....
A6KYR5_BACV8/6-309.........................--......PILSK------------------KYW......--..FMTC-Y.....
Q0CZ95_ASPTN/77-482.................KNFSFVLR--TGGEPWFTYNV------------------HTW......--..SIPV-E.....
A0T1U4_VIBCL/8-303.........................--.......SGIG------------------YVW......--..FIRI-I.....
A3I592_9BACI/6-352........................F--LEKLLIGKTYT------------------HLY......--..YIFI-M.....
A1TDU0_MYCVP/22-361.........................--...........------------------.LW......--..FLGA-Y.....

PF07786

A1HQT7_9FIRM/5-214----------------------------------.RFG..................ILH----------LLG.-.-----
A2SQB7_METLZ/5-231----------------------------------.VFG..................ILH----------LIG.-.-----
A9CIY2_AGRFC/15-234----------------------------------.FFG..................ILH----------NIA.-.-----
Q28R74_JANSC/28-249----------------------------------.FFG..................ILH----------SIA.-.-----
Q8PXM0_METMA/7-237----------------------------------.LFG..................ILH----------FFG.-.-----
A4EC93_9ACTN/4-221----------------------------------.NFG..................IIY----------CMAA-C-----
Q8U2K3_PYRFU/23-240----------------------------------.YFG..................ILH----------FLG.-.-----
A7I8Y9_METB6/6-231----------------------------------.IFG..................ILH----------LIG.-.-----
A6G0Y4_9DELT/12-237----------------------------------EAYGWTPPPTAGQLVTMLLTGDILQ----------LAG.-.-----
A3CVR7_METMJ/5-231----------------------------------.VFG..................ILH----------FIG.-.-----
Q11IW8_CHESB/30-251----------------------------------.FFG..................ILH----------HIA.-.-----
A1TRD1_ACIAC/21-249----------------------------------.HFG..................VLH----------GMA.-.-----
A2SGN2_METPP/12-230----------------------------------.SFG..................VLH----------GIA.-.-----
A2STU6_METLZ/14-241----------------------------------.YFN..................FLQ----------MMG.-.-----
Q2K839_RHIEC/16-243----------------------------------.YFG..................ILH----------CIA.-.-----
Q251W2_DESHY/5-221----------------------------------.RFG..................ILH----------FLG.-.-----
A0NYA1_LABAI/5-227----------------------------------.RFG..................ILH----------SIA.-.-----
Q21VS3_RHOFT/16-244----------------------------------.YFG..................VLH----------GMA.-.-----
Q0FKK0_PELBH/7-221----------------------------------.YFG..................ILH----------SIA.-.-----
Q2YRW9_BRUA2/16-233----------------------------------.FFG..................ILH----------QIA.-.-----
A2STU5_METLZ/19-252----------------------------------.KFG..................FLH----------MLS.-.-----
Q6SHI3_9BACT/5-214----------------------------------.YFG..................ILH----------LIW.-.-----
Q0G6B2_9RHIZ/53-275----------------------------------.FFG..................ILH----------HIA.-.-----
A3YBL4_9GAMM/14-227----------------------------------.FFG..................ILH----------FIF.-.-----
A4FZP9_METM5/5-227----------------------------------.YFG..................IIH----------FLA.-.-----
Q11N89_CHESB/6-227----------------------------------.FFG..................ILH----------AIA.-.-----
A4J1M2_DESRM/9-218----------------------------------.IFG..................ILH----------FLA.-.-----
Q6SGH9_9BACT/9-218----------------------------------.YFG..................ILH----------LIW.-.-----
A1VNB1_POLNA/5-231----------------------------------.YFG..................VLH----------GLA.-.-----
A3DGD5_CLOTH/11-220----------------------------------.SFG..................VLH----------LIG.-.-----
Q98KU6_RHILO/16-237----------------------------------.FFG..................ILH----------QIA.-.-----
A6VZM7_MARMS/12-224----------------------------------.YFG..................ILH----------FIF.-.-----
A1W6I8_ACISJ/12-240----------------------------------.YFG..................VLH----------GMA.-.-----
Q6M0I2_METMP/11-233----------------------------------.YFG..................IMH----------FLA.-.-----
O26882_METTH/9-227----------------------------------.VFG..................VLH----------FIG.-.-----
Q92KE6_RHIME/23-246----------------------------------.FFG..................ILH----------AIA.-.-----
B1ZHM9_METPB/15-237----------------------------------.FFG..................ILH----------CIA.-.-----
Q2Y4H0_9ARCH/17-243----------------------------------.VFG..................VLH----------LIG.-.-----
O29726_ARCFU/2-207----------------------------------.VFG..................IIH----------FFT.-.-----
Q12ZG6_METBU/7-234----------------------------------.IFG..................ALH----------FIG.-.-----
A4BIP8_9GAMM/6-220----------------------------------.WFG..................VLH----------FIT.-.-----
Q8THP4_METAC/31-261----------------------------------.LFG..................ILH----------FFG.-.-----
Q46DC7_METBF/7-237----------------------------------.VFG..................ILH----------FFG.-.-----
Q2FN30_METHJ/7-229----------------------------------.VFG..................ILH----------LIG.-.-----
Q1YI63_MOBAS/15-237----------------------------------.YFG..................ILH----------HIA.-.-----
Q1B004_RUBXD/18-243----------------------------------.IFG..................ILH----------LIG.-.-----
A6FRV3_9RHOB/4-228----------------------------------.YFG..................ILH----------AIA.-.-----
Q1YJ44_MOBAS/24-246----------------------------------.YFG..................ILH----------SIA.-.-----
Q26I67_FLABB/5-236----------------------------------.VID..................VLQ----------CIG.-.-----

PF05857

A6TIJ3_KLEP7/24-240---------------------------------------------------------------------SGNI-L-----
Q5NWL3_AROAE/9-222---------------------------------------------------------------------PLNV-L-----
Q88AH9_PSESM/14-243---------------------------------------------------------------------VLNV-M-----
A6M0I9_CLOB8/13-266---------------------------------------------------------------------SNNI-F-----
C1DKH3_AZOVD/14-243---------------------------------------------------------------------SFNV-L-----
A4XUI8_PSEMY/4-231---------------------------------------------------------------------TLNV-M-----
A4XH28_CALS8/24-230---------------------------------------------------------------------ELNV-I-----
A1WDN4_ACISJ/11-221---------------------------------------------------------------------PLNV-M-----
C4YYW6_9RICK/13-242---------------------------------------------------------------------TTNI-L-----
Q326X1_SHIDS/32-247---------------------------------------------------------------------EGNI-L-----
Q8P901_XANCP/6-212---------------------------------------------------------------------PLNI-L-----
R5K8R7_9CLOT/9-229---------------------------------------------------------------------WNNI-M-----
R5KLN1_9CLOT/10-244---------------------------------------------------------------------KQNI-F-----
R5QZC4_9FIRM/5-243---------------------------------------------------------------------QQNV-L-----

PF16401

H1Y6N2_9SPHI/12-268---------------------------------------------------------------------QLLS-I-----
G8TDM1_NIAKG/23-280---------------------------------------------------------------------YVLQ-L-----
F0SC25_PSESL/7-264---------------------------------------------------------------------NLLS-I-----
R6N358_9BACE/4-263---------------------------------------------------------------------WLLA-I-----

PF04235

Q8EH35_SHEON/199-352--------------------------------------------------------VML----------SAIP.M-----
YXAH_BACSU/242-392--------------------------------------------------------LLI----------GAPF.L-----
A5VFY1_SPHWW/226-385--------------------------------------------------------DQP----------GRLA.M-----
B0T5F0_CAUSK/216-381--------------------------------------------------------ESW----------AALS.L-----
Q5LBX3_BACFN/231-393--------------------------------------------------------DMW----------QKFA.F-----
A8FJB9_BACP2/218-375--------------------------------------------------------RYA----------FSPF.L-----
Q8ZNL6_SALTY/215-375--------------------------------------------------------REL----------SAPL.Q-----
Q5Z0S5_NOCFA/200-354--------------------------------------------------------GPV----------AALA.G-----
Q5LAR8_BACFN/229-391--------------------------------------------------------SSL----------SNLS.F-----
A5FKP1_FLAJ1/222-380--------------------------------------------------------PYF----------WFIL.S-----
A6LH60_PARD8/231-393--------------------------------------------------------DMW----------QKFA.F-----
Q2NUE2_SODGM/217-377--------------------------------------------------------REI----------SAPL.Q-----
Q5L251_GEOKA/223-378--------------------------------------------------------DSF----------GGAA.L-----
B9LP38_HALLT/238-398--------------------------------------------------------IYV----------GSFP.L-----
Q5WBU3_BACSK/218-382--------------------------------------------------------HMA----------TGIL.G-----
Q5LDG8_BACFN/245-405--------------------------------------------------------IYT----------ASVYPL-----
Q2N5U1_ERYLH/237-397--------------------------------------------------------SAP----------FDTL.L-----
Q1D273_MYXXD/254-423--------------------------------------------------------QEP----------GYIA.M-----
Q0RI89_FRAAA/226-396--------------------------------------------------------HAV----------TGEY.A-----
Q1GR12_SPHAL/244-406--------------------------------------------------------SVP----------FDTL.M-----
A3HTP0_9BACT/227-391--------------------------------------------------------MYL----------SDLA.F-----
Q0C162_HYPNA/232-392--------------------------------------------------------LMA----------FSAF.S-----
Q9X356_BACAN/222-381--------------------------------------------------------ILF----------GGKT.L-----
A8FH56_BACP2/222-385--------------------------------------------------------EQN----------GGLT.G-----
Q5WCD3_BACSK/239-403--------------------------------------------------------RML----------AGPL.Q-----
A4GA59_HERAR/238-403--------------------------------------------------------LPV----------GGTC.L-----
YRKO_BACSU/224-387--------------------------------------------------------GQN----------GGLT.G-----
Q47SA7_THEFY/269-436--------------------------------------------------------AST----------TGIA.T-----
Q21P05_SACD2/237-402--------------------------------------------------------YDL----------ANLS.L-----
A4FQ93_SACEN/204-361--------------------------------------------------------RYI----------LPPV.V-----
Q3IC82_PSEHT/208-361--------------------------------------------------------NSV----------AALC.M-----
Q2NDD6_ERYLH/264-425--------------------------------------------------------SYL----------PRLA.M-----
Q9HNH9_HALSA/232-393--------------------------------------------------------NYW----------GSVP.L-----
Q9KFW4_BACHD/1-165--------------------------------------------------------HIM----------SGIA.G-----
Q8ERW4_OCEIH/226-381--------------------------------------------------------DNI----------GGAA.S-----
Q7N6K6_PHOLL/210-370--------------------------------------------------------AEL----------VTPF.Q-----
A4ARZ9_MARSH/230-396--------------------------------------------------------YDL----------NNIA.M-----
B1YLL9_EXIS2/215-367--------------------------------------------------------VWL----------SGRT.L-----
A6L2L4_BACV8/234-394--------------------------------------------------------TSL----------SNFA.F-----
A1WTH2_HALHL/248-410--------------------------------------------------------NQL----------AVPF.V-----
A1S3E3_SHEAM/216-369--------------------------------------------------------VIF----------SAIP.V-----
Q9AA92_CAUCR/270-432--------------------------------------------------------YEF----------ASLP.I-----
Q0ARL9_MARMM/225-387--------------------------------------------------------TYV----------GSLV.L-----
Q07YN3_SHEFN/228-381--------------------------------------------------------LWF----------SAIA.T-----
A8F9F5_BACP2/224-375--------------------------------------------------------MIL----------GGYV.L-----
A6L9Q0_PARD8/227-389--------------------------------------------------------SSL----------RNFS.F-----
B0T422_CAUSK/230-391--------------------------------------------------------QSA----------TAPV.V-----
A6WB03_KINRD/147-299--------------------------------------------------------SAL----------AGLA.L-----
Q47R13_THEFY/238-395--------------------------------------------------------RYV----------AAPV.V-----
A8MJB9_ALKOO/219-378--------------------------------------------------------VWF----------SGKT.M-----
A6TNH6_ALKMQ/249-412--------------------------------------------------------YEV----------GTVF.L-----
Q1D7M3_MYXXD/255-425--------------------------------------------------------RNL----------AQVG.L-----
Q6NJJ5_CORDI/212-362--------------------------------------------------------NFS----------IGQL.S-----
A5UQH7_ROSS1/237-401--------------------------------------------------------TLI----------AGPV.L-----
A7MLK3_CROS8/215-375--------------------------------------------------------REL----------GAPL.Q-----
Q9KE13_BACHD/42-195--------------------------------------------------------III----------GGPL.V-----
A8GC25_SERP5/223-383--------------------------------------------------------REL----------GAPL.Q-----
Q8A424_BACTN/229-391--------------------------------------------------------KSL----------SNIV.F-----
Q9KFA2_BACHD/226-379--------------------------------------------------------RYL----------FAPI.L-----
Q9KEU3_BACHD/250-400--------------------------------------------------------LLI----------GAPF.L-----
A4FQT6_SACEN/171-324--------------------------------------------------------WAT----------AGLF.G-----
A6TBN7_KLEP7/215-375--------------------------------------------------------REL----------SAPL.Q-----
Q4KHM8_PSEF5/226-387--------------------------------------------------------SQL----------TAPL.L-----
A4F774_SACEN/171-329--------------------------------------------------------SAV----------AGLT.M-----
Q9K7D7_BACHD/224-377--------------------------------------------------------SLP----------GSYV.L-----
A6KYE7_BACV8/229-390--------------------------------------------------------DMW----------QKFA.F-----
Q2G3S1_NOVAD/241-402--------------------------------------------------------MAF----------PHLA.M-----
Q1IVW5_DEIGD/222-381--------------------------------------------------------RMG----------GGLA.T-----
A4AN58_MARSH/230-392--------------------------------------------------------DMY----------GNLA.L-----
Q9RS74_DEIRA/223-382--------------------------------------------------------RMA----------GGLL.S-----
A3HYS5_9BACT/265-426--------------------------------------------------------YYW----------GRFF.V-----
Q6D3N4_PECAS/227-387--------------------------------------------------------REL----------SSPL.Q-----
A5FKP0_FLAJ1/222-380--------------------------------------------------------PLY----------WLVL.S-----
A6LGL5_PARD8/234-396--------------------------------------------------------TNL----------INLM.T-----
Q3IPY1_NATPD/256-418--------------------------------------------------------NYW----------GALL.L-----
Q5YUW9_NOCFA/233-388--------------------------------------------------------RYG----------TAPL.V-----
Q9K6N5_BACHD/237-398--------------------------------------------------------VML----------GGPA.L-----
Q8EL60_OCEIH/225-388--------------------------------------------------------HIL----------TGIA.G-----
A9WKI7_CHLAA/242-404--------------------------------------------------------LLI----------AAPI.L-----
B0RFW7_CLAMS/254-423--------------------------------------------------------HGA----------TGVG.G-----
B1HN91_LYSSC/223-376--------------------------------------------------------VYI----------GGPI.L-----
B1HPE9_LYSSC/165-337--------------------------------------------------------GLQ----------FSPF.V-----
B1HRQ0_LYSSC/190-342--------------------------------------------------------IGL----------GVVP.T-----
B1HW32_LYSSC/220-369--------------------------------------------------------RYL----------CAPI.L-----
B1HYB2_LYSSC/222-372--------------------------------------------------------LMG----------GSQL.L-----
E3FDU1_STIAD/253-420--------------------------------------------------------SEL----------GSLG.L-----
E3FTX2_STIAD/250-412--------------------------------------------------------YAV----------GVAP.L-----
Q74VB6_YERPE/216-374--------------------------------------------------------REL----------GAPL.Q-----
Q7VYP4_BORPE/228-388--------------------------------------------------------GML----------TAPL.L-----
Q812K5_BACCR/224-376--------------------------------------------------------DGL----------TPVT.M-----
Q81SQ3_BACAN/217-376--------------------------------------------------------AMF----------SGKT.L-----
Q8NMY9_CORGL/70-221--------------------------------------------------------STV----------AGLA.L-----
Q8P7N0_XANCP/245-401--------------------------------------------------------ALL----------GGAM.M-----
Q9PFK6_XYLFA/262-418--------------------------------------------------------SMI----------AGLL.M-----
R5USE5_9BACE/227-387--------------------------------------------------------DMW----------QKFA.F-----
R6X5K4_9PORP/228-389--------------------------------------------------------SSF----------RNFS.F-----
U5L4L4_9BACI/226-379--------------------------------------------------------YMF----------GGNI.L-----
U5L6C6_9BACI/232-386--------------------------------------------------------DLF----------GGPL.L-----

PF07779

U1HPB3_ENDPU/212-693--------------------------------------------------------YFLKTNNFS..LQRIVSVL-----
Q6CDI8_YARLI/311-778--------------------------------------------------------FFIKRGDFS..LKRATSVL-----
Q9W4P0_DROME/351-846--------------------------------------------------------HMWQTGGSGSLFVRFFQAM-----
F6X8U0_XENTR/294-776--------------------------------------------------------YFWLKGDFG..IYRISQVL-----
K1QBI1_CRAGI/299-786--------------------------------------------------------YFWNKSDFS..VQRYCQVM-----
B7Q496_IXOSC/303-799--------------------------------------------------------YFWHNGDFG..LYRLWQML-----
T1INP0_STRMM/300-790--------------------------------------------------------YFWHKSDTS..VLRLFQVL-----
H2Z694_CIOSA/175-652--------------------------------------------------------YFWNKGDFG..LHRVFGVM-----
D6WF47_TRICA/333-815--------------------------------------------------------CVWQRGDIG..IVSFFRVL-----
W5MY98_LEPOC/349-830--------------------------------------------------------FFWLKGDFG..LNRVCQVL-----
G3NTP4_GASAC/295-774--------------------------------------------------------FFWLKGDFG..LYRVCQVL-----
E9GCH2_DAPPU/313-803--------------------------------------------------------FFWNGGTAS..FPRLFQVL-----
A0A0D2WR15_CAPO3/466-972--------------------------------------------------------FFYTKKQFG..ITRIIQVL-----
L2GH03_COLGN/240-722--------------------------------------------------------YFLRTEDFS..LRRATYVL-----
E0VHC9_PEDHC/297-768--------------------------------------------------------YYWHSGDGS..IVRFFRVL-----
F6XMQ8_CIOIN/290-767--------------------------------------------------------YFWNKGDFG..VHRVFGVM-----
H2QUY3_PANTR/295-776--------------------------------------------------------YFWIKGDFG..IHRVCQVL-----
T1G7I3_HELRO/252-726--------------------------------------------------------YFFNKNDFS..FHRLCTVL-----
Q17CG6_AEDAE/303-783--------------------------------------------------------YCWQTGNSG..IVRFLHVM-----
H3A7E5_LATCH/298-779--------------------------------------------------------YFWIKDDLG..LYRLCQIL-----
A0A088A578_APIME/294-775--------------------------------------------------------YFWQTGDVS..LIRFARVM-----
S8EFZ6_FOMPI/324-771--------------------------------------------------------FYIKKADFG..FSRIAQVM-----
X1WW08_ACYPI/313-776--------------------------------------------------------YMWHRSDAG..LTRYFQIL-----

PF10129

A1R109_ARTAT/441-826-VVLLLISPLI---------------LVALSRGFTW-----------LV-----------LTLSVGLYI--------AGS
A0K1D5_ARTS2/295-678-VIMLLVSPLI---------------LLALARGKVL-----------WV-----------LAATTALYV--------AGT
A2SCM7_METPP/4-366-VVFMVLSPLL---------------LLHGLQHGWR-----------GI-----------LALSVLLWL--------LAQ
A1TNJ8_ACIAC/18-379-VLFMLASPWV---------------MSVGLRRGWA-----------PV-----------LAVSTALWF--------LAQ
Q1D6T0_MYXXD/55-417-VVLLLLTPFI---------------LLGARKAGWT-----------RI-----------LCLSGLVWL--------SAQ
Q11B97_CHESB/2-386-IIYMLVSPPL---------------IWLCVTGRWG-----------WV-----------AATTIIVWV--------AAQ
Q7CT44_AGRFC/2-385-IVYMLFAPVL---------------VKLCLDGKWA-----------YV-----------MAGSLLVWM--------AGQ
B2JS58_BURP8/58-406-AFFAFAVPVI---------------LPLARSK.PW-----------LL-----------LAGSLAVWG--------IAP
Q13NS3_BURXL/7-355-AFFALLVPMI---------------LPLARSK.PW-----------LL-----------LAGSVALWA--------GAP
Q1LDM8_RALME/9-370-AVFIGLAPLA---------------IGWARKY.PL-----------AF-----------VCGSVALWL--------MAP
A1B1M7_PARDP/3-363-VLLIATVPVT---------------VPFMLRW.PW-----------LA-----------MAVSVLVWI--------LAQ
Q5FTQ3_GLUOX/17-367-VVLLALFPLI---------------YWVLKRS.VW-----------LL-----------LALSIGIWA--------IAN
Q89UF3_BRADU/67-422-IPLMAFFPLV---------------LWGLLRG.PN-----------LT-----------LAASVALYV--------AAR
Q89KT4_BRADU/82-438-IVLMAAFPVV---------------LWFMLRW.RN-----------AV-----------MISSFGLYL--------AAR
A4YU73_BRASO/12-368-IVLMGFFPPV---------------LWMMLRQ.PD-----------LT-----------MIASIVLWL--------LAR
Q6N6S8_RHOPA/12-368-IVLMGLFPPV---------------LWLMLRR.PD-----------AV-----------MIGSFVLYF--------AAR
Q1QFJ8_NITHX/39-395-IVLLAGILPI---------------LWLMLRL.PD-----------AT-----------MLGSLYLYL--------AAR
Q89VE5_BRADU/37-393-IVLMLALPLI---------------LWSMKWK.PD-----------VT-----------LGLSVVLYA--------VTW
Q6N0J3_RHOPA/44-400-IVLMFFLPPI---------------LWLMRRW.PD-----------IT-----------LGLATLLYA--------ATW
Q3SWD7_NITWN/36-392-VALMLFFPLV---------------LLVMQRS.AG-----------LA-----------LALSAGLYG--------LTW
Q89CC1_BRADU/15-372-IALVFASPFI---------------VWCLVRR.PN-----------LT-----------LAASVVLYV--------LSR
A4YYN0_BRASO/36-389-AILHICFPVV---------------LWLMMTS.AT-----------AT-----------LAVSFVLYM--------MVQ
Q89EQ8_BRADU/32-383-VLYHLLFAPL---------------LWLLLRA.PN-----------AT-----------LGASLLLYA--------LVH
Q87XJ3_PSESM/5-366-IVLLLTLPLT---------------LPLMLRK.LE-----------VA-----------VGLSIALYL--------MVP
Q0BVC0_GRABC/14-370-VVLLLAFSVL---------------MP.LLRR.PW-----------LL-----------GGLSLTLYA--------ATR
A5G015_ACICJ/9-360-VAIMGGIAPL---------------LF.MLRF.PR-----------AL-----------LVLSFALYA--------GAR
B0U809_METS4/3-358-VVLLGLAPLF---------------VLAARLS.RP-----------LA-----------LAASLALYL--------AAL
Q2K344_RHIEC/23-378-GALLLMVPII---------------LLLNERS.PL-----------LA-----------LAVSGTVWL--------LAG
Q2YRC8_BRUA2/6-358-AVMLILTPIL---------------LFLARIS.LP-----------LM-----------LGVSGVVWF--------LSG
Q983D5_RHILO/37-389-AALLLMAPAF---------------VLLISYR.PA-----------AA-----------LVASGALWL--------VAG
Q3J1N1_RHOS4/11-372-ATLLLVTPAL---------------ILAALRF.PR-----------TL-----------LVGSVLLWA--------LTG
Q11DW2_CHESB/11-364-AALLVISPVY---------------ILIGLWN.RL-----------GL-----------IAVAIVVWV--------LAG
Q1GGF0_RUEST/47-428-LVVLALMPAI---------------MSAQKLG.LW-----------AV-----------AGLSLALWL--------LAN
Q169P8_ROSDO/29-397-LVVLAMMPLV---------------IACHRAH.PA-----------LA-----------GALIVGVWF--------GAQ
Q0BQN1_GRABC/63-424-VVIMAMVPVA---------------VLLAKLD.RR-----------LP-----------VVASVLLWA--------GAL
B0RH46_CLAMS/492-873-VVLTLLVPAV---------------VWLLRRRMWW-----------VV-----------LIVSWTAYV--------LNA
B4EL00_BURCJ/18-366-VLFALASPVL---------------VPFARRH.PW-----------LL-----------VALSVASWL--------AAG
B4ELU9_BURCJ/9-352-AFFALLVPLA---------------LPLARTQ.PW-----------LM-----------LAFSGSLWY--------AAP
E3FIJ7_STIAD/5-384-IVYLALSPPL---------------VWLCVTGRWR-----------KV-----------VIGSWMLWL--------GVQ
Q13QD3_BURXL/18-362-VIFALCVPFA---------------VPLARRS.SL-----------LA-----------LGLSVAIWA--------LAR
Q5LPG0_RUEPO/27-401-LVVLAMMPLM---------------MGLRQVG.FW-----------AM-----------ALASVLIWA--------VAQ
Q63IA9_BURPS/14-358-VLFALATPAI---------------VPLARAK.PW-----------WL-----------VFGSVLMWG--------CAP
Q6NAS6_RHOPA/6-361-IVLVVAAPLI---------------LWGLLRR.PT-----------LT-----------LVCSGLLYL--------VSR
Q92L11_RHIME/23-374-AVLFLLLPGF---------------LWLNAVR.PR-----------LL-----------FAFSATLWL--------AAG
Q9KQQ7_VIBCH/3-361-IMYMLLFPLA---------------LYGFRRGYLK-----------WV-----------LALSVLIWA--------SSG

PF01757

A8DMZ1_STALU/12-334.IQYFILSYLI...............YKITPKIFNS-----------KL-----------LLIGSFFVQ--------YFF
Q035D4_LACC3/20-369.LQLYLLFPAM...............LWLFKRTAGH-----------HI-----------RLVVASFGV--------QML
A8G974_SERP5/5-314.VLYVLSLPLL......................SRL-----------NI-----------GPLLGLLFL--------AAL
Q11WN8_CYTH3/14-339.WWFYMLFIPI...............YFYIPENRRY-----------LY-----------VGIISSAAL--------VVY
A7LV98_BACO1/4-296.CSFYIL...................YLFTNKYKYF-----------YR-----------LLTVLSLIT--------WSL
Q97ER7_CLOAB/6-334.FITNIIFFLID............FVFCKIKGFKKE-----------IL-----------QGILFLVLF--------VID
A0A025FGD2_ECOLX/9-357.VVMTTLCVWIFKRIR.....NNLENSDKTNKKFSM-----------VK-----------LSVIFLCLG--------IGY
Q07PA2_RHOP5/14-375.LEFYVVALALRTSIGW...LDRPGRIRAGADRMVR-----------LL-----------IRTGVAPLI--------LAI
Q30BE9_ENTFL/7-326.IIGAAIAWYL...............VKKLNYPKAL-----------MV-----------ASVLYLIGL--------FGD
A1HPJ5_9FIRM/6-350.LWFYTLMPLWR............LIVRLMLKRPAP-----------SL-----------LLTLILQIG--------FNY
A0A0D1E273_USTMA/127-516.LWGMLSVLML...............LPIVMHLAPS-----------RR-----------FVLYALLLI--------FEG
A7LV97_BACO1/24-312.MTLMLLVPL................YGWIFLCNKS-----------WL-----------YLIIVLLSF--------YFW
Q1QWT8_CHRSD/4-315.IGAAIMLYAL...............RHLSLKALFG-----------LA-----------LSLYAMGMF--------FIY
Q2T7M4_BURTA/6-373.LIGSIVLFAI...............IALFGKRPIL-----------LV-----------LWFLFFANI--------FGL
A4B9D7_9GAMM/5-375.GLLVAAMKLF...............RRPTAVQLWW-----------VF-----------GSALVATLL--------LHE
Q5LBM3_BACFN/8-315.MIYYVVLWFI...............RKFLKKHLKW-----------VF-----------FMAATITLL--------WYF
M6C4Z5_LEPBO/44-373.VSLYLMFPFL...............KRILLKSDSK-----------KV-----------TLIFFFSAL--------ILN
A5ZUV3_9FIRM/6-346.LGCYIALPFL...............SRLLQTSTNL-----------RQ-----------YSLLYVLGI--------IIF
B2JGA6_BURP8/53-400.MCFYLFAPLV...............FSATRTRRGL-----------WR-----------TSLVLLACS--------AIM
Q9XAP7_STRCO/24-348.LWFVLLSPLL...............LRVFRLAPVP-----------VL-----------LLSLAPAVA--------FQF
Q07KV2_RHOP5/17-343.MIFYVFVATT...............MLGIFGRTGV-----------PK-----------RWVAVILAG--------VGT
Q484G4_COLP3/18-372.FHYTVLLLPLCAFINS...EKGIVILQKIEKFLTK-----------SS-----------RIIWLPLTI--------YFV
A0DGZ8_PARTE/156-556.IQLFIICLIP...............MTCYALGYKR-----------IS-----------KYLITGMII--------SSV
A7A7L5_BIFAD/6-324.AIFLALLPFL...............SRGLKALGRE-----------YH-----------LALAATVLT--------IWG
A3JPT3_9RHOB/10-350.FALLLFYPLF...............LVAVKYPFLG-----------LL-----------VLICLATKR--------EAD
A5EMI0_BRASB/26-386.LAFDLAAALLYRVSP....HLLDPINRLSLRAFAH-----------PR-----------DFFFIFLLI--------TGV
A4FKM9_SACEN/20-347.LMGFTAAALL...............YRSSWGRGPR-----------LR-----------VVLWAAVLL--------PVA
A7V903_BACUN/5-297.ILCSLIYYIT...............FRYVRLSVVS-----------RL-----------VVTGVCLFA--------LSH
Q8IG66_CAEEL/330-720.FQLYLTLPIV...............IFFLSKFRFG-----------FT-----------FAIVLCILA--------LVY
Q7UES3_RHOBA/12-486GFVLVMTLTPRGW..........RSRLNLATVVRSP-----------HC-----------LLWLIPLTM--------LPH
Q1WRZ8_LACS1/4-332.FLANIFYSFI...............IKLTTKYKVS-----------DN-----------ITTIIFIVT--------TFI
Q8PXP5_METMA/13-333.IVITTLCFFI...............LYYSNIHTLY-----------LF-----------AVILLTFQI--------ISW
Q6AH04_LEIXX/3-320.AVAAVASSTL...............MPVVANGTPA-----------SW-----------GLPGALLPR--------LTT
Q5CVD7_CRYPI/23-437.IVISVVMFPF...............MKVMKGQKKS-----------EN-----------ISYIISCGC--------IAA
A0LT35_ACIC1/10-359.AVILFLTPLL...............FALHERFGIT-----------VV-----------LVMAAFAAV--------FDV
Q8KJJ2_RHILI/23-344.FISFVLIRVL...............TTFNRLSMWI-----------IS-----------ASAIAVAFA--------PIT
Q17BV3_AEDAE/212-599.MQLAILAPLL...............LIILTANPFY-----------GI-----------ASFVLLHGL--------STA
A7F3R9_SCLS1/8-361.LKGAMLVYVF...............MLGTGGMKPR-----------YR-----------MMSSMALFV--------YFY
Q144E0_BURXL/4-320.FICQIVACIA...............VWPRSTTSGS-----------AL-----------TAANRGVLA--------APA
Q83YQ9_STRGN/5-307.SYIYGLYLLF...............YKYFHRLTTF-----------GV-----------SLILLALAF--------CIE
Q07P25_RHOP5/21-323.MICHVLAVLL..............PTRWAMIGLAA-----------LG-----------FVVFMLLPV--------RPA
Q8DSB8_STRMU/14-327.FGLLIFMPIL...............NLALRKLNTK-----------DL-----------KHIVLLAII--------FFS
A0LP70_SYNFM/14-366.LQLYLFFPLF...............SRLLDKAGEV-----------KF-----------LILCGVFTL--------LSR
A8H1P8_SHEPA/43-369.MMLFALSPWV...............MYLIKKQQIL-----------YY-----------AIPLLLIAI--------MVH
A6E8A8_9SPHI/14-335.FVLENMYFLA...............FRKAVGWKKV-----------VI-----------LFGFFILAI--------LDH
A5VFE0_SPHWW/65-420.LFGSLLALLG...............AMIIGARRRP-----------VL-----------DAVLITILA--------IAA
A5LX53_STREE/8-323.WSILIVYGLL...............SVVFKNRKSL-----------LL-----------VSVFAYIFT--------LFI
Q8P802_XANCP/22-341.FVATVVY..................LALREDLSAA-----------VL-----------AVCSLLVVW--------AWT
Q2HGI8_CHAGB/115-578.FRCSMVLFLT...............LAGTLGLRRG-----------WR-----------LGVVAGLVV--------FVY
A6BII1_9FIRM/11-365.VCIYLLFPVL...............YYIHRDQRKI-----------FI-----------YFVVIGIAM--------IFG
Q9CHP8_LACLA/4-320.LGLYLFIPLLN............IIWNYKKEIKNY-----------HL-----------YIVFIASLL--------TFL
A5N097_CLOK5/9-357.FVFTLLCLPFFKEWAC...KIHSKHYDKIIEFLTK-----------PM-----------MILLICMPY--------PFL
Q8FTN8_COREF/16-398.MLFYLTFPLF...............IPLVRKVRGV-----------GN-----------WWAFGITFL--------LSL
A7AZT9_RUMGN/12-318.ILFSFMSPII...............YGVLRQKWVG-----------LF-----------VVILVLVIN--------FSG
Q2NRT0_SODGM/9-399.FFFYLLFPWA...............APRLMNVRNP-----------WL-----------WLGICMLAY--------LLP
A4CKW1_ROBBH/7-342.IGIYQLT..................RKFRPGAFPV-----------LL-----------LMVTVGLFL--------FEP
A6FAM6_9GAMM/8-349.FQFYLIFPFI...............LAMFNRFGNV-----------FL-----------IAISLVCIT--------ISL
R7EJB8_9BACE/14-354.YIGNILYALF...............VRKFNKVALS-----------VL-----------VFVAGCFTV--------YRC
A4YYF7_BRASO/15-345.VLVYAVFFLG...............LRFVTTSPLL-----------NL-----------AMILAGIAS--------GTL
Q1D0W9_MYXXD/39-356.GFALLVGATL...............LAVTPGRWGR-----------TV-----------MLAVVAVGL--------PLV
Q16PV5_AEDAE/243-647.FQFFCIGMLI...............MMILWRFPRS-----------IK-----------TMIYVMMTI--------SIV
Q82ET0_STRAW/57-398.AGLTAATPLL...............TRLNPLWPLA-----------VV-----------LHVDLIRFG--------LGG
Q4JZS0_STREE/5-327.FLFYMLFPFF...............VWLCWDKKRA-----------FI-----------SFIISVILN--------IFC
Q7MGC8_VIBVY/15-336.IIAVAVVALF...............VHFQRQHWLL-----------PI-----------AALLYLYGV--------LAG
A6KZK8_BACV8/9-367.VGLYFIIPIF...............HAWLERATRK-----------DI-----------KLFLSIWGI--------SLF
A4CUQ6_SYNPV/6-368.FVFDLIYCAWVKLRGDHYLVDTDIPLPTMRSWVIS-----------AV-----------VLGFIEVAM--------STQ
A0A0G2MNM2_SALPT/5-319.TVIYLVSPLI.................QVKNVSGK-----------ML-----------LMLMVVIGI--------IAN
A6P1P2_9FIRM/9-341.LGLYLVTPIL...............RAFVQGASRK-----------DF-----------HYFFLLCFV--------VTY
A5FYP6_ACICJ/4-317.FLLSVATPLL...............LAACRGRLWP-----------VI-----------CIFAAFQFI--------PLP
Q7MQA5_VIBVY/5-328.IPLYFVIPMF...............QWLVRQQRQD-----------IL-----------YLFTALWLF--------TTV
Q5ZXE9_LEGPH/10-336.EQFYLIWPII...............LIVLTKKFTD-----------KK-----------IILGTILLT--------IIS
A7V3H1_BACUN/5-305.FFCFCILAII...............TKITTNNLIV-----------FT-----------VACIITYFT--------PYC
Q64YD4_BACFR/4-349.ISLYLFIPII...............SPWLRKASAK-----------EE-----------RFFIGLFLL--------STC
A5UMZ7_METS3/7-344.LGLYLSLPIF...............SPYVRSTKLR-----------GA-----------KYFLILAIS--------ASL
A3YY52_9SYNE/16-323.VVFYLLAPLL...............LLLVHSLGQT-----------PW-----------RWTSNRLVV--------CAG
A4AIT9_9ACTN/563-845AVVALLAIPAV...............RRWERRWPFA-----------FA-----------LGMLAVTLV--------VRT
A5N224_CLOK5/8-329.IEFYIIFPFI...............YKFMGKRWWL-----------FL-----------SLLVTSFFL--------IYF
E0TI88_PARBH/15-315.IMAQLFLAAY...............DRVEGGLISG-----------VA-----------VLILLGFVI--------VSY
A0A072ZP69_PSEAI/5-324.WVATLFAWFM...............LRVIQRLGLS-----------LA-----------ASCVLLAVQ--------LGL
A0E2L0_PARTE/17-375FLCLSIPTIHLIRSCFLKSKGTSDTNKNSIQDLSNY-----------IF-----------FLIITVLLY--------SMA
Q8A5U1_BACTN/9-318.FNCNILFYLI...............HYLRDKHLSL-----------MF-----------AATLLIGCT--------GFF
Q2C1R6_9GAMM/10-345.IVFSAVFALFQVVS......TGNQKVDADKPFPAL-----------WK-----------ILLFAVMII--------PVN
A7A7B8_BIFAD/5-363.IAVYLVLPVM...............KMAFDSERKL-----------AF-----------NALLAVLAG--------FTV
Q4JYU7_STREE/6-318.ILIYLCLPIL...............RQFLNSKRSY-----------LY-----------SLSLLMTIG--------LIF
A9VR59_BACWK/5-346.FQIHLLFPLLCTL........FYWFQKRTENKKDI-----------YK-----------YMTIFACLY--------FFL
A7VGI1_9CLOT/6-345.LIAMLVI..................YPLLRKYKDT-----------YT-----------LIIAPVTAL--------LIS
Q1QR03_NITHX/14-320.PVFFVV...................IKATRRISPW-----------AI-----------WGAAAALEM--------AHI
A5ZDF6_9BACE/13-326.LYLMIGFAVI...............HFAVYSIKKQ-----------HM-----------LGVSVLLFL--------LCF
Q16FE1_AEDAE/161-554.MQMFLASLGL...............LTLMWRFPKA-----------VP-----------KLLLAGTIG--------SVL
Q7CTZ0_AGRFC/8-329.FVCILLSPVL...............AFLMRRFALP-----------TL-----------AILLIITAM--------PDL
Q8G7P7_BIFLO/17-373.AGFVLATPFL...............AAMMRTIGRS-----------GA-----------WLLVGLAAA--------VAA
A1R1G8_ARTAT/18-357.LTAQLSIPVM...............ARLHERAPFL-----------TF-----------AALVALIIT--------VDS
A0QPG5_MYCS2/9-326.MICYIAVAVLG.............IVGLLKRRWVI-----------PA-----------IFVLTLCAT--------AYF
A5EXU9_DICNV/19-351.VLQFAGLTFI...............YFSFAKKMGW-----------SK-----------STLVMIAVL--------CSL
A6LGX6_PARD8/9-311.IYSCITIYFI...............YNKLPRLIKF-----------LP-----------LLIIGYFCL--------VPY
Q11WP3_CYTH3/4-324.MQFYIIVPAL...............LFVLAKLQNR-----------KI-----------VFLSVFFIL--------FSI
A6KYR5_BACV8/6-309.VVLYCFSPYL...............NRLVHNLSQK-----------SY-----------KQLLLLWGF--------FFV
Q0CZ95_ASPTN/77-482.YRGSLAVYTA...............AIALARFRRN-----------AR-----------LTGEVALVV--------YFL
A0T1U4_VIBCL/8-303.FVFSVISPML...............FYILNKIKSE-----------NK-----------LLLLVFISF--------LIN
A3I592_9BACI/6-352.VQFYLLFPLF...............LYILKKKPAL-----------SP-----------HLIWIGLAL--------QWI
A1TDU0_MYCVP/22-361.VLVLAAVPAL...............AHISTTGRLV-----------GA-----------VAATYGVVA--------IVD

PF07786

A1HQT7_9FIRM/5-214-..VSMLLGHG---------------L..RRFHPAI-----------VT-----------IIAFAFLAL........GQL
A2SQB7_METLZ/5-231-..VATILAIP---------------FVVMKVKPYV-----------PL-----------VFGLICIVL........SPF
A9CIY2_AGRFC/15-234-..AASLVGLL---------------F..LRAPAPV-----------TL-----------LFAVIAFIL........PQY
Q28R74_JANSC/28-249-..LCSLLGLL---------------A..LRLPVLA-----------IA-----------GLAVVVFYV........PEF
Q8PXM0_METMA/7-237-..LSAVLAYP---------------F..LKYGKEN-----------LF-----------F.GLLFVLA........GFY
A4EC93_9ACTN/4-221-TGIVALTDPV---------------L..KKISARW-----------GM-----------SLCLVLFAL........TWS
Q8U2K3_PYRFU/23-240-..VASILAIP---------------F..YSLGWKN-----------VF-----------P.AFFFLAG........AKV
A7I8Y9_METB6/6-231-..LAVMLSPL---------------F..FRFRTWN-----------AV-----------I.GIVFIAI........GWI
A6G0Y4_9DELT/12-237-..LCLILMGL---------------IRKLTPNRHG-----------LL-----------VWAALFASG........THL
A3CVR7_METMJ/5-231-..LAILLAPL---------------F..VRLDPEK-----------LI-----------ITSIACLIA........GYA
Q11IW8_CHESB/30-251-..LATIVGAA---------------V..LRLPVPV-----------LL-----------LLAAAVIAA........PHY
A1TRD1_ACIAC/21-249-..VMLVVARC---------------T..AGWGGWL-----------WP-----------AGALALAA.........PWA
A2SGN2_METPP/12-230-..LMLIVCRF---------------S..AGAGRWL-----------WP-----------LGLAAILL.........PQF
A2STU6_METLZ/14-241-..LSMILCIP---------------F..LRFGKWS-----------LI-----------P.AVSFILL........GLF
Q2K839_RHIEC/16-243-..LLTLIGVV---------------F..VRLPLAF-----------TL-----------LVTIALLAAWILDNFGTPGL
Q251W2_DESHY/5-221-..VMMVLYPL---------------I..QKLPNGA-----------LI-----------LGSVLIIAG........GLI
A0NYA1_LABAI/5-227-..LSSLIALP---------------F..TRLPVVF-----------AV-----------LAAALVFSL........PFW
Q21VS3_RHOFT/16-244-..LMLIIARL---------------T..ARWGGRL-----------WW-----------LGACAIAI.........QLI
Q0FKK0_PELBH/7-221-..AASLIGLA---------------V..LRLPAWG-----------MA-----------LTGAAVAAL........HLT
Q2YRW9_BRUA2/16-233-..LASVLGLL---------------F..LNLPPGL-----------T.-----------....AAVAA........PHY
A2STU5_METLZ/19-252-..ISMLIAIP---------------L..IRFGKWN-----------IL-----------F.GLLIILV........GIF
Q6SHI3_9BACT/5-214-..VSSLIAIA---------------F..INLPKTS-----------LL-----------IAALILIGS...........
Q0G6B2_9RHIZ/53-275-..FASLAGLL---------------F..IRMPWPL-----------TL-----------ALGIVVIVL........PLF
A3YBL4_9GAMM/14-227-..VASWLVLP---------------V..ARKPWLS-----------LA-----------IGIGILLA............
A4FZP9_METM5/5-227-..ISGLLGII---------------F..YRFEKIN-----------LV-----------F.AIIFLSA........GLL
Q11N89_CHESB/6-227-..AATLLGAL---------------F..LRASPLV-----------CL-----------GAATIVLML........PFV
A4J1M2_DESRM/9-218-..ISILLYPI---------------F..HRWSPGI-----------LM-----------VFGTIIIGL........QYF
Q6SGH9_9BACT/9-218-..TGTLIAIF---------------F..IQLPKIS-----------LF-----------IAALIFLFG...........
A1VNB1_POLNA/5-231-..VMLLIVRL---------------T..AGWGRWL-----------WF-----------LGSAAIAM.........KFV
A3DGD5_CLOTH/11-220-..LCMIVSPF---------------L..KKIPTPS-----------LL-----------ILSLIIGMT........QFV
Q98KU6_RHILO/16-237-..LASLLGLA---------------F..LRLPALL-----------TL-----------VVAALVIAA........PIY
A6VZM7_MARMS/12-224-..IASLLIRP---------------L..AKWPIPS-----------AL-----------AGAVIILI............
A1W6I8_ACISJ/12-240-..VMLVITRL---------------T..AGWGRWL-----------WL-----------AGLLALVS.........PWV
Q6M0I2_METMP/11-233-..ISGILGII---------------F..YRFKKLN-----------LF-----------F.SVIFLIL........GVL
O26882_METTH/9-227-..LAVILTHP---------------L..AGRRTVA-----------LA-----------L.SAVAITV........GVL
Q92KE6_RHIME/23-246-..AASLVGLL---------------F..LKLPAAV-----------SF-----------LAAAVAFAA........PLY
B1ZHM9_METPB/15-237-..ASSLLGLP---------------F..VFLPVPV-----------TA-----------LAAAAVMLA........PQV
Q2Y4H0_9ARCH/17-243-..ISIIMAYP---------------F..LKLRLWN-----------LL-----------P.GILFVSF........GLY
O29726_ARCFU/2-207-..LATLLGYL---------------F..LRFPKIQ-----------LP-----------A.GIALFFA........GIA
Q12ZG6_METBU/7-234-..VAIILSYP---------------F..LKQRSAS-----------LV-----------A.AFLTIIA........GIP
A4BIP8_9GAMM/6-220-..VASVLALP---------------F..VRRPALA-----------LT-----------IGVSVFL.............
Q8THP4_METAC/31-261-..VSAMLAYP---------------F..LKYGKEN-----------LL-----------F.SLFFVFI........GFY
Q46DC7_METBF/7-237-..VSAVLVYP---------------F..LRYGKEN-----------LL-----------F.SLFFGLI........GLY
Q2FN30_METHJ/7-229-..TALILTPL---------------L..YRLNYTG-----------LI-----------LAAALILIA...........
Q1YI63_MOBAS/15-237-..VASVLGLL---------------F..LRLPWFV-----------TA-----------ALAIAVVAL........RSF
Q1B004_RUBXD/18-243-..ASIVLAYP---------------F..LRLRWAN-----------LP-----------L.GLLVIAL........GAY
A6FRV3_9RHOB/4-228-..TFSLIGLV---------------F..LRLPLWM-----------LA-----------IGLLGVLTA........PGL
Q1YJ44_MOBAS/24-246-..LGSLLGLL---------------F..LRFPIGL-----------VF-----------FASFATLAA........PLF
Q26I67_FLABB/5-236-..LSIIITVG---------------IYYLTFKKSL-----------IF-----------SILMLILGI........SIF

PF05857

A6TIJ3_KLEP7/24-240-FAFAVTGQVL---------------RWVSQPSWYY-----------TL...........PAAGLLVAW--------IPL
Q5NWL3_AROAE/9-222-FTLLVIAGTL---------------LLVEKGRTGT-----------.............WIVAGILFL--------IGG
Q88AH9_PSESM/14-243-PTLLLGLLIA---------------QGWQHRNVTT-----------RVM..........AIVALLLAA--------VFQ
A6M0I9_CLOB8/13-266-ETFFLIALNI---------------LLIEYLRDEN-----------KDLYRK.....IYIIFLAIMFE--------VVL
C1DKH3_AZOVD/14-243-PTLALGLLLA---------------NGVRPCSPAE-----------RLL..........AIVALGVAL--------TLG
A4XUI8_PSEMY/4-231-PTLMLGLIVA---------------WSVHHSDRTG-----------LVL..........GLFTLTVSI--------VLH
A4XH28_CALS8/24-230-ATFFFAAVAL---------------FFIQKRWY..-----------.............FLVIIPLAI--------SYF
A1WDN4_ACISJ/11-221-FTLLVVTATA---------------YLVERGGKLH-----------.............LAAAGVVFL--------VGG
C4YYW6_9RICK/13-242-ISIYLGQWYI---------------YYFRNSLTRF-----------FYSGY......CHTIIMVILWY--------ISW
Q326X1_SHIDS/32-247-FAFAVAAQVL---------------TWCETRSGWR-----------TA...........AAILLMALW--------GPL
Q8P901_XANCP/6-212-LSFALAAVCI---------------RAIEERK...-----------.............WIVLAFCLL--------PAP
R5K8R7_9CLOT/9-229-FTLALVLAMI---------------WIIDALKKKM-----------QTLPKFLWYLVSFIIVAVTCLI--------AMN
R5KLN1_9CLOT/10-244-FTLAAGLVVL---------------YLGKVAKWNQ-----------MGAV.........IGIVVIMVV--------SEA
R5QZC4_9FIRM/5-243-FTLLLGLIIL---------------TIIKRSHKNV-----------IISF.........AAIVVGAYI--------SYI

PF16401

H1Y6N2_9SPHI/12-268-GCFVLLFLMY---------------.SYKQEWQGK-----------AA-----------LMVKVSGFI--------LAL
G8TDM1_NIAKG/23-280-VSFVLLFFQW---------------YIPANTLYKN-----------RW-----------LVIRTLAFA--------GAG
F0SC25_PSESL/7-264-LCFVLLFAIY---------------GDFGKKVNKR-----------TD-----------LAIKIVGIL--------LAI
R6N358_9BACE/4-263-TCFIVLFPMF---------------MRIPYKLPEK-----------VH-----------TAIKLIAYG--------IAI

PF04235

Q8EH35_SHEON/199-352-ALIYIHILVS---------------ICQNRST.........V....LK-----------PLQNVGKLA--------FSL
YXAH_BACSU/242-392-MFFYVTTVVY---------------LYHKTRV.RT......V....LQ-----------SFSAVGRMA--------FTN
A5VFY1_SPHWW/226-385-TIGHAGLFLL---------------LWRKGAW.PR......L....MS-----------GLARMGRMA--------LTL
B0T5F0_CAUSK/216-381-MTAQLVLFVE---------------LYEGFAG.KV...........LR-----------LLAPAGRMT--------LTL
Q5LBX3_BACFN/231-393-TIVLVASFVL---------------LYQTEKF.RK......L....TA-----------DLRFYGKMS--------LTN
A8FJB9_BACP2/218-375-SLFYIAVIAK---------------LLAHTESWFM...........WN-----------WLEYVGKMA--------LSC
Q8ZNL6_SALTY/215-375-TLGYAALMFG---------------FWPQLSR.CR......L....TL-----------AIACVGRMA--------LTN
Q5Z0S5_NOCFA/200-354-ALAYLTGLLL---------------LLRTETG.AL......L....TE-----------LLAPLGRMA--------LTA
Q5LAR8_BACFN/229-391-MVLLVSGLLI---------------TFYRIKD.RR......F....LM-----------RFTSYGKMS--------LTN
A5FKP1_FLAJ1/222-380-TMIFIASGLS---------------LLYSHKK.LK.....TV....FN-----------YFRAGGKMT--------LTN
A6LH60_PARD8/231-393-TFVLVSSFVL---------------LYQWEGF.RR......F....TS-----------VLRSYGKMS--------LTN
Q2NUE2_SODGM/217-377-ALGCVALLYG---------------FWPRLAD.KK......V....FR-----------LLGNVGRMA--------LTN
Q5L251_GEOKA/223-378-AVFYAAAAVF---------------ICGKPSW.QR......A....WR-----------WWQDVGKMS--------LTH
B9LP38_HALLT/238-398-AGGYLGIVML---------------YARRRPDGPV...........TR-----------GLAAVGRTA--------FTN
Q5WBU3_BACSK/218-382-GVAYAAIFGL---------------IGPKITNPSG......I....VW-----------AITSLGKRS--------LTF
Q5LDG8_BACFN/245-405-GFAYVSAICL---------------LYLHGRE.WC......L....WR-----------CLAAPGRMA--------LTN
Q2N5U1_ERYLH/237-397-GLAYACVAMV---------------LFAPDGG.........L....TK-----------TLAAVGRLS--------LTN
Q1D273_MYXXD/254-423-GAAYVAAFAL---------------LFQRERW.SR......W....LG-----------VLTPVGRMA--------LTN
Q0RI89_FRAAA/226-396-GPGYVALFGL---------------AAARLAR.PRHP.HSDRAVRCVD-----------AVAALGRRS--------LTA
Q1GR12_SPHAL/244-406-TIGWAALIML---------------LVKTAAS.HA......L....RA-----------RLAAAGRMA--------FTN
A3HTP0_9BACT/227-391-GLFYLWLIAY---------------IWHYTPW.KK......W....LE-----------PLKYPGRMA--------LTN
Q0C162_HYPNA/232-392-ALGYAGLIAL---------------FSTGKAG.PI...........RR-----------FFARAGSAS--------LSA
Q9X356_BACAN/222-381-AIFYICTLLR---------------VCENKKYIEW...........LQ-----------PFMNVGKYA--------LTN
A8FH56_BACP2/222-385-SMFYMSTLAM---------------LFLHVPQ.LR.....GA....LM-----------AFTKVGRMS--------LTC
Q5WCD3_BACSK/239-403-MLFYVSAFVL---------------LLQKGTV.AR......L....FM-----------PIASAGRMA--------LTN
A4GA59_HERAR/238-403-AAAYVATILL---------------AKETAGQ.WL...........DN-----------WLAPVGKMA--------LTH
YRKO_BACSU/224-387-SMFYMSTFAM---------------LFLYLPQ.LR.....GP....MM-----------IFTKVGRMS--------LTC
Q47SA7_THEFY/269-436-GLGYVALFGL---------------IAHRLSR.RTSR..GPV....LT-----------ALTAVGKRS--------LSC
Q21P05_SACD2/237-402-AVAICSGFIL---------------FALRENNTKT...........MR-----------CFAPYGRMA--------LTN
A4FQ93_SACEN/204-361-ALGLLGLVTS---------------AVYAMRP.APG....VL....RR-----------GLTSVGRTA--------LSC
Q3IC82_PSEHT/208-361-AIIYIHIAVK---------------LCSNNAN.........T....GK-----------LIQQAGRLA--------FSL
Q2NDD6_ERYLH/264-425-ILGLAALLAL---------------GGPKATG.WL...........GE-----------RLSFAGRAA--------FTN
Q9HNH9_HALSA/232-393-AGAYLGAVML---------------VAKRWPTGVV...........TR-----------GLAAVGRTA--------FSN
Q9KFW4_BACHD/1-165-GCAYAALFGL---------------LGPVVNRSAL......A....IR-----------ALVALGKRS--------FTF
Q8ERW4_OCEIH/226-381-AIFYVTSITL---------------LWKKEWF.RQ......L....MV-----------PLQAVGKMA--------MTN
Q7N6K6_PHOLL/210-370-ALGYMALIYG---------------FWPVISC.WR......I....NY-----------WFNQVGRMA--------MSN
A4ARZ9_MARSH/230-396-TFILIVLFIM---------------LYKKVKG.EK......M....LR-----------IFAPYGRMA--------LSN
B1YLL9_EXIS2/215-367-AVAYAAGIAL---------------LVRFGRP..............LS-----------GFQVLGRMA--------LTN
A6L2L4_BACV8/234-394-MLILVSGVVF---------------AFYKTNL.HD......G....LM-----------KITPYGKMS--------LTN
A1WTH2_HALHL/248-410-AAGWAALIIL---------------AFQRGWL.GR......L....HW-----------PLTAVGRTA--------LSG
A1S3E3_SHEAM/216-369-SVLYADLIIR---------------LCRGSET.........V....LK-----------PLQNVGKLA--------LSL
Q9AA92_CAUCR/270-432-TLGYASLAIL---------------LIRSRAI.AG......L....LN-----------PVARLGQMA--------FTN
Q0ARL9_MARMM/225-387-AFGYASTVML---------------LAKIGVFSLI...........VK-----------LFAATGRMA--------FTN
Q07YN3_SHEFN/228-381-ALIYIHIIVK---------------FCQNTPH.........R....LK-----------