Sequence alignment for CL0316

PF10129

A1R109_ARTAT/441-826-------------RDAR.ID-----MLRGLAI-----------------------VFVVV-NHV....GINSV-------
A0K1D5_ARTS2/295-678-------------RDSR.VD-----LMRGLAI-----------------------LFVVV-NHV....GMTSL-------
A2SCM7_METPP/4-366-------------RLWE.ID-----ALRGLML-----------------------VLMTL-THL.....PTRY-------
A1TNJ8_ACIAC/18-379-------------RRWE.ID-----AVRGLML-----------------------VLMTV-THL.....PTRL-------
Q1D6T0_MYXXD/55-417-------------RRPE.LD-----SLRGILL-----------------------VLMTL-THL.....PTRL-------
Q11B97_CHESB/2-386-------------RRLDILD-----GMRGYFL-----------------------VFMML-NHLA...FTGGY-------
Q7CT44_AGRT5/2-385-------------KRFDLID-----GMRGYFL-----------------------VFMLI-NHLV...FAGGF-------
B2JS58_BURP8/58-406-------------RLIE.LD-----FFRGLVL-----------------------LFIVV-DHI.....GGSI-------
Q13NS3_BURXL/7-355-------------RLIE.LD-----FFRGLVL-----------------------LIIVV-DHI.....GGSI-------
Q1LDM8_RALME/9-370-------------RRTE.VD-----LIRGIAL-----------------------LFIVV-DHV.....NGSV-------
A1B1M7_PARDP/3-363-------------RIVA.LD-----MLRGYAL-----------------------VCIML-DHM.....PIGV-------
Q5FTQ3_GLUOX/17-367-------------RDHR.VD-----ALRGIAL-----------------------LMMLV-DHV.....PDDL-------
Q89UF3_BRADU/67-422-------------HDAR.LY-----LTLGIAN-----------------------WSVFV-DHI.....PNNV-------
Q89KT4_BRADU/82-438-------------RDVR.LD-----LFRGLAN-----------------------WLIFL-GHI.....PNSV-------
A4YU73_BRASO/12-368-------------RDLR.LD-----LFRGIAN-----------------------WAIFL-DHI.....PDNV-------
Q6N6S8_RHOPA/12-368-------------RDLR.LD-----LFRGVAN-----------------------WAIYL-DHI.....PNNV-------
Q1QFJ8_NITHX/39-395-------------RDHR.LD-----LFRGIAN-----------------------WAIFL-DHI.....PNNV-------
Q89VE5_BRADU/37-393-------------RELR.LD-----LFRGLAL-----------------------WLIFI-DHL.....PSSL-------
Q6N0J3_RHOPA/44-400-------------RELR.LD-----LFRGLAL-----------------------WLIFI-DHL.....PANV-------
Q3SWD7_NITWN/36-392-------------RELR.LD-----LLRGFAL-----------------------WLIFI-DHL.....PQNL-------
Q89CC1_BRADU/15-372-------------RDLR.LD-----LFRGIGL-----------------------WMIFL-DHI.....PHDV-------
A4YYN0_BRASO/36-389-------------RDLR.ID-----ACRGLAL-----------------------WFIFV-DHV.....PDNS-------
Q89EQ8_BRADU/32-383-------------RDLR.ID-----ACRGIAL-----------------------WWIFL-DHV.....PNNI-------
Q87XJ3_PSESM/5-366-------------RDHR.ID-----FFRGLAL-----------------------IFIFW-DHV.....PDNP-------
Q0BVC0_GRABC/14-370-------------RDLR.ID-----FFRGVAL-----------------------WMIFV-DHM.....PGNV-------
A5G015_ACICJ/9-360-------------RDLR.VD-----FFRGIAL-----------------------FCIFL-DHI.....PHDT-------
B0U809_METS4/3-358-------------RDPNAID-----FWRGLAL-----------------------ITIFI-NHI.....PGNV-------
Q2K344_RHIEC/23-378-------------RDTR.LD-----VLRGLAL-----------------------IMIFI-NHV.....PGQI-------
Q2YRC8_BRUA2/6-358-------------RDTR.ID-----VFRALAL-----------------------LTIFI-NHV.....PGTI-------
Q983D5_RHILO/37-389-------------RDTR.ID-----VLRALAL-----------------------IVIFI-DHV.....PGTA-------
Q6G5Q7_BARHE/16-368-------------RDTR.ID-----VFRSLAL-----------------------LTIFI-NHI.....PGTL-------
Q3J1N1_RHOS4/11-372-------------RDKR.LD-----FFRGLAL-----------------------VMIFI-NHV.....PGTV-------
Q11DW2_CHESB/11-364-------------RDHR.ID-----AFRGIAL-----------------------LMIFV-NHV.....PGNA-------
Q1GGF0_RUEST/47-428-------------RDPR.LD-----FYRGIAM-----------------------FIILC-AHI.....PGNR-------
Q169P8_ROSDO/29-397-------------RDPR.LD-----FFRGIVM-----------------------FIILI-AHT.....PGNW-------
Q0BQN1_GRABC/63-424-------------RDLR.ID-----FFRGVSL-----------------------FIILI-DHI.....RNNS-------
B0RH46_CLAMS/492-873-------------RDRR.LD-----LFRGWTI-----------------------VAVVI-THI....EVASP-------
B4EL00_BURCJ/18-366-------------RLIE.ID-----FFRGLVL-----------------------LMIVV-DHI.....GASV-------
B4ELU9_BURCJ/9-352-------------RYAE.LD-----FFRGLVL-----------------------LVIVV-DHI.....GGSI-------
E3FIJ7_STIAD/5-384-------------...EVLD-----GLRGYFL-----------------------VFMVL-NHLT..FSGGYL-------
Q13QD3_BURXL/18-362-------------..IE.VD-----FFRGVVL-----------------------IVIVL-DHI.....PGST-------
Q5LPG0_RUEPO/27-401-------------RDLR.LD-----FFRGIAM-----------------------FIILV-AHI.....PFNP-------
Q63IA9_BURPS/14-358-------------RSIE.VD-----FFRGVVL-----------------------LTIVV-DHI.....GASV-------
Q6NAS6_RHOPA/6-361-------------RDLR.LD-----FLRGVGQ-----------------------WMIFV-DHI.....PYNF-------
Q92L11_RHIME/23-374-------------RDTR.LD-----VFRALCL-----------------------LTIFV-NHV.....PGQY-------
Q9KQQ7_VIBCH/3-361-------------RIPA.LD-----SIRGLLL-----------------------VLITF-NHLIWYSGGTTI-------

PF01757

A8DMZ1_STALU/12-334-------------RKE--LI.....YLRAMLC-----------------------IIIII.THTLT...QYMR-------
K6RN31_LACCA/20-369-------------LYE--ID.....LMRLIFI-----------------------AGVLL.NHTTT...AFQH-------
A8G974_SERP5/5-314-------------INK--SN.....YLKGIAI-----------------------ILMLI.HHLFA...YPSR-------
Q11WN8_CYTH3/14-339-------------FYF--LE.....LMRTLAA-----------------------LYVVG.VHIHQ...IVDF-------
A7LV98_BACO1/4-296-------------NLY--IDRDTSSVIKGVLI-----------------------ILIVI.GHNKV...LCST-------
F0K6S5_CLOAE/6-334-------------SLE--MD.....VIKGLGI-----------------------IAIVI.GHTES...PLLR-------
A0A009DRR0_ECOLX/9-357-------------EYF--LD.....SIRAWLM-----------------------LLGIP.FHISL...IYSS-------
Q07PA2_RHOP5/14-375-------------LHA--LD.....AVRGFAL-----------------------LLGIV.YHAAVSFMPFAA-------
Q30BE9_ENTFL/7-326-------------YSG--ID.....YFRFIAA-----------------------LLIVA.IHTSP...LSSF-------
A1HPJ5_9FIRM/6-350-------------VTA--IE.....YIRGISM-----------------------LGVVG.IHTGA...YSLT-------
Q4P0M9_USTMA/127-516-------------LDY--AD.....GLRGIAM-----------------------IMVFN.GHFVDNTFVQTH-------
A7LV97_BACO1/24-312-------------RHS--LN........YLAF-----------------------FNSWT.GHGIS...GFVE-------
Q1QWT8_CHRSD/4-315-------------NVS--LD.....VLKLTLA-----------------------VIVVI.SHAGV...LWGY-------
Q2T7M4_BURTA/6-373-------------NLG--LE.....GLRGLAC-----------------------MAVMI.GHFSY...IFSP-------
A4B9D7_9GAMM/5-375-------------IAG--LD.....GLRAIAC-----------------------LMVVA.HHVLP...RLPQ-------
A0A015ULW8_BACFG/8-315-------------DIS--ID.....ILKCIAA-----------------------IMITN.SHMDI...LYGD-------
M6C4Z5_LEPBO/44-373-------------SKS--VD.....FIRGLAI-----------------------TGIVF.IHVNS...YYQY-------
A5ZUV3_9FIRM/6-346-------------KIW--LD.....VVRATAI-----------------------LCVVL.CHSVE...AFYH-------
A1VGB5_DESVV/30-339-------------IAY--ID.....ALKVIAC-----------------------FAVIN.LHCTS...PWVS-------
B2JGA6_BURP8/53-400-------------VAA--LD.....AGRALAI-----------------------VGVIL.VHLAL...FMPA-------
Q9XAP7_STRCO/24-348-------------DRY--FD.....TLRALAL-----------------------VRVVA.YHAFGWPWA...-------
Q07KV2_RHOP5/17-343-------------ENA--IQ.....WLRAIAA-----------------------IEVVV.WHSDL...LTKH-------
Q484G4_COLP3/18-372-------------LYF--LD.....WIRILAF-----------------------AFLVF.YHSAL...MFVD-------
A0DGZ8_PARTE/156-556-------------LAI--FN.....GVRAIAF-----------------------MMVVY.GHSSL...LIIQ-------
A7A7L5_BIFAD/6-324-------------NSS--IE.....LLRIIAM-----------------------FMILM.HHFIV...HNGY-------
A3JPT3_9RHOB/10-350-------------MVW--LD.....ALRLIAG-----------------------ISMVG.LHGSTDANGQPF-------
A5EMI0_BRASB/26-386-------------NAA--LD.....HARTFLT-----------------------LVVLL.HHAVI...PYTY-------
A4FKM9_SACEN/20-347-------------KIS--WD.....VVRAGCV-----------------------MLVML.YHATF...LGVF-------
A7V903_BACUN/5-297-------------VKE--ID.....YLKCIFI-----------------------TLMII.FHLVY...IGDK-------
Q8IG66_CAEEL/330-720-------------VKL--VN.....LFRVCSS-----------------------FWVIF.SHTCL...FSLH-------
Q7UES3_RHOBA/12-486-------------RHD--LD.....ALRGIAM-----------------------LLGIF.LHAAI...AYSP-------
D8IMM9_LACSC/4-332-------------ITW--ID.....ISRAIGM-----------------------LTIII.AHSLN...SYTG-------
Q8PXP5_METMA/13-333-------------FYR--LN.....ILDGFAI-----------------------VFIVI.FHALG...GLKT-------
Q6AH04_LEIXX/3-320-------------ILG--VD.....LARGVAL-----------------------LAVFI.AHTAP...LTRD-------
Q5CVD7_CRYPI/23-437-------------LHY--LD.....WLKTLAV-----------------------WLVVF.VHVIYYLNLLNI-------
A0LT35_ACIC1/10-359-------------DPY--VD.....LVRAIAI-----------------------TLVVI.GHWLL...SNVT-------
Q8KJJ2_RHILI/23-344-------------DLS--FD.....FAKGILI-----------------------TLVII.GHLLQ...YLIY-------
Q17BV3_AEDAE/212-599-------------VGC--LS.....GLRALAT-----------------------IALFCALRLIP...MGFQ-------
A7F3R9_SCLS1/8-361-------------VKW--VD.....GLRGIAS-----------------------LLVVS.THIAR...AFDS-------
Q144E0_BURXL/4-320-------------EER--IR.....GGQAVSI-----------------------VAIVC.AEAIR...RVVD-------
Q83YQ9_STRGN/5-307-------------NTT--LH.....AVKALAC-----------------------FSIVS.LHFLL...PGEF-------
Q07P25_RHOP5/21-323-------------QVW--MD.....LARGIGV-----------------------ILVVY.GHVLG...GLVR-------
M2EB77_STRMG/14-327-------------NAG--ID.....FLRIFAM-----------------------FMIVV.THVLG...KGGI-------
A0LP70_SYNFM/14-366-------------LTW--PD.....MMKGISI-----------------------LWIVF.FHFFH...AYNN-------
A8H1P8_SHEPA/43-369-------------LNS--IN.....HFRGIAI-----------------------IFIVM.AHCYR...PAGW-------
A6E8A8_9SPHI/14-335-------------ILW--ID.....YAKFIAI-----------------------FFVIF.AHQTL...SKSW-------
A5VFE0_SPHWW/65-420-------------YRD--VD.....MLRGYAA-----------------------LAVAL.YHFLL...AYVP-------
A5LX53_STREE/8-323-------------INW--ID.....FGKGFAI-----------------------FSVLV.GHVLM...GLYE-------
Q4UW44_XANC8/22-341-------------EWQ--ID.....VAKALAI-----------------------ILVAL.GHASG...MAPA-------
Q2HGI8_CHAGB/115-578-------------TAY--LD.....GMRGLAA-----------------------LIVFF.CHFLYTSFAIAP-------
A6BII1_9FIRM/11-365-------------FGY--ID.....LLETIAI-----------------------ICIVF.YHGAI...GNAN-------
F2HK93_LACLV/4-320-------------NSS--ID.....LMKSCAI-----------------------FFVIS.VHFLL...NSGF-------
A5N097_CLOK5/9-357-------------RYD--LD.....WIRAIVV-----------------------ISIIF.YHVCD...MFIL-------
Q8FTN8_COREF/16-398-------------LPS--LT.....GARWLAA-----------------------VAVFV.LHALV...FLNV-------
Q6G5Q7_BARHE/17-365-------------DTR--ID.....VFRSLAL-----------------------LTIFI.NHIPG...TLYE-------
A0A016XC94_VIBCL/4-356-------------IPA--LD.....SIRGLLL-----------------------VLITF.NHLIW...YSGG-------
A7AZT9_RUMGN/12-318-------------WYN--FT..........LC-----------------------ILVVC.IHAQN...MHIF-------
Q2NRT0_SODGM/9-399-------------FIG--LE.....WLRFLLG-----------------------CYVMI.YHTAH...HYPQ-------
A4CKW1_ROBBH/7-342-------------LYF--ID.....AMRAWAI-----------------------LMMLQ.GHFID...GLLD-------
A6FAM6_9GAMM/8-349-------------KVD--SN.....ILKGLGI-----------------------LMIAI..HNFM...HRFP-------
A7V2Z2_BACUN/14-354-------------YEI--LD.....GLRGVAA-----------------------VMVII.FHLFE...AHAG-------
Q00XL5_OSTTA/15-388-------------LPA--LD.....SIRFFLI-----------------------AYIGV.GHFIA...CATK-------
A4YYF7_BRASO/15-345-------------LLG--LE.....LLRFLAT-----------------------ISVLL.WHYPHFAYVADT-------
Q1D0W9_MYXXD/39-356-------------HPG--LD.....CARGLAV-----------------------MAMVI.GHTLD...AVLS-------
Q16PV5_AEDAE/243-647-------------FAF--VE.....SVRVISV-----------------------FFITA.VHVLM...AFGA-------
Q82ET0_STRAW/57-398-------------DRA--VD.....TLRAFAI-----------------------LGVVL.GHWLV...TALV-------
Q4JZS0_STREE/5-327-------------YDN--LD.....GLRVISC-----------------------LGIIA.MHIKA...NADY-------
A7X0T7_STAA1/8-314-------------DYF--FD.....NARAILI-----------------------LLVVF.GHMLQ...PYTS-------
Q7MGC8_VIBVY/15-336-------------IAS--LE.....LGRIIAM-----------------------LAIIG.LHCQM...ALTY-------
A6KZK8_BACV8/9-367-------------IGW--ID.....LLRVTAC-----------------------FLVVF.AHCCD...PFVA-------
A4CUQ6_SYNPV/6-368-------------LLY--LD.....QIKAVIV-----------------------GLVIA.LHVPV...AFFP-------
B5BHU4_SALPK/5-319-------------INW--ID.....NLRGIAC-----------------------LMVVM.IHTTT...WYIT-------
A6P1P2_9FIRM/9-341-------------LAY--AD.....LLRVLSI-----------------------AAVVV.IHVVS...LWIY-------
A5FYP6_ACICJ/4-317-------------RAD--ID.....RAKGLAI-----------------------SLVVF.GHIVA...RQDP-------
Q7MQA5_VIBVY/5-328-------------VQF--FD.....LLRCVAA-----------------------VAVIA.IHVLA...PYRH-------
I7HSS1_LEGPN/10-336-------------RKD--ID.....ALRGVAV-----------------------LLVIF.DHLHI...NLV.-------
A7V3H1_BACUN/5-305-------------IEW--ID.....LCKIITM-----------------------IIVCY.DHTIQ...SIAP-------
A0A016DJ19_BACFG/4-349-------------IVF--LD.....YVRVFAC-----------------------FLVMI.VHSSE...NFYG-------
A2SCM7_METPP/5-359-------------LWE--ID.....ALRGLML-----------------------VLMTL.THLPT...RYAD-------
A7ZZ73_ECOHS/5-329-------------ELW--IN.....QIKGLCI-----------------------CLVVI.YHSVI...TFYP-------
A5UMZ7_METS3/7-344-------------IRY--VD.....QLRAVSI-----------------------LFLIA.INVAM...VFKY-------
A3YY52_9SYNE/16-323-------------NQA--ID.....LMRATCI-----------------------LWIVGFWHLLG...YAES-------
A4AIT9_9ACTN/563-845-------------IEV--PI.....VLRAVAI-----------------------VLIVA.THSDF.......-------
A5N224_CLOK5/8-329-------------VLE--MD.....VIRAASI-----------------------VAVIV.LHVSA...TVLY-------
E0TI88_PARBH/15-315-------------EEG--VD.....AGRLLAA-----------------------IGVIA.IHVGA...YDEL-------
A0A022NJA1_PSEAI/5-324-------------WIQ--MD.....VTRGVGI-----------------------LIIVF.GHSWF...VASS-------
A0E2L0_PARTE/17-375-------------MFS--LN.....LLKILAM-----------------------LSISM.SHYGI...LIGQ-------
C6IRR6_9BACE/9-318-------------IDF--VD.....LTKGVCI-----------------------ILVVM.AHIGG...AFDQ-------
Q2C1R6_9GAMM/10-345-------------YDY--LD.....NIKWVLT-----------------------ILVIL.HHCAS...TAGL-------
A7A7B8_BIFAD/5-363-------------VVG--YD.....IIKSMAM-----------------------FFVVM.LHYSFYTRFYSS-------
Q4JYU7_STREE/6-318-------------NIN--LD.....LLKVLAC-----------------------VGVVL.LHTTM...GGFK-------
A9VR59_BACWK/5-346-------------APE--FK.....VLQSIAF-----------------------LAVVLQSSLLY...TMNQ-------
A7VGI1_9CLOT/6-345-------------NGA--LD.....FWKFVFC-----------------------LVILV.FHVGE...VYGG-------
Q1QR03_NITHX/14-320-------------VDW--VD.....YAKGICI-----------------------IMVVM.MHSVQ...GVEK-------
A5ZDF6_9BACE/13-326-------------IAW--LD.....NVKMFAM-----------------------LCVIL.GHVMT...IVIK-------
Q16FE1_AEDAE/161-554-------------FQY--IE.....GVRVLTC-----------------------LTIVF.MHTRY...EPLM-------
Q7CTZ0_AGRT5/8-329-------------SSR--IN.....LMRILLI-----------------------SGIVF.VHVPH...DAET-------
Q8G7P7_BIFLO/17-373-------------DVN--YD.....LLRVVAM-----------------------CLVIG.VHVIN...NYMP-------
A1R1G8_ARTAT/18-357-------------DPA--ID.....LVRFICL-----------------------LLVVA.AHCMM...VSPV-------
A1VHZ4_DESVV/11-319-------------NDT--VQ.....ALKQLFL-----------------------LVICY.GHIFA...EGPA-------
A0QPG5_MYCS2/9-326-------------NNA--LN.....ALRLLLA-----------------------VGVIL.WHSWP...LSGH-------
A5EXU9_DICNV/19-351-------------QYE--ID.....IARGFAI-----------------------IFMVW.VHVME...EMDS-------
A6LGX6_PARD8/9-311-------------YGA--LD.....AMRILAA-----------------------FSVVC.IHYQI...VPGS-------
Q11WP3_CYTH3/4-324-------------RIG--PG.....YFRYFLC-----------------------IVVVL.FHSTN...YI..-------
A0K1D5_ARTS2/296-671-------------DSR--VD.....LMRGLAI-----------------------LFVVV.NHVGM...TSLF-------
A6KYR5_BACV8/6-309-------------HSG--LE.....CLRIISI-----------------------ILIVS.MHILG...NTFH-------
Q0CZ95_ASPTN/77-482-------------TAY--LD.....GLRGFAA-----------------------LLVYWAHHQLW...AHDG-------
A0T1U4_VIBCL/8-303-------------NFK--ID.....LLRSVGL-----------------------LLIIL.AHVLPPEIIF..-------
A3I592_9BACI/6-352-------------IDE--LN.....ITRALAI-----------------------LAVLL.IHSTS...TPVT-------
A1TDU0_MYCVP/22-361-------------DRA--ID.....VIRIVAL-----------------------VGVVV.GHTVM...ATSI-------

PF07786

A1HQT7_9FIRM/5-214-------------RIWE-ID-----ALRGLAI-----------------------VLMVV-FHLVV---DLKD-------
A2SQB7_METLZ/5-231-------------RYFE-LD-----AARGIAL-----------------------ILMIL-YHILF---CLYF-------
A9CIY2_AGRT5/15-234-------------RIGG-LD-----TLRGLAL-----------------------LAMAS-YHFTW---NLEY-------
Q28R74_JANSC/28-249-------------RIPA-LD-----IARTGAL-----------------------AAMVL-FHFVF---DLEM-------
Q8PXM0_METMA/7-237-------------RFWE-ID-----CLRGLAI-----------------------ILMLA-YHFLY---DLDF-------
A4EC93_9ACTN/4-221-------------RITI-FD-----TVRGFTM-----------------------ISMAG-FHACY---DLAY-------
Q8U2K3_PYRFU/23-240-------------RFWE-ID-----FARGIAL-----------------------TMMLI-SNFVT---DLQF-------
A7I8Y9_METB6/6-231-------------RYPE-ID-----LLRGIAL-----------------------LMMIL-FHTLF---DLAF-------
A6G0Y4_9DELT/12-237-------------RVEI-ID-----IGRGVAV-----------------------VLMIM-VHTMW---LYAD-------
A3CVR7_METMJ/5-231-------------RYWE-ID-----LARGVAV-----------------------VTMIV-FHSAF---DLNF-------
Q11IW8_CHESB/30-251-------------RIEL-ID-----IARGVAL-----------------------VAMAI-YHFTW---DLDF-------
A1TRD1_ACIAC/21-249-------------RADS-VD-----ALRGVAM-----------------------VWMTI-FHFCF---DLSH-------
A2SGN2_METPP/12-230-------------RHAR-LD-----ALRGLAI-----------------------VWMAV-FHFCF---DLAH-------
A2STU6_METLZ/14-241-------------RYWE-ID-----AIRGFSL-----------------------LAMIA-FHTVF---LLGV-------
Q2K839_RHIEC/16-243-------------RIGL-LD-----TARGIAL-----------------------IAMAS-YHFTW---DMEF-------
B8FY44_DESHD/5-221-------------RFPI-ID-----SLRTLAL-----------------------ALMIT-YHLIY---DLDQ-------
A0NYA1_9RHOB/5-227-------------RLAV-LD-----LARGLAV-----------------------VAMAI-YHFSW---DLSW-------
Q21VS3_ALBFT/16-244-------------RFDA-VD-----ALRGLAM-----------------------VWMTF-FHFSF---DLNQ-------
Q0FKK0_PELBH/7-221-------------RVGW-ID-----LARVAAL-----------------------AGMVV-FHFAR---DLEI-------
B2S625_BRUA1/16-233-------------RLGR-ID-----IAHGIAL-----------------------IAMAI-YHFGW---DLEF-------
A2STU5_METLZ/19-252-------------RYWE-ID-----AVRGLAL-----------------------FGMLY-FHFLA---CLVM-------
Q6SHI3_9BACT/5-214-------------RDSA-LD-----LMRGLAI-----------------------IMMIA-FHFIY---DLNS-------
Q0G6B2_9RHIZ/53-275-------------RIDT-ID-----VARAIAL-----------------------IAMAI-YHFAW---DLDN-------
A3YBL4_9GAMM/14-227-------------RSSS-LD-----LYRGLAV-----------------------LLMII-FHLCW---DLRE-------
A4FZP9_METM5/5-227-------------RYLE-ID-----FFRGIAI-----------------------ILMVI-SNFVT---DLKY-------
Q11N89_CHESB/6-227-------------RVVA-ID-----VARGLAI-----------------------AGVVL-FHIVW---DLEF-------
A4J1M2_DESRM/9-218-------------RLWE-LD-----FLRGVAI-----------------------LLMVF-FHLMY---DLHE-------
Q6SGH9_9BACT/9-218-------------RDQA-LD-----LMRGIAI-----------------------IMMIM-FHLIY---DLNE-------
A1VNB1_POLNA/5-231-------------RFDS-LD-----ALRGIAI-----------------------VWMTA-YHFCF---DLNH-------
A3DGD5_CLOTH/11-220-------------RIWE-ID-----VLRGILV-----------------------IIMVV-LHILF---DLEF-------
Q98KU6_RHILO/16-237-------------RIIA-ID-----IVRGIAL-----------------------LAMAS-YHFTW---DLEF-------
A6VZM7_MARMS/12-224-------------RSAF-LD-----VYRGSAV-----------------------LLMII-FHFCW---DLLN-------
A1W6I8_ACISJ/12-240-------------RHDR-LD-----ALRGFAM-----------------------VWMTA-FHFCF---DLSH-------
Q6M0I2_METMP/11-233-------------RFLE-ID-----FFRGLAI-----------------------IMMVI-SNFVT---DLKY-------
O26882_METTH/9-227-------------RFGE-VD-----ALRGAAV-----------------------LMMIV-YHTLF---DLDF-------
F6BVW5_SINMB/23-246-------------RMVL-LD-----ALRGLAL-----------------------VAMAL-YHFVW---DLEF-------
B1ZHM9_METPB/15-237-------------RIDA-LD-----LARGAAL-----------------------AAMAT-YHGLW---DLGF-------
Q2Y4H0_9ARCH/17-243-------------RFWE-ID-----FLRGIAI-----------------------IMMIT-FHLLY---DVNY-------
O29726_ARCFU/2-207-------------RYPE-ID-----IARGAAV-----------------------ILMLL-FHSFF---DAHY-------
Q12ZG6_METBU/7-234-------------RKWE-ID-----LLRGIAI-----------------------TLMVF-FHLLY---DLYY-------
A4BIP8_9GAMM/6-220-------------RLIL-ID-----QFRGIAV-----------------------ILMAI-FHFCY---DLSV-------
Q8THP4_METAC/31-261-------------RYWE-ID-----CLRGFAV-----------------------ILMLG-YHFLY---DLDF-------
Q46DC7_METBF/7-237-------------RFWE-ID-----CLRGLAV-----------------------LLMLL-YHFLY---DLDF-------
Q2FN30_METHJ/7-229-------------RYPQ-LD-----ACRGIAV-----------------------LMMIW-FHFFV---DLAF-------
Q1YI63_MOBAS/15-237-------------RIDI-ID-----IARAVAL-----------------------FAMVI-YHFTW---DLEF-------
Q1B004_RUBXD/18-243-------------RYWD-VD-----AARGVAM-----------------------GMVVL-YHLVF---DLDN-------
A6FRV3_9RHOB/4-228-------------RIMV-LD-----ALRAIAL-----------------------IGMVV-FHFVF---DLEL-------
Q1YJ44_MOBAS/24-246-------------RYVF-VD-----VWRGLAI-----------------------IGVVI-YHFGW---DLSF-------
Q26I67_FLABB/5-236-------------RLFF-ID-----AVRAFAI-----------------------IMMLQ-GHFID---TLLA-------

PF05857

A6TIJ3_KLEP7/24-240-------------GQ---TD-----MIKTVAL-----------------------VLMVT-DHTG.---..LL-------
Q5NWL3_AROAE/9-222-------------GS---LE-----ALKWIAL-----------------------LLMTG-DHVN.---.KYL-------
Q88AH9_PSESM/14-243-------------KA---LD-----LLKWLAM-----------------------LSMVL-DHLR.---...Y-------
A6M0I9_CLOB8/13-266-------------FS---GF-----SLKIIAL-----------------------VLMTM-DHMH.---.EFL-------
C1DKH3_AZOVD/14-243-------------AA---LD-----LLKWLAF-----------------------ASMLL-DHLR.---...L-------
A4XUI8_PSEMY/4-231-------------TS---LD-----LVKWLAM-----------------------LTMVI-DHLR.---..YL-------
A4XH28_CALS8/24-230-------------SK---SN-----LLKLIAA-----------------------ASMLI-DHIG.---..YL-------
A1WDN4_ACISJ/11-221-------------..---VE-----ALKWLAL-----------------------ALMTG-DHVN.---.KYL-------
C4YYW6_9RICK/13-242-------------..---QD-----LLKTLAI-----------------------IAMII-DHVG.---..LY-------
Q326X1_SHIDS/32-247-------------.Q---RD-----IIKTVAL-----------------------VLMVL-DHIN.---..LI-------
Q8P901_XANCP/6-212-------------..---RE-----LVKWLAL-----------------------LFMTG-DHTL.---.KIL-------
R5K8R7_9CLOT/9-229-------------.S---GA-----QLKYIAF-----------------------ASMLI-DHVNK---TFFI-------
R5KLN1_9CLOT/10-244-------------.T---SN-----QLKLLAC-----------------------IFMLC-DHVG.---..LV-------
R5QZC4_9FIRM/5-243-------------IS---GS-----TLKILAM-----------------------IFMVI-DHFG.---..QV-------

PF16401

H1Y6N2_9SPHI/12-268-------------RANS-LD-----ALRGTAI-----------------------LLMVLSGSIAFGGILPGW-------
G8TDM1_NIAKG/23-280-------------RNKS-LD-----ALRGFAI-----------------------LAMVLSSSIAF.CILPAW-------
F0SC25_PEDSD/7-264-------------RDSS-LD-----SLRGIAI-----------------------ILMVLSGSIAF.SILPGW-------
R6N358_9BACE/4-263-------------RALA-LD-----ALRGYAI-----------------------ITMVLSATIIS.SILPGW-------

PF04235

Q8EH35_SHEON/199-352-------------LYR--QG-----IFE.QGF-----------------------NRNTL-LKLAL--------------
YXAH_BACSU/242-392-------------AAK--SR-----YLH.EPE-----------------------KHRKG-LKRLW--------------
A5VFY1_SPHWW/226-385-------------LYR--IG-----LFD.SRF-----------------------EERRL-WQMVR--------------
B0T5F0_CAUSK/216-381-------------LGR--SG-----FFE.TPQ-----------------------RYVTA-RRLVL--------------
Q5LBX3_BACFN/231-393-------------IGR--KQ-----LFV.ASE-----------------------ATIRF-WVKAL--------------
A8FJB9_BACP2/218-375-------------MMR--AG-----VFY.ANE-----------------------RGQSL-RKRLF--------------
Q8ZNL6_SALTY/215-375-------------LMR--SG-----WLK..GQ-----------------------YSLRH-YRRTG--------------
Q5Z0S5_NOCFA/200-354-------------AAQ--RY-----RLLERAV-----------------------ERPAW-LVAVF--------------
Q5LAR8_BACFN/229-391-------------VGR--KG-----LFL.YSE-----------------------QNEQH-WLKAL--------------
A5FKP1_FLAJ1/222-380-------------LQK--ID-----FFD.RLN-----------------------EMKKR-LLYVL--------------
A6LH60_PARD8/231-393-------------IGR--RK-----LFI.SSE-----------------------ENSRF-WIKTL--------------
Q2NUE2_SODGM/217-377-------------LMR--NG-----WLA..GR-----------------------REPEH-YRRMA--------------
Q5L251_GEOKA/223-378-------------AAD--QR-----WLE.ADR-----------------------HSPAK-LRRLM--------------
B9LP38_HALLT/238-398-------------LYR--WG-----VLT..GE-----------------------RSSAL-YRRLV--------------
Q5WBU3_BACSK/218-382-------------AGR--KG-----LLN.ESP-----------------------KNKPF-LKKAA--------------
Q5LDG8_BACFN/245-405-------------IGR--KQ-----IYA.DLE-----------------------ANRVL-LKKTV--------------
Q2N5U1_ERYLH/237-397-------------LWR--NG-----LFK..GE-----------------------WRTFR-LQRLA--------------
Q1D273_MYXXD/254-423-------------AGR--LL-----LLQ.DVE-----------------------RHRAL-LRRIL--------------
Q0RI89_FRAAA/226-396-------------AAR--RR-----ILE.DPA-----------------------AHRPL-LRRVA--------------
Q1GR12_SPHAL/244-406-------------LFK--SH-----MLT..GE-----------------------WEAAR-YRKWA--------------
A3HTP0_9BACT/227-391-------------FGK--NQ-----YHK.DLK-----------------------SLVKL-IKKPV--------------
Q0C162_HYPNA/232-392-------------AVK--AG-----VID.QPK-----------------------ARIWV-LSRWV--------------
Q9X356_BACAN/222-381-------------AGK--KN-----IFK.RIP-----------------------GLIKK-IRFLQ--------------
A8FH56_BACP2/222-385-------------FVK--MA-----FFK.NME-----------------------AKKTI-WNRIW--------------
Q5WCD3_BACSK/239-403-------------MGK--AG-----MFH.DVK-----------------------ANVTR-WKRLC--------------
A4GA59_HERAR/238-403-------------SVR--LG-----WLT.QPA-----------------------RHITF-WRRVQ--------------
YRKO_BACSU/224-387-------------FVK--ME-----FFK.DME-----------------------AKKPI-WKRIW--------------
Q47SA7_THEFY/269-436-------------AAR--RR-----ILE.EPG-----------------------NHLRL-LRITA--------------
Q21P05_SACD2/237-402-------------FGR--FG-----FFH.TIS-----------------------QHKRT-LKRSL--------------
A4FQ93_SACEN/204-361-------------LMR--AG-----VFG.DDQ-----------------------RGRRL-RARLM--------------
Q3IC82_PSEHT/208-361-------------LYK--QQ-----VFA.SGL-----------------------SAKQL-ILVIS--------------
Q2NDD6_ERYLH/264-425-------------LYQ--FG-----FFS..GG-----------------------LDPGK-MKRWG--------------
Q9HNH9_HALSA/232-393-------------LFH--TG-----VTT..ND-----------------------RSRAF-YRRLV--------------
Q9KFW4_BACHD/1-165-------------MAR--KH-----LLT.EAH-----------------------LHRKQ-LRRMA--------------
Q8ERW4_OCEIH/226-381-------------AAR--KK-----WFH.HPE-----------------------KYQQK-LTVIW--------------
Q7N6K6_PHOLL/210-370-------------LMR--NG-----WLK..GE-----------------------FSVSH-YRNVA--------------
A4ARZ9_MARSH/230-396-------------AGR--IG-----FFK.TLN-----------------------EHKTL-LKKIL--------------
B1YLL9_EXIS2/215-367-------------LME--RF-----TVR...P-----------------------PATRT-IRLVF--------------
A6L2L4_BACV8/234-394-------------IGR--KG-----LFL...K-----------------------EHLKV-WNKVL--------------
A1WTH2_HALHL/248-410-------------AYK--NG-----FLT..GA-----------------------WSSRA-YARVV--------------
A1S3E3_SHEAM/216-369-------------LYR--SH-----FFN.EGL-----------------------TDAAR-IRLLL--------------
Q9AA92_CAUCR/270-432-------------LFK--TG-----FLT..GK-----------------------AKTWV-YLLLI--------------
Q0ARL9_MARMM/225-387-------------LFK--SG-----FLS..AS-----------------------WGSVR-YGILA--------------
Q07YN3_SHEFN/228-381-------------LYK--RN-----IFV.DGL-----------------------DNKTL-WQCVF--------------
A8F9F5_BACP2/224-375-------------IGK--KG-----HLT..EE-----------------------DRGMA-YRRGW--------------
A6L9Q0_PARD8/227-389-------------LGR--KG-----LFV.DPE-----------------------KHRTF-WTRTF--------------
B0T422_CAUSK/230-391-------------LYK--LG-----VLT..GK-----------------------ASTGL-YQGLI--------------
A6WB03_KINRD/147-299-------------LVR--CG-----AIA.RLE-----------------------SSPRA-VAVLL--------------
Q47R13_THEFY/238-395-------------LLR--AG-----AFH.PDV-----------------------SGRRL-RVRLA--------------
A8MJB9_ALKOO/219-378-------------VGK--KD-----VFS.RIE-----------------------ELAGI-LRKMQ--------------
A6TNH6_ALKMQ/249-412-------------CGK--LN-----IFN.KLD-----------------------ESDTF-IKKGW--------------
Q1D7M3_MYXXD/255-425-------------AGR--RG-----IFQ.DVP-----------------------SHLGF-FRRLL--------------
Q6NJJ5_CORDI/212-362-------------WAR--RG-----VLA.DVH-----------------------QHRTE-LYIWS--------------
A5UQH7_ROSS1/237-401-------------FGK--RQ-----IFQ.RLN-----------------------EKPAS-ERRLP--------------
A7MLK3_CROS8/215-375-------------LMR--SG-----WLR..GE-----------------------FSLRH-YRRTG--------------
Q9KE13_BACHD/42-195-------------VHR--KG-----WIA.NAA-----------------------EHKAI-FKRML--------------
A8GC25_SERP5/223-383-------------LMR--SG-----WLR..GT-----------------------YSPGY-YRRQA--------------
Q8A424_BACTN/229-391-------------IGR--SN-----AFL.YSE-----------------------KNIKI-WIKVF--------------
Q9KFA2_BACHD/226-379-------------FMR--AG-----AFS.PDQ-----------------------HGKRI-RRKLL--------------
Q9KEU3_BACHD/250-400-------------FAK--AR-----ILH.DPD-----------------------KHQRI-HRILW--------------
A4FQT6_SACEN/171-324-------------AVR--CG-----LVE.TLD-----------------------HRTRQ-LGVVF--------------
A6TBN7_KLEP7/215-375-------------LMR--SG-----WLK..GQ-----------------------FSLRH-YRRTG--------------
Q4KHM8_PSEF5/226-387-------------AGR--NK-----LLV.APY-----------------------AFEPH-LARLL--------------
A4F774_SACEN/171-329-------------LVT--GF-----ALA..QL-----------------------GLPNA-LDRLG--------------
Q9K7D7_BACHD/224-377-------------AAK--RK-----WFV.HPA-----------------------QEQGR-YRKGL--------------
A6KYE7_BACV8/229-390-------------IGR--KQ-----LFV.TSE-----------------------KHTRF-WVKAL--------------
Q2G3S1_NOVAD/241-402-------------LLR--SG-----FFT...T-----------------------WPKRS-LGWIA--------------
Q1IVW5_DEIGD/222-381-------------AQR--FG-----LLT.RPQ-----------------------AHLPL-LRRLA--------------
A4AN58_MARSH/230-392-------------LGK--KK-----LFV.DSE-----------------------KSNKF-WKRTL--------------
Q9RS74_DEIRA/223-382-------------AAR--AE-----VLT.RPE-----------------------RFGWL-FRRLT--------------
A3HYS5_9BACT/265-426-------------LFR--WG-----FLT..GE-----------------------KPASQ-YWLMV--------------
Q6D3N4_PECAS/227-387-------------LMR--SG-----WLK..GE-----------------------FSTAH-YRNVA--------------
A5FKP0_FLAJ1/222-380-------------LQK--LN-----FFN.RLI-----------------------ELKKL-LQYVC--------------
A6LGL5_PARD8/234-396-------------VGR--IR-----LFQ.RMD-----------------------EFRSR-LNYGA--------------
Q3IPY1_NATPD/256-418-------------LYK--YG-----IIS..NR-----------------------RASRF-YRRLL--------------
Q5YUW9_NOCFA/233-388-------------LFR--AG-----VFR.PEG-----------------------..ARI-RKRLM--------------
Q9K6N5_BACHD/237-398-------------VAK--TE-----RYR.NLQ-----------------------QQKPF-LKKVW--------------
Q8EL60_OCEIH/225-388-------------LAK--KQ-----LLT.KPE-----------------------LHLQS-LKLLS--------------
A9WKI7_CHLAA/242-404-------------.GK--RR-----LVQ.HLY-----------------------EQPAV-QRRLP--------------
B0RFW7_CLAMS/254-423-------------LGR--RR-----VLE.DPA-----------------------AHLPL-LRTLA--------------
B1HN91_LYSSC/223-376-------------.SK--WR-----LVE.RAK-----------------------ELKWL-WLALA--------------
B1HPE9_LYSSC/165-337-------------AGQ--YR-----LFE.NIS-----------------------VHRKK-IMLVT--------------
B1HRQ0_LYSSC/190-342-------------.AK--AG-----WIG.HIG-----------------------AHIQK-IKWLL--------------
B1HW32_LYSSC/220-369-------------FMR--NE-----VFS.PTS-----------------------KGYQA-RQKLF--------------
B1HYB2_LYSSC/222-372-------------LAK--KQ-----AFV.KMD-----------------------EEVKW-YKLGA--------------
E3FDU1_STIAD/253-420-------------AGR--HR-----LLQ.EPE-----------------------RHQPL-LRRLL--------------
E3FTX2_STIAD/250-412-------------...--RR-----LLP.DPL-----------------------AHRML-LIRVL--------------
Q74VB6_YERPE/216-374-------------LMR--CG-----WLR..GK-----------------------FSLRH-YRRLA--------------
Q7VYP4_BORPE/228-388-------------LGR--RH-----ALA.DPL-----------------------AHPRL-LRAVL--------------
Q812K5_BACCR/224-376-------------.GK--KG-----WLF.EVS-----------------------KHIPA-VKKIW--------------
Q81SQ3_BACAN/217-376-------------AGK--KD-----IFR.RTK-----------------------ELDPK-LKKWQ--------------
Q8NMY9_CORGL/70-221-------------LVR--YG-----VVD.RAE-----------------------NAPRA-MGVFF--------------
Q8P7N0_XANCP/245-401-------------.VR--SG-----AIA.APE-----------------------RFVRL-FGWLR--------------
Q9PFK6_XYLFA/262-418-------------.VR--SG-----AIL.QPE-----------------------RYRRL-FAWLR--------------
R5USE5_9BACE/227-387-------------IGR--KQ-----LFV.TTE-----------------------SHLKF-WVKAL--------------
R6X5K4_9PORP/228-389-------------MGR--RQ-----LFA.NLS-----------------------EHRVF-WMRTL--------------
U5L4L4_9BACI/226-379-------------AAR--RR-----AFH.EIG-----------------------RNKSR-YLLWG--------------
U5L6C6_9BACI/232-386-------------AAK--LK-----LLE.KLA-----------------------NFQKR-AAIMF--------------

PF07779

U1HPB3_ENDPU/212-693...FDKTCCNVQ.PPINLEQ-----QVLIFVA.......................TLTIL-YAFYSASKRKML.......
Q6CDI8_YARLI/311-778..PFSDTCCIHYKQPRTMGQ-----VLLLGVI.......................CAILP-IIYLGQRYTRSDYYPRFVR
Q9W4P0_DROME/351-846MNYNDGTCCSSS.EPYTTLQ-----IVAYALFGV............CMALV....CGMCL-RRWVLHLRGQTL.......
F6X8U0_XENTR/294-776VNPIDGSCCQPT.PSLTIIQ-----KLAACFFIF................A....MIAFV-SVTIVQRNKHRR.......
K1QBI1_CRAGI/299-786MNHNDGTCCRVP.DSITSIQ-----IITAAFFLV............CLLSA....IAMFL-YRRRIRRNGSKA.......
B7Q496_IXOSC/303-799MNYNDGTCCSSS.EPVTMLQ-----IITFSAFGV............ISILA....LAMIV-HRHLQLRRARAF.......
T1INP0_STRMM/300-790MNYNDGTCCSRA.EPITTLQ-----IISLSSLGILYDFIARKIVFFSVLVA....FLMIL-HKRKLKKNVRRS.......
H2Z694_CIOSA/175-652..TVDGTCCKKP.DPVTVVQ-----IILATFGSL............WFVYH....FCFVV-VNLVQKHVQRPS.......
D6WF47_TRICA/333-815MNFNDGTCCSST.ETYTTLQ-----IVTFAILGI............CASIA....IVMLC-TRLIMKWRGRPI.......
W5MY98_LEPOC/349-830LKPIDGSCCHPR.PPLNIVQ-----KLTAGVFAS................A....IMSFL-VLNLLCYSKHRR.......
G3NTP4_GASAC/295-774LRPIDGSCCQTF.ASPNLLQ-----KLSACIFAG................S....AAALL-VFHLLGRNRHRR.......
E9GCH2_DAPPU/313-803MDFNDGTCCRSP.ESATTLQ-----IVTFTILLTLMEAEDDEMAKKDVVVANGHSTVVVA-EGFDEKATTAHR.......
E9C8Z6_CAPO3/466-972....DVTCCAPY.PALTGLQ-----YVFFAV........................VLFAL-VCWLGGSYAARH.......
L2GH03_COLGN/240-722....QVTCCAPY.PSLSRVQ-----VLLLGLS.......................ILALP-ILFLDRRQDAFP.......
E0VHC9_PEDHC/297-768MNFQDGSCCSSA.EQYTSLQ-----IITFFVLFI............CFLLA....VLAKF-IETFKKSKNKTE.......
F6XMQ8_CIOIN/290-767.HATDGTCCRKP.DPLTIVQ-----IIMAVLG...............FILL....GILLA-VGIRIQRIGKPT.......
H2QUY3_PANTR/295-776LKPVDGSCCQPR.PPVTLIQ-----KLAACFFTL................S....IIGYL-IFYIIHRNAHRK.......
T1G7I3_HELRO/252-726MNFDDGSCCTSP.ENPTTVQ-----IAMAAFFAT............SLAAA....VLIAT-CRRLNGRSNKNN.......
Q17CG6_AEDAE/303-783MNYNDGTCCSSA.ESYTIIQ-----VVTYATLGV............CLAIA....CAMIV-RRWLLKLRGVNI.......
H3A7E5_LATCH/298-779LRPNDASCCLPK.PSFTVIQ-----KLTACFFGI................S....IIGFL-IFSYLFRNNHKK.......
H9KE76_APIME/294-775MNFDDGSCCSYP.EPATILQ-----LLSLSILAL.....................CIIIG-GGMWLYRKFCYY.......
S8EFZ6_FOMPI/324-771TFPMDRTCCRRY.PWPSALH-----SLVLAVA.......................VFWGP-ACVLLARRVAPP.......
X1WW08_ACYPI/313-776MNFNDGTCCSST.EPYTSLQ-----SYMLVFFII............CIFIG.....ILMA-VRYRQNRLSKNE.......

PF10129

A1R109_ARTAT/441-826--FQ.LLSQ----------------------ET----------------------------------LGVV-SGAELFVM
A0K1D5_ARTS2/295-678--FQ.LFTQ----------------------ET----------------------------------IGFV-SGAELFVL
A2SCM7_METPP/4-366--AD..PLG----------------------QP----------------------------------FGYV-SAAEGFVL
A1TNJ8_ACIAC/18-379--TM..PLG----------------------QP----------------------------------FGFV-SAAEGFVL
Q1D6T0_MYXXD/55-417--NT..ISN----------------------QP----------------------------------FGFV-SAAEGFVF
Q11B97_CHESB/2-386--LLVKFNH----------------------SE----------------------------------LGYV-QDAQGFVF
Q7CT44_AGRT5/2-385--WLVEINH----------------------RQ----------------------------------FAFV-EDAQGFVF
B2JS58_BURP8/58-406--LS.RATL----------------------HA----------------------------------YALC-DAAEVFVF
Q13NS3_BURXL/7-355--LS.RVTL----------------------HA----------------------------------YALC-DAAEVFVF
Q1LDM8_RALME/9-370--LA.DYTI----------------------RN----------------------------------FTLF-DAAEVFVF
A1B1M7_PARDP/3-363--LR.KLTL----------------------TN----------------------------------FAVF-DAAELFVL
Q5FTQ3_GLUOX/17-367--LN.RITI----------------------RN----------------------------------FGFA-DAAEIFVM
Q89UF3_BRADU/67-422--VN.LLTL----------------------RN----------------------------------FGFS-GAADLFVF
Q89KT4_BRADU/82-438--LV.WFTT----------------------RN----------------------------------YGFS-DGADLFVL
A4YU73_BRASO/12-368--VN.WITT----------------------RN----------------------------------YGFS-DAADLFVF
Q6N6S8_RHOPA/12-368--VN.WITT----------------------RN----------------------------------WGFS-DAADLFVF
Q1QFJ8_NITHX/39-395--VA.WITI----------------------RN----------------------------------YGFS-DAAELFIF
Q89VE5_BRADU/37-393--LT.WFTI----------------------RN----------------------------------YGFS-DATEIFIF
Q6N0J3_RHOPA/44-400--LT.WFTL----------------------RN----------------------------------YGFS-DATEIFIF
Q3SWD7_NITWN/36-392--LT.WLTI----------------------RN----------------------------------YGFS-DATEIFIF
Q89CC1_BRADU/15-372--VA.WLTL----------------------RN----------------------------------YGFS-DAAEFFVF
A4YYN0_BRASO/36-389--LA.WLTL----------------------RN----------------------------------YGFS-DTSEVFVF
Q89EQ8_BRADU/32-383--GS.WLTL----------------------RN----------------------------------YGFS-DAAEVFMF
Q87XJ3_PSESM/5-366--LA.QLTV----------------------RN----------------------------------FGFS-DAAEIFVF
Q0BVC0_GRABC/14-370--LG.ELTL----------------------KN----------------------------------IALS-DAMEVFVM
A5G015_ACICJ/9-360--LA.RFTV----------------------RN----------------------------------LALN-DATEIFIL
B0U809_METS4/3-358--FE.SFTY----------------------SQ----------------------------------YGTS-DAAELFVF
Q2K344_RHIEC/23-378--FE.YVTT----------------------KN----------------------------------FGFS-DAAEAFVL
Q2YRC8_BRUA2/6-358--YE.HFTH----------------------KN----------------------------------LGFS-DSAEAFVL
Q983D5_RHILO/37-389--FE.ALTY----------------------KN----------------------------------FGFS-DAAEAFVL
Q6G5Q7_BARHE/16-368--YE.SLTH----------------------RN----------------------------------FGFS-DSAEVFVL
Q3J1N1_RHOS4/11-372--WE.NFTS----------------------RN----------------------------------FGFS-DAAEGFVL
Q11DW2_CHESB/11-364--FE.NLTS----------------------RN----------------------------------FGFS-DAAEAFVL
Q1GGF0_RUEST/47-428--WT.GWIP----------------------AR----------------------------------FGFS-DATEIFVF
Q169P8_ROSDO/29-397--LT.LWIP----------------------AR----------------------------------FGFS-DATEVFVF
Q0BQN1_GRABC/63-424--FS.HLMP----------------------AS----------------------------------FGFS-DAACIFFF
B0RH46_CLAMS/492-873--YS.YVTI----------------------NA----------------------------------IGAI-TGAEMFVL
B4EL00_BURCJ/18-366--LS.RVTL----------------------HA----------------------------------FALC-DAAEVFVF
B4ELU9_BURCJ/9-352--LS.RVTL----------------------HA----------------------------------YALC-DAAEVFVF
E3FIJ7_STIAD/5-384--LV.KLNH----------------------GE----------------------------------LGYV-QDAPGFVF
Q13QD3_BURXL/18-362--LS.HLML----------------------HA----------------------------------YALC-DSAEVFVF
Q5LPG0_RUEPO/27-401--WA.GWIP----------------------AR----------------------------------FGFS-DATEIFVF
Q63IA9_BURPS/14-358--LS.RVTL----------------------HA----------------------------------FALC-DAAEVFVF
Q6NAS6_RHOPA/6-361--LN.WFTL----------------------RN----------------------------------YGFC-DAAEFFVY
Q92L11_RHIME/23-374--LE.YLTH----------------------KN----------------------------------FGFS-DSAEAFVL
Q9KQQ7_VIBCH/3-361--LQ.MITH----------------------EP----------------------------------VGVF-GAAEGFIF

PF01757

A8DMZ1_STALU/12-334--GIDGDDL----------------------RQLKVIYYA..........................QNIFI-FGTPCFII
K6RN31_LACCA/20-369--QTSSGLI----------------------STGFLATH............................LMIH-FTRMGFMF
A8G974_SERP5/5-314--ISPDIPV----------------------YHMVNSIDIEM......................FVGLFGK-ICVSMFLF
Q11WN8_CYTH3/14-339--GKIGSML----------------------F...................................AFGQ-EAVMIFFV
A7LV98_BACO1/4-296--DNKGAD.----------------------....................................YLYL-FHVICFFI
F0K6S5_CLOAE/6-334--.......----------------------....................................FVYS-YHVVLFFF
A0A009DRR0_ECOLX/9-357--HTWHVNS----------------------AEPSLWLTLF........................NDFIHS-FRMQVFFV
Q07PA2_RHOP5/14-375--GFWVIVD----------------------SHPSRVLAAF........................IFVSHT-FRMTTFFV
Q30BE9_ENTFL/7-326--SETGNFI----------------------FTR.................................IVSR-VAVPFFFM
A1HPJ5_9FIRM/6-350--NPEVNVH----------------------LFALME..............................IFTR-FSVPIFFF
Q4P0M9_USTMA/127-516--PGTIQNG----------------------TPVGL...............................LRSP-IGLVLFYM
A7LV97_BACO1/24-312--DGVS...----------------------....................................LLTE-IAVPYFFI
Q1QWT8_CHRSD/4-315--SDLGYQL----------------------TVQ.................................GLFR-IVVPIFMM
Q2T7M4_BURTA/6-373--YLASLFR----------------------PVPFLIQPSALERWIS.............IPPLTLAYSAD-AAVCVFFV
A4B9D7_9GAMM/5-375--NDSLLSE----------------------MVQTFG..............................IMAQ-AGVSVFFV
A0A015ULW8_BACFG/8-315--YSYLA..----------------------....................................TGGA-IGDALFFF
M6C4Z5_LEPBO/44-373--FGPGENA----------------------SLLTLALS............................NLFR-FGVPAFVL
A5ZUV3_9FIRM/6-346--PVLLGQL----------------------QVSFPLWNIEN......................LLFTIGR-IGVPLFLA
A1VGB5_DESVV/30-339--NFLGSPL----------------------WFVAMGNA............................VITH-LAVPMFFM
B2JGA6_BURP8/53-400--LPAWLQA----------------------LA..................................DMGQ-YGVQLFFV
Q9XAP7_STRCO/24-348--.......----------------------....................................GLVL-PSMGIMFG
Q07KV2_RHOP5/17-343--FAVAAIQ----------------------SAPLYK..............................PFGG-IGVEIFFI
Q484G4_COLP3/18-372--WGFHIES----------------------GYNSTFLKTI........................MILSSK-WRLDILFL
A0DGZ8_PARTE/156-556--ATFQTEL----------------------LVALQSQRAI........................ITVDML-YSVDIFFW
A7A7L5_BIFAD/6-324--DVLKLPL----------------------GPERIFFQLV........................MQGGGK-VGVVIFFS
A3JPT3_9RHOB/10-350--PDASPPE----------------------RLGPLVFRM...........................IIYT-ARTELFLI
A5EMI0_BRASB/26-386--FGHTDPT----------------------SFIGFDGIV..........................LATDS-FFMAMFFF
A4FKM9_SACEN/20-347--LHPELES----------------------RELV................................FPYQ-VGASLLLL
A7V903_BACUN/5-297--YPYAKQ.----------------------....................................IVYT-FHMSAFLI
Q8IG66_CAEEL/330-720--FTDTIRS----------------------VARKGESVVGWR.....................NFMMNSS-LAVDTFLF
Q7UES3_RHOBA/12-486--DAGRGWP----------------------IQDSQSSQITSL.....................FIAMVHG-FRMPLFFL
D8IMM9_LACSC/4-332--NYFSN..----------------------....................................ILFA-VNVPIFFV
Q8PXP5_METMA/13-333--SDAIFIS----------------------K...................................YLVV-FGLSLFTF
Q6AH04_LEIXX/3-320--SPFPLKL----------------------LN..................................FSDH-FAMPLFAV
Q5CVD7_CRYPI/23-437--GITRSEK----------------------EIVRQMIV............................FFSE-FGMPIFFY
A0LT35_ACIC1/10-359--YHGRTFS----------------------AEDAITGVSFG......................PWLTLLF-QVVPLFFF
Q8KJJ2_RHILI/23-344--QGTDAFW----------------------LSPYFK..............................SIYM-FHMPLFMA
Q17BV3_AEDAE/212-599--PFTNRNE----------------------FTESFNTPWSV.......................ALRVLM-LYADVYLV
A7F3R9_SCLS1/8-361--DLFLPSS----------------------GEGLRPRFLQLPL...................LRVLVQGR-IGVTIFSL
Q144E0_BURXL/4-320--AGFLQDG----------------------HVARLMKILL.........................YAAST-LGYPTLFF
Q83YQ9_STRGN/5-307--GVFYQ..----------------------....................................IVAR-FAVPFFMM
Q07P25_RHOP5/21-323--ADIFPGE----------------------ALAQWMDY............................TLYT-FHMPLFFF
M2EB77_STRMG/14-327--RSTVKEN----------------------FDLYYFVTWG........................IQVSAY-SAVNCYAL
A0LP70_SYNFM/14-366--GRFPWLL----------------------GFGNFSAWLAEQHSGSILGTI...SAALEGIAAVVFERGS-QAVGVFIV
A8H1P8_SHEPA/43-369--EIETFAD----------------------KAWF................................NLMM-NGTVFFVF
A6E8A8_9SPHI/14-335--FN.....----------------------....................................FISG-FDLPLFFF
A5VFE0_SPHWW/65-420--PGRAPVA----------------------MDQAGLIAERPF....................LLAIVNGH-FMVAIFFV
A5LX53_STREE/8-323--SNIFSIA----------------------NDVLLLLIT...........................QIYI-FHIPVFFA
Q4UW44_XANC8/22-341--YKL....----------------------....................................FAYS-FHVPLFFV
Q2HGI8_CHAGB/115-578--GYGAGSV----------------------TTAATTTPTGNHNDSNNPKPANHHYHLPLLPFIRLLFSGP-PMVCVFFI
A6BII1_9FIRM/11-365--ILSGKMT----------------------GYVNYFIQ............................TLVA-VAVPLFFV
F2HK93_LACLV/4-320--YDMTIHS----------------------TLAIFWIGI..........................RTILI-TCVPLFLV
A5N097_CLOK5/9-357--NNNIIIF----------------------ARANTELIFCKY.....................MQMFLAR-WHMVILFL
Q8FTN8_COREF/16-398--YPFQKSD----------------------LFATIHSFIP.........................MQLGS-AGVTFFFI
Q6G5Q7_BARHE/17-365--SLTHRN.----------------------....................................FGFS-DSAEVFVL
A0A016XC94_VIBCL/4-356--TTILQMI----------------------THEP................................VGVF-GAAEGFIF
A7AZT9_RUMGN/12-318--IEPVAWI----------------------NHAIWFLVE...........................RIAC-LAVPGFFM
Q2NRT0_SODGM/9-399--FKAVFGL----------------------SELT................................SMGF-FATSAFFA
A4CKW1_ROBBH/7-342--PLFRDPS----------------------NPAYATWL............................YFRG-ITAPVFFT
A6FAM6_9GAMM/8-349--TPSENEM----------------------EFTSGKVLNLFDILFTEP.........AGIIRALFSYFGH-FGVQIFIF
A7V2Z2_BACUN/14-354--GSHLTQI----------------------I...................................NHGY-LAVDFFFM
Q00XL5_OSTTA/15-388--NSLALAA----------------------LGQV...................................N-VVVGAFFV
A4YYF7_BRASO/15-345--PVGLVRG----------------------ELPFYRVLFP........................FYELGE-YGVVIFWC
Q1D0W9_MYXXD/39-356--PVVRADV----------------------WVQHYW..............................TCRG-ITAPLFLM
Q16PV5_AEDAE/243-647--SPMENPQ----------------------ALETFFRNPVMR.....................MASAIFP-FLVHTFFT
Q82ET0_STRAW/57-398--ADGGTLH----------------------TASPLQHMPWL......................APISWVF-QTLAVFFL
Q4JZS0_STREE/5-327--QIYGWIF----------------------EVFV................................PSLT-LLVYLFLL
A7X0T7_STAA1/8-314--GDKYLSA----------------------LYL.................................VIYS-FHMPTFLF
Q7MGC8_VIBVY/15-336--WQIDDIP----------------------WVGYLLN.............................QLAR-FAVPLFFL
A6KZK8_BACV8/9-367--RFDTDRP----------------------TFLQGCALG...........................SAVR-CCVPLFVM
A4CUQ6_SYNPV/6-368--TGWSGVR----------------------IPIEGIVGEGFIGF................FNWYIYAINS-FIMPMMFL
B5BHU4_SALPK/5-319--NAHSVSP----------------------LNWDIANVL..........................NSASR-VSVPLFFM
A6P1P2_9FIRM/9-341--DVPVGSG----------------------AWDIYNVYD...........................SLVR-WCVPVFVM
A5FYP6_ACICJ/4-317--AHVLWYP----------------------ALRR................................AVYG-FHMPFFFY
Q7MQA5_VIBVY/5-328--ELGVIPF----------------------DQWVTAVGI..........................NGISR-WAVPVFIL
I7HSS1_LEGPN/10-336--.......----------------------....................................PAGF-LGVDVFFV
A7V3H1_BACUN/5-305--DEALKNS----------------------FFI.................................GTIS-FHMPLFMI
A0A016DJ19_BACFG/4-349--AAGSTDM----------------------AGPQSYLASEVDRL................WVAVYDGFSR-MAVPLFMI
A2SCM7_METPP/5-359--PLGQP..----------------------....................................FGYV-SAAEGFVL
A7ZZ73_ECOHS/5-329--HLTTFQH----------------------PLSEVLSKCWIY.....................FNLYLAP-FRMPFFFF
A5UMZ7_METS3/7-344--KSVGNLQ----------------------EYVVF...............................TTFG-FGVPIFLM
A3YY52_9SYNE/16-323--IDGYKND----------------------VTY.................................RVTV-VVLGLFVF
A4AIT9_9ACTN/563-845--.......----------------------....................................FFVQ-GGSHLLLV
A5N224_CLOK5/8-329--RCRPYST----------------------TYDITFFLN...........................QLSR-FSVPAFIV
E0TI88_PARBH/15-315--PYGAGEL----------------------IR..................................AFCR-WCVPFFFI
A0A022NJA1_PSEAI/5-324--PTVLYP.----------------------....................................LLSP-FILPLFFF
A0E2L0_PARTE/17-375--NDRQSII----------------------NSNFMIIM............................INSL-YAVDIFFL
C6IRR6_9BACE/9-318--LDKHS..----------------------....................................MLSC-FRMPLYFF
Q2C1R6_9GAMM/10-345--DPIGYNL----------------------PHVKESMQYQYGIL.................STFLGINQS-FFMSLFFF
A7A7B8_BIFAD/5-363--GLAGTAV----------------------T...................................VLCV-VCVPLFFA
Q4JYU7_STREE/6-318--ETGSWNL----------------------LAYLY...............................YLGT-YSIPLFFM
A9VR59_BACWK/5-346--GNVLLEQ----------------------SLIMGMLF............................NLAK-FSAPAFIF
A7VGI1_9CLOT/6-345--KHGYLL.----------------------....................................EWGR-YAVEMFFI
Q1QR03_NITHX/14-320--AVGQDGF----------------------MHLVVE..............................FAKP-FRMPDFFL
A5ZDF6_9BACE/13-326--TNVDLSG----------------------KIIEH...............................FIVA-FNMPLFVI
Q16FE1_AEDAE/161-554--LPTSHPD----------------------KLKLSLLGKL........................GNVMTP-TTVQIFFT
Q7CTZ0_AGRT5/8-329--SPFLGLY----------------------GFFDWLRVFL........................GDALFR-IGVPCLSA
Q8G7P7_BIFLO/17-373--VKMTLAG----------------------SAETVRSVLF.........................AL.FM-VCNPLFIM
A1R1G8_ARTAT/18-357--LQKDGTV----------------------VTVNVLMEQSWF.....................TPVAWGL-MIVPLFFV
A1VHZ4_DESVV/11-319--ATLPGST----------------------LMDGLPMRL...........................WWVP-GDVGLFFF
A0QPG5_MYCS2/9-326--GVTYKPL----------------------EQ..................................LLEQ-VWVDGFFA
A5EXU9_DICNV/19-351--FGSTIPH----------------------ILVEYV..............................LSEP-FAAPVFLT
A6LGX6_PARD8/9-311--MISRYTE----------------------....................................VAAR-FAVPLFFM
Q11WP3_CYTH3/4-324--.......----------------------....................................ALGE-WAVHVFFI
A0K1D5_ARTS2/296-671--QLFTQET----------------------....................................IGFV-SGAELFVL
A6KYR5_BACV8/6-309--TSNWLNK----------------------EFILFIN.............................TLGN-TGVTLFIL
Q0CZ95_ASPTN/77-482--VGVGKAF----------------------ELAYGYDNKYYFACL..............PGVRTIFAGGH-FAVSVFFV
A0T1U4_VIBCL/8-303--.......----------------------....................................RIRS-FDVPLMIF
A3I592_9BACI/6-352--ALSIESR----------------------LYSIYVFLN...........................IFPK-FAVPVFIF
A1TDU0_MYCVP/22-361--IRDDVFI----------------------WTNLLTASPVF......................QALTWLF-QIMPLFFF

PF07786

A1HQT7_9FIRM/5-214--FYGAKLE----------------------YL.SGFWF----------------------------WVGR.SSAVLFML
A2SQB7_METLZ/5-231--FGTGLVP----------------------WF..DPYT----------------------------MSGA.PIAFLFIV
A9CIY2_AGRT5/15-234--FGYLEPG----------------------TATTGLWK----------------------------LYAR.GIASSFLF
Q28R74_JANSC/28-249--FGHVPRG----------------------TATTGIWR----------------------------ALAV.ATAGSFLC
Q8PXM0_METMA/7-237--FGLADIE----------------------LR.SGTFF----------------------------YTGR.GAAFLFIL
A4EC93_9ACTN/4-221--LYDWDMP----------------------WFTQTVFQ----------------------------DIWRASISWVFLF
Q8U2K3_PYRFU/23-240--FLGYSEY----------------------KT...FWK----------------------------VFAY.ATASLFVS
A7I8Y9_METB6/6-231--FRIAPVD----------------------VS.DGFWR----------------------------YFAY.ATASLFLL
A6G0Y4_9DELT/12-237--VETQAGS----------------------ALGVALHV----------------------------VGKG...TAGFLV
A3CVR7_METMJ/5-231--FGVLPLN----------------------VS.GGFLR----------------------------TLAY.LTASTFIF
Q11IW8_CHESB/30-251--FGYVEPG----------------------MSITGAWK----------------------------FFAR.SIACSFLF
A1TRD1_ACIAC/21-249--FGYWPQD----------------------FRGDPFWT----------------------------LQRT.AIVSLFLF
A2SGN2_METPP/12-230--FRLIGAN----------------------FHADPFWL----------------------------HQRT.GIVSLFLF
A2STU6_METLZ/14-241--FHIINVD----------------------VW.LGLGV----------------------------YLP..LGTSVFVI
Q2K839_RHIEC/16-243--MGYLAPG----------------------TAETGWLK----------------------------IYAR.AIATTFLF
B8FY44_DESHD/5-221--WTGLAVD----------------------VD.ALFWF----------------------------SIGK.TAALLFIF
A0NYA1_9RHOB/5-227--FAYVDWP----------------------VAQGTGWR----------------------------IFAA.SIAGSFLF
Q21VS3_ALBFT/16-244--FGYIKQD----------------------FYHAPLWT----------------------------WQRT.LIVSLFLF
Q0FKK0_PELBH/7-221--FGLVPHG----------------------LTMSGGWA----------------------------LFAR.LVAGSFVF
B2S625_BRUA1/16-233--FGYMAPA----------------------TTAQGGWK----------------------------LFAR.CIASSFLF
A2STU5_METLZ/19-252--FHILQ.E----------------------TR.EFLYY----------------------------YSPIVIVSAAFVF
Q6SHI3_9BACT/5-214--FGFTEVP----------------------LFTHWAGI----------------------------TWRC.LIVFLFLS
Q0G6B2_9RHIZ/53-275--FGYVTRG----------------------MATSGGWM----------------------------VFAR.CIASSFLF
A3YBL4_9GAMM/14-227--FDYIDYS----------------------LR.DPFWV----------------------------GFRS.LIISLFMS
A4FZP9_METM5/5-227--FLGYSEN----------------------LL...FWS----------------------------IFAL.YVASIFIF
Q11N89_CHESB/6-227--TGIIN.G----------------------VARHPVWL----------------------------AFGR.SLAGTFMF
A4J1M2_DESRM/9-218--FYNLPIH----------------------YQ.EGFIF----------------------------LTGK.ASATLFIL
Q6SGH9_9BACT/9-218--FGYTNIP----------------------LSNFWLTS----------------------------YWRY.LIVFLFLN
A1VNB1_POLNA/5-231--FGYLQQN----------------------FYTDPFWT----------------------------WQRS.TIVSLFLF
A3DGD5_CLOTH/11-220--VYNIPIG----------------------YG.TGFID----------------------------KIRI.VVATLFIM
Q98KU6_RHILO/16-237--FGYTDPG----------------------LTAFGWWK----------------------------IYAR.CIASTFLF
A6VZM7_MARMS/12-224--FGFLEYS----------------------IY.DPFWV----------------------------YFRS.LILTLFLT
A1W6I8_ACISJ/12-240--FGYWPQD----------------------FRADPLWT----------------------------VQRT.LIVSLFLG
Q6M0I2_METMP/11-233--FLGYSDY----------------------LL...FWS----------------------------FFAL.FVASSFVF
O26882_METTH/9-227--LGVLDLD----------------------MG.SPVIW----------------------------FTGR.LTAFLFIF
F6BVW5_SINMB/23-246--FGYVAAG----------------------TAGTGGWR----------------------------MFAR.LIASSFLF
B1ZHM9_METPB/15-237--LQLTPQN----------------------LALTPPGR----------------------------VAAH.LIAGSFLL
Q2Y4H0_9ARCH/17-243--FGGYNLN----------------------LH.SGFWL----------------------------YFGR.ATATIFIL
O29726_ARCFU/2-207--FGKIELS----------------------...GDFWY----------------------------YFPR.FIGGMFIF
Q12ZG6_METBU/7-234--FGYYDND----------------------IR.TGEVF----------------------------LIGR.AAAFLFIF
A4BIP8_9GAMM/6-220--FGFLTFE----------------------MN.GGFFT----------------------------WFRF.LIVTLFFT
Q8THP4_METAC/31-261--FGLSDVD----------------------LK.SGTLL----------------------------YIGR.GAAFLFIL
Q46DC7_METBF/7-237--FKLADIQ----------------------LR.SGVIL----------------------------YAGR.FSALLFIL
Q2FN30_METHJ/7-229--LGLPGPD----------------------PF.SGLLR----------------------------IFGM.LTTISFIG
Q1YI63_MOBAS/15-237--FNYVERG----------------------LTGHGGWR----------------------------IFAR.AIASSFLF
Q1B004_RUBXD/18-243--FGGYPIA----------------------ST.SGFWA----------------------------AFAD.ASAFVFVF
A6FRV3_9RHOB/4-228--FGLLPQG----------------------TAGSWGWS----------------------------NFAK.LVAGSFIC
Q1YJ44_MOBAS/24-246--FGYVSPS----------------------LMFSIPVT----------------------------IFAR.SLAGSFMF
Q26I67_FLABB/5-236--PEYRDTD----------------------STIFQIWS----------------------------YFRG.ITAPTFFT

PF05857

A6TIJ3_KLEP7/24-240--LAGNNEV......................MR----------------------------------LLGR-GCFPLFGL
Q5NWL3_AROAE/9-222--FNATLPV......................LF----------------------------------EVGR-VALPLFIF
Q88AH9_PSESM/14-243--VGWSIDF......................LY----------------------------------VPGR-FAFPWFCL
A6M0I9_CLOB8/13-266--ASTGIPI.....................WFN----------------------------------WIGR-LSAPLFFF
C1DKH3_AZOVD/14-243--VWPQRIW......................LY----------------------------------VPGR-LAFPFFCL
A4XUI8_PSEMY/4-231--WPEATAW......................LF----------------------------------VVGR-FAFPLFCL
A4XH28_CALS8/24-230--YFPNRVL......................FR----------------------------------IVGR-IAFPIFAF
A1WDN4_ACISJ/11-221--FNATLPV......................LF----------------------------------EAGR-VALPLFVF
C4YYW6_9RICK/13-242--LYPELTI......................MR----------------------------------IIGR-TAMPVFCF
Q326X1_SHIDS/32-247--FQLKQEW......................MF----------------------------------LAGR-GAFPLFAL
Q8P901_XANCP/6-212--HLGYMPV......................IA----------------------------------ELGR-VAFPLFAL
R5K8R7_9CLOT/9-229--YFNSKALIVM................SELFD----------------------------------ILGR-IAFPIFIS
R5KLN1_9CLOT/10-244--LMNNNWI......................MR----------------------------------AVGR-LAFPIFAF
R5QZC4_9FIRM/5-243--VLKNGIILHAPYSMFTDEQFDMLMSTVNICH----------------------------------ILGR-IAFPVFCF

PF16401

H1Y6N2_9SPHI/12-268--MYHAQVP----------------------PPAHQFKPDLPGI-----------------------TWVD-LVFPFFLF
G8TDM1_NIAKG/23-280--MYHAQTP----------------------PPGHVYTPELPGI-----------------------TWVD-LVFPFFLF
F0SC25_PEDSD/7-264--MYHAQVP----------------------PPGHKFMPEIPGI-----------------------TWVD-LVFPFFLF
R6N358_9BACE/4-263--MSHAQTP----------------------PPDHIFNPEIPGI-----------------------TWVD-LVFPFFLF

PF04235

Q8EH35_SHEON/199-352-------------------------------------------------------------------ASL..VLSTMDTL
YXAH_BACSU/242-392-------------------------------------------------------------------MAG..LVIGIGAQ
A5VFY1_SPHWW/226-385-------------------------------------------------------------------IG...YPVGLALR
B0T5F0_CAUSK/216-381-------------------------------------------------------------------AAS..LLLYAGLT
Q5LBX3_BACFN/231-393-------------------------------------------------------------------IWS..AVLFGPLY
A8FJB9_BACP2/218-375-------------------------------------------------------------------RVG..LWVGLPLN
Q8ZNL6_SALTY/215-375-------------------------------------------------------------------ALL..VALGLMIN
Q5Z0S5_NOCFA/200-354-------------------------------------------------------------------LLA..VPAAVAAA
Q5LAR8_BACFN/229-391-------------------------------------------------------------------GIS..LICFFPLY
A5FKP1_FLAJ1/222-380-------------------------------------------------------------------VIS..LVIAVIMG
A6LH60_PARD8/231-393-------------------------------------------------------------------IIT..AIAFGPLY
Q2NUE2_SODGM/217-377-------------------------------------------------------------------LWL..IPAGLIIN
Q5L251_GEOKA/223-378-------------------------------------------------------------------RWA..LCFGLALK
B9LP38_HALLT/238-398-------------------------------------------------------------------ALG...VVGLAIT
Q5WBU3_BACSK/218-382-------------------------------------------------------------------VYG..LSISLIGA
Q5LDG8_BACFN/245-405-------------------------------------------------------------------TYG..FLLGLPLS
Q2N5U1_ERYLH/237-397-------------------------------------------------------------------AIC..ALASLPML
Q1D273_MYXXD/254-423-------------------------------------------------------------------GWG..LSVGLVLN
Q0RI89_FRAAA/226-396-------------------------------------------------------------------CAG..LGVAIVGA
Q1GR12_SPHAL/244-406-------------------------------------------------------------------IAC..FAIAVPPL
A3HTP0_9BACT/227-391-------------------------------------------------------------------IIT..MVISNLYR
Q0C162_HYPNA/232-392-------------------------------------------------------------------F....LPAGLVGS
Q9X356_BACAN/222-381-------------------------------------------------------------------WSS..LCISCLLS
A8FH56_BACP2/222-385-------------------------------------------------------------------LI...CTIAFLIT
Q5WCD3_BACSK/239-403-------------------------------------------------------------------WIG..FLAGFPLT
A4GA59_HERAR/238-403-------------------------------------------------------------------WTG..FALGIPFN
YRKO_BACSU/224-387-------------------------------------------------------------------II...STIAFLIT
Q47SA7_THEFY/269-436-------------------------------------------------------------------AVG..IPLGWLTG
Q21P05_SACD2/237-402-------------------------------------------------------------------GYA..IASTVICI
A4FQ93_SACEN/204-361-------------------------------------------------------------------AIG..FGVGAPLN
Q3IC82_PSEHT/208-361-------------------------------------------------------------------SAL..LFTSLRLT
Q2NDD6_ERYLH/264-425-------------------------------------------------------------------WIG..LIVGGAIS
Q9HNH9_HALSA/232-393-------------------------------------------------------------------AVG..GTVGLAVT
Q9KFW4_BACHD/1-165-------------------------------------------------------------------VVG..ISIALVGG
Q8ERW4_OCEIH/226-381-------------------------------------------------------------------FIS..FIGFIVLK
Q7N6K6_PHOLL/210-370-------------------------------------------------------------------LVL..IPLSIAVQ
A4ARZ9_MARSH/230-396-------------------------------------------------------------------IGS..IILFVVSI
B1YLL9_EXIS2/215-367-------------------------------------------------------------------GAS..LLLSLPLL
A6L2L4_BACV8/234-394-------------------------------------------------------------------ASS..LVAFFPLY
A1WTH2_HALHL/248-410-------------------------------------------------------------------GYG..LGIGVPMS
A1S3E3_SHEAM/216-369-------------------------------------------------------------------LAL..LLGAVDLT
Q9AA92_CAUCR/270-432-------------------------------------------------------------------ALG...GAGLAWT
Q0ARL9_MARMM/225-387-------------------------------------------------------------------LIT..VPVGWWLC
Q07YN3_SHEFN/228-381-------------------------------------------------------------------WAI..TLASLDSI
A8F9F5_BACP2/224-375-------------------------------------------------------------------VWM..IVVGLALK
A6L9Q0_PARD8/227-389-------------------------------------------------------------------VIG..VVCFIPLY
B0T422_CAUSK/230-391-------------------------------------------------------------------GAG..LGALVLAG
A6WB03_KINRD/147-299-------------------------------------------------------------------ALS..AAVAVPTV
Q47R13_THEFY/238-395-------------------------------------------------------------------CWG..LGVGLPLN
A8MJB9_ALKOO/219-378-------------------------------------------------------------------IVS..LIVSVLCF
A6TNH6_ALKMQ/249-412-------------------------------------------------------------------KIT..GAVGLSTT
Q1D7M3_MYXXD/255-425-------------------------------------------------------------------GWG..LVAAVVGS
Q6NJJ5_CORDI/212-362-------------------------------------------------------------------GIA..IAIIIGIG
A5UQH7_ROSS1/237-401-------------------------------------------------------------------AGSVCLAVGLIAN
A7MLK3_CROS8/215-375-------------------------------------------------------------------FGL..VALGVLIN
Q9KE13_BACHD/42-195-------------------------------------------------------------------WIG..LLIGFPIK
A8GC25_SERP5/223-383-------------------------------------------------------------------AWL..IPLSLLIQ
Q8A424_BACTN/229-391-------------------------------------------------------------------IIA..VTAFFPIY
Q9KFA2_BACHD/226-379-------------------------------------------------------------------AVG..MYVGIPLN
Q9KEU3_BACHD/250-400-------------------------------------------------------------------IIG..FIIGIGGN
A4FQT6_SACEN/171-324-------------------------------------------------------------------GIS.VVPAGIGVW
A6TBN7_KLEP7/215-375-------------------------------------------------------------------ALL..VAAGMAVN
Q4KHM8_PSEF5/226-387-------------------------------------------------------------------RIS..LPLGLGGA
A4F774_SACEN/171-329-------------------------------------------------------------------PH...LLTAFVLA
Q9K7D7_BACHD/224-377-------------------------------------------------------------------LF...IPVGVTLK
A6KYE7_BACV8/229-390-------------------------------------------------------------------IIS..AISFAPLF
Q2G3S1_NOVAD/241-402-------------------------------------------------------------------AIG..ILGGAAAS
Q1IVW5_DEIGD/222-381-------------------------------------------------------------------VWG..LAVGLPLG
A4AN58_MARSH/230-392-------------------------------------------------------------------IIG..ATVFIPLF
Q9RS74_DEIRA/223-382-------------------------------------------------------------------VFA..LPLGLLLG
A3HYS5_9BACT/265-426-------------------------------------------------------------------LIG..YAVGLAIN
Q6D3N4_PECAS/227-387-------------------------------------------------------------------LWL..IPLGVAIN
A5FKP0_FLAJ1/222-380-------------------------------------------------------------------IIS..FLCAVVIG
A6LGL5_PARD8/234-396-------------------------------------------------------------------LVA..LVLIGLLY
Q3IPY1_NATPD/256-418-------------------------------------------------------------------VAG..GTAGLALI
Q5YUW9_NOCFA/233-388-------------------------------------------------------------------LLG...AVAAPVD
Q9K6N5_BACHD/237-398-------------------------------------------------------------------LTS..LAIGLPFN
Q8EL60_OCEIH/225-388-------------------------------------------------------------------VVG..LTISLLGA
A9WKI7_CHLAA/242-404-------------------------------------------------------------------FGGMCLAIGLVAN
B0RFW7_CLAMS/254-423-------------------------------------------------------------------LVG..MPVSVLGA
B1HN91_LYSSC/223-376-------------------------------------------------------------------LAG..LIIGITIK
B1HPE9_LYSSC/165-337-------------------------------------------------------------------IVM..FCVSIVSW
B1HRQ0_LYSSC/190-342-------------------------------------------------------------------FVT..GPFFIGFS
B1HW32_LYSSC/220-369-------------------------------------------------------------------TIG..VFIGIPLN
B1HYB2_LYSSC/222-372-------------------------------------------------------------------LL...VPIGLACK
E3FDU1_STIAD/253-420-------------------------------------------------------------------GWG..LLVGGVSN
E3FTX2_STIAD/250-412-------------------------------------------------------------------KGG..LGLGLAGS
Q74VB6_YERPE/216-374-------------------------------------------------------------------LFL..ISLSLVIQ
Q7VYP4_BORPE/228-388-------------------------------------------------------------------AVG..LPLGAAGA
Q812K5_BACCR/224-376-------------------------------------------------------------------FAT..GLFSFTIK
Q81SQ3_BACAN/217-376-------------------------------------------------------------------IIM..FVLTLPFW
Q8NMY9_CORGL/70-221-------------------------------------------------------------------AVS..AAIAIPTL
Q8P7N0_XANCP/245-401-------------------------------------------------------------------YGV..LPLGLALM
Q9PFK6_XYLFA/262-418-------------------------------------------------------------------WGA..WPLGLTAM
R5USE5_9BACE/227-387-------------------------------------------------------------------IIA..AISFAPLY
R6X5K4_9PORP/228-389-------------------------------------------------------------------VIG..AVCFVPLY
U5L4L4_9BACI/226-379-------------------------------------------------------------------GIL..AGAGILLK
U5L6C6_9BACI/232-386-------------------------------------------------------------------AVF..FAAGLLIK

PF07779

U1HPB3_ENDPU/212-693..NQPATTLLAVN.......................GITAAVGIIAMAVVYCFVADRTLIFDKVQKVSSQRTFLQM.ITI
Q6CDI8_YARLI/311-778YVSWPVPSIQDE........................TLLTACVVIAASLAYSFFCDRTQFFGKSSKQFEASEFWVL.ILL
Q9W4P0_DROME/351-846..YVPLQQQQSYDGGRAGGGSPSN..ALSALITDYGTPMVALSLLGLILAYFYLCDRTNFFMKENKYYSEFSFWIP.VGY
F6X8U0_XENTR/294-776..NKQCDDIESGEEKKPATATPAA........SSLEILLFSLSKLGLIMAYFYFCDRANLFMKENKFYTHSSFFIP.IIY
K1QBI1_CRAGI/299-786..RAADNGIRNGRSYVTSTEKTWP........DTLYEIMLCLAKLGLIMAYTFLCDRTNFFMKENKYYTHVNFLLP.FAY
B7Q496_IXOSC/303-799..RA..DDVQCLVNGEFSLHRPAIIFGKLSLFYDLTCFNFSTLQLGLIMGYFFLCDRTNFFMKENKYYTHLNFFLP.VAY
T1INP0_STRMM/300-790..QTVNCINNSSVETKS.................WYELTTSLARLGIIMGYFFLCDRTNFFMKENKYYTHLNFFLP.FAY
H2Z694_CIOSA/175-652..PGTEEENKKNNIRTT.................IVELVSAAAKMSLILLYFYICDRTDVFMKANKHYTNTRFFLP.LLY
D6WF47_TRICA/333-815..HEYSQLPDNAHQPPATPGS.............YYNLFTSLAKMALIMSYFFLCDRTNFFMKENKYYSEFSFWLP.IGY
W5MY98_LEPOC/349-830..SRHVTDLENAEEKRPAAATSMA.........SLKVPFQSVCKLGLIMVYFYLCDRADIFMKEQKFYTHSTFFIP.LIY
G3NTP4_GASAC/295-774..LVP.PDVESLEEKKPATAAAPP.........GLTAPLQALCRMGLIMSYFYLCDRADVFMKEQKFYTHSTFFIP.LIY
E9GCH2_DAPPU/313-803..KAAVEDVESSSR......................VVVTALGKLGLIMAYFYLCDRTTFFMKENKYYSHLNFWVP.VGY
E9C8Z6_CAPO3/466-972..HTGGAVASGAESAFGATARARH....MLSSPNLLSVAMPVAQLGLVLVFAFLCDRTHIFPKERKIYTHFDLIAS.IGV
L2GH03_COLGN/240-722..SARTSQVMDS..........................LLAAATLVAIAVYCLLADRTHLLIKHDKHFDVPDFILPVIGL
E0VHC9_PEDHC/297-768..KSTHHQSE........................FTIIFSALAKLALIMTYFYICDRTNFFMKETKTFSQSAFWIP.IVY
F6XMQ8_CIOIN/290-767..PTNEDEVAKNKDSIHNI...............IAELTYAAAKMSLILFYFYICDRTDVFMKSNKHYTNTRFFLP.LLY
H2QUY3_PANTR/295-776..NKPCTDLESGEEKKNIINTPVS.........SLEILLQSFCKLGLIMAYFYMCDRANLFMKENKFYTHSSFFIP.IIY
T1G7I3_HELRO/252-726..KNNNKTNNNNNNQSKNMDCP..............TLISCIAKLGLILLYFFICDRTTFFMKENKYYTHVNFFLP.FTY
Q17CG6_AEDAE/303-783..YVPLSQTSTGVTPAAANSQ...............SPIIALASLAIIMAYFYLCDRTNFFMKENKYYSEFSFWIP.VGY
H3A7E5_LATCH/298-779..SKPCTDVESGEEK.PTTATPAP........ANTEILLQSLCKLGLIMAYFYLCDRANLFMKEHKFYTNSTFFVP.LIF
H9KE76_APIME/294-775..RTEISYLRVDMENTEEANNSETIQIEQPEVQDFYTLMTSLALLSIILSYFYLCDRTNFFMKENKYYSEFSFWLP.LGY
S8EFZ6_FOMPI/324-771..TSGQPYIGDQE..........................MPAVVMSVAAALIYLADRTDFWLKEQKQFSPWVFTFL.SLL
X1WW08_ACYPI/313-776..PS...............................YVVMISLAKLGLIMIYFYICDRTNFFMKENKYYSDASFWLP.VGY

PF10129

A1R109_ARTAT/441-826LS--GVVLGMVY.G------------------------PRI.ATELGDVV----------DGTTKRAWKLYFTALAVVLI
A0K1D5_ARTS2/295-678LS--GLVLGMVY.G------------------------PKA.QDNIGEVA----------QKTGRRAGKLYVTALAVVVL
A2SCM7_METPP/4-366LS--GYMAGMVY.T------------------------ARERRDGEAVMR----------EAFLRRALKIYACQAALLLF
A1TNJ8_ACIAC/18-379LS--AYMAGMVY.G------------------------RTAARRGIPAMR----------QAFLRRATKIYACQAATLLF
Q1D6T0_MYXXD/55-417LS--AFLVGVVY.A------------------------NKIEAADPNVLW----------RSLWQRALKVYGYHVALLAF
Q11B97_CHESB/2-386LS--GLLVGMVY.A------------------------RRMLKEGYAAGA----------RKVRKRALEIYRYAAGCIFA
Q7CT44_AGRT5/2-385LS--GLLIGMVY.A------------------------RKMMKYGYDAGK----------QMIWNRAMELYRYAMGLVIA
B2JS58_BURP8/58-406LG--GFATATAY.A------------------------SLAKRHTEADAR----------NRFFKRSLELYRAFLVTAVL
Q13NS3_BURXL/7-355LG--GFATATAY.A------------------------ALAERRNETIAR----------SRFLRRSLEIYRAFLVTAAL
Q1LDM8_RALME/9-370LA--GYSAGAAY.L------------------------AMEARQGASAAS----------KRLHRRSWEIYKAFVLTGVL
A1B1M7_PARDP/3-363LS--GFLVGMVW.I------------------------KVEAREGRPAAQ----------IRFLRRAAQVWLALIAGAIL
Q5FTQ3_GLUOX/17-367LA--GYASYLAY.G------------------------RLIDRQGWKTGI----------HRIFGRCVRLYLYQTGMTLV
Q89UF3_BRADU/67-422VV--GYGVAIIH.G------------------------RMALERGYVVAA----------TRIFRRVWRLYAAYVVLFVI
Q89KT4_BRADU/82-438IS--GYTATFVF.G------------------------TMMMERGFVIGA----------TRLLRRVWQLYVAHLLLFFV
A4YU73_BRASO/12-368IS--GYTASFVY.A------------------------RMMIDRGFIVGA----------TRLFKRVWQLYVAHIVLFVI
Q6N6S8_RHOPA/12-368IS--GYTASFVY.A------------------------KMMLERGFIVGG----------TRLTKRVWQLYVAHIVLFVI
Q1QFJ8_NITHX/39-395MS--GYMTSLVC.T------------------------NIMRRRGFVAGM----------SWLMKRVWQLYVAHIFLFVL
Q89VE5_BRADU/37-393IS--GYTAAFVY.G------------------------RAMLESGVVIAT----------ARIMRRVWQIYVAHVFLFTI
Q6N0J3_RHOPA/44-400IS--GYTAAFVY.G------------------------KAMTELGFVVAA----------ARILKRVWQIYVAHVFLFTI
Q3SWD7_NITWN/36-392IS--GYTAALVY.G------------------------RAMRERGFIVAA----------ARILRRVWQIYVAHIVLFTI
Q89CC1_BRADU/15-372IS--GYLVGWIY.G------------------------PIIAGGWFLAAL----------KRLWRRAAEMYVAHIMLFLL
A4YYN0_BRASO/36-389IS--GYTCMLAY.G------------------------GAVEAQGWVTTA----------VRALRRAWEIYAAFLVLLLA
Q89EQ8_BRADU/32-383LS--GLTCALSY.G------------------------KARQSGGWTGVI----------GRTLWRSWDIYVAFLLLTLA
Q87XJ3_PSESM/5-366LA--GYASILAY.G------------------------RIARRDGMLVAG----------VRILRRTWVLYVVHIFLLTL
Q0BVC0_GRABC/14-370LA--GYGAGLAY.G------------------------KAMDRSGWLYAA----------AECARRAWTLYIAHIFLFVV
A5G015_ACICJ/9-360LA--GFAAALVY.G------------------------RKMDRAGPLSAS----------ADMLKRAWTLYIAHIFLFVL
B0U809_METS4/3-358LA--GWSIGIAIRG------------------------RSGALEPAGRTL----------LRLLSRMVEVYRAQIVITAL
Q2K344_RHIEC/23-378IS--GIAVGLAY.G------------------------SRFEPGGRIKTA----------IKAARRAFTLYLAHMITTFM
Q2YRC8_BRUA2/6-358IS--GMAVALAY.G------------------------SKFVSGNRLVLS----------LKMWRRASVLYITHIMTTMA
Q983D5_RHILO/37-389IS--GISVALAY.G------------------------TKFRPGGRLLAT----------LKMWRRAGVLYVAHIVTTMV
Q6G5Q7_BARHE/16-368LS--GVALGLSF.H------------------------NRLQQKPFTFIV----------RKLWRRALQLYAAYLFTTFV
Q3J1N1_RHOS4/11-372MS--GIAAGLAY.S------------------------KGFWTPT.WAAA----------RKIWRRAWTLYLVHLLTTFW
Q11DW2_CHESB/11-364MS--GIAVGLAY.A------------------------RPFRAGEYLKGC----------LSVWRRAGTLYVAHMVCTAI
Q1GGF0_RUEST/47-428CS--GMASAIAF.G------------------------GSFQRHGWWLGT----------ARVAYRCWQVFWAHIGLFFF
Q169P8_ROSDO/29-397CS--GMASAIAF.G------------------------AVFRDQGLLMGA----------ARVAFRCWQVYWAHIALFFA
Q0BQN1_GRABC/63-424VS--GASCAYAF.G------------------------SVYRRAGWALGT----------ARVSLRVWQIYAAQLGLVMA
B0RH46_CLAMS/492-873LS--GLVLGMVY.P------------------------MAVKKFGEMKAL----------VSILRRAFKQYIVAIAVVVI
B4EL00_BURCJ/18-366LG--GFATASAY.G------------------------AIAERHGARAAQ----------RRFVRRAMQIYRAFLATSTL
B4ELU9_BURCJ/9-352LG--GFATAIAY.N------------------------SLAERHDEAAAR----------QRFIRRAFEIYRAFLVTAGL
E3FIJ7_STIAD/5-384LS--GLLMGQVY.G------------------------ARMKKHGYKAGA----------SKIYHRVFELYRYTAGCLLA
Q13QD3_BURXL/18-362LG--GYASAAAY.T------------------------TVLAKRGESAAK----------MRFVRRCWEIYRAYLLTAVL
Q5LPG0_RUEPO/27-401CS--GMASAIAF.G------------------------GAFLKRGWWMGT----------ARIAFRIWQVYWAHIGLFFF
Q63IA9_BURPS/14-358LG--GFATASAF.L------------------------SVSARHGAGAAR----------RRFMRRAAQIYRAFLATSTL
Q6NAS6_RHOPA/6-361IS--GYSIGFAY.G------------------------PAVRAGEMVAAT----------KRLWTRAAQLYVAHIFLFLF
Q92L11_RHIME/23-374IS--GLSVGAAY.S------------------------GKFLAGGRLALT----------LKIWRRALALYVAHIMTSVV
Q9KQQ7_VIBCH/3-361MS--GLLAGMVY.S------------------------RR..EYTDRQAA----------GKVWHRAFIIYKYHIAGLFI

PF01757

A8DMZ1_STALU/12-334LS..QLLT.................................TLNYASLRI----------TYLTSRFKYII....LPYLC
K6RN31_LACCA/20-369MT..GLVLT..............................MVYYRRQRNWP----------LFYKKRFTTVG....VPYVL
A8G974_SERP5/5-314LSGYGFSL....................................KKEVSF----------KYIWGKLKNLY....ISYWI
Q11WN8_CYTH3/14-339LS..GFVIYY.............................SAENKKTLTIP----------QYFKARFLRIYPVFILACLL
A7LV98_BACO1/4-296LP...FFY......................................DIKK----------EITVKRLCDIVVRNWIPYFW
F0K6S5_CLOAE/6-334IS..GYFY.................................KDKYTHKPI----------TLIKKRIKTLY....IPFIA
A0A009DRR0_ECOLX/9-357IS..GYFSY................................MLFLRYPLK----------KWWKVRVERVG....IPMLT
Q07PA2_RHOP5/14-375VA..GFFAH................................LSFHRLGAT----------EFIYDRLKRIA....LPLAA
Q30BE9_ENTFL/7-326TS..GFFL......................................ISRY----------TCNAEKLEAFIKKTTLIYGV
A1HPJ5_9FIRM/6-350VSAFGLFVH...............................HNLEERFDYT----------GFMQRRLRTVL....VPYIV
Q4P0M9_USTMA/127-516LS..GRLNATSYF......................RNKALGRPIIWSVVP----------EAMVRRALRLL....IVGAV
A7LV97_BACO1/24-312IS..GFFFF..............................RISYYEKNNYF----------KMLKKKAKTLL....IPFIF
Q1QWT8_CHRSD/4-315VS..GYFFI................................SVIRSRSLM----------TWLKKVV........AMYVF
Q2T7M4_BURTA/6-373IS..GYVLTT............................KFFTTEELPALQ----------SAAAKRYIRLGLPSFASIFL
A4B9D7_9GAMM/5-375LS..GFLLSLPF........................WRAAYQAQPLPDLK----------IYLMRRFARIMPGFYVVLLL
A0A015ULW8_BACFG/8-315CS..GYTL.................................FLGRDMDFF----------NWYKRRINRIY....PTVFT
M6C4Z5_LEPBO/44-373SS..GIFL....................................KFTNWT----------DYWKPKIFSLL....IPYLG
A5ZUV3_9FIRM/6-346TT..GALM.................................LPRDYPDVS----------AFYKKSLFPLF....LTTEI
A1VGB5_DESVV/30-339LA..GAVI..................................PERIDDIG----------QHYRKTLWRYV....APTLL
B2JGA6_BURP8/53-400ISAATIMLTLEE........................ETKRFGNDRVLIAR----------RFYVKRFFRIAPLYYLAIAV
Q9XAP7_STRCO/24-348LG..GTLM.................................ARSLRRPAA----------TVFRNRLRRLL....PPFWC
Q07KV2_RHOP5/17-343VS..GYLMC...............................LIRPHYRSAA----------SFMYGRLMRIVPMYWIFTTL
Q484G4_COLP3/18-372VS..GVAIS................................YMITKMPLK----------SFTWQRIVKLY....LPLLF
A0DGZ8_PARTE/156-556LG..GFFMAFVMCE.....................TKRAKALGKNPASLF----------LVILHRLLRIWPCYIICIMI
A7A7L5_BIFAD/6-324IS..AWFF......................................LDKE----------QTIKSNLKRVWI.MERELLF
A3JPT3_9RHOB/10-350IS..IFLLL..............................MALERRPRGYF----------ETLKEQARRLL....IPFAF
A5EMI0_BRASB/26-386LS..GLFVW................................SGLAHKSTL----------QHLRDRLLRLG....LPFVI
A4FKM9_SACEN/20-347IS..GYFAC................................VTIGRGPVL----------RYWWGRVARLL....PPFLA
A7V903_BACUN/5-297IS..GYLA....................................NNRKDA----------RSFLRKFLWIF....IPYAC
Q8IG66_CAEEL/330-720LS..ACVASYSIRKK...................ILFRGSSSNFSIIKCL----------ALLGHRCLRLLPALSLYLLF
Q7UES3_RHOBA/12-486LS..GFFTM................................MLYRRRGMS----------KLIEHRILRIA....IPFVI
D8IMM9_LACSC/4-332LS..GYLH....................................KDKSYS----------KIITGGFFNLL....LPYIF
Q8PXP5_METMA/13-333SA..GFKFGFN...........................HSDELEEKDFLK----------KYFIKRFVRLY....KPYIG
Q6AH04_LEIXX/3-320TV..GVSAG..............................LASRRALADGR----------GMSRSRFRYGFAIRGLLLIA
Q5CVD7_CRYPI/23-437VSGRASFL...................................SSTPSLG----------VLLRKKILRLA....LPLIS
A0LT35_ACIC1/10-359VG..GYANALS...........................WSRRRAERYSWL----------GWVRQRMRRLL....VPTGG
Q8KJJ2_RHILI/23-344IS..GYLSS................................GAILRKSFT----------QGVGERAMQLL....LPMLF
Q17BV3_AEDAE/212-599IS..GFLAAYHM.........................VGEYQQKQKVAWF----------RRIVGRYLRLT....LPLIP
A7F3R9_SCLS1/8-361VT..GYVCALKPIR.....................QCRAGNQTACFSTIS----------RSAFRRVPRLV....LPTTI
Q144E0_BURXL/4-320LF..GLST.................................VACLQRSRV----------HLLKSVALTVL....YPYLL
Q83YQ9_STRGN/5-307LS..GYFS.....................................FNISR----------EKVKYRLKQMLLLTIASLIF
Q07P25_RHOP5/21-323LT..GLNV.................................EHSLRRGAK----------PFLASKGWTIA....YPYVL
M2EB77_STRMG/14-327IS..GYVG.......................................VDS----------PYRYSKCLSLW....LQVFF
A0LP70_SYNFM/14-366LS..GFGLAYS...........................LAGSGGRPGGWN----------SWYRRRLLRLFPIYWLAHLI
A8H1P8_SHEPA/43-369IS..GFLFH...............................HVFYHRWDYK----------KYMKSKTKFVF....LPYLL
A6E8A8_9SPHI/14-335LS..GYLF.................................SFKKYENYK----------AFLKARVRQLL....IPYLI
A5VFE0_SPHWW/65-420LS..SFVLTK............................GLVSGTPRSRAL----------AAMAKRLPRLLPLTLIGTLL
A5LX53_STREE/8-323LS..GYFFR................................PVSDMKEFW----------HYAKKKTIILG....IPYVF
Q4UW44_XANC8/22-341LS..GWVG.................................ERFGRRAFG----------RKTVGKLARTLLIPYVSFFL
Q2HGI8_CHAGB/115-578IS..GYALSLRPLTHAAT............TTTTTTTTPTTTQTAHTALT----------SLIFRRAPRLF....LPAFA
A6BII1_9FIRM/11-365VN..GFLL...................................FGRGFNL----------KKHIRKTIRVA....AIAII
F2HK93_LACLV/4-320AT..GFLM....................................NRKELS----------AQYVLGIVPVI....ISYIG
A5N097_CLOK5/9-357IS..GMALF................................YSLKQRSAG----------SIIKTRVSKIL....IPMVL
Q8FTN8_COREF/16-398LS..GFLIYW............................SNSELRGMRNTL----------YYCQRRITKIYPMHLIALGM
Q6G5Q7_BARHE/17-365LS..GVALGL.............................SFHNRLQQKPF----------TFIVRKLWRRALQLYAAYLF
A0A016XC94_VIBCL/4-356MS..GLLAGMV...........................YSRREYTDRQAA----------GKVWHRAFIIYK.YHIAGLF
A7AZT9_RUMGN/12-318CS..GYLFY................................RNLTWKKVT----------EKLKQRVFSLV....IPFLI
Q2NRT0_SODGM/9-399LS..GFLLAHV...........................YVRGRRLREPAS----------NFWRKRLFNLYPIHIVALLS
A4CKW1_ROBBH/7-342VS..GFIFTY............................LLLRTPRNQPDN----------PRIRKGIRRGLQLVAIGYLL
A6FAM6_9GAMM/8-349LSAYGLMKK..............................YAKNENKLLYI----------KFIIERVVKIYPMFLLAIVS
A7V2Z2_BACUN/14-354LS..GFVIGY............................AYDDRWNRMTVG----------TFFKRRIIRLHPMVIMGSIV
Q00XL5_OSTTA/15-388LS..GYVAAYTTTA.....................LGSYEAEMSRLRPSP----------QYVVSRVMGFYPLYFLVNCV
A4YYF7_BRASO/15-345IS..GFIFFLK..........................YSALIPNGAVDGW----------TFFINRLSRLYPLHLATLLL
Q1D0W9_MYXXD/39-356VA..GWAVV..............................AALGSKPTAAR----------DTYGKRVRRALLLIFLGYLV
Q16PV5_AEDAE/243-647VG..GVLLAVHFL......................DFIESGPRFRWQYFI----------MGIINRYMRLFPLYFIMWLY
Q82ET0_STRAW/57-398VG..GHVATKG...........................YASARARGTTYG----------RWLRSRLARLFKPVAAVLTL
Q4JZS0_STREE/5-327ISGFGMFCGY............................YERFKEGKIDLN----------NFYKKRYKKI.....IPFFA
A7X0T7_STAA1/8-314IS..GYFA....................................KNIDKP----------YYLEKISKRLI....VPYMI
Q7MGC8_VIBVY/15-336IS..GYLIQ..............................PKLTSAPFVTL----------GNYAKPLLKIWLVWSALSLL
A6KZK8_BACV8/9-367MT..GVLL..................................FPVRNGMS----------EFYKKRIGRIV....VPLIF
A4CUQ6_SYNPV/6-368IS..GYFVP................................RSVHKKGVV----------QYLKNRLIRLG....IPFIF
B5BHU4_SALPK/5-319IS..GYLF......................................FGER----------CAQPRHFLRIA....LCLIF
A6P1P2_9FIRM/9-341LS..GMFLL................................DPKKSLTLP----------KLFFHHILRIF....VALVV
A5FYP6_ACICJ/4-317LS..GLVTWL............................AGHAGTPPAGWP----------GLIRARARRLL....IPFAV
Q7MQA5_VIBVY/5-328IT..GALML................................SDTRPFDLP----------YYARRRLGKVL....IPFLF
I7HSS1_LEGPN/10-336IS..GFLITQI..........................IFRNTKTQTFSLI----------KFYLNRMRRILPALMLVLLV
A7V3H1_BACUN/5-305LS..GYFIN...............................PKRMRTDKIT----------TSCFSKFKHLM....VPAFS
A0A016DJ19_BACFG/4-349VS..AFLLA................................PMKEEQTTW----------QFYRQRFLRII....PPFFI
A2SCM7_METPP/5-359LS..GYMAGMVY.........................TARERRDGEAVMR----------EAFLRRALKIYACQAALLLF
A7ZZ73_ECOHS/5-329IS..GYLIR................................RYIDSVPWG----------NCLDKRIWSIFWVLALWGVV
A5UMZ7_METS3/7-344LL..GLLM.................................LDRDYSDIE----------TFIKTDFVRIF....IPFLI
A3YY52_9SYNE/16-323IS..GHLIG..............................RSRITNAAEVW----------RFYQRRMVRIY....PPYLA
A4AIT9_9ACTN/563-845IA..GYNLAR............................FQLANRSDRRRT----------RAILAGVASIA....IPAIT
A5N224_CLOK5/8-329VSGMGLTI.................................NYKKDSSYS----------EFIVKRFLKIV....PQYVL
E0TI88_PARBH/15-315AS..GYFL...................................VGRDGEL----------RISLKGLSRLV....RIFAL
A0A022NJA1_PSEAI/5-324IS..GVFF...................................RTEQPFG----------EMALRKADALL....KPFFV
A0E2L0_PARTE/17-375IS..GFILGKKL........................LTNPNLLLSPIQSM----------LMILDRIMRIYPLYWILLII
C6IRR6_9BACE/9-318IS..GIFF...................................KPYEGLY----------GFIIRKTNKLI....IPFIF
Q2C1R6_9GAMM/10-345IS..AYFVI................................PSFERKGTR----------TFMLDKLKRLG....IPTLI
A7A7B8_BIFAD/5-363VN..GALL...................................LPRKMDE----------AKHYRKTLNIV....IVVTI
Q4JYU7_STREE/6-318IN..GYLL..................................LGKREITY----------LYILQKVKWIL....ITVSS
A9VR59_BACWK/5-346IV..GFHLI...............................RLYTKQLVYR----------EYIYEKAAHLL....IPYFF
A7VGI1_9CLOT/6-345VS..GYFMCVSAAK.....................AEERHTGISLGKETF----------GFALHKIRRILPAYLYCYAL
Q1QR03_NITHX/14-320IS..GLFL.................................PLVINRDWR----------TYLDRKVVHFA....YFYLL
A5ZDF6_9BACE/13-326IS..GYSNLN............................TFNKITKWRELI----------DFVKKSVIRIL....LPVVT
Q16FE1_AEDAE/161-554MS..GLLMAVNFL......................SEAKKQPGFEWQFLR----------NKVVNRLIRFLPVYVLWILF
Q7CTZ0_AGRT5/8-329IS..GYLLF...............................RRGMSGFDYP----------ATIRSKSKTVL....LPFLL
Q8G7P7_BIFLO/17-373VS..GRFNLTCDAGRLGSTRSSGNLPGSGSDARAGGGAGQADPSSLAPYV----------RYYYKRFISLI....VPYLL
A1R1G8_ARTAT/18-357LG..GVTGLQS...........................WRRLRAHGGTGF----------DFAQLRLLRLV....RPAMA
A1VHZ4_DESVV/11-319TATSGYFTA...............................LRYPGAAMMQ----------GYWRRKVSRLC....GLFLF
A0QPG5_MYCS2/9-326IS..GFLIT...............................SSWLRNPRLR----------DYATARVLRIFPGLWVCLLI
A5EXU9_DICNV/19-351TLGVGLVY....................................SRHTSP----------KALLDRGINIL....VLGFL
A6LGX6_PARD8/9-311IT..GFFL.................................QTVIDKGRF----------KGYMQKIAILTVGTNVLYLI
Q11WP3_CYTH3/4-324LS..GYWVVKM..........................YKEKYILFKYPVS----------SFLSSRLLRLLPVFYINVIL
A0K1D5_ARTS2/296-671LS..GLVLGMV..........................YGPKAQDNIGEVA----------QKTGRRAGKLY....VTALA
A6KYR5_BACV8/6-309IS..GYFG.........................................I----------RFNTHKFFKML....VVVWF
Q0CZ95_ASPTN/77-482LS..GYVLSMKPLG.....................CIQDGDYAELGRSLS----------SAVFRRWFRLY....IPVIC
A0T1U4_VIBCL/8-303IS..GVSFT................................LSYKHIPYF----------AYLYKRILRLL....CPVWI
A3I592_9BACI/6-352LS..GFVLFYN...........................YIQKDFTKTLIV----------RFYKKRVTQIL....IPYLF
A1TDU0_MYCVP/22-361A...GVAAS..............................VQSWRPGASWG----------NWLMRRCTRLYRPVFYYLAF

PF07786

A1HQT7_9FIRM/5-214LS--GVSTV--------------------------------LG.................RRPLRRGMAVF----AWGMV
A2SQB7_METLZ/5-231IA--GISLV--------------------------------LSTGRETSP......VKAAKKLVIRSLYLL----CIAAV
A9CIY2_AGRT5/15-234LA--GFSLF--------------------------------LAHGRGLNW..........QSFGKRFAMVA----GAALL
Q28R74_JANSC/28-249LA--GMGLW--------------------------------LAHGTGIRW..........PAFWRRFAKVA----GAAGL
Q8PXM0_METMA/7-237IS--GTALS--------------------------------ISRSRALRSRSSGKPAENFTRYLERGLRLF----SMGLV
A4EC93_9ACTN/4-221IA--GWMCT--------------------------------LS.................RNNIKRAAKYA----LAALV
Q8U2K3_PYRFU/23-240IS--GLSLW--------------------------------ISHSRGREI..........KRDIMRFVKLF----GLGVL
A7I8Y9_METB6/6-231IV--GVSLS--------------------------------VSHARAARR...LQGRALVQKFLLRGGGIF----CCGLL
A6G0Y4_9DELT/12-237IM--GFSFM--------------------------------VARDQSA............TRAARRGLVIL----GAGYL
A3CVR7_METMJ/5-231LV--GLSFT--------------------------------ISYARAARR...LDGRGLALKYVRRGLTIF----GYGLI
Q11IW8_CHESB/30-251LV--GFSLY--------------------------------LAHGHRFRA..........RPFLKRLGMIA----AAAVA
A1TRD1_ACIAC/21-249CA--GMGQA--------------------------------LAWQQGVGW..........GRFGRRWVRIA----ACAVL
A2SGN2_METPP/12-230CA--GLGQA--------------------------------VALHAGQGG..........ARFWRRWAQIA----GCALL
A2STU6_METLZ/14-241IS--GTSLI--------------------------------LRHGRMLDK....PRRAYYMAILKRGIEIM----LIGLG
Q2K839_RHIEC/16-243IV--GISLA--------------------------------LSSTPTIRW..........SSFWKRFGTIA----AAAAV
B8FY44_DESHD/5-221LS--GLSSG--------------------------------FS.................KHPLKNGLRVL----FFGMI
A0NYA1_9RHOB/5-227LA--GISLD--------------------------------FAHHTGIRW..........QAFWRRLGVIV----AAAAA
Q21VS3_ALBFT/16-244CA--GLGQA--------------------------------IAVAQGQRW..........PRFWRRWAQIL----GCALL
Q0FKK0_PELBH/7-221LS--GMSLV--------------------------------LAHGAGLRW..........GAWRRRFLMIV----GAAGL
B2S625_BRUA1/16-233LV--GFSLV--------------------------------LAHGRGIRW..........RPMAKRLLQII----AAAAA
A2STU5_METLZ/19-252IA--GVAIV--------------------------------LRYNRMLGR....PLDAYYRDIAVKALVLF----FIAMC
Q6SHI3_9BACT/5-214AV--GISLV--------------------------------IAHSKQLNL..........RKFLKRLIYLG----IAALL
Q0G6B2_9RHIZ/53-275LV--GFSLI--------------------------------LAHAKGIRW..........RPFGIRLAQII----ASALA
A3YBL4_9GAMM/14-227AL--GWSCY--------------------------------LSCRNGFQW..........PSILKRKFKLF----LAAGG
A4FZP9_METM5/5-227IS--GVSFN--------------------------------ISFSKKVVS.....NNLNYKHYFIRFLKLF----AVSVL
Q11N89_CHESB/6-227LV--GVSLV--------------------------------LAHRETIHV..........RAFTRRLFSIT----AYAMV
A4J1M2_DESRM/9-218LA--GVSCS--------------------------------LS.................KSNLKRGRNLL----FIAIL
Q6SGH9_9BACT/9-218AV--GISLV--------------------------------IAYGKSFNL..........NKFIKRLALLG----LAALL
A1VNB1_POLNA/5-231TA--GLGQS--------------------------------VAVQQGQAW..........PRFWRRWAQVA----GSALL
A3DGD5_CLOTH/11-220VS--GISTA--------------------------------FS.................KNSFKRGVVVL----SAALL
Q98KU6_RHILO/16-237LV--GVSLY--------------------------------LAHGQQIRW..........NGFWKRFAMVA----GAAIA
A6VZM7_MARMS/12-224AI--GWSAY--------------------------------IALGKSNN...........SSFWKRDIKLL----ISATA
A1W6I8_ACISJ/12-240CA--GLGQA--------------------------------VAWQRQVGW..........ARFARRWSQIT----ACALL
Q6M0I2_METMP/11-233IS--GVSFN--------------------------------VSFSKKVAS.....QNLTYKSYFNRFLKLS----VIAVV
O26882_METTH/9-227LV--GVSLS--------------------------------LSHSR........RGVTSRRHYIIRGLKIF----LWGMV
F6BVW5_SINMB/23-246LA--GYSLV--------------------------------LGQLPKLRP..........RAFAIRFAKIA----GAAAL
B1ZHM9_METPB/15-237LV--GIGLV--------------------------------LANGGGVRW..........RPFLWRLARIG----GAALL
Q2Y4H0_9ARCH/17-243LV--GISLT--------------------------------LSYSRAKKK....QKKKLYLKYLKRGVKIF----SWGLL
O29726_ARCFU/2-207IS--GYTLS--------------------------------VV.............KPDFSRLKRKVLKLA----ALSLA
Q12ZG6_METBU/7-234VA--GISLT--------------------------------LSFSKQLEM...EQTKPKFIKYVKRGSKIF----LWGMA
A4BIP8_9GAMM/6-220SV--GAGLY--------------------------------LAHYPTIRW..........RKFWWREAKIA----AGALI
Q8THP4_METAC/31-261IS--GTALS--------------------------------ISRSRALASEALGKSEENFSKYLKRGLRLL----SMGMI
Q46DC7_METBF/7-237IS--GVALS--------------------------------ISHSRALNQESAGNGAENFSKYLKRGIKLY----LMGLL
Q2FN30_METHJ/7-229IA--GISAH--------------------------------LKAEKTPGM......MNQFSTFFKRGGELL----LIGMG
Q1YI63_MOBAS/15-237LV--GVSLV--------------------------------LANGRGIRW..........QPVGKRLLQVV----AGALA
Q1B004_RUBXD/18-243LA--GLSLT--------------------------------LSYRRAARP........TFGKYLRRGLRIF----AYGML
A6FRV3_9RHOB/4-228LA--GVSLV--------------------------------VAHAETVRW..........RAFAKRFVKLV----LAALA
Q1YJ44_MOBAS/24-246LV--GVGLV--------------------------------LAHFRYTHW..........QKFLTRLAKIV----VAAAA
Q26I67_FLABB/5-236IS--GIIFT--------------------------------YLLMKSKKK...GQAPERIRKGLLRGLLLI----AIGYG

PF05857

A6TIJ3_KLEP7/24-240AW--GMNLA--------------------------------R......HA----------EIRQSQLNSLW--------G
Q5NWL3_AROAE/9-222VL--AYNLA--------------------------------RPD..VMAR----------GTYGRTMKRLG--------L
Q88AH9_PSESM/14-243AI--AVNLS--------------------------------RRSAALVAP----------RVQWRYLGWLL--------A
A6M0I9_CLOB8/13-266TM--AEGFF--------------------------------Y.......T----------GNRKTYVKRLY--------L
C1DKH3_AZOVD/14-243IL--AVNLA--------------------------------RPRPEALRR----------AALARYCGWLL--------A
A4XUI8_PSEMY/4-231GI--AANVS--------------------------------RSHPGDLYS----------ENNFRYLSWIL--------A
A4XH28_CALS8/24-230QV--AAGFK--------------------------------F.......T----------SNPKRYLKRLF--------I
A1WDN4_ACISJ/11-221VL--AYNLA--------------------------------RPG..TLER----------GVYGRTMSRLA--------V
C4YYW6_9RICK/13-242FA--GYNF.--------------------------------.........----------..HDKPKTHII--------I
Q326X1_SHIDS/32-247VW--GLNLS--------------------------------R......HA----------HIRQPAINRLW--------G
Q8P901_XANCP/6-212VF--AYNLA--------------------------------Q......PG----------ADVAKLIKRLF--------L
R5K8R7_9CLOT/9-229LL--VEGYF--------------------------------K.......T----------RNRWRYLGTLL--------V
R5KLN1_9CLOT/10-244LL--VEGYR--------------------------------H.......T----------SDIRKYFIRLF--------L
R5QZC4_9FIRM/5-243LL--VEGFF--------------------------------H.......T----------HNLKKYILNLG--------I

PF16401

H1Y6N2_9SPHI/12-268AM--GAAIP--------------------------------LALVKKSA.----------VQPLWKTLLQIAQRYVLLAF
G8TDM1_NIAKG/23-280SM--GAAIP--------------------------------LALHKKVKE----------GSGTAMVLYTAIRRFAGLVF
F0SC25_PEDSD/7-264SM--GAAIP--------------------------------LAMKKKIE.----------NSSSLNIFISIVKRFVLLTF
R6N358_9BACE/4-263AM--GAAFP--------------------------------FSIGRHAEK----------GRSKLLLSYDAIKRGIQLTF

PF04235

Q8EH35_SHEON/199-352LG----------------------------------------------------------LT..................
YXAH_BACSU/242-392VL----------------------------------------------------------YS..................
A5VFY1_SPHWW/226-385LI----------------------------------------------------------HA..............VLVF
B0T5F0_CAUSK/216-381LW----------------------------------------------------------QAPL........LAAAPAGG
Q5LBX3_BACFN/231-393QL----------------------------------------------------------KV............QLMDAG
A8FJB9_BACP2/218-375AL----------------------------------------------------------VF..................
Q8ZNL6_SALTY/215-375LP----------------------------------------------------------AV...........ILQWRLD
Q5Z0S5_NOCFA/200-354VW----------------------------------------------------------QW..................
Q5LAR8_BACFN/229-391GL----------------------------------------------------------NN............MLPEFI
A5FKP1_FLAJ1/222-380II----------------------------------------------------------FY.................S
A6LH60_PARD8/231-393QL----------------------------------------------------------KV............LLMDTA
Q2NUE2_SODGM/217-377LP----------------------------------------------------------AV...........VAQWQLG
Q5L251_GEOKA/223-378TI----------------------------------------------------------PY..................
B9LP38_HALLT/238-398VA----------------------------------------------------------GV............VYIEAN
Q5WBU3_BACSK/218-382LP----------------------------------------------------------HA...........LYSNQLI
Q5LDG8_BACFN/245-405VL----------------------------------------------------------YA...............WSA
Q2N5U1_ERYLH/237-397FL----------------------------------------------------------LA...........NWVAESG
Q1D273_MYXXD/254-423GG----------------------------------------------------------GLLLF.....RLRKAGVLEW
Q0RI89_FRAAA/226-396LP----------------------------------------------------------YA...........FVSAGIA
Q1GR12_SPHAL/244-406VG----------------------------------------------------------LA...........LYQMRTG
A3HTP0_9BACT/227-391VI----------------------------------------------------------FIF..........LLPDWGI
Q0C162_HYPNA/232-392LW----------------------------------------------------------GA...........RLLLDAD
Q9X356_BACAN/222-381CP----------------------------------------------------------II..............YYFI
A8FH56_BACP2/222-385QS----------------------------------------------------------ST...........IIVAINP
Q5WCD3_BACSK/239-403LL----------------------------------------------------------EVS..........IRYNLID
A4GA59_HERAR/238-403LA----------------------------------------------------------WATM........VVAEAIDP
YRKO_BACSU/224-387QS----------------------------------------------------------SI...........LLDMFNL
Q47SA7_THEFY/269-436LL----------------------------------------------------------HA...........LDHVGIL
Q21P05_SACD2/237-402AL----------------------------------------------------------MAG.........TFVLVGEP
A4FQ93_SACEN/204-361LL----------------------------------------------------------T...................
Q3IC82_PSEHT/208-361TE----------------------------------------------------------QY..................
Q2NDD6_ERYLH/264-425LW----------------------------------------------------------IA...........LWVREGG
Q9HNH9_HALSA/232-393AA----------------------------------------------------------GV............WYITAA
Q9KFW4_BACHD/1-165LP----------------------------------------------------------LA...........IVGAHSW
Q8ERW4_OCEIH/226-381LG----------------------------------------------------------PY..................
Q7N6K6_PHOLL/210-370IF----------------------------------------------------------SV...........VFQYIHN
A4ARZ9_MARSH/230-396AL----------------------------------------------------------TALI........FMQMGENP
B1YLL9_EXIS2/215-367YP----------------------------------------------------------IV...............QIH
A6L2L4_BACV8/234-394GL----------------------------------------------------------GN............MLPDFI
A1WTH2_HALHL/248-410IV----------------------------------------------------------GI...........AYREWRD
A1S3E3_SHEAM/216-369LY----------------------------------------------------------FS..................
Q9AA92_CAUCR/270-432GW----------------------------------------------------------ES...........SMKLATD
Q0ARL9_MARMM/225-387HT----------------------------------------------------------ST............TTMIVG
Q07YN3_SHEFN/228-381LS----------------------------------------------------------LS..................
A8F9F5_BACP2/224-375CA----------------------------------------------------------TF..................
A6L9Q0_PARD8/227-389YL----------------------------------------------------------SL............SLPGLL
B0T422_CAUSK/230-391MA----------------------------------------------------------ET............IYVLLP
A6WB03_KINRD/147-299LA----------------------------------------------------------QA..................
Q47R13_THEFY/238-395LA----------------------------------------------------------T...................
A8MJB9_ALKOO/219-378IP----------------------------------------------------------MV..............KLYL
A6TNH6_ALKMQ/249-412II----------------------------------------------------------CI...........IFGYFYL
Q1D7M3_MYXXD/255-425VP----------------------------------------------------------GVVVTV....LMQKKVLTPE
Q6NJJ5_CORDI/212-362IP----------------------------------------------------------WG..................
A5UQH7_ROSS1/237-401LA----------------------------------------------------------LA............WQMRVT
A7MLK3_CROS8/215-375LP----------------------------------------------------------AI...........VVQWHLG
Q9KE13_BACHD/42-195IA----------------------------------------------------------TV..................
A8GC25_SERP5/223-383LP----------------------------------------------------------AV...........ALQWHLH
Q8A424_BACTN/229-391GL----------------------------------------------------------IN............ILPDFI
Q9KFA2_BACHD/226-379LL----------------------------------------------------------IF..................
Q9KEU3_BACHD/250-400LL----------------------------------------------------------AA..................
A4FQT6_SACEN/171-324IQ----------------------------------------------------------VI..................
A6TBN7_KLEP7/215-375LP----------------------------------------------------------AI...........FAQWYLA
Q4KHM8_PSEF5/226-387LL----------------------------------------------------------YG.............YWAAY
A4F774_SACEN/171-329AA----------------------------------------------------------GS............VAALLW
Q9K7D7_BACHD/224-377AL----------------------------------------------------------PL..................
A6KYE7_BACV8/229-390QL----------------------------------------------------------KE.............LIMAS
Q2G3S1_NOVAD/241-402VA----------------------------------------------------------AL...........SWLAAHG
Q1IVW5_DEIGD/222-381VL----------------------------------------------------------LA..............WLNT
A4AN58_MARSH/230-392LL----------------------------------------------------------EK............NFAELT
Q9RS74_DEIRA/223-382AV----------------------------------------------------------LA..............FLNT
A3HYS5_9BACT/265-426YY----------------------------------------------------------EM............QTILDA
Q6D3N4_PECAS/227-387SI----------------------------------------------------------GV...........VGQWLVG
A5FKP0_FLAJ1/222-380IG----------------------------------------------------------FN.................I
A6LGL5_PARD8/234-396LL----------------------------------------------------------KP...........YIPAASW
Q3IPY1_NATPD/256-418LT----------------------------------------------------------GV...........WYREAVG
Q5YUW9_NOCFA/233-388LA----------------------------------------------------------AG..................
Q9K6N5_BACHD/237-398LL----------------------------------------------------------FF.............YSSTQ
Q8EL60_OCEIH/225-388LP----------------------------------------------------------LS............FIGSVW
A9WKI7_CHLAA/242-404LA----------------------------------------------------------LA............WLVMYG
B0RFW7_CLAMS/254-423LP----------------------------------------------------------LV...........LAAVGAI
B1HN91_LYSSC/223-376SL----------------------------------------------------------PI..................
B1HPE9_LYSSC/165-337LY----------------------------------------------------------QWHYVPTANVNINHLSKIQL
B1HRQ0_LYSSC/190-342LW----------------------------------------------------------IW..................
B1HW32_LYSSC/220-369LL----------------------------------------------------------IF..................
B1HYB2_LYSSC/222-372SI----------------------------------------------------------SF..................
E3FDU1_STIAD/253-420GA----------------------------------------------------------TFLV.......GQLTNAGHI
E3FTX2_STIAD/250-412AL----------------------------------------------------------NAW.........LEARLGSA
Q74VB6_YERPE/216-374IP----------------------------------------------------------GV...........ALQVYVG
Q7VYP4_BORPE/228-388AV----------------------------------------------------------YA.............WSGLP
Q812K5_BACCR/224-376IL----------------------------------------------------------AM..................
Q81SQ3_BACAN/217-376FF----------------------------------------------------------MV..............RYFL
Q8NMY9_CORGL/70-221II----------------------------------------------------------QA..................
Q8P7N0_XANCP/245-401LV----------------------------------------------------------SYR..........LEPWMDP
Q9PFK6_XYLFA/262-418LL----------------------------------------------------------SVH..........LASWQDV
R5USE5_9BACE/227-387SL----------------------------------------------------------KE.............QIMQS
R6X5K4_9PORP/228-389FI----------------------------------------------------------TA............SLPDMI
U5L4L4_9BACI/226-379AS----------------------------------------------------------PL..................
U5L6C6_9BACI/232-386LV----------------------------------------------------------PY..................

PF07779

U1HPB3_ENDPU/212-693VMLGGVLTVRKPGDTSAETSAKPTRATLGQKFLSRDQTDEWKGWMQFVIL----------IYHYTGMSNVLWVYQIIRLL
Q6CDI8_YARLI/311-778FLVATGYSFEPQNDNS...............FLNRHQTEEWKGWMQIIIL----------IYHITGASKILPIYKFVRVL
Q9W4P0_DROME/351-846VFALGLFFTED.SRFT..............KVLNRDQTDELRGWILLVVL----------IYYMTGAQRVLPIHMHIKLL
F6X8U0_XENTR/294-776ILVLGVFYNEN.TKEA..............KLLNREQTDEWKGWMQLVIL----------IYHISGASSFLPVYMHVRVL
K1QBI1_CRAGI/299-786LMILGFFFTEN.TDQT..............KVLHRDQTDEWKGWMQLVIM----------IYHLTGASKVLPIYMHIRVL
B7Q496_IXOSC/303-799VFALGLFFTEE.TQHT..............QVLHRDQTNEWKGWMQLIIL----------IYHTTGASQVLPIYMHVRVL
T1INP0_STRMM/300-790VFALGLFFTEE.TQLT..............KVLHRDQTNEWKGWMQLVIL----------IYHMTGASQVLPIYMNIRVL
H2Z694_CIOSA/175-652IVFLGVFGIDA.AEKP..............VFLNRNQTDEWKGWMQLIIL----------IYHMTGASVNVPIYMHIRLL
D6WF47_TRICA/333-815VTVLGLFFTED.SKYT..............KVLHRDQLNEWKGWMQLVIL----------VYHITGASRILPINMHIKVL
W5MY98_LEPOC/349-830IFVLGVFYTEN.GKET..............KVLNREQTDEWKGWMQLVIL----------IYHISGASAFIPVYMHVRVL
G3NTP4_GASAC/295-774IFVLGVFYNEN.TKES..............KLLNREQTDEWKGWMQLVIL----------IYHVSGASAFLPVYMHVRVL
E9GCH2_DAPPU/313-803VFALGLFFNEE.SRST..............KVLHRDQTDEWKGWMQLVIL----------IYHMTGASQVIPLYMQMRVL
E9C8Z6_CAPO3/466-972MFVAGWCTLTHVKTAP..............TFLSRDQTDEWKGWMQIVFL----------IYHFLGGSSVLPLYMLVRVF
L2GH03_COLGN/240-722VILAGL......SLRSRPPVLSSAKGLATTSFLSREQTDEWKGWMQAFIL----------LYNYHAASESLAMYKVHKFL
E0VHC9_PEDHC/297-768ILCVGLFFTED.SGNS..............KVLHRNQTDEWKGWMQLVLL----------IYHWTGAQKVLPIFLLSRVI
F6XMQ8_CIOIN/290-767IVFLGIFGIDS.TKQP..............VFLNRDQTDEWKGWMQLVIL----------IYHVTGASVNVPIYMHVRLL
H2QUY3_PANTR/295-776ILVLGVFYNEN.TKET..............KVLNREQTDEWKGWMQLVIL----------IYHISGASTFLPVYMHIRVL
T1G7I3_HELRO/252-726LMILGLFFTES.TKQV..............QVLNRCQTDEWKGWMQIVIL----------IYHLTGASKVLSIYMHIRVM
Q17CG6_AEDAE/303-783VFVLGLFFTED.SKFT..............KVLHRDQTDELKGWMQLVIL----------IYYMTGASHVLPIYMHIKVL
H3A7E5_LATCH/298-779ILMLGVFCNEN.AKES..............KLLNRDQTDEWKGWMQLVIL----------LYHISGASSFLPVYMHVRVL
H9KE76_APIME/294-775ILALGLFFTEDRERGP..............RTLNREQTDEWKGLMQAVVL----------IYHVTGAKNVLPIYMYLRLI
S8EFZ6_FOMPI/324-771SLAAGLSTMRQADKDL..............GFLNREQTDEWKGWMQIAIL----------IYHYTGASKISGIYNVIRVL
X1WW08_ACYPI/313-776VFVLGLFFTEE.SRYT..............KVLHRDQTDEWKGWMQLIIL----------IYNLTGASIKTSIANHVQIL

PF10129

A1R109_ARTAT/441-826VYGLSLLPFI.--....NAAAVT--TFTDQGTGGAGRAAAGTTYDLYAGMEGLL--------------------------
A0K1D5_ARTS2/295-678VFALSLIPAF.--....NSDVLT--SFTDQGTGGAGRSGAGRTYDLYTGMQGLL--------------------------
A2SCM7_METPP/4-366LFTVIALIGVL--A...RQDAIT--NL......................ISFYF--------------------------
A1TNJ8_ACIAC/18-379LFTVITFIGIR--V...DEPAIK--GL......................LTFYL--------------------------
Q1D6T0_MYXXD/55-417AFAVIGTLGMA--T...HRPAIH--NL......................LGFFH--------------------------
Q11B97_CHESB/2-386VVILGLILS..--....KSSTYW--EP.....................WLWKLA--------------------------
Q7CT44_AGRT5/2-385VLFFRMVIP..--....HAPYIW--YN.....................WLGMTS--------------------------
B2JS58_BURP8/58-406MLVVSAVMSAF--SI..DAPNMA--TT.....................DLDDMM--------------------------
Q13NS3_BURXL/7-355MLLVSAALTAL--SI..DGPNLA--TT.....................DLDDLL--------------------------
Q1LDM8_RALME/9-370MLLFGFLLAMC--KV..PAPAVR--AT.....................EAPAFM--------------------------
A1B1M7_PARDP/3-363LALFSALLFKL--QM..NHTAVW--FQ.....................YARWIV--------------------------
Q5FTQ3_GLUOX/17-367FVWTVRQWR..--....HYQPLP--EY.....................TIEPQL--------------------------
Q89UF3_BRADU/67-422YIDTIAYVASQ--SM..APEIIH--EY.....................NISGIL--------------------------
Q89KT4_BRADU/82-438YLTAVHYLAHR--FD..DLHLMD--QF.....................NVAPLM--------------------------
A4YU73_BRASO/12-368YIVAISYLATR--FG..VSEIID--EF.....................NVAGLV--------------------------
Q6N6S8_RHOPA/12-368YIVAIGYVAQR--FS..DPEIIN--EF.....................NVAGLV--------------------------
Q1QFJ8_NITHX/39-395YAAMIGHIAQS--YD..NPALIN--EF.....................NIAGLV--------------------------
Q89VE5_BRADU/37-393FLAEISYVATS--FE..NPLYTE--EM.....................GIMDFL--------------------------
Q6N0J3_RHOPA/44-400FLAEISYVATS--FQ..NPLYSE--EM.....................GILDFL--------------------------
Q3SWD7_NITWN/36-392FLAEISYVASS--SE..NPLYTE--EM.....................GILDFL--------------------------
Q89CC1_BRADU/15-372FTAQIARTARR--FD..NPMYEH--EF.....................NVFNFL--------------------------
A4YYN0_BRASO/36-389YAALVWVIGG.--....GSRFVD--ET.....................NTGFLF--------------------------
Q89EQ8_BRADU/32-383CAIVVHLAG..--....GGPLAD--KS.....................NTRILL--------------------------
Q87XJ3_PSESM/5-366LMGIVFVANNH--VE..TRDMVQ--QM.....................GLEYFV--------------------------
Q0BVC0_GRABC/14-370FAAQVTYAAQF--MD..RTDYLD--EI.....................NLDVLG--------------------------
A5G015_ACICJ/9-360FAAQVALAAIW--FA..RPQYIS--GV.....................GIDHLV--------------------------
B0U809_METS4/3-358ALAMLAAAALL--LD..NPLLLE--WH.....................NAGPVF--------------------------
Q2K344_RHIEC/23-378TLALFICGAWL--FH..RPGLLV--EI.....................NILAVL--------------------------
Q2YRC8_BRUA2/6-358TIAIFAAAAIF--LK..RSELLT--QI.....................NIAPLI--------------------------
Q983D5_RHILO/37-389VIALFCTVAVL--TR..RPELLK--LI.....................NIEPLM--------------------------
Q6G5Q7_BARHE/16-368TLSLFLGAFCL--WQ..TEKLLS--MN.....................NVGLFF--------------------------
Q3J1N1_RHOS4/11-372AIAISAAFALW--FA..APDLLH--QN.....................QVWILF--------------------------
Q11DW2_CHESB/11-364AIGILAAGVVF--LD..TIDVLA--RV.....................NFTPLL--------------------------
Q1GGF0_RUEST/47-428VAMSMAALDLY--GG.FEKSYIG--SL.....................NLRPFF--------------------------
Q169P8_ROSDO/29-397IAGTMVFLNST--EL.FERDYVG--QL.....................NLYPFF--------------------------
Q0BQN1_GRABC/63-424VAALPGLLAHV--TGHRHYNFVE--LF.....................ELYHLY--------------------------
B0RH46_CLAMS/492-873VFALSFVPFL.--....DTDVIT--TFTDRGTGADGKVTTGQVYDLYPNGARLL--------------------------
B4EL00_BURCJ/18-366MLVVSVVLDHY--GI..DAPNLA--LD.....................DVSVML--------------------------
B4ELU9_BURCJ/9-352MLLITAALNAF--AI..DGPNMP--TN.....................DLDGLL--------------------------
E3FIJ7_STIAD/5-384IIALGFLLT..--....ESSVYW--EP.....................WLWQLA--------------------------
Q13QD3_BURXL/18-362TLLSGAALAAL--NL..NRPMID--LT.....................GWPPFA--------------------------
Q5LPG0_RUEPO/27-401TAMSMAALDLS--GL.FEKSYVD--GL.....................NLQHFF--------------------------
Q63IA9_BURPS/14-358MLVVSAVLDHY--GI..DAPNMA--LD.....................DISVLL--------------------------
Q6NAS6_RHOPA/6-361FTAQISRAARR--FD..NPMYKD--EF.....................NVAQFL--------------------------
Q92L11_RHIME/23-374TLAIFAGGALY--FG..RQELIG--EI.....................NIRPIV--------------------------
Q9KQQ7_VIBCH/3-361AMLWFWLGSHY--FA..EQVTVF--GG.....................SFSNLP--------------------------

PF01757

A8DMZ1_STALU/12-334VGCFYCYSESR--KL--GDPFWH--QF---------------------WQNVVL..........................
K6RN31_LACCA/20-369WNTLLLAGSVL--LG--VGGFTI--AN---------------------FWPDYL..........................
A8G974_SERP5/5-314VLFIFVPIGII--FF--PGERYS--LS---------------------PSLFLE..........................
Q11WN8_CYTH3/14-339TYVAKSFISDE--WL--DFQWIS--FL---------------------ENICMLQDFS......................
A7LV98_BACO1/4-296ICIACYVISSV--VN--HEFNWD--WS---------------------HVWAFVN.........................
F0K6S5_CLOAE/6-334YELIFLVLHNF--FI--KFNVYH--FK---------------------YYSMGDFISS......................
A0A009DRR0_ECOLX/9-357AIPLLTLPQFI--ML--QYVKGK--AE---------------------SWPGLSL.........................
Q07PA2_RHOP5/14-375GLPILLIVFVP--IF--TAAAVI--KN---------------------GGQLPAP.........................
Q30BE9_ENTFL/7-326AILLYIPINVY--NG--YFKMDN--LL---------------------PNIIKD..........................
A1HPJ5_9FIRM/6-350WSLLYMLHYTL--VS--GDTQPW--TP---------------------PLIYEY..........................
Q4P0M9_USTMA/127-516WLVIQKVECGT--HA--FDQTVI--AE---------------------GWLQSGNLGYPQWCNVNFNNPSPFPR......
A7LV97_BACO1/24-312WNIVGGGILCL--YN--RAQVGD--SI---------------------VNCVQQ..........................
Q1QWT8_CHRSD/4-315WMLVYAYFWID--VP--ALTPYE--LL---------------------KVLRVA..........................
Q2T7M4_BURTA/6-373AWILWRSGAIY--TA--HASEIG--VA---------------------GWVSSWYAGPFTFS..................
A4B9D7_9GAMM/5-375SFGLSITVFGS--EL--NMESLM--RL---------------------ATGLTFLN........................
A0A015ULW8_BACFG/8-315WALIAAVFFDQ--RY--DMPEI.--..---------------------................................
M6C4Z5_LEPBO/44-373VSFLAACIKLQ--SL--PSITEY--LN---------------------GILFGS..........................
A5ZUV3_9FIRM/6-346WIFFNYIFCCV--IE--HQTFNI--SR---------------------LLLEML..........................
A1VGB5_DESVV/30-339SLVLYKILGIL--LL--DQRDYL--AG---------------------VFYNIG..........................
B2JGA6_BURP8/53-400YSFGNYLAAHF--NT--QITAPH--DV---------------------SDVLANFLF.......................
Q9XAP7_STRCO/24-348WGLFVVGAMLA--RG--WMPGWQ--IV---------------------YWVVPLG.........................
Q07KV2_RHOP5/17-343VVVAYAINPNW--KL--GGSDYG--VE---------------------TLTKSY..........................
Q484G4_COLP3/18-372AIAIVVAPQSY--YE--AIQKGV--FE---------------------GNFWQFWSSHY.....................
A0DGZ8_PARTE/156-556NSYILPYLGGG--PR--WWSAMN--YT---------------------DCAAGAFRNL......................
A7A7L5_BIFAD/6-324WSLILVAFYLV--FD--RTDLGM--KL---------------------MVKSIA..........................
A3JPT3_9RHOB/10-350WTVFYALYSLI--KA--YSYGYQ--DA---------------------IFNDLQSV........................
A5EMI0_BRASB/26-386AALTVIPLAYY--AI--ELRANP--EA---------------------TFAAFW..........................
A4FKM9_SACEN/20-347AVVLIYAVMRL--FP--VDGWFD--PG---------------------WGDLLANLL.......................
A7V903_BACUN/5-297MEAAYTVMSHF--LP--VRESVD--AI---------------------TPTVLL..........................
Q8IG66_CAEEL/330-720MGLVYNHLADG--PF--WNANGM--FG---------------------TECNVTTIWP......................
Q7UES3_RHOBA/12-486GMSTIIPSIWI--VA--GHIQAN--PS---------------------ANVTVFDETDLLIPGVQDDLAAVEKALAAGAD
D8IMM9_LACSC/4-332TSFIMIMLTAV--SL--HFHPIY--LG---------------------RIADSTRYAALAAL..................
Q8PXP5_METMA/13-333YSLLISVPLFF--VT--YISVYY--LN---------------------LDYKGLNIFWED....................
Q6AH04_LEIXX/3-320LGILVGLFGAQ--VY--PILHYC--GA---------------------VCLLLL..........................
Q5CVD7_CRYPI/23-437GYFILLPITHY--VA--NGRRPC--TY---------------------TLDGAPANFH......................
A0LT35_ACIC1/10-359YAAAIVAVVVL--CR--LLGVSA--AN---------------------TALAAW..........................
Q8KJJ2_RHILI/23-344WCTLIWTLKSA--VI--FPTKSL--TD---------------------TLLDLS..........................
Q17BV3_AEDAE/212-599VLIFYSVVWEH--LG--SGPQWG--DV---------------------VVKNANLCKHNFW...................
A7F3R9_SCLS1/8-361ATTIIWFLCQF--GI--YKIAKR--SD---------------------SWWIEATSPDITPYFGD...............
Q144E0_BURXL/4-320WSILQTGVQWF--VA--EYRDYS--LQ---------------------QMGPTR..........................
Q83YQ9_STRGN/5-307YSIVHFIDLVL--SG--ELAEKM--AT---------------------IDQSDFANF.......................
Q07P25_RHOP5/21-323WSLIQGSIIML--LA--RDVNIP--IT---------------------AHDLAA..........................
M2EB77_STRMG/14-327YTLLFILFFTF--LQ--KPITYH--DW---------------------IQAFFP..........................
A0LP70_SYNFM/14-366YLVSPFMDRQD--PI--DFRFVL--SV---------------------LGDRFY..........................
A8H1P8_SHEPA/43-369LSLPWIVWHLT--VG--TDPMMH--QA---------------------LANITAPA........................
A6E8A8_9SPHI/14-335LNLVTYVLWLI--FF--KDFDPY--YY---------------------TKEPLYKQFI......................
A5VFE0_SPHWW/65-420PFLLFAAGLLP--TQ--EAAQVS--GS---------------------EWLDRSGGIKYWAPWPE...............
A5LX53_STREE/8-323YSIIHFCLQKV--AG--ASVRVP--TT---------------------IFNLLN..........................
Q4UW44_XANC8/22-341VAYGYWILSAV--LN--GTSQSW--AG---------------------HPWWHPFV........................
Q2HGI8_CHAGB/115-578STLLITLLVAS--GV--YERTRA--VA---------------------ADPALLRNVREPHVGFDVTDNDGGGGGGGG..
A6BII1_9FIRM/11-365WGVITIIFLMF--IR--GEYLSA--KE---------------------FLLTFW..........................
F2HK93_LACLV/4-320ISLLVWGVLSL--VG--KGSDFS--TA---------------------INGIFD..........................
A5N097_CLOK5/9-357GCVFLNPITSY--LY--GLSIGR--KQ---------------------SFIEQIKLYFT.....................
Q8FTN8_COREF/16-398FLLASAKITAS--GV--QWVLDF--AD---------------------LKFWLPNALL......................
Q6G5Q7_BARHE/17-365TTFVTLSLFLG--AF--CLWQTE--KL---------------------LSMNNVG.........................
A0A016XC94_VIBCL/4-356IAMLWFWLGSH--YF--AEQVTV--FG---------------------GSFSNL..........................
A7AZT9_RUMGN/12-318WNFLYYILHFV--AR--RIPYFG--QL---------------------FDTAVPFSL.......................
Q2NRT0_SODGM/9-399SMLVVTLMQWL--AI--PPEGPG--AT---------------------IRFVVYDTNEVLGQTHPELFRHY.........
A4CKW1_ROBBH/7-342RTNLFGLLQGQ--IY--PSFYLV--DV---------------------LHCIGV..........................
A6FAM6_9GAMM/8-349YFVFMFTFNVV--YN--GMGFAE--WF---------------------VPLSKPLILKL.....................
A7V2Z2_BACUN/14-354GAAFFYFQESP--CF--PPIENT--SI---------------------GTMLLVMLLGCTLL..................
Q00XL5_OSTTA/15-388FAPMFFYADSF--YN--GPVAAA--AH---------------------GLMTFTLT........................
A4YYF7_BRASO/15-345VAGLQAIYVAQ--HG--FAFVYQ--SN---------------------DLGHFLAQLF......................
Q1D0W9_MYXXD/39-356HWPGWSTVIQM--GL--TERMLT--KV---------------------LVFD............................
Q16PV5_AEDAE/243-647QVSWFDRMGSG--AT--GHSLVG--VE---------------------MQLCKENGWSN.....................
Q82ET0_STRAW/57-398WTLAVGGLLAA--GA--DFGTVH--TL---------------------VKLALS..........................
Q4JZS0_STREE/5-327FLIFIDILVER--SF--SHLIEG--FT---------------------EATLVF..........................
A7X0T7_STAA1/8-314FFAFFSIYYFL--TG--KSDELQ--LD---------------------PFNPVF..........................
Q7MGC8_VIBVY/15-336MPFNFQVVAEH--GY--LAERQG--YW---------------------GYLAQT..........................
A6KZK8_BACV8/9-367WSVMLPVLYFI--YL--NYITTT--DN---------------------PTIDMSAFTLEM....................
A4CUQ6_SYNPV/6-368GLFIVNNISLL--IG--RLSPSS--PL---------------------EFLSLS..........................
B5BHU4_SALPK/5-319YSVVALAYISL--FT--SINVEL--SL---------------------KNVLQK..........................
A6P1P2_9FIRM/9-341WGAVYAIVDFG--RV--NGAFTW--AG---------------------IRSALY..........................
A5FYP6_ACICJ/4-317MAFAITAGKLA--AA--RFIHVD--NP---------------------PQGLLGGL........................
Q7MQA5_VIBVY/5-328WSLFYALLSGL--SA--SGFDSS--KV---------------------TEVLSN..........................
I7HSS1_LEGPN/10-336SSVMSYFLLLV--PD--LKNYST--SL---------------------LATILSSSNIYFW...................
A7V3H1_BACUN/5-305WYIIQCCLFRE--IP--EVKAS.--..---------------------................................
A0A016DJ19_BACFG/4-349FMILYSTLPML--WG--QINGET--SL---------------------TDLSRI..........................
A2SCM7_METPP/5-359LFTVIALIGVL--AR--QDAITN--LI---------------------SFYFEQ..........................
A7ZZ73_ECOHS/5-329QWLALSALNQW--LA--PERDLS--NA---------------------SNAAYADS........................
A5UMZ7_METS3/7-344WNTLLALLMTA--SA--GKLSFS--FS---------------------CVVYFM..........................
A3YY52_9SYNE/16-323ALLLFDLCGLL--KP--GQFIGA--AL---------------------LSASFS..........................
A4AIT9_9ACTN/563-845WIGIVTLLGTA--YA--ATTVFL--VN---------------------NFVGSA..........................
A5N224_CLOK5/8-329WCILYVLIITK--NF--NIYSDL--SD---------------------MVYGNV..........................
E0TI88_PARBH/15-315SCVLFLPLHFL--RY--VETPIE--GV---------------------GVEFLL..........................
A0A022NJA1_PSEAI/5-324TMLGYVILRDL--LR--GQPLLP--DI---------------------GGVLYA..........................
A0E2L0_PARTE/17-375YIILPKLFTNV--GY--TENCMD--NI---------------------AYVSTL..........................
C6IRR6_9BACE/9-318FYVSAFLLKYI--VW--KIAPET--FH---------------------LPVSWREL........................
Q2C1R6_9GAMM/10-345TLFLILPSGSI--ES--FVSNIK--GF---------------------FLTGNI..........................
A7A7B8_BIFAD/5-363WRLLAAAFFVF--VD--GSHPVT--LK---------------------DLVLFL..........................
Q4JYU7_STREE/6-318WSFIVWLFKRD--FT--TNPIKK--IV---------------------GSLIQR..........................
A9VR59_BACWK/5-346WSILYLLTTND--VI--TLQGGI--KS---------------------LLLGTA..........................
A7VGI1_9CLOT/6-345GLCVWFVEVGR--YV--YLKEGI--IG---------------------LFIAIVKMIPN.....................
Q1QR03_NITHX/14-320WTAIQFGFKAP--HF--AAEVGW--PG---------------------VIHLYL..........................
A5ZDF6_9BACE/13-326FCVIGLTPNFI--..--......--..---------------------................................
Q16FE1_AEDAE/161-554TGSVYGILSSG--PM--AYHTLK--AH---------------------SLPCRNLWWAN.....................
Q7CTZ0_AGRT5/8-329WNGALFAVVLL--VQ--LFDVGV--GY---------------------FPDLWNASPR......................
Q8G7P7_BIFLO/17-373YAGGMGFVAYL--VI--DHRSVG--GA---------------------VSGTLF..........................
A1R1G8_ARTAT/18-357VLAVMWGGLWV--AL--LLGVHP--AV---------------------IQLMTA..........................
A1VHZ4_DESVV/11-319LNAVLGCVFLA--TG--REGVFT--WD---------------------ALVNLLGLNG......................
A0QPG5_MYCS2/9-326IAFVMAPIGVL--LQ--GGSVSG--LM---------------------SSYAPIEYVLNNAVLN................
A5EXU9_DICNV/19-351LNIVRFSLPII--WD--ASLLNE--PF---------------------PYVAVI..........................
A6LGX6_PARD8/9-311LGFLYGTLDAL--SI--KDVCLQ--LL---------------------GVPVWG..........................
Q11WP3_CYTH3/4-324MIAVICFVKQQ--SL--HEYIRV--LN---------------------PDVPFVLSH.......................
A0K1D5_ARTS2/296-671VVVLVFALSLI--PA--FNSDVL--TS---------------------FTDQGTGGAGRSGAGRTYDL............
A6KYR5_BACV8/6-309YSIVSYLIETI--WL--HTPHTW--TG---------------------LASSLL..........................
Q0CZ95_ASPTN/77-482TTICYMTVLHL--FK--IRTVTE--LQ---------------------GSYLSELWNWYAEF..................
A0T1U4_VIBCL/8-303FLTVFFIIYHE--RS--YSTFDN--IL---------------------KSYTLI..........................
A3I592_9BACI/6-352FSVFYYAAMQF--YV--THDFSL--TW---------------------HALFSVE.........................
A1TDU0_MYCVP/22-361WAVALVVLRLL--LP--VHVYEP--VA---------------------GISVQL..........................

PF07786

A1HQT7_9FIRM/5-214LTAITY....I..YN--P.QTYI--.R-----------------------------------------------------
A2SQB7_METLZ/5-231ITIVTW....I..VY--P.EETV--.V-----------------------------------------------------
A9CIY2_AGRT5/15-234ITVATY....F..AF--P.DSFI--.F-----------------------------------------------------
Q28R74_JANSC/28-249VSIGTY....I..AF--P.HAFV--.F-----------------------------------------------------
Q8PXM0_METMA/7-237ITVITW....I..FF--P.GQYI--.L-----------------------------------------------------
A4EC93_9ACTN/4-221VWLATT....L..VS--V.DDSV--.N-----------------------------------------------------
Q8U2K3_PYRFU/23-240ITLTTH....I..VL--D.KGTI--.Y-----------------------------------------------------
A7I8Y9_METB6/6-231VTVATW....W..YL--Q.EGYV--.I-----------------------------------------------------
A6G0Y4_9DELT/12-237MNALKFVVPGLLGLL--P.DAFI--EA-----------------------------------------------------
A3CVR7_METMJ/5-231ITAVTR....L..LL--P.NVYI--.V-----------------------------------------------------
Q11IW8_CHESB/30-251ITAATY....I..LF--P.DSFI--.F-----------------------------------------------------
A1TRD1_ACIAC/21-249VSAGSY....L..MF--P.RSYI--.H-----------------------------------------------------
A2SGN2_METPP/12-230VSAGSA....L..MF--P.RSWI--.S-----------------------------------------------------
A2STU6_METLZ/14-241VSVIASLLILV..FI--NDGRYV--.Y-----------------------------------------------------
Q2K839_RHIEC/16-243ISIATR....V..AM--P.DTWI--.Y-----------------------------------------------------
B8FY44_DESHD/5-221ITLVTY....V..TF--P.EQYV--.R-----------------------------------------------------
A0NYA1_9RHOB/5-227VSAVTY....F..TF--G.DTFV--.R-----------------------------------------------------
Q21VS3_ALBFT/16-244VTVGSW....W..MF--P.QSYI--.Y-----------------------------------------------------
Q0FKK0_PELBH/7-221VSLATY....A..AF--P.QRFV--.Y-----------------------------------------------------
B2S625_BRUA1/16-233ISAVTW....Y..MT--P.DSFI--.F-----------------------------------------------------
A2STU5_METLZ/19-252ITALTWLASVV..IF--HDDVFV--.K-----------------------------------------------------
Q6SHI3_9BACT/5-214VSAGTF....V..MF--P.NGWV--.Y-----------------------------------------------------
Q0G6B2_9RHIZ/53-275ITVVTM....V..VT--P.DSFV--.F-----------------------------------------------------
A3YBL4_9GAMM/14-227ISLATY....L..AF--P.QNWI--.F-----------------------------------------------------
A4FZP9_METM5/5-227ITIITS....R..FL--T.SGTI--.Y-----------------------------------------------------
Q11N89_CHESB/6-227ITLVTW....F..VF--P.ESFI--.F-----------------------------------------------------
A4J1M2_DESRM/9-218LTIITM....I..AV--P.GSNI--.I-----------------------------------------------------
Q6SGH9_9BACT/9-218VSVGTY....I..MF--P.DAWV--.Y-----------------------------------------------------
A1VNB1_POLNA/5-231VSAGSY....A..MY--P.QSFI--.Y-----------------------------------------------------
A3DGD5_CLOTH/11-220ISFVTF....I..VG--R.EYFI--.S-----------------------------------------------------
Q98KU6_RHILO/16-237ISVVTR....I..AT--P.DGFI--.F-----------------------------------------------------
A6VZM7_MARMS/12-224ISLATY....L..TI--P.NQWI--.Y-----------------------------------------------------
A1W6I8_ACISJ/12-240VTVGSF....L..MF--P.RSFI--.Y-----------------------------------------------------
Q6M0I2_METMP/11-233ITAVTA....Y..FL--T.SGTI--.Y-----------------------------------------------------
O26882_METTH/9-227ITAATW....I..YP--H.NGFI--.V-----------------------------------------------------
F6BVW5_SINMB/23-246ISIGTW....F..AF--P.QSFI--.F-----------------------------------------------------
B1ZHM9_METPB/15-237ITAATR....I..AF--P.QSYI--.F-----------------------------------------------------
Q2Y4H0_9ARCH/17-243ITLATW....L..FL--R.AGFV--.V-----------------------------------------------------
O29726_ARCFU/2-207ITAVTL....V..FV--P.EKTV--.V-----------------------------------------------------
Q12ZG6_METBU/7-234ITAGSY....I..FL--R.EGII--.I-----------------------------------------------------
A4BIP8_9GAMM/6-220ISISTL....L..MY--P.RSWV--.W-----------------------------------------------------
Q8THP4_METAC/31-261ITGITW....I..FF--P.GQYI--.L-----------------------------------------------------
Q46DC7_METBF/7-237LTGITW....I..FL--P.EEYI--.V-----------------------------------------------------
Q2FN30_METHJ/7-229ITIVTW....W..VM--DGEGYV--.V-----------------------------------------------------
Q1YI63_MOBAS/15-237ITVATY....F..AT--P.NSFV--.Y-----------------------------------------------------
Q1B004_RUBXD/18-243ITLAFR.......LV--D.YGYV--.I-----------------------------------------------------
A6FRV3_9RHOB/4-228VSVATY....A..MM--P.GQFV--.Y-----------------------------------------------------
Q1YJ44_MOBAS/24-246ISVVTY....G..AF--P.TSFI--.Y-----------------------------------------------------
Q26I67_FLABB/5-236LRAPVFEWITG..TF--R.TYFL--.V-----------------------------------------------------

PF05857

A6TIJ3_KLEP7/24-240WALVAQVSFML--IG--Y.....--..-----------------------------------------------------
Q5NWL3_AROAE/9-222FGAVASVPFIA--LG--G.....--LA-----------------------------------------------------
Q88AH9_PSESM/14-243FAALSEIPYRL--FM--A.....--..-----------------------------------------------------
A6M0I9_CLOB8/13-266FSIVMSLGKFI--SW--KISVDD--PS-----------------------------------------------------
C1DKH3_AZOVD/14-243FALLSEWPYRL--LV--D.....--..-----------------------------------------------------
A4XUI8_PSEMY/4-231FSLISEMPYRA--LS--E.....--..-----------------------------------------------------
A4XH28_CALS8/24-230FALVSQIPFSL--MT--G.....--..-----------------------------------------------------
A1WDN4_ACISJ/11-221FGALASVPFVA--LG--G.....--LY-----------------------------------------------------
C4YYW6_9RICK/13-242FGVLLQIYTTV--LF--K.....--..-----------------------------------------------------
Q326X1_SHIDS/32-247WGIIAQFAYYL--AG--F.....--..-----------------------------------------------------
Q8P901_XANCP/6-212WGLVATPIAAI--AF--N.....--..-----------------------------------------------------
R5K8R7_9CLOT/9-229FGIISEVPFDM--CT--S....N--VF-----------------------------------------------------
R5KLN1_9CLOT/10-244FTLISEVPFDL--AS--T....G--QV-----------------------------------------------------
R5QZC4_9FIRM/5-243FALISEPVYDL--AC--A....G--TL-----------------------------------------------------

PF16401

H1Y6N2_9SPHI/12-268FSVFTMHARSW--VM--SAAPGL--AD-----------------------------------------------------
G8TDM1_NIAKG/23-280FALFTMHARS.--.M--SKEPES--WH-----------------------------------------------------
F0SC25_PEDSD/7-264FALFTMHARAW--VL--SSEPGL--KE-----------------------------------------------------
R6N358_9BACE/4-263FAIFIQHFYPY--VL--SSPQDL--RS-----------------------------------------------------

PF04235

Q8EH35_SHEON/199-352.QNPMLVMFSD--II-----------------------------------------------------------------
YXAH_BACSU/242-392......VTDKE--IC-----------------------------------------------------------------
A5VFY1_SPHWW/226-385HNDGAPTVVSG--IV-----------------------------------------------------------------
B0T5F0_CAUSK/216-381GKAMGRQSLQW--IL-----------------------------------------------------------------
Q5LBX3_BACFN/231-393QPDMIRQTVGV--VM-----------------------------------------------------------------
A8FJB9_BACP2/218-375...VPNELVEF--VV-----------------------------------------------------------------
Q8ZNL6_SALTY/215-375WAYRWCAFLLQ--AP-----------------------------------------------------------------
Q5Z0S5_NOCFA/200-354.RTPYLELWSS--PS-----------------------------------------------------------------
Q5LAR8_BACFN/229-391TRNAIRVPLQL--II-----------------------------------------------------------------
A5FKP1_FLAJ1/222-380AIERKAGFLQF--FH-----------------------------------------------------------------
A6LH60_PARD8/231-393DSAIVRQTAGV--VL-----------------------------------------------------------------
Q2NUE2_SODGM/217-377WDYRWCGFLLQ--MP-----------------------------------------------------------------
Q5L251_GEOKA/223-378.WAAANDLTMY--IQ-----------------------------------------------------------------
B9LP38_HALLT/238-398DWSAGAALYWR--QF-----------------------------------------------------------------
Q5WBU3_BACSK/218-382ELPPALVGLTF--SL-----------------------------------------------------------------
Q5LDG8_BACFN/245-405VNGHPFGTTAH--TA-----------------------------------------------------------------
Q2N5U1_ERYLH/237-397FPGVLAGSVAL--VF-----------------------------------------------------------------
Q1D273_MYXXD/254-423DPKGPWMMIVN--GF-----------------------------------------------------------------
Q0RI89_FRAAA/226-396HVDAGTVHRMS--WL-----------------------------------------------------------------
Q1GR12_SPHAL/244-406YDAVSVFGSTI--AL-----------------------------------------------------------------
A3HTP0_9BACT/227-391YRNEFLRPVFF--KL-----------------------------------------------------------------
Q0C162_HYPNA/232-392AMISGQFMLGN--AV-----------------------------------------------------------------
Q9X356_BACAN/222-381KMDVYYSKDVQ--LW-----------------------------------------------------------------
A8FH56_BACP2/222-385FENTLWVSIAT--AL-----------------------------------------------------------------
Q5WCD3_BACSK/239-403INPVFTQGLAE--GI-----------------------------------------------------------------
A4GA59_HERAR/238-403LHPSLYSFLLY--AW-----------------------------------------------------------------
YRKO_BACSU/224-387SENMLWKDISS--VL-----------------------------------------------------------------
Q47SA7_THEFY/269-436SLSAEESVAVA--SI-----------------------------------------------------------------
Q21P05_SACD2/237-402QFNTWLETLAL--TF-----------------------------------------------------------------
A4FQ93_SACEN/204-361..AFGGEQWFM--VD-----------------------------------------------------------------
Q3IC82_PSEHT/208-361.SSGVFYALQE--LI-----------------------------------------------------------------
Q2NDD6_ERYLH/264-425FTYYGTQAAMV--GF-----------------------------------------------------------------
Q9HNH9_HALSA/232-393DWAASAGLLWG--QF-----------------------------------------------------------------
Q9KFW4_BACHD/1-165ELSPIATGLIQ--AI-----------------------------------------------------------------
Q8ERW4_OCEIH/226-381.LFGNPSWFSY--VQ-----------------------------------------------------------------
Q7N6K6_PHOLL/210-370WDYFWSGIVGY--IL-----------------------------------------------------------------
A4ARZ9_MARSH/230-396SFSTWPAMLGL--TA-----------------------------------------------------------------
B1YLL9_EXIS2/215-367QGRFPDGLANY--FF-----------------------------------------------------------------
A6L2L4_BACV8/234-394TNKSILTPLSL--II-----------------------------------------------------------------
A1WTH2_HALHL/248-410WELLSGFFFST--QL-----------------------------------------------------------------
A1S3E3_SHEAM/216-369.ESRALVNLAE--IT-----------------------------------------------------------------
Q9AA92_CAUCR/270-432FAEPQATGRYN--MA-----------------------------------------------------------------
Q0ARL9_MARMM/225-387EFSTQAMADGN--AL-----------------------------------------------------------------
Q07YN3_SHEFN/228-381.GNQMLESMSD--LL-----------------------------------------------------------------
A8F9F5_BACP2/224-375....IDAPWSE--FV-----------------------------------------------------------------
A6L9Q0_PARD8/227-389ERTEELRPMST--IV-----------------------------------------------------------------
B0T422_CAUSK/230-391SHDWTIRGVAR--WL-----------------------------------------------------------------
A6WB03_KINRD/147-299..SDLAASGFS--IV-----------------------------------------------------------------
Q47R13_THEFY/238-395..ALGGAELFL--LD-----------------------------------------------------------------
A8MJB9_ALKOO/219-378ESSTYRQLDQY--FF-----------------------------------------------------------------
A6TNH6_ALKMQ/249-412PSLMVSSLVFG--LF-----------------------------------------------------------------
Q1D7M3_MYXXD/255-425TMPVWLPLVLA--PL-----------------------------------------------------------------
Q6NJJ5_CORDI/212-362...LTQSHTLT--VL-----------------------------------------------------------------
A5UQH7_ROSS1/237-401DLSSPLAGLWS--IL-----------------------------------------------------------------
A7MLK3_CROS8/215-375WDYRWCAFLLQ--AP-----------------------------------------------------------------
Q9KE13_BACHD/42-195...LSPANLET--IQ-----------------------------------------------------------------
A8GC25_SERP5/223-383WDYRWSGFLLQ--VP-----------------------------------------------------------------
Q8A424_BACTN/229-391SREALLVPSVL--LC-----------------------------------------------------------------
Q9KFA2_BACHD/226-379...VPGGIFDL--SV-----------------------------------------------------------------
Q9KEU3_BACHD/250-400......LSNQQ--LY-----------------------------------------------------------------
A4FQT6_SACEN/171-324...SKQEPTFF--LI-----------------------------------------------------------------
A6TBN7_KLEP7/215-375WDYRWCAFLLQ--AP-----------------------------------------------------------------
Q4KHM8_PSEF5/226-387APGGGLEVLGY--GV-----------------------------------------------------------------
A4F774_SACEN/171-329QEQDPLSAGFT--PS-----------------------------------------------------------------
Q9K7D7_BACHD/224-377..LFSGIPVLG--VL-----------------------------------------------------------------
A6KYE7_BACV8/229-390DSELIRQTAGT--AF-----------------------------------------------------------------
Q2G3S1_NOVAD/241-402WPPRAMFGAIE--SG-----------------------------------------------------------------
Q1IVW5_DEIGD/222-381QSTFAAGLLAI--PV-----------------------------------------------------------------
A4AN58_MARSH/230-392DVKIHAQTLLK--VV-----------------------------------------------------------------
Q9RS74_DEIRA/223-382RSDLTAGLLAI--PV-----------------------------------------------------------------
A3HYS5_9BACT/265-426NFSILSFKQAD--IT-----------------------------------------------------------------
Q6D3N4_PECAS/227-387WEYRWSGLLLQ--IP-----------------------------------------------------------------
A5FKP0_FLAJ1/222-380AIIYKAGFLKF--FH-----------------------------------------------------------------
A6LGL5_PARD8/234-396REVSINAWMGA--TT-----------------------------------------------------------------
Q3IPY1_NATPD/256-418WETAPVVLLAH--QF-----------------------------------------------------------------
Q5YUW9_NOCFA/233-388..VFVGGDVIF--LT-----------------------------------------------------------------
Q9K6N5_BACHD/237-398SELFLSMLAYG--IG-----------------------------------------------------------------
Q8EL60_OCEIH/225-388QPSFFVSGLLF--GL-----------------------------------------------------------------
A9WKI7_CHLAA/242-404NLDSILVGLLQ--QL-----------------------------------------------------------------
B0RFW7_CLAMS/254-423AADPVALYLLG--VL-----------------------------------------------------------------
B1HN91_LYSSC/223-376.MLTRTYLLDY--LK-----------------------------------------------------------------
B1HPE9_LYSSC/165-337EEHITNMEQFA--LI-----------------------------------------------------------------
B1HRQ0_LYSSC/190-342FASQADDQQLQ--SI-----------------------------------------------------------------
B1HW32_LYSSC/220-369...IPGGLFDL--PV-----------------------------------------------------------------
B1HYB2_LYSSC/222-372....IESNFSS--IL-----------------------------------------------------------------
E3FDU1_STIAD/253-420PQGAPWMFFLP--TV-----------------------------------------------------------------
E3FTX2_STIAD/250-412VLLTPAGLLQT--AA-----------------------------------------------------------------
Q74VB6_YERPE/216-374WDYRWAGFLLQ--VP-----------------------------------------------------------------
Q7VYP4_BORPE/228-388GQPLGIDLIGL--GA-----------------------------------------------------------------
Q812K5_BACCR/224-376..FIKHPVLIM--LQ-----------------------------------------------------------------
Q81SQ3_BACAN/217-376STSSYEPLYMQ--GL-----------------------------------------------------------------
Q8NMY9_CORGL/70-221..RDITSSGFS--IV-----------------------------------------------------------------
Q8P7N0_XANCP/245-401ARLDPRLSLAF--AL-----------------------------------------------------------------
Q9PFK6_XYLFA/262-418TRVDPRAFSAF--AL-----------------------------------------------------------------
R5USE5_9BACE/227-387DNSLIQQTVGT--AF-----------------------------------------------------------------
R6X5K4_9PORP/228-389SNKAMLTPMNT--VV-----------------------------------------------------------------
U5L4L4_9BACI/226-379..MVQETGWTG--VL-----------------------------------------------------------------
U5L6C6_9BACI/232-386.MGPDNLATEY--FQ-----------------------------------------------------------------

PF07779

U1HPB3_ENDPU/212-693VASYLFMTGYGHTIYFLKTNNFS..LQ---------------------RIVSVL--------------------------
Q6CDI8_YARLI/311-778VAAYLFMTGFGHATFFIKRGDFS..LK---------------------RATSVL--------------------------
Q9W4P0_DROME/351-846ISGYFFLTGYTHFTHMWQTGGSGSLFV---------------------RFFQAM--------------------------
F6X8U0_XENTR/294-776VAAYLFQTGYGHFSYFWLKGDFG..IY---------------------RISQVL--------------------------
K1QBI1_CRAGI/299-786VSAYLFLTGYGHFSYFWNKSDFS..VQ---------------------RYCQVM--------------------------
B7Q496_IXOSC/303-799VTSYLFLTGYGHFTYFWHNGDFG..LY---------------------RLWQML--------------------------
T1INP0_STRMM/300-790VSAYLFLSGYGHFSYFWHKSDTS..VL---------------------RLFQVL--------------------------
H2Z694_CIOSA/175-652VSMYLFMTGYGHFSYFWNKGDFG..LH---------------------RVFGVM--------------------------
D6WF47_TRICA/333-815ISAYLFLLGYEQFCCVWQRGDIG..IV---------------------SFFRVL--------------------------
W5MY98_LEPOC/349-830VAAYLFQTGYGHFSFFWLKGDFG..LN---------------------RVCQVL--------------------------
G3NTP4_GASAC/295-774VAAYLFQTGYGHFSFFWLKGDFG..LY---------------------RVCQVL--------------------------
E9GCH2_DAPPU/313-803VSSYLFLTGFGHLSFFWNGGTAS..FP---------------------RLFQVL--------------------------
E9C8Z6_CAPO3/466-972VASYLFLTGFGHFTFFYTKKQFG..IT---------------------RIIQVL--------------------------
L2GH03_COLGN/240-722VATYIFLSCYGHTSYFLRTEDFS..LR---------------------RATYVL--------------------------
E0VHC9_PEDHC/297-768ISAYVFLSGYGHFFYYWHSGDGS..IV---------------------RFFRVL--------------------------
F6XMQ8_CIOIN/290-767VAMYLFMTGYGHFSYFWNKGDFG..VH---------------------RVFGVM--------------------------
H2QUY3_PANTR/295-776VAAYLFQTGYGHFSYFWIKGDFG..IH---------------------RVCQVL--------------------------
T1G7I3_HELRO/252-726VSAYLFLSAYGHFVYFFNKNDFS..FH---------------------RLCTVL--------------------------
Q17CG6_AEDAE/303-783ISGYLFLSGYSHFTYCWQTGNSG..IV---------------------RFLHVM--------------------------
H3A7E5_LATCH/298-779VAAYLFQTGYGHFSYFWIKDDLG..LY---------------------RLCQIL--------------------------
H9KE76_APIME/294-775NSAYLFLSGYGHFCYFWQTGDVS..LI---------------------RFARVM--------------------------
S8EFZ6_FOMPI/324-771VAAYLFMTGYGHTTFYIKKADFG..FS---------------------RIAQVM--------------------------
X1WW08_ACYPI/313-776ISAYLFLTGYGHFYYMWHRSDAG..LT---------------------RYFQIL--------------------------

PF10129

A1R109_ARTAT/441-826--------------------------------------------------------------------------------
A0K1D5_ARTS2/295-678--------------------------------------------------------------------------------
A2SCM7_METPP/4-366--------------------------------------------------------------------------------
A1TNJ8_ACIAC/18-379--------------------------------------------------------------------------------
Q1D6T0_MYXXD/55-417--------------------------------------------------------------------------------
Q11B97_CHESB/2-386--------------------------------------------------------------------------------
Q7CT44_AGRT5/2-385--------------------------------------------------------------------------------
B2JS58_BURP8/58-406--------------------------------------------------------------------------------
Q13NS3_BURXL/7-355--------------------------------------------------------------------------------
Q1LDM8_RALME/9-370--------------------------------------------------------------------------------
A1B1M7_PARDP/3-363--------------------------------------------------------------------------------
Q5FTQ3_GLUOX/17-367--------------------------------------------------------------------------------
Q89UF3_BRADU/67-422--------------------------------------------------------------------------------
Q89KT4_BRADU/82-438--------------------------------------------------------------------------------
A4YU73_BRASO/12-368--------------------------------------------------------------------------------
Q6N6S8_RHOPA/12-368--------------------------------------------------------------------------------
Q1QFJ8_NITHX/39-395--------------------------------------------------------------------------------
Q89VE5_BRADU/37-393--------------------------------------------------------------------------------
Q6N0J3_RHOPA/44-400--------------------------------------------------------------------------------
Q3SWD7_NITWN/36-392--------------------------------------------------------------------------------
Q89CC1_BRADU/15-372--------------------------------------------------------------------------------
A4YYN0_BRASO/36-389--------------------------------------------------------------------------------
Q89EQ8_BRADU/32-383--------------------------------------------------------------------------------
Q87XJ3_PSESM/5-366--------------------------------------------------------------------------------
Q0BVC0_GRABC/14-370--------------------------------------------------------------------------------
A5G015_ACICJ/9-360--------------------------------------------------------------------------------
B0U809_METS4/3-358--------------------------------------------------------------------------------
Q2K344_RHIEC/23-378--------------------------------------------------------------------------------
Q2YRC8_BRUA2/6-358--------------------------------------------------------------------------------
Q983D5_RHILO/37-389--------------------------------------------------------------------------------
Q6G5Q7_BARHE/16-368--------------------------------------------------------------------------------
Q3J1N1_RHOS4/11-372--------------------------------------------------------------------------------
Q11DW2_CHESB/11-364--------------------------------------------------------------------------------
Q1GGF0_RUEST/47-428--------------------------------------------------------------------------------
Q169P8_ROSDO/29-397--------------------------------------------------------------------------------
Q0BQN1_GRABC/63-424--------------------------------------------------------------------------------
B0RH46_CLAMS/492-873--------------------------------------------------------------------------------
B4EL00_BURCJ/18-366--------------------------------------------------------------------------------
B4ELU9_BURCJ/9-352--------------------------------------------------------------------------------
E3FIJ7_STIAD/5-384--------------------------------------------------------------------------------
Q13QD3_BURXL/18-362--------------------------------------------------------------------------------
Q5LPG0_RUEPO/27-401--------------------------------------------------------------------------------
Q63IA9_BURPS/14-358--------------------------------------------------------------------------------
Q6NAS6_RHOPA/6-361--------------------------------------------------------------------------------
Q92L11_RHIME/23-374--------------------------------------------------------------------------------
Q9KQQ7_VIBCH/3-361--------------------------------------------------------------------------------

PF01757

A8DMZ1_STALU/12-334................................................................................
K6RN31_LACCA/20-369................................................................................
A8G974_SERP5/5-314................................................................................
Q11WN8_CYTH3/14-339................................................................................
A7LV98_BACO1/4-296................................................................................
F0K6S5_CLOAE/6-334................................................................................
A0A009DRR0_ECOLX/9-357................................................................................
Q07PA2_RHOP5/14-375................................................................................
Q30BE9_ENTFL/7-326................................................................................
A1HPJ5_9FIRM/6-350................................................................................
Q4P0M9_USTMA/127-516................................................................................
A7LV97_BACO1/24-312................................................................................
Q1QWT8_CHRSD/4-315................................................................................
Q2T7M4_BURTA/6-373................................................................................
A4B9D7_9GAMM/5-375................................................................................
A0A015ULW8_BACFG/8-315................................................................................
M6C4Z5_LEPBO/44-373................................................................................
A5ZUV3_9FIRM/6-346................................................................................
A1VGB5_DESVV/30-339................................................................................
B2JGA6_BURP8/53-400................................................................................
Q9XAP7_STRCO/24-348................................................................................
Q07KV2_RHOP5/17-343................................................................................
Q484G4_COLP3/18-372................................................................................
A0DGZ8_PARTE/156-556................................................................................
A7A7L5_BIFAD/6-324................................................................................
A3JPT3_9RHOB/10-350................................................................................
A5EMI0_BRASB/26-386................................................................................
A4FKM9_SACEN/20-347................................................................................
A7V903_BACUN/5-297................................................................................
Q8IG66_CAEEL/330-720................................................................................
Q7UES3_RHOBA/12-486VNQRSEQGDSPFLVAAFLGRDDIAEVLLDHDADPELGNHKGERPIDVMRAPWGTTEFVAGLLQIEVDREDVESGREKIAA
D8IMM9_LACSC/4-332................................................................................
Q8PXP5_METMA/13-333................................................................................
Q6AH04_LEIXX/3-320................................................................................
Q5CVD7_CRYPI/23-437................................................................................
A0LT35_ACIC1/10-359................................................................................
Q8KJJ2_RHILI/23-344................................................................................
Q17BV3_AEDAE/212-599................................................................................
A7F3R9_SCLS1/8-361................................................................................
Q144E0_BURXL/4-320................................................................................
Q83YQ9_STRGN/5-307................................................................................
Q07P25_RHOP5/21-323................................................................................
M2EB77_STRMG/14-327................................................................................
A0LP70_SYNFM/14-366................................................................................
A8H1P8_SHEPA/43-369................................................................................
A6E8A8_9SPHI/14-335................................................................................
A5VFE0_SPHWW/65-420................................................................................
A5LX53_STREE/8-323................................................................................
Q4UW44_XANC8/22-341................................................................................
Q2HGI8_CHAGB/115-578................................................................................
A6BII1_9FIRM/11-365................................................................................
F2HK93_LACLV/4-320................................................................................
A5N097_CLOK5/9-357................................................................................
Q8FTN8_COREF/16-398................................................................................
Q6G5Q7_BARHE/17-365................................................................................
A0A016XC94_VIBCL/4-356................................................................................
A7AZT9_RUMGN/12-318................................................................................
Q2NRT0_SODGM/9-399................................................................................
A4CKW1_ROBBH/7-342................................................................................
A6FAM6_9GAMM/8-349................................................................................
A7V2Z2_BACUN/14-354................................................................................
Q00XL5_OSTTA/15-388................................................................................
A4YYF7_BRASO/15-345................................................................................
Q1D0W9_MYXXD/39-356................................................................................
Q16PV5_AEDAE/243-647................................................................................
Q82ET0_STRAW/57-398................................................................................
Q4JZS0_STREE/5-327................................................................................
A7X0T7_STAA1/8-314................................................................................
Q7MGC8_VIBVY/15-336................................................................................
A6KZK8_BACV8/9-367................................................................................
A4CUQ6_SYNPV/6-368................................................................................
B5BHU4_SALPK/5-319................................................................................
A6P1P2_9FIRM/9-341................................................................................
A5FYP6_ACICJ/4-317................................................................................
Q7MQA5_VIBVY/5-328................................................................................
I7HSS1_LEGPN/10-336................................................................................
A7V3H1_BACUN/5-305................................................................................
A0A016DJ19_BACFG/4-349................................................................................
A2SCM7_METPP/5-359................................................................................
A7ZZ73_ECOHS/5-329................................................................................
A5UMZ7_METS3/7-344................................................................................
A3YY52_9SYNE/16-323................................................................................
A4AIT9_9ACTN/563-845................................................................................
A5N224_CLOK5/8-329................................................................................
E0TI88_PARBH/15-315................................................................................
A0A022NJA1_PSEAI/5-324................................................................................
A0E2L0_PARTE/17-375................................................................................
C6IRR6_9BACE/9-318................................................................................
Q2C1R6_9GAMM/10-345................................................................................
A7A7B8_BIFAD/5-363................................................................................
Q4JYU7_STREE/6-318................................................................................
A9VR59_BACWK/5-346................................................................................
A7VGI1_9CLOT/6-345................................................................................
Q1QR03_NITHX/14-320................................................................................
A5ZDF6_9BACE/13-326................................................................................
Q16FE1_AEDAE/161-554................................................................................
Q7CTZ0_AGRT5/8-329................................................................................
Q8G7P7_BIFLO/17-373................................................................................
A1R1G8_ARTAT/18-357................................................................................
A1VHZ4_DESVV/11-319................................................................................
A0QPG5_MYCS2/9-326................................................................................
A5EXU9_DICNV/19-351................................................................................
A6LGX6_PARD8/9-311................................................................................
Q11WP3_CYTH3/4-324................................................................................
A0K1D5_ARTS2/296-671................................................................................
A6KYR5_BACV8/6-309................................................................................
Q0CZ95_ASPTN/77-482................................................................................
A0T1U4_VIBCL/8-303................................................................................
A3I592_9BACI/6-352................................................................................
A1TDU0_MYCVP/22-361................................................................................

PF07786

A1HQT7_9FIRM/5-214--------------------------------------------------------------------------------
A2SQB7_METLZ/5-231--------------------------------------------------------------------------------
A9CIY2_AGRT5/15-234--------------------------------------------------------------------------------
Q28R74_JANSC/28-249--------------------------------------------------------------------------------
Q8PXM0_METMA/7-237--------------------------------------------------------------------------------
A4EC93_9ACTN/4-221--------------------------------------------------------------------------------
Q8U2K3_PYRFU/23-240--------------------------------------------------------------------------------
A7I8Y9_METB6/6-231--------------------------------------------------------------------------------
A6G0Y4_9DELT/12-237--------------------------------------------------------------------------------
A3CVR7_METMJ/5-231--------------------------------------------------------------------------------
Q11IW8_CHESB/30-251--------------------------------------------------------------------------------
A1TRD1_ACIAC/21-249--------------------------------------------------------------------------------
A2SGN2_METPP/12-230--------------------------------------------------------------------------------
A2STU6_METLZ/14-241--------------------------------------------------------------------------------
Q2K839_RHIEC/16-243--------------------------------------------------------------------------------
B8FY44_DESHD/5-221--------------------------------------------------------------------------------
A0NYA1_9RHOB/5-227--------------------------------------------------------------------------------
Q21VS3_ALBFT/16-244--------------------------------------------------------------------------------
Q0FKK0_PELBH/7-221--------------------------------------------------------------------------------
B2S625_BRUA1/16-233--------------------------------------------------------------------------------
A2STU5_METLZ/19-252--------------------------------------------------------------------------------
Q6SHI3_9BACT/5-214--------------------------------------------------------------------------------
Q0G6B2_9RHIZ/53-275--------------------------------------------------------------------------------
A3YBL4_9GAMM/14-227--------------------------------------------------------------------------------
A4FZP9_METM5/5-227--------------------------------------------------------------------------------
Q11N89_CHESB/6-227--------------------------------------------------------------------------------
A4J1M2_DESRM/9-218--------------------------------------------------------------------------------
Q6SGH9_9BACT/9-218--------------------------------------------------------------------------------
A1VNB1_POLNA/5-231--------------------------------------------------------------------------------
A3DGD5_CLOTH/11-220--------------------------------------------------------------------------------
Q98KU6_RHILO/16-237--------------------------------------------------------------------------------
A6VZM7_MARMS/12-224--------------------------------------------------------------------------------
A1W6I8_ACISJ/12-240--------------------------------------------------------------------------------
Q6M0I2_METMP/11-233--------------------------------------------------------------------------------
O26882_METTH/9-227--------------------------------------------------------------------------------
F6BVW5_SINMB/23-246--------------------------------------------------------------------------------
B1ZHM9_METPB/15-237--------------------------------------------------------------------------------
Q2Y4H0_9ARCH/17-243--------------------------------------------------------------------------------
O29726_ARCFU/2-207--------------------------------------------------------------------------------
Q12ZG6_METBU/7-234--------------------------------------------------------------------------------
A4BIP8_9GAMM/6-220--------------------------------------------------------------------------------
Q8THP4_METAC/31-261--------------------------------------------------------------------------------
Q46DC7_METBF/7-237--------------------------------------------------------------------------------
Q2FN30_METHJ/7-229--------------------------------------------------------------------------------
Q1YI63_MOBAS/15-237--------------------------------------------------------------------------------
Q1B004_RUBXD/18-243--------------------------------------------------------------------------------
A6FRV3_9RHOB/4-228--------------------------------------------------------------------------------
Q1YJ44_MOBAS/24-246--------------------------------------------------------------------------------
Q26I67_FLABB/5-236--------------------------------------------------------------------------------

PF05857

A6TIJ3_KLEP7/24-240--------------------------------------------------------------------------------
Q5NWL3_AROAE/9-222--------------------------------------------------------------------------------
Q88AH9_PSESM/14-243--------------------------------------------------------------------------------
A6M0I9_CLOB8/13-266--------------------------------------------------------------------------------
C1DKH3_AZOVD/14-243--------------------------------------------------------------------------------
A4XUI8_PSEMY/4-231--------------------------------------------------------------------------------
A4XH28_CALS8/24-230--------------------------------------------------------------------------------
A1WDN4_ACISJ/11-221--------------------------------------------------------------------------------
C4YYW6_9RICK/13-242--------------------------------------------------------------------------------
Q326X1_SHIDS/32-247--------------------------------------------------------------------------------
Q8P901_XANCP/6-212--------------------------------------------------------------------------------
R5K8R7_9CLOT/9-229--------------------------------------------------------------------------------
R5KLN1_9CLOT/10-244--------------------------------------------------------------------------------
R5QZC4_9FIRM/5-243--------------------------------------------------------------------------------

PF16401

H1Y6N2_9SPHI/12-268--------------------------------------------------------------------------------
G8TDM1_NIAKG/23-280--------------------------------------------------------------------------------
F0SC25_PEDSD/7-264--------------------------------------------------------------------------------
R6N358_9BACE/4-263--------------------------------------------------------------------------------

PF04235

Q8EH35_SHEON/199-352--------------------------------------------------------------------------------
YXAH_BACSU/242-392--------------------------------------------------------------------------------
A5VFY1_SPHWW/226-385--------------------------------------------------------------------------------
B0T5F0_CAUSK/216-381--------------------------------------------------------------------------------
Q5LBX3_BACFN/231-393--------------------------------------------------------------------------------
A8FJB9_BACP2/218-375--------------------------------------------------------------------------------
Q8ZNL6_SALTY/215-375--------------------------------------------------------------------------------
Q5Z0S5_NOCFA/200-354--------------------------------------------------------------------------------
Q5LAR8_BACFN/229-391--------------------------------------------------------------------------------
A5FKP1_FLAJ1/222-380--------------------------------------------------------------------------------
A6LH60_PARD8/231-393--------------------------------------------------------------------------------
Q2NUE2_SODGM/217-377--------------------------------------------------------------------------------
Q5L251_GEOKA/223-378--------------------------------------------------------------------------------
B9LP38_HALLT/238-398--------------------------------------------------------------------------------
Q5WBU3_BACSK/218-382--------------------------------------------------------------------------------
Q5LDG8_BACFN/245-405--------------------------------------------------------------------------------
Q2N5U1_ERYLH/237-397--------------------------------------------------------------------------------
Q1D273_MYXXD/254-423--------------------------------------------------------------------------------
Q0RI89_FRAAA/226-396--------------------------------------------------------------------------------
Q1GR12_SPHAL/244-406--------------------------------------------------------------------------------
A3HTP0_9BACT/227-391--------------------------------------------------------------------------------
Q0C162_HYPNA/232-392--------------------------------------------------------------------------------
Q9X356_BACAN/222-381--------------------------------------------------------------------------------
A8FH56_BACP2/222-385--------------------------------------------------------------------------------
Q5WCD3_BACSK/239-403--------------------------------------------------------------------------------
A4GA59_HERAR/238-403--------------------------------------------------------------------------------
YRKO_BACSU/224-387--------------------------------------------------------------------------------
Q47SA7_THEFY/269-436--------------------------------------------------------------------------------
Q21P05_SACD2/237-402--------------------------------------------------------------------------------
A4FQ93_SACEN/204-361--------------------------------------------------------------------------------
Q3IC82_PSEHT/208-361--------------------------------------------------------------------------------
Q2NDD6_ERYLH/264-425--------------------------------------------------------------------------------
Q9HNH9_HALSA/232-393--------------------------------------------------------------------------------
Q9KFW4_BACHD/1-165--------------------------------------------------------------------------------
Q8ERW4_OCEIH/226-381--------------------------------------------------------------------------------
Q7N6K6_PHOLL/210-370--------------------------------------------------------------------------------
A4ARZ9_MARSH/230-396--------------------------------------------------------------------------------
B1YLL9_EXIS2/215-367--------------------------------------------------------------------------------
A6L2L4_BACV8/234-394--------------------------------------------------------------------------------
A1WTH2_HALHL/248-410--------------------------------------------------------------------------------
A1S3E3_SHEAM/216-369--------------------------------------------------------------------------------
Q9AA92_CAUCR/270-432--------------------------------------------------------------------------------
Q0ARL9_MARMM/225-387--------------------------------------------------------------------------------
Q07YN3_SHEFN/228-381--------------------------------------------------------------------------------
A8F9F5_BACP2/224-375--------------------------------------------------------------------------------
A6L9Q0_PARD8/227-389--------------------------------------------------------------------------------
B0T422_CAUSK/230-391--------------------------------------------------------------------------------
A6WB03_KINRD/147-299--------------------------------------------------------------------------------
Q47R13_THEFY/238-395--------------------------------------------------------------------------------
A8MJB9_ALKOO/219-378--------------------------------------------------------------------------------
A6TNH6_ALKMQ/249-412--------------------------------------------------------------------------------
Q1D7M3_MYXXD/255-425--------------------------------------------------------------------------------
Q6NJJ5_CORDI/212-362--------------------------------------------------------------------------------
A5UQH7_ROSS1/237-401--------------------------------------------------------------------------------
A7MLK3_CROS8/215-375--------------------------------------------------------------------------------
Q9KE13_BACHD/42-195--------------------------------------------------------------------------------
A8GC25_SERP5/223-383--------------------------------------------------------------------------------
Q8A424_BACTN/229-391--------------------------------------------------------------------------------
Q9KFA2_BACHD/226-379--------------------------------------------------------------------------------
Q9KEU3_BACHD/250-400--------------------------------------------------------------------------------
A4FQT6_SACEN/171-324--------------------------------------------------------------------------------
A6TBN7_KLEP7/215-375--------------------------------------------------------------------------------
Q4KHM8_PSEF5/226-387--------------------------------------------------------------------------------
A4F774_SACEN/171-329--------------------------------------------------------------------------------
Q9K7D7_BACHD/224-377--------------------------------------------------------------------------------
A6KYE7_BACV8/229-390--------------------------------------------------------------------------------
Q2G3S1_NOVAD/241-402--------------------------------------------------------------------------------
Q1IVW5_DEIGD/222-381--------------------------------------------------------------------------------
A4AN58_MARSH/230-392--------------------------------------------------------------------------------
Q9RS74_DEIRA/223-382--------------------------------------------------------------------------------
A3HYS5_9BACT/265-426--------------------------------------------------------------------------------
Q6D3N4_PECAS/227-387--------------------------------------------------------------------------------
A5FKP0_FLAJ1/222-380--------------------------------------------------------------------------------
A6LGL5_PARD8/234-396--------------------------------------------------------------------------------
Q3IPY1_NATPD/256-418--------------------------------------------------------------------------------
Q5YUW9_NOCFA/233-388--------------------------------------------------------------------------------
Q9K6N5_BACHD/237-398--------------------------------------------------------------------------------
Q8EL60_OCEIH/225-388--------------------------------------------------------------------------------
A9WKI7_CHLAA/242-404--------------------------------------------------------------------------------
B0RFW7_CLAMS/254-423--------------------------------------------------------------------------------
B1HN91_LYSSC/223-376--------------------------------------------------------------------------------
B1HPE9_LYSSC/165-337--------------------------------------------------------------------------------
B1HRQ0_LYSSC/190-342--------------------------------------------------------------------------------
B1HW32_LYSSC/220-369--------------------------------------------------------------------------------
B1HYB2_LYSSC/222-372--------------------------------------------------------------------------------
E3FDU1_STIAD/253-420--------------------------------------------------------------------------------
E3FTX2_STIAD/250-412--------------------------------------------------------------------------------
Q74VB6_YERPE/216-374--------------------------------------------------------------------------------
Q7VYP4_BORPE/228-388--------------------------------------------------------------------------------
Q812K5_BACCR/224-376--------------------------------------------------------------------------------
Q81SQ3_BACAN/217-376--------------------------------------------------------------------------------
Q8NMY9_CORGL/70-221--------------------------------------------------------------------------------
Q8P7N0_XANCP/245-401--------------------------------------------------------------------------------
Q9PFK6_XYLFA/262-418--------------------------------------------------------------------------------
R5USE5_9BACE/227-387--------------------------------------------------------------------------------
R6X5K4_9PORP/228-389--------------------------------------------------------------------------------
U5L4L4_9BACI/226-379--------------------------------------------------------------------------------
U5L6C6_9BACI/232-386--------------------------------------------------------------------------------

PF07779

U1HPB3_ENDPU/212-693--------------------------------------------------------------------------------
Q6CDI8_YARLI/311-778--------------------------------------------------------------------------------
Q9W4P0_DROME/351-846--------------------------------------------------------------------------------
F6X8U0_XENTR/294-776--------------------------------------------------------------------------------
K1QBI1_CRAGI/299-786--------------------------------------------------------------------------------
B7Q496_IXOSC/303-799--------------------------------------------------------------------------------
T1INP0_STRMM/300-790--------------------------------------------------------------------------------
H2Z694_CIOSA/175-652--------------------------------------------------------------------------------
D6WF47_TRICA/333-815--------------------------------------------------------------------------------
W5MY98_LEPOC/349-830--------------------------------------------------------------------------------
G3NTP4_GASAC/295-774--------------------------------------------------------------------------------
E9GCH2_DAPPU/313-803--------------------------------------------------------------------------------
E9C8Z6_CAPO3/466-972--------------------------------------------------------------------------------
L2GH03_COLGN/240-722--------------------------------------------------------------------------------
E0VHC9_PEDHC/297-768--------------------------------------------------------------------------------
F6XMQ8_CIOIN/290-767--------------------------------------------------------------------------------
H2QUY3_PANTR/295-776--------------------------------------------------------------------------------
T1G7I3_HELRO/252-726--------------------------------------------------------------------------------
Q17CG6_AEDAE/303-783--------------------------------------------------------------------------------
H3A7E5_LATCH/298-779--------------------------------------------------------------------------------
H9KE76_APIME/294-775--------------------------------------------------------------------------------
S8EFZ6_FOMPI/324-771--------------------------------------------------------------------------------
X1WW08_ACYPI/313-776--------------------------------------------------------------------------------

PF10129

A1R109_ARTAT/441-826----------------------QFPVPQGLIPALLLLQVG------------------PWQ------FNIMGL-Y-----
A0K1D5_ARTS2/295-678----------------------QFPVSGAVIPAVLLLQFG------------------PWQ------FNVMGL-Y-----
A2SCM7_METPP/4-366----------------------EQPVT..AFFSGLLLIYS------------------PPL------LDILPL-Y-----
A1TNJ8_ACIAC/18-379----------------------AKPLE..ALVGGLLLVYE------------------PPL------LDILPI-Y-----
Q1D6T0_MYXXD/55-417----------------------EDPFT..ALWSSLFLLYC------------------PPL------LDILPL-Y-----
Q11B97_CHESB/2-386----------------------SHDPF..YAIASLLLLYQ------------------PTY------MDILPQ-Y-----
Q7CT44_AGRT5/2-385----------------------FDDPL..RLAAIATFLFQ------------------PTF------MDILPQ-Y-----
B2JS58_BURP8/58-406----------------------DTPTA..VLRDILLFRRQ------------------PYL------ASVLPM-Y-----
Q13NS3_BURXL/7-355----------------------DTPLA..ALRDILLFRRQ------------------PYL------ASVLPM-Y-----
Q1LDM8_RALME/9-370----------------------AQPIE..TLFQVIGLARQ------------------PFV------SDVLPM-Y-----
A1B1M7_PARDP/3-363----------------------EHPIG..YVATVALMWMQ------------------PNL------LDVLAL-Y-----
Q5FTQ3_GLUOX/17-367----------------------AHGYS..GLWRILTFDAL------------------PSY------LNILPL-Y-----
Q89UF3_BRADU/67-422----------------------EHPLR..ILVRGLVLQEE------------------PLN------LDLLQL-M-----
Q89KT4_BRADU/82-438----------------------DFPVE..TLSQGLVLKFK------------------PLN------LDVLPL-Y-----
A4YU73_BRASO/12-368----------------------DHASD..TLAQGLILKFK------------------PVN------LDVLPL-Y-----
Q6N6S8_RHOPA/12-368----------------------ANPIE..TLRQGLLLKFK------------------PVN------LDVLPL-Y-----
Q1QFJ8_NITHX/39-395----------------------SNPFD..VLTQGLLLRFK------------------PLN------MDVLPL-Y-----
Q89VE5_BRADU/37-393----------------------KQPDV..TIVQALLLRFR------------------PVN------MDVLPL-Y-----
Q6N0J3_RHOPA/44-400----------------------KQPDV..TIVQALLLRFR------------------PVN------MDVLPL-Y-----
Q3SWD7_NITWN/36-392----------------------KQPDV..TIVQALLLKFR------------------PVN------MDVLPL-Y-----
Q89CC1_BRADU/15-372----------------------SHPDE..LIGQAIVLKYK------------------PVN------LDVLPL-Y-----
A4YYN0_BRASO/36-389----------------------REPGP..TLVHVALLQFA------------------PVN------TDILLT-F-----
Q89EQ8_BRADU/32-383----------------------DQPGV..TLAHAAILQYR------------------PVN------TDILPL-F-----
Q87XJ3_PSESM/5-366----------------------GNPQQ..ALADELLLRFK------------------PNL------TDPLPL-Y-----
Q0BVC0_GRABC/14-370----------------------ADPYG..ALLHVLLLHYQ------------------PAY------MNILPV-Y-----
A5G015_ACICJ/9-360----------------------AKPLS..AIIEAVPLLYQ------------------PAY------LNVLPL-Y-----
B0U809_METS4/3-358----------------------TDPVQ..TTLGWVTLLHQ------------------LGF------FNILPL-Y-----
Q2K344_RHIEC/23-378----------------------MNLKE..GIPALLLLGHQ------------------IGY------NNILPM-Y-----
Q2YRC8_BRUA2/6-358----------------------KKPVE..GLFGLVTLGHQ------------------LGY------NNILSM-Y-----
Q983D5_RHILO/37-389----------------------KNTPE..VLVGIVTLGHQ------------------LGY------NNILPV-Y-----
Q6G5Q7_BARHE/16-368----------------------TQPFI..AFFSVLSFGHQ------------------LGY------NNILPL-Y-----
Q3J1N1_RHOS4/11-372----------------------QKPLG..FLIGVPALTHQ------------------LGY------TNILPL-Y-----
Q11DW2_CHESB/11-364----------------------EQPLR..TMVGLPLLTHQ------------------LGY------LNILPM-Y-----
Q1GGF0_RUEST/47-428----------------------NDPAE..QIVGIFTLTYV------------------PNY------FDILPM-Y-----
Q169P8_ROSDO/29-397----------------------NRPEE..NLLGLLTLTYV------------------PNY------FDILPM-Y-----
Q0BQN1_GRABC/63-424----------------------DDPVQ..AFRGIVMLSYV------------------PGY------LDVLPV-Y-----
B0RH46_CLAMS/492-873----------------------DYPPPWYAIRDLLLLRMG------------------PWV------FNIMGL-F-----
B4EL00_BURCJ/18-366----------------------ASPLT..GAAELLTFQRQ------------------PYL------ASVLPM-Y-----
B4ELU9_BURCJ/9-352----------------------HKPLA..ALRDILLFRRQ------------------PYL------ASVLPM-Y-----
E3FIJ7_STIAD/5-384----------------------RNDWG..FALAAAALLYQ------------------PTY------MDILPQ-Y-----
Q13QD3_BURXL/18-362----------------------VQPLR..EALDIMLLRRQ------------------PYL------SSVLPM-Y-----
Q5LPG0_RUEPO/27-401----------------------GDPMP..QMLGLFTLTYI------------------PNY------FDILPM-Y-----
Q63IA9_BURPS/14-358----------------------ASPLT..VLVELLTFKRQ------------------PYL------ASVLPM-Y-----
Q6NAS6_RHOPA/6-361----------------------ENPDV..MIQQALLLKYK------------------PVN------LDVLPL-Y-----
Q92L11_RHIME/23-374----------------------EQTEQ..GIVAMVLLGHQ------------------LGY------NNILSM-Y-----
Q9KQQ7_VIBCH/3-361----------------------TMPFM..TMLMSFLLLNK------------------PAY------LEILPL-Y-----

PF01757

A8DMZ1_STALU/12-334...........................--...........------------------GYWY.....GYFILI-I.....
K6RN31_LACCA/20-369...........................--..SALLHGDQF------------------YLY........YVLV-T.....
A8G974_SERP5/5-314...........................--NLMGIKSTYNS------------------EWW........FFKL-Y.....
Q11WN8_CYTH3/14-339.......................TGKP--GVWIQPFMGNT------------------PLW........SLSY-E.....
A7LV98_BACO1/4-296.........................GT--QTPLLKNFGFI------------------FPW........FLPT-Y.....
F0K6S5_CLOAE/6-334......................AAKIL--TFHEIQSEVLG------------------QFW........FIKV-L.....
A0A009DRR0_ECOLX/9-357.........................YD--KYNTLAWELIS------------------HLW........FLLV-L.....
Q07PA2_RHOP5/14-375.........................PP--PAAILSKLSLA------------------HLW........FLYV-L.....
Q30BE9_ENTFL/7-326...........................--...IVFDGTLY------------------HLW........YLPA-S.....
A1HPJ5_9FIRM/6-350...........................--...LLFGLASY------------------QLY........FLVL-L.....
Q4P0M9_USTMA/127-516......DWQISTSLGDIVVGLLRLGTN--RDYLQQLLNTS------------------MLW........SIVP-Q.....
A7LV97_BACO1/24-312...........................--...LFMSNWYG------------------PLW........YVRD-L.....
Q1QWT8_CHRSD/4-315...........................--......VMGYH------------------HLW........FLSA-L.....
Q2T7M4_BURTA/6-373..................DVFTDGLAG--APLFSRTALNP------------------ALW........TIQV-E.....
A4B9D7_9GAMM/5-375........................SFH--PVTLFPVDING------------------PLWSIGFEVVSYLFL-F.....
A0A015ULW8_BACFG/8-315...........................--.......LIKG------------------GGW........FVSC-I.....
M6C4Z5_LEPBO/44-373...........................--........WCA------------------PYY........FVPL-L.....
A5ZUV3_9FIRM/6-346...........................--...FLKSSSLS------------------HMW........YMPV-I.....
A1VGB5_DESVV/30-339...........................--......SNPGF------------------HLW........FMWI-Y.....
B2JGA6_BURP8/53-400........................IHA--WLPGAVNTVVP------------------GGW........SIGV-E.....
Q9XAP7_STRCO/24-348.........................DP--PGSAWGEQAWE------------------ILW........YLRT-Y.....
Q07KV2_RHOP5/17-343..........................L--VLPQSGYPILG------------------VGW........SLEY-E.....
Q484G4_COLP3/18-372.....................FTFAWD--KRMNAPFPTYN------------------HMW........YVLY-L.....
A0DGZ8_PARTE/156-556.......................LFID--NFFHDWDLCFG------------------WGW........YLTS-D.....
A7A7L5_BIFAD/6-324...........................--......PLSMG------------------LWW........YATA-Y.....
A3JPT3_9RHOB/10-350........................SAW--LGYFVLGDVKY------------------HMH........FIQT-L.....
A5EMI0_BRASB/26-386..........................W--KTVTVGPWPSG------------------PIW........FIWV-L.....
A4FKM9_SACEN/20-347.......................MLWN--WHPQDHPFIDG------------------SHW........TVPL-Q.....
A7V903_BACUN/5-297...........................--..DKIFLHPMG------------------PYW........YLHT-L.....
Q8IG66_CAEEL/330-720.......................HFAF--VSNFFPSTCVP------------------WLW........YISL-D.....
Q7UES3_RHOBA/12-486MMGETLSGPSSGMATDGGANAVDWKGL--MFLLFEFPATG------------------HLW........FLWF-LCFLVT
D8IMM9_LACSC/4-332..................YGAGTPINN--LLGKFFIPAIG------------------AIW........FLLA-M.....
Q8PXP5_METMA/13-333....................LTYYKLF--YFILGENFICG------------------HLW........YLIT-L.....
Q6AH04_LEIXX/3-320...........................--.....PFLFVR------------------ARW........LAVA-A.....
Q5CVD7_CRYPI/23-437......................LYYFM--YVKDFKCHGFE------------------WLW........FLAL-L.....
A0LT35_ACIC1/10-359...........................--.......GVAF------------------HLW........FLSV-Y.....
Q8KJJ2_RHILI/23-344...........................--......TEVIG------------------TYW........FIWA-A.....
Q17BV3_AEDAE/212-599....................NNILFVQ--NWYPVEESCAP------------------HTF........QLAV-E.....
A7F3R9_SCLS1/8-361................AVKSLLYHLIT--TWTRGWNIYDG------------------NQW........TLLP-L.....
Q144E0_BURXL/4-320...........................--....LAWAPVG------------------QFW........FLYA-L.....
Q83YQ9_STRGN/5-307.......................FFFN--SPRDLIGPAAT------------------PTW........YLLA-I.....
Q07P25_RHOP5/21-323...........................--....IWYQPIG------------------QFW........FLYA-L.....
M2EB77_STRMG/14-327...........................--.......IITG------------------QYW........YVTA-Y.....
A0LP70_SYNFM/14-366...........................--PAETVFYYLVP------------------AWW........FFGL-L.....
A8H1P8_SHEPA/43-369........................QAA--SWYVITGRTLT------------------AYW........YIPM-G.....
A6E8A8_9SPHI/14-335......................GIFYG--NGIQGYLIHSI------------------ASW........FIIC-L.....
A5VFE0_SPHWW/65-420...............PGLTGAAKDALH--LFASGVSQYNS------------------ALW........TMKY-E.....
A5LX53_STREE/8-323...........................--....IYKFPLG------------------VSW........YLYT-L.....
Q4UW44_XANC8/22-341........................GLL--WANGSSLYVLP------------------ALW........FLPA-L.....
Q2HGI8_CHAGB/115-578...GSVFALAVWAWAGEMARFVHVWDW--REFGGSTVLDV------------------HLW........TVPV-E.....
A6BII1_9FIRM/11-365...........................--...QTRPNWTS------------------HLW........FLGE-L.....
F2HK93_LACLV/4-320...........................--......YSTDS------------------YSW........YVEM-Y.....
A5N097_CLOK5/9-357......................SVSRN--MEAMTTGFGPM------------------HLW........FLLY-L.....
Q8FTN8_COREF/16-398......................IHTWN--PDWASLSGMNV------------------PSW........SLAA-E.....
Q6G5Q7_BARHE/17-365.........................LF--FTQPFIAFFSV------------------LSFGHQLGYNNILPL-Y.....
A0A016XC94_VIBCL/4-356...........................--PTMPFMTMLMS------------------FLLLNKPAYLEILPL-Y.....
A7AZT9_RUMGN/12-318........................QEF--INAVFCYKYNP------------------VFW........FMLY-L.....
Q2NRT0_SODGM/9-399.........MDNVQLAFNSVLQLLMLQ--AWNPYFLTFNA------------------PLW........SLSA-L.....
A4CKW1_ROBBH/7-342...........................--...........------------------...........ALLL-I.....
A6FAM6_9GAMM/8-349......................SLLYN--FYPNQGLSIVG------------------PWW........FLSF-I.....
A7V2Z2_BACUN/14-354...................PLPLKFDI--RGWTEMHPLNG------------------PAW........SLYY-E.....
Q00XL5_OSTTA/15-388.........................QA--WFPMHAELWNA------------------PSW........FLSA-L.....
A4YYF7_BRASO/15-345.......................MASD--WLPPTGVSFNG------------------PIW........SVSI-E.....
Q1D0W9_MYXXD/39-356...........................--...........------------------...........ALQC-I.....
Q16PV5_AEDAE/243-647......................FLFVN--NYYKFDKGCMQ------------------QTW........YLAA-D.....
Q82ET0_STRAW/57-398...........................--...........------------------PLW........FLLV-F.....
Q4JZS0_STREE/5-327..........................G--LLPNNQPDVIG------------------VSW........TIGV-I.....
A7X0T7_STAA1/8-314...........................--...........------------------ALW........FLIT-L.....
Q7MGC8_VIBVY/15-336...........................--PLNSLLEGGLV------------------HLW........FLPA-L.....
A6KZK8_BACV8/9-367.....................TITKIW--TFIFNFNYDTT------------------PLW........YLYM-L.....
A4CUQ6_SYNPV/6-368...........................--...DIPFNRIG------------------VLW........FLLV-L.....
B5BHU4_SALPK/5-319...........................--.......PVFY------------------HLW........FFFA-I.....
A6P1P2_9FIRM/9-341...........................--..TALLGNTHY------------------HLW........FLYI-I.....
A5FYP6_ACICJ/4-317.........................AD--TIWHPLASPAY------------------SLW........YLAV-L.....
Q7MQA5_VIBVY/5-328...........................--...SPEHATYY------------------HLG........FFYY-F.....
I7HSS1_LEGPN/10-336....................KFINIGY--FSTDATIQQLL------------------HTW........SLGV-E.....
A7V3H1_BACUN/5-305...........................--.........LE------------------SYW........FLSC-L.....
A0A016DJ19_BACFG/4-349...........................--..FLNFPTLAG------------------HLW........FMYP-L.....
A2SCM7_METPP/5-359...........................--...PVTAFFSG------------------LLLIYSPPLLDILPL-Y.....
A7ZZ73_ECOHS/5-329.........................TG--EFLHGMITAST------------------SLW........YLYA-L.....
A5UMZ7_METS3/7-344...........................--......SKFMT------------------QHW........YAWM-L.....
A3YY52_9SYNE/16-323...........................--......LEPPL------------------TLW........YISM-I.....
A4AIT9_9ACTN/563-845...........................--.....EWTSQW------------------RYW........FLEA-LLWSML
A5N224_CLOK5/8-329...........................--.........FY------------------HFY........FVPL-I.....
E0TI88_PARBH/15-315...........................--......LGTNY------------------HLW........FLSS-L.....
A0A022NJA1_PSEAI/5-324...........................--...SVDTLPWQ------------------ALW........YLPH-F.....
A0E2L0_PARTE/17-375..........................T--HNIFNKFGCFE------------------WSW........YIAV-EIQTLI
C6IRR6_9BACE/9-318........................LFV--FHGHDLIKFNP------------------PIW........FLLA-L.....
Q2C1R6_9GAMM/10-345...........................--........NLG------------------VTW........FCWT-L.....
A7A7B8_BIFAD/5-363...........................--LGGGFGDYPTG------------------YFW........FMNA-L.....
Q4JYU7_STREE/6-318...........................--.......GYFF------------------QFW........FFGA-L.....
A9VR59_BACWK/5-346...........................--.........AP------------------HLW........YVIM-M.....
A7VGI1_9CLOT/6-345......................FLLLS--MSGVQGTQVVM------------------ITW........YISA-M.....
Q1QR03_NITHX/14-320...........................--...MSFIDPFG------------------TLW........FIYL-L.....
A5ZDF6_9BACE/13-326...........................--.........FS------------------PFW........FLNM-I.....
Q16FE1_AEDAE/161-554......................LVFVN--NLPIQDNFCMI------------------HAW........YLGA-D.....
Q7CTZ0_AGRT5/8-329......................EIISH--GTALEELPVNV------------------PLY........FLRD-L.....
Q8G7P7_BIFLO/17-373...........................--..DLFSGYDDS------------------VYW........FVFM-L.....
A1R1G8_ARTAT/18-357...........................--.......GAAM------------------PLW........FLAA-Y.....
A1VHZ4_DESVV/11-319.......................FLNW--FHLGNDSPFGA------------------GQW........FFTL-L.....
A0QPG5_MYCS2/9-326.................VYYAGINGTP--QGIPWPGVWNG------------------SLW........TLVF-E.....
A5EXU9_DICNV/19-351...........................--...........------------------.TW........QISV-D.....
A6LGX6_PARD8/9-311...........................--..........G------------------IVW........YLFT-L.....
Q11WP3_CYTH3/4-324........................IFI--LGLCTTGMIIP------------------PSW........SLDI-E.....
A0K1D5_ARTS2/296-671.............YTGMQGLLQFPVSG--AVIPAVLLLQF------------------GPWQ.....FNVMGL-Y.....
A6KYR5_BACV8/6-309...........................--......PILSK------------------KYW........FMTC-Y.....
Q0CZ95_ASPTN/77-482...................KNFSFVLR--TGGEPWFTYNV------------------HTW........SIPV-E.....
A0T1U4_VIBCL/8-303...........................--.......SGIG------------------YVW........FIRI-I.....
A3I592_9BACI/6-352..........................F--LEKLLIGKTYT------------------HLY........YIFI-M.....
A1TDU0_MYCVP/22-361...........................--...........------------------.LW........FLGA-Y.....

PF07786

A1HQT7_9FIRM/5-214--------------------------------------FG..................ILH--------LLG.-.-----
A2SQB7_METLZ/5-231--------------------------------------FG..................ILH--------LIG.-.-----
A9CIY2_AGRT5/15-234--------------------------------------FG..................ILH--------NIA.-.-----
Q28R74_JANSC/28-249--------------------------------------FG..................ILH--------SIA.-.-----
Q8PXM0_METMA/7-237--------------------------------------FG..................ILH--------FFG.-.-----
A4EC93_9ACTN/4-221--------------------------------------FG..................IIY--------CMAA-C-----
Q8U2K3_PYRFU/23-240--------------------------------------FG..................ILH--------FLG.-.-----
A7I8Y9_METB6/6-231--------------------------------------FG..................ILH--------LIG.-.-----
A6G0Y4_9DELT/12-237--------------------------------------YGWTPPPTAGQLVTMLLTGDILQ--------LAG.-.-----
A3CVR7_METMJ/5-231--------------------------------------FG..................ILH--------FIG.-.-----
Q11IW8_CHESB/30-251--------------------------------------FG..................ILH--------HIA.-.-----
A1TRD1_ACIAC/21-249--------------------------------------FG..................VLH--------GMA.-.-----
A2SGN2_METPP/12-230--------------------------------------FG..................VLH--------GIA.-.-----
A2STU6_METLZ/14-241--------------------------------------FN..................FLQ--------MMG.-.-----
Q2K839_RHIEC/16-243--------------------------------------FG..................ILH--------CIA.-.-----
B8FY44_DESHD/5-221--------------------------------------FG..................ILH--------FLG.-.-----
A0NYA1_9RHOB/5-227--------------------------------------FG..................ILH--------SIA.-.-----
Q21VS3_ALBFT/16-244--------------------------------------FG..................VLH--------GMA.-.-----
Q0FKK0_PELBH/7-221--------------------------------------FG..................ILH--------SIA.-.-----
B2S625_BRUA1/16-233--------------------------------------FG..................ILH--------QIA.-.-----
A2STU5_METLZ/19-252--------------------------------------FG..................FLH--------MLS.-.-----
Q6SHI3_9BACT/5-214--------------------------------------FG..................ILH--------LIW.-.-----
Q0G6B2_9RHIZ/53-275--------------------------------------FG..................ILH--------HIA.-.-----
A3YBL4_9GAMM/14-227--------------------------------------FG..................ILH--------FIF.-.-----
A4FZP9_METM5/5-227--------------------------------------FG..................IIH--------FLA.-.-----
Q11N89_CHESB/6-227--------------------------------------FG..................ILH--------AIA.-.-----
A4J1M2_DESRM/9-218--------------------------------------FG..................ILH--------FLA.-.-----
Q6SGH9_9BACT/9-218--------------------------------------FG..................ILH--------LIW.-.-----
A1VNB1_POLNA/5-231--------------------------------------FG..................VLH--------GLA.-.-----
A3DGD5_CLOTH/11-220--------------------------------------FG..................VLH--------LIG.-.-----
Q98KU6_RHILO/16-237--------------------------------------FG..................ILH--------QIA.-.-----
A6VZM7_MARMS/12-224--------------------------------------FG..................ILH--------FIF.-.-----
A1W6I8_ACISJ/12-240--------------------------------------FG..................VLH--------GMA.-.-----
Q6M0I2_METMP/11-233--------------------------------------FG..................IMH--------FLA.-.-----
O26882_METTH/9-227--------------------------------------FG..................VLH--------FIG.-.-----
F6BVW5_SINMB/23-246--------------------------------------FG..................ILH--------AIA.-.-----
B1ZHM9_METPB/15-237--------------------------------------FG..................ILH--------CIA.-.-----
Q2Y4H0_9ARCH/17-243--------------------------------------FG..................VLH--------LIG.-.-----
O29726_ARCFU/2-207--------------------------------------FG..................IIH--------FFT.-.-----
Q12ZG6_METBU/7-234--------------------------------------FG..................ALH--------FIG.-.-----
A4BIP8_9GAMM/6-220--------------------------------------FG..................VLH--------FIT.-.-----
Q8THP4_METAC/31-261--------------------------------------FG..................ILH--------FFG.-.-----
Q46DC7_METBF/7-237--------------------------------------FG..................ILH--------FFG.-.-----
Q2FN30_METHJ/7-229--------------------------------------FG..................ILH--------LIG.-.-----
Q1YI63_MOBAS/15-237--------------------------------------FG..................ILH--------HIA.-.-----
Q1B004_RUBXD/18-243--------------------------------------FG..................ILH--------LIG.-.-----
A6FRV3_9RHOB/4-228--------------------------------------FG..................ILH--------AIA.-.-----
Q1YJ44_MOBAS/24-246--------------------------------------FG..................ILH--------SIA.-.-----
Q26I67_FLABB/5-236--------------------------------------ID..................VLQ--------CIG.-.-----

PF05857

A6TIJ3_KLEP7/24-240----------------------------------------------------------.PW--------YSGN-I-----
Q5NWL3_AROAE/9-222----------------------------------------------------------FGW--------WPLN-V-----
Q88AH9_PSESM/14-243----------------------------------------------------------.DA--------TVLN-V-----
A6M0I9_CLOB8/13-266----------------------------------------------------------YFP--------VSNN-I-----
C1DKH3_AZOVD/14-243----------------------------------------------------------.AP--------DSFN-V-----
A4XUI8_PSEMY/4-231----------------------------------------------------------.MS--------NTLN-V-----
A4XH28_CALS8/24-230----------------------------------------------------------.DP--------YELN-V-----
A1WDN4_ACISJ/11-221----------------------------------------------------------AGW--------WPLN-V-----
C4YYW6_9RICK/13-242----------------------------------------------------------.QF--------LTTN-I-----
Q326X1_SHIDS/32-247----------------------------------------------------------.PW--------YEGN-I-----
Q8P901_XANCP/6-212----------------------------------------------------------.RA--------LPLN-I-----
R5K8R7_9CLOT/9-229----------------------------------------------------------FEP--------NWNN-I-----
R5KLN1_9CLOT/10-244----------------------------------------------------------FDL--------QKQN-I-----
R5QZC4_9FIRM/5-243----------------------------------------------------------FSL--------GQQN-V-----

PF16401

H1Y6N2_9SPHI/12-268---------------------------------------------------------------------QLLS-I-----
G8TDM1_NIAKG/23-280---------------------------------------------------------------------YVLQ-L-----
F0SC25_PEDSD/7-264---------------------------------------------------------------------NLLS-I-----
R6N358_9BACE/4-263---------------------------------------------------------------------WLLA-I-----

PF04235

Q8EH35_SHEON/199-352----------------------------------------------------------VML--------SAIP.M-----
YXAH_BACSU/242-392----------------------------------------------------------LLI--------GAPF.L-----
A5VFY1_SPHWW/226-385----------------------------------------------------------DQP--------GRLA.M-----
B0T5F0_CAUSK/216-381----------------------------------------------------------ESW--------AALS.L-----
Q5LBX3_BACFN/231-393----------------------------------------------------------DMW--------QKFA.F-----
A8FJB9_BACP2/218-375----------------------------------------------------------RYA--------FSPF.L-----
Q8ZNL6_SALTY/215-375----------------------------------------------------------REL--------SAPL.Q-----
Q5Z0S5_NOCFA/200-354----------------------------------------------------------GPV--------AALA.G-----
Q5LAR8_BACFN/229-391----------------------------------------------------------SSL--------SNLS.F-----
A5FKP1_FLAJ1/222-380----------------------------------------------------------PYF--------WFIL.S-----
A6LH60_PARD8/231-393----------------------------------------------------------DMW--------QKFA.F-----
Q2NUE2_SODGM/217-377----------------------------------------------------------REI--------SAPL.Q-----
Q5L251_GEOKA/223-378----------------------------------------------------------DSF--------GGAA.L-----
B9LP38_HALLT/238-398----------------------------------------------------------IYV--------GSFP.L-----
Q5WBU3_BACSK/218-382----------------------------------------------------------HMA--------TGIL.G-----
Q5LDG8_BACFN/245-405----------------------------------------------------------IYT--------ASVYPL-----
Q2N5U1_ERYLH/237-397----------------------------------------------------------SAP--------FDTL.L-----
Q1D273_MYXXD/254-423----------------------------------------------------------QEP--------GYIA.M-----
Q0RI89_FRAAA/226-396----------------------------------------------------------HAV--------TGEY.A-----
Q1GR12_SPHAL/244-406----------------------------------------------------------SVP--------FDTL.M-----
A3HTP0_9BACT/227-391----------------------------------------------------------MYL--------SDLA.F-----
Q0C162_HYPNA/232-392----------------------------------------------------------LMA--------FSAF.S-----
Q9X356_BACAN/222-381----------------------------------------------------------ILF--------GGKT.L-----
A8FH56_BACP2/222-385----------------------------------------------------------EQN--------GGLT.G-----
Q5WCD3_BACSK/239-403----------------------------------------------------------RML--------AGPL.Q-----
A4GA59_HERAR/238-403----------------------------------------------------------LPV--------GGTC.L-----
YRKO_BACSU/224-387----------------------------------------------------------GQN--------GGLT.G-----
Q47SA7_THEFY/269-436----------------------------------------------------------AST--------TGIA.T-----
Q21P05_SACD2/237-402----------------------------------------------------------YDL--------ANLS.L-----
A4FQ93_SACEN/204-361----------------------------------------------------------RYI--------LPPV.V-----
Q3IC82_PSEHT/208-361----------------------------------------------------------NSV--------AALC.M-----
Q2NDD6_ERYLH/264-425----------------------------------------------------------SYL--------PRLA.M-----
Q9HNH9_HALSA/232-393----------------------------------------------------------NYW--------GSVP.L-----
Q9KFW4_BACHD/1-165----------------------------------------------------------HIM--------SGIA.G-----
Q8ERW4_OCEIH/226-381----------------------------------------------------------DNI--------GGAA.S-----
Q7N6K6_PHOLL/210-370----------------------------------------------------------AEL--------VTPF.Q-----
A4ARZ9_MARSH/230-396----------------------------------------------------------YDL--------NNIA.M-----
B1YLL9_EXIS2/215-367----------------------------------------------------------VWL--------SGRT.L-----
A6L2L4_BACV8/234-394----------------------------------------------------------TSL--------SNFA.F-----
A1WTH2_HALHL/248-410----------------------------------------------------------NQL--------AVPF.V-----
A1S3E3_SHEAM/216-369----------------------------------------------------------VIF--------SAIP.V-----
Q9AA92_CAUCR/270-432----------------------------------------------------------YEF--------ASLP.I-----
Q0ARL9_MARMM/225-387----------------------------------------------------------TYV--------GSLV.L-----
Q07YN3_SHEFN/228-381----------------------------------------------------------LWF--------SAIA.T-----
A8F9F5_BACP2/224-375----------------------------------------------------------MIL--------GGYV.L-----
A6L9Q0_PARD8/227-389----------------------------------------------------------SSL--------RNFS.F-----
B0T422_CAUSK/230-391----------------------------------------------------------QSA--------TAPV.V-----
A6WB03_KINRD/147-299----------------------------------------------------------SAL--------AGLA.L-----
Q47R13_THEFY/238-395----------------------------------------------------------RYV--------AAPV.V-----
A8MJB9_ALKOO/219-378----------------------------------------------------------VWF--------SGKT.M-----
A6TNH6_ALKMQ/249-412----------------------------------------------------------YEV--------GTVF.L-----
Q1D7M3_MYXXD/255-425----------------------------------------------------------RNL--------AQVG.L-----
Q6NJJ5_CORDI/212-362----------------------------------------------------------NFS--------IGQL.S-----
A5UQH7_ROSS1/237-401----------------------------------------------------------TLI--------AGPV.L-----
A7MLK3_CROS8/215-375----------------------------------------------------------REL--------GAPL.Q-----
Q9KE13_BACHD/42-195----------------------------------------------------------III--------GGPL.V-----
A8GC25_SERP5/223-383----------------------------------------------------------REL--------GAPL.Q-----
Q8A424_BACTN/229-391----------------------------------------------------------KSL--------SNIV.F-----
Q9KFA2_BACHD/226-379----------------------------------------------------------RYL--------FAPI.L-----
Q9KEU3_BACHD/250-400----------------------------------------------------------LLI--------GAPF.L-----
A4FQT6_SACEN/171-324----------------------------------------------------------WAT--------AGLF.G-----
A6TBN7_KLEP7/215-375----------------------------------------------------------REL--------SAPL.Q-----
Q4KHM8_PSEF5/226-387----------------------------------------------------------SQL--------TAPL.L-----
A4F774_SACEN/171-329----------------------------------------------------------SAV--------AGLT.M-----
Q9K7D7_BACHD/224-377----------------------------------------------------------SLP--------GSYV.L-----
A6KYE7_BACV8/229-390----------------------------------------------------------DMW--------QKFA.F-----
Q2G3S1_NOVAD/241-402----------------------------------------------------------MAF--------PHLA.M-----
Q1IVW5_DEIGD/222-381----------------------------------------------------------RMG--------GGLA.T-----
A4AN58_MARSH/230-392----------------------------------------------------------DMY--------GNLA.L-----
Q9RS74_DEIRA/223-382----------------------------------------------------------RMA--------GGLL.S-----
A3HYS5_9BACT/265-426----------------------------------------------------------YYW--------GRFF.V-----
Q6D3N4_PECAS/227-387----------------------------------------------------------REL--------SSPL.Q-----
A5FKP0_FLAJ1/222-380----------------------------------------------------------PLY--------WLVL.S-----
A6LGL5_PARD8/234-396----------------------------------------------------------TNL--------INLM.T-----
Q3IPY1_NATPD/256-418----------------------------------------------------------NYW--------GALL.L-----
Q5YUW9_NOCFA/233-388----------------------------------------------------------RYG--------TAPL.V-----
Q9K6N5_BACHD/237-398----------------------------------------------------------VML--------GGPA.L-----
Q8EL60_OCEIH/225-388----------------------------------------------------------HIL--------TGIA.G-----
A9WKI7_CHLAA/242-404----------------------------------------------------------LLI--------AAPI.L-----
B0RFW7_CLAMS/254-423----------------------------------------------------------HGA--------TGVG.G-----
B1HN91_LYSSC/223-376----------------------------------------------------------VYI--------GGPI.L-----
B1HPE9_LYSSC/165-337----------------------------------------------------------GLQ--------FSPF.V-----
B1HRQ0_LYSSC/190-342----------------------------------------------------------IGL--------GVVP.T-----
B1HW32_LYSSC/220-369----------------------------------------------------------RYL--------CAPI.L-----
B1HYB2_LYSSC/222-372----------------------------------------------------------LMG--------GSQL.L-----
E3FDU1_STIAD/253-420----------------------------------------------------------SEL--------GSLG.L-----
E3FTX2_STIAD/250-412----------------------------------------------------------YAV--------GVAP.L-----
Q74VB6_YERPE/216-374----------------------------------------------------------REL--------GAPL.Q-----
Q7VYP4_BORPE/228-388----------------------------------------------------------GML--------TAPL.L-----
Q812K5_BACCR/224-376----------------------------------------------------------DGL--------TPVT.M-----
Q81SQ3_BACAN/217-376----------------------------------------------------------AMF--------SGKT.L-----
Q8NMY9_CORGL/70-221----------------------------------------------------------STV--------AGLA.L-----
Q8P7N0_XANCP/245-401----------------------------------------------------------ALL--------GGAM.M-----
Q9PFK6_XYLFA/262-418----------------------------------------------------------SMI--------AGLL.M-----
R5USE5_9BACE/227-387----------------------------------------------------------DMW--------QKFA.F-----
R6X5K4_9PORP/228-389----------------------------------------------------------SSF--------RNFS.F-----
U5L4L4_9BACI/226-379----------------------------------------------------------YMF--------GGNI.L-----
U5L6C6_9BACI/232-386----------------------------------------------------------DLF--------GGPL.L-----

PF07779

U1HPB3_ENDPU/212-693---------------------VRLNLLSCLLAYVMRTDYN------------------FYY--------FPAL-S-----
Q6CDI8_YARLI/311-778---------------------FRMNFLSILLAYVMDTDYL------------------FYY--------FAPL-V-----
Q9W4P0_DROME/351-846---------------------FRANFLSVLLCFCMNRPYQ------------------FYY--------FVPL-L-----
F6X8U0_XENTR/294-776---------------------FRLNFLVVVLCVVMDRPYQ------------------FYY--------FVPL-V-----
K1QBI1_CRAGI/299-786---------------------FRLNFLVVVLCFVMNRPYQ------------------FYY--------FVPL-V-----
B7Q496_IXOSC/303-799---------------------FRMNLLVVVLCLSMNRPYQ------------------FYY--------FVPL-V-----
T1INP0_STRMM/300-790---------------------FRVNLLVVVLCLCMNRPYQ------------------FYY--------FVPL-I-----
H2Z694_CIOSA/175-652---------------------FRLNFLTIMLCLTMDRPYQ------------------FYY--------FVPM-C-----
D6WF47_TRICA/333-815---------------------FQLNFITVTLCLCMNRPYQ------------------FYY--------FVPL-L-----
W5MY98_LEPOC/349-830---------------------FRLNFLVVVLCLVMDRPYQ------------------FYY--------FVPL-V-----
G3NTP4_GASAC/295-774---------------------FRLNFLVLVLCLVMDRPYQ------------------FYY--------FVPL-V-----
E9GCH2_DAPPU/313-803---------------------FRMNLMTVVICLCMNRPYQ------------------SYY--------FVPL-V-----
E9C8Z6_CAPO3/466-972---------------------TRLNVLTIGLCMVMDKPYQ------------------FYY--------FVPL-S-----
L2GH03_COLGN/240-722---------------------VRLNLLSCILGLATSSEWI------------------IYS--------.APL-M-----
E0VHC9_PEDHC/297-768---------------------FRLNFMQFVVCLCMNRPYQ------------------FYE--------FLPL-V-----
F6XMQ8_CIOIN/290-767---------------------FRLNFLTVMLCLTMDRSYQ------------------FYY--------FVPM-C-----
H2QUY3_PANTR/295-776---------------------FRLNFLVVVLCIVMDRPYQ------------------FYY--------FVPL-V-----
T1G7I3_HELRO/252-726---------------------VRFNLLVVLLCLSMNRPYQ------------------FYY--------FVPL-V-----
Q17CG6_AEDAE/303-783---------------------FKINFLTVILCLCMNRPYQ------------------FYF--------FVPL-L-----
H3A7E5_LATCH/298-779---------------------FRLNFLVVVLCLVMDRPYQ------------------FYY--------FVPL-V-----
H9KE76_APIME/294-775---------------------FRLNFLTVSLCLCMNRPYQ------------------FYH--------FVPL-V-----
S8EFZ6_FOMPI/324-771---------------------IRLNFLTLLLAYTMNTDYI------------------SYY--------FAPL-V-----
X1WW08_ACYPI/313-776---------------------FRLNMLTVVLCVCMNRPYQ------------------FYY--------YIPL-V-----

PF10129

A1R109_ARTAT/441-826-VVLLLISPLI---------------LVAL--SRGFTW-----------LVLTL---------SVGLYI--------AGS
A0K1D5_ARTS2/295-678-VIMLLVSPLI---------------LLAL--ARGKVL-----------WVLAA---------TTALYV--------AGT
A2SCM7_METPP/4-366-VVFMVLSPLL---------------LLHG--LQHGWR-----------GILAL---------SVLLWL--------LAQ
A1TNJ8_ACIAC/18-379-VLFMLASPWV---------------MSVG--LRRGWA-----------PVLAV---------STALWF--------LAQ
Q1D6T0_MYXXD/55-417-VVLLLLTPFI---------------LLGA--RKAGWT-----------RILCL---------SGLVWL--------SAQ
Q11B97_CHESB/2-386-IIYMLVSPPL---------------IWLC--VTGRWG-----------WVAAT---------TIIVWV--------AAQ
Q7CT44_AGRT5/2-385-IVYMLFAPVL---------------VKLC--LDGKWA-----------YVMAG---------SLLVWM--------AGQ
B2JS58_BURP8/58-406-AFFAFAVPVI---------------LPLA--RSK.PW-----------LLLAG---------SLAVWG--------IAP
Q13NS3_BURXL/7-355-AFFALLVPMI---------------LPLA--RSK.PW-----------LLLAG---------SVALWA--------GAP
Q1LDM8_RALME/9-370-AVFIGLAPLA---------------IGWA--RKY.PL-----------AFVCG---------SVALWL--------MAP
A1B1M7_PARDP/3-363-VLLIATVPVT---------------VPFM--LRW.PW-----------LAMAV---------SVLVWI--------LAQ
Q5FTQ3_GLUOX/17-367-VVLLALFPLI---------------YWVL--KRS.VW-----------LLLAL---------SIGIWA--------IAN
Q89UF3_BRADU/67-422-IPLMAFFPLV---------------LWGL--LRG.PN-----------LTLAA---------SVALYV--------AAR
Q89KT4_BRADU/82-438-IVLMAAFPVV---------------LWFM--LRW.RN-----------AVMIS---------SFGLYL--------AAR
A4YU73_BRASO/12-368-IVLMGFFPPV---------------LWMM--LRQ.PD-----------LTMIA---------SIVLWL--------LAR
Q6N6S8_RHOPA/12-368-IVLMGLFPPV---------------LWLM--LRR.PD-----------AVMIG---------SFVLYF--------AAR
Q1QFJ8_NITHX/39-395-IVLLAGILPI---------------LWLM--LRL.PD-----------ATMLG---------SLYLYL--------AAR
Q89VE5_BRADU/37-393-IVLMLALPLI---------------LWSM--KWK.PD-----------VTLGL---------SVVLYA--------VTW
Q6N0J3_RHOPA/44-400-IVLMFFLPPI---------------LWLM--RRW.PD-----------ITLGL---------ATLLYA--------ATW
Q3SWD7_NITWN/36-392-VALMLFFPLV---------------LLVM--QRS.AG-----------LALAL---------SAGLYG--------LTW
Q89CC1_BRADU/15-372-IALVFASPFI---------------VWCL--VRR.PN-----------LTLAA---------SVVLYV--------LSR
A4YYN0_BRASO/36-389-AILHICFPVV---------------LWLM--MTS.AT-----------ATLAV---------SFVLYM--------MVQ
Q89EQ8_BRADU/32-383-VLYHLLFAPL---------------LWLL--LRA.PN-----------ATLGA---------SLLLYA--------LVH
Q87XJ3_PSESM/5-366-IVLLLTLPLT---------------LPLM--LRK.LE-----------VAVGL---------SIALYL--------MVP
Q0BVC0_GRABC/14-370-VVLLLAFSVL---------------MP.L--LRR.PW-----------LLGGL---------SLTLYA--------ATR
A5G015_ACICJ/9-360-VAIMGGIAPL---------------LF.M--LRF.PR-----------ALLVL---------SFALYA--------GAR
B0U809_METS4/3-358-VVLLGLAPLF---------------VLAA--RLS.RP-----------LALAA---------SLALYL--------AAL
Q2K344_RHIEC/23-378-GALLLMVPII---------------LLLN--ERS.PL-----------LALAV---------SGTVWL--------LAG
Q2YRC8_BRUA2/6-358-AVMLILTPIL---------------LFLA--RIS.LP-----------LMLGV---------SGVVWF--------LSG
Q983D5_RHILO/37-389-AALLLMAPAF---------------VLLI--SYR.PA-----------AALVA---------SGALWL--------VAG
Q6G5Q7_BARHE/16-368-IVLMLFAPFA---------------LYLS--CKQ.KG-----------LLLLG---------SFMLYL--------LSG
Q3J1N1_RHOS4/11-372-ATLLLVTPAL---------------ILAA--LRF.PR-----------TLLVG---------SVLLWA--------LTG
Q11DW2_CHESB/11-364-AALLVISPVY---------------ILIG--LWN.RL-----------GLIAV---------AIVVWV--------LAG
Q1GGF0_RUEST/47-428-LVVLALMPAI---------------MSAQ--KLG.LW-----------AVAGL---------SLALWL--------LAN
Q169P8_ROSDO/29-397-LVVLAMMPLV---------------IACH--RAH.PA-----------LAGAL---------IVGVWF--------GAQ
Q0BQN1_GRABC/63-424-VVIMAMVPVA---------------VLLA--KLD.RR-----------LPVVA---------SVLLWA--------GAL
B0RH46_CLAMS/492-873-VVLTLLVPAV---------------VWLL--RRRMWW-----------VVLIV---------SWTAYV--------LNA
B4EL00_BURCJ/18-366-VLFALASPVL---------------VPFA--RRH.PW-----------LLVAL---------SVASWL--------AAG
B4ELU9_BURCJ/9-352-AFFALLVPLA---------------LPLA--RTQ.PW-----------LMLAF---------SGSLWY--------AAP
E3FIJ7_STIAD/5-384-IVYLALSPPL---------------VWLC--VTGRWR-----------KVVIG---------SWMLWL--------GVQ
Q13QD3_BURXL/18-362-VIFALCVPFA---------------VPLA--RRS.SL-----------LALGL---------SVAIWA--------LAR
Q5LPG0_RUEPO/27-401-LVVLAMMPLM---------------MGLR--QVG.FW-----------AMALA---------SVLIWA--------VAQ
Q63IA9_BURPS/14-358-VLFALATPAI---------------VPLA--RAK.PW-----------WLVFG---------SVLMWG--------CAP
Q6NAS6_RHOPA/6-361-IVLVVAAPLI---------------LWGL--LRR.PT-----------LTLVC---------SGLLYL--------VSR
Q92L11_RHIME/23-374-AVLFLLLPGF---------------LWLN--AVR.PR-----------LLFAF---------SATLWL--------AAG
Q9KQQ7_VIBCH/3-361-IMYMLLFPLA---------------LYGF--RRGYLK-----------WVLAL---------SVLIWA--------SSG

PF01757

A8DMZ1_STALU/12-334.IQYFILSYLI...............YKIT--PKIFNS-----------KLLLI---------GSFFVQ--------YFF
K6RN31_LACCA/20-369.LQLYLLFPAM...............LWLF--KRTAGH-----------HIRLV---------VASFGV--------QML
A8G974_SERP5/5-314.VLYVLSLPLL...................--...SRL-----------NIGPL---------LGLLFL--------AAL
Q11WN8_CYTH3/14-339.WWFYMLFIPI...............YFYI--PENRRY-----------LYVGI---------ISSAAL--------VVY
A7LV98_BACO1/4-296.CSFYIL...................YLFT--NKYKYF-----------YRLLT---------VLSLIT--------WSL
F0K6S5_CLOAE/6-334.FITNIIFFLID............FVFCKI--KGFKKE-----------ILQGI---------LFLVLF--------VID
A0A009DRR0_ECOLX/9-357.VVMTTLCVWIFKRIR.....NNLENSDKT--NKKFSM-----------VKLSV---------IFLCLG--------IGY
Q07PA2_RHOP5/14-375.LEFYVVALALRTSIGW...LDRPGRIRAG--ADRMVR-----------LLIRT---------GVAPLI--------LAI
Q30BE9_ENTFL/7-326.IIGAAIAWYL...............VKKL--NYPKAL-----------MVASV---------LYLIGL--------FGD
A1HPJ5_9FIRM/6-350.LWFYTLMPLWR............LIVRLM--LKRPAP-----------SLLLT---------LILQIG--------FNY
Q4P0M9_USTMA/127-516.LWGMLSVLML...............LPIV--MHLAPS-----------RRFVL---------YALLLI--------FEG
A7LV97_BACO1/24-312.MTLMLLVPL................YGWI--FLCNKS-----------WLYLI---------IVLLSF--------YFW
Q1QWT8_CHRSD/4-315.IGAAIMLYAL...............RHLS--LKALFG-----------LALSL---------YAMGMF--------FIY
Q2T7M4_BURTA/6-373.LIGSIVLFAI...............IALF--GKRPIL-----------LVLWF---------LFFANI--------FGL
A4B9D7_9GAMM/5-375.GLLVAAMKLF...............RRPT--AVQLWW-----------VFGSA---------LVATLL--------LHE
A0A015ULW8_BACFG/8-315.MIYYVVLWFI...............RKFL--KKHLKW-----------VFFMA---------ATITLL--------WYF
M6C4Z5_LEPBO/44-373.VSLYLMFPFL...............KRIL--LKSDSK-----------KVTLI---------FFFSAL--------ILN
A5ZUV3_9FIRM/6-346.LGCYIALPFL...............SRLL--QTSTNL-----------RQYSL---------LYVLGI--------IIF
A1VGB5_DESVV/30-339.IGYMVVLPVL...............VVIA--RDNTAR-----------NVFIY---------SGIFFV--------FIV
B2JGA6_BURP8/53-400.MCFYLFAPLV...............FSAT--RTRRGL-----------WRTSL---------VLLACS--------AIM
Q9XAP7_STRCO/24-348.LWFVLLSPLL...............LRVF--RLAPVP-----------VLLLS---------LAPAVA--------FQF
Q07KV2_RHOP5/17-343.MIFYVFVATT...............MLGI--FGRTGV-----------PKRWV---------AVILAG--------VGT
Q484G4_COLP3/18-372.FHYTVLLLPLCAFINS...EKGIVILQKI--EKFLTK-----------SSRII---------WLPLTI--------YFV
A0DGZ8_PARTE/156-556.IQLFIICLIP...............MTCY--ALGYKR-----------ISKYL---------ITGMII--------SSV
A7A7L5_BIFAD/6-324.AIFLALLPFL...............SRGL--KALGRE-----------YHLAL---------AATVLT--------IWG
A3JPT3_9RHOB/10-350.FALLLFYPLF...............LVAV--KYPFLG-----------LLVLI---------CLATKR--------EAD
A5EMI0_BRASB/26-386.LAFDLAAALLYRVSP....HLLDPINRLS--LRAFAH-----------PRDFF---------FIFLLI--------TGV
A4FKM9_SACEN/20-347.LMGFTAAALL...............YRSS--WGRGPR-----------LRVVL---------WAAVLL--------PVA
A7V903_BACUN/5-297.ILCSLIYYIT...............FRYV--RLSVVS-----------RLVVT---------GVCLFA--------LSH
Q8IG66_CAEEL/330-720.FQLYLTLPIV...............IFFL--SKFRFG-----------FTFAI---------VLCILA--------LVY
Q7UES3_RHOBA/12-486GFVLVMTLTPRGW..........RSRLNLA--TVVRSP-----------HCLLW---------LIPLTM--------LPH
D8IMM9_LACSC/4-332.FLANIFYSFI...............IKLT--TKYKVS-----------DNITT---------IIFIVT--------TFI
Q8PXP5_METMA/13-333.IVITTLCFFI...............LYYS--NIHTLY-----------LFAVI---------LLTFQI--------ISW
Q6AH04_LEIXX/3-320.AVAAVASSTL...............MPVV--ANGTPA-----------SWGLP---------GALLPR--------LTT
Q5CVD7_CRYPI/23-437.IVISVVMFPF...............MKVM--KGQKKS-----------ENISY---------IISCGC--------IAA
A0LT35_ACIC1/10-359.AVILFLTPLL...............FALH--ERFGIT-----------VVLVM---------AAFAAV--------FDV
Q8KJJ2_RHILI/23-344.FISFVLIRVL...............TTFN--RLSMWI-----------ISASA---------IAVAFA--------PIT
Q17BV3_AEDAE/212-599.MQLAILAPLL...............LIIL--TANPFY-----------GIASF---------VLLHGL--------STA
A7F3R9_SCLS1/8-361.LKGAMLVYVF...............MLGT--GGMKPR-----------YRMMS---------SMALFV--------YFY
Q144E0_BURXL/4-320.FICQIVACIA...............VWPR--STTSGS-----------ALTAA---------NRGVLA--------APA
Q83YQ9_STRGN/5-307.SYIYGLYLLF...............YKYF--HRLTTF-----------GVSLI---------LLALAF--------CIE
Q07P25_RHOP5/21-323.MICHVLAVLL..............PTRWA--MIGLAA-----------LGFVV---------FMLLPV--------RPA
M2EB77_STRMG/14-327.FGLLIFMPIL...............NLAL--RKLNTK-----------DLKHI---------VLLAII--------FFS
A0LP70_SYNFM/14-366.LQLYLFFPLF...............SRLL--DKAGEV-----------KFLIL---------CGVFTL--------LSR
A8H1P8_SHEPA/43-369.MMLFALSPWV...............MYLI--KKQQIL-----------YYAIP---------LLLIAI--------MVH
A6E8A8_9SPHI/14-335.FVLENMYFLA...............FRKA--VGWKKV-----------VILFG---------FFILAI--------LDH
A5VFE0_SPHWW/65-420.LFGSLLALLG...............AMII--GARRRP-----------VLDAV---------LITILA--------IAA
A5LX53_STREE/8-323.WSILIVYGLL...............SVVF--KNRKSL-----------LLVSV---------FAYIFT--------LFI
Q4UW44_XANC8/22-341.FVATVVY..................LALR--EDLSAA-----------VLAVC---------SLLVVW--------AWT
Q2HGI8_CHAGB/115-578.FRCSMVLFLT...............LAGT--LGLRRG-----------WRLGV---------VAGLVV--------FVY
A6BII1_9FIRM/11-365.VCIYLLFPVL...............YYIH--RDQRKI-----------FIYFV---------VIGIAM--------IFG
F2HK93_LACLV/4-320.LGLYLFIPLLN............IIWNYK--KEIKNY-----------HLYIV---------FIASLL--------TFL
A5N097_CLOK5/9-357.FVFTLLCLPFFKEWAC...KIHSKHYDKI--IEFLTK-----------PMMIL---------LICMPY--------PFL
Q8FTN8_COREF/16-398.MLFYLTFPLF...............IPLV--RKVRGV-----------GNWWA---------FGITFL--------LSL
Q6G5Q7_BARHE/17-365.IVLMLFAPFA...............LYLS--CKQKGL-----------LLLGS---------FMLYLL--------SGF
A0A016XC94_VIBCL/4-356.IMYMLLFPLA...............LYGF--RRGYLK-----------WVLAL---------SVLIWA--------SSG
A7AZT9_RUMGN/12-318.ILFSFMSPII...............YGVL--RQKWVG-----------LFVVI---------LVLVIN--------FSG
Q2NRT0_SODGM/9-399.FFFYLLFPWA...............APRL--MNVRNP-----------WLWLG---------ICMLAY--------LLP
A4CKW1_ROBBH/7-342.IGIYQLT..................RKFR--PGAFPV-----------LLLMV---------TVGLFL--------FEP
A6FAM6_9GAMM/8-349.FQFYLIFPFI...............LAMF--NRFGNV-----------FLIAI---------SLVCIT--------ISL
A7V2Z2_BACUN/14-354.YIGNILYALF...............VRKF--NKVALS-----------VLVFV---------AGCFTV--------YRC
Q00XL5_OSTTA/15-388.TFALAAMPFA...............LPSI--AQMKRE-----------HLNRT---------FKVLLI--------VSL
A4YYF7_BRASO/15-345.VLVYAVFFLG...............LRFV--TTSPLL-----------NLAMI---------LAGIAS--------GTL
Q1D0W9_MYXXD/39-356.GFALLVGATL...............LAVT--PGRWGR-----------TVMLA---------VVAVGL--------PLV
Q16PV5_AEDAE/243-647.FQFFCIGMLI...............MMIL--WRFPRS-----------IKTMI---------YVMMTI--------SIV
Q82ET0_STRAW/57-398.AGLTAATPLL...............TRLN--PLWPLA-----------VVLHV---------DLIRFG--------LGG
Q4JZS0_STREE/5-327.FLFYMLFPFF...............VWLC--WDKKRA-----------FISFI---------ISVILN--------IFC
A7X0T7_STAA1/8-314.FFFHVILVIV...............RRFN--PYKVLS-----------VSIII---------SIGAGF--------SDN
Q7MGC8_VIBVY/15-336.IIAVAVVALF...............VHFQ--RQHWLL-----------PIAAL---------LYLYGV--------LAG
A6KZK8_BACV8/9-367.VGLYFIIPIF...............HAWL--ERATRK-----------DIKLF---------LSIWGI--------SLF
A4CUQ6_SYNPV/6-368.FVFDLIYCAWVKLRGDHYLVDTDIPLPTM--RSWVIS-----------AVVLG---------FIEVAM--------STQ
B5BHU4_SALPK/5-319.TVIYLVSPLI.................QV--KNVSGK-----------MLLML---------MVVIGI--------IAN
A6P1P2_9FIRM/9-341.LGLYLVTPIL...............RAFV--QGASRK-----------DFHYF---------FLLCFV--------VTY
A5FYP6_ACICJ/4-317.FLLSVATPLL...............LAAC--RGRLWP-----------VICIF---------AAFQFI--------PLP
Q7MQA5_VIBVY/5-328.IPLYFVIPMF...............QWLV--RQQRQD-----------ILYLF---------TALWLF--------TTV
I7HSS1_LEGPN/10-336.EQFYLIWPII...............LIVL--TKKFTD-----------KKIIL---------GTILLT--------IIS
A7V3H1_BACUN/5-305.FFCFCILAII...............TKIT--TNNLIV-----------FTVAC---------IITYFT--------PYC
A0A016DJ19_BACFG/4-349.ISLYLFIPII...............SPWL--RKASAK-----------EERFF---------IGLFLL--------STC
A2SCM7_METPP/5-359.VVFMVLSPLL...............LLHG--LQHGWR-----------GILAL---------SVLLWL--------LAQ
A7ZZ73_ECOHS/5-329.IVYFVVCKIF...............SRLA--LLLFAL-----------FVLLS---------VAVNFV--------PTP
A5UMZ7_METS3/7-344.LGLYLSLPIF...............SPYV--RSTKLR-----------GAKYF---------LILAIS--------ASL
A3YY52_9SYNE/16-323.VVFYLLAPLL...............LLLV--HSLGQT-----------PWRWT---------SNRLVV--------CAG
A4AIT9_9ACTN/563-845AVVALLAIPAV...............RRWE--RRWPFA-----------FALGM---------LAVTLV--------VRT
A5N224_CLOK5/8-329.IEFYIIFPFI...............YKFM--GKRWWL-----------FLSLL---------VTSFFL--------IYF
E0TI88_PARBH/15-315.IMAQLFLAAY...............DRVE--GGLISG-----------VAVLI---------LLGFVI--------VSY
A0A022NJA1_PSEAI/5-324.WVATLFAWFM...............LRVI--QRLGLS-----------LAASC---------VLLAVQ--------LGL
A0E2L0_PARTE/17-375FLCLSIPTIHLIRSCFLKSKGTSDTNKNSI--QDLSNY-----------IFFLI---------ITVLLY--------SMA
C6IRR6_9BACE/9-318.FNCNILFYLI...............HYLR--DKHLSL-----------MFAAT---------LLIGCT--------GFF
Q2C1R6_9GAMM/10-345.IVFSAVFALFQVVS......TGNQKVDAD--KPFPAL-----------WKILL---------FAVMII--------PVN
A7A7B8_BIFAD/5-363.IAVYLVLPVM...............KMAF--DSERKL-----------AFNAL---------LAVLAG--------FTV
Q4JYU7_STREE/6-318.ILIYLCLPIL...............RQFL--NSKRSY-----------LYSLS---------LLMTIG--------LIF
A9VR59_BACWK/5-346.FQIHLLFPLLCTL........FYWFQKRT--ENKKDI-----------YKYMT---------IFACLY--------FFL
A7VGI1_9CLOT/6-345.LIAMLVI..................YPLL--RKYKDT-----------YTLII---------APVTAL--------LIS
Q1QR03_NITHX/14-320.PVFFVV...................IKAT--RRISPW-----------AIWGA---------AAALEM--------AHI
A5ZDF6_9BACE/13-326.LYLMIGFAVI...............HFAV--YSIKKQ-----------HMLGV---------SVLLFL--------LCF
Q16FE1_AEDAE/161-554.MQMFLASLGL...............LTLM--WRFPKA-----------VPKLL---------LAGTIG--------SVL
Q7CTZ0_AGRT5/8-329.FVCILLSPVL...............AFLM--RRFALP-----------TLAIL---------LIITAM--------PDL
Q8G7P7_BIFLO/17-373.AGFVLATPFL...............AAMM--RTIGRS-----------GAWLL---------VGLAAA--------VAA
A1R1G8_ARTAT/18-357.LTAQLSIPVM...............ARLH--ERAPFL-----------TFAAL---------VALIIT--------VDS
A1VHZ4_DESVV/11-319.LLFYLVYPVM...............NRAV--TTPARG-----------RLLLW---------GCVALA--------AVM
A0QPG5_MYCS2/9-326.MICYIAVAVLG.............IVGLL--KRRWVI-----------PAIFV---------LTLCAT--------AYF
A5EXU9_DICNV/19-351.VLQFAGLTFI...............YFSF--AKKMGW-----------SKSTL---------VMIAVL--------CSL
A6LGX6_PARD8/9-311.IYSCITIYFI...............YNKL--PRLIKF-----------LPLLI---------IGYFCL--------VPY
Q11WP3_CYTH3/4-324.MQFYIIVPAL...............LFVL--AKLQNR-----------KIVFL---------SVFFIL--------FSI
A0K1D5_ARTS2/296-671.VIMLLVSPLI...............LLAL--ARGKVL-----------WVLAA---------TTALYV--------AGT
A6KYR5_BACV8/6-309.VVLYCFSPYL...............NRLV--HNLSQK-----------SYKQL---------LLLWGF--------FFV
Q0CZ95_ASPTN/77-482.YRGSLAVYTA...............AIAL--ARFRRN-----------ARLTG---------EVALVV--------YFL
A0T1U4_VIBCL/8-303.FVFSVISPML...............FYIL--NKIKSE-----------NKLLL---------LVFISF--------LIN
A3I592_9BACI/6-352.VQFYLLFPLF...............LYIL--KKKPAL-----------SPHLI---------WIGLAL--------QWI
A1TDU0_MYCVP/22-361.VLVLAAVPAL...............AHIS--TTGRLV-----------GAVAA---------TYGVVA--------IVD

PF07786

A1HQT7_9FIRM/5-214-..VSMLLGHG---------------L..R--RFHPAI-----------VTIIA---------FAFLAL........GQL
A2SQB7_METLZ/5-231-..VATILAIP---------------FVVM--KVKPYV-----------PLVFG---------LICIVL........SPF
A9CIY2_AGRT5/15-234-..AASLVGLL---------------F..L--RAPAPV-----------TLLFA---------VIAFIL........PQY
Q28R74_JANSC/28-249-..LCSLLGLL---------------A..L--RLPVLA-----------IAGLA---------VVVFYV........PEF
Q8PXM0_METMA/7-237-..LSAVLAYP---------------F..L--KYGKEN-----------LFF.G---------LLFVLA........GFY
A4EC93_9ACTN/4-221-TGIVALTDPV---------------L..K--KISARW-----------GMSLC---------LVLFAL........TWS
Q8U2K3_PYRFU/23-240-..VASILAIP---------------F..Y--SLGWKN-----------VFP.A---------FFFLAG........AKV
A7I8Y9_METB6/6-231-..LAVMLSPL---------------F..F--RFRTWN-----------AVI.G---------IVFIAI........GWI
A6G0Y4_9DELT/12-237-..LCLILMGL---------------IRKL--TPNRHG-----------LLVWA---------ALFASG........THL
A3CVR7_METMJ/5-231-..LAILLAPL---------------F..V--RLDPEK-----------LIITS---------IACLIA........GYA
Q11IW8_CHESB/30-251-..LATIVGAA---------------V..L--RLPVPV-----------LLLLA---------AAVIAA........PHY
A1TRD1_ACIAC/21-249-..VMLVVARC---------------T..A--GWGGWL-----------WPAGA---------LALAA.........PWA
A2SGN2_METPP/12-230-..LMLIVCRF---------------S..A--GAGRWL-----------WPLGL---------AAILL.........PQF
A2STU6_METLZ/14-241-..LSMILCIP---------------F..L--RFGKWS-----------LIP.A---------VSFILL........GLF
Q2K839_RHIEC/16-243-..LLTLIGVV---------------F..V--RLPLAF-----------TLLVT---------IALLAAWILDNFGTPGL
B8FY44_DESHD/5-221-..VMMVLYPL---------------I..Q--KLPNGA-----------LILGS---------VLIIAG........GLI
A0NYA1_9RHOB/5-227-..LSSLIALP---------------F..T--RLPVVF-----------AVLAA---------ALVFSL........PFW
Q21VS3_ALBFT/16-244-..LMLIIARL---------------T..A--RWGGRL-----------WWLGA---------CAIAI.........QLI
Q0FKK0_PELBH/7-221-..AASLIGLA---------------V..L--RLPAWG-----------MALTG---------AAVAAL........HLT
B2S625_BRUA1/16-233-..LASVLGLL---------------F..L--NLPPGL-----------T....---------.AAVAA........PHY
A2STU5_METLZ/19-252-..ISMLIAIP---------------L..I--RFGKWN-----------ILF.G---------LLIILV........GIF
Q6SHI3_9BACT/5-214-..VSSLIAIA---------------F..I--NLPKTS-----------LLIAA---------LILIGS...........
Q0G6B2_9RHIZ/53-275-..FASLAGLL---------------F..I--RMPWPL-----------TLALG---------IVVIVL........PLF
A3YBL4_9GAMM/14-227-..VASWLVLP---------------V..A--RKPWLS-----------LAIGI---------GILLA............
A4FZP9_METM5/5-227-..ISGLLGII---------------F..Y--RFEKIN-----------LVF.A---------IIFLSA........GLL
Q11N89_CHESB/6-227-..AATLLGAL---------------F..L--RASPLV-----------CLGAA---------TIVLML........PFV
A4J1M2_DESRM/9-218-..ISILLYPI---------------F..H--RWSPGI-----------LMVFG---------TIIIGL........QYF
Q6SGH9_9BACT/9-218-..TGTLIAIF---------------F..I--QLPKIS-----------LFIAA---------LIFLFG...........
A1VNB1_POLNA/5-231-..VMLLIVRL---------------T..A--GWGRWL-----------WFLGS---------AAIAM.........KFV
A3DGD5_CLOTH/11-220-..LCMIVSPF---------------L..K--KIPTPS-----------LLILS---------LIIGMT........QFV
Q98KU6_RHILO/16-237-..LASLLGLA---------------F..L--RLPALL-----------TLVVA---------ALVIAA........PIY
A6VZM7_MARMS/12-224-..IASLLIRP---------------L..A--KWPIPS-----------ALAGA---------VIILI............
A1W6I8_ACISJ/12-240-..VMLVITRL---------------T..A--GWGRWL-----------WLAGL---------LALVS.........PWV
Q6M0I2_METMP/11-233-..ISGILGII---------------F..Y--RFKKLN-----------LFF.S---------VIFLIL........GVL
O26882_METTH/9-227-..LAVILTHP---------------L..A--GRRTVA-----------LAL.S---------AVAITV........GVL
F6BVW5_SINMB/23-246-..AASLVGLL---------------F..L--KLPAAV-----------SFLAA---------AVAFAA........PLY
B1ZHM9_METPB/15-237-..ASSLLGLP---------------F..V--FLPVPV-----------TALAA---------AAVMLA........PQV
Q2Y4H0_9ARCH/17-243-..ISIIMAYP---------------F..L--KLRLWN-----------LLP.G---------ILFVS