Sequence alignment for CL0316

PF10129

A1R109_ARTAT/441-826-----------------------RDAR.ID-----MLRGLAIVFVVV-NHV....GINSVFQ.L----------------
A0K1D5_ARTS2/295-678-----------------------RDSR.VD-----LMRGLAILFVVV-NHV....GMTSLFQ.L----------------
A5CT98_CLAM3/468-850-----------------------RDRR.LD-----LFRGWTIVAVVI-THI....EVASPYS.Y----------------
A2SCM7_METPP/4-366-----------------------RLWE.ID-----ALRGLMLVLMTL-THL.....PTRYAD..----------------
A1TNJ8_ACIAC/18-379-----------------------RRWE.ID-----AVRGLMLVLMTV-THL.....PTRLTM..----------------
A6SUD0_JANMA/21-383-----------------------RRWE.LD-----ALRGLMLVMMFS-THL.....PTRFSI..----------------
Q1D6T0_MYXXD/55-417-----------------------RRPE.LD-----SLRGILLVLMTL-THL.....PTRLNT..----------------
Q11B97_MESSB/2-386-----------------------RRLDILD-----GMRGYFLVFMML-NHL...AFTGGYLLVK----------------
Q098N2_STIAD/51-435-----------------------QRLEVLD-----GLRGYFLVFMVL-NHL...TFSGGYLLVK----------------
Q7CT44_AGRT5/2-385-----------------------KRFDLID-----GMRGYFLVFMLI-NHL...VFAGGFWLVE----------------
A5F6W9_VIBC3/3-362-----------------------RIPA.LD-----SIRGLLLVLITF-NHLIWYSGGTTILQ.M----------------
B2TAN0_BURPP/16-364-----------------------RSIE.VD-----FFRGVVLIVIVL-DHI.....PGSALS.H----------------
Q1BP03_BURCA/9-357-----------------------RYAE.LD-----FFRGLVLLVIVV-DHI.....GGSILS.R----------------
B2JS58_BURP8/58-406-----------------------RLIE.LD-----FFRGLVLLFIVV-DHI.....GGSILS.R----------------
Q13NS3_BURXL/7-355-----------------------RLIE.LD-----FFRGLVLLIIVV-DHI.....GGSILS.R----------------
A9ALA8_BURM1/18-368-----------------------RLIE.VD-----FFRGIVLLMIVV-DHI.....GASVLS.R----------------
A5XMC5_BURML/14-364-----------------------RSIE.VD-----FFRGLVLLTIVV-DHI.....GASVLS.R----------------
Q1LDM8_RALME/9-370-----------------------RRTE.VD-----LIRGIALLFIVV-DHV.....NGSVLA.D----------------
A1B1M7_PARDP/3-363-----------------------RIVA.LD-----MLRGYALVCIML-DHM.....PIGVLR.K----------------
Q5FTQ3_GLUOX/17-367-----------------------RDHR.VD-----ALRGIALLMMLV-DHV.....PDDLLN.R----------------
Q89UF3_BRAJA/67-422-----------------------HDAR.LY-----LTLGIANWSVFV-DHI.....PNNVVN.L----------------
Q132X2_RHOPS/15-370-----------------------RDLR.LD-----LFRGMANWAIFL-DHV.....PNNVVA.W----------------
Q134C6_RHOPS/15-370-----------------------RDLR.LD-----LFRGMANWAIFL-DHI.....PNNAVA.W----------------
Q138V8_RHOPS/8-363-----------------------RDLR.LD-----LFRGLANWAIFL-DHV.....PNNLIA.W----------------
Q89KT4_BRAJA/82-438-----------------------RDVR.LD-----LFRGLANWLIFL-GHI.....PNSVLV.W----------------
A4YU73_BRASO/12-368-----------------------RDLR.LD-----LFRGIANWAIFL-DHI.....PDNVVN.W----------------
Q6N6S8_RHOPA/12-368-----------------------RDLR.LD-----LFRGVANWAIYL-DHI.....PNNVVN.W----------------
Q1QFJ8_NITHX/39-395-----------------------RDHR.LD-----LFRGIANWAIFL-DHI.....PNNVVA.W----------------
Q89VE5_BRAJA/37-393-----------------------RELR.LD-----LFRGLALWLIFI-DHL.....PSSLLT.W----------------
Q07GY5_RHOP5/35-391-----------------------RELR.LD-----LFRGLALWLIFI-DHL.....PANLLT.W----------------
Q6N0J3_RHOPA/44-400-----------------------RELR.LD-----LFRGLALWLIFI-DHL.....PANVLT.W----------------
Q3SWD7_NITWN/36-392-----------------------RELR.LD-----LLRGFALWLIFI-DHL.....PQNLLT.W----------------
Q89CC1_BRAJA/15-372-----------------------RDLR.LD-----LFRGIGLWMIFL-DHI.....PHDVVA.W----------------
Q130V7_RHOPS/19-375-----------------------RDLR.LD-----FLRGVGQWMIFI-DHI.....PYNVLH.W----------------
A4YYN0_BRASO/36-389-----------------------RDLR.ID-----ACRGLALWFIFV-DHV.....PDNSLA.W----------------
Q89EQ8_BRAJA/32-383-----------------------RDLR.ID-----ACRGIALWWIFL-DHV.....PNNIGS.W----------------
A5EUM2_BRASB/9-363-----------------------RDHR.ID-----LFRGLSLWLIFI-DHI.....PEVYLN.R----------------
Q87XJ3_PSESM/5-366-----------------------RDHR.ID-----FFRGLALIFIFW-DHV.....PDNPLA.Q----------------
Q0BVC0_GRABC/14-370-----------------------RDLR.ID-----FFRGVALWMIFV-DHM.....PGNVLG.E----------------
A5G015_ACICJ/9-360-----------------------RDLR.VD-----FFRGIALFCIFL-DHI.....PHDTLA.R----------------
B0U809_METS4/3-358-----------------------RDPNAID-----FWRGLALITIFI-NHI.....PGNVFE.S----------------
A6UE98_SINMW/23-375-----------------------RDTR.LD-----VFRALCLLTIFV-NHV.....PGQYLE.Y----------------
Q2K344_RHIEC/23-378-----------------------RDTR.LD-----VLRGLALIMIFI-NHV.....PGQIFE.Y----------------
Q2YRC8_BRUA2/6-358-----------------------RDTR.ID-----VFRALALLTIFI-NHV.....PGTIYE.H----------------
Q983D5_RHILO/37-389-----------------------RDTR.ID-----VLRALALIVIFI-DHV.....PGTAFE.A----------------
Q6G5Q7_BARHE/16-368-----------------------RDTR.ID-----VFRSLALLTIFI-NHI.....PGTLYE.S----------------
A1UR89_BARBK/16-368-----------------------RDTR.ID-----VVRSLALLTIFI-NHI.....PGTIYE.H----------------
Q0FH42_9RHOB/16-377-----------------------RDPR.ID-----AFRGLALLMIFV-DHV.....PGNPYE.Y----------------
A3VIJ0_9RHOB/5-370-----------------------RDSR.ID-----FFRGLLLWMIFV-DHV.....PGNPYEHW----------------
A3SZ27_9RHOB/26-392-----------------------RDPR.ID-----AFRGLALIMIII-DHM.....PGNPWE.H----------------
Q3J1N1_RHOS4/11-372-----------------------RDKR.LD-----FFRGLALVMIFI-NHV.....PGTVWE.N----------------
A3V5J7_9RHOB/13-374-----------------------RDPR.LD-----VFRGLALVMIFI-NHA.....PRNWLE.N----------------
Q11DW2_MESSB/11-364-----------------------RDHR.ID-----AFRGIALLMIFV-NHV.....PGNAFE.N----------------
Q0G5B4_9RHIZ/12-366-----------------------RDNR.ID-----FWRGVALIMIFV-NHV.....PGTFWE.S----------------
Q1YF78_MOBAS/13-366-----------------------RDYR.VD-----FWRGIALAMIFV-NHI.....PGNVWE.N----------------
A3X8H2_9RHOB/38-419-----------------------RDPR.LD-----FYRGIAMFIILV-AHI.....PGNRWT.G----------------
Q1GGF0_SILST/47-428-----------------------RDPR.LD-----FYRGIAMFIILC-AHI.....PGNRWT.G----------------
Q5LPG0_SILPO/35-409-----------------------RDLR.LD-----FFRGIAMFIILV-AHI.....PFNPWA.G----------------
A6DWM4_9RHOB/18-395-----------------------RDIR.LD-----FFRGIAMFIILC-AHT.....PSNFFT.S----------------
Q169P8_ROSDO/29-397-----------------------RDPR.LD-----FFRGIVMFIILI-AHT.....PGNWLT.L----------------
Q2PYB5_9BACT/21-406-----------------------RDPR.LD-----FYRGIAMLIIFT-SHT.....PGNFWG.D----------------
Q0BQN1_GRABC/63-424-----------------------RDLR.ID-----FFRGVSLFIILI-DHI.....RNNSFS.H----------------

PF01757

A8DMZ1_STALU/12-334-----------------------RKE--LI.....YLRAMLCIIIII.THTLT...QYMRGIDG----------------
Q035D4_LACC3/20-369-----------------------LYE--ID.....LMRLIFIAGVLL.NHTTT...AFQHQTSS----------------
A8G974_SERP5/5-314-----------------------INK--SN.....YLKGIAIILMLI.HHLFA...YPSRISPD----------------
Q11WN8_CYTH3/14-339-----------------------FYF--LE.....LMRTLAALYVVG.VHIHQ...IVDFGKIG----------------
A7LV98_BACOV/4-296-----------------------NLY--IDRDTSSVIKGVLIILIVI.GHNKV...LCSTDNKG----------------
Q97ER7_CLOAB/6-334-----------------------SLE--MD.....VIKGLGIIAIVI.GHTES...PLLR....----------------
OPGC_SHIF8/9-357-----------------------EYF--LD.....SIRAWLMLLGIP.FHISL...IYSSHTWH----------------
Q07PA2_RHOP5/14-375-----------------------LHA--LD.....AVRGFALLLGIV.YHAAVSFMPFAAGFWV----------------
Q30BE9_ENTFL/7-326-----------------------YSG--ID.....YFRFIAALLIVA.IHTSP...LSSFSETG----------------
A1HPJ5_9FIRM/6-350-----------------------VTA--IE.....YIRGISMLGVVG.IHTGA...YSLTNPEV----------------
Q4P0M9_USTMA/127-516-----------------------LDY--AD.....GLRGIAMIMVFN.GHFVDNTFVQTHPGTI----------------
A7LV97_BACOV/24-312-----------------------RHS--LN........YLAFFNSWT.GHGIS...GFVEDGVS----------------
Q1ZBT2_9GAMM/5-295-----------------------NEA--FD.....ALKGLLIVFVIL.GHVLL...GSISGNLG----------------
Q1QWT8_CHRSD/4-315-----------------------NVS--LD.....VLKLTLAVIVVI.SHAGV...LWGYSDLG----------------
Q2T7M4_BURTA/6-373-----------------------NLG--LE.....GLRGLACMAVMI.GHFSY...IFSPYLAS----------------
A4B9D7_9GAMM/5-375-----------------------IAG--LD.....GLRAIACLMVVA.HHVLP...RLPQNDSL----------------
Q5LBM3_BACFN/8-315-----------------------DIS--ID.....ILKCIAAIMITN.SHMDI...LYGDYSYL----------------
Q04X27_LEPBL/44-373-----------------------SKS--VD.....FIRGLAITGIVF.IHVNS...YYQYFGPG----------------
A5ZUV3_9FIRM/6-346-----------------------KIW--LD.....VVRATAILCVVL.CHSVE...AFYHPVLL----------------
A1VGB5_DESVV/30-339-----------------------IAY--ID.....ALKVIACFAVIN.LHCTS...PWVSNFLG----------------
B2JGA6_BURP8/53-400-----------------------VAA--LD.....AGRALAIVGVIL.VHLAL...FMPALPAW----------------
Q9XAP7_STRCO/24-348-----------------------DRY--FD.....TLRALALVRVVA.YHAFGWPWA.......----------------
Q07KV2_RHOP5/17-343-----------------------ENA--IQ.....WLRAIAAIEVVV.WHSDL...LTKHFAVA----------------
Q484G4_COLP3/18-372-----------------------LYF--LD.....WIRILAFAFLVF.YHSAL...MFVDWGFH----------------
A0DGZ8_PARTE/156-556-----------------------LAI--FN.....GVRAIAFMMVVY.GHSSL...LIIQATFQ----------------
A7A7L5_BIFAD/6-324-----------------------NSS--IE.....LLRIIAMFMILM.HHFIV...HNGYDVLK----------------
A3JPT3_9RHOB/10-350-----------------------MVW--LD.....ALRLIAGISMVG.LHGSTDANGQPFPDAS----------------
A5EMI0_BRASB/26-386-----------------------NAA--LD.....HARTFLTLVVLL.HHAVI...PYTYFGHT----------------
A4FKM9_SACEN/20-347-----------------------KIS--WD.....VVRAGCVMLVML.YHATF...LGVFLHPE----------------
A7V903_BACUN/5-297-----------------------VKE--ID.....YLKCIFITLMII.FHLVY...IGDKYPYA----------------
Q8IG66_CAEEL/330-720-----------------------VKL--VN.....LFRVCSSFWVIF.SHTCL...FSLHFTDT----------------
Q7UES3_RHOBA/12-486-----------------------RHD--LD.....ALRGIAMLLGIF.LHAAI...AYSPDAGR----------------
Q1WRZ8_LACS1/4-332-----------------------ITW--ID.....ISRAIGMLTIII.AHSLN...SYTGNYFS----------------
Q8PXP5_METMA/13-333-----------------------FYR--LN.....ILDGFAIVFIVI.FHALG...GLKTSDAI----------------
Q6AH04_LEIXX/3-320-----------------------ILG--VD.....LARGVALLAVFI.AHTAP...LTRDSPFP----------------
Q5CVD7_CRYPI/23-437-----------------------LHY--LD.....WLKTLAVWLVVF.VHVIYYLNLLNIGITR----------------
A0LT35_ACIC1/10-359-----------------------DPY--VD.....LVRAIAITLVVI.GHWLL...SNVTYHGR----------------
Q8KJJ2_RHILI/23-344-----------------------DLS--FD.....FAKGILITLVII.GHLLQ...YLIYQGTD----------------
Q17BV3_AEDAE/212-599-----------------------VGC--LS.....GLRALATIALFCALRLIP...MGFQPFTN----------------
A7F3R9_SCLS1/8-361-----------------------VKW--VD.....GLRGIASLLVVS.THIAR...AFDSDLFL----------------
Q144E0_BURXL/4-320-----------------------EER--IR.....GGQAVSIVAIVC.AEAIR...RVVDAGFL----------------
Q83YQ9_STRGN/5-307-----------------------NTT--LH.....AVKALACFSIVS.LHFLL...PGEFGVFY----------------
Q07P25_RHOP5/21-323-----------------------QVW--MD.....LARGIGVILVVY.GHVLG...GLVRADIF----------------
Q8DSB8_STRMU/14-327-----------------------NAG--ID.....FLRIFAMFMIVV.THVLG...KGGIRSTV----------------
A0LP70_SYNFM/14-366-----------------------LTW--PD.....MMKGISILWIVF.FHFFH...AYNNGRFP----------------
A8H1P8_SHEPA/43-369-----------------------LNS--IN.....HFRGIAIIFIVM.AHCYR...PAGWEIET----------------
A6E8A8_9SPHI/14-335-----------------------ILW--ID.....YAKFIAIFFVIF.AHQTL...SKSWFN..----------------
A5VFE0_SPHWW/65-420-----------------------YRD--VD.....MLRGYAALAVAL.YHFLL...AYVPPGRA----------------
A5LX53_STRPN/8-323-----------------------INW--ID.....FGKGFAIFSVLV.GHVLM...GLYESNIF----------------
Q8P802_XANCP/22-341-----------------------EWQ--ID.....VAKALAIILVAL.GHASG...MAPAYKL.----------------
Q2HGI8_CHAGB/115-578-----------------------TAY--LD.....GMRGLAALIVFF.CHFLYTSFAIAPGYGA----------------
A6BII1_9FIRM/11-365-----------------------FGY--ID.....LLETIAIICIVF.YHGAI...GNANILSG----------------
Q9CHP8_LACLA/4-320-----------------------NSS--ID.....LMKSCAIFFVIS.VHFLL...NSGFYDMT----------------
A5N097_CLOK5/9-357-----------------------RYD--LD.....WIRAIVVISIIF.YHVCD...MFILNNNI----------------
Q8FTN8_COREF/16-398-----------------------LPS--LT.....GARWLAAVAVFV.LHALV...FLNVYPFQ----------------
Q6G5Q7_BARHE/17-365-----------------------DTR--ID.....VFRSLALLTIFI.NHIPG...TLYESLTH----------------
A3H030_VIBCL/4-356-----------------------IPA--LD.....SIRGLLLVLITF.NHLIW...YSGGTTIL----------------
A7AZT9_RUMGN/12-318-----------------------WYN--FT..........LCILVVC.IHAQN...MHIFIEPV----------------
Q2NRT0_SODGM/9-399-----------------------FIG--LE.....WLRFLLGCYVMI.YHTAH...HYPQFKAV----------------
A4CKW1_ROBBH/7-342-----------------------LYF--ID.....AMRAWAILMMLQ.GHFID...GLLDPLFR----------------
A6FAM6_9GAMM/8-349-----------------------KVD--SN.....ILKGLGILMIAI..HNFM...HRFPTPSE----------------
A7V2Z2_BACUN/14-354-----------------------YEI--LD.....GLRGVAAVMVII.FHLFE...AHAGGSHL----------------
Q00XL5_OSTTA/15-388-----------------------LPA--LD.....SIRFFLIAYIGV.GHFIA...CATKNSLA----------------
A4YYF7_BRASO/15-345-----------------------LLG--LE.....LLRFLATISVLL.WHYPHFAYVADTPVGL----------------
Q1D0W9_MYXXD/39-356-----------------------HPG--LD.....CARGLAVMAMVI.GHTLD...AVLSPVVR----------------
Q16PV5_AEDAE/243-647-----------------------FAF--VE.....SVRVISVFFITA.VHVLM...AFGASPME----------------
Q82ET0_STRAW/57-398-----------------------DRA--VD.....TLRAFAILGVVL.GHWLV...TALVADGG----------------
Q4JZS0_STRPN/5-327-----------------------YDN--LD.....GLRVISCLGIIA.MHIKA...NADYQIYG----------------
Q931U6_STAAM/8-314-----------------------DYF--FD.....NARAILILLVVF.GHMLQ...PYTSGDKY----------------
Q7MGC8_VIBVY/15-336-----------------------IAS--LE.....LGRIIAMLAIIG.LHCQM...ALTYWQID----------------
A6KZK8_BACV8/9-367-----------------------IGW--ID.....LLRVTACFLVVF.AHCCD...PFVARFDT----------------
A4CUQ6_SYNPV/6-368-----------------------LLY--LD.....QIKAVIVGLVIA.LHVPV...AFFPTGWS----------------
Q5PLM9_SALPA/5-319-----------------------INW--ID.....NLRGIACLMVVM.IHTTT...WYITNAHS----------------
A6P1P2_9FIRM/9-341-----------------------LAY--AD.....LLRVLSIAAVVV.IHVVS...LWIYDVPV----------------
A5FYP6_ACICJ/4-317-----------------------RAD--ID.....RAKGLAISLVVF.GHIVA...RQDPAHVL----------------
Q7MQA5_VIBVY/5-328-----------------------VQF--FD.....LLRCVAAVAVIA.IHVLA...PYRHELGV----------------
Q5X6W8_LEGPA/10-336-----------------------RKD--ID.....ALRGVAVLLVIF.DHLHI...NLV.....----------------
A7V3H1_BACUN/5-305-----------------------IEW--ID.....LCKIITMIIVCY.DHTIQ...SIAPDEAL----------------
Q64YD4_BACFR/4-349-----------------------IVF--LD.....YVRVFACFLVMI.VHSSE...NFYGAAGS----------------
A2SCM7_METPP/5-359-----------------------LWE--ID.....ALRGLMLVLMTL.THLPT...RYADPLGQ----------------
A7ZZ73_ECOHS/5-329-----------------------ELW--IN.....QIKGLCICLVVI.YHSVI...TFYPHLTT----------------
A5UMZ7_METS3/7-344-----------------------IRY--VD.....QLRAVSILFLIA.INVAM...VFKYKSVG----------------
A3YY52_9SYNE/16-323-----------------------NQA--ID.....LMRATCILWIVGFWHLLG...YAESIDGY----------------
A4AIT9_9ACTN/563-845-----------------------IEV--PI.....VLRAVAIVLIVA.THSDF...........----------------
A5N224_CLOK5/8-329-----------------------VLE--MD.....VIRAASIVAVIV.LHVSA...TVLYRCRP----------------
E0TI88_PARBH/15-315-----------------------EEG--VD.....AGRLLAAIGVIA.IHVGA...YDELPYGA----------------
A3L950_PSEAI/5-324-----------------------WIQ--MD.....VTRGVGILIIVF.GHSWF...VASSPTVL----------------
A0E2L0_PARTE/17-375-----------------------MFS--LN.....LLKILAMLSISM.SHYGI...LIGQNDRQ----------------
Q8A5U1_BACTN/9-318-----------------------IDF--VD.....LTKGVCIILVVM.AHIGG...AFDQLDKH----------------
Q2C1R6_9GAMM/10-345-----------------------YDY--LD.....NIKWVLTILVIL.HHCAS...TAGLDPIG----------------
A7A7B8_BIFAD/5-363-----------------------VVG--YD.....IIKSMAMFFVVM.LHYSFYTRFYSSGLAG----------------
Q4JYU7_STRPN/6-318-----------------------NIN--LD.....LLKVLACVGVVL.LHTTM...GGFKETGS----------------
A9VR59_BACWK/5-346-----------------------APE--FK.....VLQSIAFLAVVLQSSLLY...TMNQGNVL----------------
A7VGI1_9CLOT/6-345-----------------------NGA--LD.....FWKFVFCLVILV.FHVGE...VYGGKHGY----------------
Q1QR03_NITHX/14-320-----------------------VDW--VD.....YAKGICIIMVVM.MHSVQ...GVEKAVGQ----------------
A5ZDF6_9BACE/13-326-----------------------IAW--LD.....NVKMFAMLCVIL.GHVMT...IVIKTNVD----------------
Q16FE1_AEDAE/161-554-----------------------FQY--IE.....GVRVLTCLTIVF.MHTRY...EPLMLPTS----------------
Q7CTZ0_AGRT5/8-329-----------------------SSR--IN.....LMRILLISGIVF.VHVPH...DAETSPFL----------------
Q8G7P7_BIFLO/17-373-----------------------DVN--YD.....LLRVVAMCLVIG.VHVIN...NYMPVKMT----------------
A1R1G8_ARTAT/18-357-----------------------DPA--ID.....LVRFICLLLVVA.AHCMM...VSPVLQKD----------------
A1VHZ4_DESVV/11-319-----------------------NDT--VQ.....ALKQLFLLVICY.GHIFA...EGPAATLP----------------
A0QPG5_MYCS2/9-326-----------------------NNA--LN.....ALRLLLAVGVIL.WHSWP...LSGHGVTY----------------
A5EXU9_DICNV/19-351-----------------------QYE--ID.....IARGFAIIFMVW.VHVME...EMDSFGST----------------
A6LGX6_PARD8/9-311-----------------------YGA--LD.....AMRILAAFSVVC.IHYQI...VPGSMISR----------------
Q11WP3_CYTH3/4-324-----------------------RIG--PG.....YFRYFLCIVVVL.FHSTN...YI......----------------
A0K1D5_ARTS2/296-671-----------------------DSR--VD.....LMRGLAILFVVV.NHVGM...TSLFQLFT----------------
A6KYR5_BACV8/6-309-----------------------HSG--LE.....CLRIISIILIVS.MHILG...NTFHTSNW----------------
Q0CZ95_ASPTN/77-482-----------------------TAY--LD.....GLRGFAALLVYWAHHQLW...AHDGVGVG----------------
A0T1U4_VIBCL/8-303-----------------------NFK--ID.....LLRSVGLLLIIL.AHVLPPEIIF......----------------
A3I592_9BACI/6-352-----------------------IDE--LN.....ITRALAILAVLL.IHSTS...TPVTALSI----------------
A1TDU0_MYCVP/22-361-----------------------DRA--ID.....VIRIVALVGVVV.GHTVM...ATSIIRDD----------------

PF07786

A1HQT7_9FIRM/5-214-----------------------RIWE-ID-----ALRGLAIVLMVV-FHLVV---DLKDFYGA----------------
A2SQB7_METLZ/5-231-----------------------RYFE-LD-----AARGIALILMIL-YHILF---CLYFFGTG----------------
A9CIY2_AGRT5/15-234-----------------------RIGG-LD-----TLRGLALLAMAS-YHFTW---NLEYFGYL----------------
Q28R74_JANSC/28-249-----------------------RIPA-LD-----IARTGALAAMVL-FHFVF---DLEMFGHV----------------
Q8PXM0_METMA/7-237-----------------------RFWE-ID-----CLRGLAIILMLA-YHFLY---DLDFFGLA----------------
A4EC93_9ACTN/4-221-----------------------RITI-FD-----TVRGFTMISMAG-FHACY---DLAYLYDW----------------
Q8U2K3_PYRFU/23-240-----------------------RFWE-ID-----FARGIALTMMLI-SNFVT---DLQFFLGY----------------
A7I8Y9_METB6/6-231-----------------------RYPE-ID-----LLRGIALLMMIL-FHTLF---DLAFFRIA----------------
A6G0Y4_9DELT/12-237-----------------------RVEI-ID-----IGRGVAVVLMIM-VHTMW---LYADVETQ----------------
A3CVR7_METMJ/5-231-----------------------RYWE-ID-----LARGVAVVTMIV-FHSAF---DLNFFGVL----------------
Q11IW8_MESSB/30-251-----------------------RIEL-ID-----IARGVALVAMAI-YHFTW---DLDFFGYV----------------
A1TRD1_ACIAC/21-249-----------------------RADS-VD-----ALRGVAMVWMTI-FHFCF---DLSHFGYW----------------
A2SGN2_METPP/12-230-----------------------RHAR-LD-----ALRGLAIVWMAV-FHFCF---DLAHFRLI----------------
A2STU6_METLZ/14-241-----------------------RYWE-ID-----AIRGFSLLAMIA-FHTVF---LLGVFHII----------------
Q2K839_RHIEC/16-243-----------------------RIGL-LD-----TARGIALIAMAS-YHFTW---DMEFMGYL----------------
Q251W2_DESHY/5-221-----------------------RFPI-ID-----SLRTLALALMIT-YHLIY---DLDQWTGL----------------
A0NYA1_9RHOB/5-227-----------------------RLAV-LD-----LARGLAVVAMAI-YHFSW---DLSWFAYV----------------
Q21VS3_RHOFD/16-244-----------------------RFDA-VD-----ALRGLAMVWMTF-FHFSF---DLNQFGYI----------------
Q0FKK0_9RHOB/7-221-----------------------RVGW-ID-----LARVAALAGMVV-FHFAR---DLEIFGLV----------------
Q2YRW9_BRUA2/16-233-----------------------RLGR-ID-----IAHGIALIAMAI-YHFGW---DLEFFGYM----------------
A2STU5_METLZ/19-252-----------------------RYWE-ID-----AVRGLALFGMLY-FHFLA---CLVMFHIL----------------
Q6SHI3_9BACT/5-214-----------------------RDSA-LD-----LMRGLAIIMMIA-FHFIY---DLNSFGFT----------------
Q0G6B2_9RHIZ/53-275-----------------------RIDT-ID-----VARAIALIAMAI-YHFAW---DLDNFGYV----------------
A3YBL4_9GAMM/14-227-----------------------RSSS-LD-----LYRGLAVLLMII-FHLCW---DLREFDYI----------------
A4FZP9_METM5/5-227-----------------------RYLE-ID-----FFRGIAIILMVI-SNFVT---DLKYFLGY----------------
Q11N89_MESSB/6-227-----------------------RVVA-ID-----VARGLAIAGVVL-FHIVW---DLEFTGII----------------
A4J1M2_DESRM/9-218-----------------------RLWE-LD-----FLRGVAILLMVF-FHLMY---DLHEFYNL----------------
Q6SGH9_9BACT/9-218-----------------------RDQA-LD-----LMRGIAIIMMIM-FHLIY---DLNEFGYT----------------
A1VNB1_POLNA/5-231-----------------------RFDS-LD-----ALRGIAIVWMTA-YHFCF---DLNHFGYL----------------
A3DGD5_CLOTH/11-220-----------------------RIWE-ID-----VLRGILVIIMVV-LHILF---DLEFVYNI----------------
Q98KU6_RHILO/16-237-----------------------RIIA-ID-----IVRGIALLAMAS-YHFTW---DLEFFGYT----------------
A6VZM7_MARMS/12-224-----------------------RSAF-LD-----VYRGSAVLLMII-FHFCW---DLLNFGFL----------------
A1W6I8_ACISJ/12-240-----------------------RHDR-LD-----ALRGFAMVWMTA-FHFCF---DLSHFGYW----------------
Q6M0I2_METMP/11-233-----------------------RFLE-ID-----FFRGLAIIMMVI-SNFVT---DLKYFLGY----------------
O26882_METTH/9-227-----------------------RFGE-VD-----ALRGAAVLMMIV-YHTLF---DLDFLGVL----------------
Q92KE6_RHIME/23-246-----------------------RMVL-LD-----ALRGLALVAMAL-YHFVW---DLEFFGYV----------------
B1ZHM9_METPB/15-237-----------------------RIDA-LD-----LARGAALAAMAT-YHGLW---DLGFLQLT----------------
Q2Y4H0_9ARCH/17-243-----------------------RFWE-ID-----FLRGIAIIMMIT-FHLLY---DVNYFGGY----------------
O29726_ARCFU/2-207-----------------------RYPE-ID-----IARGAAVILMLL-FHSFF---DAHYFGKI----------------
Q12ZG6_METBU/7-234-----------------------RKWE-ID-----LLRGIAITLMVF-FHLLY---DLYYFGYY----------------
A4BIP8_9GAMM/6-220-----------------------RLIL-ID-----QFRGIAVILMAI-FHFCY---DLSVFGFL----------------
Q8THP4_METAC/31-261-----------------------RYWE-ID-----CLRGFAVILMLG-YHFLY---DLDFFGLS----------------
Q46DC7_METBF/7-237-----------------------RFWE-ID-----CLRGLAVLLMLL-YHFLY---DLDFFKLA----------------
Q2FN30_METHJ/7-229-----------------------RYPQ-LD-----ACRGIAVLMMIW-FHFFV---DLAFLGLP----------------
Q1YI63_MOBAS/15-237-----------------------RIDI-ID-----IARAVALFAMVI-YHFTW---DLEFFNYV----------------
Q1B004_RUBXD/18-243-----------------------RYWD-VD-----AARGVAMGMVVL-YHLVF---DLDNFGGY----------------
A6FRV3_9RHOB/4-228-----------------------RIMV-LD-----ALRAIALIGMVV-FHFVF---DLELFGLL----------------
Q1YJ44_MOBAS/24-246-----------------------RYVF-VD-----VWRGLAIIGVVI-YHFGW---DLSFFGYV----------------
Q26I67_FLABB/5-236-----------------------RLFF-ID-----AVRAFAIIMMLQ-GHFID---TLLAPEYR----------------

PF05857

Q8KNJ7_SALTI/21-241-----------------------LQ---RD-----VIRMIAFMAMVG-DHIA...TAFQLDMPF................
A7LWV3_BACOV/16-233-----------------------LS---GS-----ALKVIAVLSMVV-DHSA...YYLLEDGTLLY............ET
Q84A20_ECOLX/31-248-----------------------GQ---RD-----IIKTVALVLMVL-DHAN...RILHLDQSW................
A6TIJ3_KLEP7/24-240-----------------------GQ---TD-----MIKTVALVLMVT-DHTG...LLLAGNNEV................
A5Z378_9FIRM/20-251-----------------------IS---TF-----TLKIIAMITMII-DHVG...FLFFQDNHQTY............II
A5KIL9_9FIRM/5-244-----------------------IS---GS-----TLKILAMIFMVI-DHFG...QVVLKNGIILHAPYSMFTDEQFDML
Q5NWL3_AROAE/9-222-----------------------GS---LE-----ALKWIALLLMTG-DHVN..KYLFNATLPV................
Q88AH9_PSESM/14-243-----------------------KA---LD-----LLKWLAMLSMVL-DHLR....YVGWSIDF................
Q1H9V9_9ZZZZ/19-235-----------------------GS---IE-----SLKWLALLLMTG-DHVN..KYLFNGTLPY................
A3JHE7_9ALTE/11-236-----------------------SW---LT-----LLKWVAIASMTL-DHCN..RFLLSEAGAI................
A8F272_RICM5/12-244-----------------------NY---QD-----WLKALAIIAMII-DHVG...LYLYPELTI................
A4WGU9_ENT38/21-253-----------------------AA---LD-----MVKVLALLAMLG-DHIN..TLFLTPPEPL................
A7VEF3_9CLOT/9-245-----------------------IT---SN-----QLKLLACIFMLC-DHVG...FVLMNNNWI................
A6M0I9_CLOB8/13-266-----------------------FS---GF-----SLKIIALVLMTM-DHMH..EFLASTGIPI...............W
A4NTD4_HAEIF/7-239-----------------------SQ---TE-----CLKWLALITMII-DHIGVAFSNAYPALSW................
C1DKH3_AZOVD/14-243-----------------------AA---LD-----LLKWLAFASMLL-DHLR....LVWPQRIW................
Q0VUV5_9ZZZZ/9-222-----------------------GS---LE-----LLKWLALVLMTG-DHVN..KYLFNGTIDW................
A7VF03_9CLOT/8-229-----------------------LS---GA-----QLKYIAFASMLI-DHVNKTFFIYFNSKAL................
A4XUI8_PSEMY/4-231-----------------------TS---LD-----LVKWLAMLTMVI-DHLR...YLWPEATAW................
Q0B109_BURCM/9-222-----------------------GT---VE-----ALKWLALVLMTG-DHVN..KYLFNATLPV................
A4XH28_CALS8/24-230-----------------------SK---SN-----LLKLIAAASMLI-DHIG...YLYFPNRVL................
Q5ZHG7_9BACT/23-233-----------------------GT---IE-----ALKWLALLAMTG-DHVN..KYLFNGTLPY................
Q4UUW2_XANC8/4-213-----------------------GG---RE-----LVKWLALLFMTG-DHTL..KILHLGYVPV................
FIMCH_DICNO/7-241-----------------------FS---AF-----QLKVIAIIAMSL-DHSA...LLFLSDGSWRY............EC
A5TTI6_FUSNP/5-248-----------------------IN---SF-----TLHILAMIFMVS-DHLW...NIFFPNQVW................
Q65AG0_YERPE/74-291-----------------------GQ---TD-----LIKTVALLLMVA-DHIS...MLCGLDNDW................
Q2P3I2_XANOM/4-206-----------------------SG---RE-----ALKWIALVLMTG-DHVA..KVLFGGYVPV................

PF04235

YXAH_BACSU/242-392-----------------------------------AAKSRYLH.EPE-KHRKG---LKRLWMAG----------------
A3IC17_9BACI/222-377-----------------------------------ASKWRLVE.RAK-KLKWL---WLALAITG----------------
A5VFY1_SPHWW/226-385-----------------------------------LYRIGLFD.SRF-EERRL---WQMVRIG.----------------
A9VP60_BACWK/224-378-----------------------------------VGKKGWLF.EVD-QHIPA---VKKIWLIT----------------
A7AFV0_9PORP/228-389-----------------------------------IGRKELFV.TSE-THLRF---WVKVLIIA----------------
B0T5F0_CAUSK/216-381-----------------------------------LGRSGFFE.TPQ-RYVTA---RRLVLAAS----------------
Q5LBX3_BACFN/231-393-----------------------------------IGRKQLFV.ASE-ATIRF---WVKALIWS----------------
A8FJB9_BACP2/218-375-----------------------------------MMRAGVFY.ANE-RGQSL---RKRLFRVG----------------
Q4MVH1_BACCE/182-334-----------------------------------IFTGIMFV....-.....---........----------------
A7GNB8_BACCN/217-376-----------------------------------AGKKDIFR.QAK-ELDSK---LKKWQIIM----------------
A8M3I5_SALAI/225-391-----------------------------------AGRKSVLT.WGP-ERKRV---LGLVAFTG----------------
A6CU81_9BACI/142-303-----------------------------------AGKAGIFK.PDT-EHLGF---IHKIRNIT----------------
Q3R094_XYLFA/261-419-----------------------------------FVRSGAIL.QPE-RYTRL---FAWLRWGA----------------
Q8ZNL6_SALTY/215-375-----------------------------------LMRSGWLK..GQ-YSLRH---YRRTGALL----------------
Q31YW0_SHIBS/215-375-----------------------------------LMRSGWLK..GQ-FSLRH---YRRTGFVL----------------
A5ZJ36_9BACE/227-388-----------------------------------IGRKQLFV.TTE-SHLKF---WVKALIIA----------------
Q5Z0S5_NOCFA/200-354-----------------------------------AAQRYRLLERAV-ERPAW---LVAVFLLA----------------
A3IA01_9BACI/163-335-----------------------------------AGQYRLFE.NIP-LHRKK---ILLATIVM----------------
Q5LAR8_BACFN/229-391-----------------------------------VGRKGLFL.YSE-QNEQH---WLKALGIS----------------
A5FKP1_FLAJ1/222-380-----------------------------------LQKIDFFD.RLN-EMKKR---LLYVLVIS----------------
Q1CGS9_YERPN/216-376-----------------------------------LMRCGWLR..GK-FSLRH---YRRLALFL----------------
Q08VU8_STIAD/181-346-----------------------------------WVGRRLLP.DPL-AHRML---LIRVLKGG----------------
A6LH60_PARD8/231-393-----------------------------------IGRRKLFI.SSE-ENSRF---WIKTLIIT----------------
Q2NUE2_SODGM/217-377-----------------------------------LMRNGWLA..GR-REPEH---YRRMALWL----------------
Q4UWH0_XANC8/244-402-----------------------------------FVRSGAIA.APE-RFVRL---FGWLRYGV----------------
Q5L251_GEOKA/223-378-----------------------------------AADQRWLE.ADR-HSPAK---LRRLMRWA----------------
B9LP38_HALLT/238-398-----------------------------------LYRWGVLT..GE-RSSAL---YRRLVALG----------------
A5CQC9_CLAM3/228-397-----------------------------------LGRRRVLE.DPA-AHLPL---LRGLALVG----------------
Q2BCM0_9BACI/228-382-----------------------------------AARRRAFH.EIG-RNKSR---YLLWGGIL----------------
Q5WBU3_BACSK/218-382-----------------------------------AGRKGLLN.ESP-KNKPF---LKKAAVYG----------------
Q5LDG8_BACFN/245-405-----------------------------------IGRKQIYA.DLE-ANRVL---LKKTVTYG----------------
B1KH41_SHEWM/231-384-----------------------------------LYRKGIFQ.QGF-SKRHL---IWFALASI----------------
A4EHF6_9RHOB/229-382-----------------------------------AVKSGMID...N-AAHPL---WRRARRVC----------------
Q2N5U1_ERYLH/237-397-----------------------------------LWRNGLFK..GE-WRTFR---LQRLAAIC----------------
Q1D273_MYXXD/254-423-----------------------------------AGRLLLLQ.DVE-RHRAL---LRRILGWG----------------
A1RM83_SHESW/239-392-----------------------------------LYQQGTFE.RGF-SKSVL---VKLVLASV----------------
A3V2Y2_9RHOB/212-368-----------------------------------AYKSGFFDAGSP-AFCVL---ARRLPLL.----------------
Q0RI89_FRAAA/226-396-----------------------------------AARRRILE.DPA-AHRPL---LRRVACAG----------------
A0RC19_BACAH/265-424-----------------------------------AGKKDIFR.RTK-ELDPK---LKKWQIIM----------------
Q1GR12_SPHAL/244-406-----------------------------------LFKSHMLT..GE-WEAAR---YRKWAIAC----------------
A3HTP0_9BACT/227-391-----------------------------------FGKNQYHK.DLK-SLVKL---IKKPVIIT----------------
Q0C162_HYPNA/232-392-----------------------------------AVKAGVID.QPK-ARIWV---LSRWVF..----------------
Q01SV0_SOLUE/222-364-----------------------------------AWRSGLLR.KPE-DHRGA---LATLLIAG----------------
Q9X356_BACAN/222-381-----------------------------------AGKKNIFK.RIP-GLIKK---IRFLQWSS----------------
Q6HBG3_BACHK/154-304-----------------------------------AAKKNVFV.CLE-QELVW---YKRGLIL.----------------
A6F241_9ALTE/221-382-----------------------------------AARLHLAE.RNS-GHVRL---LVAVALVG----------------
A7AF04_9PORP/59-221-----------------------------------VGRIRLFE.RMD-EFRGR---LNRWALLA----------------
A7M2T0_BACOV/229-391-----------------------------------VGRRKYFL.YSE-QNERL---WLKALAIS----------------
Q2B965_9BACI/232-387-----------------------------------AAKLKLLE.KLA-NFQKR---AAIMFAVF----------------
A3WAG6_9SPHN/263-424-----------------------------------LYRLGFFS..GA-FNRSK---MVMWGWIG----------------
Q0HGE7_SHESM/244-397-----------------------------------LYRQGSFE.QGF-ERNTL---IKLVLASL----------------
A8FH56_BACP2/222-385-----------------------------------FVKMAFFK.NME-AKKTI---WNRIWLI.----------------
Q5WCD3_BACSK/239-403-----------------------------------MGKAGMFH.DVK-ANVTR---WKRLCWIG----------------
A4GA59_HERAR/238-403-----------------------------------SVRLGWLT.QPA-RHITF---WRRVQWTG----------------
YRKO_BACSU/224-387-----------------------------------FVKMEFFK.DME-AKKPI---WKRIWII.----------------
Q7WHI1_BORBR/228-389-----------------------------------LGRRHALA.DPQ-AHPRL---LRAVLAVG----------------
Q47SA7_THEFY/269-436-----------------------------------AARRRILE.EPG-NHLRL---LRITAAVG----------------
Q2P0R0_XANOM/244-402-----------------------------------FVRSGAIA.TPE-RFPRL---FATMRYAV----------------
Q21P05_SACD2/237-402-----------------------------------FGRFGFFH.TIS-QHKRT---LKRSLGYA----------------
A4FQ93_SACEN/204-361-----------------------------------LMRAGVFG.DDQ-RGRRL---RARLMAIG----------------
A3WF33_9SPHN/238-398-----------------------------------LWKDRMLR..AE-WRTFR---LQRLAAIC----------------
Q3IC82_PSEHT/208-361-----------------------------------LYKQQVFA.SGL-SAKQL---ILVISSAL----------------
Q2NDD6_ERYLH/264-425-----------------------------------LYQFGFFS..GG-LDPGK---MKRWGWIG----------------
A3XLE1_LEEBM/228-392-----------------------------------LGKNKLVY.DLK-SFILK---LKKPALLI----------------
Q9HNH9_HALSA/232-393-----------------------------------LFHTGVTT..ND-RSRAF---YRRLVAVG----------------
A4YYJ4_BRASO/266-405-----------------------------------IWRFRVLR....-.DTPY---HRIVLLLT----------------
A3I7E6_9BACI/220-373-----------------------------------FMRNEVFS.PTN-KGHQA---RQKLFTIG----------------
A4IKX9_GEOTN/224-379-----------------------------------AAKEHWLE.AGR-YPTAA---LRRLMSGA----------------
Q9KFW4_BACHD/1-165-----------------------------------MARKHLLT.EAH-LHRKQ---LRRMAVVG----------------
Q4A0U4_STAS1/90-261-----------------------------------SAQFGMIF.KFN-RYKIW---SVVALISG----------------
Q8ERW4_OCEIH/226-381-----------------------------------AARKKWFH.HPE-KYQQK---LTVIWFIS----------------
Q7N6K6_PHOLL/210-370-----------------------------------LMRNGWLK..GE-FSVSH---YRNVALVL----------------
A4ARZ9_MARSH/230-396-----------------------------------AGRIGFFK.TLN-EHKTL---LKKILIGS----------------
B1YLL9_EXIS2/215-367-----------------------------------LMERFTVR...P-PATRT---IRLVFGAS----------------
A6L2L4_BACV8/234-394-----------------------------------IGRKGLFL...K-EHLKV---WNKVLASS----------------
A1WTH2_HALHL/248-410-----------------------------------AYKNGFLT..GA-WSSRA---YARVVGYG----------------
A3UFR8_9RHOB/215-377-----------------------------------AAKLDMLDPQAT-RWRLR---CAIALPAL----------------
A6CPZ4_9BACI/231-386-----------------------------------AGKLHILE.RIP-DNKKF---WITLLVIL----------------
A1S3E3_SHEAM/216-369-----------------------------------LYRSHFFN.EGL-TDAAR---IRLLLLAL----------------
Q094W5_STIAD/188-355-----------------------------------AGRHRLLQ.EPE-RHQPL---LRRLLGWG----------------
Q9AA92_CAUCR/270-432-----------------------------------LFKTGFLT..GK-AKTWV---YLLLIALG----------------
Q0ARL9_MARMM/225-387-----------------------------------LFKSGFLS..AS-WGSVR---YGILALIT----------------
Q07YN3_SHEFN/228-381-----------------------------------LYKRNIFV.DGL-DNKTL---WQCVFWAI----------------
A0XYG1_9GAMM/200-353-----------------------------------AYKEGIFN.KGL-SNQQL---WVCGLGVL----------------
Q1NBB8_9SPHN/227-389-----------------------------------MLKSGFLT..GR-WDAEQ---YRRTARHC----------------
A8F9F5_BACP2/224-375-----------------------------------IGKKGHLT..EE-DRGMA---YRRGWVWM----------------
A7AGL6_9PORP/228-390-----------------------------------MGRRQLFA.NLS-EHRVF---WMRTLVIG----------------
A6L9Q0_PARD8/227-389-----------------------------------LGRKGLFV.DPE-KHRTF---WTRTFVIG----------------
B0T422_CAUSK/230-391-----------------------------------LYKLGVLT..GK-ASTGL---YQGLIGAG----------------
A6WB03_KINRD/147-299-----------------------------------LVRCGAIA.RLE-SSPRA---VAVLLALS----------------
Q64ZH4_BACFR/244-394-----------------------------------MVKYSRLF....-..LPY---CLAFWAVF----------------
Q49WA7_STAS1/224-378-----------------------------------AYKMNLIELIRT-KSSSF---LKWGSLI.----------------
A6T3W0_JANMA/238-403-----------------------------------AVRCGWLT.QPW-RHTTL---WRRVRLIG----------------
Q47R13_THEFY/238-395-----------------------------------LLRAGAFH.PDV-SGRRL---RVRLACWG----------------
A8MJB9_ALKOO/219-378-----------------------------------VGKKDVFS.RIE-ELAGI---LRKMQIVS----------------
A3UE46_9RHOB/225-387-----------------------------------LFKLGFLL..GR-WSVRN---YVIAAAIG----------------
A6TNH6_ALKMQ/249-412-----------------------------------CGKLNIFN.KLD-ESDTF---IKKGWKIT----------------
Q1D7M3_MYXXD/255-425-----------------------------------AGRRGIFQ.DVP-SHLGF---FRRLLGWG----------------
Q6NJJ5_CORDI/212-362-----------------------------------WARRGVLA.DVH-QHRTE---LYIWSGIA----------------
A3ID96_9BACI/222-373-----------------------------------LAKKQAFT.KMD-EEVKW---YKLGALL.----------------
A5UQH7_ROSS1/237-401-----------------------------------FGKRQIFQ.RLN-EKPAS---ERRLPAGS----------------
A7MLK3_CROS8/215-375-----------------------------------LMRSGWLR..GE-FSLRH---YRRTGFGL----------------
Q9KE13_BACHD/42-195-----------------------------------VHRKGWIA.NAA-EHKAI---FKRMLWIG----------------
A8GC25_SERP5/223-383-----------------------------------LMRSGWLR..GT-YSPGY---YRRQAAWL----------------
Q8A424_BACTN/229-391-----------------------------------IGRSNAFL.YSE-KNIKI---WIKVFIIA----------------
Q9KFA2_BACHD/226-379-----------------------------------FMRAGAFS.PDQ-HGKRI---RRKLLAVG----------------
B4SQY9_STRM5/245-403-----------------------------------FAGSGALA.APE-RFPRL---YAVLRWIA----------------
Q9KEU3_BACHD/250-400-----------------------------------FAKARILH.DPD-KHQRI---HRILWIIG----------------
A4FQT6_SACEN/171-324-----------------------------------AVRCGLVE.TLD-HRTRQ---LGVVFGIS----------------
A6TBN7_KLEP7/215-375-----------------------------------LMRSGWLK..GQ-FSLRH---YRRTGALL----------------
A4QGF8_CORGB/53-205-----------------------------------LVRYGVVD.RAE-NAPRA---MGVFFAVS----------------
A3UEP5_9RHOB/214-372-----------------------------------LMRSGALN....-LSGET---LRRVVLVS----------------
Q4KHM8_PSEF5/226-387-----------------------------------AGRNKLLV.APY-AFEPH---LARLLRIS----------------
A4F774_SACEN/171-329-----------------------------------LVTGFALA..QL-GLPNA---LDRLGPH.----------------
A0Z0S4_9GAMM/214-384-----------------------------------FAREGGLQWFTQ-RPERV---FNTGRWMF----------------
Q9K7D7_BACHD/224-377-----------------------------------AAKRKWFV.HPA-QEQGR---YRKGLLF.----------------
A3I5J9_9BACI/189-342-----------------------------------VAKAGWVG.HIG-AHIQQ---IKWLLLVT----------------
A6KYE7_BACV8/229-390-----------------------------------IGRKQLFV.TSE-KHTRF---WVKALIIS----------------
Q2G3S1_NOVAD/241-402-----------------------------------LLRSGFFT...T-WPKRS---LGWIAAIG----------------
A7NS93_ROSCS/241-405-----------------------------------AGKRQVLQ.RLM-QLPAN---ERRLPAGR----------------
A4WCI7_ENT38/215-375-----------------------------------LMRSGWLK..GE-FSLRH---YRLTGSGL----------------
Q1IVW5_DEIGD/222-381-----------------------------------AQRFGLLT.RPQ-AHLPL---LRRLAVWG----------------
A4AN58_MARSH/230-392-----------------------------------LGKKKLFV.DSE-KSNKF---WKRTLIIG----------------
Q8EH35_SHEON/233-386-----------------------------------LYRQGIFE.QGF-NRNTL---LKLALASL----------------
A5PD45_9SPHN/224-385-----------------------------------LYRFGIFS..GR-LDQRR---QRLWGWAG----------------
Q9RS74_DEIRA/223-382-----------------------------------AARAEVLT.RPE-RFGWL---FRRLTVFA----------------
A3HYS5_9BACT/265-426-----------------------------------LFRWGFLT..GE-KPASQ---YWLMVLIG----------------
Q6D3N4_ERWCT/227-387-----------------------------------LMRSGWLK..GE-FSTAH---YRNVALWL----------------
A5FKP0_FLAJ1/222-380-----------------------------------LQKLNFFN.RLI-ELKKL---LQYVCIIS----------------
A6LGL5_PARD8/234-396-----------------------------------VGRIRLFQ.RMD-EFRSR---LNYGALVA----------------
Q3IPY1_NATPD/256-418-----------------------------------LYKYGIIS..NR-RASRF---YRRLLVAG----------------
Q4LA20_STAHJ/233-386-----------------------------------LSRCGWFEKDAK-HFWTS---KLFIYLIP----------------
Q5YUW9_NOCFA/233-388-----------------------------------LFRAGVFR.PEG-..ARI---RKRLMLLG----------------
YAMY_BACAD/182-335-----------------------------------IFTFFMFI....-.....---........----------------
B9LDU3_CHLSY/241-405-----------------------------------VGKRRLVQ.HLY-EQPAV---QRRLPFGG----------------
Q9K6N5_BACHD/237-398-----------------------------------VAKTERYR.NLQ-QQKPF---LKKVWLTS----------------
Q8EL60_OCEIH/225-388-----------------------------------LAKKQLLT.KPE-LHLQS---LKLLSVVG----------------
A4BFW6_9GAMM/238-400-----------------------------------LYREGLFS.GQL-TNRQL---TQRTTVF.----------------

PF07779

CAS1_CRYNJ/373-830DVMRHE..........GATGTCCKRYDWVT-----PIQGLILAVLIL-WAPLGTF......ITP----------------
Q6CDI8_YARLI/295-780QELLDHKYDITNGPVYPFSDTCCIHYKQPR-----TMGQVLLLGVIC-AILPIIYLGQR.YTRS----------------
A8N197_COPC7/296-746DVLPKK.........FPFNKTCCNSYPWPN-----YVHSFLLFAIIV-SAPLI.....C..YLT----------------
E9GCH2_DAPPU/311-808ERMDF............NDGTCCRSPESAT-----TLQIVTFTILLT-LMEAEDDE..MAKKDV----------------
D6WF47_TRICA/331-820DYMNF............NDGTCCSSTETYT-----TLQIVTFAILGI-CASIAIVM..LCTRLI----------------
B3NSS9_DROER/352-855DYMNY............NDGTCCSSSEPYT-----TLQIVAYALFGV-CMALVCGM..CLRRW.----------------
B2RAS9_HUMAN/293-785KILKP............VDGSCCQPRPPVT-----LIQKLAACFFTL-SIIGYLI...FYIIHR----------------
CASD1_MOUSE/293-785KVVKP............VDGSCCQPRPPLT-----LIQKLAACFFTL-SIIGYFI...FYVIHR----------------

PF10129

A1R109_ARTAT/441-826LSQET----------------------------------LGVV-SGAELFVMLS--GVVLGMVY.G--------------
A0K1D5_ARTS2/295-678FTQET----------------------------------IGFV-SGAELFVLLS--GLVLGMVY.G--------------
A5CT98_CLAM3/468-850VTINA----------------------------------IGAI-TGAEMFVLLS--GLVLGMVY.P--------------
A2SCM7_METPP/4-366PLGQP----------------------------------FGYV-SAAEGFVLLS--GYMAGMVY.T--------------
A1TNJ8_ACIAC/18-379PLGQP----------------------------------FGFV-SAAEGFVLLS--AYMAGMVY.G--------------
A6SUD0_JANMA/21-383GFGQM----------------------------------LGYV-SAAEGFVMLS--AFMAGMIY.T--------------
Q1D6T0_MYXXD/55-417ISNQP----------------------------------FGFV-SAAEGFVFLS--AFLVGVVY.A--------------
Q11B97_MESSB/2-386FNHSE----------------------------------LGYV-QDAQGFVFLS--GLLVGMVY.A--------------
Q098N2_STIAD/51-435LNHGE----------------------------------LGYV-QDAPGFVFLS--GLLMGQVY.G--------------
Q7CT44_AGRT5/2-385INHRQ----------------------------------FAFV-EDAQGFVFLS--GLLIGMVY.A--------------
A5F6W9_VIBC3/3-362ITHEP----------------------------------VGVF-GAAEGFIFMS--GLLAGMVY.S--------------
B2TAN0_BURPP/16-364LMLHA----------------------------------YALC-DSAEVFVFLG--GYASAAAY.T--------------
Q1BP03_BURCA/9-357VTLHA----------------------------------YALC-DAAEVFVFLG--GFATAIAY.N--------------
B2JS58_BURP8/58-406ATLHA----------------------------------YALC-DAAEVFVFLG--GFATATAY.A--------------
Q13NS3_BURXL/7-355VTLHA----------------------------------YALC-DAAEVFVFLG--GFATATAY.A--------------
A9ALA8_BURM1/18-368VTLHA----------------------------------FALC-DAAEVFVFLG--GFATASAY.G--------------
A5XMC5_BURML/14-364VTLHA----------------------------------FALC-DAAEVFVFLG--GFATASAF.L--------------
Q1LDM8_RALME/9-370YTIRN----------------------------------FTLF-DAAEVFVFLA--GYSAGAAY.L--------------
A1B1M7_PARDP/3-363LTLTN----------------------------------FAVF-DAAELFVLLS--GFLVGMVW.I--------------
Q5FTQ3_GLUOX/17-367ITIRN----------------------------------FGFA-DAAEIFVMLA--GYASYLAY.G--------------
Q89UF3_BRAJA/67-422LTLRN----------------------------------FGFS-GAADLFVFVV--GYGVAIIH.G--------------
Q132X2_RHOPS/15-370LTMRN----------------------------------YGFS-DAAELFVFVS--GFTVAFVY.S--------------
Q134C6_RHOPS/15-370LTMRN----------------------------------YGFS-DAAELFVYVS--GFTVAFVY.A--------------
Q138V8_RHOPS/8-363VTARN----------------------------------YGFS-DAAELFIFIS--GFTVAFVY.G--------------
Q89KT4_BRAJA/82-438FTTRN----------------------------------YGFS-DGADLFVLIS--GYTATFVF.G--------------
A4YU73_BRASO/12-368ITTRN----------------------------------YGFS-DAADLFVFIS--GYTASFVY.A--------------
Q6N6S8_RHOPA/12-368ITTRN----------------------------------WGFS-DAADLFVFIS--GYTASFVY.A--------------
Q1QFJ8_NITHX/39-395ITIRN----------------------------------YGFS-DAAELFIFMS--GYMTSLVC.T--------------
Q89VE5_BRAJA/37-393FTIRN----------------------------------YGFS-DATEIFIFIS--GYTAAFVY.G--------------
Q07GY5_RHOP5/35-391LTIRN----------------------------------YGFS-DATEIFIFIS--GYTAAFVY.G--------------
Q6N0J3_RHOPA/44-400FTLRN----------------------------------YGFS-DATEIFIFIS--GYTAAFVY.G--------------
Q3SWD7_NITWN/36-392LTIRN----------------------------------YGFS-DATEIFIFIS--GYTAALVY.G--------------
Q89CC1_BRAJA/15-372LTLRN----------------------------------YGFS-DAAEFFVFIS--GYLVGWIY.G--------------
Q130V7_RHOPS/19-375FTLRN----------------------------------YGFC-DAAEFFVYIS--GYSIGFAY.G--------------
A4YYN0_BRASO/36-389LTLRN----------------------------------YGFS-DTSEVFVFIS--GYTCMLAY.G--------------
Q89EQ8_BRAJA/32-383LTLRN----------------------------------YGFS-DAAEVFMFLS--GLTCALSY.G--------------
A5EUM2_BRASB/9-363ITPKN----------------------------------FGFS-DAAEILVFLS--GVASGMVY.T--------------
Q87XJ3_PSESM/5-366LTVRN----------------------------------FGFS-DAAEIFVFLA--GYASILAY.G--------------
Q0BVC0_GRABC/14-370LTLKN----------------------------------IALS-DAMEVFVMLA--GYGAGLAY.G--------------
A5G015_ACICJ/9-360FTVRN----------------------------------LALN-DATEIFILLA--GFAAALVY.G--------------
B0U809_METS4/3-358FTYSQ----------------------------------YGTS-DAAELFVFLA--GWSIGIAIRG--------------
A6UE98_SINMW/23-375LTHKN----------------------------------FGFS-DSAEAFVLIS--GLSVGVAY.S--------------
Q2K344_RHIEC/23-378VTTKN----------------------------------FGFS-DAAEAFVLIS--GIAVGLAY.G--------------
Q2YRC8_BRUA2/6-358FTHKN----------------------------------LGFS-DSAEAFVLIS--GMAVALAY.G--------------
Q983D5_RHILO/37-389LTYKN----------------------------------FGFS-DAAEAFVLIS--GISVALAY.G--------------
Q6G5Q7_BARHE/16-368LTHRN----------------------------------FGFS-DSAEVFVLLS--GVALGLSF.H--------------
A1UR89_BARBK/16-368ITHKH----------------------------------FGFS-DSTEIFVLLS--GVSLALSF.S--------------
Q0FH42_9RHOB/16-377LTIRN----------------------------------LGFS-DAAEAFFIMS--GIAAGLAY.S--------------
A3VIJ0_9RHOB/5-370ATIRN----------------------------------WGFS-DAAESFFIIS--GIAAGIAY.S--------------
A3SZ27_9RHOB/26-392LTIRN----------------------------------IGFS-DAAEAFFIMS--GIAAGIAY.S--------------
Q3J1N1_RHOS4/11-372FTSRN----------------------------------FGFS-DAAEGFVLMS--GIAAGLAY.S--------------
A3V5J7_9RHOB/13-374LTNRN----------------------------------FGFS-DAAEGFVLMS--GIAAGIAY.S--------------
Q11DW2_MESSB/11-364LTSRN----------------------------------FGFS-DAAEAFVLMS--GIAVGLAY.A--------------
Q0G5B4_9RHIZ/12-366YTSRN----------------------------------FGFS-DAAELFVFLA--GFAAAFAY.G--------------
Q1YF78_MOBAS/13-366FTSRN----------------------------------FGFS-DAAELFVFLA--GFASAYAY.A--------------
A3X8H2_9RHOB/38-419WIPAR----------------------------------FGFS-DATEIFVFCS--GMASAIAF.G--------------
Q1GGF0_SILST/47-428WIPAR----------------------------------FGFS-DATEIFVFCS--GMASAIAF.G--------------
Q5LPG0_SILPO/35-409WIPAR----------------------------------FGFS-DATEIFVFCS--GMASAIAF.G--------------
A6DWM4_9RHOB/18-395WIPAR----------------------------------WGFS-DATEIFVFCS--GMASAIAF.G--------------
Q169P8_ROSDO/29-397WIPAR----------------------------------FGFS-DATEVFVFCS--GMASAIAF.G--------------
Q2PYB5_9BACT/21-406WIPGR----------------------------------FGFS-DATEIFVFCS--GMASAIAF.G--------------
Q0BQN1_GRABC/63-424LMPAS----------------------------------FGFS-DAACIFFFVS--GASCAYAF.G--------------

PF01757

A8DMZ1_STALU/12-334DDLRQLKVIYYA..........................QNIFI-FGTPCFIILS..QLLT....................
Q035D4_LACC3/20-369GLISTGFLATH............................LMIH-FTRMGFMFMT..GLVLT...................
A8G974_SERP5/5-314IPVYHMVNSIDIEM......................FVGLFGK-ICVSMFLFLSGYGFSL....................
Q11WN8_CYTH3/14-339SMLF...................................AFGQ-EAVMIFFVLS..GFVIYY..................
A7LV98_BACOV/4-296AD.....................................YLYL-FHVICFFILP...FFY....................
Q97ER7_CLOAB/6-334.......................................FVYS-YHVVLFFFIS..GYFY....................
OPGC_SHIF8/9-357VNSAEPSLWLTLF........................NDFIHS-FRMQVFFVIS..GYFSY...................
Q07PA2_RHOP5/14-375IVDSHPSRVLAAF........................IFVSHT-FRMTTFFVVA..GFFAH...................
Q30BE9_ENTFL/7-326NFIFTR.................................IVSR-VAVPFFFMTS..GFFL....................
A1HPJ5_9FIRM/6-350NVHLFALME..............................IFTR-FSVPIFFFVSAFGLFVH...................
Q4P0M9_USTMA/127-516QNGTPVGL...............................LRSP-IGLVLFYMLS..GRLNATSYF...............
A7LV97_BACOV/24-312.......................................LLTE-IAVPYFFIIS..GFFFF...................
Q1ZBT2_9GAMM/5-295RE.....................................IIYF-FHMPLFLAVT..GYFVK...................
Q1QWT8_CHRSD/4-315YQLTVQ.................................GLFR-IVVPIFMMVS..GYFFI...................
Q2T7M4_BURTA/6-373LFRPVPFLIQPSALERWIS.............IPPLTLAYSAD-AAVCVFFVIS..GYVLTT..................
A4B9D7_9GAMM/5-375LSEMVQTFG..............................IMAQ-AGVSVFFVLS..GFLLSLPF................
Q5LBM3_BACFN/8-315A......................................TGGA-IGDALFFFCS..GYTL....................
Q04X27_LEPBL/44-373ENASLLTLALS............................NLFR-FGVPAFVLSS..GIFL....................
A5ZUV3_9FIRM/6-346GQLQVSFPLWNIEN......................LLFTIGR-IGVPLFLATT..GALM....................
A1VGB5_DESVV/30-339SPLWFVAMGNA............................VITH-LAVPMFFMLA..GAVI....................
B2JGA6_BURP8/53-400LQALA..................................DMGQ-YGVQLFFVISAATIMLTLEE................
Q9XAP7_STRCO/24-348.......................................GLVL-PSMGIMFGLG..GTLM....................
Q07KV2_RHOP5/17-343AIQSAPLYK..............................PFGG-IGVEIFFIVS..GYLMC...................
Q484G4_COLP3/18-372IESGYNSTFLKTI........................MILSSK-WRLDILFLVS..GVAIS...................
A0DGZ8_PARTE/156-556TELLVALQSQRAI........................ITVDML-YSVDIFFWLG..GFFMAFVMCE..............
A7A7L5_BIFAD/6-324LPLGPERIFFQLV........................MQGGGK-VGVVIFFSIS..AWFF....................
A3JPT3_9RHOB/10-350PPERLGPLVFRM...........................IIYT-ARTELFLIIS..IFLLL...................
A5EMI0_BRASB/26-386DPTSFIGFDGIV..........................LATDS-FFMAMFFFLS..GLFVW...................
A4FKM9_SACEN/20-347LESRELV................................FPYQ-VGASLLLLIS..GYFAC...................
A7V903_BACUN/5-297KQ.....................................IVYT-FHMSAFLIIS..GYLA....................
Q8IG66_CAEEL/330-720IRSVARKGESVVGWR.....................NFMMNSS-LAVDTFLFLS..ACVASYSIRKK.............
Q7UES3_RHOBA/12-486GWPIQDSQSSQITSL.....................FIAMVHG-FRMPLFFLLS..GFFTM...................
Q1WRZ8_LACS1/4-332N......................................ILFA-VNVPIFFVLS..GYLH....................
Q8PXP5_METMA/13-333FISK...................................YLVV-FGLSLFTFSA..GFKFGFN.................
Q6AH04_LEIXX/3-320LKLLN..................................FSDH-FAMPLFAVTV..GVSAG...................
Q5CVD7_CRYPI/23-437SEKEIVRQMIV............................FFSE-FGMPIFFYVSGRASFL....................
A0LT35_ACIC1/10-359TFSAEDAITGVSFG......................PWLTLLF-QVVPLFFFVG..GYANALS.................
Q8KJJ2_RHILI/23-344AFWLSPYFK..............................SIYM-FHMPLFMAIS..GYLSS...................
Q17BV3_AEDAE/212-599RNEFTESFNTPWSV.......................ALRVLM-LYADVYLVIS..GFLAAYHM................
A7F3R9_SCLS1/8-361PSSGEGLRPRFLQLPL...................LRVLVQGR-IGVTIFSLVT..GYVCALKPIR..............
Q144E0_BURXL/4-320QDGHVARLMKILL.........................YAAST-LGYPTLFFLF..GLST....................
Q83YQ9_STRGN/5-307Q......................................IVAR-FAVPFFMMLS..GYFS....................
Q07P25_RHOP5/21-323PGEALAQWMDY............................TLYT-FHMPLFFFLT..GLNV....................
Q8DSB8_STRMU/14-327KENFDLYYFVTWG........................IQVSAY-SAVNCYALIS..GYVG....................
A0LP70_SYNFM/14-366WLLGFGNFSAWLAEQHSGSILGTI...SAALEGIAAVVFERGS-QAVGVFIVLS..GFGLAYS.................
A8H1P8_SHEPA/43-369FADKAWF................................NLMM-NGTVFFVFIS..GFLFH...................
A6E8A8_9SPHI/14-335.......................................FISG-FDLPLFFFLS..GYLF....................
A5VFE0_SPHWW/65-420PVAMDQAGLIAERPF....................LLAIVNGH-FMVAIFFVLS..SFVLTK..................
A5LX53_STRPN/8-323SIANDVLLLLIT...........................QIYI-FHIPVFFALS..GYFFR...................
Q8P802_XANCP/22-341.......................................FAYS-FHVPLFFVLS..GWVG....................
Q2HGI8_CHAGB/115-578GSVTTAATTTPTGNHNDSNNPKPANHHYHLPLLPFIRLLFSGP-PMVCVFFIIS..GYALSLRPLTHAAT..........
A6BII1_9FIRM/11-365KMTGYVNYFIQ............................TLVA-VAVPLFFVVN..GFLL....................
Q9CHP8_LACLA/4-320IHSTLAIFWIGI..........................RTILI-TCVPLFLVAT..GFLM....................
A5N097_CLOK5/9-357IIFARANTELIFCKY.....................MQMFLAR-WHMVILFLIS..GMALF...................
Q8FTN8_COREF/16-398KSDLFATIHSFIP.........................MQLGS-AGVTFFFILS..GFLIYW..................
Q6G5Q7_BARHE/17-365RN.....................................FGFS-DSAEVFVLLS..GVALGL..................
A3H030_VIBCL/4-356QMITHEP................................VGVF-GAAEGFIFMS..GLLAGMV.................
A7AZT9_RUMGN/12-318AWINHAIWFLVE...........................RIAC-LAVPGFFMCS..GYLFY...................
Q2NRT0_SODGM/9-399FGLSELT................................SMGF-FATSAFFALS..GFLLAHV.................
A4CKW1_ROBBH/7-342DPSNPAYATWL............................YFRG-ITAPVFFTVS..GFIFTY..................
A6FAM6_9GAMM/8-349NEMEFTSGKVLNLFDILFTEP.........AGIIRALFSYFGH-FGVQIFIFLSAYGLMKK...................
A7V2Z2_BACUN/14-354TQII...................................NHGY-LAVDFFFMLS..GFVIGY..................
Q00XL5_OSTTA/15-388LAALGQV...................................N-VVVGAFFVLS..GYVAAYTTTA..............
A4YYF7_BRASO/15-345VRGELPFYRVLFP........................FYELGE-YGVVIFWCIS..GFIFFLK.................
Q1D0W9_MYXXD/39-356ADVWVQHYW..............................TCRG-ITAPLFLMVA..GWAVV...................
Q16PV5_AEDAE/243-647NPQALETFFRNPVMR.....................MASAIFP-FLVHTFFTVG..GVLLAVHFL...............
Q82ET0_STRAW/57-398TLHTASPLQHMPWL......................APISWVF-QTLAVFFLVG..GHVATKG.................
Q4JZS0_STRPN/5-327WIFEVFV................................PSLT-LLVYLFLLISGFGMFCGY..................
Q931U6_STAAM/8-314LSALYL.................................VIYS-FHMPTFLFIS..GYFA....................
Q7MGC8_VIBVY/15-336DIPWVGYLLN.............................QLAR-FAVPLFFLIS..GYLIQ...................
A6KZK8_BACV8/9-367DRPTFLQGCALG...........................SAVR-CCVPLFVMMT..GVLL....................
A4CUQ6_SYNPV/6-368GVRIPIEGIVGEGFIGF................FNWYIYAINS-FIMPMMFLIS..GYFVP...................
Q5PLM9_SALPA/5-319VSPLNWDIANVL..........................NSASR-VSVPLFFMIS..GYLF....................
A6P1P2_9FIRM/9-341GSGAWDIYNVYD...........................SLVR-WCVPVFVMLS..GMFLL...................
A5FYP6_ACICJ/4-317WYPALRR................................AVYG-FHMPFFFYLS..GLVTWL..................
Q7MQA5_VIBVY/5-328IPFDQWVTAVGI..........................NGISR-WAVPVFILIT..GALML...................
Q5X6W8_LEGPA/10-336.......................................PAGF-LGVDVFFVIS..GFLITQI.................
A7V3H1_BACUN/5-305KNSFFI.................................GTIS-FHMPLFMILS..GYFIN...................
Q64YD4_BACFR/4-349TDMAGPQSYLASEVDRL................WVAVYDGFSR-MAVPLFMIVS..AFLLA...................
A2SCM7_METPP/5-359P......................................FGYV-SAAEGFVLLS..GYMAGMVY................
A7ZZ73_ECOHS/5-329FQHPLSEVLSKCWIY.....................FNLYLAP-FRMPFFFFIS..GYLIR...................
A5UMZ7_METS3/7-344NLQEYVVF...............................TTFG-FGVPIFLMLL..GLLM....................
A3YY52_9SYNE/16-323KNDVTY.................................RVTV-VVLGLFVFIS..GHLIG...................
A4AIT9_9ACTN/563-845.......................................FFVQ-GGSHLLLVIA..GYNLAR..................
A5N224_CLOK5/8-329YSTTYDITFFLN...........................QLSR-FSVPAFIVVSGMGLTI....................
E0TI88_PARBH/15-315GELIR..................................AFCR-WCVPFFFIAS..GYFL....................
A3L950_PSEAI/5-324YP.....................................LLSP-FILPLFFFIS..GVFF....................
A0E2L0_PARTE/17-375SIINSNFMIIM............................INSL-YAVDIFFLIS..GFILGKKL................
Q8A5U1_BACTN/9-318S......................................MLSC-FRMPLYFFIS..GIFF....................
Q2C1R6_9GAMM/10-345YNLPHVKESMQYQYGIL.................STFLGINQS-FFMSLFFFIS..AYFVI...................
A7A7B8_BIFAD/5-363TAVT...................................VLCV-VCVPLFFAVN..GALL....................
Q4JYU7_STRPN/6-318WNLLAYLY...............................YLGT-YSIPLFFMIN..GYLL....................
A9VR59_BACWK/5-346LEQSLIMGMLF............................NLAK-FSAPAFIFIV..GFHLI...................
A7VGI1_9CLOT/6-345LL.....................................EWGR-YAVEMFFIVS..GYFMCVSAAK..............
Q1QR03_NITHX/14-320DGFMHLVVE..............................FAKP-FRMPDFFLIS..GLFL....................
A5ZDF6_9BACE/13-326LSGKIIEH...............................FIVA-FNMPLFVIIS..GYSNLN..................
Q16FE1_AEDAE/161-554HPDKLKLSLLGKL........................GNVMTP-TTVQIFFTMS..GLLMAVNFL...............
Q7CTZ0_AGRT5/8-329GLYGFFDWLRVFL........................GDALFR-IGVPCLSAIS..GYLLF...................
Q8G7P7_BIFLO/17-373LAGSAETVRSVLF.........................AL.FM-VCNPLFIMVS..GRFNLTCDAGRLGSTRSSGNLPGS
A1R1G8_ARTAT/18-357GTVVTVNVLMEQSWF.....................TPVAWGL-MIVPLFFVLG..GVTGLQS.................
A1VHZ4_DESVV/11-319GSTLMDGLPMRL...........................WWVP-GDVGLFFFTATSGYFTA...................
A0QPG5_MYCS2/9-326KPLEQ..................................LLEQ-VWVDGFFAIS..GFLIT...................
A5EXU9_DICNV/19-351IPHILVEYV..............................LSEP-FAAPVFLTTLGVGLVY....................
A6LGX6_PARD8/9-311YTE....................................VAAR-FAVPLFFMIT..GFFL....................
Q11WP3_CYTH3/4-324.......................................ALGE-WAVHVFFILS..GYWVVKM.................
A0K1D5_ARTS2/296-671QET....................................IGFV-SGAELFVLLS..GLVLGMV.................
A6KYR5_BACV8/6-309LNKEFILFIN.............................TLGN-TGVTLFILIS..GYFG....................
Q0CZ95_ASPTN/77-482KAFELAYGYDNKYYFACL..............PGVRTIFAGGH-FAVSVFFVLS..GYVLSMKPLG..............
A0T1U4_VIBCL/8-303.......................................RIRS-FDVPLMIFIS..GVSFT...................
A3I592_9BACI/6-352ESRLYSIYVFLN...........................IFPK-FAVPVFIFLS..GFVLFYN.................
A1TDU0_MYCVP/22-361VFIWTNLLTASPVF......................QALTWLF-QIMPLFFFA...GVAAS...................

PF07786

A1HQT7_9FIRM/5-214KLEYL.SGFWF----------------------------WVGR.SSAVLFMLLS--GVSTVL------------------
A2SQB7_METLZ/5-231LVPWF..DPYT----------------------------MSGA.PIAFLFIVIA--GISLVL------------------
A9CIY2_AGRT5/15-234EPGTATTGLWK----------------------------LYAR.GIASSFLFLA--GFSLFL------------------
Q28R74_JANSC/28-249PRGTATTGIWR----------------------------ALAV.ATAGSFLCLA--GMGLWL------------------
Q8PXM0_METMA/7-237DIELR.SGTFF----------------------------YTGR.GAAFLFILIS--GTALSI------------------
A4EC93_9ACTN/4-221DMPWFTQTVFQ----------------------------DIWRASISWVFLFIA--GWMCTL------------------
Q8U2K3_PYRFU/23-240SEYKT...FWK----------------------------VFAY.ATASLFVSIS--GLSLWI------------------
A7I8Y9_METB6/6-231PVDVS.DGFWR----------------------------YFAY.ATASLFLLIV--GVSLSV------------------
A6G0Y4_9DELT/12-237AGSALGVALHV----------------------------VGKG...TAGFLVIM--GFSFMV------------------
A3CVR7_METMJ/5-231PLNVS.GGFLR----------------------------TLAY.LTASTFIFLV--GLSFTI------------------
Q11IW8_MESSB/30-251EPGMSITGAWK----------------------------FFAR.SIACSFLFLV--GFSLYL------------------
A1TRD1_ACIAC/21-249PQDFRGDPFWT----------------------------LQRT.AIVSLFLFCA--GMGQAL------------------
A2SGN2_METPP/12-230GANFHADPFWL----------------------------HQRT.GIVSLFLFCA--GLGQAV------------------
A2STU6_METLZ/14-241NVDVW.LGLGV----------------------------YLP..LGTSVFVIIS--GTSLIL------------------
Q2K839_RHIEC/16-243APGTAETGWLK----------------------------IYAR.AIATTFLFIV--GISLAL------------------
Q251W2_DESHY/5-221AVDVD.ALFWF----------------------------SIGK.TAALLFIFLS--GLSSGF------------------
A0NYA1_9RHOB/5-227DWPVAQGTGWR----------------------------IFAA.SIAGSFLFLA--GISLDF------------------
Q21VS3_RHOFD/16-244KQDFYHAPLWT----------------------------WQRT.LIVSLFLFCA--GLGQAI------------------
Q0FKK0_9RHOB/7-221PHGLTMSGGWA----------------------------LFAR.LVAGSFVFLS--GMSLVL------------------
Q2YRW9_BRUA2/16-233APATTAQGGWK----------------------------LFAR.CIASSFLFLV--GFSLVL------------------
A2STU5_METLZ/19-252Q.ETR.EFLYY----------------------------YSPIVIVSAAFVFIA--GVAIVL------------------
Q6SHI3_9BACT/5-214EVPLFTHWAGI----------------------------TWRC.LIVFLFLSAV--GISLVI------------------
Q0G6B2_9RHIZ/53-275TRGMATSGGWM----------------------------VFAR.CIASSFLFLV--GFSLIL------------------
A3YBL4_9GAMM/14-227DYSLR.DPFWV----------------------------GFRS.LIISLFMSAL--GWSCYL------------------
A4FZP9_METM5/5-227SENLL...FWS----------------------------IFAL.YVASIFIFIS--GVSFNI------------------
Q11N89_MESSB/6-227N.GVARHPVWL----------------------------AFGR.SLAGTFMFLV--GVSLVL------------------
A4J1M2_DESRM/9-218PIHYQ.EGFIF----------------------------LTGK.ASATLFILLA--GVSCSL------------------
Q6SGH9_9BACT/9-218NIPLSNFWLTS----------------------------YWRY.LIVFLFLNAV--GISLVI------------------
A1VNB1_POLNA/5-231QQNFYTDPFWT----------------------------WQRS.TIVSLFLFTA--GLGQSV------------------
A3DGD5_CLOTH/11-220PIGYG.TGFID----------------------------KIRI.VVATLFIMVS--GISTAF------------------
Q98KU6_RHILO/16-237DPGLTAFGWWK----------------------------IYAR.CIASTFLFLV--GVSLYL------------------
A6VZM7_MARMS/12-224EYSIY.DPFWV----------------------------YFRS.LILTLFLTAI--GWSAYI------------------
A1W6I8_ACISJ/12-240PQDFRADPLWT----------------------------VQRT.LIVSLFLGCA--GLGQAV------------------
Q6M0I2_METMP/11-233SDYLL...FWS----------------------------FFAL.FVASSFVFIS--GVSFNV------------------
O26882_METTH/9-227DLDMG.SPVIW----------------------------FTGR.LTAFLFIFLV--GVSLSL------------------
Q92KE6_RHIME/23-246AAGTAGTGGWR----------------------------MFAR.LIASSFLFLA--GYSLVL------------------
B1ZHM9_METPB/15-237PQNLALTPPGR----------------------------VAAH.LIAGSFLLLV--GIGLVL------------------
Q2Y4H0_9ARCH/17-243NLNLH.SGFWL----------------------------YFGR.ATATIFILLV--GISLTL------------------
O29726_ARCFU/2-207ELS...GDFWY----------------------------YFPR.FIGGMFIFIS--GYTLSV------------------
Q12ZG6_METBU/7-234DNDIR.TGEVF----------------------------LIGR.AAAFLFIFVA--GISLTL------------------
A4BIP8_9GAMM/6-220TFEMN.GGFFT----------------------------WFRF.LIVTLFFTSV--GAGLYL------------------
Q8THP4_METAC/31-261DVDLK.SGTLL----------------------------YIGR.GAAFLFILIS--GTALSI------------------
Q46DC7_METBF/7-237DIQLR.SGVIL----------------------------YAGR.FSALLFILIS--GVALSI------------------
Q2FN30_METHJ/7-229GPDPF.SGLLR----------------------------IFGM.LTTISFIGIA--GISAHL------------------
Q1YI63_MOBAS/15-237ERGLTGHGGWR----------------------------IFAR.AIASSFLFLV--GVSLVL------------------
Q1B004_RUBXD/18-243PIAST.SGFWA----------------------------AFAD.ASAFVFVFLA--GLSLTL------------------
A6FRV3_9RHOB/4-228PQGTAGSWGWS----------------------------NFAK.LVAGSFICLA--GVSLVV------------------
Q1YJ44_MOBAS/24-246SPSLMFSIPVT----------------------------IFAR.SLAGSFMFLV--GVGLVL------------------
Q26I67_FLABB/5-236DTDSTIFQIWS----------------------------YFRG.ITAPTFFTIS--GIIFTY------------------

PF05857

Q8KNJ7_SALTI/21-241LNM.....-------------------------------.AGR-CAFPLFALVSGCNMAG--------------------
A7LWV3_BACOV/16-233MRC.....-------------------------------.IGR-IAFPVFAFLIAEGFRH--------------------
Q84A20_ECOLX/31-248MFL.....-------------------------------.AGR-GAFPLFALVWGLNLSR--------------------
A6TIJ3_KLEP7/24-240MRL.....-------------------------------.LGR-GCFPLFGLAWGMNLAR--------------------
A5Z378_9FIRM/20-251LRS.....-------------------------------.IGR-ISFPIFCFVLVEGFFH--------------------
A5KIL9_9FIRM/5-244MSTVNICH-------------------------------ILGR-IAFPVFCFLLVEGFFH--------------------
Q5NWL3_AROAE/9-222LFE.....-------------------------------.VGR-VALPLFIFVLAYNLAR--------------------
Q88AH9_PSESM/14-243LYV.....-------------------------------.PGR-FAFPWFCLAIAVNLSR--------------------
Q1H9V9_9ZZZZ/19-235LFE.....-------------------------------.AGR-LAMPLFVFVLAYNLAR--------------------
A3JHE7_9ALTE/11-236APG.....-------------------------------.LGR-LAMPLFVFVLAYNLAR--------------------
A8F272_RICM5/12-244MRI.....-------------------------------.IGR-TAMPVFCFFAGYNF..--------------------
A4WGU9_ENT38/21-253AYA.....-------------------------------.AGR-MAFPLFTLIWAMNVQR--------------------
A7VEF3_9CLOT/9-245MRA.....-------------------------------.VGR-LAFPIFAFLLVEGYRH--------------------
A6M0I9_CLOB8/13-266FNW.....-------------------------------.IGR-LSAPLFFFTMAEGFFY--------------------
A4NTD4_HAEIF/7-239CRV.....-------------------------------.IGR-FSYVAFGFIIALNLSR--------------------
C1DKH3_AZOVD/14-243LYV.....-------------------------------.PGR-LAFPFFCLILAVNLAR--------------------
Q0VUV5_9ZZZZ/9-222LFD.....-------------------------------.AGR-LCLPIFVFVLAYNLAR--------------------
A7VF03_9CLOT/8-229IVMSELFD-------------------------------ILGR-IAFPIFISLLVEGYFK--------------------
A4XUI8_PSEMY/4-231LFV.....-------------------------------.VGR-FAFPLFCLGIAANVSR--------------------
Q0B109_BURCM/9-222LFE.....-------------------------------.AGR-VALPLFVFVLAYNLAR--------------------
A4XH28_CALS8/24-230FRI.....-------------------------------.VGR-IAFPIFAFQVAAGFKF--------------------
Q5ZHG7_9BACT/23-233LFE.....-------------------------------.AGR-LALPLFVFVLAYNLAR--------------------
Q4UUW2_XANC8/4-213IAE.....-------------------------------.LGR-VAFPLFALVFAYNLAQ--------------------
FIMCH_DICNO/7-241LRF.....-------------------------------.VGR-LTLPLMCFFLVEGFFH--------------------
A5TTI6_FUSNP/5-248LYV.....-------------------------------.IGR-LAFPIFAFMIVEGFFR--------------------
Q65AG0_YERPE/74-291LRL.....-------------------------------.AGR-GAFPLFGLVWAMNLAR--------------------
Q2P3I2_XANOM/4-206LSE.....-------------------------------.LGR-IAFPVFALVMAYNLAQ--------------------

PF04235

YXAH_BACSU/242-392---------------------------------------..LV-IGIGAQVLYS--------------------------
A3IC17_9BACI/222-377---------------------------------------..LI-IGITIKSLPI--------------------------
A5VFY1_SPHWW/226-385---------------------------------------..YP-VGLALRLIHA--------------------------
A9VP60_BACWK/224-378---------------------------------------..GI-FSFTIKILAM--------------------------
A7AFV0_9PORP/228-389---------------------------------------..AI-CFAPLYSLKE--------------------------
B0T5F0_CAUSK/216-381---------------------------------------..LL-LYAGLTLWQA--------------------------
Q5LBX3_BACFN/231-393---------------------------------------..AV-LFGPLYQLKV--------------------------
A8FJB9_BACP2/218-375---------------------------------------..LW-VGLPLNALVF--------------------------
Q4MVH1_BACCE/182-334---------------------------------------....-LSVIAVWYQY--------------------------
A7GNB8_BACCN/217-376---------------------------------------..FI-LTLPMWFFMI--------------------------
A8M3I5_SALAI/225-391---------------------------------------..LA-AGIVAGVPSA--------------------------
A6CU81_9BACI/142-303---------------------------------------..FL-ISIPLVTLLA--------------------------
Q3R094_XYLFA/261-419---------------------------------------..WP-LGLTAMLLSV--------------------------
Q8ZNL6_SALTY/215-375---------------------------------------..VA-LGLMINLPAV--------------------------
Q31YW0_SHIBS/215-375---------------------------------------..MA-IGVTINLPAI--------------------------
A5ZJ36_9BACE/227-388---------------------------------------..AI-SFAPLYSLKE--------------------------
Q5Z0S5_NOCFA/200-354---------------------------------------..VP-AAVAAAVWQW--------------------------
A3IA01_9BACI/163-335---------------------------------------..FL-VSIGSWLYQW--------------------------
Q5LAR8_BACFN/229-391---------------------------------------..LI-CFFPLYGLNN--------------------------
A5FKP1_FLAJ1/222-380---------------------------------------..LV-IAVIMGIIFY--------------------------
Q1CGS9_YERPN/216-376---------------------------------------..IS-LSLVIQIPGV--------------------------
Q08VU8_STIAD/181-346---------------------------------------..LG-LGLAGSALNA--------------------------
A6LH60_PARD8/231-393---------------------------------------..AI-AFGPLYQLKV--------------------------
Q2NUE2_SODGM/217-377---------------------------------------..IP-AGLIINLPAV--------------------------
Q4UWH0_XANC8/244-402---------------------------------------..LP-LGLALMLVSY--------------------------
Q5L251_GEOKA/223-378---------------------------------------..LC-FGLALKTIPY--------------------------
B9LP38_HALLT/238-398---------------------------------------...V-VGLAITVAGV--------------------------
A5CQC9_CLAM3/228-397---------------------------------------..LP-LSVLGALPLV--------------------------
Q2BCM0_9BACI/228-382---------------------------------------..AG-AGILLKASPL--------------------------
Q5WBU3_BACSK/218-382---------------------------------------..LS-ISLIGALPHA--------------------------
Q5LDG8_BACFN/245-405---------------------------------------..FL-LGLPLSVLYA--------------------------
B1KH41_SHEWM/231-384---------------------------------------..FF-STLDSLLSFS--------------------------
A4EHF6_9RHOB/229-382---------------------------------------..LL-PGAALSLLGA--------------------------
Q2N5U1_ERYLH/237-397---------------------------------------..AL-ASLPMLFLLA--------------------------
Q1D273_MYXXD/254-423---------------------------------------..LS-VGLVLNGGGL--------------------------
A1RM83_SHESW/239-392---------------------------------------..TL-SLLDTVLGLT--------------------------
A3V2Y2_9RHOB/212-368---------------------------------------..LA-VALPVNGVYA--------------------------
Q0RI89_FRAAA/226-396---------------------------------------..LG-VAIVGALPYA--------------------------
A0RC19_BACAH/265-424---------------------------------------..FV-LTLPFWFFMV--------------------------
Q1GR12_SPHAL/244-406---------------------------------------..FA-IAVPPLVGLA--------------------------
A3HTP0_9BACT/227-391---------------------------------------..MV-ISNLYRVIFI--------------------------
Q0C162_HYPNA/232-392---------------------------------------..LP-AGLVGSLWGA--------------------------
Q01SV0_SOLUE/222-364---------------------------------------..VA-LGGVASFLHS--------------------------
Q9X356_BACAN/222-381---------------------------------------..LC-ISCLLSCPII--------------------------
Q6HBG3_BACHK/154-304---------------------------------------..IP-IALSMKYIGI--------------------------
A6F241_9ALTE/221-382---------------------------------------..LV-VGTALAMAEV--------------------------
A7AF04_9PORP/59-221---------------------------------------..LA-GLGLLYVARS--------------------------
A7M2T0_BACOV/229-391---------------------------------------..LL-CFFPIYGLNN--------------------------
Q2B965_9BACI/232-387---------------------------------------..FA-AGLLIKLVPY--------------------------
A3WAG6_9SPHN/263-424---------------------------------------..VI-GGGLAHLGLG--------------------------
Q0HGE7_SHESM/244-397---------------------------------------..VL-SALDTLLGLT--------------------------
A8FH56_BACP2/222-385---------------------------------------..CT-IAFLITQSST--------------------------
Q5WCD3_BACSK/239-403---------------------------------------..FL-AGFPLTLLEV--------------------------
A4GA59_HERAR/238-403---------------------------------------..FA-LGIPFNLAWA--------------------------
YRKO_BACSU/224-387---------------------------------------..ST-IAFLITQSSI--------------------------
Q7WHI1_BORBR/228-389---------------------------------------..LP-LGAAGAAVYA--------------------------
Q47SA7_THEFY/269-436---------------------------------------..IP-LGWLTGLLHA--------------------------
Q2P0R0_XANOM/244-402---------------------------------------..LP-LGLCVMLASY--------------------------
Q21P05_SACD2/237-402---------------------------------------..IA-STVICIALMA--------------------------
A4FQ93_SACEN/204-361---------------------------------------..FG-VGAPLNLLT.--------------------------
A3WF33_9SPHN/238-398---------------------------------------..AL-LAIPPLLALA--------------------------
Q3IC82_PSEHT/208-361---------------------------------------..LF-TSLRLTTEQY--------------------------
Q2NDD6_ERYLH/264-425---------------------------------------..LI-VGGAISLWIA--------------------------
A3XLE1_LEEBM/228-392---------------------------------------..AV-ITNVYRILFL--------------------------
Q9HNH9_HALSA/232-393---------------------------------------..GT-VGLAVTAAGV--------------------------
A4YYJ4_BRASO/266-405---------------------------------------..AL-AALAVTIDAG--------------------------
A3I7E6_9BACI/220-373---------------------------------------..VF-IGIPLNLLIF--------------------------
A4IKX9_GEOTN/224-379---------------------------------------..LC-LGLALKTIPY--------------------------
Q9KFW4_BACHD/1-165---------------------------------------..IS-IALVGGLPLA--------------------------
Q4A0U4_STAS1/90-261---------------------------------------..II-STIGWYLLEK--------------------------
Q8ERW4_OCEIH/226-381---------------------------------------..FI-GFIVLKLGPY--------------------------
Q7N6K6_PHOLL/210-370---------------------------------------..IP-LSIAVQIFSV--------------------------
A4ARZ9_MARSH/230-396---------------------------------------..II-LFVVSIALTA--------------------------
B1YLL9_EXIS2/215-367---------------------------------------..LL-LSLPLLYPIV--------------------------
A6L2L4_BACV8/234-394---------------------------------------..LV-AFFPLYGLGN--------------------------
A1WTH2_HALHL/248-410---------------------------------------..LG-IGVPMSIVGI--------------------------
A3UFR8_9RHOB/215-377---------------------------------------..VL-IGLPLNIAYA--------------------------
A6CPZ4_9BACI/231-386---------------------------------------..SI-VGLSLKSLPF--------------------------
A1S3E3_SHEAM/216-369---------------------------------------..LL-GAVDLTLYFS--------------------------
Q094W5_STIAD/188-355---------------------------------------..LL-VGGVSNGATF--------------------------
Q9AA92_CAUCR/270-432---------------------------------------...G-AGLAWTGWES--------------------------
Q0ARL9_MARMM/225-387---------------------------------------..VP-VGWWLCHTST--------------------------
Q07YN3_SHEFN/228-381---------------------------------------..TL-ASLDSILSLS--------------------------
A0XYG1_9GAMM/200-353---------------------------------------..IF-CSIRLSTSTL--------------------------
Q1NBB8_9SPHN/227-389---------------------------------------..FL-IGVPPMGALA--------------------------
A8F9F5_BACP2/224-375---------------------------------------..IV-VGLALKCATF--------------------------
A7AGL6_9PORP/228-390---------------------------------------..AV-CFVPLYFITA--------------------------
A6L9Q0_PARD8/227-389---------------------------------------..VV-CFIPLYYLSL--------------------------
B0T422_CAUSK/230-391---------------------------------------..LG-ALVLAGMAET--------------------------
A6WB03_KINRD/147-299---------------------------------------..AA-VAVPTVLAQA--------------------------
Q64ZH4_BACFR/244-394---------------------------------------..YA-VAFLLPVWGV--------------------------
Q49WA7_STAS1/224-378---------------------------------------..AI-LGYCIKMPFA--------------------------
A6T3W0_JANMA/238-403---------------------------------------..FG-IGIPFNLIWA--------------------------
Q47R13_THEFY/238-395---------------------------------------..LG-VGLPLNLAT.--------------------------
A8MJB9_ALKOO/219-378---------------------------------------..LI-VSVLCFIPMV--------------------------
A3UE46_9RHOB/225-387---------------------------------------..LG-VGLPIVAWGG--------------------------
A6TNH6_ALKMQ/249-412---------------------------------------..GA-VGLSTTIICI--------------------------
Q1D7M3_MYXXD/255-425---------------------------------------..LV-AAVVGSVPGV--------------------------
Q6NJJ5_CORDI/212-362---------------------------------------..IA-IIIGIGIPWG--------------------------
A3ID96_9BACI/222-373---------------------------------------..VP-IGLACKSVSF--------------------------
A5UQH7_ROSS1/237-401---------------------------------------VCLA-VGLIANLALA--------------------------
A7MLK3_CROS8/215-375---------------------------------------..VA-LGVLINLPAI--------------------------
Q9KE13_BACHD/42-195---------------------------------------..LL-IGFPIKIATV--------------------------
A8GC25_SERP5/223-383---------------------------------------..IP-LSLLIQLPAV--------------------------
Q8A424_BACTN/229-391---------------------------------------..VT-AFFPIYGLIN--------------------------
Q9KFA2_BACHD/226-379---------------------------------------..MY-VGIPLNLLIF--------------------------
B4SQY9_STRM5/245-403---------------------------------------..LP-LGLLVTVLGV--------------------------
Q9KEU3_BACHD/250-400---------------------------------------..FI-IGIGGNLLAA--------------------------
A4FQT6_SACEN/171-324---------------------------------------.VVP-AGIGVWIQVI--------------------------
A6TBN7_KLEP7/215-375---------------------------------------..VA-AGMAVNLPAI--------------------------
A4QGF8_CORGB/53-205---------------------------------------..AA-IAIPTLIIQA--------------------------
A3UEP5_9RHOB/214-372---------------------------------------..GL-VGIPLALGTA--------------------------
Q4KHM8_PSEF5/226-387---------------------------------------..LP-LGLGGALLYG--------------------------
A4F774_SACEN/171-329---------------------------------------..LL-TAFVLAAAGS--------------------------
A0Z0S4_9GAMM/214-384---------------------------------------.LLG-LSAMAIEAWM--------------------------
Q9K7D7_BACHD/224-377---------------------------------------..IP-VGVTLKALPL--------------------------
A3I5J9_9BACI/189-342---------------------------------------GPFF-IGFSLWIWFA--------------------------
A6KYE7_BACV8/229-390---------------------------------------..AI-SFAPLFQLKE--------------------------
Q2G3S1_NOVAD/241-402---------------------------------------..IL-GGAAASVAAL--------------------------
A7NS93_ROSCS/241-405---------------------------------------VCLV-VGLVANFALT--------------------------
A4WCI7_ENT38/215-375---------------------------------------..VL-LGVAINLPAV--------------------------
Q1IVW5_DEIGD/222-381---------------------------------------..LA-VGLPLGVLLA--------------------------
A4AN58_MARSH/230-392---------------------------------------..AT-VFIPLFLLEK--------------------------
Q8EH35_SHEON/233-386---------------------------------------..VL-STMDTLLGLT--------------------------
A5PD45_9SPHN/224-385---------------------------------------..LV-VGGGLTAWIA--------------------------
Q9RS74_DEIRA/223-382---------------------------------------..LP-LGLLLGAVLA--------------------------
A3HYS5_9BACT/265-426---------------------------------------..YA-VGLAINYYEM--------------------------
Q6D3N4_ERWCT/227-387---------------------------------------..IP-LGVAINSIGV--------------------------
A5FKP0_FLAJ1/222-380---------------------------------------..FL-CAVVIGIGFN--------------------------
A6LGL5_PARD8/234-396---------------------------------------..LV-LIGLLYLLKP--------------------------
Q3IPY1_NATPD/256-418---------------------------------------..GT-AGLALILTGV--------------------------
Q4LA20_STAHJ/233-386---------------------------------------..VS-IFAKSTILWL--------------------------
Q5YUW9_NOCFA/233-388---------------------------------------...A-VAAPVDLAAG--------------------------
YAMY_BACAD/182-335---------------------------------------....-LSVGGLLLQY--------------------------
B9LDU3_CHLSY/241-405---------------------------------------MCLA-IGLVANLALA--------------------------
Q9K6N5_BACHD/237-398---------------------------------------..LA-IGLPFNLLFF--------------------------
Q8EL60_OCEIH/225-388---------------------------------------..LT-ISLLGALPLS--------------------------
A4BFW6_9GAMM/238-400---------------------------------------..LL-GGFSLVITGL--------------------------

PF07779

CAS1_CRYNJ/373-830R.LPPNSPILDY..........................LPATS-IAPALSTFGLAMGYLF--------------------
Q6CDI8_YARLI/295-780D.YYPRFVRYVSWPVPS.....................IQDET-LLTACVVIAASLAYSF--------------------
A8N197_COPC7/296-746A.SPGTRSVML...........................NATNP-SNLPLLVLSGGLIAIY--------------------
E9GCH2_DAPPU/311-808V.VANGHSTVVVAEGFDE.KATTAHRKAAV....EDVESSSRV-VVTALGKLGLIMAYFY--------------------
D6WF47_TRICA/331-820M.KWRGRPIHEYSQLPDN.AHQPPATP...........GSYYN-LFTSLAKMALIMSYFF--------------------
B3NSS9_DROER/352-855LLHLRGQTLYVPLQQQQQSHEGGRASGGSPSNALSALITDYGT-PMVALSLLGLILAYFY--------------------
B2RAS9_HUMAN/293-785N.AHRKNKPCTDLESGEE.KKNIINTP..........VSSLEI-LLQSFCKLGLIMAYFY--------------------
CASD1_MOUSE/293-785N.AHRKNKPCTDLESGEE.KKNIINTP..........VSSLEI-LLQSFCKLGLIMAYFY--------------------

PF10129

A1R109_ARTAT/441-826----------PRI......ATELGDVV----------DGTTKRAWKLYFTALAVVLIVYGLSLLPFI-.--....NAAAV
A0K1D5_ARTS2/295-678----------PKA......QDNIGEVA----------QKTGRRAGKLYVTALAVVVLVFALSLIPAF-.--....NSDVL
A5CT98_CLAM3/468-850----------LAVK.....KFGEMKAL----------VSILRRAFKQYIVAIAVVVIVFALTFVPFL-.--....NTDVI
A2SCM7_METPP/4-366----------ARER.....RDGEAVMR----------EAFLRRALKIYACQAALLLFLFTVIALIGV-L--A...RQDAI
A1TNJ8_ACIAC/18-379----------RTAA.....RRGIPAMR----------QAFLRRATKIYACQAATLLFLFTVITFIGI-R--V...DEPAI
A6SUD0_JANMA/21-383----------RKAL.....HDGVEAMR----------QAFFKRTLTVYACHVACLLLLFTLIAALGL-K--F...DQPGL
Q1D6T0_MYXXD/55-417----------NKIE.....AADPNVLW----------RSLWQRALKVYGYHVALLAFAFAVIGTLGM-A--T...HRPAI
Q11B97_MESSB/2-386----------RRML.....KEGYAAGA----------RKVRKRALEIYRYAAGCIFAVVILGLILS.-.--....KSSTY
Q098N2_STIAD/51-435----------ARMK.....KHGYKAGA----------SKIYHRVFELYRYTAGCLLAIIALGFLLT.-.--....ESSVY
Q7CT44_AGRT5/2-385----------RKMM.....KYGYDAGK----------QMIWNRAMELYRYAMGLVIAVLFFRMVIP.-.--....HAPYI
A5F6W9_VIBC3/3-362----------RR.......EYTDRQAA----------GKVWHRAFIIYKYHIAGLFIAMLWFWLGSH-Y--FA..EQVTV
B2TAN0_BURPP/16-364----------AVLA.....GRGETAAK----------MRFVRRCWEIYRAYLLTAILTLLSGAILAT-L--NL..NRPMV
Q1BP03_BURCA/9-357----------SLAE.....RHDEAAAR----------QRFIRRAFEIYRAFLVTAGLMLLITAALNA-F--AI..DGPNM
B2JS58_BURP8/58-406----------SLAK.....RHTEADAR----------NRFFKRSLELYRAFLVTAVLMLVVSAVMSA-F--SI..DAPNM
Q13NS3_BURXL/7-355----------ALAE.....RRNETIAR----------SRFLRRSLEIYRAFLVTAALMLLVSAALTA-L--SI..DGPNL
A9ALA8_BURM1/18-368----------AIAE.....RQGARAAQ----------RRFVRRAMQIYRAFLATSTLMLVVSAVLDH-Y--GI..DAPNL
A5XMC5_BURML/14-364----------SVSA.....RHGAGAAR----------RRFMRRAAQIYRAFLATSTLMLVVSAVLDH-Y--GI..DAPNM
Q1LDM8_RALME/9-370----------AMEA.....RQGASAAS----------KRLHRRSWEIYKAFVLTGVLMLLFGFLLAM-C--KV..PAPAV
A1B1M7_PARDP/3-363----------KVEA.....REGRPAAQ----------IRFLRRAAQVWLALIAGAILLALFSALLFK-L--QM..NHTAV
Q5FTQ3_GLUOX/17-367----------RLID.....RQGWKTGI----------HRIFGRCVRLYLYQTGMTLVFVWTVRQWR.-.--....HYQPL
Q89UF3_BRAJA/67-422----------RMAL.....ERGYVVAA----------TRIFRRVWRLYAAYVVLFVIYIDTIAYVAS-Q--SM..APEII
Q132X2_RHOPS/15-370----------KTLH.....AKGILAAT----------AGILGRVWQIYVAYVLLFVFYVVAVGYVAQ-R--YG..HAHLL
Q134C6_RHOPS/15-370----------RMMR.....AKGLLAAA----------IGILGRVWQIYVAYVLLFVFYVVAVGYVGQ-V--DG..HAHLL
Q138V8_RHOPS/8-363----------RMMT.....VKGVIAAS----------VGLLGRVWKIYVAYLLLFMFYVVAVGYVAQ-R--FG..HAHLL
Q89KT4_BRAJA/82-438----------TMMM.....ERGFVIGA----------TRLLRRVWQLYVAHLLLFFVYLTAVHYLAH-R--FD..DLHLM
A4YU73_BRASO/12-368----------RMMI.....DRGFIVGA----------TRLFKRVWQLYVAHIVLFVIYIVAISYLAT-R--FG..VSEII
Q6N6S8_RHOPA/12-368----------KMML.....ERGFIVGG----------TRLTKRVWQLYVAHIVLFVIYIVAIGYVAQ-R--FS..DPEII
Q1QFJ8_NITHX/39-395----------NIMR.....RRGFVAGM----------SWLMKRVWQLYVAHIFLFVLYAAMIGHIAQ-S--YD..NPALI
Q89VE5_BRAJA/37-393----------RAML.....ESGVVIAT----------ARIMRRVWQIYVAHVFLFTIFLAEISYVAT-S--FE..NPLYT
Q07GY5_RHOP5/35-391----------RAMR.....DSGFMVAS----------ARIMKRVWQIYVAHVFLFVIFLAEISYVAT-S--FE..NPLYT
Q6N0J3_RHOPA/44-400----------KAMT.....ELGFVVAA----------ARILKRVWQIYVAHVFLFTIFLAEISYVAT-S--FQ..NPLYS
Q3SWD7_NITWN/36-392----------RAMR.....ERGFIVAA----------ARILRRVWQIYVAHIVLFTIFLAEISYVAS-S--SE..NPLYT
Q89CC1_BRAJA/15-372----------PIIA.....GGWFLAAL----------KRLWRRAAEMYVAHIMLFLLFTAQIARTAR-R--FD..NPMYE
Q130V7_RHOPS/19-375----------PAIR.....RGEMVAAI----------KRLWTRAVQLYVAHIFLFLFFTAQIARAAR-R--FD..NPMYK
A4YYN0_BRASO/36-389----------GAVE.....AQGWVTTA----------VRALRRAWEIYAAFLVLLLAYAALVWVIGG-.--....GSRFV
Q89EQ8_BRAJA/32-383----------KARQ.....SGGWTGVI----------GRTLWRSWDIYVAFLLLTLACAIVVHLAG.-.--....GGPLA
A5EUM2_BRASB/9-363----------PIVR.....QSGLRIAL----------QRAIKRGFEIYFAQLCTTALLLLIASLLAI-W--....QPDLL
Q87XJ3_PSESM/5-366----------RIAR.....RDGMLVAG----------VRILRRTWVLYVVHIFLLTLLMGIVFVANN-H--VE..TRDMV
Q0BVC0_GRABC/14-370----------KAMD.....RSGWLYAA----------AECARRAWTLYIAHIFLFVVFAAQVTYAAQ-F--MD..RTDYL
A5G015_ACICJ/9-360----------RKMD.....RAGPLSAS----------ADMLKRAWTLYIAHIFLFVLFAAQVALAAI-W--FA..RPQYI
B0U809_METS4/3-358----------RSGA.....LEPAGRTL----------LRLLSRMVEVYRAQIVITALALAMLAAAAL-L--LD..NPLLL
A6UE98_SINMW/23-375----------GKFL.....AGGRLALT----------LKIWRRALALYVAHIMTSVVTLAIFAGGAL-Y--FG..RQELI
Q2K344_RHIEC/23-378----------SRFE.....PGGRIKTA----------IKAARRAFTLYLAHMITTFMTLALFICGAW-L--FH..RPGLL
Q2YRC8_BRUA2/6-358----------SKFV.....SGNRLVLS----------LKMWRRASVLYITHIMTTMATIAIFAAAAI-F--LK..RSELL
Q983D5_RHILO/37-389----------TKFR.....PGGRLLAT----------LKMWRRAGVLYVAHIVTTMVVIALFCTVAV-L--TR..RPELL
Q6G5Q7_BARHE/16-368----------NRLQ.....QKPFTFIV----------RKLWRRALQLYAAYLFTTFVTLSLFLGAFC-L--WQ..TEKLL
A1UR89_BARBK/16-368----------SLPE.....RMNFTKNL----------RKIWQRIVQLYTAYLFASLTTLGLFLGAFL-I--WQ..CEKLT
Q0FH42_9RHOB/16-377----------GGFA.....RKPFLTAA----------EPVWKRAWTLYLAHILLTFWGIAIFAVGAE-V--FG..LPELL
A3VIJ0_9RHOB/5-370----------GRFATWR..DTGLWPAI----------APMWKRSWVLYLSHIFLTVAGIAIFALGAE-A--LG..LVELL
A3SZ27_9RHOB/26-392----------PAIGRWMSGELRLWDAM----------APLWRRAWQLYIVHIVLTVAAIGLYAWAAD-T--FV..RSEFR
Q3J1N1_RHOS4/11-372----------KGFW.....TPT.WAAA----------RKIWRRAWTLYLVHLLTTFWAIAISAAFAL-W--FA..APDLL
A3V5J7_9RHOB/13-374----------GYFR.....RADPLTGI----------ARVLRRVWTIYQVHILITVVALAIAAAAAL-W--FG..APDMM
Q11DW2_MESSB/11-364----------RPFR.....AGEYLKGC----------LSVWRRAGTLYVAHMVCTAIAIGILAAGVV-F--LD..TIDVL
Q0G5B4_9RHIZ/12-366----------RPFL.....AGQRLFAT----------VKAFRRAGTLFLVQMTLTVLTIGLFAWATL-A--FG..EGEMM
Q1YF78_MOBAS/13-366----------PLFL.....AGERVAAT----------LKAWRRAGVLYLVHITLTVAAIGIFSWAAL-A--LG..YGDMM
A3X8H2_9RHOB/38-419----------GSFA.....KQGWALGT----------ARVVFRCWQVFWAHIGLFFFVAMSMAALDT-Y--GTF.EKTYI
Q1GGF0_SILST/47-428----------GSFQ.....RHGWWLGT----------ARVAYRCWQVFWAHIGLFFFVAMSMAALDL-Y--GGF.EKSYI
Q5LPG0_SILPO/35-409----------GAFL.....KRGWWMGT----------ARIAFRIWQVYWAHIGLFFFTAMSMAALDL-S--GLF.EKSYV
A6DWM4_9RHOB/18-395----------RTFD.....RAGWTLGT----------GRVGYRVWQVYWAHIGMFVVIATMLAAFDV-W--GDF.GKSYI
Q169P8_ROSDO/29-397----------AVFR.....DQGLLMGA----------ARVAFRCWQVYWAHIALFFAIAGTMVFLNS-T--ELF.ERDYV
Q2PYB5_9BACT/21-406----------GSYD.....KRGWMLGT----------ARVLFRCWQVYWAHICLFLAIAMMLVTIDL-F--EF..EKNYV
Q0BQN1_GRABC/63-424----------SVYR.....RAGWALGT----------ARVSLRVWQIYAAQLGLVMAVAALPGLLAH-V--TGHRHYNFV

PF01757

A8DMZ1_STALU/12-334.............T-----LNYASLRI----------TYLTSRFKYII....LPYLCVGCFYCYSES-R--KL--GDPFW
Q035D4_LACC3/20-369...........MVY-----YRRQRNWP----------LFYKKRFTTVG....VPYVLWNTLLLAGSV-L--LG--VGGFT
A8G974_SERP5/5-314..............-----..KKEVSF----------KYIWGKLKNLY....ISYWIVLFIFVPIGI-I--FF--PGERY
Q11WN8_CYTH3/14-339...........SAE-----NKKTLTIP----------QYFKARFLRIYPVFILACLLTYVAKSFISD-E--WL--DFQWI
A7LV98_BACOV/4-296..............-----....DIKK----------EITVKRLCDIVVRNWIPYFWICIACYVISS-V--VN--HEFNW
Q97ER7_CLOAB/6-334.............K-----DKYTHKPI----------TLIKKRIKTLY....IPFIAYELIFLVLHN-F--FI--KFNVY
OPGC_SHIF8/9-357.............M-----LFLRYPLK----------KWWKVRVERVG....IPMLTAIPLLTLPQF-I--ML--QYVKG
Q07PA2_RHOP5/14-375.............L-----SFHRLGAT----------EFIYDRLKRIA....LPLAAGLPILLIVFV-P--IF--TAAAV
Q30BE9_ENTFL/7-326..............-----....ISRY----------TCNAEKLEAFIKKTTLIYGVAILLYIPINV-Y--NG--YFKMD
A1HPJ5_9FIRM/6-350............HN-----LEERFDYT----------GFMQRRLRTVL....VPYIVWSLLYMLHYT-L--VS--GDTQP
Q4P0M9_USTMA/127-516.......RNKALGR-----PIIWSVVP----------EAMVRRALRLL....IVGAVWLVIQKVECG-T--HA--FDQTV
A7LV97_BACOV/24-312...........RIS-----YYEKNNYF----------KMLKKKAKTLL....IPFIFWNIVGGGILC-L--YN--RAQVG
Q1ZBT2_9GAMM/5-295.............D-----TLLKRPSL----------DILRQYTHRML....IPFIVAFIFYTTVTV-S--SY--GSVTF
Q1QWT8_CHRSD/4-315.............S-----VIRSRSLM----------TWLKKVV........AMYVFWMLVYAYFWI-D--VP--ALTPY
Q2T7M4_BURTA/6-373..........KFFT-----TEELPALQ----------SAAAKRYIRLGLPSFASIFLAWILWRSGAI-Y--TA--HASEI
A4B9D7_9GAMM/5-375........WRAAYQ-----AQPLPDLK----------IYLMRRFARIMPGFYVVLLLSFGLSITVFG-S--EL--NMESL
Q5LBM3_BACFN/8-315.............F-----LGRDMDFF----------NWYKRRINRIY....PTVFTWALIAAVFFD-Q--RY--DMPEI
Q04X27_LEPBL/44-373..............-----..KFTNWT----------DYWKPKIFSLL....IPYLGVSFLAACIKL-Q--SL--PSITE
A5ZUV3_9FIRM/6-346.............L-----PRDYPDVS----------AFYKKSLFPLF....LTTEIWIFFNYIFCC-V--IE--HQTFN
A1VGB5_DESVV/30-339..............-----PERIDDIG----------QHYRKTLWRYV....APTLLSLVLYKILGI-L--LL--DQRDY
B2JGA6_BURP8/53-400........ETKRFG-----NDRVLIAR----------RFYVKRFFRIAPLYYLAIAVYSFGNYLAAH-F--NT--QITAP
Q9XAP7_STRCO/24-348.............A-----RSLRRPAA----------TVFRNRLRRLL....PPFWCWGLFVVGAML-A--RG--WMPGW
Q07KV2_RHOP5/17-343............LI-----RPHYRSAA----------SFMYGRLMRIVPMYWIFTTLVVVAYAINPN-W--KL--GGSDY
Q484G4_COLP3/18-372.............Y-----MITKMPLK----------SFTWQRIVKLY....LPLLFAIAIVVAPQS-Y--YE--AIQKG
A0DGZ8_PARTE/156-556.......TKRAKAL-----GKNPASLF----------LVILHRLLRIWPCYIICIMINSYILPYLGG-G--PR--WWSAM
A7A7L5_BIFAD/6-324..............-----....LDKE----------QTIKSNLKRVWI.MERELLFWSLILVAFYL-V--FD--RTDLG
A3JPT3_9RHOB/10-350...........MAL-----ERRPRGYF----------ETLKEQARRLL....IPFAFWTVFYALYSL-I--KA--YSYGY
A5EMI0_BRASB/26-386.............S-----GLAHKSTL----------QHLRDRLLRLG....LPFVIAALTVIPLAY-Y--AI--ELRAN
A4FKM9_SACEN/20-347.............V-----TIGRGPVL----------RYWWGRVARLL....PPFLAAVVLIYAVMR-L--FP--VDGWF
A7V903_BACUN/5-297..............-----..NNRKDA----------RSFLRKFLWIF....IPYACMEAAYTVMSH-F--LP--VRESV
Q8IG66_CAEEL/330-720......ILFRGSSS-----NFSIIKCL----------ALLGHRCLRLLPALSLYLLFMGLVYNHLAD-G--PF--WNANG
Q7UES3_RHOBA/12-486.............M-----LYRRRGMS----------KLIEHRILRIA....IPFVIGMSTIIPSIW-I--VA--GHIQA
Q1WRZ8_LACS1/4-332..............-----..KDKSYS----------KIITGGFFNLL....LPYIFTSFIMIMLTA-V--SL--HFHPI
Q8PXP5_METMA/13-333..........HSDE-----LEEKDFLK----------KYFIKRFVRLY....KPYIGYSLLISVPLF-F--VT--YISVY
Q6AH04_LEIXX/3-320...........LAS-----RRALADGR----------GMSRSRFRYGFAIRGLLLIALGILVGLFGA-Q--VY--PILHY
Q5CVD7_CRYPI/23-437..............-----.SSTPSLG----------VLLRKKILRLA....LPLISGYFILLPITH-Y--VA--NGRRP
A0LT35_ACIC1/10-359..........WSRR-----RAERYSWL----------GWVRQRMRRLL....VPTGGYAAAIVAVVV-L--CR--LLGVS
Q8KJJ2_RHILI/23-344.............G-----AILRKSFT----------QGVGERAMQLL....LPMLFWCTLIWTLKS-A--VI--FPTKS
Q17BV3_AEDAE/212-599.........VGEYQ-----QKQKVAWF----------RRIVGRYLRLT....LPLIPVLIFYSVVWE-H--LG--SGPQW
A7F3R9_SCLS1/8-361.......QCRAGNQ-----TACFSTIS----------RSAFRRVPRLV....LPTTIATTIIWFLCQ-F--GI--YKIAK
Q144E0_BURXL/4-320.............V-----ACLQRSRV----------HLLKSVALTVL....YPYLLWSILQTGVQW-F--VA--EYRDY
Q83YQ9_STRGN/5-307..............-----...FNISR----------EKVKYRLKQMLLLTIASLIFYSIVHFIDLV-L--SG--ELAEK
Q07P25_RHOP5/21-323.............E-----HSLRRGAK----------PFLASKGWTIA....YPYVLWSLIQGSIIM-L--LA--RDVNI
Q8DSB8_STRMU/14-327..............-----.....VDS----------PYRYSKCLSLW....LQVFFYTLLFILFFT-F--LQ--KPITY
A0LP70_SYNFM/14-366..........LAGS-----GGRPGGWN----------SWYRRRLLRLFPIYWLAHLIYLVSPFMDRQ-D--PI--DFRFV
A8H1P8_SHEPA/43-369............HV-----FYHRWDYK----------KYMKSKTKFVF....LPYLLLSLPWIVWHL-T--VG--TDPMM
A6E8A8_9SPHI/14-335.............S-----FKKYENYK----------AFLKARVRQLL....IPYLILNLVTYVLWL-I--FF--KDFDP
A5VFE0_SPHWW/65-420..........GLVS-----GTPRSRAL----------AAMAKRLPRLLPLTLIGTLLPFLLFAAGLL-P--TQ--EAAQV
A5LX53_STRPN/8-323.............P-----VSDMKEFW----------HYAKKKTIILG....IPYVFYSIIHFCLQK-V--AG--ASVRV
Q8P802_XANCP/22-341.............E-----RFGRRAFG----------RKTVGKLARTLLIPYVSFFLVAYGYWILSA-V--LN--GTSQS
Q2HGI8_CHAGB/115-578..TTTTTTTTPTTT-----QTAHTALT----------SLIFRRAPRLF....LPAFASTLLITLLVA-S--GV--YERTR
A6BII1_9FIRM/11-365..............-----.FGRGFNL----------KKHIRKTIRVA....AIAIIWGVITIIFLM-F--IR--GEYLS
Q9CHP8_LACLA/4-320..............-----..NRKELS----------AQYVLGIVPVI....ISYIGISLLVWGVLS-L--VG--KGSDF
A5N097_CLOK5/9-357.............Y-----SLKQRSAG----------SIIKTRVSKIL....IPMVLGCVFLNPITS-Y--LY--GLSIG
Q8FTN8_COREF/16-398..........SNSE-----LRGMRNTL----------YYCQRRITKIYPMHLIALGMFLLASAKITA-S--GV--QWVLD
Q6G5Q7_BARHE/17-365...........SFH-----NRLQQKPF----------TFIVRKLWRRALQLYAAYLFTTFVTLSLFL-G--AF--CLWQT
A3H030_VIBCL/4-356..........YSRR-----EYTDRQAA----------GKVWHRAFIIYK.YHIAGLFIAMLWFWLGS-H--YF--AEQVT
A7AZT9_RUMGN/12-318.............R-----NLTWKKVT----------EKLKQRVFSLV....IPFLIWNFLYYILHF-V--AR--RIPYF
Q2NRT0_SODGM/9-399..........YVRG-----RRLREPAS----------NFWRKRLFNLYPIHIVALLSSMLVVTLMQW-L--AI--PPEGP
A4CKW1_ROBBH/7-342..........LLLR-----TPRNQPDN----------PRIRKGIRRGLQLVAIGYLLRTNLFGLLQG-Q--IY--PSFYL
A6FAM6_9GAMM/8-349...........YAK-----NENKLLYI----------KFIIERVVKIYPMFLLAIVSYFVFMFTFNV-V--YN--GMGFA
A7V2Z2_BACUN/14-354..........AYDD-----RWNRMTVG----------TFFKRRIIRLHPMVIMGSIVGAAFFYFQES-P--CF--PPIEN
Q00XL5_OSTTA/15-388.......LGSYEAE-----MSRLRPSP----------QYVVSRVMGFYPLYFLVNCVFAPMFFYADS-F--YN--GPVAA
A4YYF7_BRASO/15-345.........YSALI-----PNGAVDGW----------TFFINRLSRLYPLHLATLLLVAGLQAIYVA-Q--HG--FAFVY
Q1D0W9_MYXXD/39-356...........AAL-----GSKPTAAR----------DTYGKRVRRALLLIFLGYLVHWPGWSTVIQ-M--GL--TERML
Q16PV5_AEDAE/243-647.......DFIESGP-----RFRWQYFI----------MGIINRYMRLFPLYFIMWLYQVSWFDRMGS-G--AT--GHSLV
Q82ET0_STRAW/57-398..........YASA-----RARGTTYG----------RWLRSRLARLFKPVAAVLTLWTLAVGGLLA-A--GA--DFGTV
Q4JZS0_STRPN/5-327..........YERF-----KEGKIDLN----------NFYKKRYKKI.....IPFFAFLIFIDILVE-R--SF--SHLIE
Q931U6_STAAM/8-314..............-----..KNIDKP----------YYLEKISKRLI....VPYMIFFAFFSIYYF-L--TG--KSDEL
Q7MGC8_VIBVY/15-336...........PKL-----TSAPFVTL----------GNYAKPLLKIWLVWSALSLLMPFNFQVVAE-H--GY--LAERQ
A6KZK8_BACV8/9-367..............-----FPVRNGMS----------EFYKKRIGRIV....VPLIFWSVMLPVLYF-I--YL--NYITT
A4CUQ6_SYNPV/6-368.............R-----SVHKKGVV----------QYLKNRLIRLG....IPFIFGLFIVNNISL-L--IG--RLSPS
Q5PLM9_SALPA/5-319..............-----....FGER----------CAQPRHFLRIA....LCLIFYSVVALAYIS-L--FT--SINVE
A6P1P2_9FIRM/9-341.............D-----PKKSLTLP----------KLFFHHILRIF....VALVVWGAVYAIVDF-G--RV--NGAFT
A5FYP6_ACICJ/4-317..........AGHA-----GTPPAGWP----------GLIRARARRLL....IPFAVMAFAITAGKL-A--AA--RFIHV
Q7MQA5_VIBVY/5-328.............S-----DTRPFDLP----------YYARRRLGKVL....IPFLFWSLFYALLSG-L--SA--SGFDS
Q5X6W8_LEGPA/10-336.........IFRNT-----KTQTFSLI----------KFYLNRMRRILPALMLVLLVSSVMSYFLLL-V--PD--LKNYS
A7V3H1_BACUN/5-305............PK-----RMRTDKIT----------TSCFSKFKHLM....VPAFSWYIIQCCLFR-E--IP--EVKAS
Q64YD4_BACFR/4-349.............P-----MKEEQTTW----------QFYRQRFLRII....PPFFIFMILYSTLPM-L--WG--QINGE
A2SCM7_METPP/5-359.........TARER-----RDGEAVMR----------EAFLRRALKIYACQAALLLFLFTVIALIGV-L--AR--QDAIT
A7ZZ73_ECOHS/5-329.............R-----YIDSVPWG----------NCLDKRIWSIFWVLALWGVVQWLALSALNQ-W--LA--PERDL
A5UMZ7_METS3/7-344.............L-----DRDYSDIE----------TFIKTDFVRIF....IPFLIWNTLLALLMT-A--SA--GKLSF
A3YY52_9SYNE/16-323...........RSR-----ITNAAEVW----------RFYQRRMVRIY....PPYLAALLLFDLCGL-L--KP--GQFIG
A4AIT9_9ACTN/563-845..........FQLA-----NRSDRRRT----------RAILAGVASIA....IPAITWIGIVTLLGT-A--YA--ATTVF
A5N224_CLOK5/8-329.............N-----YKKDSSYS----------EFIVKRFLKIV....PQYVLWCILYVLIIT-K--NF--NIYSD
E0TI88_PARBH/15-315..............-----.VGRDGEL----------RISLKGLSRLV....RIFALSCVLFLPLHF-L--RY--VETPI
A3L950_PSEAI/5-324..............-----.RTEQPFG----------EMALRKADALL....KPFFVTMLGYVILRD-L--LR--GQPLL
A0E2L0_PARTE/17-375........LTNPNL-----LLSPIQSM----------LMILDRIMRIYPLYWILLIIYIILPKLFTN-V--GY--TENCM
Q8A5U1_BACTN/9-318..............-----.KPYEGLY----------GFIIRKTNKLI....IPFIFFYVSAFLLKY-I--VW--KIAPE
Q2C1R6_9GAMM/10-345.............P-----SFERKGTR----------TFMLDKLKRLG....IPTLITLFLILPSGS-I--ES--FVSNI
A7A7B8_BIFAD/5-363..............-----.LPRKMDE----------AKHYRKTLNIV....IVVTIWRLLAAAFFV-F--VD--GSHPV
Q4JYU7_STRPN/6-318..............-----LGKREITY----------LYILQKVKWIL....ITVSSWSFIVWLFKR-D--FT--TNPIK
A9VR59_BACWK/5-346............RL-----YTKQLVYR----------EYIYEKAAHLL....IPYFFWSILYLLTTN-D--VI--TLQGG
A7VGI1_9CLOT/6-345.......AEERHTG-----ISLGKETF----------GFALHKIRRILPAYLYCYALGLCVWFVEVG-R--YV--YLKEG
Q1QR03_NITHX/14-320.............P-----LVINRDWR----------TYLDRKVVHFA....YFYLLWTAIQFGFKA-P--HF--AAEVG
A5ZDF6_9BACE/13-326..........TFNK-----ITKWRELI----------DFVKKSVIRIL....LPVVTFCVIGLTPNF-I--..--.....
Q16FE1_AEDAE/161-554.......SEAKKQP-----GFEWQFLR----------NKVVNRLIRFLPVYVLWILFTGSVYGILSS-G--PM--AYHTL
Q7CTZ0_AGRT5/8-329............RR-----GMSGFDYP----------ATIRSKSKTVL....LPFLLWNGALFAVVL-L--VQ--LFDVG
Q8G7P7_BIFLO/17-373GSDARAGGGAGQAD-----PSSLAPYV----------RYYYKRFISLI....VPYLLYAGGMGFVAY-L--VI--DHRSV
A1R1G8_ARTAT/18-357..........WRRL-----RAHGGTGF----------DFAQLRLLRLV....RPAMAVLAVMWGGLW-V--AL--LLGVH
A1VHZ4_DESVV/11-319............LR-----YPGAAMMQ----------GYWRRKVSRLC....GLFLFLNAVLGCVFL-A--TG--REGVF
A0QPG5_MYCS2/9-326............SS-----WLRNPRLR----------DYATARVLRIFPGLWVCLLIIAFVMAPIGV-L--LQ--GGSVS
A5EXU9_DICNV/19-351..............-----..SRHTSP----------KALLDRGINIL....VLGFLLNIVRFSLPI-I--WD--ASLLN
A6LGX6_PARD8/9-311.............Q-----TVIDKGRF----------KGYMQKIAILTVGTNVLYLILGFLYGTLDA-L--SI--KDVCL
Q11WP3_CYTH3/4-324.........YKEKY-----ILFKYPVS----------SFLSSRLLRLLPVFYINVILMIAVICFVKQ-Q--SL--HEYIR
A0K1D5_ARTS2/296-671.........YGPKA-----QDNIGEVA----------QKTGRRAGKLY....VTALAVVVLVFALSL-I--PA--FNSDV
A6KYR5_BACV8/6-309..............-----.......I----------RFNTHKFFKML....VVVWFYSIVSYLIET-I--WL--HTPHT
Q0CZ95_ASPTN/77-482.......CIQDGDY-----AELGRSLS----------SAVFRRWFRLY....IPVICTTICYMTVLH-L--FK--IRTVT
A0T1U4_VIBCL/8-303.............L-----SYKHIPYF----------AYLYKRILRLL....CPVWIFLTVFFIIYH-E--RS--YSTFD
A3I592_9BACI/6-352..........YIQK-----DFTKTLIV----------RFYKKRVTQIL....IPYLFFSVFYYAAMQ-F--YV--THDFS
A1TDU0_MYCVP/22-361...........VQS-----WRPGASWG----------NWLMRRCTRLYRPVFYYLAFWAVALVVLRL-L--LP--VHVYE

PF07786

A1HQT7_9FIRM/5-214-------------------G.................RRPLRRGMAVF----AWGMVLTAITY....-I..YN--P.QTY
A2SQB7_METLZ/5-231-------------------STGRETSP......VKAAKKLVIRSLYLL----CIAAVITIVTW....-I..VY--P.EET
A9CIY2_AGRT5/15-234-------------------AHGRGLNW..........QSFGKRFAMVA----GAALLITVATY....-F..AF--P.DSF
Q28R74_JANSC/28-249-------------------AHGTGIRW..........PAFWRRFAKVA----GAAGLVSIGTY....-I..AF--P.HAF
Q8PXM0_METMA/7-237-------------------SRSRALRSRSSGKPAENFTRYLERGLRLF----SMGLVITVITW....-I..FF--P.GQY
A4EC93_9ACTN/4-221-------------------S.................RNNIKRAAKYA----LAALVVWLATT....-L..VS--V.DDS
Q8U2K3_PYRFU/23-240-------------------SHSRGREI..........KRDIMRFVKLF----GLGVLITLTTH....-I..VL--D.KGT
A7I8Y9_METB6/6-231-------------------SHARAARR...LQGRALVQKFLLRGGGIF----CCGLLVTVATW....-W..YL--Q.EGY
A6G0Y4_9DELT/12-237-------------------ARDQSA............TRAARRGLVIL----GAGYLMNALKFVVPG-LLGLL--P.DAF
A3CVR7_METMJ/5-231-------------------SYARAARR...LDGRGLALKYVRRGLTIF----GYGLIITAVTR....-L..LL--P.NVY
Q11IW8_MESSB/30-251-------------------AHGHRFRA..........RPFLKRLGMIA----AAAVAITAATY....-I..LF--P.DSF
A1TRD1_ACIAC/21-249-------------------AWQQGVGW..........GRFGRRWVRIA----ACAVLVSAGSY....-L..MF--P.RSY
A2SGN2_METPP/12-230-------------------ALHAGQGG..........ARFWRRWAQIA----GCALLVSAGSA....-L..MF--P.RSW
A2STU6_METLZ/14-241-------------------RHGRMLDK....PRRAYYMAILKRGIEIM----LIGLGVSVIASLLIL-V..FI--NDGRY
Q2K839_RHIEC/16-243-------------------SSTPTIRW..........SSFWKRFGTIA----AAAAVISIATR....-V..AM--P.DTW
Q251W2_DESHY/5-221-------------------S.................KHPLKNGLRVL----FFGMIITLVTY....-V..TF--P.EQY
A0NYA1_9RHOB/5-227-------------------AHHTGIRW..........QAFWRRLGVIV----AAAAAVSAVTY....-F..TF--G.DTF
Q21VS3_RHOFD/16-244-------------------AVAQGQRW..........PRFWRRWAQIL----GCALLVTVGSW....-W..MF--P.QSY
Q0FKK0_9RHOB/7-221-------------------AHGAGLRW..........GAWRRRFLMIV----GAAGLVSLATY....-A..AF--P.QRF
Q2YRW9_BRUA2/16-233-------------------AHGRGIRW..........RPMAKRLLQII----AAAAAISAVTW....-Y..MT--P.DSF
A2STU5_METLZ/19-252-------------------RYNRMLGR....PLDAYYRDIAVKALVLF----FIAMCITALTWLASV-V..IF--HDDVF
Q6SHI3_9BACT/5-214-------------------AHSKQLNL..........RKFLKRLIYLG----IAALLVSAGTF....-V..MF--P.NGW
Q0G6B2_9RHIZ/53-275-------------------AHAKGIRW..........RPFGIRLAQII----ASALAITVVTM....-V..VT--P.DSF
A3YBL4_9GAMM/14-227-------------------SCRNGFQW..........PSILKRKFKLF----LAAGGISLATY....-L..AF--P.QNW
A4FZP9_METM5/5-227-------------------SFSKKVVS.....NNLNYKHYFIRFLKLF----AVSVLITIITS....-R..FL--T.SGT
Q11N89_MESSB/6-227-------------------AHRETIHV..........RAFTRRLFSIT----AYAMVITLVTW....-F..VF--P.ESF
A4J1M2_DESRM/9-218-------------------S.................KSNLKRGRNLL----FIAILLTIITM....-I..AV--P.GSN
Q6SGH9_9BACT/9-218-------------------AYGKSFNL..........NKFIKRLALLG----LAALLVSVGTY....-I..MF--P.DAW
A1VNB1_POLNA/5-231-------------------AVQQGQAW..........PRFWRRWAQVA----GSALLVSAGSY....-A..MY--P.QSF
A3DGD5_CLOTH/11-220-------------------S.................KNSFKRGVVVL----SAALLISFVTF....-I..VG--R.EYF
Q98KU6_RHILO/16-237-------------------AHGQQIRW..........NGFWKRFAMVA----GAAIAISVVTR....-I..AT--P.DGF
A6VZM7_MARMS/12-224-------------------ALGKSNN...........SSFWKRDIKLL----ISATAISLATY....-L..TI--P.NQW
A1W6I8_ACISJ/12-240-------------------AWQRQVGW..........ARFARRWSQIT----ACALLVTVGSF....-L..MF--P.RSF
Q6M0I2_METMP/11-233-------------------SFSKKVAS.....QNLTYKSYFNRFLKLS----VIAVVITAVTA....-Y..FL--T.SGT
O26882_METTH/9-227-------------------SHSR........RGVTSRRHYIIRGLKIF----LWGMVITAATW....-I..YP--H.NGF
Q92KE6_RHIME/23-246-------------------GQLPKLRP..........RAFAIRFAKIA----GAAALISIGTW....-F..AF--P.QSF
B1ZHM9_METPB/15-237-------------------ANGGGVRW..........RPFLWRLARIG----GAALLITAATR....-I..AF--P.QSY
Q2Y4H0_9ARCH/17-243-------------------SYSRAKKK....QKKKLYLKYLKRGVKIF----SWGLLITLATW....-L..FL--R.AGF
O29726_ARCFU/2-207-------------------V.............KPDFSRLKRKVLKLA----ALSLAITAVTL....-V..FV--P.EKT
Q12ZG6_METBU/7-234-------------------SFSKQLEM...EQTKPKFIKYVKRGSKIF----LWGMAITAGSY....-I..FL--R.EGI
A4BIP8_9GAMM/6-220-------------------AHYPTIRW..........RKFWWREAKIA----AGALIISISTL....-L..MY--P.RSW
Q8THP4_METAC/31-261-------------------SRSRALASEALGKSEENFSKYLKRGLRLL----SMGMIITGITW....-I..FF--P.GQY
Q46DC7_METBF/7-237-------------------SHSRALNQESAGNGAENFSKYLKRGIKLY----LMGLLLTGITW....-I..FL--P.EEY
Q2FN30_METHJ/7-229-------------------KAEKTPGM......MNQFSTFFKRGGELL----LIGMGITIVTW....-W..VM--DGEGY
Q1YI63_MOBAS/15-237-------------------ANGRGIRW..........QPVGKRLLQVV----AGALAITVATY....-F..AT--P.NSF
Q1B004_RUBXD/18-243-------------------SYRRAARP........TFGKYLRRGLRIF----AYGMLITLAFR....-...LV--D.YGY
A6FRV3_9RHOB/4-228-------------------AHAETVRW..........RAFAKRFVKLV----LAALAVSVATY....-A..MM--P.GQF
Q1YJ44_MOBAS/24-246-------------------AHFRYTHW..........QKFLTRLAKIV----VAAAAISVVTY....-G..AF--P.TSF
Q26I67_FLABB/5-236-------------------LLMKSKKK...GQAPERIRKGLLRGLLLI----AIGYGLRAPVFEWIT-G..TF--R.TYF

PF05857

Q8KNJ7_SALTI/21-241-------------------.......K----------TLRQHSLNRLW----LMALLAQPGYWLAFR-.--..--....D
A7LWV3_BACOV/16-233-------------------.......T----------RNRRRYFLQLL----LFAVISEVPWYLLDG-.--..--.....
Q84A20_ECOLX/31-248-------------------......HA----------HIRQLAINRLW----GWAVFSQFWYYFAGF-.--..--.....
A6TIJ3_KLEP7/24-240-------------------......HA----------EIRQSQLNSLW----GWALVAQVSFMLIGY-.--..--.....
A5Z378_9FIRM/20-251-------------------.......T----------SDRLKHAIRLG----IFALVSEIPYDMLYG-.--..--.....
A5KIL9_9FIRM/5-244-------------------.......T----------HNLKKYILNLG----IFALISEPVYDLACA-.--..--....G
Q5NWL3_AROAE/9-222-------------------..PDVMAR----------GTYGRTMKRLG----LFGAVASVPFIALGG-.--..--.....
Q88AH9_PSESM/14-243-------------------RSAALVAP----------RVQWRYLGWLL----AFAALSEIPYRLFMA-.--..--.....
Q1H9V9_9ZZZZ/19-235-------------------..PIANQN----------GAVKRTLTRLG----IFAVIATPPFIALGN-.--..--.....
A3JHE7_9ALTE/11-236-------------------.....MPV----------NKMPKLVFRLF----AFGVLATPAYLAVGA-.--..--....T
A8F272_RICM5/12-244-------------------........----------..HDKPKTHII----IFGVLLQIYTTVLFK-.--..--.....
A4WGU9_ENT38/21-253-------------------......RP----------ERLQVRANRQW----IWAVITQPVFSLAFA-.--..--.....
A7VEF3_9CLOT/9-245-------------------.......T----------SDIRKYFIRLF----LFALISEVPFDLAST-.--..--....G
A6M0I9_CLOB8/13-266-------------------.......T----------GNRKTYVKRLY----LFSIVMSLGKFISWK-.--..--ISVDD
A4NTD4_HAEIF/7-239-------------------......DK----------VNFKSYFTWMI----ATAFSSEISFTLFEP-.--..--.....
C1DKH3_AZOVD/14-243-------------------PRPEALRR----------AALARYCGWLL----AFALLSEWPYRLLVD-.--..--.....
Q0VUV5_9ZZZZ/9-222-------------------..PGVFER----------GAYPRTMKRMA----LFGVVASVPFIALGG-.--..--.....
A7VF03_9CLOT/8-229-------------------.......T----------RNRWRYLGTLL----VFGIISEVPFDMCTS-.--..--....N
A4XUI8_PSEMY/4-231-------------------SHPGDLYS----------ENNFRYLSWIL----AFSLISEMPYRALSE-.--..--.....
Q0B109_BURCM/9-222-------------------..PGTLER----------GVYGRTMSRLA----MFGALASVPFVALGG-.--..--.....
A4XH28_CALS8/24-230-------------------.......T----------SNPKRYLKRLF----IFALVSQIPFSLMTG-.--..--.....
Q5ZHG7_9BACT/23-233-------------------..PGALER----------GLYGRAMKRLL----AFGLVASVPFIALGG-.--..--.....
Q4UUW2_XANC8/4-213-------------------......PG----------ADVAKLIKRLF----LWGLIATPIAAIAFN-.--..--.....
FIMCH_DICNO/7-241-------------------.......S----------RNHQKYLGRLL----FFGVIAQPFYSWMIA-F--DQ--IDSAD
A5TTI6_FUSNP/5-248-------------------.......T----------KNRKKYLIRIF----IFAIISEIPFNLFSG-.--.L--AIRAV
Q65AG0_YERPE/74-291-------------------......HP----------QIQQRALNRLW----IWAGVAQGGWILAGL-.--..--.....
Q2P3I2_XANOM/4-206-------------------......PR----------ADYAKSVLRLA----GWGLLAQPFHAWAFG-.--..--.....

PF04235

YXAH_BACSU/242-392-------------------........----------................VTDKEICLLIGAPF.L-----------
A3IC17_9BACI/222-377-------------------........----------...........MFTRTYLFDYLKVYIGGPI.L-----------
A5VFY1_SPHWW/226-385-------------------........----------......VLVFHNDGAPTVVSGIVDQPGRLA.M-----------
A9VP60_BACWK/224-378-------------------........----------............FVKHPILIMLQDSLTPVT.M-----------
A7AFV0_9PORP/228-389-------------------........----------.....QIMASDNALIKQTVGTAFDMWQKFA.F-----------
B0T5F0_CAUSK/216-381-------------------PL......----------..LAAAPAGGGKAMGRQSLQWILESWAALS.L-----------
Q5LBX3_BACFN/231-393-------------------........----------....QLMDAGQPDMIRQTVGVVMDMWQKFA.F-----------
A8FJB9_BACP2/218-375-------------------........----------.............VPNELVEFVVRYAFSPF.L-----------
Q4MVH1_BACCE/182-334-------------------GHVPA..E----------PFINGIMETEDGTMDAASQFLKIGITVGPI.I-----------
A7GNB8_BACCN/217-376-------------------........----------......RYFVTKQPYEPIYMSGFTMFSGKT.L-----------
A8M3I5_SALAI/225-391-------------------L.......----------...MAASVWTDPPIGIAAIAGTLHLAGGYA.A-----------
A6CU81_9BACI/142-303-------------------........----------...LFKLEILGAGIKNSSYVQLFTSLSGVT.L-----------
Q3R094_XYLFA/261-419-------------------H.......----------...LASWQDVTRVDPRAFSAFALSMIAGLL.M-----------
Q8ZNL6_SALTY/215-375-------------------........----------...ILQWRLDWAYRWCAFLLQAPRELSAPL.Q-----------
Q31YW0_SHIBS/215-375-------------------........----------...ALQWQLDWAYRWCAFLLQMPRELSAPF.Q-----------
A5ZJ36_9BACE/227-388-------------------........----------.....QIMQSDNSLIQQTVGTAFDMWQKFA.F-----------
Q5Z0S5_NOCFA/200-354-------------------........----------...........RTPYLELWSSPSGPVAALA.G-----------
A3IA01_9BACI/163-335-------------------QYVPTANV----------NIDQLSKIQLEEHITNMEQFALIGLQFSPF.V-----------
Q5LAR8_BACFN/229-391-------------------........----------....MLPEFITRNAIRVPLQLIISSLSNLS.F-----------
A5FKP1_FLAJ1/222-380-------------------........----------.........SAIERKAGFLQFFHPYFWFIL.S-----------
Q1CGS9_YERPN/216-376-------------------........----------...ALQVYVGWDYRWAGFLLQVPRELGAPL.Q-----------
Q08VU8_STIAD/181-346-------------------W.......----------...LEARLGSAVLLTPAGLLQTAAYAVGVAPL-----------
A6LH60_PARD8/231-393-------------------........----------....LLMDTADSAIVRQTAGVVLDMWQKFA.F-----------
Q2NUE2_SODGM/217-377-------------------........----------...VAQWQLGWDYRWCGFLLQMPREISAPL.Q-----------
Q4UWH0_XANC8/244-402-------------------R.......----------...LEPWMDPARLDPRLSLAFALALLGGAM.M-----------
Q5L251_GEOKA/223-378-------------------........----------...........WAAANDLTMYIQDSFGGAA.L-----------
B9LP38_HALLT/238-398-------------------........----------....VYIEANDWSAGAALYWRQFIYVGSFP.L-----------
A5CQC9_CLAM3/228-397-------------------........----------...LATVGAIDADPVALYLLGVLHGATGVG.G-----------
Q2BCM0_9BACI/228-382-------------------........----------............MVQETGWTGVLYMFGGNI.L-----------
Q5WBU3_BACSK/218-382-------------------........----------...LYSNQLIELPPALVGLTFSLHMATGIL.G-----------
Q5LDG8_BACFN/245-405-------------------........----------.......WSAVNGHPFGTTAHTAIYTASVYPL-----------
B1KH41_SHEWM/231-384-------------------........----------...........ENPILHTLSGVIVLLSAIP.M-----------
A4EHF6_9RHOB/229-382-------------------........----------.........AMWQWGATLSGAALTLSIAPL.A-----------
Q2N5U1_ERYLH/237-397-------------------........----------...NWVAESGFPGVLAGSVALVFSAPFDTL.L-----------
Q1D273_MYXXD/254-423-------------------LLF.....----------RLRKAGVLEWDPKGPWMMIVNGFQEPGYIA.M-----------
A1RM83_SHESW/239-392-------------------........----------...........KNTILVAFSDVLIMLSAIP.M-----------
A3V2Y2_9RHOB/212-368-------------------........----------....AAILGFLPDGVPTYLGFAALALGAPT.L-----------
Q0RI89_FRAAA/226-396-------------------........----------...FVSAGIAHVDAGTVHRMSWLHAVTGEY.A-----------
A0RC19_BACAH/265-424-------------------........----------......RYFLSTSSYEPLYMQGLAMFSGKT.L-----------
Q1GR12_SPHAL/244-406-------------------........----------...LYQMRTGYDAVSVFGSTIALSVPFDTL.M-----------
A3HTP0_9BACT/227-391-------------------F.......----------...LLPDWGIYRNEFLRPVFFKLMYLSDLA.F-----------
Q0C162_HYPNA/232-392-------------------........----------...RLLLDADAMISGQFMLGNAVLMAFSAF.S-----------
Q01SV0_SOLUE/222-364-------------------........----------.....................RFEDLFVIIPL-----------
Q9X356_BACAN/222-381-------------------........----------......YYFIKMDVYYSKDVQLWILFGGKT.L-----------
Q6HBG3_BACHK/154-304-------------------........----------............MLFENKWSLFVLNIGSLL.L-----------
A6F241_9ALTE/221-382-------------------........----------........KLGEESLAHRVVNLLGGVGAPPLL-----------
A7AF04_9PORP/59-221-------------------........----------...YLPPVAWGEVSFYSWMSSTTTNLINLL.T-----------
A7M2T0_BACOV/229-391-------------------........----------....MLPEFIERSAVLVPLQLILSSFSSLS.F-----------
Q2B965_9BACI/232-387-------------------........----------...........MGPDNLATEYFQDLFGGPL.L-----------
A3WAG6_9SPHN/263-424-------------------........----------...LIVKQAGFTFYAGNAAFLGWSPLPRLA.M-----------
Q0HGE7_SHESM/244-397-------------------........----------...........QNPTLVMFSDIIVMLSAIP.T-----------
A8FH56_BACP2/222-385-------------------........----------...IIVAINPFENTLWVSIATALEQNGGLT.G-----------
Q5WCD3_BACSK/239-403-------------------S.......----------...IRYNLIDINPVFTQGLAEGIRMLAGPL.Q-----------
A4GA59_HERAR/238-403-------------------TM......----------..VVAEAIDPLHPSLYSFLLYAWLPVGGTC.L-----------
YRKO_BACSU/224-387-------------------........----------...LLDMFNLSENMLWKDISSVLGQNGGLT.G-----------
Q7WHI1_BORBR/228-389-------------------........----------.....WSGLPGQPLGIDLIGLGAGMLTAPL.L-----------
Q47SA7_THEFY/269-436-------------------........----------...LDHVGILSLSAEESVAVASIASTTGIA.T-----------
Q2P0R0_XANOM/244-402-------------------A.......----------...LEPWIDPARLDMRLSGAFALSLIAGPL.M-----------
Q21P05_SACD2/237-402-------------------G.......----------..TFVLVGEPQFNTWLETLALTFYDLANLS.L-----------
A4FQ93_SACEN/204-361-------------------........----------............AFGGEQWFMVDRYILPPV.V-----------
A3WF33_9SPHN/238-398-------------------........----------...WWVSDSAFAPAFAGAAAIVLSAPFDTL.L-----------
Q3IC82_PSEHT/208-361-------------------........----------...........SSGVFYALQELINSVAALC.M-----------
Q2NDD6_ERYLH/264-425-------------------........----------...LWVREGGFTYYGTQAAMVGFSYLPRLA.M-----------
A3XLE1_LEEBM/228-392-------------------T.......----------...LFTSLDLYKTEGFRSAFIKMMVICDVA.M-----------
Q9HNH9_HALSA/232-393-------------------........----------....WYITAADWAASAGLLWGQFNYWGSVP.L-----------
A4YYJ4_BRASO/266-405-------------------........----------.......................SSLATVS.L-----------
A3I7E6_9BACI/220-373-------------------........----------.............IPGGLFDLPVRYLCAPI.L-----------
A4IKX9_GEOTN/224-379-------------------........----------...........WAGANTLTMYIQDNFGGAV.L-----------
Q9KFW4_BACHD/1-165-------------------........----------...IVGAHSWELSPIATGLIQAIHIMSGIA.G-----------
Q4A0U4_STAS1/90-261-------------------AYVVPNFK----------LLRQKSEVSINHYAENVDHYHHLITIFSPF.M-----------
Q8ERW4_OCEIH/226-381-------------------........----------...........LFGNPSWFSYVQDNIGGAA.S-----------
Q7N6K6_PHOLL/210-370-------------------........----------...VFQYIHNWDYFWSGIVGYILAELVTPF.Q-----------
A4ARZ9_MARSH/230-396-------------------LI......----------..FMQMGENPSFSTWPAMLGLTAYDLNNIA.M-----------
B1YLL9_EXIS2/215-367-------------------........----------.......QIHQGRFPDGLANYFFVWLSGRT.L-----------
A6L2L4_BACV8/234-394-------------------........----------....MLPDFITNKSILTPLSLIITSLSNFA.F-----------
A1WTH2_HALHL/248-410-------------------........----------...AYREWRDWELLSGFFFSTQLNQLAVPF.V-----------
A3UFR8_9RHOB/215-377-------------------L.......----------...VASGPGLGWGQIADLLGFLSIAVGGPV.L-----------
A6CPZ4_9BACI/231-386-------------------........----------...........TVEANVAYSYIQDMLGAPF.L-----------
A1S3E3_SHEAM/216-369-------------------........----------...........ESRALVNLAEITVIFSAIP.V-----------
Q094W5_STIAD/188-355-------------------LV......----------.GQLTNAGHIPQGAPWMFFLPTVSELGSLG.L-----------
Q9AA92_CAUCR/270-432-------------------........----------...SMKLATDFAEPQATGRYNMAYEFASLP.I-----------
Q0ARL9_MARMM/225-387-------------------........----------....TTMIVGEFSTQAMADGNALTYVGSLV.L-----------
Q07YN3_SHEFN/228-381-------------------........----------...........GNQMLESMSDLLLWFSAIA.T-----------
A0XYG1_9GAMM/200-353-------------------........----------...........TGGLGMSLQEISNMFAALC.M-----------
Q1NBB8_9SPHN/227-389-------------------........----------...IWVWASGFAALPALGTALAWSFPFRVP.L-----------
A8F9F5_BACP2/224-375-------------------........----------..............IDAPWSEFVMILGGYV.L-----------
A7AGL6_9PORP/228-390-------------------........----------....SLPDMISNKAMLTPMNTVVSSFRNFS.F-----------
A6L9Q0_PARD8/227-389-------------------........----------....SLPGLLERTEELRPMSTIVSSLRNFS.F-----------
B0T422_CAUSK/230-391-------------------........----------....IYVLLPSHDWTIRGVARWLQSATAPV.V-----------
A6WB03_KINRD/147-299-------------------........----------............SDLAASGFSIVSALAGLA.L-----------
Q64ZH4_BACFR/244-394-------------------........----------...........DGFALRVGQTLFKTYGNLG.Q-----------
Q49WA7_STAS1/224-378-------------------........----------............IDYDNGSFAVINAVGGPI.V-----------
A6T3W0_JANMA/238-403-------------------AL......----------..ILSEAIDPLHPSPYSYIAYAWLPVGGVC.L-----------
Q47R13_THEFY/238-395-------------------........----------............ALGGAELFLLDRYVAAPV.V-----------
A8MJB9_ALKOO/219-378-------------------........----------......KLYLESSTYRQLDQYFFVWFSGKT.M-----------
A3UE46_9RHOB/225-387-------------------........----------....QQAIAHDFALDTLWLHTATNYAGSLL.V-----------
A6TNH6_ALKMQ/249-412-------------------........----------...IFGYFYLPSLMVSSLVFGLFYEVGTVF.L-----------
Q1D7M3_MYXXD/255-425-------------------VVTV....----------LMQKKVLTPETMPVWLPLVLAPLRNLAQVG.L-----------
Q6NJJ5_CORDI/212-362-------------------........----------.............LTQSHTLTVLNFSIGQL.S-----------
A3ID96_9BACI/222-373-------------------........----------..............IESDFSSILLIGGSQL.L-----------
A5UQH7_ROSS1/237-401-------------------........----------....WQMRVTDLSSPLAGLWSILTLIAGPV.L-----------
A7MLK3_CROS8/215-375-------------------........----------...VVQWHLGWDYRWCAFLLQAPRELGAPL.Q-----------
Q9KE13_BACHD/42-195-------------------........----------.............LSPANLETIQIIIGGPL.V-----------
A8GC25_SERP5/223-383-------------------........----------...ALQWHLHWDYRWSGFLLQVPRELGAPL.Q-----------
Q8A424_BACTN/229-391-------------------........----------....ILPDFISREALLVPSVLLCKSLSNIV.F-----------
Q9KFA2_BACHD/226-379-------------------........----------.............VPGGIFDLSVRYLFAPI.L-----------
B4SQY9_STRM5/245-403-------------------A.......----------...WKPYLVPGAYDLPVTAAMALVTVGGLL.M-----------
Q9KEU3_BACHD/250-400-------------------........----------................LSNQQLYLLIGAPF.L-----------
A4FQT6_SACEN/171-324-------------------........----------.............SKQEPTFFLIWATAGLF.G-----------
A6TBN7_KLEP7/215-375-------------------........----------...FAQWYLAWDYRWCAFLLQAPRELSAPL.Q-----------
A4QGF8_CORGB/53-205-------------------........----------............RDITSSGFSIVSTVAGLA.L-----------
A3UEP5_9RHOB/214-372-------------------........----------......IHGALAGFVFDVSLHPVMRFSKPF.I-----------
Q4KHM8_PSEF5/226-387-------------------........----------.....YWAAYAPGGGLEVLGYGVSQLTAPL.L-----------
A4F774_SACEN/171-329-------------------........----------....VAALLWQEQDPLSAGFTPSSAVAGLT.M-----------
A0Z0S4_9GAMM/214-384-------------------TYA.....----------.LSYRVFGDTASGGVTQLMGDLAFLFGTLL.L-----------
Q9K7D7_BACHD/224-377-------------------........----------............LFSGIPVLGVLSLPGSYV.L-----------
A3I5J9_9BACI/189-342-------------------........----------............SQADDQQLQSIIGLGVVP.T-----------
A6KYE7_BACV8/229-390-------------------........----------.....LIMASDSELIRQTAGTAFDMWQKFA.F-----------
Q2G3S1_NOVAD/241-402-------------------........----------...SWLAAHGWPPRAMFGAIESGMAFPHLA.M-----------
A7NS93_ROSCS/241-405-------------------........----------....WLMWTVDMTSPLAGLPSVLLLIFGPV.L-----------
A4WCI7_ENT38/215-375-------------------........----------...IAQWLLGWDYRWCAFLLQAPRELSAPF.Q-----------
Q1IVW5_DEIGD/222-381-------------------........----------......WLNTQSTFAAGLLAIPVRMGGGLA.T-----------
A4AN58_MARSH/230-392-------------------........----------....NFAELTDVKIHAQTLLKVVDMYGNLA.L-----------
Q8EH35_SHEON/233-386-------------------........----------...........QNPMLVMFSDIIVMLSAIP.M-----------
A5PD45_9SPHN/224-385-------------------........----------...MATMQGGFTYYGVLAAFLGWSHFPRLF.M-----------
Q9RS74_DEIRA/223-382-------------------........----------......FLNTRSDLTAGLLAIPVRMAGGLL.S-----------
A3HYS5_9BACT/265-426-------------------........----------....QTILDANFSILSFKQADITYYWGRFF.V-----------
Q6D3N4_ERWCT/227-387-------------------........----------...VGQWLVGWEYRWSGLLLQIPRELSSPL.Q-----------
A5FKP0_FLAJ1/222-380-------------------........----------.........IAIIYKAGFLKFFHPLYWLVL.S-----------
A6LGL5_PARD8/234-396-------------------........----------...YIPAASWREVSINAWMGATTTNLINLM.T-----------
Q3IPY1_NATPD/256-418-------------------........----------...WYREAVGWETAPVVLLAHQFNYWGALL.L-----------
Q4LA20_STAHJ/233-386-------------------........----------..............DNEAISGTLVAIFGPI.L-----------
Q5YUW9_NOCFA/233-388-------------------........----------............VFVGGDVIFLTRYGTAPL.V-----------
YAMY_BACAD/182-335-------------------CYVPE.QP----------FNNLNGLEKNYQNMDQLKWFLHLGVATGPI.L-----------
B9LDU3_CHLSY/241-405-------------------........----------....WLVMYGNLDSILVGLLQQLLLIAAPI.L-----------
Q9K6N5_BACHD/237-398-------------------........----------.....YSSTQSELFLSMLAYGIGVMLGGPA.L-----------
Q8EL60_OCEIH/225-388-------------------........----------....FIGSVWQPSFFVSGLLFGLHILTGIA.G-----------
A4BFW6_9GAMM/238-400-------------------........----------...VYNHVHGWTAESSMLGGSQFNYLGSAL.V-----------

PF07779

CAS1_CRYNJ/373-830-------------------LADRTHVF----------QKEQKDYDAVIFGMITLAAFVAGLLTIKNSGKDLGFLNRDITD
Q6CDI8_YARLI/295-780-------------------FCDRTQFF----------GKSSKQFEASEFWVLILLFLVATGYSFEPQN.DNSFLNRHQTE
A8N197_COPC7/296-746-------------------LSDRSWLW----------LKEHKQFDAINFTFLCLLAVGIGLASLKRADNDLGFLNRDQTD
E9GCH2_DAPPU/311-808-------------------LCDRTTFF----------MKENKYYSHLNFWVPVGYVFALGLFFNEESR.STKVLHRDQTD
D6WF47_TRICA/331-820-------------------LCDRTNFF----------MKENKYYSEFSFWLPIGYVTVLGLFFTEDSK.YTKVLHRDQLN
B3NSS9_DROER/352-855-------------------LCDRTNFF----------MKENKYYSEFSFWIPVGYVFALGLFFTEDSR.FTKVLNRDQTD
B2RAS9_HUMAN/293-785-------------------MCDRANLF----------MKENKFYTHSSFFIPIIYILVLGVFYNENTK.ETKVLNREQTD
CASD1_MOUSE/293-785-------------------MCDRANLF----------MKENKFYTHSSFFIPIIYILVLGVFYNENTK.ETKVLNREQTD

PF10129

A1R109_ARTAT/441-826TTFTDQGTGGAGRAAAGTTYDLYAGMEGLL--------------------------------------------------
A0K1D5_ARTS2/295-678TSFTDQGTGGAGRSGAGRTYDLYTGMQGLL--------------------------------------------------
A5CT98_CLAM3/468-850TTFTDRGTGADGKVTTGQVYDLYPNGARLL--------------------------------------------------
A2SCM7_METPP/4-366TNL......................ISFYF--------------------------------------------------
A1TNJ8_ACIAC/18-379KGL......................LTFYL--------------------------------------------------
A6SUD0_JANMA/21-383KNL......................IGFYL--------------------------------------------------
Q1D6T0_MYXXD/55-417HNL......................LGFFH--------------------------------------------------
Q11B97_MESSB/2-386WEP.....................WLWKLA--------------------------------------------------
Q098N2_STIAD/51-435WEP.....................WLWQLA--------------------------------------------------
Q7CT44_AGRT5/2-385WYN.....................WLGMTS--------------------------------------------------
A5F6W9_VIBC3/3-362FGG.....................SFSNLP--------------------------------------------------
B2TAN0_BURPP/16-364DLT.....................GWPPFA--------------------------------------------------
Q1BP03_BURCA/9-357PTN.....................DLDGLL--------------------------------------------------
B2JS58_BURP8/58-406ATT.....................DLDDMM--------------------------------------------------
Q13NS3_BURXL/7-355ATT.....................DLDDLL--------------------------------------------------
A9ALA8_BURM1/18-368ALD.....................DVSVML--------------------------------------------------
A5XMC5_BURML/14-364ALD.....................DISVLL--------------------------------------------------
Q1LDM8_RALME/9-370RAT.....................EAPAFM--------------------------------------------------
A1B1M7_PARDP/3-363WFQ.....................YARWIV--------------------------------------------------
Q5FTQ3_GLUOX/17-367PEY.....................TIEPQL--------------------------------------------------
Q89UF3_BRAJA/67-422HEY.....................NISGIL--------------------------------------------------
Q132X2_RHOPS/15-370DEY.....................NIRSLI--------------------------------------------------
Q134C6_RHOPS/15-370DQY.....................NIRRLI--------------------------------------------------
Q138V8_RHOPS/8-363DEF.....................NIRRLI--------------------------------------------------
Q89KT4_BRAJA/82-438DQF.....................NVAPLM--------------------------------------------------
A4YU73_BRASO/12-368DEF.....................NVAGLV--------------------------------------------------
Q6N6S8_RHOPA/12-368NEF.....................NVAGLV--------------------------------------------------
Q1QFJ8_NITHX/39-395NEF.....................NIAGLV--------------------------------------------------
Q89VE5_BRAJA/37-393EEM.....................GIMDFL--------------------------------------------------
Q07GY5_RHOP5/35-391EEM.....................GILDFL--------------------------------------------------
Q6N0J3_RHOPA/44-400EEM.....................GILDFL--------------------------------------------------
Q3SWD7_NITWN/36-392EEM.....................GILDFL--------------------------------------------------
Q89CC1_BRAJA/15-372HEF.....................NVFNFL--------------------------------------------------
Q130V7_RHOPS/19-375DEF.....................NVAQFL--------------------------------------------------
A4YYN0_BRASO/36-389DET.....................NTGFLF--------------------------------------------------
Q89EQ8_BRAJA/32-383DKS.....................NTRILL--------------------------------------------------
A5EUM2_BRASB/9-363HHA.....................NVAVFF--------------------------------------------------
Q87XJ3_PSESM/5-366QQM.....................GLEYFV--------------------------------------------------
Q0BVC0_GRABC/14-370DEI.....................NLDVLG--------------------------------------------------
A5G015_ACICJ/9-360SGV.....................GIDHLV--------------------------------------------------
B0U809_METS4/3-358EWH.....................NAGPVF--------------------------------------------------
A6UE98_SINMW/23-375GEI.....................NIRPIV--------------------------------------------------
Q2K344_RHIEC/23-378VEI.....................NILAVL--------------------------------------------------
Q2YRC8_BRUA2/6-358TQI.....................NIAPLI--------------------------------------------------
Q983D5_RHILO/37-389KLI.....................NIEPLM--------------------------------------------------
Q6G5Q7_BARHE/16-368SMN.....................NVGLFF--------------------------------------------------
A1UR89_BARBK/16-368SMN.....................NIGLFI--------------------------------------------------
Q0FH42_9RHOB/16-377EKN.....................NLSAIF--------------------------------------------------
A3VIJ0_9RHOB/5-370TKN.....................NLKQVF--------------------------------------------------
A3SZ27_9RHOB/26-392VMH.....................NLALLY--------------------------------------------------
Q3J1N1_RHOS4/11-372HQN.....................QVWILF--------------------------------------------------
A3V5J7_9RHOB/13-374RKH.....................GIWVLV--------------------------------------------------
Q11DW2_MESSB/11-364ARV.....................NFTPLL--------------------------------------------------
Q0G5B4_9RHIZ/12-366HRM.....................NLAALL--------------------------------------------------
Q1YF78_MOBAS/13-366RTI.....................GLRSFI--------------------------------------------------
A3X8H2_9RHOB/38-419NSL.....................NLQHFF--------------------------------------------------
Q1GGF0_SILST/47-428GSL.....................NLRPFF--------------------------------------------------
Q5LPG0_SILPO/35-409DGL.....................NLQHFF--------------------------------------------------
A6DWM4_9RHOB/18-395SSL.....................NLQHFF--------------------------------------------------
Q169P8_ROSDO/29-397GQL.....................NLYPFF--------------------------------------------------
Q2PYB5_9BACT/21-406NSL.....................NLGRFF--------------------------------------------------
Q0BQN1_GRABC/63-424ELF.....................ELYHLY--------------------------------------------------

PF01757

A8DMZ1_STALU/12-334HQF---------------------WQNVVL..................................................
Q035D4_LACC3/20-369IAN---------------------FWPDYL..................................................
A8G974_SERP5/5-314SLS---------------------PSLFLE..................................................
Q11WN8_CYTH3/14-339SFL---------------------ENICMLQDFS..............................................
A7LV98_BACOV/4-296DWS---------------------HVWAFVN.................................................
Q97ER7_CLOAB/6-334HFK---------------------YYSMGDFISS..............................................
OPGC_SHIF8/9-357KAE---------------------SWPGLSL.................................................
Q07PA2_RHOP5/14-375IKN---------------------GGQLPAP.................................................
Q30BE9_ENTFL/7-326NLL---------------------PNIIKD..................................................
A1HPJ5_9FIRM/6-350WTP---------------------PLIYEY..................................................
Q4P0M9_USTMA/127-516IAE---------------------GWLQSGNLGYPQWCNVNFNNPSPFPR..............................
A7LV97_BACOV/24-312DSI---------------------VNCVQQ..................................................
Q1ZBT2_9GAMM/5-295EQA---------------------ITKLIY..................................................
Q1QWT8_CHRSD/4-315ELL---------------------KVLRVA..................................................
Q2T7M4_BURTA/6-373GVA---------------------GWVSSWYAGPFTFS..........................................
A4B9D7_9GAMM/5-375MRL---------------------ATGLTFLN................................................
Q5LBM3_BACFN/8-315...---------------------........................................................
Q04X27_LEPBL/44-373YLN---------------------GILFGS..................................................
A5ZUV3_9FIRM/6-346ISR---------------------LLLEML..................................................
A1VGB5_DESVV/30-339LAG---------------------VFYNIG..................................................
B2JGA6_BURP8/53-400HDV---------------------SDVLANFLF...............................................
Q9XAP7_STRCO/24-348QIV---------------------YWVVPLG.................................................
Q07KV2_RHOP5/17-343GVE---------------------TLTKSY..................................................
Q484G4_COLP3/18-372VFE---------------------GNFWQFWSSHY.............................................
A0DGZ8_PARTE/156-556NYT---------------------DCAAGAFRNL..............................................
A7A7L5_BIFAD/6-324MKL---------------------MVKSIA..................................................
A3JPT3_9RHOB/10-350QDA---------------------IFNDLQSV................................................
A5EMI0_BRASB/26-386PEA---------------------TFAAFW..................................................
A4FKM9_SACEN/20-347DPG---------------------WGDLLANLL...............................................
A7V903_BACUN/5-297DAI---------------------TPTVLL..................................................
Q8IG66_CAEEL/330-720MFG---------------------TECNVTTIWP..............................................
Q7UES3_RHOBA/12-486NPS---------------------ANVTVFDETDLLIPGVQDDLAAVEKALAAGADVNQRSEQGDSPFLVAAFLGRDDIA
Q1WRZ8_LACS1/4-332YLG---------------------RIADSTRYAALAAL..........................................
Q8PXP5_METMA/13-333YLN---------------------LDYKGLNIFWED............................................
Q6AH04_LEIXX/3-320CGA---------------------VCLLLL..................................................
Q5CVD7_CRYPI/23-437CTY---------------------TLDGAPANFH..............................................
A0LT35_ACIC1/10-359AAN---------------------TALAAW..................................................
Q8KJJ2_RHILI/23-344LTD---------------------TLLDLS..................................................
Q17BV3_AEDAE/212-599GDV---------------------VVKNANLCKHNFW...........................................
A7F3R9_SCLS1/8-361RSD---------------------SWWIEATSPDITPYFGD.......................................
Q144E0_BURXL/4-320SLQ---------------------QMGPTR..................................................
Q83YQ9_STRGN/5-307MAT---------------------IDQSDFANF...............................................
Q07P25_RHOP5/21-323PIT---------------------AHDLAA..................................................
Q8DSB8_STRMU/14-327HDW---------------------IQAFFP..................................................
A0LP70_SYNFM/14-366LSV---------------------LGDRFY..................................................
A8H1P8_SHEPA/43-369HQA---------------------LANITAPA................................................
A6E8A8_9SPHI/14-335YYY---------------------TKEPLYKQFI..............................................
A5VFE0_SPHWW/65-420SGS---------------------EWLDRSGGIKYWAPWPE.......................................
A5LX53_STRPN/8-323PTT---------------------IFNLLN..................................................
Q8P802_XANCP/22-341WAG---------------------HPWWHPFV................................................
Q2HGI8_CHAGB/115-578AVA---------------------ADPALLRNVREPHVGFDVTDNDGGGGGGGG..........................
A6BII1_9FIRM/11-365AKE---------------------FLLTFW..................................................
Q9CHP8_LACLA/4-320STA---------------------INGIFD..................................................
A5N097_CLOK5/9-357RKQ---------------------SFIEQIKLYFT.............................................
Q8FTN8_COREF/16-398FAD---------------------LKFWLPNALL..............................................
Q6G5Q7_BARHE/17-365EKL---------------------LSMNNVG.................................................
A3H030_VIBCL/4-356VFG---------------------GSFSNL..................................................
A7AZT9_RUMGN/12-318GQL---------------------FDTAVPFSL...............................................
Q2NRT0_SODGM/9-399GAT---------------------IRFVVYDTNEVLGQTHPELFRHY.................................
A4CKW1_ROBBH/7-342VDV---------------------LHCIGV..................................................
A6FAM6_9GAMM/8-349EWF---------------------VPLSKPLILKL.............................................
A7V2Z2_BACUN/14-354TSI---------------------GTMLLVMLLGCTLL..........................................
Q00XL5_OSTTA/15-388AAH---------------------GLMTFTLT................................................
A4YYF7_BRASO/15-345QSN---------------------DLGHFLAQLF..............................................
Q1D0W9_MYXXD/39-356TKV---------------------LVFD....................................................
Q16PV5_AEDAE/243-647GVE---------------------MQLCKENGWSN.............................................
Q82ET0_STRAW/57-398HTL---------------------VKLALS..................................................
Q4JZS0_STRPN/5-327GFT---------------------EATLVF..................................................
Q931U6_STAAM/8-314QLD---------------------PFNPVF..................................................
Q7MGC8_VIBVY/15-336GYW---------------------GYLAQT..................................................
A6KZK8_BACV8/9-367TDN---------------------PTIDMSAFTLEM............................................
A4CUQ6_SYNPV/6-368SPL---------------------EFLSLS..................................................
Q5PLM9_SALPA/5-319LSL---------------------KNVLQK..................................................
A6P1P2_9FIRM/9-341WAG---------------------IRSALY..................................................
A5FYP6_ACICJ/4-317DNP---------------------PQGLLGGL................................................
Q7MQA5_VIBVY/5-328SKV---------------------TEVLSN..................................................
Q5X6W8_LEGPA/10-336TSL---------------------LATILSSSNIYFW...........................................
A7V3H1_BACUN/5-305...---------------------........................................................
Q64YD4_BACFR/4-349TSL---------------------TDLSRI..................................................
A2SCM7_METPP/5-359NLI---------------------SFYFEQ..................................................
A7ZZ73_ECOHS/5-329SNA---------------------SNAAYADS................................................
A5UMZ7_METS3/7-344SFS---------------------CVVYFM..................................................
A3YY52_9SYNE/16-323AAL---------------------LSASFS..................................................
A4AIT9_9ACTN/563-845LVN---------------------NFVGSA..................................................
A5N224_CLOK5/8-329LSD---------------------MVYGNV..................................................
E0TI88_PARBH/15-315EGV---------------------GVEFLL..................................................
A3L950_PSEAI/5-324PDI---------------------GGVLYA..................................................
A0E2L0_PARTE/17-375DNI---------------------AYVSTL..................................................
Q8A5U1_BACTN/9-318TFH---------------------LPVSWREL................................................
Q2C1R6_9GAMM/10-345KGF---------------------FLTGNI..................................................
A7A7B8_BIFAD/5-363TLK---------------------DLVLFL..................................................
Q4JYU7_STRPN/6-318KIV---------------------GSLIQR..................................................
A9VR59_BACWK/5-346IKS---------------------LLLGTA..................................................
A7VGI1_9CLOT/6-345IIG---------------------LFIAIVKMIPN.............................................
Q1QR03_NITHX/14-320WPG---------------------VIHLYL..................................................
A5ZDF6_9BACE/13-326...---------------------........................................................
Q16FE1_AEDAE/161-554KAH---------------------SLPCRNLWWAN.............................................
Q7CTZ0_AGRT5/8-329VGY---------------------FPDLWNASPR..............................................
Q8G7P7_BIFLO/17-373GGA---------------------VSGTLF..................................................
A1R1G8_ARTAT/18-357PAV---------------------IQLMTA..................................................
A1VHZ4_DESVV/11-319TWD---------------------ALVNLLGLNG..............................................
A0QPG5_MYCS2/9-326GLM---------------------SSYAPIEYVLNNAVLN........................................
A5EXU9_DICNV/19-351EPF---------------------PYVAVI..................................................
A6LGX6_PARD8/9-311QLL---------------------GVPVWG..................................................
Q11WP3_CYTH3/4-324VLN---------------------PDVPFVLSH...............................................
A0K1D5_ARTS2/296-671LTS---------------------FTDQGTGGAGRSGAGRTYDL....................................
A6KYR5_BACV8/6-309WTG---------------------LASSLL..................................................
Q0CZ95_ASPTN/77-482ELQ---------------------GSYLSELWNWYAEF..........................................
A0T1U4_VIBCL/8-303NIL---------------------KSYTLI..................................................
A3I592_9BACI/6-352LTW---------------------HALFSVE.................................................
A1TDU0_MYCVP/22-361PVA---------------------GISVQL..................................................

PF07786

A1HQT7_9FIRM/5-214I.R-----------------------------------------------------------------------------
A2SQB7_METLZ/5-231V.V-----------------------------------------------------------------------------
A9CIY2_AGRT5/15-234I.F-----------------------------------------------------------------------------
Q28R74_JANSC/28-249V.F-----------------------------------------------------------------------------
Q8PXM0_METMA/7-237I.L-----------------------------------------------------------------------------
A4EC93_9ACTN/4-221V.N-----------------------------------------------------------------------------
Q8U2K3_PYRFU/23-240I.Y-----------------------------------------------------------------------------
A7I8Y9_METB6/6-231V.I-----------------------------------------------------------------------------
A6G0Y4_9DELT/12-237IEA-----------------------------------------------------------------------------
A3CVR7_METMJ/5-231I.V-----------------------------------------------------------------------------
Q11IW8_MESSB/30-251I.F-----------------------------------------------------------------------------
A1TRD1_ACIAC/21-249I.H-----------------------------------------------------------------------------
A2SGN2_METPP/12-230I.S-----------------------------------------------------------------------------
A2STU6_METLZ/14-241V.Y-----------------------------------------------------------------------------
Q2K839_RHIEC/16-243I.Y-----------------------------------------------------------------------------
Q251W2_DESHY/5-221V.R-----------------------------------------------------------------------------
A0NYA1_9RHOB/5-227V.R-----------------------------------------------------------------------------
Q21VS3_RHOFD/16-244I.Y-----------------------------------------------------------------------------
Q0FKK0_9RHOB/7-221V.Y-----------------------------------------------------------------------------
Q2YRW9_BRUA2/16-233I.F-----------------------------------------------------------------------------
A2STU5_METLZ/19-252V.K-----------------------------------------------------------------------------
Q6SHI3_9BACT/5-214V.Y-----------------------------------------------------------------------------
Q0G6B2_9RHIZ/53-275V.F-----------------------------------------------------------------------------
A3YBL4_9GAMM/14-227I.F-----------------------------------------------------------------------------
A4FZP9_METM5/5-227I.Y-----------------------------------------------------------------------------
Q11N89_MESSB/6-227I.F-----------------------------------------------------------------------------
A4J1M2_DESRM/9-218I.I-----------------------------------------------------------------------------
Q6SGH9_9BACT/9-218V.Y-----------------------------------------------------------------------------
A1VNB1_POLNA/5-231I.Y-----------------------------------------------------------------------------
A3DGD5_CLOTH/11-220I.S-----------------------------------------------------------------------------
Q98KU6_RHILO/16-237I.F-----------------------------------------------------------------------------
A6VZM7_MARMS/12-224I.Y-----------------------------------------------------------------------------
A1W6I8_ACISJ/12-240I.Y-----------------------------------------------------------------------------
Q6M0I2_METMP/11-233I.Y-----------------------------------------------------------------------------
O26882_METTH/9-227I.V-----------------------------------------------------------------------------
Q92KE6_RHIME/23-246I.F-----------------------------------------------------------------------------
B1ZHM9_METPB/15-237I.F-----------------------------------------------------------------------------
Q2Y4H0_9ARCH/17-243V.V-----------------------------------------------------------------------------
O29726_ARCFU/2-207V.V-----------------------------------------------------------------------------
Q12ZG6_METBU/7-234I.I-----------------------------------------------------------------------------
A4BIP8_9GAMM/6-220V.W-----------------------------------------------------------------------------
Q8THP4_METAC/31-261I.L-----------------------------------------------------------------------------
Q46DC7_METBF/7-237I.V-----------------------------------------------------------------------------
Q2FN30_METHJ/7-229V.V-----------------------------------------------------------------------------
Q1YI63_MOBAS/15-237V.Y-----------------------------------------------------------------------------
Q1B004_RUBXD/18-243V.I-----------------------------------------------------------------------------
A6FRV3_9RHOB/4-228V.Y-----------------------------------------------------------------------------
Q1YJ44_MOBAS/24-246I.Y-----------------------------------------------------------------------------
Q26I67_FLABB/5-236L.V-----------------------------------------------------------------------------

PF05857

Q8KNJ7_SALTI/21-241AGL-----------------------------------------------------------------------------
A7LWV3_BACOV/16-233...-----------------------------------------------------------------------------
Q84A20_ECOLX/31-248...-----------------------------------------------------------------------------
A6TIJ3_KLEP7/24-240...-----------------------------------------------------------------------------
A5Z378_9FIRM/20-251RFY-----------------------------------------------------------------------------
A5KIL9_9FIRM/5-244TLF-----------------------------------------------------------------------------
Q5NWL3_AROAE/9-222LAF-----------------------------------------------------------------------------
Q88AH9_PSESM/14-243...-----------------------------------------------------------------------------
Q1H9V9_9ZZZZ/19-235LMM-----------------------------------------------------------------------------
A3JHE7_9ALTE/11-236SKY-----------------------------------------------------------------------------
A8F272_RICM5/12-244...-----------------------------------------------------------------------------
A4WGU9_ENT38/21-253GHQ-----------------------------------------------------------------------------
A7VEF3_9CLOT/9-245QVF-----------------------------------------------------------------------------
A6M0I9_CLOB8/13-266PSY-----------------------------------------------------------------------------
A4NTD4_HAEIF/7-239...-----------------------------------------------------------------------------
C1DKH3_AZOVD/14-243...-----------------------------------------------------------------------------
Q0VUV5_9ZZZZ/9-222LGG-----------------------------------------------------------------------------
A7VF03_9CLOT/8-229VFF-----------------------------------------------------------------------------
A4XUI8_PSEMY/4-231...-----------------------------------------------------------------------------
Q0B109_BURCM/9-222LYA-----------------------------------------------------------------------------
A4XH28_CALS8/24-230...-----------------------------------------------------------------------------
Q5ZHG7_9BACT/23-233VVG-----------------------------------------------------------------------------
Q4UUW2_XANC8/4-213...-----------------------------------------------------------------------------
FIMCH_DICNO/7-241LRF-----------------------------------------------------------------------------
A5TTI6_FUSNP/5-248IML-----------------------------------------------------------------------------
Q65AG0_YERPE/74-291...-----------------------------------------------------------------------------
Q2P3I2_XANOM/4-206...-----------------------------------------------------------------------------

PF04235

YXAH_BACSU/242-392--------------------------------------------------------------------------------
A3IC17_9BACI/222-377--------------------------------------------------------------------------------
A5VFY1_SPHWW/226-385--------------------------------------------------------------------------------
A9VP60_BACWK/224-378--------------------------------------------------------------------------------
A7AFV0_9PORP/228-389--------------------------------------------------------------------------------
B0T5F0_CAUSK/216-381--------------------------------------------------------------------------------
Q5LBX3_BACFN/231-393--------------------------------------------------------------------------------
A8FJB9_BACP2/218-375--------------------------------------------------------------------------------
Q4MVH1_BACCE/182-334--------------------------------------------------------------------------------
A7GNB8_BACCN/217-376--------------------------------------------------------------------------------
A8M3I5_SALAI/225-391--------------------------------------------------------------------------------
A6CU81_9BACI/142-303--------------------------------------------------------------------------------
Q3R094_XYLFA/261-419--------------------------------------------------------------------------------
Q8ZNL6_SALTY/215-375--------------------------------------------------------------------------------
Q31YW0_SHIBS/215-375--------------------------------------------------------------------------------
A5ZJ36_9BACE/227-388--------------------------------------------------------------------------------
Q5Z0S5_NOCFA/200-354--------------------------------------------------------------------------------
A3IA01_9BACI/163-335--------------------------------------------------------------------------------
Q5LAR8_BACFN/229-391--------------------------------------------------------------------------------
A5FKP1_FLAJ1/222-380--------------------------------------------------------------------------------
Q1CGS9_YERPN/216-376--------------------------------------------------------------------------------
Q08VU8_STIAD/181-346--------------------------------------------------------------------------------
A6LH60_PARD8/231-393--------------------------------------------------------------------------------
Q2NUE2_SODGM/217-377--------------------------------------------------------------------------------
Q4UWH0_XANC8/244-402--------------------------------------------------------------------------------
Q5L251_GEOKA/223-378--------------------------------------------------------------------------------
B9LP38_HALLT/238-398--------------------------------------------------------------------------------
A5CQC9_CLAM3/228-397--------------------------------------------------------------------------------
Q2BCM0_9BACI/228-382--------------------------------------------------------------------------------
Q5WBU3_BACSK/218-382--------------------------------------------------------------------------------
Q5LDG8_BACFN/245-405--------------------------------------------------------------------------------
B1KH41_SHEWM/231-384--------------------------------------------------------------------------------
A4EHF6_9RHOB/229-382--------------------------------------------------------------------------------
Q2N5U1_ERYLH/237-397--------------------------------------------------------------------------------
Q1D273_MYXXD/254-423--------------------------------------------------------------------------------
A1RM83_SHESW/239-392--------------------------------------------------------------------------------
A3V2Y2_9RHOB/212-368--------------------------------------------------------------------------------
Q0RI89_FRAAA/226-396--------------------------------------------------------------------------------
A0RC19_BACAH/265-424--------------------------------------------------------------------------------
Q1GR12_SPHAL/244-406--------------------------------------------------------------------------------
A3HTP0_9BACT/227-391--------------------------------------------------------------------------------
Q0C162_HYPNA/232-392--------------------------------------------------------------------------------
Q01SV0_SOLUE/222-364--------------------------------------------------------------------------------
Q9X356_BACAN/222-381--------------------------------------------------------------------------------
Q6HBG3_BACHK/154-304--------------------------------------------------------------------------------
A6F241_9ALTE/221-382--------------------------------------------------------------------------------
A7AF04_9PORP/59-221--------------------------------------------------------------------------------
A7M2T0_BACOV/229-391--------------------------------------------------------------------------------
Q2B965_9BACI/232-387--------------------------------------------------------------------------------
A3WAG6_9SPHN/263-424--------------------------------------------------------------------------------
Q0HGE7_SHESM/244-397--------------------------------------------------------------------------------
A8FH56_BACP2/222-385--------------------------------------------------------------------------------
Q5WCD3_BACSK/239-403--------------------------------------------------------------------------------
A4GA59_HERAR/238-403--------------------------------------------------------------------------------
YRKO_BACSU/224-387--------------------------------------------------------------------------------
Q7WHI1_BORBR/228-389--------------------------------------------------------------------------------
Q47SA7_THEFY/269-436--------------------------------------------------------------------------------
Q2P0R0_XANOM/244-402--------------------------------------------------------------------------------
Q21P05_SACD2/237-402--------------------------------------------------------------------------------
A4FQ93_SACEN/204-361--------------------------------------------------------------------------------
A3WF33_9SPHN/238-398--------------------------------------------------------------------------------
Q3IC82_PSEHT/208-361--------------------------------------------------------------------------------
Q2NDD6_ERYLH/264-425--------------------------------------------------------------------------------
A3XLE1_LEEBM/228-392--------------------------------------------------------------------------------
Q9HNH9_HALSA/232-393--------------------------------------------------------------------------------
A4YYJ4_BRASO/266-405--------------------------------------------------------------------------------
A3I7E6_9BACI/220-373--------------------------------------------------------------------------------
A4IKX9_GEOTN/224-379--------------------------------------------------------------------------------
Q9KFW4_BACHD/1-165--------------------------------------------------------------------------------
Q4A0U4_STAS1/90-261--------------------------------------------------------------------------------
Q8ERW4_OCEIH/226-381--------------------------------------------------------------------------------
Q7N6K6_PHOLL/210-370--------------------------------------------------------------------------------
A4ARZ9_MARSH/230-396--------------------------------------------------------------------------------
B1YLL9_EXIS2/215-367--------------------------------------------------------------------------------
A6L2L4_BACV8/234-394--------------------------------------------------------------------------------
A1WTH2_HALHL/248-410--------------------------------------------------------------------------------
A3UFR8_9RHOB/215-377--------------------------------------------------------------------------------
A6CPZ4_9BACI/231-386--------------------------------------------------------------------------------
A1S3E3_SHEAM/216-369--------------------------------------------------------------------------------
Q094W5_STIAD/188-355--------------------------------------------------------------------------------
Q9AA92_CAUCR/270-432--------------------------------------------------------------------------------
Q0ARL9_MARMM/225-387--------------------------------------------------------------------------------
Q07YN3_SHEFN/228-381--------------------------------------------------------------------------------
A0XYG1_9GAMM/200-353--------------------------------------------------------------------------------
Q1NBB8_9SPHN/227-389--------------------------------------------------------------------------------
A8F9F5_BACP2/224-375--------------------------------------------------------------------------------
A7AGL6_9PORP/228-390--------------------------------------------------------------------------------
A6L9Q0_PARD8/227-389--------------------------------------------------------------------------------
B0T422_CAUSK/230-391--------------------------------------------------------------------------------
A6WB03_KINRD/147-299--------------------------------------------------------------------------------
Q64ZH4_BACFR/244-394--------------------------------------------------------------------------------
Q49WA7_STAS1/224-378--------------------------------------------------------------------------------
A6T3W0_JANMA/238-403--------------------------------------------------------------------------------
Q47R13_THEFY/238-395--------------------------------------------------------------------------------
A8MJB9_ALKOO/219-378--------------------------------------------------------------------------------
A3UE46_9RHOB/225-387--------------------------------------------------------------------------------
A6TNH6_ALKMQ/249-412--------------------------------------------------------------------------------
Q1D7M3_MYXXD/255-425--------------------------------------------------------------------------------
Q6NJJ5_CORDI/212-362--------------------------------------------------------------------------------
A3ID96_9BACI/222-373--------------------------------------------------------------------------------
A5UQH7_ROSS1/237-401--------------------------------------------------------------------------------
A7MLK3_CROS8/215-375--------------------------------------------------------------------------------
Q9KE13_BACHD/42-195--------------------------------------------------------------------------------
A8GC25_SERP5/223-383--------------------------------------------------------------------------------
Q8A424_BACTN/229-391--------------------------------------------------------------------------------
Q9KFA2_BACHD/226-379--------------------------------------------------------------------------------
B4SQY9_STRM5/245-403--------------------------------------------------------------------------------
Q9KEU3_BACHD/250-400--------------------------------------------------------------------------------
A4FQT6_SACEN/171-324--------------------------------------------------------------------------------
A6TBN7_KLEP7/215-375--------------------------------------------------------------------------------
A4QGF8_CORGB/53-205--------------------------------------------------------------------------------
A3UEP5_9RHOB/214-372--------------------------------------------------------------------------------
Q4KHM8_PSEF5/226-387--------------------------------------------------------------------------------
A4F774_SACEN/171-329--------------------------------------------------------------------------------
A0Z0S4_9GAMM/214-384--------------------------------------------------------------------------------
Q9K7D7_BACHD/224-377--------------------------------------------------------------------------------
A3I5J9_9BACI/189-342--------------------------------------------------------------------------------
A6KYE7_BACV8/229-390--------------------------------------------------------------------------------
Q2G3S1_NOVAD/241-402--------------------------------------------------------------------------------
A7NS93_ROSCS/241-405--------------------------------------------------------------------------------
A4WCI7_ENT38/215-375--------------------------------------------------------------------------------
Q1IVW5_DEIGD/222-381--------------------------------------------------------------------------------
A4AN58_MARSH/230-392--------------------------------------------------------------------------------
Q8EH35_SHEON/233-386--------------------------------------------------------------------------------
A5PD45_9SPHN/224-385--------------------------------------------------------------------------------
Q9RS74_DEIRA/223-382--------------------------------------------------------------------------------
A3HYS5_9BACT/265-426--------------------------------------------------------------------------------
Q6D3N4_ERWCT/227-387--------------------------------------------------------------------------------
A5FKP0_FLAJ1/222-380--------------------------------------------------------------------------------
A6LGL5_PARD8/234-396--------------------------------------------------------------------------------
Q3IPY1_NATPD/256-418--------------------------------------------------------------------------------
Q4LA20_STAHJ/233-386--------------------------------------------------------------------------------
Q5YUW9_NOCFA/233-388--------------------------------------------------------------------------------
YAMY_BACAD/182-335--------------------------------------------------------------------------------
B9LDU3_CHLSY/241-405--------------------------------------------------------------------------------
Q9K6N5_BACHD/237-398--------------------------------------------------------------------------------
Q8EL60_OCEIH/225-388--------------------------------------------------------------------------------
A4BFW6_9GAMM/238-400--------------------------------------------------------------------------------

PF07779

CAS1_CRYNJ/373-830EWK---------------------GWMQIA--------------------------------------------------
Q6CDI8_YARLI/295-780EWK---------------------GWMQII--------------------------------------------------
A8N197_COPC7/296-746EWK---------------------GWMQ..--------------------------------------------------
E9GCH2_DAPPU/311-808EWK---------------------GWMQLV--------------------------------------------------
D6WF47_TRICA/331-820EWK---------------------GWMQLV--------------------------------------------------
B3NSS9_DROER/352-855ELR---------------------GWILLV--------------------------------------------------
B2RAS9_HUMAN/293-785EWK---------------------GWMQLV--------------------------------------------------
CASD1_MOUSE/293-785EWK---------------------GWMQLV--------------------------------------------------

PF10129

A1R109_ARTAT/441-826------------------------------------------------------------------------------QF
A0K1D5_ARTS2/295-678------------------------------------------------------------------------------QF
A5CT98_CLAM3/468-850------------------------------------------------------------------------------DY
A2SCM7_METPP/4-366------------------------------------------------------------------------------EQ
A1TNJ8_ACIAC/18-379------------------------------------------------------------------------------AK
A6SUD0_JANMA/21-383------------------------------------------------------------------------------EN
Q1D6T0_MYXXD/55-417------------------------------------------------------------------------------ED
Q11B97_MESSB/2-386------------------------------------------------------------------------------SH
Q098N2_STIAD/51-435------------------------------------------------------------------------------RN
Q7CT44_AGRT5/2-385------------------------------------------------------------------------------FD
A5F6W9_VIBC3/3-362------------------------------------------------------------------------------TM
B2TAN0_BURPP/16-364------------------------------------------------------------------------------VQ
Q1BP03_BURCA/9-357------------------------------------------------------------------------------HK
B2JS58_BURP8/58-406------------------------------------------------------------------------------DT
Q13NS3_BURXL/7-355------------------------------------------------------------------------------DT
A9ALA8_BURM1/18-368------------------------------------------------------------------------------AS
A5XMC5_BURML/14-364------------------------------------------------------------------------------AS
Q1LDM8_RALME/9-370------------------------------------------------------------------------------AQ
A1B1M7_PARDP/3-363------------------------------------------------------------------------------EH
Q5FTQ3_GLUOX/17-367------------------------------------------------------------------------------AH
Q89UF3_BRAJA/67-422------------------------------------------------------------------------------EH
Q132X2_RHOPS/15-370------------------------------------------------------------------------------AD
Q134C6_RHOPS/15-370------------------------------------------------------------------------------AD
Q138V8_RHOPS/8-363------------------------------------------------------------------------------AD
Q89KT4_BRAJA/82-438------------------------------------------------------------------------------DF
A4YU73_BRASO/12-368------------------------------------------------------------------------------DH
Q6N6S8_RHOPA/12-368------------------------------------------------------------------------------AN
Q1QFJ8_NITHX/39-395------------------------------------------------------------------------------SN
Q89VE5_BRAJA/37-393------------------------------------------------------------------------------KQ
Q07GY5_RHOP5/35-391------------------------------------------------------------------------------KQ
Q6N0J3_RHOPA/44-400------------------------------------------------------------------------------KQ
Q3SWD7_NITWN/36-392------------------------------------------------------------------------------KQ
Q89CC1_BRAJA/15-372------------------------------------------------------------------------------SH
Q130V7_RHOPS/19-375------------------------------------------------------------------------------EN
A4YYN0_BRASO/36-389------------------------------------------------------------------------------RE
Q89EQ8_BRAJA/32-383------------------------------------------------------------------------------DQ
A5EUM2_BRASB/9-363------------------------------------------------------------------------------AD
Q87XJ3_PSESM/5-366------------------------------------------------------------------------------GN
Q0BVC0_GRABC/14-370------------------------------------------------------------------------------AD
A5G015_ACICJ/9-360------------------------------------------------------------------------------AK
B0U809_METS4/3-358------------------------------------------------------------------------------TD
A6UE98_SINMW/23-375------------------------------------------------------------------------------EQ
Q2K344_RHIEC/23-378------------------------------------------------------------------------------MN
Q2YRC8_BRUA2/6-358------------------------------------------------------------------------------KK
Q983D5_RHILO/37-389------------------------------------------------------------------------------KN
Q6G5Q7_BARHE/16-368------------------------------------------------------------------------------TQ
A1UR89_BARBK/16-368------------------------------------------------------------------------------TQ
Q0FH42_9RHOB/16-377------------------------------------------------------------------------------ER
A3VIJ0_9RHOB/5-370------------------------------------------------------------------------------QN
A3SZ27_9RHOB/26-392------------------------------------------------------------------------------DQ
Q3J1N1_RHOS4/11-372------------------------------------------------------------------------------QK
A3V5J7_9RHOB/13-374------------------------------------------------------------------------------KD
Q11DW2_MESSB/11-364------------------------------------------------------------------------------EQ
Q0G5B4_9RHIZ/12-366------------------------------------------------------------------------------DE
Q1YF78_MOBAS/13-366------------------------------------------------------------------------------TM
A3X8H2_9RHOB/38-419------------------------------------------------------------------------------NN
Q1GGF0_SILST/47-428------------------------------------------------------------------------------ND
Q5LPG0_SILPO/35-409------------------------------------------------------------------------------GD
A6DWM4_9RHOB/18-395------------------------------------------------------------------------------EN
Q169P8_ROSDO/29-397------------------------------------------------------------------------------NR
Q2PYB5_9BACT/21-406------------------------------------------------------------------------------ND
Q0BQN1_GRABC/63-424------------------------------------------------------------------------------DD

PF01757

A8DMZ1_STALU/12-334................................................................................
Q035D4_LACC3/20-369................................................................................
A8G974_SERP5/5-314................................................................................
Q11WN8_CYTH3/14-339...............................................................................T
A7LV98_BACOV/4-296................................................................................
Q97ER7_CLOAB/6-334..............................................................................AA
OPGC_SHIF8/9-357................................................................................
Q07PA2_RHOP5/14-375................................................................................
Q30BE9_ENTFL/7-326................................................................................
A1HPJ5_9FIRM/6-350................................................................................
Q4P0M9_USTMA/127-516..............................................................DWQISTSLGDIVVGLLRL
A7LV97_BACOV/24-312................................................................................
Q1ZBT2_9GAMM/5-295................................................................................
Q1QWT8_CHRSD/4-315................................................................................
Q2T7M4_BURTA/6-373..........................................................................DVFTDG
A4B9D7_9GAMM/5-375................................................................................
Q5LBM3_BACFN/8-315................................................................................
Q04X27_LEPBL/44-373................................................................................
A5ZUV3_9FIRM/6-346................................................................................
A1VGB5_DESVV/30-339................................................................................
B2JGA6_BURP8/53-400................................................................................
Q9XAP7_STRCO/24-348................................................................................
Q07KV2_RHOP5/17-343................................................................................
Q484G4_COLP3/18-372.............................................................................FTF
A0DGZ8_PARTE/156-556...............................................................................L
A7A7L5_BIFAD/6-324................................................................................
A3JPT3_9RHOB/10-350................................................................................
A5EMI0_BRASB/26-386................................................................................
A4FKM9_SACEN/20-347...............................................................................M
A7V903_BACUN/5-297................................................................................
Q8IG66_CAEEL/330-720...............................................................................H
Q7UES3_RHOBA/12-486EVLLDHDADPELGNHKGERPIDVMRAPWGTTEFVAGLLQIEVDREDVESGREKIAAMMGETLSGPSSGMATDGGANAVDW
Q1WRZ8_LACS1/4-332..........................................................................YGAGTP
Q8PXP5_METMA/13-333............................................................................LTYY
Q6AH04_LEIXX/3-320................................................................................
Q5CVD7_CRYPI/23-437..............................................................................LY
A0LT35_ACIC1/10-359................................................................................
Q8KJJ2_RHILI/23-344................................................................................
Q17BV3_AEDAE/212-599............................................................................NNIL
A7F3R9_SCLS1/8-361........................................................................AVKSLLYH
Q144E0_BURXL/4-320................................................................................
Q83YQ9_STRGN/5-307...............................................................................F
Q07P25_RHOP5/21-323................................................................................
Q8DSB8_STRMU/14-327................................................................................
A0LP70_SYNFM/14-366................................................................................
A8H1P8_SHEPA/43-369................................................................................
A6E8A8_9SPHI/14-335..............................................................................GI
A5VFE0_SPHWW/65-420.......................................................................PGLTGAAKD
A5LX53_STRPN/8-323................................................................................
Q8P802_XANCP/22-341................................................................................
Q2HGI8_CHAGB/115-578...........................................................GSVFALAVWAWAGEMARFVHV
A6BII1_9FIRM/11-365................................................................................
Q9CHP8_LACLA/4-320................................................................................
A5N097_CLOK5/9-357..............................................................................SV
Q8FTN8_COREF/16-398..............................................................................IH
Q6G5Q7_BARHE/17-365................................................................................
A3H030_VIBCL/4-356................................................................................
A7AZT9_RUMGN/12-318................................................................................
Q2NRT0_SODGM/9-399.................................................................MDNVQLAFNSVLQLL
A4CKW1_ROBBH/7-342................................................................................
A6FAM6_9GAMM/8-349..............................................................................SL
A7V2Z2_BACUN/14-354...........................................................................PLPLK
Q00XL5_OSTTA/15-388................................................................................
A4YYF7_BRASO/15-345...............................................................................M
Q1D0W9_MYXXD/39-356................................................................................
Q16PV5_AEDAE/243-647..............................................................................FL
Q82ET0_STRAW/57-398................................................................................
Q4JZS0_STRPN/5-327................................................................................
Q931U6_STAAM/8-314................................................................................
Q7MGC8_VIBVY/15-336................................................................................
A6KZK8_BACV8/9-367.............................................................................TIT
A4CUQ6_SYNPV/6-368................................................................................
Q5PLM9_SALPA/5-319................................................................................
A6P1P2_9FIRM/9-341................................................................................
A5FYP6_ACICJ/4-317................................................................................
Q7MQA5_VIBVY/5-328................................................................................
Q5X6W8_LEGPA/10-336............................................................................KFIN
A7V3H1_BACUN/5-305................................................................................
Q64YD4_BACFR/4-349................................................................................
A2SCM7_METPP/5-359................................................................................
A7ZZ73_ECOHS/5-329................................................................................
A5UMZ7_METS3/7-344................................................................................
A3YY52_9SYNE/16-323................................................................................
A4AIT9_9ACTN/563-845................................................................................
A5N224_CLOK5/8-329................................................................................
E0TI88_PARBH/15-315................................................................................
A3L950_PSEAI/5-324................................................................................
A0E2L0_PARTE/17-375................................................................................
Q8A5U1_BACTN/9-318................................................................................
Q2C1R6_9GAMM/10-345................................................................................
A7A7B8_BIFAD/5-363................................................................................
Q4JYU7_STRPN/6-318................................................................................
A9VR59_BACWK/5-346................................................................................
A7VGI1_9CLOT/6-345..............................................................................FL
Q1QR03_NITHX/14-320................................................................................
A5ZDF6_9BACE/13-326................................................................................
Q16FE1_AEDAE/161-554..............................................................................LV
Q7CTZ0_AGRT5/8-329..............................................................................EI
Q8G7P7_BIFLO/17-373................................................................................
A1R1G8_ARTAT/18-357................................................................................
A1VHZ4_DESVV/11-319...............................................................................F
A0QPG5_MYCS2/9-326.........................................................................VYYAGIN
A5EXU9_DICNV/19-351................................................................................
A6LGX6_PARD8/9-311................................................................................
Q11WP3_CYTH3/4-324................................................................................
A0K1D5_ARTS2/296-671.....................................................................YTGMQGLLQFP
A6KYR5_BACV8/6-309................................................................................
Q0CZ95_ASPTN/77-482...........................................................................KNFSF
A0T1U4_VIBCL/8-303................................................................................
A3I592_9BACI/6-352................................................................................
A1TDU0_MYCVP/22-361................................................................................

PF07786

A1HQT7_9FIRM/5-214--------------------------------------------------------------------------------
A2SQB7_METLZ/5-231--------------------------------------------------------------------------------
A9CIY2_AGRT5/15-234--------------------------------------------------------------------------------
Q28R74_JANSC/28-249--------------------------------------------------------------------------------
Q8PXM0_METMA/7-237--------------------------------------------------------------------------------
A4EC93_9ACTN/4-221--------------------------------------------------------------------------------
Q8U2K3_PYRFU/23-240--------------------------------------------------------------------------------
A7I8Y9_METB6/6-231--------------------------------------------------------------------------------
A6G0Y4_9DELT/12-237--------------------------------------------------------------------------------
A3CVR7_METMJ/5-231--------------------------------------------------------------------------------
Q11IW8_MESSB/30-251--------------------------------------------------------------------------------
A1TRD1_ACIAC/21-249--------------------------------------------------------------------------------
A2SGN2_METPP/12-230--------------------------------------------------------------------------------
A2STU6_METLZ/14-241--------------------------------------------------------------------------------
Q2K839_RHIEC/16-243--------------------------------------------------------------------------------
Q251W2_DESHY/5-221--------------------------------------------------------------------------------
A0NYA1_9RHOB/5-227--------------------------------------------------------------------------------
Q21VS3_RHOFD/16-244--------------------------------------------------------------------------------
Q0FKK0_9RHOB/7-221--------------------------------------------------------------------------------
Q2YRW9_BRUA2/16-233--------------------------------------------------------------------------------
A2STU5_METLZ/19-252--------------------------------------------------------------------------------
Q6SHI3_9BACT/5-214--------------------------------------------------------------------------------
Q0G6B2_9RHIZ/53-275--------------------------------------------------------------------------------
A3YBL4_9GAMM/14-227--------------------------------------------------------------------------------
A4FZP9_METM5/5-227--------------------------------------------------------------------------------
Q11N89_MESSB/6-227--------------------------------------------------------------------------------
A4J1M2_DESRM/9-218--------------------------------------------------------------------------------
Q6SGH9_9BACT/9-218--------------------------------------------------------------------------------
A1VNB1_POLNA/5-231--------------------------------------------------------------------------------
A3DGD5_CLOTH/11-220--------------------------------------------------------------------------------
Q98KU6_RHILO/16-237--------------------------------------------------------------------------------
A6VZM7_MARMS/12-224--------------------------------------------------------------------------------
A1W6I8_ACISJ/12-240--------------------------------------------------------------------------------
Q6M0I2_METMP/11-233--------------------------------------------------------------------------------
O26882_METTH/9-227--------------------------------------------------------------------------------
Q92KE6_RHIME/23-246--------------------------------------------------------------------------------
B1ZHM9_METPB/15-237--------------------------------------------------------------------------------
Q2Y4H0_9ARCH/17-243--------------------------------------------------------------------------------
O29726_ARCFU/2-207--------------------------------------------------------------------------------
Q12ZG6_METBU/7-234--------------------------------------------------------------------------------
A4BIP8_9GAMM/6-220--------------------------------------------------------------------------------
Q8THP4_METAC/31-261--------------------------------------------------------------------------------
Q46DC7_METBF/7-237--------------------------------------------------------------------------------
Q2FN30_METHJ/7-229--------------------------------------------------------------------------------
Q1YI63_MOBAS/15-237--------------------------------------------------------------------------------
Q1B004_RUBXD/18-243--------------------------------------------------------------------------------
A6FRV3_9RHOB/4-228--------------------------------------------------------------------------------
Q1YJ44_MOBAS/24-246--------------------------------------------------------------------------------
Q26I67_FLABB/5-236--------------------------------------------------------------------------------

PF05857

Q8KNJ7_SALTI/21-241--------------------------------------------------------------------------------
A7LWV3_BACOV/16-233--------------------------------------------------------------------------------
Q84A20_ECOLX/31-248--------------------------------------------------------------------------------
A6TIJ3_KLEP7/24-240--------------------------------------------------------------------------------
A5Z378_9FIRM/20-251--------------------------------------------------------------------------------
A5KIL9_9FIRM/5-244--------------------------------------------------------------------------------
Q5NWL3_AROAE/9-222--------------------------------------------------------------------------------
Q88AH9_PSESM/14-243--------------------------------------------------------------------------------
Q1H9V9_9ZZZZ/19-235--------------------------------------------------------------------------------
A3JHE7_9ALTE/11-236--------------------------------------------------------------------------------
A8F272_RICM5/12-244--------------------------------------------------------------------------------
A4WGU9_ENT38/21-253--------------------------------------------------------------------------------
A7VEF3_9CLOT/9-245--------------------------------------------------------------------------------
A6M0I9_CLOB8/13-266--------------------------------------------------------------------------------
A4NTD4_HAEIF/7-239--------------------------------------------------------------------------------
C1DKH3_AZOVD/14-243--------------------------------------------------------------------------------
Q0VUV5_9ZZZZ/9-222--------------------------------------------------------------------------------
A7VF03_9CLOT/8-229--------------------------------------------------------------------------------
A4XUI8_PSEMY/4-231--------------------------------------------------------------------------------
Q0B109_BURCM/9-222--------------------------------------------------------------------------------
A4XH28_CALS8/24-230--------------------------------------------------------------------------------
Q5ZHG7_9BACT/23-233--------------------------------------------------------------------------------
Q4UUW2_XANC8/4-213--------------------------------------------------------------------------------
FIMCH_DICNO/7-241--------------------------------------------------------------------------------
A5TTI6_FUSNP/5-248--------------------------------------------------------------------------------
Q65AG0_YERPE/74-291--------------------------------------------------------------------------------
Q2P3I2_XANOM/4-206--------------------------------------------------------------------------------

PF04235

YXAH_BACSU/242-392--------------------------------------------------------------------------------
A3IC17_9BACI/222-377--------------------------------------------------------------------------------
A5VFY1_SPHWW/226-385--------------------------------------------------------------------------------
A9VP60_BACWK/224-378--------------------------------------------------------------------------------
A7AFV0_9PORP/228-389--------------------------------------------------------------------------------
B0T5F0_CAUSK/216-381--------------------------------------------------------------------------------
Q5LBX3_BACFN/231-393--------------------------------------------------------------------------------
A8FJB9_BACP2/218-375--------------------------------------------------------------------------------
Q4MVH1_BACCE/182-334--------------------------------------------------------------------------------
A7GNB8_BACCN/217-376--------------------------------------------------------------------------------
A8M3I5_SALAI/225-391--------------------------------------------------------------------------------
A6CU81_9BACI/142-303--------------------------------------------------------------------------------
Q3R094_XYLFA/261-419--------------------------------------------------------------------------------
Q8ZNL6_SALTY/215-375--------------------------------------------------------------------------------
Q31YW0_SHIBS/215-375--------------------------------------------------------------------------------
A5ZJ36_9BACE/227-388--------------------------------------------------------------------------------
Q5Z0S5_NOCFA/200-354--------------------------------------------------------------------------------
A3IA01_9BACI/163-335--------------------------------------------------------------------------------
Q5LAR8_BACFN/229-391--------------------------------------------------------------------------------
A5FKP1_FLAJ1/222-380--------------------------------------------------------------------------------
Q1CGS9_YERPN/216-376--------------------------------------------------------------------------------
Q08VU8_STIAD/181-346--------------------------------------------------------------------------------
A6LH60_PARD8/231-393--------------------------------------------------------------------------------
Q2NUE2_SODGM/217-377--------------------------------------------------------------------------------
Q4UWH0_XANC8/244-402--------------------------------------------------------------------------------
Q5L251_GEOKA/223-378--------------------------------------------------------------------------------
B9LP38_HALLT/238-398--------------------------------------------------------------------------------
A5CQC9_CLAM3/228-397--------------------------------------------------------------------------------
Q2BCM0_9BACI/228-382--------------------------------------------------------------------------------
Q5WBU3_BACSK/218-382--------------------------------------------------------------------------------
Q5LDG8_BACFN/245-405--------------------------------------------------------------------------------
B1KH41_SHEWM/231-384--------------------------------------------------------------------------------
A4EHF6_9RHOB/229-382--------------------------------------------------------------------------------
Q2N5U1_ERYLH/237-397--------------------------------------------------------------------------------
Q1D273_MYXXD/254-423--------------------------------------------------------------------------------
A1RM83_SHESW/239-392--------------------------------------------------------------------------------
A3V2Y2_9RHOB/212-368--------------------------------------------------------------------------------
Q0RI89_FRAAA/226-396--------------------------------------------------------------------------------
A0RC19_BACAH/265-424--------------------------------------------------------------------------------
Q1GR12_SPHAL/244-406--------------------------------------------------------------------------------
A3HTP0_9BACT/227-391--------------------------------------------------------------------------------
Q0C162_HYPNA/232-392--------------------------------------------------------------------------------
Q01SV0_SOLUE/222-364--------------------------------------------------------------------------------
Q9X356_BACAN/222-381--------------------------------------------------------------------------------
Q6HBG3_BACHK/154-304--------------------------------------------------------------------------------
A6F241_9ALTE/221-382--------------------------------------------------------------------------------
A7AF04_9PORP/59-221--------------------------------------------------------------------------------
A7M2T0_BACOV/229-391--------------------------------------------------------------------------------
Q2B965_9BACI/232-387--------------------------------------------------------------------------------
A3WAG6_9SPHN/263-424--------------------------------------------------------------------------------
Q0HGE7_SHESM/244-397--------------------------------------------------------------------------------
A8FH56_BACP2/222-385--------------------------------------------------------------------------------
Q5WCD3_BACSK/239-403--------------------------------------------------------------------------------
A4GA59_HERAR/238-403--------------------------------------------------------------------------------
YRKO_BACSU/224-387--------------------------------------------------------------------------------
Q7WHI1_BORBR/228-389--------------------------------------------------------------------------------
Q47SA7_THEFY/269-436--------------------------------------------------------------------------------
Q2P0R0_XANOM/244-402--------------------------------------------------------------------------------
Q21P05_SACD2/237-402--------------------------------------------------------------------------------
A4FQ93_SACEN/204-361--------------------------------------------------------------------------------
A3WF33_9SPHN/238-398--------------------------------------------------------------------------------
Q3IC82_PSEHT/208-361--------------------------------------------------------------------------------
Q2NDD6_ERYLH/264-425--------------------------------------------------------------------------------
A3XLE1_LEEBM/228-392--------------------------------------------------------------------------------
Q9HNH9_HALSA/232-393--------------------------------------------------------------------------------
A4YYJ4_BRASO/266-405--------------------------------------------------------------------------------
A3I7E6_9BACI/220-373--------------------------------------------------------------------------------
A4IKX9_GEOTN/224-379--------------------------------------------------------------------------------
Q9KFW4_BACHD/1-165--------------------------------------------------------------------------------
Q4A0U4_STAS1/90-261--------------------------------------------------------------------------------
Q8ERW4_OCEIH/226-381--------------------------------------------------------------------------------
Q7N6K6_PHOLL/210-370--------------------------------------------------------------------------------
A4ARZ9_MARSH/230-396--------------------------------------------------------------------------------
B1YLL9_EXIS2/215-367--------------------------------------------------------------------------------
A6L2L4_BACV8/234-394--------------------------------------------------------------------------------
A1WTH2_HALHL/248-410--------------------------------------------------------------------------------
A3UFR8_9RHOB/215-377--------------------------------------------------------------------------------
A6CPZ4_9BACI/231-386--------------------------------------------------------------------------------
A1S3E3_SHEAM/216-369--------------------------------------------------------------------------------
Q094W5_STIAD/188-355--------------------------------------------------------------------------------
Q9AA92_CAUCR/270-432--------------------------------------------------------------------------------
Q0ARL9_MARMM/225-387--------------------------------------------------------------------------------
Q07YN3_SHEFN/228-381--------------------------------------------------------------------------------
A0XYG1_9GAMM/200-353--------------------------------------------------------------------------------
Q1NBB8_9SPHN/227-389--------------------------------------------------------------------------------
A8F9F5_BACP2/224-375--------------------------------------------------------------------------------
A7AGL6_9PORP/228-390--------------------------------------------------------------------------------
A6L9Q0_PARD8/227-389--------------------------------------------------------------------------------
B0T422_CAUSK/230-391--------------------------------------------------------------------------------
A6WB03_KINRD/147-299--------------------------------------------------------------------------------
Q64ZH4_BACFR/244-394--------------------------------------------------------------------------------
Q49WA7_STAS1/224-378--------------------------------------------------------------------------------
A6T3W0_JANMA/238-403--------------------------------------------------------------------------------
Q47R13_THEFY/238-395--------------------------------------------------------------------------------
A8MJB9_ALKOO/219-378--------------------------------------------------------------------------------
A3UE46_9RHOB/225-387--------------------------------------------------------------------------------
A6TNH6_ALKMQ/249-412--------------------------------------------------------------------------------
Q1D7M3_MYXXD/255-425--------------------------------------------------------------------------------
Q6NJJ5_CORDI/212-362--------------------------------------------------------------------------------
A3ID96_9BACI/222-373--------------------------------------------------------------------------------
A5UQH7_ROSS1/237-401--------------------------------------------------------------------------------
A7MLK3_CROS8/215-375--------------------------------------------------------------------------------
Q9KE13_BACHD/42-195--------------------------------------------------------------------------------
A8GC25_SERP5/223-383--------------------------------------------------------------------------------
Q8A424_BACTN/229-391--------------------------------------------------------------------------------
Q9KFA2_BACHD/226-379--------------------------------------------------------------------------------
B4SQY9_STRM5/245-403--------------------------------------------------------------------------------
Q9KEU3_BACHD/250-400--------------------------------------------------------------------------------
A4FQT6_SACEN/171-324--------------------------------------------------------------------------------
A6TBN7_KLEP7/215-375--------------------------------------------------------------------------------
A4QGF8_CORGB/53-205--------------------------------------------------------------------------------
A3UEP5_9RHOB/214-372--------------------------------------------------------------------------------
Q4KHM8_PSEF5/226-387--------------------------------------------------------------------------------
A4F774_SACEN/171-329--------------------------------------------------------------------------------
A0Z0S4_9GAMM/214-384--------------------------------------------------------------------------------
Q9K7D7_BACHD/224-377--------------------------------------------------------------------------------
A3I5J9_9BACI/189-342--------------------------------------------------------------------------------
A6KYE7_BACV8/229-390--------------------------------------------------------------------------------
Q2G3S1_NOVAD/241-402--------------------------------------------------------------------------------
A7NS93_ROSCS/241-405--------------------------------------------------------------------------------
A4WCI7_ENT38/215-375--------------------------------------------------------------------------------
Q1IVW5_DEIGD/222-381--------------------------------------------------------------------------------
A4AN58_MARSH/230-392--------------------------------------------------------------------------------
Q8EH35_SHEON/233-386--------------------------------------------------------------------------------
A5PD45_9SPHN/224-385--------------------------------------------------------------------------------
Q9RS74_DEIRA/223-382--------------------------------------------------------------------------------
A3HYS5_9BACT/265-426--------------------------------------------------------------------------------
Q6D3N4_ERWCT/227-387--------------------------------------------------------------------------------
A5FKP0_FLAJ1/222-380--------------------------------------------------------------------------------
A6LGL5_PARD8/234-396--------------------------------------------------------------------------------
Q3IPY1_NATPD/256-418--------------------------------------------------------------------------------
Q4LA20_STAHJ/233-386--------------------------------------------------------------------------------
Q5YUW9_NOCFA/233-388--------------------------------------------------------------------------------
YAMY_BACAD/182-335--------------------------------------------------------------------------------
B9LDU3_CHLSY/241-405--------------------------------------------------------------------------------
Q9K6N5_BACHD/237-398--------------------------------------------------------------------------------
Q8EL60_OCEIH/225-388--------------------------------------------------------------------------------
A4BFW6_9GAMM/238-400--------------------------------------------------------------------------------

PF07779

CAS1_CRYNJ/373-830------------------------------------------------------------------------------IL
Q6CDI8_YARLI/295-780------------------------------------------------------------------------------IL
A8N197_COPC7/296-746------------------------------------------------------------------------------..
E9GCH2_DAPPU/311-808------------------------------------------------------------------------------IL
D6WF47_TRICA/331-820------------------------------------------------------------------------------IL
B3NSS9_DROER/352-855------------------------------------------------------------------------------VL
B2RAS9_HUMAN/293-785------------------------------------------------------------------------------IL
CASD1_MOUSE/293-785------------------------------------------------------------------------------IL

PF10129

A1R109_ARTAT/441-826PVPQGLIPALLLLQVG------------------PWQ------FNIMGLY------VVLLLISPL-------------I-
A0K1D5_ARTS2/295-678PVSGAVIPAVLLLQFG------------------PWQ------FNVMGLY------VIMLLVSPL-------------I-
A5CT98_CLAM3/468-850PPPWYAIRDLLLLRMG------------------PWV------FNIMGLF------VVLTLLVPA-------------V-
A2SCM7_METPP/4-366PVT..AFFSGLLLIYS------------------PPL------LDILPLY------VVFMVLSPL-------------L-
A1TNJ8_ACIAC/18-379PLE..ALVGGLLLVYE------------------PPL------LDILPIY------VLFMLASPW-------------V-
A6SUD0_JANMA/21-383PVT..GLLAGILLIYN------------------PPL------LDILPLY------VMLLLISPW-------------I-
Q1D6T0_MYXXD/55-417PFT..ALWSSLFLLYC------------------PPL------LDILPLY------VVLLLLTPF-------------I-
Q11B97_MESSB/2-386DPF..YAIASLLLLYQ------------------PTY------MDILPQY------IIYMLVSPP-------------L-
Q098N2_STIAD/51-435DWG..FALAAAALLYQ------------------PTY------MDILPQY------IVYLALSPP-------------L-
Q7CT44_AGRT5/2-385DPL..RLAAIATFLFQ------------------PTF------MDILPQY------IVYMLFAPV-------------L-
A5F6W9_VIBC3/3-362PFM..TMLMSFLLLNK------------------PAY------LEILPLY------IMYMLLFPL-------------A-
B2TAN0_BURPP/16-364PLR..EAFDIMLLRRQ------------------PYL------SSVLPMY------VIFALSVPF-------------A-
Q1BP03_BURCA/9-357PLA..ALRDILLFRRQ------------------PYL------ASVLPMY------AFFALLVPL-------------A-
B2JS58_BURP8/58-406PTA..VLRDILLFRRQ------------------PYL------ASVLPMY------AFFAFAVPV-------------I-
Q13NS3_BURXL/7-355PLA..ALRDILLFRRQ------------------PYL------ASVLPMY------AFFALLVPM-------------I-
A9ALA8_BURM1/18-368PLT..GLAELLTFQRQ------------------PYL------ASVLPMY------VLFALASPV-------------L-
A5XMC5_BURML/14-364PLT..VLVELLTFKRQ------------------PYL------ASVLPMY------VLFALATPA-------------I-
Q1LDM8_RALME/9-370PIE..TLFQVIGLARQ------------------PFV------SDVLPMY------AVFIGLAPL-------------A-
A1B1M7_PARDP/3-363PIG..YVATVALMWMQ------------------PNL------LDVLALY------VLLIATVPV-------------T-
Q5FTQ3_GLUOX/17-367GYS..GLWRILTFDAL------------------PSY------LNILPLY------VVLLALFPL-------------I-
Q89UF3_BRAJA/67-422PLR..ILVRGLVLQEE------------------PLN------LDLLQLM------IPLMAFFPL-------------V-
Q132X2_RHOPS/15-370PVE..FLKHGLLLEYR------------------PLN------LDVLPLY------IALMAPFPL-------------V-
Q134C6_RHOPS/15-370PVE..FLKHGLLLEYR------------------PLN------LDVLPLY------IALMAPFPP-------------V-
Q138V8_RHOPS/8-363PIE..YMKHGMLLEYR------------------PLN------LDVLPLY------AVLMALFPP-------------F-
Q89KT4_BRAJA/82-438PVE..TLSQGLVLKFK------------------PLN------LDVLPLY------IVLMAAFPV-------------V-
A4YU73_BRASO/12-368ASD..TLAQGLILKFK------------------PVN------LDVLPLY------IVLMGFFPP-------------V-
Q6N6S8_RHOPA/12-368PIE..TLRQGLLLKFK------------------PVN------LDVLPLY------IVLMGLFPP-------------V-
Q1QFJ8_NITHX/39-395PFD..VLTQGLLLRFK------------------PLN------MDVLPLY------IVLLAGILP-------------I-
Q89VE5_BRAJA/37-393PDV..TIVQALLLRFR------------------PVN------MDVLPLY------IVLMLALPL-------------I-
Q07GY5_RHOP5/35-391PDV..TIIQALLLRFR------------------PVN------MDVLPLY------IVLMFFLPP-------------M-
Q6N0J3_RHOPA/44-400PDV..TIVQALLLRFR------------------PVN------MDVLPLY------IVLMFFLPP-------------I-
Q3SWD7_NITWN/36-392PDV..TIVQALLLKFR------------------PVN------MDVLPLY------VALMLFFPL-------------V-
Q89CC1_BRAJA/15-372PDE..LIGQAIVLKYK------------------PVN------LDVLPLY------IALVFASPF-------------I-
Q130V7_RHOPS/19-375PDI..MIQQALLLKYK------------------PVN------LDVLPLY------IVLVVAAPL-------------I-
A4YYN0_BRASO/36-389PGP..TLVHVALLQFA------------------PVN------TDILLTF------AILHICFPV-------------V-
Q89EQ8_BRAJA/32-383PGV..TLAHAAILQYR------------------PVN------TDILPLF------VLYHLLFAP-------------L-
A5EUM2_BRASB/9-363PFE..ALWQAVTMRYS------------------PVN------LDPLLLM------ITLHFALVL-------------V-
Q87XJ3_PSESM/5-366PQQ..ALADELLLRFK------------------PNL------TDPLPLY------IVLLLTLPL-------------T-
Q0BVC0_GRABC/14-370PYG..ALLHVLLLHYQ------------------PAY------MNILPVY------VVLLLAFSV-------------L-
A5G015_ACICJ/9-360PLS..AIIEAVPLLYQ------------------PAY------LNVLPLY------VAIMGGIAP-------------L-
B0U809_METS4/3-358PVQ..TTLGWVTLLHQ------------------LGF------FNILPLY------VVLLGLAPL-------------F-
A6UE98_SINMW/23-375TEQ..GIVAMVLLGHQ------------------LGY------NNILSMY------AVLFLLLPG-------------F-
Q2K344_RHIEC/23-378LKE..GIPALLLLGHQ------------------IGY------NNILPMY------GALLLMVPI-------------I-
Q2YRC8_BRUA2/6-358PVE..GLFGLVTLGHQ------------------LGY------NNILSMY------AVMLILTPI-------------L-
Q983D5_RHILO/37-389TPE..VLVGIVTLGHQ------------------LGY------NNILPVY------AALLLMAPA-------------F-
Q6G5Q7_BARHE/16-368PFI..AFFSVLSFGHQ------------------LGY------NNILPLY------IVLMLFAPF-------------A-
A1UR89_BARBK/16-368PVV..AFFSMLSFGHQ------------------LGY------NNILPLY------IVFTLFAPF-------------I-
Q0FH42_9RHOB/16-377PGE..TLAALPALLHQ------------------IGY------VNILPAY------SVLLLATPF-------------A-
A3VIJ0_9RHOB/5-370TAQ..AIIGIVTLGHQ------------------IGY------MNILPAY------SVLLVAAPF-------------A-
A3SZ27_9RHOB/26-392TGA..AMAGLVTLGYQ------------------IGY------VNILPSY------TVLLLAGPA-------------L-
Q3J1N1_RHOS4/11-372PLG..FLIGVPALTHQ------------------LGY------TNILPLY------ATLLLVTPA-------------L-
A3V5J7_9RHOB/13-374PLG..FLIGVPLLGHQ------------------LGY------VNILPLY------LVLLLLVPP-------------V-
Q11DW2_MESSB/11-364PLR..TMVGLPLLTHQ------------------LGY------LNILPMY------AALLVISPV-------------Y-
Q0G5B4_9RHIZ/12-366PLE..AYFGLASFGHQ------------------FGY------VNILPLY------IVLLLMVPL-------------H-
Q1YF78_MOBAS/13-366PME..TMIGVAGLGHQ------------------LGY------VNILPMY------CVLLLMLPL-------------H-
A3X8H2_9RHOB/38-419PAP..NLVGLFTLTYV------------------PNY------FDILPMY------LVVLALMPL-------------M-
Q1GGF0_SILST/47-428PAE..QIVGIFTLTYV------------------PNY------FDILPMY------LVVLALMPA-------------I-
Q5LPG0_SILPO/35-409PMP..QMLGLFTLTYI------------------PNY------FDILPMY------LVVLAMMPL-------------M-
A6DWM4_9RHOB/18-395PAP..QLVGLLTLSYV------------------PNY------FDILPMY------LVILAMMPI-------------I-
Q169P8_ROSDO/29-397PEE..NLLGLLTLTYV------------------PNY------FDILPMY------LVVLAMMPL-------------V-
Q2PYB5_9BACT/21-406TKD..QLFGLLTLTYV------------------PNY------FDILPMY------IAILLMMPL-------------I-
Q0BQN1_GRABC/63-424PVQ..AFRGIVMLSYV------------------PGY------LDVLPVY------VVIMAMVPV-------------A-

PF01757

A8DMZ1_STALU/12-334...--...........------------------GYWY.....GYFILII......IQYFILSYL-------------I.
Q035D4_LACC3/20-369...--..SALLHGDQF------------------YLY........YVLVT......LQLYLLFPA-------------M.
A8G974_SERP5/5-314...--NLMGIKSTYNS------------------EWW........FFKLY......VLYVLSLPL-------------L.
Q11WN8_CYTH3/14-339GKP--GVWIQPFMGNT------------------PLW........SLSYE......WWFYMLFIP-------------I.
A7LV98_BACOV/4-296.GT--QTPLLKNFGFI------------------FPW........FLPTY......CSFYIL...-------------..
Q97ER7_CLOAB/6-334KIL--TFHEIQSEVLG------------------QFW........FIKVL......FITNIIFFL-------------ID
OPGC_SHIF8/9-357.YD--KYNTLAWELIS------------------HLW........FLLVL......VVMTTLCVW-------------IF
Q07PA2_RHOP5/14-375.PP--PAAILSKLSLA------------------HLW........FLYVL......LEFYVVALA-------------LR
Q30BE9_ENTFL/7-326...--...IVFDGTLY------------------HLW........YLPAS......IIGAAIAWY-------------L.
A1HPJ5_9FIRM/6-350...--...LLFGLASY------------------QLY........FLVLL......LWFYTLMPL-------------WR
Q4P0M9_USTMA/127-516GTN--RDYLQQLLNTS------------------MLW........SIVPQ......LWGMLSVLM-------------L.
A7LV97_BACOV/24-312...--...LFMSNWYG------------------PLW........YVRDL......MTLMLLVPL-------------..
Q1ZBT2_9GAMM/5-295...--........PYY------------------HLW........YIPAV......MIFIYYIKI-------------L.
Q1QWT8_CHRSD/4-315...--......VMGYH------------------HLW........FLSAL......IGAAIMLYA-------------L.
Q2T7M4_BURTA/6-373LAG--APLFSRTALNP------------------ALW........TIQVE......LIGSIVLFA-------------I.
A4B9D7_9GAMM/5-375SFH--PVTLFPVDING------------------PLWSIGFEVVSYLFLF......GLLVAAMKL-------------F.
Q5LBM3_BACFN/8-315...--.......LIKG------------------GGW........FVSCI......MIYYVVLWF-------------I.
Q04X27_LEPBL/44-373...--........WCA------------------PYY........FVPLL......VSLYLMFPF-------------L.
A5ZUV3_9FIRM/6-346...--...FLKSSSLS------------------HMW........YMPVI......LGCYIALPF-------------L.
A1VGB5_DESVV/30-339...--......SNPGF------------------HLW........FMWIY......IGYMVVLPV-------------L.
B2JGA6_BURP8/53-400IHA--WLPGAVNTVVP------------------GGW........SIGVE......MCFYLFAPL-------------V.
Q9XAP7_STRCO/24-348.DP--PGSAWGEQAWE------------------ILW........YLRTY......LWFVLLSPL-------------L.
Q07KV2_RHOP5/17-343..L--VLPQSGYPILG------------------VGW........SLEYE......MIFYVFVAT-------------T.
Q484G4_COLP3/18-372AWD--KRMNAPFPTYN------------------HMW........YVLYL......FHYTVLLLP-------------LC
A0DGZ8_PARTE/156-556FID--NFFHDWDLCFG------------------WGW........YLTSD......IQLFIICLI-------------P.
A7A7L5_BIFAD/6-324...--......PLSMG------------------LWW........YATAY......AIFLALLPF-------------L.
A3JPT3_9RHOB/10-350SAW--LGYFVLGDVKY------------------HMH........FIQTL......FALLLFYPL-------------F.
A5EMI0_BRASB/26-386..W--KTVTVGPWPSG------------------PIW........FIWVL......LAFDLAAAL-------------LY
A4FKM9_SACEN/20-347LWN--WHPQDHPFIDG------------------SHW........TVPLQ......LMGFTAAAL-------------L.
A7V903_BACUN/5-297...--..DKIFLHPMG------------------PYW........YLHTL......ILCSLIYYI-------------T.
Q8IG66_CAEEL/330-720FAF--VSNFFPSTCVP------------------WLW........YISLD......FQLYLTLPI-------------V.
Q7UES3_RHOBA/12-486KGL--MFLLFEFPATG------------------HLW........FLWFLCFLVTGFVLVMTLTP-------------RG
Q1WRZ8_LACS1/4-332INN--LLGKFFIPAIG------------------AIW........FLLAM......FLANIFYSF-------------I.
Q8PXP5_METMA/13-333KLF--YFILGENFICG------------------HLW........YLITL......IVITTLCFF-------------I.
Q6AH04_LEIXX/3-320...--.....PFLFVR------------------ARW........LAVAA......AVAAVASST-------------L.
Q5CVD7_CRYPI/23-437YFM--YVKDFKCHGFE------------------WLW........FLALL......IVISVVMFP-------------F.
A0LT35_ACIC1/10-359...--.......GVAF------------------HLW........FLSVY......AVILFLTPL-------------L.
Q8KJJ2_RHILI/23-344...--......TEVIG------------------TYW........FIWAA......FISFVLIRV-------------L.
Q17BV3_AEDAE/212-599FVQ--NWYPVEESCAP------------------HTF........QLAVE......MQLAILAPL-------------L.
A7F3R9_SCLS1/8-361LIT--TWTRGWNIYDG------------------NQW........TLLPL......LKGAMLVYV-------------F.
Q144E0_BURXL/4-320...--....LAWAPVG------------------QFW........FLYAL......FICQIVACI-------------A.
Q83YQ9_STRGN/5-307FFN--SPRDLIGPAAT------------------PTW........YLLAI......SYIYGLYLL-------------F.
Q07P25_RHOP5/21-323...--....IWYQPIG------------------QFW........FLYAL......MICHVLAVL-------------L.
Q8DSB8_STRMU/14-327...--.......IITG------------------QYW........YVTAY......FGLLIFMPI-------------L.
A0LP70_SYNFM/14-366...--PAETVFYYLVP------------------AWW........FFGLL......LQLYLFFPL-------------F.
A8H1P8_SHEPA/43-369QAA--SWYVITGRTLT------------------AYW........YIPMG......MMLFALSPW-------------V.
A6E8A8_9SPHI/14-335FYG--NGIQGYLIHSI------------------ASW........FIICL......FVLENMYFL-------------A.
A5VFE0_SPHWW/65-420ALH--LFASGVSQYNS------------------ALW........TMKYE......LFGSLLALL-------------G.
A5LX53_STRPN/8-323...--....IYKFPLG------------------VSW........YLYTL......WSILIVYGL-------------L.
Q8P802_XANCP/22-341GLL--WANGSSLYVLP------------------ALW........FLPAL......FVATVVY..-------------..
Q2HGI8_CHAGB/115-578WDW--REFGGSTVLDV------------------HLW........TVPVE......FRCSMVLFL-------------T.
A6BII1_9FIRM/11-365...--...QTRPNWTS------------------HLW........FLGEL......VCIYLLFPV-------------L.
Q9CHP8_LACLA/4-320...--......YSTDS------------------YSW........YVEMY......LGLYLFIPL-------------LN
A5N097_CLOK5/9-357SRN--MEAMTTGFGPM------------------HLW........FLLYL......FVFTLLCLP-------------FF
Q8FTN8_COREF/16-398TWN--PDWASLSGMNV------------------PSW........SLAAE......MLFYLTFPL-------------F.
Q6G5Q7_BARHE/17-365.LF--FTQPFIAFFSV------------------LSFGHQLGYNNILPLY......IVLMLFAPF-------------A.
A3H030_VIBCL/4-356...--PTMPFMTMLMS------------------FLLLNKPAYLEILPLY......IMYMLLFPL-------------A.
A7AZT9_RUMGN/12-318QEF--INAVFCYKYNP------------------VFW........FMLYL......ILFSFMSPI-------------I.
Q2NRT0_SODGM/9-399MLQ--AWNPYFLTFNA------------------PLW........SLSAL......FFFYLLFPW-------------A.
A4CKW1_ROBBH/7-342...--...........------------------...........ALLLI......IGIYQLT..-------------..
A6FAM6_9GAMM/8-349LYN--FYPNQGLSIVG------------------PWW........FLSFI......FQFYLIFPF-------------I.
A7V2Z2_BACUN/14-354FDI--RGWTEMHPLNG------------------PAW........SLYYE......YIGNILYAL-------------F.
Q00XL5_OSTTA/15-388.QA--WFPMHAELWNA------------------PSW........FLSAL......TFALAAMPF-------------A.
A4YYF7_BRASO/15-345ASD--WLPPTGVSFNG------------------PIW........SVSIE......VLVYAVFFL-------------G.
Q1D0W9_MYXXD/39-356...--...........------------------...........ALQCI......GFALLVGAT-------------L.
Q16PV5_AEDAE/243-647FVN--NYYKFDKGCMQ------------------QTW........YLAAD......FQFFCIGML-------------I.
Q82ET0_STRAW/57-398...--...........------------------PLW........FLLVF......AGLTAATPL-------------L.
Q4JZS0_STRPN/5-327..G--LLPNNQPDVIG------------------VSW........TIGVI......FLFYMLFPF-------------F.
Q931U6_STAAM/8-314...--...........------------------ALW........FLITL......FFFHVILVI-------------V.
Q7MGC8_VIBVY/15-336...--PLNSLLEGGLV------------------HLW........FLPAL......IIAVAVVAL-------------F.
A6KZK8_BACV8/9-367KIW--TFIFNFNYDTT------------------PLW........YLYML......VGLYFIIPI-------------F.
A4CUQ6_SYNPV/6-368...--...DIPFNRIG------------------VLW........FLLVL......FVFDLIYCA-------------WV
Q5PLM9_SALPA/5-319...--.......PVFY------------------HLW........FFFAI......TVIYLVSPL-------------I.
A6P1P2_9FIRM/9-341...--..TALLGNTHY------------------HLW........FLYII......LGLYLVTPI-------------L.
A5FYP6_ACICJ/4-317.AD--TIWHPLASPAY------------------SLW........YLAVL......FLLSVATPL-------------L.
Q7MQA5_VIBVY/5-328...--...SPEHATYY------------------HLG........FFYYF......IPLYFVIPM-------------F.
Q5X6W8_LEGPA/10-336IGY--FSTDATIQQLL------------------HTW........SLGVE......EQFYLIWPI-------------I.
A7V3H1_BACUN/5-305...--.........LE------------------SYW........FLSCL......FFCFCILAI-------------I.
Q64YD4_BACFR/4-349...--..FLNFPTLAG------------------HLW........FMYPL......ISLYLFIPI-------------I.
A2SCM7_METPP/5-359...--...PVTAFFSG------------------LLLIYSPPLLDILPLY......VVFMVLSPL-------------L.
A7ZZ73_ECOHS/5-329.TG--EFLHGMITAST------------------SLW........YLYAL......IVYFVVCKI-------------F.
A5UMZ7_METS3/7-344...--......SKFMT------------------QHW........YAWML......LGLYLSLPI-------------F.
A3YY52_9SYNE/16-323...--......LEPPL------------------TLW........YISMI......VVFYLLAPL-------------L.
A4AIT9_9ACTN/563-845...--.....EWTSQW------------------RYW........FLEALLWSMLAVVALLAIPA-------------V.
A5N224_CLOK5/8-329...--.........FY------------------HFY........FVPLI......IEFYIIFPF-------------I.
E0TI88_PARBH/15-315...--......LGTNY------------------HLW........FLSSL......IMAQLFLAA-------------Y.
A3L950_PSEAI/5-324...--...SVDTLPWQ------------------ALW........YLPHF......WVATLFAWF-------------M.
A0E2L0_PARTE/17-375..T--HNIFNKFGCFE------------------WSW........YIAVEIQTLIFLCLSIPTIH-------------LI
Q8A5U1_BACTN/9-318LFV--FHGHDLIKFNP------------------PIW........FLLAL......FNCNILFYL-------------I.
Q2C1R6_9GAMM/10-345...--........NLG------------------VTW........FCWTL......IVFSAVFAL-------------FQ
A7A7B8_BIFAD/5-363...--LGGGFGDYPTG------------------YFW........FMNAL......IAVYLVLPV-------------M.
Q4JYU7_STRPN/6-318...--.......GYFF------------------QFW........FFGAL......ILIYLCLPI-------------L.
A9VR59_BACWK/5-346...--.........AP------------------HLW........YVIMM......FQIHLLFPL-------------LC
A7VGI1_9CLOT/6-345LLS--MSGVQGTQVVM------------------ITW........YISAM......LIAMLVI..-------------..
Q1QR03_NITHX/14-320...--...MSFIDPFG------------------TLW........FIYLL......PVFFVV...-------------..
A5ZDF6_9BACE/13-326...--.........FS------------------PFW........FLNMI......LYLMIGFAV-------------I.
Q16FE1_AEDAE/161-554FVN--NLPIQDNFCMI------------------HAW........YLGAD......MQMFLASLG-------------L.
Q7CTZ0_AGRT5/8-329ISH--GTALEELPVNV------------------PLY........FLRDL......FVCILLSPV-------------L.
Q8G7P7_BIFLO/17-373...--..DLFSGYDDS------------------VYW........FVFML......AGFVLATPF-------------L.
A1R1G8_ARTAT/18-357...--.......GAAM------------------PLW........FLAAY......LTAQLSIPV-------------M.
A1VHZ4_DESVV/11-319LNW--FHLGNDSPFGA------------------GQW........FFTLL......LLFYLVYPV-------------M.
A0QPG5_MYCS2/9-326GTP--QGIPWPGVWNG------------------SLW........TLVFE......MICYIAVAV-------------LG
A5EXU9_DICNV/19-351...--...........------------------.TW........QISVD......VLQFAGLTF-------------I.
A6LGX6_PARD8/9-311...--..........G------------------IVW........YLFTL......IYSCITIYF-------------I.
Q11WP3_CYTH3/4-324IFI--LGLCTTGMIIP------------------PSW........SLDIE......MQFYIIVPA-------------L.
A0K1D5_ARTS2/296-671VSG--AVIPAVLLLQF------------------GPWQ.....FNVMGLY......VIMLLVSPL-------------I.
A6KYR5_BACV8/6-309...--......PILSK------------------KYW........FMTCY......VVLYCFSPY-------------L.
Q0CZ95_ASPTN/77-482VLR--TGGEPWFTYNV------------------HTW........SIPVE......YRGSLAVYT-------------A.
A0T1U4_VIBCL/8-303...--.......SGIG------------------YVW........FIRII......FVFSVISPM-------------L.
A3I592_9BACI/6-352..F--LEKLLIGKTYT------------------HLY........YIFIM......VQFYLLFPL-------------F.
A1TDU0_MYCVP/22-361...--...........------------------.LW........FLGAY......VLVLAAVPA-------------L.

PF07786

A1HQT7_9FIRM/5-214--------------FG..................ILH--------LLG..------..VSMLLGH-------------G-
A2SQB7_METLZ/5-231--------------FG..................ILH--------LIG..------..VATILAI-------------P-
A9CIY2_AGRT5/15-234--------------FG..................ILH--------NIA..------..AASLVGL-------------L-
Q28R74_JANSC/28-249--------------FG..................ILH--------SIA..------..LCSLLGL-------------L-
Q8PXM0_METMA/7-237--------------FG..................ILH--------FFG..------..LSAVLAY-------------P-
A4EC93_9ACTN/4-221--------------FG..................IIY--------CMAAC------TGIVALTDP-------------V-
Q8U2K3_PYRFU/23-240--------------FG..................ILH--------FLG..------..VASILAI-------------P-
A7I8Y9_METB6/6-231--------------FG..................ILH--------LIG..------..LAVMLSP-------------L-
A6G0Y4_9DELT/12-237--------------YGWTPPPTAGQLVTMLLTGDILQ--------LAG..------..LCLILMG-------------L-
A3CVR7_METMJ/5-231--------------FG..................ILH--------FIG..------..LAILLAP-------------L-
Q11IW8_MESSB/30-251--------------FG..................ILH--------HIA..------..LATIVGA-------------A-
A1TRD1_ACIAC/21-249--------------FG..................VLH--------GMA..------..VMLVVAR-------------C-
A2SGN2_METPP/12-230--------------FG..................VLH--------GIA..------..LMLIVCR-------------F-
A2STU6_METLZ/14-241--------------FN..................FLQ--------MMG..------..LSMILCI-------------P-
Q2K839_RHIEC/16-243--------------FG..................ILH--------CIA..------..LLTLIGV-------------V-
Q251W2_DESHY/5-221--------------FG..................ILH--------FLG..------..VMMVLYP-------------L-
A0NYA1_9RHOB/5-227--------------FG..................ILH--------SIA..------..LSSLIAL-------------P-
Q21VS3_RHOFD/16-244--------------FG..................VLH--------GMA..------..LMLIIAR-------------L-
Q0FKK0_9RHOB/7-221--------------FG..................ILH--------SIA..------..AASLIGL-------------A-
Q2YRW9_BRUA2/16-233--------------FG..................ILH--------QIA..------..LASVLGL-------------L-
A2STU5_METLZ/19-252--------------FG..................FLH--------MLS..------..ISMLIAI-------------P-
Q6SHI3_9BACT/5-214--------------FG..................ILH--------LIW..------..VSSLIAI-------------A-
Q0G6B2_9RHIZ/53-275--------------FG..................ILH--------HIA..------..FASLAGL-------------L-
A3YBL4_9GAMM/14-227--------------FG..................ILH--------FIF..------..VASWLVL-------------P-
A4FZP9_METM5/5-227--------------FG..................IIH--------FLA..------..ISGLLGI-------------I-
Q11N89_MESSB/6-227--------------FG..................ILH--------AIA..------..AATLLGA-------------L-
A4J1M2_DESRM/9-218--------------FG..................ILH--------FLA..------..ISILLYP-------------I-
Q6SGH9_9BACT/9-218--------------FG..................ILH--------LIW..------..TGTLIAI-------------F-
A1VNB1_POLNA/5-231--------------FG..................VLH--------GLA..------..VMLLIVR-------------L-
A3DGD5_CLOTH/11-220--------------FG..................VLH--------LIG..------..LCMIVSP-------------F-
Q98KU6_RHILO/16-237--------------FG..................ILH--------QIA..------..LASLLGL-------------A-
A6VZM7_MARMS/12-224--------------FG..................ILH--------FIF..------..IASLLIR-------------P-
A1W6I8_ACISJ/12-240--------------FG..................VLH--------GMA..------..VMLVITR-------------L-
Q6M0I2_METMP/11-233--------------FG..................IMH--------FLA..------..ISGILGI-------------I-
O26882_METTH/9-227--------------FG..................VLH--------FIG..------..LAVILTH-------------P-
Q92KE6_RHIME/23-246--------------FG..................ILH--------AIA..------..AASLVGL-------------L-
B1ZHM9_METPB/15-237--------------FG..................ILH--------CIA..------..ASSLLGL-------------P-
Q2Y4H0_9ARCH/17-243--------------FG..................VLH--------LIG..------..ISIIMAY-------------P-
O29726_ARCFU/2-207--------------FG..................IIH--------FFT..------..LATLLGY-------------L-
Q12ZG6_METBU/7-234--------------FG..................ALH--------FIG..------..VAIILSY-------------P-
A4BIP8_9GAMM/6-220--------------FG..................VLH--------FIT..------..VASVLAL-------------P-
Q8THP4_METAC/31-261--------------FG..................ILH--------FFG..------..VSAMLAY-------------P-
Q46DC7_METBF/7-237--------------FG..................ILH--------FFG..------..VSAVLVY-------------P-
Q2FN30_METHJ/7-229--------------FG..................ILH--------LIG..------..TALILTP-------------L-
Q1YI63_MOBAS/15-237--------------FG..................ILH--------HIA..------..VASVLGL-------------L-
Q1B004_RUBXD/18-243--------------FG..................ILH--------LIG..------..ASIVLAY-------------P-
A6FRV3_9RHOB/4-228--------------FG..................ILH--------AIA..------..TFSLIGL-------------V-
Q1YJ44_MOBAS/24-246--------------FG..................ILH--------SIA..------..LGSLLGL-------------L-
Q26I67_FLABB/5-236--------------ID..................VLQ--------CIG..------..LSIIITV-------------G-

PF05857

Q8KNJ7_SALTI/21-241----------------------------------MWW--------QLNIL------FAFAVVMQV-------------V-
A7LWV3_BACOV/16-233----------------------------------ADG--------THNVM------FTLALGITA-------------L-
Q84A20_ECOLX/31-248----------------------------------PWY--------EGNIL------FAFAVAAQV-------------L-
A6TIJ3_KLEP7/24-240----------------------------------PWY--------SGNIL------FAFAVTGQV-------------L-
A5Z378_9FIRM/20-251----------------------------------DMA--------RQNVI------FTLFIGYMA-------------I-
A5KIL9_9FIRM/5-244----------------------------------SLG--------QQNVL------FTLLLGLII-------------L-
Q5NWL3_AROAE/9-222----------------------------------GWW--------PLNVL------FTLLVIAGT-------------L-
Q88AH9_PSESM/14-243----------------------------------DAT--------VLNVM------PTLLLGLLI-------------A-
Q1H9V9_9ZZZZ/19-235----------------------------------GWF--------PLNIL------FTLLVIAAI-------------I-
A3JHE7_9ALTE/11-236----------------------------------GWW--------PLNIL------FTFMTLTTV-------------V-
A8F272_RICM5/12-244----------------------------------QLL--------TTNIL------ISLYLGQWY-------------I-
A4WGU9_ENT38/21-253----------------------------------PWW--------ALNIL------FVFAGVTQL-------------L-
A7VEF3_9CLOT/9-245----------------------------------DLQ--------KQNIF------FTLAAGLIV-------------L-
A6M0I9_CLOB8/13-266----------------------------------FPV--------SNNIF------ETFFLIALN-------------I-
A4NTD4_HAEIF/7-239----------------------------------NYD--------RLNVL------FQFLSVIGV-------------I-
C1DKH3_AZOVD/14-243----------------------------------APD--------SFNVL------PTLALGLLL-------------A-
Q0VUV5_9ZZZZ/9-222----------------------------------GWW--------PLNVM------FTLLVITAT-------------L-
A7VF03_9CLOT/8-229----------------------------------EPN--------WNNIM------FTLALVLAM-------------I-
A4XUI8_PSEMY/4-231----------------------------------MSN--------TLNVM------PTLMLGLIV-------------A-
Q0B109_BURCM/9-222----------------------------------GWW--------PLNVM------FTLLVVTAT-------------A-
A4XH28_CALS8/24-230----------------------------------DPY--------ELNVI------ATFFFAAVA-------------L-
Q5ZHG7_9BACT/23-233----------------------------------GWW--------PLNVM------FTLLAATAM-------------L-
Q4UUW2_XANC8/4-213----------------------------------RAL--------PLNIL------LSFALAAVC-------------I-
FIMCH_DICNO/7-241----------------------------------FLQ--------TGNVL------FTLALALLA-------------L-
A5TTI6_FUSNP/5-248----------------------------------FYP--------YNNVL------WTFLIALCG-------------L-
Q65AG0_YERPE/74-291----------------------------------RPD--------LGNIL------FAFAVSGQA-------------L-
Q2P3I2_XANOM/4-206----------------------------------YWL--------PLNVL------LTFACAALL-------------V-

PF04235

YXAH_BACSU/242-392----------------------------------MFF--------YVTTV------VYLYHKTRV.RT.....V....L-
A3IC17_9BACI/222-377----------------------------------SVG--------YAAVI------VLLCLLPIV.PK.....L....L-
A5VFY1_SPHWW/226-385----------------------------------TIG--------HAGLF------LLLWRKGAW.PR.....L....M-
A9VP60_BACWK/224-378----------------------------------TFF--------YGSTI------ILLFHYKKV.AR.....L....L-
A7AFV0_9PORP/228-389----------------------------------TFI--------LVSSF------VLLYQKECF.RK.....A....V-
B0T5F0_CAUSK/216-381----------------------------------MTA--------QLVLF------VELYEGFAG.KV..........L-
Q5LBX3_BACFN/231-393----------------------------------TIV--------LVASF------VLLYQTEKF.RK.....L....T-
A8FJB9_BACP2/218-375----------------------------------SLF--------YIAVI------AKLLAHTESWFM..........W-
Q4MVH1_BACCE/182-334----------------------------------SAF--------YVGAL------ILLLQLKPV.QT.....L....L-
A7GNB8_BACCN/217-376----------------------------------FIF--------YILTL------MRLLQKEQW.QK.....L....L-
A8M3I5_SALAI/225-391----------------------------------AAG--------YLALF------ALLAATVRR.PPG..LI.....V-
A6CU81_9BACI/142-303----------------------------------CFF--------YISAL------TLLLRKENWQKR..........L-
Q3R094_XYLFA/261-419----------------------------------CLG--------YLAWG------IRAAFA................L-
Q8ZNL6_SALTY/215-375----------------------------------TLG--------YAALM------FGFWPQLSR.CR.....L....T-
Q31YW0_SHIBS/215-375----------------------------------AIG--------YASLF------YGFWPQLSR.FK.....L....V-
A5ZJ36_9BACE/227-388----------------------------------TIV--------LISSF------ILLYQKAKF.QK.....A....V-
Q5Z0S5_NOCFA/200-354----------------------------------ALA--------YLTGL------LLLLRTETG.AL.....L....T-
A3IA01_9BACI/163-335----------------------------------SAF--------YMGAI------ILCLQSALF.QQ.....L....L-
Q5LAR8_BACFN/229-391----------------------------------MVL--------LVSGL------LITFYRIKD.RR.....F....L-
A5FKP1_FLAJ1/222-380----------------------------------TMI--------FIASG------LSLLYSHKK.LK....TV....F-
Q1CGS9_YERPN/216-376----------------------------------AVG--------YLALL------YGFWPTLSR.WA.....I....S-
Q08VU8_STIAD/181-346----------------------------------AAA--------YAAGL------ALLWGTARGRRW..........L-
A6LH60_PARD8/231-393----------------------------------TFV--------LVSSF------VLLYQWEGF.RR.....F....T-
Q2NUE2_SODGM/217-377----------------------------------ALG--------CVALL------YGFWPRLAD.KK.....V....F-
Q4UWH0_XANC8/244-402----------------------------------CLG--------YAAWV------MRFAAQ................L-
Q5L251_GEOKA/223-378----------------------------------AVF--------YAAAA------VFICGKPSW.QR.....A....W-
B9LP38_HALLT/238-398----------------------------------AGG--------YLGIV------MLYARRRPDGPV..........T-
A5CQC9_CLAM3/228-397----------------------------------ALG--------LLGLV------GWAVAARARRGDAAPGPV....L-
Q2BCM0_9BACI/228-382----------------------------------SLG--------YIFLF------AWLYAVKGR.FV.....L....F-
Q5WBU3_BACSK/218-382----------------------------------GVA--------YAAIF------GLIGPKITNPSG.....I....V-
Q5LDG8_BACFN/245-405----------------------------------GFA--------YVSAI------CLLYLHGRE.WC.....L....W-
B1KH41_SHEWM/231-384----------------------------------ALI--------YMHLL------IKICQNRST........V....L-
A4EHF6_9RHOB/229-382----------------------------------TLG--------YLGLI------AAIARPPGP........V....M-
Q2N5U1_ERYLH/237-397----------------------------------GLA--------YACVA------MVLFAPDGG........L....T-
Q1D273_MYXXD/254-423----------------------------------GAA--------YVAAF------ALLFQRERW.SR.....W....L-
A1RM83_SHESW/239-392----------------------------------ALI--------YIHIM------VIICKNNPN........R....L-
A3V2Y2_9RHOB/212-368----------------------------------AAV--------YVVIV------VRLAPR................L-
Q0RI89_FRAAA/226-396----------------------------------GPG--------YVALF------GLAAARLAR.PRHPHSDRAVRCV-
A0RC19_BACAH/265-424----------------------------------FIF--------YIFTL------MRLLQKEKW.QT.....L....L-
Q1GR12_SPHAL/244-406----------------------------------TIG--------WAALI------MLLVKTAAS.HA.....L....R-
A3HTP0_9BACT/227-391----------------------------------GLF--------YLWLI------AYIWHYTPW.KK.....W....L-
Q0C162_HYPNA/232-392----------------------------------ALG--------YAGLI------ALFSTGKAG.PI..........R-
Q01SV0_SOLUE/222-364----------------------------------ASA--------YAGAV------LLWYHSGGG..............-
Q9X356_BACAN/222-381----------------------------------AIF--------YICTL------LRVCENKKYIEW..........L-
Q6HBG3_BACHK/154-304----------------------------------AIG--------YIAAF------SLIFIHISK.MK.....I....F-
A6F241_9ALTE/221-382----------------------------------AMG--------YGAVL------LLWWRGRGR.LTG...AV....R-
A7AF04_9PORP/59-221----------------------------------AYL--------WVIVV------MEGYRLQKV.QR.....A....M-
A7M2T0_BACOV/229-391----------------------------------MVL--------LVAGL------LLTFYRVKD.RS.....F....F-
Q2B965_9BACI/232-387----------------------------------AAS--------YAIMI------ALLADTEKG.SR.....L....L-
A3WAG6_9SPHN/263-424----------------------------------VLG--------LAALL------VTYSPAWTG.WL..........A-
Q0HGE7_SHESM/244-397----------------------------------ALI--------YIHIL------VKICQNRST........V....L-
A8FH56_BACP2/222-385----------------------------------SMF--------YMSTL------AMLFLHVPQ.LR....GA....L-
Q5WCD3_BACSK/239-403----------------------------------MLF--------YVSAF------VLLLQKGTV.AR.....L....F-
A4GA59_HERAR/238-403----------------------------------AAA--------YVATI------LLAKETAGQ.WL..........D-
YRKO_BACSU/224-387----------------------------------SMF--------YMSTF------AMLFLYLPQ.LR....GP....M-
Q7WHI1_BORBR/228-389----------------------------------SAS--------YAAAL------LLAMRRPAG.AR.....L....A-
Q47SA7_THEFY/269-436----------------------------------GLG--------YVALF------GLIAHRLSR.RTSR.GPV....L-
Q2P0R0_XANOM/244-402----------------------------------CLG--------YAAWV------VRLAPR................L-
Q21P05_SACD2/237-402----------------------------------AVA--------ICSGF------ILFALRENNTKT..........M-
A4FQ93_SACEN/204-361----------------------------------ALG--------LLGLV------TSAVYAMRP.APG...VL....R-
A3WF33_9SPHN/238-398----------------------------------GLA--------YAALA------MAFFDREGG........F....T-
Q3IC82_PSEHT/208-361----------------------------------AII--------YIHIA------VKLCSNNAN........T....G-
Q2NDD6_ERYLH/264-425----------------------------------ILG--------LAALL------ALGGPKATG.WL..........G-
A3XLE1_LEEBM/228-392----------------------------------GLF--------YLWVL------GWLWYMTPF.QK.....L....L-
Q9HNH9_HALSA/232-393----------------------------------AGA--------YLGAV------MLVAKRWPTGVV..........T-
A4YYJ4_BRASO/266-405----------------------------------ALA--------YGALI------LSAASTTWG.VR.....L....L-
A3I7E6_9BACI/220-373----------------------------------SIG--------YIGIL------GKLVEYKRLDWL..........W-
A4IKX9_GEOTN/224-379----------------------------------AVF--------YAIAA------MLVCRKTNW.QP.....V....W-
Q9KFW4_BACHD/1-165----------------------------------GCA--------YAALF------GLLGPVVNRSAL.....A....I-
Q4A0U4_STAS1/90-261----------------------------------SIF--------YASCL------ILLLNISWA.RK.....V....L-
Q8ERW4_OCEIH/226-381----------------------------------AIF--------YVTSI------TLLWKKEWF.RQ.....L....M-
Q7N6K6_PHOLL/210-370----------------------------------ALG--------YMALI------YGFWPVISC.WR.....I....N-
A4ARZ9_MARSH/230-396----------------------------------TFI--------LIVLF------IMLYKKVKG.EK.....M....L-
B1YLL9_EXIS2/215-367----------------------------------AVA--------YAAGI------ALLVRFGRP.............L-
A6L2L4_BACV8/234-394----------------------------------MLI--------LVSGV------VFAFYKTNL.HD.....G....L-
A1WTH2_HALHL/248-410----------------------------------AAG--------WAALI------ILAFQRGWL.GR.....L....H-
A3UFR8_9RHOB/215-377----------------------------------TLA--------YICAI------RLLIDLFKL.............P-
A6CPZ4_9BACI/231-386----------------------------------SVS--------YAILL------ALLLINRKI.SV.....V....L-
A1S3E3_SHEAM/216-369----------------------------------SVL--------YADLI------IRLCRGSET........V....L-
Q094W5_STIAD/188-355----------------------------------AAF--------YMAGL------ALLFQRPRG.KK.....W....L-
Q9AA92_CAUCR/270-432----------------------------------TLG--------YASLA------ILLIRSRAI.AG.....L....L-
Q0ARL9_MARMM/225-387----------------------------------AFG--------YASTV------MLLAKIGVFSLI..........V-
Q07YN3_SHEFN/228-381----------------------------------ALI--------YIHII------VKFCQNTPH........R....L-
A0XYG1_9GAMM/200-353----------------------------------AGL--------YIHVI------VKFCKNSPQ........F....G-
Q1NBB8_9SPHN/227-389----------------------------------SVG--------WAALI------LWLFNRNPGHPL..........A-
A8F9F5_BACP2/224-375----------------------------------AIG--------YIQAF------IVFYYSKAA.QG.....L....K-
A7AGL6_9PORP/228-390----------------------------------MCV--------LVACF------VFLWQQVST.HE.....M....L-
A6L9Q0_PARD8/227-389----------------------------------MCV--------LVSSF------IFLWQWKAP.HK.....V....L-