Sequence alignment for CL0318

PF00034

A3HYX9_9BACT/875-956--------------------------------------------------------------------------------
A3HZ82_9BACT/43-133--------------------------------------------------------------------------------
C1DG42_AZOVD/275-353--------------------------------------------------------------------------------
B7WXJ0_COMTE/360-430--------------------------------------------------------------------------------
B9CBC2_9BURK/27-112--------------------------------------------------------------------------------
A9AXG3_HERA2/43-143--------------------------------------------------------------------------------
C1DFA7_AZOVD/306-383--------------------------------------------------------------------------------
A8LM31_DINSH/328-405--------------------------------------------------------------------------------
B0T7F6_CAUSK/26-116--------------------------------------------------------------------------------
B2JCS4_BURP8/352-440--------------------------------------------------------------------------------
B5EHP5_GEOBB/212-284--------------------------------------------------------------------------------
B8G4P7_CHLAD/50-144--------------------------------------------------------------------------------
B1ZB08_METPB/335-412--------------------------------------------------------------------------------
B1KHG1_SHEWM/32-108--------------------------------------------------------------------------------
A9VUA5_BACWK/254-346--------------------------------------------------------------------------------
A8LFE5_FRASN/80-157--------------------------------------------------------------------------------
B7L1L9_METC4/220-312--------------------------------------------------------------------------------
F2G8F3_ALTMD/346-423--------------------------------------------------------------------------------
B3EQ05_CHLPB/58-152--------------------------------------------------------------------------------
B0T8R9_CAUSK/311-388--------------------------------------------------------------------------------
A8ZSU7_DESOH/195-276--------------------------------------------------------------------------------
A8LLC8_DINSH/31-128--------------------------------------------------------------------------------
A3NRU4_BURP0/284-372--------------------------------------------------------------------------------
Q88K14_PSEPK/301-386--------------------------------------------------------------------------------
A4TY13_9PROT/152-228--------------------------------------------------------------------------------
A1BJ75_CHLPD/29-111--------------------------------------------------------------------------------
A3J8G6_9ALTE/27-106--------------------------------------------------------------------------------
A1WG03_VEREI/332-402--------------------------------------------------------------------------------
A4XW00_PSEMY/347-424--------------------------------------------------------------------------------
Q39AI6_BURS3/179-260--------------------------------------------------------------------------------
A1B9M0_PARDP/46-156--------------------------------------------------------------------------------
Q39YV3_GEOMG/27-115--------------------------------------------------------------------------------
A7BUA8_9GAMM/389-471--------------------------------------------------------------------------------
A3QA98_SHELP/222-305--------------------------------------------------------------------------------
A2SE78_METPP/627-702--------------------------------------------------------------------------------
A4JP31_BURVG/324-409--------------------------------------------------------------------------------
Q4ZHS4_9BACT/51-134--------------------------------------------------------------------------------
Q30UG6_SULDN/232-306--------------------------------------------------------------------------------
Q8PDT1_XANCP/89-171--------------------------------------------------------------------------------
A1WG32_VEREI/45-122--------------------------------------------------------------------------------
A5EDI9_BRASB/315-392--------------------------------------------------------------------------------
Q1YG19_MOBAS/332-409--------------------------------------------------------------------------------
Q2Y5C4_NITMU/429-515--------------------------------------------------------------------------------
Q0B3A9_BURCM/317-403--------------------------------------------------------------------------------
A3STM9_9RHOB/325-402--------------------------------------------------------------------------------
Q31AG8_PROM9/56-128--------------------------------------------------------------------------------
Q082F6_SHEFN/243-322--------------------------------------------------------------------------------
Q12DL3_POLSJ/329-399--------------------------------------------------------------------------------
A1SVU2_PSYIN/325-409--------------------------------------------------------------------------------
A0RN17_CAMFF/82-164--------------------------------------------------------------------------------
A1ZL74_9BACT/89-171--------------------------------------------------------------------------------
Q9A473_CAUCR/33-122--------------------------------------------------------------------------------
C550A_CYACA/53-150--------------------------------------------------------------------------------
A1TL76_ACIAC/329-399--------------------------------------------------------------------------------
A5FYU3_ACICJ/37-115--------------------------------------------------------------------------------
A6F0E0_9ALTE/24-101--------------------------------------------------------------------------------
A4BD02_9GAMM/317-394--------------------------------------------------------------------------------
A0Y0T7_9GAMM/320-397--------------------------------------------------------------------------------
A6FFR6_9GAMM/239-315--------------------------------------------------------------------------------
Q0HNQ4_SHESM/21-99--------------------------------------------------------------------------------
A1VJ52_POLNA/329-399--------------------------------------------------------------------------------
A4VP34_PSEU5/326-403--------------------------------------------------------------------------------
Q0EVT7_9PROT/77-155--------------------------------------------------------------------------------
A7ZBK3_CAMC1/105-210--------------------------------------------------------------------------------
Q6SFP3_9BACT/26-105--------------------------------------------------------------------------------
A6Q6Z1_SULNB/20-100--------------------------------------------------------------------------------
Q04SS0_LEPBJ/86-170--------------------------------------------------------------------------------
A5K1I5_PLAVS/17-115--------------------------------------------------------------------------------
A3TK92_9MICO/47-131--------------------------------------------------------------------------------
Q39TS3_GEOMG/180-272--------------------------------------------------------------------------------
Q8RMH3_9PROT/68-146--------------------------------------------------------------------------------
A6VC11_PSEA7/299-387--------------------------------------------------------------------------------
A5W506_PSEP1/78-158--------------------------------------------------------------------------------
A0M192_GRAFK/78-166--------------------------------------------------------------------------------
A7IKI0_XANP2/328-405--------------------------------------------------------------------------------
A3K2E0_9RHOB/327-404--------------------------------------------------------------------------------
Q2S8A0_HAHCH/192-278--------------------------------------------------------------------------------
Q13JV0_BURXL/306-383--------------------------------------------------------------------------------
Q3SUK3_NITWN/142-233--------------------------------------------------------------------------------
A7HE13_ANADF/168-247--------------------------------------------------------------------------------
A4YQB5_BRASO/168-249--------------------------------------------------------------------------------
A6Q697_SULNB/29-123--------------------------------------------------------------------------------
A1SRC3_PSYIN/67-145--------------------------------------------------------------------------------
Q027S6_SOLUE/288-368--------------------------------------------------------------------------------
A6FD45_9GAMM/307-378--------------------------------------------------------------------------------
Q28P34_JANSC/328-406--------------------------------------------------------------------------------
Q11EG2_MESSB/324-401--------------------------------------------------------------------------------
A6D1T6_9VIBR/37-123--------------------------------------------------------------------------------
Q0KCW9_CUPNH/320-395--------------------------------------------------------------------------------
Q31FA6_THICR/38-130--------------------------------------------------------------------------------
A1K4P5_AZOSB/315-391--------------------------------------------------------------------------------
Q2SWV4_BURTA/320-395--------------------------------------------------------------------------------
Q7MS60_WOLSU/370-444--------------------------------------------------------------------------------
A3NRU1_BURP0/368-455--------------------------------------------------------------------------------
Q1IUL0_KORVE/174-268--------------------------------------------------------------------------------
A1VKK0_POLNA/125-213--------------------------------------------------------------------------------
CYC6_CYAME/23-100--------------------------------------------------------------------------------
A4TVI5_9PROT/25-101--------------------------------------------------------------------------------
Q2W8Y8_MAGSA/39-118--------------------------------------------------------------------------------
Q0JYV8_CUPNH/22-98--------------------------------------------------------------------------------
A3YDZ4_9GAMM/322-399--------------------------------------------------------------------------------
Q01VF3_SOLUE/20-94--------------------------------------------------------------------------------
A6DS70_9BACT/760-855--------------------------------------------------------------------------------
A3PPU8_RHOS1/325-402--------------------------------------------------------------------------------
A5V793_SPHWW/210-289--------------------------------------------------------------------------------
Q2KU03_BORA1/330-418--------------------------------------------------------------------------------
O67504_AQUAE/17-104--------------------------------------------------------------------------------
A5V688_SPHWW/48-125--------------------------------------------------------------------------------
A2WG67_9BURK/51-122--------------------------------------------------------------------------------
A6CZ52_9VIBR/337-414--------------------------------------------------------------------------------
CY553_BACPA/21-92--------------------------------------------------------------------------------
A6DJL4_9BACT/1100-1184--------------------------------------------------------------------------------
A1SUP1_PSYIN/38-121--------------------------------------------------------------------------------
Q7UVI8_RHOBA/1468-1558--------------------------------------------------------------------------------
A6EYI6_9ALTE/46-122--------------------------------------------------------------------------------
A3JCN8_9ALTE/330-406--------------------------------------------------------------------------------
A6FWD1_9RHOB/160-234--------------------------------------------------------------------------------
Q7TU05_RHOBA/860-991--------------------------------------------------------------------------------
Q2CDA3_9RHOB/327-404--------------------------------------------------------------------------------
Q0A972_ALHEH/46-123--------------------------------------------------------------------------------
Q6LKC1_PHOPR/276-367--------------------------------------------------------------------------------
A7GN62_BACCN/180-253--------------------------------------------------------------------------------
A3EV82_9BACT/32-116--------------------------------------------------------------------------------
A6GFL8_9DELT/29-119--------------------------------------------------------------------------------
A6DKH0_9BACT/26-110--------------------------------------------------------------------------------
QCRC_COREF/69-147--------------------------------------------------------------------------------
Q01PC8_SOLUE/140-223--------------------------------------------------------------------------------
QCRC_COREF/179-255--------------------------------------------------------------------------------
Q15T42_PSEA6/326-403--------------------------------------------------------------------------------
A6Q613_NITSB/296-399--------------------------------------------------------------------------------
Q7BPS0_CAMJU/19-100--------------------------------------------------------------------------------
CCOP_HELPX/207-288--------------------------------------------------------------------------------
Q054F0_LEPBL/30-116--------------------------------------------------------------------------------
Q8F0C5_LEPIN/50-137--------------------------------------------------------------------------------
A3RXZ0_RALSL/335-410--------------------------------------------------------------------------------
Q1YZR8_PHOPR/320-397--------------------------------------------------------------------------------
Q605U5_METCA/34-112--------------------------------------------------------------------------------
Q07QU5_RHOP5/38-117--------------------------------------------------------------------------------
Q2SN04_HAHCH/322-399--------------------------------------------------------------------------------
Q98CI0_RHILO/338-415--------------------------------------------------------------------------------
A6EZ12_9ALTE/336-412--------------------------------------------------------------------------------
Q07M26_RHOP5/79-165--------------------------------------------------------------------------------
A7Z6T4_BACA2/49-120--------------------------------------------------------------------------------
Q8XPY3_RALSO/395-482--------------------------------------------------------------------------------
A2SDV3_METPP/323-393--------------------------------------------------------------------------------
A8EWF8_ARCB4/105-206--------------------------------------------------------------------------------
Q0AG80_NITEC/32-122--------------------------------------------------------------------------------
Q5HXC2_CAMJR/201-289--------------------------------------------------------------------------------
A0KNP1_AERHH/188-300--------------------------------------------------------------------------------
A3V1B1_9RHOB/326-403--------------------------------------------------------------------------------
A4ASX0_MARSH/13-99--------------------------------------------------------------------------------
A4VQ99_PSEU5/49-133--------------------------------------------------------------------------------
A7HD95_ANADF/221-299--------------------------------------------------------------------------------
A3RTX2_RALSL/32-112--------------------------------------------------------------------------------
Q0BSR0_GRABC/318-393--------------------------------------------------------------------------------
A5G2Z9_ACICJ/97-183--------------------------------------------------------------------------------
A4CGX1_ROBBH/51-134--------------------------------------------------------------------------------
Q1Q9F9_PSYCK/370-446--------------------------------------------------------------------------------
Q12E68_POLSJ/29-109--------------------------------------------------------------------------------
Q1Q1H2_9BACT/481-562--------------------------------------------------------------------------------
A1B8Y6_PARDP/329-406--------------------------------------------------------------------------------
Q4ZVH0_PSEU2/347-424--------------------------------------------------------------------------------
Q6MR17_BDEBA/74-159--------------------------------------------------------------------------------
A3ERB9_9BACT/32-118--------------------------------------------------------------------------------
A5WG96_PSYWF/180-265--------------------------------------------------------------------------------
Q89WT8_BRAJA/117-197--------------------------------------------------------------------------------
Q9ZGF8_HELMO/122-196--------------------------------------------------------------------------------
Q87H21_VIBPA/33-131--------------------------------------------------------------------------------
A4BKK2_9GAMM/119-205--------------------------------------------------------------------------------
Q9I3K0_PSEAE/342-419--------------------------------------------------------------------------------
A7GWI4_CAMC5/119-196--------------------------------------------------------------------------------
CY552_THIFE/53-134--------------------------------------------------------------------------------
Q01YB9_SOLUE/516-640--------------------------------------------------------------------------------
Q0FDI4_9RHOB/329-406--------------------------------------------------------------------------------
Q026L5_SOLUE/59-136--------------------------------------------------------------------------------
A6GWL6_FLAPJ/97-178--------------------------------------------------------------------------------
Q1CR68_HELPH/53-154--------------------------------------------------------------------------------
Q1GLL6_SILST/329-406--------------------------------------------------------------------------------
Q83NH4_TROW8/156-232--------------------------------------------------------------------------------
Q747D3_GEOSL/26-104--------------------------------------------------------------------------------
A3K6G3_9RHOB/40-143--------------------------------------------------------------------------------
Q2G890_NOVAD/22-106--------------------------------------------------------------------------------
A6V5K9_PSEA7/33-113--------------------------------------------------------------------------------
Q1N1Q9_9GAMM/312-388--------------------------------------------------------------------------------
A6D951_9VIBR/49-129--------------------------------------------------------------------------------
Q7ULK4_RHOBA/434-513--------------------------------------------------------------------------------
A5W1M7_PSEP1/806-907--------------------------------------------------------------------------------
A0NUW4_9RHOB/329-406--------------------------------------------------------------------------------
Q396U3_BURS3/183-262--------------------------------------------------------------------------------
A0YHE8_9GAMM/124-210--------------------------------------------------------------------------------
Q7MS08_WOLSU/78-158--------------------------------------------------------------------------------
A6SZ46_JANMA/140-225--------------------------------------------------------------------------------
Q1V738_VIBAL/19-98--------------------------------------------------------------------------------
A6DG27_9BACT/331-408--------------------------------------------------------------------------------
A6DK49_9BACT/120-205--------------------------------------------------------------------------------
A8FUN2_SHESH/19-100--------------------------------------------------------------------------------
A4A383_9GAMM/316-393--------------------------------------------------------------------------------
Q30P22_SULDN/23-102--------------------------------------------------------------------------------
A3Z583_9SYNE/27-105--------------------------------------------------------------------------------
Q3KFL1_PSEPF/354-431--------------------------------------------------------------------------------
A5EUE1_BRASB/49-132--------------------------------------------------------------------------------
Q5LV33_SILPO/328-405--------------------------------------------------------------------------------
A5FJF1_FLAJ1/53-143--------------------------------------------------------------------------------
Q7VG08_HELHP/17-100--------------------------------------------------------------------------------
Q92UI9_RHIME/326-403--------------------------------------------------------------------------------
Q1IN35_KORVE/21-100--------------------------------------------------------------------------------
Q1D0X4_MYXXD/25-115--------------------------------------------------------------------------------
Q2IUP4_RHOP2/578-669--------------------------------------------------------------------------------
Q926I1_RHIME/24-103--------------------------------------------------------------------------------
A6SVA7_JANMA/330-407--------------------------------------------------------------------------------
Q160K5_ROSDO/328-405--------------------------------------------------------------------------------
A3WTY2_9BRAD/141-221--------------------------------------------------------------------------------
Q02BQ9_SOLUE/215-307--------------------------------------------------------------------------------
A3U177_9RHOB/111-198--------------------------------------------------------------------------------
Q11G47_MESSB/29-108--------------------------------------------------------------------------------
Q820S2_NITEU/123-211--------------------------------------------------------------------------------
A5FXN1_ACICJ/320-395--------------------------------------------------------------------------------
Q3BPP2_XANC5/46-123--------------------------------------------------------------------------------
Q748S1_GEOSL/109-203--------------------------------------------------------------------------------
Q47UL0_COLP3/316-393--------------------------------------------------------------------------------
Q5LL42_SILPO/110-197--------------------------------------------------------------------------------
Q1ID54_PSEE4/176-262--------------------------------------------------------------------------------
Q92VB2_RHIME/326-403--------------------------------------------------------------------------------
A3YPD8_CAMJU/105-208--------------------------------------------------------------------------------
A6DPC1_9BACT/868-958--------------------------------------------------------------------------------
Q1MG21_RHIL3/50-141--------------------------------------------------------------------------------
A3Z568_9SYNE/45-127--------------------------------------------------------------------------------
A1VA32_DESVV/62-133--------------------------------------------------------------------------------
Q1LCS0_RALME/54-132--------------------------------------------------------------------------------
Q0G167_9RHIZ/327-404--------------------------------------------------------------------------------
A6Q8D3_SULNB/21-109--------------------------------------------------------------------------------
Q1DDJ6_MYXXD/17-102--------------------------------------------------------------------------------
Q1V125_PELUQ/30-111--------------------------------------------------------------------------------
A3VMV9_9RHOB/328-405--------------------------------------------------------------------------------
Q2VZK6_MAGSA/61-138--------------------------------------------------------------------------------
A6DM55_9BACT/1011-1091--------------------------------------------------------------------------------
Q11XM0_CYTH3/38-121--------------------------------------------------------------------------------

PF13442

A0K328_BURCH/75-153--------------------------------------------------------------------------------
A0K328_BURCH/215-290--------------------------------------------------------------------------------
B1JSZ9_BURCC/75-153--------------------------------------------------------------------------------
B1JSZ9_BURCC/215-290--------------------------------------------------------------------------------
Q1BRF5_BURCA/75-153--------------------------------------------------------------------------------
Q1BRF5_BURCA/215-290--------------------------------------------------------------------------------
A2VU33_9BURK/75-153--------------------------------------------------------------------------------
A2VU33_9BURK/215-290--------------------------------------------------------------------------------
B4EF33_BURCJ/75-153--------------------------------------------------------------------------------
B4EF33_BURCJ/215-290--------------------------------------------------------------------------------
C5A8N1_BURGB/76-154--------------------------------------------------------------------------------
C5A8N1_BURGB/220-295--------------------------------------------------------------------------------
A3MQQ2_BURM7/51-129--------------------------------------------------------------------------------
A3MQQ2_BURM7/195-270--------------------------------------------------------------------------------
A4LN20_BURPE/51-129--------------------------------------------------------------------------------
A4LN20_BURPE/195-270--------------------------------------------------------------------------------
A5J5U3_BURML/51-129--------------------------------------------------------------------------------
A5J5U3_BURML/195-270--------------------------------------------------------------------------------
A5XRS8_BURML/51-129--------------------------------------------------------------------------------
A5XRS8_BURML/195-270--------------------------------------------------------------------------------
A8EGW2_BURPE/51-129--------------------------------------------------------------------------------
A8EGW2_BURPE/195-270--------------------------------------------------------------------------------
A8KF95_BURPE/51-129--------------------------------------------------------------------------------
A8KF95_BURPE/195-270--------------------------------------------------------------------------------
B2H915_BURPE/51-129--------------------------------------------------------------------------------
B2H915_BURPE/195-270--------------------------------------------------------------------------------
C0XW58_BURPE/51-129--------------------------------------------------------------------------------
C0XW58_BURPE/195-270--------------------------------------------------------------------------------
C4KXQ3_BURPE/51-129--------------------------------------------------------------------------------
C4KXQ3_BURPE/195-270--------------------------------------------------------------------------------
C5ZFF6_BURPE/51-129--------------------------------------------------------------------------------
C5ZFF6_BURPE/195-270--------------------------------------------------------------------------------
C6U0W3_BURPE/51-129--------------------------------------------------------------------------------
C6U0W3_BURPE/195-270--------------------------------------------------------------------------------
B7CVC2_BURPE/51-129--------------------------------------------------------------------------------
B7CVC2_BURPE/195-270--------------------------------------------------------------------------------
A1V8M8_BURMS/75-153--------------------------------------------------------------------------------
A1V8M8_BURMS/219-294--------------------------------------------------------------------------------
A2S6E6_BURM9/75-153--------------------------------------------------------------------------------
A2S6E6_BURM9/219-294--------------------------------------------------------------------------------
A3P0T7_BURP0/75-153--------------------------------------------------------------------------------
A3P0T7_BURP0/219-294--------------------------------------------------------------------------------
A5TIA4_BURML/75-153--------------------------------------------------------------------------------
A5TIA4_BURML/219-294--------------------------------------------------------------------------------
A9K196_BURML/75-153--------------------------------------------------------------------------------
A9K196_BURML/219-294--------------------------------------------------------------------------------
B1HAC1_BURPE/75-153--------------------------------------------------------------------------------
B1HAC1_BURPE/219-294--------------------------------------------------------------------------------
C5NBD6_BURML/75-153--------------------------------------------------------------------------------
C5NBD6_BURML/219-294--------------------------------------------------------------------------------
Q3JY17_BURP1/75-153--------------------------------------------------------------------------------
Q3JY17_BURP1/219-294--------------------------------------------------------------------------------
Q62FM1_BURMA/75-153--------------------------------------------------------------------------------
Q62FM1_BURMA/219-294--------------------------------------------------------------------------------
Q63PM0_BURPS/75-153--------------------------------------------------------------------------------
Q63PM0_BURPS/219-294--------------------------------------------------------------------------------
Q2Y8Z1_NITMU/39-105--------------------------------------------------------------------------------
A3NEY9_BURP6/75-153--------------------------------------------------------------------------------
A3NEY9_BURP6/219-294--------------------------------------------------------------------------------
Q13SS3_BURXL/75-153--------------------------------------------------------------------------------
Q13SS3_BURXL/218-293--------------------------------------------------------------------------------
Q2STJ4_BURTA/75-153--------------------------------------------------------------------------------
Q2STJ4_BURTA/220-295--------------------------------------------------------------------------------
B2T7I2_BURPP/75-153--------------------------------------------------------------------------------
B2T7I2_BURPP/220-295--------------------------------------------------------------------------------
A1TJ54_ACIAC/76-151--------------------------------------------------------------------------------
A1TJ54_ACIAC/219-294--------------------------------------------------------------------------------
A3RTQ6_RALSL/78-156--------------------------------------------------------------------------------
A3RTQ6_RALSL/215-290--------------------------------------------------------------------------------
B5SK16_RALSL/78-156--------------------------------------------------------------------------------
B5SK16_RALSL/215-290--------------------------------------------------------------------------------
B5RZE1_RALSL/78-156--------------------------------------------------------------------------------
B5RZE1_RALSL/215-290--------------------------------------------------------------------------------
B2UFB9_RALPJ/78-156--------------------------------------------------------------------------------
B2UFB9_RALPJ/217-292--------------------------------------------------------------------------------
A5II84_LEGPC/352-429--------------------------------------------------------------------------------
Q5WSR4_LEGPL/352-429--------------------------------------------------------------------------------
Q5X0Y3_LEGPA/352-429--------------------------------------------------------------------------------
Q5ZRI3_LEGPH/352-429--------------------------------------------------------------------------------
C6BG20_RALP1/78-156--------------------------------------------------------------------------------
C6BG20_RALP1/218-293--------------------------------------------------------------------------------
F0Q4K8_ACIAP/76-151--------------------------------------------------------------------------------
F0Q4K8_ACIAP/219-294--------------------------------------------------------------------------------
Q8XUU9_RALSO/78-156--------------------------------------------------------------------------------
Q8XUU9_RALSO/214-289--------------------------------------------------------------------------------
A1VIW0_POLNA/80-155--------------------------------------------------------------------------------
A1VIW0_POLNA/213-288--------------------------------------------------------------------------------
B3EB84_GEOLS/352-421--------------------------------------------------------------------------------
B3EB84_GEOLS/436-501--------------------------------------------------------------------------------
B3EB84_GEOLS/512-577--------------------------------------------------------------------------------
Q12GP1_POLSJ/80-155--------------------------------------------------------------------------------
Q12GP1_POLSJ/208-283--------------------------------------------------------------------------------
Q0AFI2_NITEC/44-110--------------------------------------------------------------------------------
C6WTZ7_METML/211-287--------------------------------------------------------------------------------
Q82WE5_NITEU/35-101--------------------------------------------------------------------------------
A1VU04_POLNA/31-97--------------------------------------------------------------------------------
C6JUF9_PSEFL/35-101--------------------------------------------------------------------------------
C6JUF4_PSEFL/35-101--------------------------------------------------------------------------------
A3X1R5_9BRAD/34-102--------------------------------------------------------------------------------
Q8KP42_PSEME/35-101--------------------------------------------------------------------------------
B1ZRL1_OPITP/34-103--------------------------------------------------------------------------------
D0J2D1_COMT2/26-92--------------------------------------------------------------------------------
C8N731_9GAMM/102-179--------------------------------------------------------------------------------
Q3J8I0_NITOC/35-102--------------------------------------------------------------------------------
Q2G427_NOVAD/30-96--------------------------------------------------------------------------------
Q2G7T2_NOVAD/31-97--------------------------------------------------------------------------------
C5BNC6_TERTT/224-296--------------------------------------------------------------------------------
A3ZY52_9PLAN/1756-1835--------------------------------------------------------------------------------
Q0F3R3_9PROT/335-410--------------------------------------------------------------------------------
A4XEH7_NOVAD/35-101--------------------------------------------------------------------------------
A0RN00_CAMFF/205-280--------------------------------------------------------------------------------
C4ZM80_THASP/26-92--------------------------------------------------------------------------------
B4AKK7_BACPU/178-249--------------------------------------------------------------------------------
A8FEI8_BACP2/178-249--------------------------------------------------------------------------------
Q89GY7_BRAJA/40-112--------------------------------------------------------------------------------
Q7UL60_RHOBA/230-305--------------------------------------------------------------------------------
Q1NJ28_9DELT/211-281--------------------------------------------------------------------------------
B5EHM0_GEOBB/34-103--------------------------------------------------------------------------------
Q1K0H2_DESAC/350-419--------------------------------------------------------------------------------
Q8EQC7_OCEIH/180-249--------------------------------------------------------------------------------
Q11NE0_CYTH3/154-225--------------------------------------------------------------------------------
A5WD19_PSYWF/136-211--------------------------------------------------------------------------------
D0VWQ8_ALCXX/7-82--------------------------------------------------------------------------------
D6XW92_BACIE/51-118--------------------------------------------------------------------------------
P95552_PSEST/32-106--------------------------------------------------------------------------------
A4BV27_9GAMM/79-153--------------------------------------------------------------------------------
C5BK07_TERTT/25-100--------------------------------------------------------------------------------
A2SCL5_METPP/36-107--------------------------------------------------------------------------------
C5CN75_VARPS/92-168--------------------------------------------------------------------------------
Q5WGR1_BACSK/178-250--------------------------------------------------------------------------------
A2SLQ6_METPP/84-159--------------------------------------------------------------------------------
D2R455_PIRSD/244-319--------------------------------------------------------------------------------
B2A017_OPITP/98-173--------------------------------------------------------------------------------
A4B9A6_9GAMM/56-132--------------------------------------------------------------------------------
B3T2H7_9ZZZZ/21-95--------------------------------------------------------------------------------
A5IAJ3_LEGPC/61-138--------------------------------------------------------------------------------
Q1QDL1_PSYCK/145-220--------------------------------------------------------------------------------
D3G0J4_BACPE/179-251--------------------------------------------------------------------------------
B6EP52_ALISL/55-131--------------------------------------------------------------------------------
A0RBX8_BACAH/178-249--------------------------------------------------------------------------------
B0AM87_BACAN/178-249--------------------------------------------------------------------------------
B0Q297_BACAN/178-249--------------------------------------------------------------------------------
B0QG91_BACAN/178-249--------------------------------------------------------------------------------
B1EYK7_BACAN/178-249--------------------------------------------------------------------------------
B1GFJ8_BACAN/178-249--------------------------------------------------------------------------------
B1UMW0_BACAN/178-249--------------------------------------------------------------------------------
B3JAQ8_BACAN/178-249--------------------------------------------------------------------------------
B3YRF3_BACCE/178-249--------------------------------------------------------------------------------
B3Z7J4_BACCE/178-249--------------------------------------------------------------------------------
B3ZTY1_BACCE/178-249--------------------------------------------------------------------------------
B7JH09_BACC0/178-249--------------------------------------------------------------------------------
C1EN21_BACC3/178-249--------------------------------------------------------------------------------
C2NF71_BACCE/178-249--------------------------------------------------------------------------------
C2TEA4_BACCE/178-249--------------------------------------------------------------------------------
C3EZD1_BACTU/178-249--------------------------------------------------------------------------------
C3G0Q1_BACTU/178-249--------------------------------------------------------------------------------
C3GGJ6_BACTU/178-249--------------------------------------------------------------------------------
C3HG73_BACTU/178-249--------------------------------------------------------------------------------
C3L8R5_BACAC/178-249--------------------------------------------------------------------------------
C3P5B1_BACAA/178-249--------------------------------------------------------------------------------
Q6HL31_BACHK/178-249--------------------------------------------------------------------------------
Q81SU9_BACAN/178-249--------------------------------------------------------------------------------
Q4FUM0_PSYA2/143-218--------------------------------------------------------------------------------
Q1YS14_9GAMM/67-143--------------------------------------------------------------------------------
Q1QE86_PSYCK/91-166--------------------------------------------------------------------------------
C3B1J5_BACMY/178-249--------------------------------------------------------------------------------
C3BIA6_9BACI/178-249--------------------------------------------------------------------------------
D6XUY1_BACIE/178-250--------------------------------------------------------------------------------
B5V2U6_BACCE/178-249--------------------------------------------------------------------------------
B7HL34_BACC7/178-249--------------------------------------------------------------------------------
B9IVP6_BACCQ/178-249--------------------------------------------------------------------------------
C2MII8_BACCE/178-249--------------------------------------------------------------------------------
C2S1G8_BACCE/178-249--------------------------------------------------------------------------------
Q63DK8_BACCZ/178-249--------------------------------------------------------------------------------
Q81FP7_BACCR/172-243--------------------------------------------------------------------------------
C3GYS6_BACTU/178-249--------------------------------------------------------------------------------
B5URU6_BACCE/178-249--------------------------------------------------------------------------------
B7HHS8_BACC4/178-249--------------------------------------------------------------------------------
C2MYL6_BACCE/178-249--------------------------------------------------------------------------------
C2NWM6_BACCE/178-249--------------------------------------------------------------------------------
C2QQR7_BACCE/178-249--------------------------------------------------------------------------------
C2RKU7_BACCE/178-249--------------------------------------------------------------------------------
C2SYQ2_BACCE/178-249--------------------------------------------------------------------------------
C2UBM2_BACCE/178-249--------------------------------------------------------------------------------
C2WK72_BACCE/178-249--------------------------------------------------------------------------------
C2X9K4_BACCE/178-249--------------------------------------------------------------------------------
C2Y8G0_BACCE/178-249--------------------------------------------------------------------------------
C2Z5M9_BACCE/178-249--------------------------------------------------------------------------------
C2ZM95_BACCE/178-249--------------------------------------------------------------------------------
C3C034_BACTU/178-249--------------------------------------------------------------------------------
C3E1B1_BACTU/178-249--------------------------------------------------------------------------------
C3EIK3_BACTK/178-249--------------------------------------------------------------------------------
Q4MST6_BACCE/178-249--------------------------------------------------------------------------------
Q73AX1_BACC1/178-249--------------------------------------------------------------------------------
C1A678_GEMAT/516-598--------------------------------------------------------------------------------
Q21JH2_SACD2/34-109--------------------------------------------------------------------------------
C2Q9R0_BACCE/178-249--------------------------------------------------------------------------------
A9VMD4_BACWK/178-249--------------------------------------------------------------------------------
C2PTR4_BACCE/178-249--------------------------------------------------------------------------------
C2SHL7_BACCE/178-249--------------------------------------------------------------------------------
C2XRR1_BACCE/178-249--------------------------------------------------------------------------------
C3A3S0_BACMY/178-249--------------------------------------------------------------------------------
B7IPA2_BACC2/178-249--------------------------------------------------------------------------------
C2TV22_BACCE/178-249--------------------------------------------------------------------------------
C2UT44_BACCE/178-249--------------------------------------------------------------------------------
C2V9J2_BACCE/178-249--------------------------------------------------------------------------------
C2YPE5_BACCE/178-249--------------------------------------------------------------------------------
C3CGJ2_BACTU/178-249--------------------------------------------------------------------------------
C3CZE5_BACTU/178-249--------------------------------------------------------------------------------
C3DHL8_BACTS/178-249--------------------------------------------------------------------------------
C3FHX4_BACTB/178-249--------------------------------------------------------------------------------
C3HY61_BACTU/178-249--------------------------------------------------------------------------------
C3IH73_BACTU/178-249--------------------------------------------------------------------------------
Q3ESN2_BACTI/178-249--------------------------------------------------------------------------------
C2VRF5_BACCE/178-249--------------------------------------------------------------------------------
A3JE72_9ALTE/56-132--------------------------------------------------------------------------------
C2PCP2_BACCE/178-249--------------------------------------------------------------------------------
A0L6L8_MAGSM/25-95--------------------------------------------------------------------------------
B8KYK8_9GAMM/634-708--------------------------------------------------------------------------------
Q4FV72_PSYA2/93-168--------------------------------------------------------------------------------
Q82TZ4_NITEU/85-152--------------------------------------------------------------------------------
A6W1H2_MARMS/29-105--------------------------------------------------------------------------------
A4A914_9GAMM/17-93--------------------------------------------------------------------------------
D4H0P9_DENA2/26-97--------------------------------------------------------------------------------
B8KLV3_9GAMM/22-98--------------------------------------------------------------------------------
A9W2D2_METEP/56-134--------------------------------------------------------------------------------
B7KSQ2_METC4/56-134--------------------------------------------------------------------------------
C5AXV6_METEA/56-134--------------------------------------------------------------------------------
C7CJT2_METED/56-134--------------------------------------------------------------------------------
Q0FQZ5_9RHOB/60-138--------------------------------------------------------------------------------
Q1LDJ6_RALME/52-132--------------------------------------------------------------------------------
Q3A729_PELCD/69-146--------------------------------------------------------------------------------
A6EF04_9SPHI/412-488--------------------------------------------------------------------------------
Q605U1_METCA/45-120--------------------------------------------------------------------------------
Q2S8E3_HAHCH/60-136--------------------------------------------------------------------------------
A3Q9B5_SHELP/19-95--------------------------------------------------------------------------------
Q1LII5_RALME/19-93--------------------------------------------------------------------------------
B1ZVK5_OPITP/8-83--------------------------------------------------------------------------------
Q1IIF1_KORVE/68-152--------------------------------------------------------------------------------
A3TSJ1_9RHOB/75-157--------------------------------------------------------------------------------
B1LYY5_METRJ/58-136--------------------------------------------------------------------------------
A3K6B2_9RHOB/58-136--------------------------------------------------------------------------------
B7RVE4_9GAMM/425-501--------------------------------------------------------------------------------
Q1GQD3_SPHAL/80-161--------------------------------------------------------------------------------
A0Z1D9_9GAMM/430-506--------------------------------------------------------------------------------
A3VLY6_9RHOB/63-141--------------------------------------------------------------------------------
Q9KH03_CUPNE/611-686--------------------------------------------------------------------------------
Q88HM2_PSEPK/18-94--------------------------------------------------------------------------------
A2SG66_METPP/49-118--------------------------------------------------------------------------------
A8LI62_DINSH/59-137--------------------------------------------------------------------------------
A5WCC6_PSYWF/115-190--------------------------------------------------------------------------------
C9QBF2_9VIBR/55-131--------------------------------------------------------------------------------
Q1JVS4_DESAC/25-92--------------------------------------------------------------------------------
A0LNA9_SYNFM/67-151--------------------------------------------------------------------------------
B7RZH9_9GAMM/25-101--------------------------------------------------------------------------------
D2WEZ5_9GAMM/30-104--------------------------------------------------------------------------------
C8PYE9_9GAMM/116-192--------------------------------------------------------------------------------
B1ZKW8_METPB/56-134--------------------------------------------------------------------------------
Q5LT99_SILPO/60-138--------------------------------------------------------------------------------
C6E8A8_GEOSM/29-106--------------------------------------------------------------------------------
E0TI01_PARBH/75-157--------------------------------------------------------------------------------
A9WF34_CHLAA/94-175--------------------------------------------------------------------------------
B9LHX9_CHLSY/94-175--------------------------------------------------------------------------------
B8G9D9_CHLAD/94-175--------------------------------------------------------------------------------
A7HSP3_PARL1/649-723--------------------------------------------------------------------------------
D0LWM7_HALO1/365-433--------------------------------------------------------------------------------
A6DGN2_9BACT/21-96--------------------------------------------------------------------------------
Q2BM08_9GAMM/16-92--------------------------------------------------------------------------------
Q21LI4_SACD2/423-490--------------------------------------------------------------------------------
Q2S0S2_SALRD/114-197--------------------------------------------------------------------------------
Q0YNZ6_9CHLB/35-111--------------------------------------------------------------------------------
B1ZSK7_OPITP/523-610--------------------------------------------------------------------------------
D0D4Y1_9RHOB/62-140--------------------------------------------------------------------------------
Q026Z1_SOLUE/491-561--------------------------------------------------------------------------------
B4RBL1_PHEZH/38-106--------------------------------------------------------------------------------
Q0YRR8_9CHLB/36-112--------------------------------------------------------------------------------
A4ABJ9_9GAMM/59-137--------------------------------------------------------------------------------
Q84LN7_CHLVU/52-130--------------------------------------------------------------------------------
A0YFF9_9GAMM/632-707--------------------------------------------------------------------------------
Q4W6G0_PSEPU/622-695--------------------------------------------------------------------------------
Q0I8W0_SYNS3/21-97--------------------------------------------------------------------------------
E6TZH9_BACCJ/180-254--------------------------------------------------------------------------------
Q1N1U1_9GAMM/38-115--------------------------------------------------------------------------------
B6B5B9_9RHOB/69-147--------------------------------------------------------------------------------
A6VEW6_PSEA7/18-94--------------------------------------------------------------------------------
B7RIJ2_9RHOB/64-142--------------------------------------------------------------------------------
A4C9E1_9GAMM/182-254--------------------------------------------------------------------------------
Q4KAC1_PSEF5/53-129--------------------------------------------------------------------------------
C6E1Z8_GEOSM/25-100--------------------------------------------------------------------------------
Q471V2_CUPPJ/631-706--------------------------------------------------------------------------------
B4U7B8_HYDS0/42-117--------------------------------------------------------------------------------
D0CP62_9RHOB/426-500--------------------------------------------------------------------------------
Q26HW6_FLABB/102-181--------------------------------------------------------------------------------
Q8GCG9_PSEFL/18-94--------------------------------------------------------------------------------
D5SY03_PLAL2/362-450--------------------------------------------------------------------------------
A4BFL7_9GAMM/24-88--------------------------------------------------------------------------------
A3L1D9_PSEAI/18-94--------------------------------------------------------------------------------
A3LGA3_PSEAI/18-94--------------------------------------------------------------------------------
B7V728_PSEA8/18-94--------------------------------------------------------------------------------
Q02DL8_PSEAB/18-94--------------------------------------------------------------------------------
Q9HT82_PSEAE/18-94--------------------------------------------------------------------------------
D3S0D5_FERPA/76-139--------------------------------------------------------------------------------
Q5LL07_SILPO/30-104--------------------------------------------------------------------------------
D0J6H9_COMT2/104-185--------------------------------------------------------------------------------
A7H7J6_ANADF/38-103--------------------------------------------------------------------------------
Q3AKY1_SYNSC/17-93--------------------------------------------------------------------------------
A5VWC9_PSEP1/68-150--------------------------------------------------------------------------------
B0KEW0_PSEPG/68-150--------------------------------------------------------------------------------
B1J3Z3_PSEPW/68-150--------------------------------------------------------------------------------
Q9HTM7_PSEAE/47-123--------------------------------------------------------------------------------
D0CI16_9SYNE/31-107--------------------------------------------------------------------------------
Q02E34_PSEAB/47-123--------------------------------------------------------------------------------
A3L1T9_PSEAI/47-123--------------------------------------------------------------------------------
A3LIE6_PSEAI/47-123--------------------------------------------------------------------------------
B7V5L9_PSEA8/47-123--------------------------------------------------------------------------------
B9M8G0_GEOSF/51-126--------------------------------------------------------------------------------
B8KSW1_9GAMM/101-179--------------------------------------------------------------------------------
A6VED5_PSEA7/45-121--------------------------------------------------------------------------------
A1W767_ACISJ/63-138--------------------------------------------------------------------------------
B9MJ36_ACIET/63-138--------------------------------------------------------------------------------
A9BZT2_DELAS/622-697--------------------------------------------------------------------------------
A4VN17_PSEU5/68-150--------------------------------------------------------------------------------
Q0ACJ7_ALHEH/98-174--------------------------------------------------------------------------------
Q4FV28_PSYA2/32-109--------------------------------------------------------------------------------
A1K9F5_AZOSB/602-677--------------------------------------------------------------------------------
Q3KKA8_PSEPF/7-83--------------------------------------------------------------------------------
B1JFS5_PSEPW/68-150--------------------------------------------------------------------------------
A5EMR9_BRASB/626-701--------------------------------------------------------------------------------
B4D145_9BACT/68-137--------------------------------------------------------------------------------
A6EI04_9SPHI/26-100--------------------------------------------------------------------------------
Q88C05_PSEPK/68-150--------------------------------------------------------------------------------
Q7NZ83_CHRVO/47-123--------------------------------------------------------------------------------
Q9AF95_9RHOO/605-680--------------------------------------------------------------------------------
Q1QE33_PSYCK/32-109--------------------------------------------------------------------------------
B0UF76_METS4/91-172--------------------------------------------------------------------------------
A9F4Z4_SORC5/91-172--------------------------------------------------------------------------------
A3PCC0_PROM0/31-108--------------------------------------------------------------------------------
A4VGU0_PSEU5/60-138--------------------------------------------------------------------------------
B1Y086_LEPCP/35-110--------------------------------------------------------------------------------
B7G2Z5_PHATC/72-143--------------------------------------------------------------------------------
A1WF08_VEREI/621-696--------------------------------------------------------------------------------
B1JFJ2_PSEPW/18-94--------------------------------------------------------------------------------
D2QKH1_SPILD/42-109--------------------------------------------------------------------------------
A0L539_MAGSM/166-238--------------------------------------------------------------------------------
Q1IGY0_PSEE4/18-94--------------------------------------------------------------------------------
C5CQ48_VARPS/612-687--------------------------------------------------------------------------------
Q6N4Z5_RHOPA/638-713--------------------------------------------------------------------------------
B8KKI4_9GAMM/55-133--------------------------------------------------------------------------------
B5JNZ8_9BACT/52-133--------------------------------------------------------------------------------
A0Y8S9_9GAMM/622-697--------------------------------------------------------------------------------
A2C131_PROM1/36-112--------------------------------------------------------------------------------
B0KG05_PSEPG/18-94--------------------------------------------------------------------------------
Q3KBY3_PSEPF/17-93--------------------------------------------------------------------------------
Q8RTS8_9PROT/651-725--------------------------------------------------------------------------------
A1WTA0_HALHL/21-98--------------------------------------------------------------------------------
Q07KS9_RHOP5/641-716--------------------------------------------------------------------------------
E8YS57_9BURK/45-120--------------------------------------------------------------------------------
B8R969_9BACT/65-140--------------------------------------------------------------------------------
B8H4A4_CAUCN/35-111--------------------------------------------------------------------------------
Q9A8X9_CAUCR/35-111--------------------------------------------------------------------------------
B4CXG6_9BACT/32-109--------------------------------------------------------------------------------
A4XUG0_PSEMY/68-150--------------------------------------------------------------------------------
Q2IXK0_RHOP2/644-719--------------------------------------------------------------------------------
C4K9Z0_THASP/48-122--------------------------------------------------------------------------------
B1FT19_9BURK/45-120--------------------------------------------------------------------------------
E6VCM9_RHOPX/638-713--------------------------------------------------------------------------------
A5VWQ7_PSEP1/18-94--------------------------------------------------------------------------------
Q88RK4_PSEPK/18-94--------------------------------------------------------------------------------
Q0KAI6_CUPNH/582-657--------------------------------------------------------------------------------
B7S1Q2_9GAMM/35-111--------------------------------------------------------------------------------
E1TEX3_BURSG/45-120--------------------------------------------------------------------------------
Q46LX6_PROMT/36-112--------------------------------------------------------------------------------
D2QK82_SPILD/25-95--------------------------------------------------------------------------------
C5BSV8_TERTT/1230-1297--------------------------------------------------------------------------------
B7S2D0_9GAMM/68-146--------------------------------------------------------------------------------
B9R5L0_9RHOB/612-687--------------------------------------------------------------------------------
Q13QS4_BURXL/45-120--------------------------------------------------------------------------------
B9QVQ8_9RHOB/17-93--------------------------------------------------------------------------------
B8KQH3_9GAMM/31-98--------------------------------------------------------------------------------
D5WEW9_BURSC/45-120--------------------------------------------------------------------------------
B0T3F8_CAUSK/36-112--------------------------------------------------------------------------------
C4KB05_THASP/28-92--------------------------------------------------------------------------------
A1WW82_HALHL/90-167--------------------------------------------------------------------------------
A4BFF1_9GAMM/24-92--------------------------------------------------------------------------------
A5KGE9_CAMJU/71-137--------------------------------------------------------------------------------
A1VXP2_CAMJJ/71-137--------------------------------------------------------------------------------
A3YQA3_CAMJU/71-137--------------------------------------------------------------------------------
A3ZF72_CAMJU/71-137--------------------------------------------------------------------------------
B3EJX0_CHLPB/146-225--------------------------------------------------------------------------------
A1TWT3_MARAV/44-120--------------------------------------------------------------------------------
D2MR24_CAMJU/71-137--------------------------------------------------------------------------------
A3YKK9_CAMJU/71-137--------------------------------------------------------------------------------
A3ZJN7_CAMJU/71-137--------------------------------------------------------------------------------
B5QIA5_CAMJU/71-137--------------------------------------------------------------------------------
Q0PBX9_CAMJE/71-137--------------------------------------------------------------------------------
A8FJW7_CAMJ8/71-137--------------------------------------------------------------------------------
B0TS56_SHEHH/27-94--------------------------------------------------------------------------------
A7H1N6_CAMJD/71-137--------------------------------------------------------------------------------
A1WSQ3_VEREI/55-130--------------------------------------------------------------------------------
QHED_COMTE/622-697--------------------------------------------------------------------------------
A5VG31_SPHWW/615-690--------------------------------------------------------------------------------
A5V5X2_SPHWW/57-123--------------------------------------------------------------------------------
B7X052_COMTE/622-697--------------------------------------------------------------------------------
B3R1B3_CUPTR/636-711--------------------------------------------------------------------------------
D0IWC5_COMT2/622-697--------------------------------------------------------------------------------
Q1QF01_NITHX/68-148--------------------------------------------------------------------------------
A0Z3Y4_9GAMM/641-716--------------------------------------------------------------------------------
B7RXM4_9GAMM/605-679--------------------------------------------------------------------------------
B1Y7W8_LEPCP/63-138--------------------------------------------------------------------------------
D3FLC6_CAMJI/71-137--------------------------------------------------------------------------------
Q5HX07_CAMJR/71-137--------------------------------------------------------------------------------
C7JEE1_ACEP3/619-694--------------------------------------------------------------------------------
C7JQJ9_ACEPA/619-694--------------------------------------------------------------------------------
C7JZR4_ACEPA/619-694--------------------------------------------------------------------------------
C7K2I2_ACEPA/619-694--------------------------------------------------------------------------------
C7KBQ1_ACEPA/619-694--------------------------------------------------------------------------------
C7KL17_ACEPA/619-694--------------------------------------------------------------------------------
C7KVD0_ACEPA/619-694--------------------------------------------------------------------------------
C7L556_ACEPA/619-694--------------------------------------------------------------------------------
A7NJ91_ROSCS/100-182--------------------------------------------------------------------------------
C5CPS1_VARPS/42-117--------------------------------------------------------------------------------
A8EVK9_ARCB4/387-456--------------------------------------------------------------------------------
Q47WF2_COLP3/36-109--------------------------------------------------------------------------------
A4A7C0_9GAMM/654-729--------------------------------------------------------------------------------
B8GPJ9_THISH/24-93--------------------------------------------------------------------------------
Q82Y64_NITEU/48-115--------------------------------------------------------------------------------
Q1QG40_NITHX/70-151--------------------------------------------------------------------------------
A4ABA2_9GAMM/426-499--------------------------------------------------------------------------------
D5X2V9_THIK1/41-111--------------------------------------------------------------------------------
A3L1W6_PSEAI/55-133--------------------------------------------------------------------------------
A3LIH3_PSEAI/55-133--------------------------------------------------------------------------------
B7V5J1_PSEA8/55-133--------------------------------------------------------------------------------
Q02E62_PSEAB/55-133--------------------------------------------------------------------------------
Q9HTQ4_PSEAE/55-133--------------------------------------------------------------------------------
Q0BZB7_HYPNA/37-107--------------------------------------------------------------------------------
Q21JC5_SACD2/72-165--------------------------------------------------------------------------------
NIRC_PARDP/23-97--------------------------------------------------------------------------------
A5VXY0_PSEP1/68-150--------------------------------------------------------------------------------
Q1QFM0_NITHX/68-148--------------------------------------------------------------------------------
Q135A3_RHOPS/641-716--------------------------------------------------------------------------------
C1AAV5_GEMAT/57-124--------------------------------------------------------------------------------
B8KW87_9GAMM/19-85--------------------------------------------------------------------------------
Q169Z8_ROSDO/26-100--------------------------------------------------------------------------------
A0Z5T1_9GAMM/60-126--------------------------------------------------------------------------------
Q7VD12_PROMA/41-117--------------------------------------------------------------------------------
C1AAU5_GEMAT/503-570--------------------------------------------------------------------------------
Q11ZY1_POLSJ/635-710--------------------------------------------------------------------------------
A8G0N9_SHESH/28-95--------------------------------------------------------------------------------
Q5NW84_AROAE/45-111--------------------------------------------------------------------------------
A8PQE4_9COXI/63-139--------------------------------------------------------------------------------
Q0AJH5_NITEC/28-95--------------------------------------------------------------------------------
B5WW29_9BURK/45-120--------------------------------------------------------------------------------
A0Z5N7_9GAMM/37-103--------------------------------------------------------------------------------
B2JX30_BURP8/50-125--------------------------------------------------------------------------------
D5CQP3_SIDLE/23-93--------------------------------------------------------------------------------
A1VBG6_DESVV/352-421--------------------------------------------------------------------------------
E3IKU2_DESVR/352-421--------------------------------------------------------------------------------
Q728W8_DESVH/352-421--------------------------------------------------------------------------------
A6VEA5_PSEA7/61-139--------------------------------------------------------------------------------
A2W3G8_9BURK/172-243--------------------------------------------------------------------------------
E6VR86_DESAO/28-93--------------------------------------------------------------------------------
Q4K966_PSEF5/28-93--------------------------------------------------------------------------------
Q315B2_DESDG/27-92--------------------------------------------------------------------------------
A2SLA8_METPP/65-140--------------------------------------------------------------------------------
B6ARF2_9BACT/47-108--------------------------------------------------------------------------------
Q7UKT3_RHOBA/60-129--------------------------------------------------------------------------------
A3ZL90_9PLAN/38-114--------------------------------------------------------------------------------
D1RGY4_LEGLO/35-114--------------------------------------------------------------------------------
D3HQM6_LEGLN/35-114--------------------------------------------------------------------------------
Q1Q4F5_9BACT/116-192--------------------------------------------------------------------------------
C4FJP2_9AQUI/297-366--------------------------------------------------------------------------------
D3P8P2_DEFDS/26-95--------------------------------------------------------------------------------
D9SIK9_GALCS/24-94--------------------------------------------------------------------------------
Q3SIT8_THIDA/21-80--------------------------------------------------------------------------------
A6UL88_SINMW/71-147--------------------------------------------------------------------------------
C7RBR8_KANKD/70-157--------------------------------------------------------------------------------
A6CBQ2_9PLAN/55-123--------------------------------------------------------------------------------
B8KVD8_9GAMM/610-683--------------------------------------------------------------------------------
Q89MF2_BRAJA/61-136--------------------------------------------------------------------------------
Q46TV3_CUPPJ/26-98--------------------------------------------------------------------------------
D2R7R9_PIRSD/50-127--------------------------------------------------------------------------------
A5V502_SPHWW/612-686--------------------------------------------------------------------------------
A3ZQN4_9PLAN/34-103--------------------------------------------------------------------------------
C6BWV7_DESAD/28-93--------------------------------------------------------------------------------
B1Y5Y6_LEPCP/37-112--------------------------------------------------------------------------------
D5W8B0_BURSC/32-103--------------------------------------------------------------------------------
A8EWG4_ARCB4/134-211--------------------------------------------------------------------------------
Q5P5Q6_AROAE/31-96--------------------------------------------------------------------------------

PF14495

CY550_SYNY3/26-160--------VELTE.........STRTIPL.......DEAGG---------------------------------------
A0YIA2_LYNSP/27-163--------IELTE.........DLRTFPL.......NEQGE---------------------------------------
B5W3Z1_SPIMA/27-163--------LELTE.........ELRTLPI.......NAQGD---------------------------------------
D8FTU7_9CYAN/26-162--------VELSE.........EVRTVPL.......NAQGK---------------------------------------
CY550_TRIEI/26-161--------AKLDD.........NVRTLPL.......NED.K---------------------------------------
B4VPE5_9CYAN/41-177--------LELSE.........DIRTVPV.......NEQGN---------------------------------------
CY550_APHHA/27-163--------LELDE.........ESRTVQY.......NEQGD---------------------------------------
CY550_PHATC/27-163--------IDLDE.........ATRTVVV.......DSSGK---------------------------------------
A6MVU4_RHDSA/27-161--------IDLDE.........NTRTIPL.......DSSGT---------------------------------------
B7T207_VAULI/27-163--------IELDE.........ATRTVAQ.......DNSSK---------------------------------------
D1GJF7_FUCVE/25-161--------IELDE.........ATRTIPV.......TSDGK---------------------------------------
C6KIN7_AURAN/27-162--------IDLDD.........ATRTVSL........DGSK---------------------------------------
CY550_CYAPA/27-162--------AALDE.........ETRTVAL........NSTE---------------------------------------
CY550_PORYE/27-163--------IELDE.........ATRTVPL.......ESSGR---------------------------------------
D4NY78_GALSU/31-167--------NDLDE.........KSRTVLL.......NENGK---------------------------------------
CY550_CYAME/17-150--------ISWAT.........EVVK..........DVSGQ---------------------------------------
C550A_CYACA/28-164--------LELNE.........EARTVKL.......NSEGQ---------------------------------------
D9IXN9_9ALVE/21-157--------KELDS.........EALTIPL.......NEAGR---------------------------------------
CY550_EMIHU/28-164--------LELDE.........DTRTVTL.......DGKGN---------------------------------------
A0YIA1_LYNSP/32-167--------DGVDPYVRRYLAS.QPVEIPA.......DNQGH---------------------------------------
D8FTU8_9CYAN/31-167--------DALDPYVVRYLQAKEPIELEL.......NGQGE---------------------------------------
B0C732_ACAM1/13-153--------GDIEDYIVRYLKVTEPVPIVM.......DASGE---------------------------------------
B8HUH8_CYAP4/28-165--------ARVDEYVYRFLAK.EPVTIPI.......NSAGE---------------------------------------
PSBV2_THEEB/36-172--------AGVDNYVIQYLKVTDTVELPV.......NDRGE---------------------------------------
PSBV2_SYNJB/38-165--------ARIDPYVNQYLRVSGPVELPL.......DAAGH---------------------------------------
C5501_GLOVI/39-173--------ALKDKYVTVNLGVRGPVDLPA.......DGVGN---------------------------------------
C5502_GLOVI/28-166--------TTAEA.........PSEPAPVAKPDVVSAATGE---------------------------------------
CY550_SYNJB/41-180--------AR............DIPAVAL........SPTE---------------------------------------
D9IXJ6_9ALVE/24-160--------RSLTD.........SIRTVKL.......SENND---------------------------------------
CY550_PROM3/34-170--------AQWDA.........ETLTVPA.......GSGGQ---------------------------------------
A3YVH4_9SYNE/47-183--------AQWDT.........ATLTVPG.......DPDGN---------------------------------------
A4CRA5_SYNPV/34-170--------ASWDA.........ETLTVPA.......DSEGS---------------------------------------
Q064V6_9SYNE/27-163--------VQWDA.........ETLTVPV.......NPDGA---------------------------------------
B1X599_PAUCH/44-180--------AQWDA.........STLTVPA.......SPDGT---------------------------------------
A5GV34_SYNR3/45-181--------VQWDA.........ETLTVPA.......DASGS---------------------------------------
A3INJ0_9CHRO/27-161--------LELTE.........ETRTVPL.......TEEGE---------------------------------------
CY550_CYAP8/26-160--------LELDE.........ATRTVAL.......DETGK---------------------------------------
A8YI71_MICAE/27-161--------LELNE.........KTLTITL.......NDAGE---------------------------------------
B7KBF5_CYAP7/27-161--------LELDK.........DTLTIPL.......NEGGD---------------------------------------
CY550_SYNP2/35-170--------TALRE.........VDRTVNL.......NET.E---------------------------------------
CY550_ACAM1/27-162--------AELDD.........ATRTVAL.......NE.GS---------------------------------------
B4WKJ4_9SYNE/35-171--------SEIDP.........ASRTVSL.......NETGE---------------------------------------
CY550_CYAP4/26-162--------AQLDA.........TTRTVAL.......NDQGK---------------------------------------
CY550_THEEB/27-163--------AELTP.........EVLTVPL.......NSEGK---------------------------------------
B4WI32_9SYNE/35-171--------AELDA.........NLRTIPL.......NEAGD---------------------------------------
CY550_SYNE7/31-167--------AELTA.........ETRTVKL.......NPQGD---------------------------------------
A0ZF54_NODSP/27-163--------LELDE.........AIRTVPL.......NDQGD---------------------------------------
D4TF74_9NOST/7-143--------VELDE.........ATRTVKL.......NEAGD---------------------------------------
D7E275_NOSA0/27-163--------VELDE.........ATRTVPL.......NEIGG---------------------------------------

PF09098

Q2BKZ1_9GAMM/29-197--------------------------------------------------------------------------------
A1K4V1_AZOSB/28-193--------------------------------------------------------------------------------
Q8VUT0_PARDE/24-190--------------------------------------------------------------------------------
A8ES16_ARCB4/28-194--------------------------------------------------------------------------------
A0NPA8_9RHOB/27-192--------------------------------------------------------------------------------
Q4K966_PSEF5/31-196--------------------------------------------------------------------------------
Q5P5Q6_AROAE/34-200--------------------------------------------------------------------------------
Q2BHT3_9GAMM/23-191--------------------------------------------------------------------------------
B1J9N8_PSEPW/50-215--------------------------------------------------------------------------------
Q5P0U9_AROAE/48-212--------------------------------------------------------------------------------
Q3KBY9_PSEPF/28-193--------------------------------------------------------------------------------

PF02167

CY1_RHOCB/30-274------------------------------F.....SFEGI---------------------------------------
A9W5T2_METEP/36-282------------------------------W.....SFAGM---------------------------------------
B7WUZ9_COMTE/27-250------------------------------W.....DKAP.---------------------------------------
B1KHU2_SHEWM/26-232------------------------------L.....ESAN.---------------------------------------
A8LMT4_DINSH/33-254------------------------------F.....PFEGP---------------------------------------
B0UHS1_METS4/35-283------------------------------W.....TFSGV---------------------------------------
A3WER2_9SPHN/55-280------------------------------F.....AFDGP---------------------------------------
CY1_SCHPO/77-295------------------------------W.....PQSKV---------------------------------------
Q47HW4_DECAR/24-238------------------------------I.....DKWP.---------------------------------------
Q1YLW6_MOBAS/60-298------------------------------W.....SFAGP---------------------------------------
Q2VZT2_MAGSA/444-663------------------------------F.....SWEGF---------------------------------------
Q18853_CAEEL/49-266------------------------------W.....AHSGP---------------------------------------
Q3R1J0_XYLFA/35-252------------------------------L.....EHAG.---------------------------------------
Q21AU1_RHOPB/449-689------------------------------W.....SFAGP---------------------------------------
Q309Z8_TOXGO/165-383------------------------------F.....WFKSL---------------------------------------
Q4FPG7_PELUB/34-255------------------------------W.....SFKGL---------------------------------------
Q1HQ62_BOMMO/77-295------------------------------W.....NHSGW---------------------------------------
Q29BY0_DROPS/78-297------------------------------W.....NHKGL---------------------------------------
A7URV6_ANOGA/67-285------------------------------W.....NHKGM---------------------------------------
Q1NGI3_9SPHN/50-278------------------------------F.....SFDGP---------------------------------------
A0L4I9_MAGSM/37-276------------------------------W.....SHLGP---------------------------------------
A5CCC9_ORITB/37-255------------------------------W.....PFNGI---------------------------------------
Q0BIV2_BURCM/32-251------------------------------L.....DRAP.---------------------------------------
A3S9Z7_9RHOB/34-275------------------------------F.....SFEGP---------------------------------------
Q15PI7_PSEA6/25-243------------------------------L.....DTAD.---------------------------------------
Q9VAM8_DROME/80-299------------------------------W.....NHKGL---------------------------------------
C6BF85_RALP1/28-246------------------------------L.....DPAP.---------------------------------------
Q8I6U9_PLAF7/163-381------------------------------F.....WFKSM---------------------------------------
Q6NAJ2_RHOPA/447-687------------------------------W.....SFAGP---------------------------------------
Q5LX54_SILPO/35-282------------------------------F.....SFEGP---------------------------------------
Q3SHU9_THIDA/27-240------------------------------L.....DKAP.---------------------------------------
Q0ARQ6_MARMM/35-267------------------------------W.....HHDGP---------------------------------------
CY1_RHOVI/37-277------------------------------W.....SFAGP---------------------------------------
CY1_DICDI/48-266------------------------------W.....EHRFP---------------------------------------
A6FK74_9RHOB/51-273------------------------------F.....SFEGP---------------------------------------
A4U106_9PROT/35-254------------------------------F.....SWDGF---------------------------------------
A6WZD7_OCHA4/50-288------------------------------W.....SFAGP---------------------------------------
A3V2K9_9RHOB/36-283------------------------------F.....PFEGP---------------------------------------
A0NYN7_9RHOB/37-292------------------------------W.....SFSGP---------------------------------------
Q31GY5_THICR/28-217------------------------------L.....EKAN.---------------------------------------
Q2YAB5_NITMU/27-244------------------------------L.....DTAP.---------------------------------------
Q21U76_RHOFD/33-256------------------------------W.....DKAP.---------------------------------------
Q0FDH4_9RHOB/32-255------------------------------F.....SFEGP---------------------------------------
A3VZ49_9RHOB/36-277------------------------------F.....SFEGP---------------------------------------
Q12FB3_POLSJ/31-254------------------------------W.....DKAP.---------------------------------------
Q98HU6_RHILO/45-283------------------------------W.....SFTGP---------------------------------------
Q0G7X2_9RHIZ/70-308------------------------------W.....SFAGP---------------------------------------
Q9JXH1_NEIMB/34-265------------------------------Y.....EKVD.---------------------------------------
Q606Q5_METCA/25-239------------------------------L.....DDVA.---------------------------------------
Q0FQ99_9RHOB/36-259------------------------------F.....SFEGP---------------------------------------
A4C8A1_9GAMM/30-248------------------------------L.....MHAN.---------------------------------------
Q5KFT4_CRYNJ/84-302------------------------------F.....EHYGP---------------------------------------
Q7W082_BORPE/27-281------------------------------L.....EKAP.---------------------------------------
Q2N670_ERYLH/52-277------------------------------W.....SFDGP---------------------------------------
A5P9W2_9SPHN/52-278------------------------------W.....SFDGP---------------------------------------
Q0C5B1_HYPNA/36-317------------------------------W.....PFEGV---------------------------------------
Q4P5I2_USTMA/273-491------------------------------W.....SHSGV---------------------------------------
Q4U9S9_THEAN/164-382------------------------------F.....WFKNA---------------------------------------
Q5P7F4_AROAE/32-250------------------------------L.....DKAP.---------------------------------------
A4A5E3_9GAMM/447-675------------------------------C.....DEVE.---------------------------------------
Q1V4G5_VIBAL/25-244------------------------------L.....DKAN.---------------------------------------
A3JUZ2_9RHOB/42-267------------------------------F.....SFDGP---------------------------------------
A3JXC6_9RHOB/41-283------------------------------F.....SFEGP---------------------------------------
Q5NNX8_ZYMMO/54-279------------------------------L.....PSDGL---------------------------------------
A4G9H2_HERAR/27-253------------------------------L.....DRAP.---------------------------------------
Q2GGU6_EHRCR/34-249------------------------------W.....KFDGI---------------------------------------
Q3IY11_RHOS4/33-277------------------------------F.....SFEGP---------------------------------------
A7TQ32_VANPO/62-281------------------------------W.....SHNGP---------------------------------------
Q2S9X6_HAHCH/27-251------------------------------L.....DHVD.---------------------------------------
A3UG74_9RHOB/36-266------------------------------F.....SFEGP---------------------------------------
Q11GB9_MESSB/42-280------------------------------W.....SFAGP---------------------------------------
Q5ZS16_LEGPH/27-245------------------------------M.....DYVP.---------------------------------------
E0TH88_PARBH/38-318------------------------------W.....HSDGI---------------------------------------
Q6VBC1_TIGCA/46-264------------------------------W.....SHKGP---------------------------------------
A1B4F4_PARDP/220-443------------------------------F.....SFEGP---------------------------------------
Q9AAW8_CAUCR/34-279------------------------------W.....SFEGP---------------------------------------
A7T224_NEMVE/42-238------------------------------W.....SHNGV---------------------------------------
A3JAB5_9ALTE/26-250------------------------------L.....DHIK.---------------------------------------
Q2LZL6_DROPS/77-295------------------------------W.....NHKGL---------------------------------------
Q2GDE1_NEOSM/33-247------------------------------W.....SFEGP---------------------------------------
Q2URC0_ASPOR/83-302------------------------------W.....EHAKW---------------------------------------
Q5GRL2_WOLTR/34-249------------------------------W.....SFDGA---------------------------------------
A1WPT3_VEREI/29-252------------------------------W.....DKAP.---------------------------------------
Q3JEC0_NITOC/27-239------------------------------L.....DTVE.---------------------------------------
Q16CM3_ROSDO/34-256------------------------------F.....SFEGP---------------------------------------
A4YPL3_BRASO/446-686------------------------------W.....SFAGP---------------------------------------
A4HT63_LEIIN/13-246------------------------------WYWNHNDRFEI---------------------------------------
Q2GAK0_NOVAD/50-270------------------------------L.....ASNGA---------------------------------------
Q82W83_NITEU/27-233------------------------------L.....DKAP.---------------------------------------
A2SE24_METPP/27-254------------------------------W.....DKFPQ---------------------------------------
A6GMB1_9BURK/25-251------------------------------L.....DTAP.---------------------------------------
A0YES0_9GAMM/447-692------------------------------C.....DSID.---------------------------------------
Q1QAE1_PSYCK/46-236------------------------------C.....STAP.---------------------------------------
CY1_NEUCR/85-304------------------------------W.....VHEQW---------------------------------------
A8AFY8_CITK8/31-265------------------------------W.....SFSGI---------------------------------------
Q1GTG5_SPHAL/45-267------------------------------L.....ASDGL---------------------------------------
A3VGU9_9RHOB/36-257------------------------------F.....SFEGP---------------------------------------
A3U3Y9_9RHOB/34-257------------------------------F.....SFEGP---------------------------------------
CY1_EUGGR/11-231------------------------------W.....PHFQW---------------------------------------
Q28VL8_JANSC/34-258------------------------------F.....SFQGP---------------------------------------
Q59ZJ2_CANAL/57-276------------------------------W.....PHNGM---------------------------------------
Q1RIA3_RICBR/32-250------------------------------W.....HFEGL---------------------------------------
Q5PAG3_ANAMM/36-251------------------------------W.....KFSGI---------------------------------------
Q2KTR9_BORA1/20-275------------------------------L.....DRAP.---------------------------------------
A7ATE9_BABBO/165-383------------------------------F.....WFKGP---------------------------------------
Q3SPC2_NITWN/446-686------------------------------W.....SFAGP---------------------------------------
Q6P4K0_XENTR/80-298------------------------------W.....SHNGL---------------------------------------
A5CY14_VESOH/30-219------------------------------L.....DQAN.---------------------------------------
A0Z7E2_9GAMM/447-675------------------------------C.....DPIA.---------------------------------------
A1K424_AZOSB/32-250------------------------------L.....DKAP.---------------------------------------
A7HVC5_PARL1/42-261------------------------------W.....SFEGM---------------------------------------
A4S995_OSTLU/22-240------------------------------W.....PHDGL---------------------------------------
A1SA15_SHEAM/26-231------------------------------L.....EKAN.---------------------------------------
Q2GKU3_ANAPZ/33-248------------------------------W.....KFSGI---------------------------------------
A5V642_SPHWW/50-278------------------------------F.....ASDGP---------------------------------------
A3SIH3_9RHOB/34-256------------------------------F.....SFEGP---------------------------------------
Q0K6A7_CUPNH/29-246------------------------------L.....EPAP.---------------------------------------
Q1ZGW4_9GAMM/24-243------------------------------L.....DKAN.---------------------------------------
Q2CK81_9RHOB/36-287------------------------------F.....PFEGW---------------------------------------
Q9FQ96_CHLRE/85-303------------------------------W.....GHEGV---------------------------------------
A4F0J5_9RHOB/34-257------------------------------F.....SFEGP---------------------------------------
CY1_ALLVD/26-243------------------------------L.....ESAN.---------------------------------------
CY1_RHORU/36-270------------------------------W.....SWKGI---------------------------------------
Q92PE8_RHIME/52-289------------------------------W.....TFAGL---------------------------------------

PF09086

A0L4E9_MAGSM/25-120--------------------------------------AAE---------------------------------------
B2JWN6_BURP8/39-134--------------------------------------YRT---------------------------------------
Q3SMF4_THIDA/32-129--------------------------------------QAG---------------------------------------
Q8E911_SHEON/48-141--------------------------------------YQA---------------------------------------
SHP_RHOS4/29-126--------------------------------------YEA---------------------------------------
Q2WAX9_MAGSA/178-275--------------------------------------QAG---------------------------------------
A1VMG8_POLNA/41-135--------------------------------------YTA---------------------------------------
Q47C89_DECAR/34-130--------------------------------------SQQ---------------------------------------
A0RN71_CAMFF/40-138--------------------------------------KND---------------------------------------
Q220Q7_RHOFD/37-130--------------------------------------QEN---------------------------------------
A3CZ63_SHEB5/52-145--------------------------------------YQA---------------------------------------
A0YHK9_9GAMM/35-128--------------------------------------FQT---------------------------------------
Q5NXN7_AROAE/38-135--------------------------------------AAD---------------------------------------
Q0F2E5_9PROT/30-129--------------------------------------YRT---------------------------------------
Q21RT6_RHOFD/35-128--------------------------------------QEN---------------------------------------
CYCA_METME/38-136--------------------------------------SAN---------------------------------------
Q2RPG6_RHORT/198-295--------------------------------------AAE---------------------------------------

PF02433

A0LA61_MAGSM/3-235HESIEKNIPLMSILVVIVISIGAIIEIFPLFWIDKTI.EKV.......................................
A7HTB7_PARL1/7-232HATVEKNSILLLVLTLIVVAIGGLVEIVPTFLIKSTI.EDV.......................................
Q1NF35_9SPHN/8-233HGTLERNVSLLGIAALITVAIGGIVEIAPLFWIDNTI.EKV.......................................
A3WG87_9SPHN/19-244HKRLEKNITLLAIATFITVAIGGLVQITPLFYLENTI.EEV.......................................
Q57EZ8_BRUAB/7-232HSKLEKNATLLLIASLAVVTVGGLVEIAPLFYLENTI.EKV.......................................
Q8KLH6_RHIEC/8-233HKTLEKNATLLLVGSLLVVSIGGIVEIAPLFYLQNTI.EKV.......................................
Q989I1_RHILO/7-232HAIIEKNATLLLVGSLLVVTVGGIVEIAPLFYLDNTI.EKV.......................................
Q1YNS2_MOBAS/30-255HGRVERNATLLLVLSLLVVSVGGIVEIAPLFYLENTI.EKV.......................................
A1B350_PARDP/7-231HKVLEKNATLLLVFSFLVVTIGGIVEIAPLFYLQNTI.EKV.......................................
O30728_RHOCA/7-232HHVLEKNATLLLIFAFLVVTIGGIVEIAPLFYLENTI.EKV.......................................
A3XC97_9RHOB/7-232HKILETNATLLLVCSFLVVTIGGLVQIAPLFWLENTI.EKV.......................................
A3K3E9_9RHOB/7-243HAILEKNVTLLAVFAFLVVTIGGLVQIVPLFYLENTI.EDV.......................................
Q16AS6_ROSDO/7-231HKFIETNATLLLVLSFLVVTIGGLVQITPLFYLENTI.EKV.......................................
Q3J013_RHOS4/7-231HKILETNATLLLIFSFFVVTIGGLVQIVPLFYLENTI.EKV.......................................
A3U175_9RHOB/44-268HQRFERNATLLLMASLAVVSIGGIVEIAPLFWLENTI.EEV.......................................
Q28KI9_JANSC/7-230HKKIETNATLLLALSFVVVSIGGIVEIAPLFYLENTI.EDV.......................................
A3JT80_9RHOB/7-231HQILERSPTLLLVFSFLVVTIGGIVEIAPLFYLENTI.EKV.......................................
A4EEP6_9RHOB/18-243HAFLERSPTLLLVSSLLVVMVGGIVEIAPLFYLENTI.EEV.......................................
A3VER1_9RHOB/7-237HAVLEKNATLLLVGSLLVVTVGGIVEIAPLFYLENTI.EDV.......................................
Q3SLW1_THIDA/7-235HEWVETNIGLMAVLTMLAISVGGLVEIAPLFFIDKTI.EKV.......................................
Q1H3N7_METFK/3-231HDKIERNLGILLVFTMLAISAGGMVEIIPLFFIEETV.EKV.......................................
A1AV86_RUTMC/11-234QVKLEKNIFGMYLFMALSVSLAGIVEIVPLFTNPEAVKDKVIAID..GSTKS.....LLWPRSEGQ..............
Q0EVT5_9PROT/4-204QEKLEKNIWGLLIMVAIVVSIGGIVEIVPLFYLDNTV.EKLTKDE...................................
Q31E69_THICR/11-267QERLERNIFGLFMATALAVSIAGIVEIVPLFYLKETV.DYTEKTDKYGNVKNEKFPELVWERTFTQDADGKLVSDKALYK
A1ZN78_9BACT/487-705HRVLERKPILFTVLTTIAILIGGLIELMPTFLIQSNV.PTI.......................................
A3HZP0_9BACT/489-703HRAWERKPIFFTVLATVAIAIGGAIEIIPTILVKSNV.PTI.......................................
A2U1I4_9FLAO/488-721HTWLERKPIKLTIYATIAILIGGVVQIIPTLLVKSNI.PTI.......................................
Q26FM8_FLABB/488-721HTWLERKPLKMTLYSTIAILIGGLVQIVPSLMVDDYI.PVI.......................................
Q1VRL1_9FLAO/488-721HTWLERRPVKLTIFATIAILIGGMVQIIPSLIVDDYV.PII.......................................
A0M1B2_GRAFK/488-721HSWLERRPVKLTIFATIAILIGGIVQIVPSLMVDDYV.PVI.......................................
A4CGK1_ROBBH/488-721HTWLERKPVQLTILATIAILIGGAVQIIPTLLVKSNI.PTI.......................................
A4AMY4_MARSH/488-718HTWLERKPIQLTILATIAILIGGIVQIVPTILVKSNI.PTI.......................................
A5FGW0_FLAJ1/488-722HSWLERKPIQLTILATIAILIGGIIQIVPTIMVKSNI.PTI.......................................
Q11W03_CYTH3/490-704HRWIERKPIQLMFFSLIVILIGGMVEMIPTFLVKSNI.PTI.......................................
Q9ZMT5_HELPJ/2-225FSFLEKNPFFFTLAFIFVFSIAGLVEILPNFFKSA...RPI.......................................
Q7VGR3_HELHP/2-236FSFLERNPFFFTVAFLLVFSIAGLVEVLPGFAKKA...QPI.......................................
A0Y5P3_9GAMM/10-224HEIVEKNVGLMAILTVFAISFGALVEITPLMFQDDTT.KPV.......................................
Q483P2_COLP3/5-214HEKVEKNVGLFFLFTVFAISIGGLVEITPLFFQKELA.TPV.......................................
A4ESJ1_9RHOB/5-232HQKLERHSLGFAMTILVVASIGGLVEIAPLFTIENTV.EKV.......................................
A5V795_SPHWW/5-231HYRIERKSVALAVAIMIVASIGGLIEIAPLFTIDDTV.ESD.......................................
Q11G34_MESSB/5-232HRKLERTAVGFVLAIIGVSSIGGLVEIAPLFTIDETV.EKV.......................................
A6ULT7_SINMW/6-233HRKLERTAIGFVLAIILAASVGGIVEIAPLFTIDETV.EDV.......................................
A3W3T8_9RHOB/5-231HYNLEKISLGLVGAIIAVASVGGIVEIVPLFTIEQTV.DIP.......................................
A4YQT8_BRASO/12-238HQVFEKNSIILVIGILLVIAIGGLVEITPLFYLKSTI.EAV.......................................
Q6NDT6_RHOPA/7-233HKIFETNSVVLIVGILLVIAIGGLVEITPLFYLKSTI.EKV.......................................
Q43943_AZOCA/10-235HAIFEKHSILLLLGVLIVISIGGLVEIVPLFYLKSTI.EKV.......................................
B0UQJ0_METS4/14-238HEFFEKNSILLIIGILIVVAIGGLIEIVPLFYLKSTI.EVV.......................................
A0NRD9_9RHOB/7-233HEVFEKNSFILLIGILVMVAIGGLVEIAPLFYLKSTI.EKT.......................................
Q9A8F2_CAUCR/7-234HAKFERHSLLLVVGILLVVSIGGLVEIAPLFWLQGTI.EKV.......................................
Q0AQJ4_MARMM/13-239KSLFEKNSLILTVGVLVTVSIGGIVEIAPLFYLDSTI.EEV.......................................
A3UHC8_9RHOB/13-239KKVLEQNSLVLTVGVLAVVSIGGLVEIAPLFYLDETI.EEV.......................................
Q0C2U4_HYPNA/7-242HGKLERNSLVLTVGILIAVAIGGIVEIAPLFYMENTI.EKV.......................................
Q2RP20_RHORT/7-234HAKIETNALFLTVGIFLTVIIGGIVEIVPLFTIESTI.EKV.......................................
Q6N0B7_9PROT/7-232HAKVETNVFFLAVGILLTVIVGGLVEVVPLFTIESTI.EKV.......................................
Q2VZ08_MAGSA/22-246HAKLETNIFFLAVGILLTIVVGGLVEVVPLFSIESTI.EKV.......................................
Q9ZHR6_AZOBR/10-234HDTIERNTLLLIVLILITVSIGGLVQIVPLFTIESTI.EKV.......................................

PF03150

Q8F0I4_LEPIN/51-203--------------------------------------------------------------------------------
C6BNA1_RALP1/79-264--------------------------------------------------------------------------------
A6BYG0_YERPE/178-330--------------------------------------------------------------------------------
Q1YWH3_PHOPR/28-184--------------------------------------------------------------------------------
A6F840_9GAMM/555-713--------------------------------------------------------------------------------
Q8F892_LEPIN/52-219--------------------------------------------------------------------------------
Q484C5_COLP3/54-237--------------------------------------------------------------------------------
Q3INL9_NATPD/73-234--------------------------------------------------------------------------------
A3UWY1_VIBSP/13-162--------------------------------------------------------------------------------
Q1GKQ2_SILST/33-249--------------------------------------------------------------------------------
Q486C9_COLP3/49-204--------------------------------------------------------------------------------
A6Q197_NITSB/55-208--------------------------------------------------------------------------------
Q5F5Z9_NEIG1/87-240--------------------------------------------------------------------------------
A6GX50_FLAPJ/292-445--------------------------------------------------------------------------------
Q8TLV0_METAC/32-221--------------------------------------------------------------------------------
A1K8M4_AZOSB/40-192--------------------------------------------------------------------------------
B7KRA1_METC4/52-210--------------------------------------------------------------------------------
Q11XQ6_CYTH3/64-216--------------------------------------------------------------------------------
Q2SJ93_HAHCH/58-238--------------------------------------------------------------------------------
A3Y8E4_9GAMM/70-220--------------------------------------------------------------------------------
Q4KAL8_PSEF5/75-229--------------------------------------------------------------------------------
A3W5C9_9RHOB/42-195--------------------------------------------------------------------------------
Q30U36_SULDN/51-205--------------------------------------------------------------------------------
Q1GGR1_SILST/23-201--------------------------------------------------------------------------------
Q5GYD6_XANOR/64-215--------------------------------------------------------------------------------
Q1D085_MYXXD/13-165--------------------------------------------------------------------------------
A3Y6T1_9GAMM/42-187--------------------------------------------------------------------------------
Q1M6A3_RHIL3/38-225--------------------------------------------------------------------------------
Q1W080_9FLAO/85-237--------------------------------------------------------------------------------
A6END5_9BACT/315-468--------------------------------------------------------------------------------
A6E6T8_9SPHI/51-203--------------------------------------------------------------------------------
A6DF01_9PROT/28-180--------------------------------------------------------------------------------
A6Q435_NITSB/36-186--------------------------------------------------------------------------------
A6E9L0_9SPHI/56-209--------------------------------------------------------------------------------
A6Q2F2_NITSB/73-226--------------------------------------------------------------------------------
A6FB20_9GAMM/75-301--------------------------------------------------------------------------------
Q89RR6_BRAJA/62-213--------------------------------------------------------------------------------
A1ZHU0_9BACT/93-247--------------------------------------------------------------------------------
A5ERS8_BRASB/105-228--------------------------------------------------------------------------------
A3SUF2_9RHOB/36-255--------------------------------------------------------------------------------
A3U6U9_CROAH/70-271--------------------------------------------------------------------------------
A4YL27_BRASO/71-223--------------------------------------------------------------------------------
Q2S6C9_SALRD/73-225--------------------------------------------------------------------------------
A5KWD9_9GAMM/77-226--------------------------------------------------------------------------------
A2TYR9_9FLAO/54-208--------------------------------------------------------------------------------
A5FEK6_FLAJ1/64-216--------------------------------------------------------------------------------
A4CLH8_ROBBH/253-405--------------------------------------------------------------------------------
Q01SD6_SOLUE/44-196--------------------------------------------------------------------------------
A4JDM2_BURVG/79-265--------------------------------------------------------------------------------
A0RR40_CAMFF/59-212--------------------------------------------------------------------------------
A5FLX5_FLAJ1/76-228--------------------------------------------------------------------------------
Q8TLW5_METAC/28-207--------------------------------------------------------------------------------
A0Z6X4_9GAMM/73-225--------------------------------------------------------------------------------
Q21KC7_SACD2/61-220--------------------------------------------------------------------------------
Q121U4_POLSJ/49-200--------------------------------------------------------------------------------
A4BSR1_9GAMM/48-206--------------------------------------------------------------------------------
A3YTD3_CAMJU/32-183--------------------------------------------------------------------------------
A5V5J3_SPHWW/45-199--------------------------------------------------------------------------------
Q01N94_SOLUE/45-264--------------------------------------------------------------------------------
A7ZB45_CAMC1/30-178--------------------------------------------------------------------------------
Q04R97_LEPBJ/67-226--------------------------------------------------------------------------------
A1ZDI4_9BACT/73-277--------------------------------------------------------------------------------
A3J636_9FLAO/49-202--------------------------------------------------------------------------------
Q5NNF0_ZYMMO/185-337--------------------------------------------------------------------------------
A4TW02_9PROT/47-197--------------------------------------------------------------------------------
Q5LKV8_SILPO/68-222--------------------------------------------------------------------------------
A3U8R2_CROAH/307-460--------------------------------------------------------------------------------
A3VKF2_9RHOB/37-253--------------------------------------------------------------------------------
A5FH16_FLAJ1/294-447--------------------------------------------------------------------------------
Q6LS42_PHOPR/21-257--------------------------------------------------------------------------------
B1Z920_METPB/50-202--------------------------------------------------------------------------------
A9AMB6_BURM1/46-234--------------------------------------------------------------------------------
Q62D58_BURMA/144-354--------------------------------------------------------------------------------
Q1ZQE5_PHOAS/27-183--------------------------------------------------------------------------------
A1ZVL2_9BACT/84-236--------------------------------------------------------------------------------
A0RRL9_CAMFF/20-163--------------------------------------------------------------------------------
A6Q5I5_NITSB/29-181--------------------------------------------------------------------------------
Q1MY71_9GAMM/424-576--------------------------------------------------------------------------------
Q938I4_BACFG/172-325--------------------------------------------------------------------------------
A6VSB8_MARMS/53-213--------------------------------------------------------------------------------
A1VWA4_POLNA/64-241--------------------------------------------------------------------------------
A0LBU5_MAGSM/40-191--------------------------------------------------------------------------------
A4BKK3_9GAMM/76-230--------------------------------------------------------------------------------
A6QAR8_SULNB/32-183--------------------------------------------------------------------------------
Q6MPF1_BDEBA/65-218--------------------------------------------------------------------------------
A3ZYH2_9PLAN/519-671--------------------------------------------------------------------------------
Q82T06_NITEU/25-227--------------------------------------------------------------------------------
A3YE98_9GAMM/33-212--------------------------------------------------------------------------------
Q88IQ6_PSEPK/53-204--------------------------------------------------------------------------------
Q1D0X2_MYXXD/73-227--------------------------------------------------------------------------------
A8ET72_ARCB4/31-181--------------------------------------------------------------------------------
Q0AFW6_NITEC/38-192--------------------------------------------------------------------------------
Q1DDN5_MYXXD/52-212--------------------------------------------------------------------------------
A6C5X2_9PLAN/104-250--------------------------------------------------------------------------------
Q1VW26_9FLAO/46-199--------------------------------------------------------------------------------
MAUG_METFK/45-197--------------------------------------------------------------------------------
A6GX61_FLAPJ/52-205--------------------------------------------------------------------------------
Q2SPL2_HAHCH/45-264--------------------------------------------------------------------------------
Q9RYL1_DEIRA/48-199--------------------------------------------------------------------------------
A4A162_9PLAN/44-195--------------------------------------------------------------------------------
A6VXU4_MARMS/42-221--------------------------------------------------------------------------------
A3N227_ACTP2/179-330--------------------------------------------------------------------------------
Q091L5_STIAD/54-206--------------------------------------------------------------------------------
Q1JXK4_DESAC/56-210--------------------------------------------------------------------------------
A4AM30_MARSH/56-242--------------------------------------------------------------------------------
A3XL95_LEEBM/37-190--------------------------------------------------------------------------------
A6CUR1_9VIBR/67-217--------------------------------------------------------------------------------
Q1GMK7_SILST/17-169--------------------------------------------------------------------------------
B7L1U1_METC4/64-217--------------------------------------------------------------------------------
Q64SV6_BACFR/27-200--------------------------------------------------------------------------------
A6EQ79_9BACT/52-205--------------------------------------------------------------------------------
A6G5S3_9DELT/86-242--------------------------------------------------------------------------------
Q3JEU9_NITOC/75-294--------------------------------------------------------------------------------
Q5H6P7_XANOR/39-192--------------------------------------------------------------------------------
Q2W7Z9_MAGSA/128-283--------------------------------------------------------------------------------
Q1GLZ0_SILST/44-260--------------------------------------------------------------------------------
Q47YZ2_COLP3/18-196--------------------------------------------------------------------------------
Q74CY3_GEOSL/25-235--------------------------------------------------------------------------------
Q0F178_9PROT/60-216--------------------------------------------------------------------------------
B1KR19_SHEWM/62-291--------------------------------------------------------------------------------
A7HE20_ANADF/128-282--------------------------------------------------------------------------------
A7IKZ8_XANP2/69-220--------------------------------------------------------------------------------
Q606V7_METCA/33-209--------------------------------------------------------------------------------
A1K4Z1_AZOSB/76-228--------------------------------------------------------------------------------
Q0A4P3_ALHEH/58-212--------------------------------------------------------------------------------
A6D4V3_9VIBR/37-189--------------------------------------------------------------------------------
Q13JY9_BURXL/50-232--------------------------------------------------------------------------------
A3XYQ2_9VIBR/47-199--------------------------------------------------------------------------------
A1ZPE3_9BACT/58-212--------------------------------------------------------------------------------
Q3M2C9_ANAVT/55-215--------------------------------------------------------------------------------
Q60BW8_METCA/39-193--------------------------------------------------------------------------------
A0L7Q4_MAGSM/41-193--------------------------------------------------------------------------------
A6G0M7_9DELT/82-298--------------------------------------------------------------------------------
Q1MNM9_LAWIP/176-328--------------------------------------------------------------------------------
Q1YU87_9GAMM/90-243--------------------------------------------------------------------------------
Q5FS76_GLUOX/63-272--------------------------------------------------------------------------------
A6GBH1_9DELT/56-265--------------------------------------------------------------------------------
Q2IRT9_RHOP2/49-200--------------------------------------------------------------------------------
A3XAJ8_9RHOB/31-209--------------------------------------------------------------------------------
A3P679_BURP0/161-346--------------------------------------------------------------------------------
Q0F3R5_9PROT/49-201--------------------------------------------------------------------------------
Q2BPT8_9GAMM/97-252--------------------------------------------------------------------------------
A6AZ99_VIBPA/42-192--------------------------------------------------------------------------------
A5UZD3_ROSS1/64-224--------------------------------------------------------------------------------
A3EU40_9BACT/46-198--------------------------------------------------------------------------------
Q60BZ4_METCA/291-445--------------------------------------------------------------------------------
Q28L23_JANSC/50-267--------------------------------------------------------------------------------
A1ZIW5_9BACT/23-173--------------------------------------------------------------------------------
A8EVL6_ARCB4/21-201--------------------------------------------------------------------------------
A6E9K8_9SPHI/43-196--------------------------------------------------------------------------------
A6GDF5_9DELT/70-296--------------------------------------------------------------------------------
MAUG_PARDP/27-206--------------------------------------------------------------------------------
Q26B23_FLABB/305-451--------------------------------------------------------------------------------
Q8XRW3_RALSO/38-214--------------------------------------------------------------------------------
Q3J7P6_NITOC/62-215--------------------------------------------------------------------------------
Q3IJA1_PSEHT/69-222--------------------------------------------------------------------------------
Q1CW97_MYXXD/58-212--------------------------------------------------------------------------------
Q72TP5_LEPIC/49-197--------------------------------------------------------------------------------
A4C4S6_9GAMM/59-282--------------------------------------------------------------------------------
Q7P1B3_CHRVO/44-196--------------------------------------------------------------------------------
Q4KBF2_PSEF5/51-202--------------------------------------------------------------------------------
Q5LL75_SILPO/53-202--------------------------------------------------------------------------------
A2TWF3_9FLAO/304-456--------------------------------------------------------------------------------
Q17ZF1_HELAH/64-218--------------------------------------------------------------------------------
Q607J0_METCA/30-226--------------------------------------------------------------------------------
Q1NTA5_9DELT/76-227--------------------------------------------------------------------------------
B1KFB6_SHEWM/53-205--------------------------------------------------------------------------------
B1KCX7_SHEWM/52-211--------------------------------------------------------------------------------
Q89U67_BRAJA/52-204--------------------------------------------------------------------------------
A9BZD0_DELAS/66-225--------------------------------------------------------------------------------
A6ELS0_9BACT/56-210--------------------------------------------------------------------------------
A6CFU9_9PLAN/55-206--------------------------------------------------------------------------------
Q6LRX8_PHOPR/43-267--------------------------------------------------------------------------------

PF07635

A3HTU3_9BACT/51-114--------------------------------------------------------------------------------
A3I118_9BACT/44-102--------------------------------------------------------------------------------
A3ZLZ4_9PLAN/50-109--------------------------------------------------------------------------------
A3ZMN5_9PLAN/39-92--------------------------------------------------------------------------------
A3ZMT3_9PLAN/37-98--------------------------------------------------------------------------------
A3ZN17_9PLAN/43-103--------------------------------------------------------------------------------
A3ZPP8_9PLAN/38-93--------------------------------------------------------------------------------
A3ZQC7_9PLAN/440-498--------------------------------------------------------------------------------
A3ZR06_9PLAN/44-104--------------------------------------------------------------------------------
A3ZR51_9PLAN/42-99--------------------------------------------------------------------------------
A3ZT41_9PLAN/44-99--------------------------------------------------------------------------------
A3ZUT4_9PLAN/48-105--------------------------------------------------------------------------------
A3ZV10_9PLAN/45-100--------------------------------------------------------------------------------
A3ZVC0_9PLAN/58-116--------------------------------------------------------------------------------
A3ZW90_9PLAN/38-95--------------------------------------------------------------------------------
A3ZWB8_9PLAN/50-104--------------------------------------------------------------------------------
A3ZX73_9PLAN/28-83--------------------------------------------------------------------------------
A3ZYK0_9PLAN/49-110--------------------------------------------------------------------------------
A3ZYU8_9PLAN/40-98--------------------------------------------------------------------------------
A4A0H7_9PLAN/47-103--------------------------------------------------------------------------------
A4A1D3_9PLAN/53-112--------------------------------------------------------------------------------
A4A1F2_9PLAN/45-92--------------------------------------------------------------------------------
A4AN48_MARSH/194-253--------------------------------------------------------------------------------
A4ANE2_MARSH/5-66--------------------------------------------------------------------------------
A4AUD4_MARSH/59-122--------------------------------------------------------------------------------
A4AVR7_MARSH/60-123--------------------------------------------------------------------------------
A4GIC2_9BACT/10-57--------------------------------------------------------------------------------
A6BYQ2_9PLAN/45-102--------------------------------------------------------------------------------
A6BZQ8_9PLAN/61-119--------------------------------------------------------------------------------
A6C0V1_9PLAN/46-101--------------------------------------------------------------------------------
A6C0V3_9PLAN/50-106--------------------------------------------------------------------------------
A6C253_9PLAN/40-94--------------------------------------------------------------------------------
A6C2C1_9PLAN/47-102--------------------------------------------------------------------------------
A6C3K8_9PLAN/50-108--------------------------------------------------------------------------------
A6C3N6_9PLAN/40-98--------------------------------------------------------------------------------
A6C4F3_9PLAN/58-119--------------------------------------------------------------------------------
A6C550_9PLAN/57-115--------------------------------------------------------------------------------
A6C5R3_9PLAN/48-105--------------------------------------------------------------------------------
A6C5R9_9PLAN/53-113--------------------------------------------------------------------------------
A6C5S7_9PLAN/325-383--------------------------------------------------------------------------------
A6C5W3_9PLAN/52-111--------------------------------------------------------------------------------
A6C5W8_9PLAN/40-100--------------------------------------------------------------------------------
A6C622_9PLAN/59-115--------------------------------------------------------------------------------
A6C6I6_9PLAN/53-108--------------------------------------------------------------------------------
A6C6P1_9PLAN/45-102--------------------------------------------------------------------------------
A6C707_9PLAN/40-97--------------------------------------------------------------------------------
A6C7F0_9PLAN/56-114--------------------------------------------------------------------------------
A6C7K1_9PLAN/611-669--------------------------------------------------------------------------------
A6C7M1_9PLAN/51-111--------------------------------------------------------------------------------
A6C7N1_9PLAN/54-114--------------------------------------------------------------------------------
A6C812_9PLAN/61-120--------------------------------------------------------------------------------
A6C929_9PLAN/45-102--------------------------------------------------------------------------------
A6C976_9PLAN/50-110--------------------------------------------------------------------------------
A6C9B1_9PLAN/15-74--------------------------------------------------------------------------------
A6C9P5_9PLAN/51-105--------------------------------------------------------------------------------
A6CA77_9PLAN/47-103--------------------------------------------------------------------------------
A6CAH7_9PLAN/56-117--------------------------------------------------------------------------------
A6CAJ5_9PLAN/47-107--------------------------------------------------------------------------------
A6CBB4_9PLAN/40-94--------------------------------------------------------------------------------
A6CBB4_9PLAN/139-193--------------------------------------------------------------------------------
A6CBL4_9PLAN/65-123--------------------------------------------------------------------------------
A6CBW0_9PLAN/43-100--------------------------------------------------------------------------------
A6CD10_9PLAN/48-105--------------------------------------------------------------------------------
A6CD54_9PLAN/60-118--------------------------------------------------------------------------------
A6CD74_9PLAN/45-105--------------------------------------------------------------------------------
A6CE68_9PLAN/33-92--------------------------------------------------------------------------------
A6CEL5_9PLAN/57-116--------------------------------------------------------------------------------
A6CFD0_9PLAN/52-109--------------------------------------------------------------------------------
A6CGM6_9PLAN/53-112--------------------------------------------------------------------------------
A6DFA4_9BACT/35-98--------------------------------------------------------------------------------
A6DFA7_9BACT/32-95--------------------------------------------------------------------------------
A6DGI5_9BACT/49-112--------------------------------------------------------------------------------
A6DGX0_9BACT/52-122--------------------------------------------------------------------------------
A6DHV4_9BACT/41-111--------------------------------------------------------------------------------
A6DI37_9BACT/32-90--------------------------------------------------------------------------------
A6DJ39_9BACT/57-117--------------------------------------------------------------------------------
A6DKV0_9BACT/48-111--------------------------------------------------------------------------------
A6DLB5_9BACT/38-96--------------------------------------------------------------------------------
A6DNW9_9BACT/37-95--------------------------------------------------------------------------------
A6DP48_9BACT/33-92--------------------------------------------------------------------------------
A6DRU3_9BACT/38-108--------------------------------------------------------------------------------
A6DSN3_9BACT/36-92--------------------------------------------------------------------------------
Q01SA1_SOLUE/36-93--------------------------------------------------------------------------------
Q01T04_SOLUE/35-89--------------------------------------------------------------------------------
Q01TA8_SOLUE/38-98--------------------------------------------------------------------------------
Q01Z91_SOLUE/33-90--------------------------------------------------------------------------------
Q01ZJ6_SOLUE/36-90--------------------------------------------------------------------------------
Q02A24_SOLUE/42-96--------------------------------------------------------------------------------
Q02AF0_SOLUE/46-106--------------------------------------------------------------------------------
Q02AQ9_SOLUE/48-104--------------------------------------------------------------------------------
Q15XP5_PSEA6/55-117--------------------------------------------------------------------------------
Q6SI19_9BACT/67-123--------------------------------------------------------------------------------
Q7UDW3_RHOBA/42-94--------------------------------------------------------------------------------
Q7UEL0_RHOBA/42-101--------------------------------------------------------------------------------
Q7UFP2_RHOBA/55-111--------------------------------------------------------------------------------
Q7UGA7_RHOBA/63-110--------------------------------------------------------------------------------
Q7UGC1_RHOBA/103-163--------------------------------------------------------------------------------
Q7UGF7_RHOBA/41-98--------------------------------------------------------------------------------
Q7UGR4_RHOBA/53-99--------------------------------------------------------------------------------
Q7UH44_RHOBA/41-89--------------------------------------------------------------------------------
Q7UH72_RHOBA/60-118--------------------------------------------------------------------------------
Q7UHK6_RHOBA/101-159--------------------------------------------------------------------------------
Q7UIF4_RHOBA/87-145--------------------------------------------------------------------------------
Q7UIH1_RHOBA/55-102--------------------------------------------------------------------------------
Q7UJ37_RHOBA/52-108--------------------------------------------------------------------------------
Q7UJ53_RHOBA/68-113--------------------------------------------------------------------------------
Q7UJ65_RHOBA/61-123--------------------------------------------------------------------------------
Q7UJH8_RHOBA/111-158--------------------------------------------------------------------------------
Q7UKM7_RHOBA/187-247--------------------------------------------------------------------------------
Q7UKQ6_RHOBA/43-90--------------------------------------------------------------------------------
Q7UKX0_RHOBA/43-92--------------------------------------------------------------------------------
Q7ULB8_RHOBA/63-119--------------------------------------------------------------------------------
Q7ULJ5_RHOBA/82-135--------------------------------------------------------------------------------
Q7UM61_RHOBA/92-148--------------------------------------------------------------------------------
Q7UN57_RHOBA/80-138--------------------------------------------------------------------------------
Q7UP09_RHOBA/72-127--------------------------------------------------------------------------------
Q7UPC3_RHOBA/72-119--------------------------------------------------------------------------------
Q7UPJ6_RHOBA/57-104--------------------------------------------------------------------------------
Q7UQ28_RHOBA/63-123--------------------------------------------------------------------------------
Q7UQA7_RHOBA/309-363--------------------------------------------------------------------------------
Q7UQJ4_RHOBA/66-125--------------------------------------------------------------------------------
Q7UQW0_RHOBA/87-145--------------------------------------------------------------------------------
Q7UR32_RHOBA/62-120--------------------------------------------------------------------------------
Q7URV8_RHOBA/55-114--------------------------------------------------------------------------------
Q7US10_RHOBA/125-181--------------------------------------------------------------------------------
Q7USY1_RHOBA/92-151--------------------------------------------------------------------------------
Q7UTM0_RHOBA/601-659--------------------------------------------------------------------------------
Q7UUL3_RHOBA/116-163--------------------------------------------------------------------------------
Q7UUV9_RHOBA/53-98--------------------------------------------------------------------------------
Q7UV66_RHOBA/143-201--------------------------------------------------------------------------------
Q7UVE2_RHOBA/77-133--------------------------------------------------------------------------------
Q7UVE4_RHOBA/90-150--------------------------------------------------------------------------------
Q7UW71_RHOBA/71-130--------------------------------------------------------------------------------
Q7UY38_RHOBA/55-113--------------------------------------------------------------------------------
Q7UYC9_RHOBA/78-136--------------------------------------------------------------------------------
Q7UYG9_RHOBA/121-173--------------------------------------------------------------------------------
Q7UYH7_RHOBA/577-628--------------------------------------------------------------------------------
Q7UYJ9_RHOBA/45-104--------------------------------------------------------------------------------
Q7UYR6_RHOBA/54-108--------------------------------------------------------------------------------
Q7UYT2_RHOBA/60-107--------------------------------------------------------------------------------
Q7UZ36_RHOBA/89-145--------------------------------------------------------------------------------

PF06537

Q09ED4_STIAD/244-768------------------------------------------------------------------LPQEAWLGGRTTVS
A9L399_SHEB9/43-541------------------------------------------------------------------YTDITASGGATT.T
Q12RB3_SHEDO/50-548------------------------------------------------------------------YTDVTASGGATT.T
A3QAQ1_SHELP/45-543------------------------------------------------------------------YTQVTALGGDTT.T
Q488R9_COLP3/44-538------------------------------------------------------------------YTHISQLGGDAT.A
A8H0B2_SHEPA/53-551------------------------------------------------------------------YTDIKASGGDTT.T

PF00034

A3HYX9_9BACT/875-956------------------------A-MLG...KSLFTT.L....--------------------...TCK-T-CH.----
A3HZ82_9BACT/43-133------------------------V-SAG...KTLF.D.T....--------------------...NCK-T-CH.----
C1DG42_AZOVD/275-353------------------------V-AQG...ERVY.R.T....--------------------...ACV-A-CH.----
B7WXJ0_COMTE/360-430------------------------F-AKV...NAIF.Q.Q....--------------------...HCV-V-CH.----
B9CBC2_9BURK/27-112------------------------L-SKG...KDLVES.H....--------------------...NCA-A-CH.----
A9AXG3_HERA2/43-143------------------------L-EFG...QRNY.E.Q....--------------------...YCA-T-CH.----
C1DFA7_AZOVD/306-383------------------------F-ARV...AEVI.H.T....--------------------...RCT-V-CH.----
A8LM31_DINSH/328-405------------------------F-DAA...YEAV.L.G....--------------------...NCS-M-CH.----
B0T7F6_CAUSK/26-116------------------------S-VDG...AAIY.N......--------------------...RCA-A-CH.----
B2JCS4_BURP8/352-440------------------------F-EAG...QRIY.M.D....--------------------...KCS-M-CH.----
B5EHP5_GEOBB/212-284------------------------L-PEG...KALY.R.E....--------------------...HCG-Q-CH.----
B8G4P7_CHLAD/50-144------------------------P-KRG...KELF...G....--------------------...PCA-A-CH.----
B1ZB08_METPB/335-412------------------------P-DHV...VELV.A.G....--------------------...RCA-M-CH.----
B1KHG1_SHEWM/32-108------------------------A-ADD...QALL.N......--------------------...MCK-A-CH.----
A9VUA5_BACWK/254-346------------------------A-QEG...QEIF.N.K....--------------------...SCI-G-CH.----
A8LFE5_FRASN/80-157------------------------V-RQG...RALF.L.Q....--------------------...GCA-T-CH.----
B7L1L9_METC4/220-312------------------------A-ELG...ERLFSA.R....--------------------...GCS-G-CH.----
F2G8F3_ALTMD/346-423------------------------N-ERV...ANLI.A.T....--------------------...HCV-S-CH.----
B3EQ05_CHLPB/58-152------------------------A-MSG...QELY.T.A....--------------------...NCA-A-CH.----
B0T8R9_CAUSK/311-388------------------------F-PVA...LAIV.Q.K....--------------------...HCV-M-CH.----
A8ZSU7_DESOH/195-276------------------------A-AEG...KTAFTE.M....--------------------...GCY-G-CH.----
A8LLC8_DINSH/31-128------------------------V-ALG...ATVY.A.D....--------------------...HCA-A-CH.----
A3NRU4_BURP0/284-372------------------------A-LRG...QRIF.A.D....--------------------...RCA-G-CH.----
Q88K14_PSEPK/301-386------------------------S-ALG...NKLF.A.E....--------------------...ACA-S-CH.----
A4TY13_9PROT/152-228------------------------I-AAG...QKLYDA......--------------------...DCM-E-CH.----
A1BJ75_CHLPD/29-111------------------------A-AAG...KAVY.D.A....--------------------...SCA-S-CH.----
A3J8G6_9ALTE/27-106------------------------A-AAG...KAKA...A....--------------------...VCA-A-CH.----
A1WG03_VEREI/332-402------------------------Y-ASV...QQVL.A.Q....--------------------...RCY-L-CH.----
A4XW00_PSEMY/347-424------------------------F-AKV...ESVI.H.E....--------------------...RCT-V-CH.----
Q39AI6_BURS3/179-260------------------------A-TRGRWSQGLP........--------------------...ACA-Q-CH.----
A1B9M0_PARDP/46-156------------------------P-EEG...VRVM.T.TNA..--------------------.LGNCV-A-CH.----
Q39YV3_GEOMG/27-115------------------------G-DPG...KDLF.D.K....--------------------...QCS-G-CH.----
A7BUA8_9GAMM/389-471------------------------V-KKG...AELYQS.K....--------------------...ICM-T-CH.----
A3QA98_SHELP/222-305------------------------P-ARG...EQVY.R.A....--------------------...HCQ-S-CH.----
A2SE78_METPP/627-702------------------------V-DRG...RALYAS......--------------------...TCV-W-CH.----
A4JP31_BURVG/324-409------------------------I-DP....ARLY.L.G....--------------------...NCA-T-CH.----
Q4ZHS4_9BACT/51-134------------------------G-DPG....ELFIK......--------------------...SCA-S-CH.----
Q30UG6_SULDN/232-306------------------------S-GDG...ADIFVG......--------------------...ACS-A-CH.----
Q8PDT1_XANCP/89-171------------------------S-TDG...KTIF.D.N....--------------------...LCT-A-CH.----
A1WG32_VEREI/45-122------------------------A-QTG...QQLYQT......--------------------...SCQ-G-CH.----
A5EDI9_BRASB/315-392------------------------F-AEV...ADIV.T.S....--------------------...RCS-M-CH.----
Q1YG19_MOBAS/332-409------------------------F-EDA...QAIV.M.A....--------------------...RCS-M-CH.----
Q2Y5C4_NITMU/429-515------------------------I-SNG...AVHF.A.E....--------------------...NCV-A-CH.----
Q0B3A9_BURCM/317-403------------------------G-QRG...AVLF.Q.A....--------------------...SCA-Q-CH.----
A3STM9_9RHOB/325-402------------------------F-DRV...HDIV.R.G....--------------------...RCS-M-CH.----
Q31AG8_PROM9/56-128------------------------A-KEG...DALF.KIN....--------------------....CV-G-CH.----
Q082F6_SHEFN/243-322------------------------A-AQG...QGSF.M.K....--------------------...GCF-A-CH.----
Q12DL3_POLSJ/329-399------------------------Y-AAV...QKVL.A.Q....--------------------...RCY-Q-CH.----
A1SVU2_PSYIN/325-409------------------------I-DEG...ARLY.A.T....--------------------...ACQ-A-CH.----
A0RN17_CAMFF/82-164------------------------A-SKG...EELY.N.A....--------------------...NCK-H-CH.----
A1ZL74_9BACT/89-171------------------------L-EEC...QPLY.E.R....--------------------...YCQ-H-CH.----
Q9A473_CAUCR/33-122------------------------A-VNG...QKLA.Q.R....--------------------...HCG-G-CH.----
C550A_CYACA/53-150------------------------I-KKG...KRLF.N.S....--------------------...HCG-S-CH.----
A1TL76_ACIAC/329-399------------------------Y-ALL...QPVL.A.Q....--------------------...RCY-M-CH.----
A5FYU3_ACICJ/37-115------------------------A-ATG...QTLY.D.A....--------------------...NCA-A-CH.----
A6F0E0_9ALTE/24-101------------------------P-EAG...EANA...A....--------------------...VCA-G-CH.----
A4BD02_9GAMM/317-394------------------------D-EQA...WNIV.Q.T....--------------------...HCT-E-CH.----
A0Y0T7_9GAMM/320-397------------------------D-TQV...WDII.S.K....--------------------...HCT-Q-CH.----
A6FFR6_9GAMM/239-315------------------------T-GGG...KTI.........--------------------...PCM-S-CH.----
Q0HNQ4_SHESM/21-99------------------------A-QDA...EAIF.N.K....--------------------...ACT-V-CH.----
A1VJ52_POLNA/329-399------------------------F-AEV...KSVI.D.Q....--------------------...RCV-M-CH.----
A4VP34_PSEU5/326-403------------------------F-SEI...NEVI.E.Q....--------------------...RCT-V-CH.----
Q0EVT7_9PROT/77-155------------------------E-SSA...KAIF.G.D....--------------------...NCA-G-CH.----
A7ZBK3_CAMC1/105-210------------------------A-AKG...AETFGA.A....--------------------...GCT-G-CH.----
Q6SFP3_9BACT/26-105------------------------V-EAG...KIRY.D.K....--------------------...TCI-N-CH.----
A6Q6Z1_SULNB/20-100------------------------A-ESG...KKVF.E.T....--------------------...YCW-G-CH.----
Q04SS0_LEPBJ/86-170------------------------I-VEG...KKIF.Q.T....--------------------...TCA-A-CH.----
A5K1I5_PLAVS/17-115------------------------Y-KKG...AKLF.K.A....--------------------...KCA-Q-CH.----
A3TK92_9MICO/47-131------------------------V-TAG...KKLFQA......--------------------...NCA-S-CH.----
Q39TS3_GEOMG/180-272------------------------L-IKG...RELYKE.M....--------------------...HCA-G-CH.----
Q8RMH3_9PROT/68-146------------------------L-NKG...YVIF.A.T....--------------------...ACS-G-CH.----
A6VC11_PSEA7/299-387------------------------G-KRG...RQQYLN......--------------------...VCA-G-CH.----
A5W506_PSEP1/78-158------------------------V-EIG...ASAY.N.Q....--------------------...NCA-A-CH.----
A0M192_GRAFK/78-166------------------------A-AKG...KVIF.D.S....--------------------...KCL-A-CH.----
A7IKI0_XANP2/328-405------------------------P-DDV...QNIV.M.G....--------------------...RCS-M-CH.----
A3K2E0_9RHOB/327-404------------------------F-DEV...HDIV.L.G....--------------------...RCS-M-CH.----
Q2S8A0_HAHCH/192-278------------------------A-RKG...FQVYKA......--------------------...RCM-H-CH.----
Q13JV0_BURXL/306-383------------------------V-AHG...KTLY.S.S....--------------------...SCA-K-CH.----
Q3SUK3_NITWN/142-233------------------------A-ENG...KNLFTGNEKFAN--------------------GGPPCM-A-CH.----
A7HE13_ANADF/168-247------------------------L-SPG...AALLKQ.E....--------------------...SCL-Q-CH.----
A4YQB5_BRASO/168-249------------------------V-TGGDAASQIP........--------------------...ACA-S-CH.----
A6Q697_SULNB/29-123------------------------P-PQA...DKIY.A.K....--------------------...ECA-L-CH.----
A1SRC3_PSYIN/67-145------------------------P-RSG...EKIY.N.T....--------------------...YCM-A-CH.----
Q027S6_SOLUE/288-368------------------------L-AEG...KRVFVA.R....--------------------...RCN-E-CH.----
A6FD45_9GAMM/307-378------------------------F-SEV...QTIV.V.E....--------------------...RCA-M-CH.----
Q28P34_JANSC/328-406------------------------F-QEA...VGIV.R.G....--------------------...NCS-M-CH.----
Q11EG2_MESSB/324-401------------------------F-PAV...RDTV.M.G....--------------------...RCA-M-CH.----
A6D1T6_9VIBR/37-123------------------------V-AIG...KQKYEA......--------------------...LCI-S-CH.----
Q0KCW9_CUPNH/320-395------------------------F-AKV...QEVM.N.A....--------------------...RCV-Q-CH.----
Q31FA6_THICR/38-130------------------------V-KIG...QHLF.K.Q....--------------------...HCA-V-CH.----
A1K4P5_AZOSB/315-391------------------------F-AAV...KAVI.D.S....--------------------...RCV-A-CH.----
Q2SWV4_BURTA/320-395------------------------I-KDV...APIL.Q.Q....--------------------...RCV-A-CH.----
Q7MS60_WOLSU/370-444------------------------L-EAG...ELLV.K.M....--------------------...SCS-H-CH.----
A3NRU1_BURP0/368-455------------------------Q-RPG...AGVY.F.A....--------------------...FCA-R-CH.----
Q1IUL0_KORVE/174-268------------------------I-ARG...KALFVK.L....--------------------...ECW-K-CH.----
A1VKK0_POLNA/125-213------------------------S-VEV...QALLNK.A....--------------------...NCA-S-CH.----
CYC6_CYAME/23-100------------------------L-AHG...EQIF.S.A....--------------------...NCA-A-CH.----
A4TVI5_9PROT/25-101------------------------A-ADA...VAVMAD......--------------------...ACA-G-CH.----
Q2W8Y8_MAGSA/39-118------------------------K-DNA...QDVM...R....--------------------...ICA-G-CH.----
Q0JYV8_CUPNH/22-98------------------------A-ADP...AALYSQ......--------------------...HCA-A-CH.----
A3YDZ4_9GAMM/322-399------------------------E-QKV...NVIV.Q.E....--------------------...RCA-S-CH.----
Q01VF3_SOLUE/20-94------------------------A-DPG...KVVFET......--------------------...RCS-Q-CH.----
A6DS70_9BACT/760-855------------------------A-THG...KELLLK.N....--------------------...ACI-A-CH.----
A3PPU8_RHOS1/325-402------------------------F-AEV...TDIV.T.G....--------------------...RCS-M-CH.----
A5V793_SPHWW/210-289------------------------V-AKG...REVFAA......--------------------...NCV-A-CH.----
Q2KU03_BORA1/330-418------------------------E-TPG...ALSFLN......--------------------...NCA-G-CH.----
O67504_AQUAE/17-104------------------------A-ADG...KAIFQQ.K....--------------------...GCG-S-CH.----
A5V688_SPHWW/48-125------------------------V-PLT...SQIFEK......--------------------...SCA-G-CH.----
A2WG67_9BURK/51-122------------------------L-AQQ...HWVL........--------------------...NCM-G-CH.----
A6CZ52_9VIBR/337-414------------------------F-AQI...NDVI.Q.E....--------------------...RCS-V-CH.----
CY553_BACPA/21-92------------------------A-VDA...EAVVQQ......--------------------...KCI-S-CH.----
A6DJL4_9BACT/1100-1184------------------------A-ANG...KTLA...A....--------------------...ACI-V-CH.----
A1SUP1_PSYIN/38-121------------------------A-AEG...QQIFNE......--------------------...SCG-S-CH.----
Q7UVI8_RHOBA/1468-1558------------------------A-EIG...QKIFEQ.A....--------------------...TCA-S-CH.----
A6EYI6_9ALTE/46-122------------------------P-AEG...RKLA...A....--------------------...QCK-T-CH.----
A3JCN8_9ALTE/330-406------------------------T-EKV...YALI.D.K....--------------------...HCV-A-CH.----
A6FWD1_9RHOB/160-234------------------------P-EYG...EYL..S.S....--------------------...ECK-T-CH.----
Q7TU05_RHOBA/860-991------------------------S-ARG...SKLF.T.A....--------------------...HCA-N-CH.----
Q2CDA3_9RHOB/327-404------------------------F-EEV...ERIV.I.G....--------------------...RCS-M-CH.----
Q0A972_ALHEH/46-123------------------------Q-LRH...KELLAS......--------------------...TCF-A-CH.----
Q6LKC1_PHOPR/276-367------------------------I-ELG...KTLSEV.N....--------------------...GCI-G-CH.----
A7GN62_BACCN/180-253------------------------N-DEG...YKLLEK.N....--------------------...TCL-T-CH.----
A3EV82_9BACT/32-116------------------------L-DEG...KKIY.R.S....--------------------...NCA-V-CH.----
A6GFL8_9DELT/29-119------------------------L-EQG...RDLYRR......--------------------...YCV-S-CH.----
A6DKH0_9BACT/26-110------------------------P-NKG...KEIY.T.K....--------------------...SCA-A-CH.----
QCRC_COREF/69-147------------------------I-AEG...KDLY.D.V....--------------------...ACI-T-CH.----
Q01PC8_SOLUE/140-223------------------------A-HRG...VEAY.G.T....--------------------...YCA-K-CH.----
QCRC_COREF/179-255------------------------V-SRG...GDLF.R.L....--------------------...NCA-S-CH.----
Q15T42_PSEA6/326-403------------------------E-QHA...FDVI.Q.T....--------------------...HCA-N-CH.----
A6Q613_NITSB/296-399------------------------V-KKG...KELA.M.T....--------------------...NCA-S-CH.----
Q7BPS0_CAMJU/19-100------------------------A-ADG...ATLF...K....--------------------...KCA-V-CH.----
CCOP_HELPX/207-288------------------------I-DKG...KELFES.M....--------------------...GCT-G-CH.----
Q054F0_LEPBL/30-116------------------------A-VRG...SIVFRT......--------------------...YCV-L-CH.----
Q8F0C5_LEPIN/50-137------------------------L-QKG...QEIFLQ......--------------------...NCS-S-CH.----
A3RXZ0_RALSL/335-410------------------------F-AKV...QAVV.T.A....--------------------...RCY-Q-CH.----
Q1YZR8_PHOPR/320-397------------------------F-ESV...NTVI.Q.A....--------------------...RCS-V-CH.----
Q605U5_METCA/34-112------------------------A-RHG...AKVY.R.S....--------------------...ACA-G-CH.----
Q07QU5_RHOP5/38-117------------------------E-RRG...KAFA.K.A....--------------------...NCS-R-CH.----
Q2SN04_HAHCH/322-399------------------------F-IQA...AAII.H.N....--------------------...RCA-S-CH.----
Q98CI0_RHILO/338-415------------------------F-PAV...RDTV.L.G....--------------------...RCS-M-CH.----
A6EZ12_9ALTE/336-412------------------------A-AKV...GATI.E.Q....--------------------...HCA-G-CH.----
Q07M26_RHOP5/79-165------------------------A-KQG...DEIF.Q.E....--------------------...KCA-I-CH.----
A7Z6T4_BACA2/49-120------------------------N-ASP...EEIY.K.A....--------------------...NCI-T-CH.----
Q8XPY3_RALSO/395-482------------------------V-QAG...RALF.A.G....--------------------...TCS-V-CH.----
A2SDV3_METPP/323-393------------------------F-AQV...QAVV.G.E....--------------------...RCA-M-CH.----
A8EWF8_ARCB4/105-206------------------------V-ANG...ETLVTT......--------------------...NCT-A-CH.----
Q0AG80_NITEC/32-122------------------------F-KHA...EKLY.D.T....--------------------...YCA-Q-CH.----
Q5HXC2_CAMJR/201-289------------------------P-VRG...KKLF.E.E....--------------------...NCV-A-CH.----
A0KNP1_AERHH/188-300------------------------Q-LKG...YQLFKD.K....--------------------...GCT-A-CHN----
A3V1B1_9RHOB/326-403------------------------F-EEA...HDIV.I.G....--------------------...RCS-M-CH.----
A4ASX0_MARSH/13-99------------------------I-ERG...SEIY.A.D....--------------------...FCV-T-CH.----
A4VQ99_PSEU5/49-133------------------------V-VRG...KAVWEN.N....--------------------...NCI-G-CH.----
A7HD95_ANADF/221-299------------------------P-SNG...AAVYAG......--------------------...RCA-A-CH.----
A3RTX2_RALSL/32-112------------------------N-AQA...RTWA...A....--------------------...SCA-S-CH.----
Q0BSR0_GRABC/318-393------------------------F-SRI...MTIV.Q.N....--------------------...RCT-P-CH.----
A5G2Z9_ACICJ/97-183------------------------V-AAG...EKLF.S.T....--------------------...DCA-M-CH.----
A4CGX1_ROBBH/51-134------------------------V-ANG...KRTY.K.M....--------------------...LCV-I-CH.----
Q1Q9F9_PSYCK/370-446------------------------D-DAI...MKVV.E.A....--------------------...KCS-V-CH.----
Q12E68_POLSJ/29-109------------------------A-KAG...ETKN...A....--------------------...MCI-G-CH.----
Q1Q1H2_9BACT/481-562------------------------L-ERG...RELTLK.G....--------------------...NCA-I-CH.----
A1B8Y6_PARDP/329-406------------------------W-DDA...YNAV.M.G....--------------------...RCS-M-CH.----
Q4ZVH0_PSEU2/347-424------------------------F-NKV...HDVI.R.Q....--------------------...RCS-V-CH.----
Q6MR17_BDEBA/74-159------------------------V-AYG...KKFYAT......--------------------...NCA-M-CH.----
A3ERB9_9BACT/32-118------------------------P-ARG...KEVYNQ......--------------------...YCY-K-CH.----
A5WG96_PSYWF/180-265------------------------L-MAG...ERLFLQ......--------------------...NCA-V-CH.----
Q89WT8_BRAJA/117-197------------------------S-KKG...TQVAAG.R....--------------------...RCA-S-CH.----
Q9ZGF8_HELMO/122-196------------------------P-VKG...EAYYKQ......--------------------...VCA-A-CH.----
Q87H21_VIBPA/33-131------------------------I-AAG..EKQAM........--------------------...VCK-A-CH.----
A4BKK2_9GAMM/119-205------------------------A-AKG...EKLFNA.N....--------------------....CG-D-CH.----
Q9I3K0_PSEAE/342-419------------------------F-DKV...HHVI.Q.E....--------------------...RCT-V-CH.----
A7GWI4_CAMC5/119-196------------------------H-AMG...EGVY.L.V....--------------------...QCA-A-CH.----
CY552_THIFE/53-134------------------------A-PAP...YRVS...S....--------------------...DCM-V-CH.----
Q01YB9_SOLUE/516-640------------------------A-ARG...KEAFET.R....--------------------...GCM-A-CH.----
Q0FDI4_9RHOB/329-406------------------------F-DDI...SDII.I.S....--------------------...RCS-M-CH.----
Q026L5_SOLUE/59-136------------------------I-DRG...RGLY.S.V....--------------------...NCA-F-CH.----
A6GWL6_FLAPJ/97-178------------------------S-DKG...KVLF.D.I....--------------------...YCA-I-CH.----
Q1CR68_HELPH/53-154------------------------A-NKG...KQLV.A.E....--------------------...NCT-A-CH.----
Q1GLL6_SILST/329-406------------------------F-EDV...MNVV.P.G....--------------------...RCA-M-CH.----
Q83NH4_TROW8/156-232------------------------L-VLG...AELF.K.V....--------------------...NCA-A-CH.----
Q747D3_GEOSL/26-104------------------------A-ASG...EKLF.A.E....--------------------...KCA-M-CH.----
A3K6G3_9RHOB/40-143------------------------A-ARG...ETVFTA.A....--------------------...GCA-S-CH.----
Q2G890_NOVAD/22-106------------------------A-PDG...RTLF.A.Q....--------------------...NCS-S-CH.----
A6V5K9_PSEA7/33-113------------------------L-ARG...KAMA.Q.K....--------------------...MCS-R-CH.----
Q1N1Q9_9GAMM/312-388------------------------D-ARA...VQIS.E.Q....--------------------...RCA-A-CH.----
A6D951_9VIBR/49-129------------------------A-GDA...ERGI...T....--------------------...ACI-A-CH.----
Q7ULK4_RHOBA/434-513------------------------A-DRG...EKLYQK.V....--------------------...GCV-A-CH.----
A5W1M7_PSEP1/806-907------------------------L-ERG...RQVAAA.G....--------------------...DCA-V-CH.----
A0NUW4_9RHOB/329-406------------------------I-DDV...MNII.P.G....--------------------...RCG-M-CH.----
Q396U3_BURS3/183-262------------------------V-VHGAPMRNIP........--------------------...ACA-A-CH.----
A0YHE8_9GAMM/124-210------------------------L-RNG...NNVY.Q.G....--------------------...NCG-S-CH.----
Q7MS08_WOLSU/78-158------------------------L-ENG...KRLY.D.R....--------------------...DCA-S-CH.----
A6SZ46_JANMA/140-225------------------------L-LRA...AQLYAA......--------------------...NCA-A-CH.----
Q1V738_VIBAL/19-98------------------------A-SASSIPEKAS........--------------------...VCS-G-CH.----
A6DG27_9BACT/331-408------------------------M-KRG...QKVY.N.G....--------------------...LCI-T-CH.----
A6DK49_9BACT/120-205------------------------S-KMG...KDLY.E.K....--------------------...NCL-A-CH.----
A8FUN2_SHESH/19-100------------------------L-AVE...NKLI...E....--------------------...ECE-T-CH.----
A4A383_9GAMM/316-393------------------------A-TRA...HGII.R.E....--------------------...RCT-S-CH.----
Q30P22_SULDN/23-102------------------------Q-AAGFDAESVFEK......--------------------...ECQ-G-CH.----
A3Z583_9SYNE/27-105------------------------A-ADG...EQLF.N.N....--------------------...HCA-G-CH.----
Q3KFL1_PSEPF/354-431------------------------F-DKV...HNVI.Q.E....--------------------...RCA-V-CH.----
A5EUE1_BRASB/49-132------------------------A-TRG...KALFGA......--------------------...NCA-T-CH.----
Q5LV33_SILPO/328-405------------------------F-DQA...HDVV.L.G....--------------------...RCS-M-CH.----
A5FJF1_FLAJ1/53-143------------------------P-VKG...KELF.N.A....--------------------...NCA-A-CH.----
Q7VG08_HELHP/17-100------------------------F-ADA...PAAF...K....--------------------...KCV-A-CH.----
Q92UI9_RHIME/326-403------------------------F-PAI...KETI.S.T....--------------------...RCS-M-CH.----
Q1IN35_KORVE/21-100------------------------A-ADG...AEVYKS......--------------------...KCA-S-CH.----
Q1D0X4_MYXXD/25-115------------------------A-SQG...ATLFTQ......--------------------...RCA-T-CH.----
Q2IUP4_RHOP2/578-669------------------------P-DNG...KAIYVA......--------------------...QCV-A-CH.----
Q926I1_RHIME/24-103------------------------I-HEG...RQLALE......--------------------...VCA-V-CH.----
A6SVA7_JANMA/330-407------------------------F-AKV...QEVI.T.Q....--------------------...RCV-S-CH.----
Q160K5_ROSDO/328-405------------------------F-EAA...YDTV.V.G....--------------------...NCS-M-CH.----
A3WTY2_9BRAD/141-221------------------------A-RMG...SLAFVKFR....--------------------...GCV-A-CHQ----
Q02BQ9_SOLUE/215-307------------------------A-DNG...KKLFEQ.L....--------------------...ACN-N-CH.----
A3U177_9RHOB/111-198------------------------V-QAG...RSVF.A.A....--------------------...HCS-Q-CH.----
Q11G47_MESSB/29-108------------------------I-VRG...RALV.E.A....--------------------...NCS-R-CH.----
Q820S2_NITEU/123-211------------------------V-ETG...KKLYQGGNLEN.--------------------SIPACS-S-CH.----
A5FXN1_ACICJ/320-395------------------------V-ARI...EPII.H.E....--------------------...RCA-A-CH.----
Q3BPP2_XANC5/46-123------------------------K-ASG...QDVYQA......--------------------...ICQ-G-CH.----
Q748S1_GEOSL/109-203------------------------R-AKE...DNLF.V.T....--------------------...KCG-G-CH.----
Q47UL0_COLP3/316-393------------------------N-AQV...QHII.E.T....--------------------...RCS-A-CH.----
Q5LL42_SILPO/110-197------------------------S-DAI...SKLYAD......--------------------...NCS-A-CH.----
Q1ID54_PSEE4/176-262------------------------V-RQG...FALFQQ......--------------------...NCL-A-CH.----
Q92VB2_RHIME/326-403------------------------F-SKV...RDTV.L.G....--------------------...RCS-M-CH.----
A3YPD8_CAMJU/105-208------------------------A-KKG...KEFFEN......--------------------...NCF-A-CH.----
A6DPC1_9BACT/868-958------------------------M-DEG...KKHF.D.A....--------------------...LCA-T-CH.----
Q1MG21_RHIL3/50-141------------------------A-EEAERRARTL........--------------------...MCG-G-CH.----
A3Z568_9SYNE/45-127------------------------L-ENG...SQVF.S.A....--------------------...QCA-A-CH.----
A1VA32_DESVV/62-133------------------------L-TKG...ATLF.R.Q....--------------------...HCG-G-CH.----
Q1LCS0_RALME/54-132------------------------A-PSS........SEE....--------------------...TCR-A-CH.----
Q0G167_9RHIZ/327-404------------------------L-NEA...EAVI.L.S....--------------------...RCS-M-CH.----
A6Q8D3_SULNB/21-109------------------------G-DPA...QTLIEK.N....--------------------...KCM-S-CH.----
Q1DDJ6_MYXXD/17-102------------------------A-DAV...ADVW.K.A....--------------------...KCT-V-CH.----
Q1V125_PELUQ/30-111------------------------L-KAG...KEIAQN......--------------------...ICS-G-CH.----
A3VMV9_9RHOB/328-405------------------------F-EDV...LWVV.Q.G....--------------------...RCS-M-CH.----
Q2VZK6_MAGSA/61-138------------------------F-TRA...KQIY.F.E....--------------------...RCA-G-CH.----
A6DM55_9BACT/1011-1091------------------------S-TIG...AELFYD.L....--------------------...GCI-S-CH.----
Q11XM0_CYTH3/38-121------------------------V-EAG...KALVAQ.S....--------------------...DCK-T-CH.----

PF13442

A0K328_BURCH/75-153---------------------RT-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A0K328_BURCH/215-290---------------------DA-A.TAG---KALY.A.S....-----------------------TCQ.A.CH.----
B1JSZ9_BURCC/75-153---------------------RT-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
B1JSZ9_BURCC/215-290---------------------DA-A.TAG---KALY.A.S....-----------------------TCQ.A.CH.----
Q1BRF5_BURCA/75-153---------------------RT-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
Q1BRF5_BURCA/215-290---------------------DA-A.TAG---KALY.A.S....-----------------------TCQ.A.CH.----
A2VU33_9BURK/75-153---------------------RT-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A2VU33_9BURK/215-290---------------------DA-A.TAG---KALY.A.S....-----------------------TCQ.A.CH.----
B4EF33_BURCJ/75-153---------------------RT-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
B4EF33_BURCJ/215-290---------------------DA-A.TAG---KALY.A.S....-----------------------TCQ.A.CH.----
C5A8N1_BURGB/76-154---------------------KT-Y.KSG---EEIY.K.A....-----------------------VCV.T.CH.----
C5A8N1_BURGB/220-295---------------------AA-G.GAG---QALY.N.S....-----------------------TCQ.A.CH.----
A3MQQ2_BURM7/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A3MQQ2_BURM7/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A4LN20_BURPE/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A4LN20_BURPE/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A5J5U3_BURML/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A5J5U3_BURML/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A5XRS8_BURML/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A5XRS8_BURML/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A8EGW2_BURPE/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A8EGW2_BURPE/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A8KF95_BURPE/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A8KF95_BURPE/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
B2H915_BURPE/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
B2H915_BURPE/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
C0XW58_BURPE/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
C0XW58_BURPE/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
C4KXQ3_BURPE/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
C4KXQ3_BURPE/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
C5ZFF6_BURPE/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
C5ZFF6_BURPE/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
C6U0W3_BURPE/51-129---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
C6U0W3_BURPE/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
B7CVC2_BURPE/51-129---------------------HV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
B7CVC2_BURPE/195-270---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A1V8M8_BURMS/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A1V8M8_BURMS/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A2S6E6_BURM9/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A2S6E6_BURM9/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A3P0T7_BURP0/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A3P0T7_BURP0/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A5TIA4_BURML/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A5TIA4_BURML/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
A9K196_BURML/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A9K196_BURML/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
B1HAC1_BURPE/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
B1HAC1_BURPE/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
C5NBD6_BURML/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
C5NBD6_BURML/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
Q3JY17_BURP1/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
Q3JY17_BURP1/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
Q62FM1_BURMA/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
Q62FM1_BURMA/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
Q63PM0_BURPS/75-153---------------------HV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
Q63PM0_BURPS/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
Q2Y8Z1_NITMU/39-105---------------------FR-W.RDG---AEVY.S.K....-----------------------VCS.Y.CH.----
A3NEY9_BURP6/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
A3NEY9_BURP6/219-294---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
Q13SS3_BURXL/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCS.A.CH.----
Q13SS3_BURXL/218-293---------------------DA-S.QAG---KALY.Q.Q....-----------------------VCQ.A.CH.----
Q2STJ4_BURTA/75-153---------------------RV-Y.KTG---EEVY.K.A....-----------------------VCV.T.CH.----
Q2STJ4_BURTA/220-295---------------------SS-A.SAG---KALY.E.S....-----------------------TCQ.A.CH.----
B2T7I2_BURPP/75-153---------------------RV-Y.KSG---EEVY.K.A....-----------------------VCS.A.CH.----
B2T7I2_BURPP/220-295---------------------DA-S.QAG---KALY.Q.Q....-----------------------VCQ.A.CH.----
A1TJ54_ACIAC/76-151---------------------RP-L.RSG---EEVF.K.G....-----------------------QCA.A.CH.----
A1TJ54_ACIAC/219-294---------------------VA-A.GAG---EALY.K.Q....-----------------------ACQ.V.CH.----
A3RTQ6_RALSL/78-156---------------------RV-Y.KTG---EQLY.K.E....-----------------------VCA.T.CH.----
A3RTQ6_RALSL/215-290---------------------AA-G.DIG---KKVY.D.S....-----------------------TCQ.M.CH.----
B5SK16_RALSL/78-156---------------------RV-Y.KTG---EQLY.K.E....-----------------------VCA.T.CH.----
B5SK16_RALSL/215-290---------------------AA-G.DIG---KKVY.D.S....-----------------------TCQ.M.CH.----
B5RZE1_RALSL/78-156---------------------RV-Y.KTG---EQLY.K.E....-----------------------VCA.T.CH.----
B5RZE1_RALSL/215-290---------------------AA-G.DIG---KKVY.D.S....-----------------------TCQ.M.CH.----
B2UFB9_RALPJ/78-156---------------------RV-F.KTG---EQLY.K.E....-----------------------VCA.T.CH.----
B2UFB9_RALPJ/217-292---------------------SA-G.EVG---KKVY.E.S....-----------------------TCQ.M.CH.----
A5II84_LEGPC/352-429---------------------PT-I.ARG---RQVY.L.K....-----------------------ACL.I.CH.----
Q5WSR4_LEGPL/352-429---------------------PT-I.ARG---RQVY.L.K....-----------------------ACL.I.CH.----
Q5X0Y3_LEGPA/352-429---------------------PT-I.ARG---RQVY.L.K....-----------------------ACL.I.CH.----
Q5ZRI3_LEGPH/352-429---------------------PS-V.ARG---RQVY.L.K....-----------------------ACL.I.CH.----
C6BG20_RALP1/78-156---------------------RV-F.KTG---EQLY.K.E....-----------------------VCA.T.CH.----
C6BG20_RALP1/218-293---------------------SA-G.EVG---KKVY.E.S....-----------------------TCQ.M.CH.----
F0Q4K8_ACIAP/76-151---------------------RP-L.RSG---EEVF.K.G....-----------------------QCA.A.CH.----
F0Q4K8_ACIAP/219-294---------------------VA-A.GAG---EALY.K.Q....-----------------------ACQ.V.CH.----
Q8XUU9_RALSO/78-156---------------------HV-Y.KTG---EQLY.K.E....-----------------------VCA.T.CH.----
Q8XUU9_RALSO/214-289---------------------AA-G.DIG---KKVY.D.S....-----------------------TCQ.M.CH.----
A1VIW0_POLNA/80-155---------------------RP-L.RTG---EEVY.K.G....-----------------------QCI.A.CH.----
A1VIW0_POLNA/213-288---------------------TD-T.GAG---EALY.K.Q....-----------------------ACF.A.CH.----
B3EB84_GEOLS/352-421---------------------NQ-L.EAG---RELF.L.H....-----------------------QCF.A.CH.----
B3EB84_GEOLS/436-501---------------------AA-G.DRG---TVLY.E.E....-----------------------NCA.A.CH.----
B3EB84_GEOLS/512-577---------------------SA-K.DQG---ATLY.E.E....-----------------------NCA.A.CH.----
Q12GP1_POLSJ/80-155---------------------RP-L.KSG---EEVY.K.A....-----------------------QCV.A.CH.----
Q12GP1_POLSJ/208-283---------------------AA-A.GAG---EALY.K.Q....-----------------------ACV.A.CH.----
Q0AFI2_NITEC/44-110---------------------GQ-W.SGG---ENVY.A.K....-----------------------VCG.Y.CH.----
C6WTZ7_METML/211-287---------------------VA-G.KSG---EEVY.K.A....-----------------------VCS.M.CH.----
Q82WE5_NITEU/35-101---------------------FA-W.KDG---AEIY.A.K....-----------------------ICA.Y.CH.----
A1VU04_POLNA/31-97---------------------LK-I.SEG---QRFY.Q.K....-----------------------VCA.K.CH.----
C6JUF9_PSEFL/35-101---------------------GV-W.KGG---ENVY.A.K....-----------------------VCG.H.CH.----
C6JUF4_PSEFL/35-101---------------------GV-W.KGG---ENVY.A.K....-----------------------VCG.H.CH.----
A3X1R5_9BRAD/34-102---------------------GQ-W.GSG---KNLY.D.K....-----------------------LCG.L.CH.----
Q8KP42_PSEME/35-101---------------------GV-W.KGG---ENVY.Q.K....-----------------------ICG.H.CH.----
B1ZRL1_OPITP/34-103---------------------AG-F.GSG---RHVF.A.Q....-----------------------HCH.T.CHP----
D0J2D1_COMT2/26-92---------------------HN-I.GPG---QRFY.E.K....-----------------------TCA.K.CH.----
C8N731_9GAMM/102-179---------------------AP-A.FDA---KGEY.D.K....-----------------------ICA.A.CH.----
Q3J8I0_NITOC/35-102---------------------GS-W.KNG---AEVY.A.K....-----------------------VCG.Y.CH.----
Q2G427_NOVAD/30-96---------------------QP-L.RTP---ETVY.A.K....-----------------------TCG.Y.CH.----
Q2G7T2_NOVAD/31-97---------------------AK-G.RAP---EKVY.K.V....-----------------------TCG.Y.CH.----
C5BNC6_TERTT/224-296---------------------GN-A.ANG---QLLY.A.NA.TL-----------------------NCT.T.CH.----
A3ZY52_9PLAN/1756-1835---------------------DL-I.TAG---EVLY.E.D...L-----------------------GCI.A.CH.----
Q0F3R3_9PROT/335-410---------------------FS-L.DDG---KKLY.E.S....-----------------------SCE.M.CH.----
A4XEH7_NOVAD/35-101---------------------GQ-W.KSP---QEAW.E.K....-----------------------TCS.R.CH.----
A0RN00_CAMFF/205-280---------------------NL-V.AAG---REAW.P......-----------------------TCA.A.CH.----
C4ZM80_THASP/26-92---------------------PP-A.EGR---DRTY.A.K....-----------------------VCS.F.CH.----
B4AKK7_BACPU/178-249---------------------DT-S.AEE---YKIY.QEQ....-----------------------TCI.S.CH.----
A8FEI8_BACP2/178-249---------------------DT-S.AAE---YKIY.QEQ....-----------------------TCI.S.CH.----
Q89GY7_BRAJA/40-112---------------------AQ-I.DHG---KSTY.A.E....-----------------------KCS.H.CH.----
Q7UL60_RHOBA/230-305---------------------QA-M.KRG---EAIY.N.R....-----------------------TCV.N.CH.----
Q1NJ28_9DELT/211-281---------------------EA-M.AAG---REHY.D.R....-----------------------SCR.A.CH.----
B5EHM0_GEOBB/34-103---------------------AR-V.ARG---ERAF.M.A....-----------------------NCN.K.CHP----
Q1K0H2_DESAC/350-419---------------------NV-Q.QAG---AELF.K.L....-----------------------QCY.A.CH.----
Q8EQC7_OCEIH/180-249---------------------DT-E.HPG---YAAY.E.N....-----------------------SCL.S.CH.----
Q11NE0_CYTH3/154-225---------------------HT-I.REG---EVIF.A.A....-----------------------KCV.L.CH.----
A5WD19_PSYWF/136-211---------------------GK-P.RDG---KAVY.E.S....-----------------------ICQ.N.CH.----
D0VWQ8_ALCXX/7-82---------------------QL-D.PAG---EKLY.R.S....-----------------------ACV.V.CH.----
D6XW92_BACIE/51-118---------------------DP-I.ELG---EHVY.I.G....-----------------------QCA.S.CH.----
P95552_PSEST/32-106---------------------TQ-P.TDS---QALY.E.Q....-----------------------HCQ.S.CH.----
A4BV27_9GAMM/79-153---------------------SD-A.RSG---EQVV.K.Q....-----------------------VCS.A.CH.----
C5BK07_TERTT/25-100---------------------AA-A.PSP---ESIY.N.A....-----------------------YCI.A.CH.----
A2SCL5_METPP/36-107---------------------AS-A.ALG---RSLY.T.S....-----------------------YCA.R.CH.----
C5CN75_VARPS/92-168---------------------RP-L.AAG---EAVF.K.A....-----------------------QCA.A.CH.----
Q5WGR1_BACSK/178-250---------------------DE-E.AEG---FEIY.S.SQ..D-----------------------SCI.Q.CH.----
A2SLQ6_METPP/84-159---------------------SA-L.KGG---EDVY.K.A....-----------------------QCA.A.CH.----
D2R455_PIRSD/244-319---------------------DS-L.KRG---EAIY.Q.R....-----------------------VCA.N.CH.----
B2A017_OPITP/98-173---------------------VF-I.DAG---RATF.A.S....-----------------------TCA.S.CH.----
A4B9A6_9GAMM/56-132---------------------SG-P.KSG---DEVY.S.T....-----------------------ACA.A.CH.----
B3T2H7_9ZZZZ/21-95---------------------PK-M.DLG---LEIY.N.NK..A-----------------------QCG.V.CH.----
A5IAJ3_LEGPC/61-138---------------------SK-K.EPG---QDIY.D.K....-----------------------YCS.V.CH.----
Q1QDL1_PSYCK/145-220---------------------DG-P.RDG---KAVY.N.A....-----------------------VCQ.T.CH.----
D3G0J4_BACPE/179-251---------------------DT-E.AEG---YAIY.S.AQ..A-----------------------SCI.G.CH.----
B6EP52_ALISL/55-131---------------------TG-P.RTG---DQVY.N.T....-----------------------FCI.A.CH.----
A0RBX8_BACAH/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B0AM87_BACAN/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B0Q297_BACAN/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B0QG91_BACAN/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B1EYK7_BACAN/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B1GFJ8_BACAN/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B1UMW0_BACAN/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B3JAQ8_BACAN/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B3YRF3_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B3Z7J4_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B3ZTY1_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B7JH09_BACC0/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C1EN21_BACC3/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2NF71_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2TEA4_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3EZD1_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3G0Q1_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3GGJ6_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3HG73_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3L8R5_BACAC/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3P5B1_BACAA/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
Q6HL31_BACHK/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
Q81SU9_BACAN/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
Q4FUM0_PSYA2/143-218---------------------DG-P.RDG---KAVY.S.A....-----------------------VCQ.T.CH.----
Q1YS14_9GAMM/67-143---------------------AS-A.RTG---GDIY.A.V....-----------------------NCI.A.CH.----
Q1QE86_PSYCK/91-166---------------------LA-A.DAG---AALY.E.K....-----------------------QCK.V.CH.----
C3B1J5_BACMY/178-249---------------------DK-N.DEG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3BIA6_9BACI/178-249---------------------DK-N.DEG---YKLM.Q.K...N-----------------------TCL.T.CH.----
D6XUY1_BACIE/178-250---------------------DT-S.AAG---YEVY.Q.SQ..D-----------------------SCI.S.CH.----
B5V2U6_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B7HL34_BACC7/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B9IVP6_BACCQ/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2MII8_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2S1G8_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
Q63DK8_BACCZ/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
Q81FP7_BACCR/172-243---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3GYS6_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B5URU6_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B7HHS8_BACC4/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2MYL6_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2NWM6_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2QQR7_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2RKU7_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2SYQ2_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2UBM2_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2WK72_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2X9K4_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2Y8G0_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2Z5M9_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2ZM95_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3C034_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3E1B1_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3EIK3_BACTK/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
Q4MST6_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
Q73AX1_BACC1/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C1A678_GEMAT/516-598---------------------AR-I.ASG---VAFM.R.NT.SS-----------------------GCA.E.CH.----
Q21JH2_SACD2/34-109---------------------AS-A.NTA---SGTY.Q.Q....-----------------------FCA.S.CH.----
C2Q9R0_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
A9VMD4_BACWK/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2PTR4_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2SHL7_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2XRR1_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3A3S0_BACMY/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
B7IPA2_BACC2/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2TV22_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2UT44_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2V9J2_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2YPE5_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3CGJ2_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3CZE5_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3DHL8_BACTS/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3FHX4_BACTB/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3HY61_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C3IH73_BACTU/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
Q3ESN2_BACTI/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
C2VRF5_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
A3JE72_9ALTE/56-132---------------------AG-P.RSG---SEVY.G.A....-----------------------VCL.A.CH.----
C2PCP2_BACCE/178-249---------------------DK-N.DDG---YKLM.Q.K...N-----------------------TCL.T.CH.----
A0L6L8_MAGSM/25-95---------------------AA-G.TSP---DKIY.A.E....-----------------------ACA.G.CH.----
B8KYK8_9GAMM/634-708---------------------ET-L.AKG---HAVY.A.Q....-----------------------YCA.V.CH.----
Q4FV72_PSYA2/93-168---------------------LA-A.DAG---ATLY.E.K....-----------------------QCK.V.CH.----
Q82TZ4_NITEU/85-152---------------------PA-G.ATG---EKIF.K.G....-----------------------ACV.Q.CH.----
A6W1H2_MARMS/29-105---------------------HA-A.RSG---ETLY.N.S....-----------------------YCI.A.CH.----
A4A914_9GAMM/17-93---------------------AH-A.EPN---MEKY.G.K....-----------------------SCA.V.CH.----
D4H0P9_DENA2/26-97---------------------ND-V.KTG---KEIV.E.D...S-----------------------ACR.R.CH.----
B8KLV3_9GAMM/22-98---------------------AQ-A.EPN---MEKY.G.K....-----------------------SCA.V.CH.----
A9W2D2_METEP/56-134---------------------KA-I.TIG---DSGF.N.Q....-----------------------NCA.R.CH.----
B7KSQ2_METC4/56-134---------------------KA-I.TIG---DSGF.N.Q....-----------------------NCA.R.CH.----
C5AXV6_METEA/56-134---------------------KA-I.TIG---DSGF.N.Q....-----------------------NCA.R.CH.----
C7CJT2_METED/56-134---------------------KA-I.TIG---DSGF.N.Q....-----------------------NCA.R.CH.----
Q0FQZ5_9RHOB/60-138---------------------AA-V.EIG---ASGY.N.Q....-----------------------NCA.R.CH.----
Q1LDJ6_RALME/52-132---------------------PE-N.ALG---KRTY.G.S....-----------------------VCS.M.CH.----
Q3A729_PELCD/69-146---------------------AA-T.DNG---AVLF.Q.Q....-----------------------HCA.V.CH.----
A6EF04_9SPHI/412-488---------------------TN-T.KTA---AGIF.Q.Q....-----------------------LCA.S.CH.----
Q605U1_METCA/45-120---------------------PD-Y.RQG---MYTY.S.M....-----------------------YCS.R.CH.----
Q2S8E3_HAHCH/60-136---------------------SG-P.REP---ADIY.A.S....-----------------------KCF.A.CH.----
A3Q9B5_SHELP/19-95---------------------TF-A.QEG---EAVY.N.K....-----------------------ACH.V.CH.----
Q1LII5_RALME/19-93---------------------ET-T.IDP---ASIY.S.S....-----------------------HCA.A.CH.----
B1ZVK5_OPITP/8-83---------------------SP-G.RDV---NQLY.A.E....-----------------------LCS.G.CH.----
Q1IIF1_KORVE/68-152---------------------DN-L.MTG---AMLY.E.K....-----------------------NCS.L.CH.----
A3TSJ1_9RHOB/75-157---------------------EM-V.EAG---GERY.A.A....-----------------------MCA.H.CH.----
B1LYY5_METRJ/58-136---------------------HA-I.AIG---ASGF.N.Q....-----------------------NCA.R.CH.----
A3K6B2_9RHOB/58-136---------------------KA-V.KIG---ASGY.N.Q....-----------------------NCA.R.CH.----
B7RVE4_9GAMM/425-501---------------------KT-A.QRG---RAIF.T.AQSQP-----------------------NCS.L.CH.----
Q1GQD3_SPHAL/80-161---------------------AR-I.ASG---AGLY.T.E....-----------------------MCS.G.CH.----
A0Z1D9_9GAMM/430-506---------------------DQ-A.LLG---KTIF.T.AKAQP-----------------------GCG.V.CH.----
A3VLY6_9RHOB/63-141---------------------KA-I.EIG---ASGY.T.Q....-----------------------NCA.R.CH.----
Q9KH03_CUPNE/611-686---------------------AK-V.ADG---QKLY.V.N....-----------------------NCV.F.CH.----
Q88HM2_PSEPK/18-94---------------------QA-A.QDP---EAVF.N.R....-----------------------ACQ.M.CH.----
A2SG66_METPP/49-118---------------------AR-I.SAG---KSRF.D.S....-----------------------TCA.AFCH.----
A8LI62_DINSH/59-137---------------------TA-I.DIG---ASGY.N.Q....-----------------------NCA.R.CH.----
A5WCC6_PSYWF/115-190---------------------LA-A.DAG---QKLY.E.V....-----------------------KCK.Q.CH.----
C9QBF2_9VIBR/55-131---------------------TG-P.REG---SQVY.G.T....-----------------------FCI.A.CH.----
Q1JVS4_DESAC/25-92---------------------KG-W.RAG---KKTY.K.S....-----------------------VCM.S.CH.----
A0LNA9_SYNFM/67-151---------------------RL-V.SDG---ARTY.D.E....-----------------------VCR.Y.CH.----
B7RZH9_9GAMM/25-101---------------------ER-L.KDG---KRTY.Q.K....-----------------------VCA.G.CH.----
D2WEZ5_9GAMM/30-104---------------------AK-S.DSP---HDIY.M.D....-----------------------NCA.S.CH.----
C8PYE9_9GAMM/116-192---------------------DK-P.REG---KVIY.E.G....-----------------------VCH.T.CH.----
B1ZKW8_METPB/56-134---------------------KA-I.AIG---DSGF.N.Q....-----------------------NCA.R.CH.----
Q5LT99_SILPO/60-138---------------------AA-I.RIG---DSGY.N.Q....-----------------------NCA.R.CH.----
C6E8A8_GEOSM/29-106---------------------AD-K.VDG---KAKF.D.Q....-----------------------HCA.V.CH.----
E0TI01_PARBH/75-157---------------------AM-V.EAG---AGEY.K.A....-----------------------MCQ.H.CH.----
A9WF34_CHLAA/94-175---------------------AL-L.AHG---QSRY.N.A....-----------------------FCA.P.CH.----
B9LHX9_CHLSY/94-175---------------------AL-L.AHG---QSRY.N.A....-----------------------FCA.P.CH.----
B8G9D9_CHLAD/94-175---------------------AL-L.AHG---QSRY.N.A....-----------------------FCA.P.CH.----
A7HSP3_PARL1/649-723---------------------ET-V.RQG---EIGY.S.T....-----------------------YCM.L.CH.----
D0LWM7_HALO1/365-433---------------------EL-L.RTG---AKVY.R.R....-----------------------QCA.V.CH.----
A6DGN2_9BACT/21-96---------------------DT-I.QRG---EEIY.K.Q....-----------------------VCH.I.CH.----
Q2BM08_9GAMM/16-92---------------------PA-A.AMA---NETY.N.T....-----------------------KCV.A.CH.----
Q21LI4_SACD2/423-490---------------------PE-P.LTG---EEHY.Q.A....-----------------------KCA.S.CH.----
Q2S0S2_SALRD/114-197---------------------EV-L.ERG---RERY.E.I....-----------------------QCS.V.CH.----
Q0YNZ6_9CHLB/35-111---------------------YD-M.VQG---KDVY.E.R....-----------------------ACS.V.CH.----
B1ZSK7_OPITP/523-610---------------------LP-P.DEA---GKLF.A.R....-----------------------LCV.Q.CH.----
D0D4Y1_9RHOB/62-140---------------------TA-V.QIG---ASGY.N.Q....-----------------------NCA.R.CH.----
Q026Z1_SOLUE/491-561---------------------TA-E.RRG---RAVY.E.Q....-----------------------SCQ.I.CH.----
B4RBL1_PHEZH/38-106---------------------DA-P.TPG---KLVY.D.Q....-----------------------YCA.S.CH.----
Q0YRR8_9CHLB/36-112---------------------YN-L.PQG---QETY.N.R....-----------------------ACG.V.CH.----
A4ABJ9_9GAMM/59-137---------------------MA-A.IDG---EATY.N.T....-----------------------ACL.A.CH.----
Q84LN7_CHLVU/52-130---------------------GD-L.TLG---QQVF.D.N....-----------------------NCP.R.AT.----
A0YFF9_9GAMM/632-707---------------------AT-A.LEG---KILY.Q.D....-----------------------NCN.G.CH.----
Q4W6G0_PSEPU/622-695---------------------AS-I.EAG---AKLY.D.G....-----------------------YCS.Q.CH.----
Q0I8W0_SYNS3/21-97---------------------LA-V.ETG---ASLF.Q.N....-----------------------NCA.S.CHP----
E6TZH9_BACCJ/180-254---------------------DT-E.SEA---YAIY.Q.TQ..D-----------------------SCI.G.CH.----
Q1N1U1_9GAMM/38-115---------------------PQ-D.PHL---KQIY.Q.S....-----------------------SCK.N.CH.----
B6B5B9_9RHOB/69-147---------------------AA-I.DIG---GSGY.N.Q....-----------------------NCA.R.CH.----
A6VEW6_PSEA7/18-94---------------------QA-A.QDP---EAVF.N.R....-----------------------TCG.A.CH.----
B7RIJ2_9RHOB/64-142---------------------EA-L.EIG---ESGY.I.Q....-----------------------NCA.R.CH.----
A4C9E1_9GAMM/182-254---------------------LA-P.NLG---AALF.N.E....-----------------------KCS.G.CH.----
Q4KAC1_PSEF5/53-129---------------------PA-D.PAL---AQVY.A.S....-----------------------SCQ.L.CH.----
C6E1Z8_GEOSM/25-100---------------------PA-P.PKM---PYAF.E.M....-----------------------YCV.M.CH.----
Q471V2_CUPPJ/631-706---------------------GK-V.QEG---QKLY.V.N....-----------------------NCV.F.CH.----
B4U7B8_HYDS0/42-117---------------------QE-Y.EMA---KQIY.F.N....-----------------------RCA.G.CH.----
D0CP62_9RHOB/426-500---------------------TA-W.ADA---QSDY.A.E....-----------------------HCA.S.CH.----
Q26HW6_FLABB/102-181---------------------EN-L.ASG---QELY.N.I....-----------------------YCA.I.CH.----
Q8GCG9_PSEFL/18-94---------------------QA-T.QDP---EAVY.N.R....-----------------------VCG.A.CH.----
D5SY03_PLAL2/362-450---------------------EL-M.KRG---QERY.N.I....-----------------------YCA.T.CH.----
A4BFL7_9GAMM/24-88---------------------DL-L.FLG---QGLY.I.D....-----------------------QCQ.R.CH.----
A3L1D9_PSEAI/18-94---------------------QA-A.QDP---EAVF.N.R....-----------------------TCG.A.CH.----
A3LGA3_PSEAI/18-94---------------------QA-A.QDP---EAVF.N.R....-----------------------TCG.A.CH.----
B7V728_PSEA8/18-94---------------------QA-A.QDP---EAVF.N.R....-----------------------TCG.A.CH.----
Q02DL8_PSEAB/18-94---------------------QA-A.QDP---EAVF.N.R....-----------------------TCG.A.CH.----
Q9HT82_PSEAE/18-94---------------------QA-A.QDP---EAVF.N.R....-----------------------TCG.A.CH.----
D3S0D5_FERPA/76-139---------------------EE-L.NGG---EGLY.K.K....-----------------------YCR.G.CH.----
Q5LL07_SILPO/30-104---------------------LD-P.DAL---RRLV.Q.Q....-----------------------DCG.S.CH.----
D0J6H9_COMT2/104-185---------------------AN-P.AVT---ALLQ.K.G....-----------------------ACF.S.CH.----
A7H7J6_ANADF/38-103---------------------EA-L.ARG---ERVF.R.A....-----------------------KCL.H.CH.----
Q3AKY1_SYNSC/17-93---------------------RD-A.STG---ALLF.E.Q....-----------------------HCA.G.CHI----
A5VWC9_PSEP1/68-150---------------------AL-I.QAG---AGNY.N.A....-----------------------MCI.G.CH.----
B0KEW0_PSEPG/68-150---------------------AL-I.QAG---AGNY.N.A....-----------------------MCI.G.CH.----
B1J3Z3_PSEPW/68-150---------------------AL-I.QAG---AGNY.N.A....-----------------------MCI.G.CH.----
Q9HTM7_PSEAE/47-123---------------------PA-E.PAL---AQVY.S.A....-----------------------SCK.L.CH.----
D0CI16_9SYNE/31-107---------------------PD-A.SPG---ALLF.E.Q....-----------------------HCA.G.CHI----
Q02E34_PSEAB/47-123---------------------PA-D.PAL---AQVY.S.A....-----------------------SCK.L.CH.----
A3L1T9_PSEAI/47-123---------------------PA-D.PAL---AQVY.S.A....-----------------------SCK.L.CH.----
A3LIE6_PSEAI/47-123---------------------PA-D.PAL---AQVY.S.A....-----------------------SCK.L.CH.----
B7V5L9_PSEA8/47-123---------------------PA-D.PAL---AQVY.S.A....-----------------------SCK.L.CH.----
B9M8G0_GEOSF/51-126---------------------QE-P.PKM---PYVF.G.M....-----------------------YCF.M.CH.----
B8KSW1_9GAMM/101-179---------------------SG-A.RSG---DAVY.N.S....-----------------------ACM.A.CH.----
A6VED5_PSEA7/45-121---------------------PA-D.AAL---AQVY.S.A....-----------------------SCK.L.CH.----
A1W767_ACISJ/63-138---------------------AE-F.DRA---RQIY.F.E....-----------------------RCA.G.CH.----
B9MJ36_ACIET/63-138---------------------AE-F.DRA---RQIY.F.E....-----------------------RCA.G.CH.----
A9BZT2_DELAS/622-697---------------------SL-V.AEG---TALY.V.S....-----------------------NCA.F.CH.----
A4VN17_PSEU5/68-150---------------------EQ-M.RSG---AGNY.A.A....-----------------------MCV.G.CHL----
Q0ACJ7_ALHEH/98-174---------------------FD-A.EVA---QQIN.Q.A....-----------------------ACM.A.CH.----
Q4FV28_PSYA2/32-109---------------------AE-A.ANI---ATTY.N.E....-----------------------SCA.A.CH.----
A1K9F5_AZOSB/602-677---------------------AD-V.AAG---TALY.V.S....-----------------------NCV.F.CH.----
Q3KKA8_PSEPF/7-83---------------------QA-T.QDP---EAVY.N.R....-----------------------VCG.A.CH.----
B1JFS5_PSEPW/68-150---------------------AL-I.KAG---AGNY.N.A....-----------------------MCI.G.CHL----
A5EMR9_BRASB/626-701---------------------KD-V.PEG---TALY.I.A....-----------------------ACA.T.CH.----
B4D145_9BACT/68-137---------------------GE-A.RTG---AAIY.Q.K....-----------------------MCA.D.CH.----
A6EI04_9SPHI/26-100---------------------GA-A.YAG---WMVW.Q.E...H-----------------------NCH.A.CH.----
Q88C05_PSEPK/68-150---------------------TL-I.RAG---AGNY.N.A....-----------------------MCI.G.CH.----
Q7NZ83_CHRVO/47-123---------------------PA-D.AQL---ARKY.E.R....-----------------------SCL.I.CH.----
Q9AF95_9RHOO/605-680---------------------DD-V.AEG---TGLY.V.T....-----------------------NCV.F.CH.----
Q1QE33_PSYCK/32-109---------------------AG-A.AST---ATTY.N.E....-----------------------SCA.A.CH.----
B0UF76_METS4/91-172---------------------AL-L.GLG---RDRY.D.V....-----------------------FCS.P.CH.----
A9F4Z4_SORC5/91-172---------------------AV-I.RRG---QDRF.N.I....-----------------------YCA.P.CHD----
A3PCC0_PROM0/31-108---------------------SD-I.RDG---ETIF.R.N....-----------------------VCA.G.CH.----
A4VGU0_PSEU5/60-138---------------------GA-A.RSG---SDVY.G.K....-----------------------FCT.A.CH.----
B1Y086_LEPCP/35-110---------------------AN-T.MKG---FRTW.R.A...A-----------------------ACD.R.CH.----
B7G2Z5_PHATC/72-143---------------------TN-F.QQG---ARLF.E.S....-----------------------NCA.L.CH.----
A1WF08_VEREI/621-696---------------------AK-V.QAG---TMLY.I.S....-----------------------NCV.F.CH.----
B1JFJ2_PSEPW/18-94---------------------QA-T.QDP---EALY.N.R....-----------------------TCA.A.CH.----
D2QKH1_SPILD/42-109---------------------AT-K.VAG---KTVF.E.N....-----------------------SCK.S.CH.----
A0L539_MAGSM/166-238---------------------GD-A.QQG---AAHY.Q.A....-----------------------LCQ.S.CH.----
Q1IGY0_PSEE4/18-94---------------------QA-T.QDP---EALY.N.R....-----------------------SCA.A.CH.----
C5CQ48_VARPS/612-687---------------------AK-V.QAG---TMLY.V.S....-----------------------NCV.F.CH.----
Q6N4Z5_RHOPA/638-713---------------------KD-V.AEG---TAIY.V.A....-----------------------ACA.T.CH.----
B8KKI4_9GAMM/55-133---------------------VA-V.VDG---EGTY.N.M....-----------------------ACL.A.CH.----
B5JNZ8_9BACT/52-133---------------------PD-L.IAG---QATW.G.A....-----------------------TCK.T.CHL----
A0Y8S9_9GAMM/622-697---------------------EV-I.AKG---SSAY.A.N....-----------------------ACV.T.CH.----
A2C131_PROM1/36-112---------------------IE-A.DSG---KNLF.N.H....-----------------------NCA.G.CHI----
B0KG05_PSEPG/18-94---------------------QA-T.QDP---EVLY.N.R....-----------------------TCA.A.CH.----
Q3KBY3_PSEPF/17-93---------------------EA-A.QEP---EAVF.N.R....-----------------------SCV.M.CH.----
Q8RTS8_9PROT/651-725---------------------QQ-I.MEG---ESLF.L.R....-----------------------NCA.K.CH.----
A1WTA0_HALHL/21-98---------------------VA-L.ADG---ESIY.T.NGTSP-----------------------TCS.S.CH.----
Q07KS9_RHOP5/641-716---------------------KD-V.PEG---TAIY.V.A....-----------------------ACA.T.CH.----
E8YS57_9BURK/45-120---------------------AN-T.FQG---WKTW.R.A...L-----------------------ACE.R.CH.----
B8R969_9BACT/65-140---------------------AE-F.ELG---RKVY.F.E....-----------------------RCA.G.CH.----
B8H4A4_CAUCN/35-111---------------------PA-N.ARL---ASLY.E.T....-----------------------SCH.A.CH.----
Q9A8X9_CAUCR/35-111---------------------PA-N.ARL---ASLY.E.T....-----------------------SCH.A.CH.----
B4CXG6_9BACT/32-109---------------------KQ-F.DQT---VKPFLE.D....-----------------------HCY.S.CH.----
A4XUG0_PSEMY/68-150---------------------AL-I.RAG---AGNY.N.S....-----------------------MCI.G.CHL----
Q2IXK0_RHOP2/644-719---------------------KD-V.PEG---TAIY.V.A....-----------------------ACA.T.CH.----
C4K9Z0_THASP/48-122---------------------AR-A.REL---VHIV.R.Q....-----------------------DCG.S.CH.----
B1FT19_9BURK/45-120---------------------SN-T.LQG---WKTW.R.A...L-----------------------ACE.R.CH.----
E6VCM9_RHOPX/638-713---------------------KD-V.AEG---TAIY.V.A....-----------------------ACA.T.CH.----
A5VWQ7_PSEP1/18-94---------------------QA-T.QDP---EVLY.N.R....-----------------------TCA.A.CH.----
Q88RK4_PSEPK/18-94---------------------QA-T.QDP---EVLY.N.R....-----------------------TCA.A.CH.----
Q0KAI6_CUPNH/582-657---------------------AQ-V.KAG---TGLY.V.S....-----------------------NCV.L.CH.----
B7S1Q2_9GAMM/35-111---------------------PA-D.AEL---ASIY.N.R....-----------------------SCR.S.CH.----
E1TEX3_BURSG/45-120---------------------SN-T.FQG---WKTW.R.A...L-----------------------ACE.R.CH.----
Q46LX6_PROMT/36-112---------------------IE-A.DSG---RTLF.N.H....-----------------------NCA.G.CHI----
D2QK82_SPILD/25-95---------------------PA-A.KTA---RENY.A.T....-----------------------YCA.S.CH.----
C5BSV8_TERTT/1230-1297---------------------GS-A.LTG---EQEY.S.A....-----------------------QCA.S.CH.----
B7S2D0_9GAMM/68-146---------------------SG-A.RSG---EDVY.N.S....-----------------------ACL.A.CH.----
B9R5L0_9RHOB/612-687---------------------EQ-V.TAG---LATY.V.S....-----------------------NCL.F.CH.----
Q13QS4_BURXL/45-120---------------------PN-T.LQG---WKTW.R.A...L-----------------------ACE.R.CH.----
B9QVQ8_9RHOB/17-93---------------------AD-V.AAG---KDLA.L.Q....-----------------------WCA.S.CH.----
B8KQH3_9GAMM/31-98---------------------TP-A.ADG---KLLF.D.M....-----------------------HCA.K.CH.----
D5WEW9_BURSC/45-120---------------------SN-T.LQG---WKTW.R.A...L-----------------------ACE.R.CH.----
B0T3F8_CAUSK/36-112---------------------PA-N.PRL---AALY.G.E....-----------------------SCK.A.CH.----
C4KB05_THASP/28-92---------------------AL-A.ADG---AALL.A.A....-----------------------NCL.S.CH.----
A1WW82_HALHL/90-167---------------------NE-D.HPG---LAIY.R.SGTAP-----------------------SCR.S.CH.----
A4BFF1_9GAMM/24-92---------------------GN-H.EAG---QKIY.A.E....-----------------------QCA.S.CH.----
A5KGE9_CAMJU/71-137---------------------VN-P.SII---NSLY.K.Q....-----------------------KCA.T.CH.----
A1VXP2_CAMJJ/71-137---------------------AN-P.TII---NSLY.K.Q....-----------------------KCA.T.CH.----
A3YQA3_CAMJU/71-137---------------------AN-P.TII---NSLY.K.Q....-----------------------KCA.T.CH.----
A3ZF72_CAMJU/71-137---------------------AN-P.TII---NSLY.K.Q....-----------------------KCA.T.CH.----
B3EJX0_CHLPB/146-225---------------------YD-I.VDG---EKIY.E.L....-----------------------NCA.D.CH.----
A1TWT3_MARAV/44-120---------------------PA-S.PEL---AAVY.Q.R....-----------------------SCQ.A.CH.----
D2MR24_CAMJU/71-137---------------------AN-P.TII---NSLY.K.Q....-----------------------KCA.T.CH.----
A3YKK9_CAMJU/71-137---------------------VN-P.SII---NSLY.K.Q....-----------------------KCA.T.CH.----
A3ZJN7_CAMJU/71-137---------------------VN-P.SII---NSLY.K.Q....-----------------------KCA.T.CH.----
B5QIA5_CAMJU/71-137---------------------VN-P.SII---NSLY.K.Q....-----------------------KCA.T.CH.----
Q0PBX9_CAMJE/71-137---------------------VN-P.SII---NSLY.K.Q....-----------------------KCA.T.CH.----
A8FJW7_CAMJ8/71-137---------------------VN-P.SII---NSLY.K.Q....-----------------------KCA.T.CH.----
B0TS56_SHEHH/27-94---------------------GN-P.KKG---KHLY.K.K....-----------------------ECK.A.CH.----
A7H1N6_CAMJD/71-137---------------------AN-P.SII---SSLY.K.Q....-----------------------KCA.T.CH.----
A1WSQ3_VEREI/55-130---------------------AK-T.LEG---WKTW.R.A...L-----------------------ACE.R.CH.----
QHED_COMTE/622-697---------------------AK-V.EAG---TMLY.V.A....-----------------------NCV.F.CH.----
A5VG31_SPHWW/615-690---------------------KD-V.APG---GALY.V.S....-----------------------NCL.F.CH.----
A5V5X2_SPHWW/57-123---------------------PA-T.APG---KAIF.A.E....-----------------------HCA.V.CH.----
B7X052_COMTE/622-697---------------------AK-V.EAG---TMLY.V.A....-----------------------NCV.F.CH.----
B3R1B3_CUPTR/636-711---------------------AL-V.KDG---TALY.V.S....-----------------------NCV.L.CH.----
D0IWC5_COMT2/622-697---------------------AK-V.EAG---TMLY.V.A....-----------------------NCV.F.CH.----
Q1QF01_NITHX/68-148---------------------QL-I.LKG---AGQY.A.A....-----------------------MCA.D.CHL----
A0Z3Y4_9GAMM/641-716---------------------AL-H.TEG---LKLF.A.G....-----------------------NCQ.W.CH.----
B7RXM4_9GAMM/605-679---------------------EE-I.DRG---GVAY.T.R....-----------------------FCA.R.CH.----
B1Y7W8_LEPCP/63-138---------------------AE-F.DLG---RKTY.F.E....-----------------------RCA.G.CH.----
D3FLC6_CAMJI/71-137---------------------VN-P.SII---NSLY.K.Q....-----------------------KCA.T.CH.----
Q5HX07_CAMJR/71-137---------------------VN-P.SII---NSLY.K.Q....-----------------------KCA.T.CH.----
C7JEE1_ACEP3/619-694---------------------EK-A.KLG---YQKY.Q.Q....-----------------------YCL.A.CH.----
C7JQJ9_ACEPA/619-694---------------------EK-A.KLG---YQKY.Q.Q....-----------------------YCL.A.CH.----
C7JZR4_ACEPA/619-694---------------------EK-A.KLG---YQKY.Q.Q....-----------------------YCL.A.CH.----
C7K2I2_ACEPA/619-694---------------------EK-A.KLG---YQKY.Q.Q....-----------------------YCL.A.CH.----
C7KBQ1_ACEPA/619-694---------------------EK-A.KLG---YQKY.Q.Q....-----------------------YCL.A.CH.----
C7KL17_ACEPA/619-694---------------------EK-A.KLG---YQKY.Q.Q....-----------------------YCL.A.CH.----
C7KVD0_ACEPA/619-694---------------------EK-A.KLG---YQKY.Q.Q....-----------------------YCL.A.CH.----
C7L556_ACEPA/619-694---------------------EK-A.KLG---YQKY.Q.Q....-----------------------YCL.A.CH.----
A7NJ91_ROSCS/100-182---------------------EL-L.ERG---AQRY.R.I....-----------------------YCA.V.CH.----
C5CPS1_VARPS/42-117---------------------PE-T.MKG---FRTW.RSA....-----------------------ACD.R.CH.----
A8EVK9_ARCB4/387-456---------------------NI-L.EVG---KSIY.Q.I....-----------------------ECR.I.CH.----
Q47WF2_COLP3/36-109---------------------AD-Y.EKA---KLQY.F.Q....-----------------------RCA.G.CH.----
A4A7C0_9GAMM/654-729---------------------ET-I.NEG---LVHY.A.R....-----------------------NCS.V.CH.----
B8GPJ9_THISH/24-93---------------------AD-V.NRG---QQLH.A.T....-----------------------NCV.S.CH.----
Q82Y64_NITEU/48-115---------------------AA-D.ASG---EDIF.Y.A....-----------------------NCT.K.CH.----
Q1QG40_NITHX/70-151---------------------SL-M.RTG---RKDF.E.I....-----------------------FCS.P.CH.----
A4ABA2_9GAMM/426-499---------------------ET-V.HRG---GDLY.Y.S....-----------------------HCW.M.CH.----
D5X2V9_THIK1/41-111---------------------AN-V.AQG---QKYY.D.N...L-----------------------KCA.A.CH.----
A3L1W6_PSEAI/55-133---------------------GG-A.RSG---EDIV.G.K....-----------------------TCN.T.CH.----
A3LIH3_PSEAI/55-133---------------------GG-A.RSG---EDIV.G.K....-----------------------TCN.T.CH.----
B7V5J1_PSEA8/55-133---------------------GG-A.RSG---EDIV.G.K....-----------------------TCN.T.CH.----
Q02E62_PSEAB/55-133---------------------GG-A.RSG---EDIV.G.K....-----------------------TCN.T.CH.----
Q9HTQ4_PSEAE/55-133---------------------GG-A.RSG---EDIV.G.K....-----------------------TCN.T.CH.----
Q0BZB7_HYPNA/37-107---------------------AD-M.SLG---AAL..A.L....-----------------------SCS.G.CH.----
Q21JC5_SACD2/72-165---------------------DR-L.LAG---GADY.N.D....-----------------------MCT.G.CHL----
NIRC_PARDP/23-97---------------------AR-Q.DEL---RHLV.R.Q....-----------------------DCG.S.CH.----
A5VXY0_PSEP1/68-150---------------------NL-I.RVG---AGNY.N.A....-----------------------MCI.G.CH.----
Q1QFM0_NITHX/68-148---------------------QL-I.LKG---AGQY.A.A....-----------------------MCA.D.CHL----
Q135A3_RHOPS/641-716---------------------KD-V.LEG---TAIY.V.A....-----------------------ACA.T.CH.----
C1AAV5_GEMAT/57-124---------------------EQ-A.TEG---QAVY.K.K....-----------------------SCA.E.CH.----
B8KW87_9GAMM/19-85---------------------AE-P.HPG---EALY.N.E....-----------------------NCA.A.CH.----
Q169Z8_ROSDO/26-100---------------------AE-Q.DRL---AHFV.Q.Q....-----------------------DCG.S.CH.----
A0Z5T1_9GAMM/60-126---------------------RS-A.LAG---AALY.D.T....-----------------------HCA.T.CH.----
Q7VD12_PROMA/41-117---------------------NN-Q.TNG---ERLF.I.E....-----------------------NCA.G.CH.----
C1AAU5_GEMAT/503-570---------------------AQ-A.TKG---KEVF.A.S....-----------------------SCL.G.CH.----
Q11ZY1_POLSJ/635-710---------------------AQ-V.PAG---TALY.V.S....-----------------------NCV.L.CH.----
A8G0N9_SHESH/28-95---------------------GN-P.KKG---KHLY.K.K....-----------------------QCK.S.CH.----
Q5NW84_AROAE/45-111---------------------RD-R.HPG---KAVF.A.K....-----------------------ICA.T.CH.----
A8PQE4_9COXI/63-139---------------------NN-N.RSG---KIIF.E.N....-----------------------KCI.L.CH.----
Q0AJH5_NITEC/28-95---------------------AE-N.ASG---EDIF.F.A....-----------------------SCT.K.CH.----
B5WW29_9BURK/45-120---------------------SN-T.LQG---WKTW.R.A...L-----------------------ACE.R.CH.----
A0Z5N7_9GAMM/37-103---------------------TE-A.ASG---ASLF.Q.N....-----------------------NCL.H.CH.----
B2JX30_BURP8/50-125---------------------ND-T.LQG---WKTW.R.A...L-----------------------ACE.R.CH.----
D5CQP3_SIDLE/23-93---------------------GD-A.TNG---KNLF.T.K...Y-----------------------DCN.S.CH.----
A1VBG6_DESVV/352-421---------------------NM-H.EAG---RELW.Q.V....-----------------------QCA.N.CH.----
E3IKU2_DESVR/352-421---------------------NM-H.EAG---RELW.Q.V....-----------------------QCA.N.CH.----
Q728W8_DESVH/352-421---------------------NM-H.EAG---RELW.Q.V....-----------------------QCA.N.CH.----
A6VEA5_PSEA7/61-139---------------------GG-A.RSG---EDIV.G.K....-----------------------TCN.T.CH.----
A2W3G8_9BURK/172-243---------------------AD-A.ALA---RQHW.V.L....-----------------------NCM.G.CH.----
E6VR86_DESAO/28-93---------------------GN-G.RKG---KFLY.R.K....-----------------------NCR.S.CH.----
Q4K966_PSEF5/28-93---------------------FA-A.RDA---QSIL.K.E....-----------------------TCQ.G.CH.----
Q315B2_DESDG/27-92---------------------GN-A.RKG---KYLF.R.K....-----------------------HCR.S.CH.----
A2SLA8_METPP/65-140---------------------AN-T.MKG---FRTW.R.A...A-----------------------ACD.R.CH.----
B6ARF2_9BACT/47-108---------------------PS-G.LTG---EVLF.D.R....-----------------------ACS.Q.CH.----
Q7UKT3_RHOBA/60-129---------------------PV-L.SAG---LKIY.A.E....-----------------------QCL.Q.CH.----
A3ZL90_9PLAN/38-114---------------------ID-F.AAA---QKLL.A.T....-----------------------SCA.D.CH.----
D1RGY4_LEGLO/35-114---------------------GT-K.NEG---EQIY.N.H....-----------------------FCV.N.CH.----
D3HQM6_LEGLN/35-114---------------------GT-K.NEG---EQIY.N.H....-----------------------FCV.N.CH.----
Q1Q4F5_9BACT/116-192---------------------EE-Y.KKA---NWEY.F.N....-----------------------RCG.G.CH.----
C4FJP2_9AQUI/297-366---------------------NK-V.KVG---EYLF.K.L....-----------------------ECR.V.CH.----
D3P8P2_DEFDS/26-95---------------------AN-A.RKG---KRVW.K.K....-----------------------NCRLA.CHD----
D9SIK9_GALCS/24-94---------------------GQ-A.TAG---KALF.D.K...Y-----------------------QCN.S.CH.----
Q3SIT8_THIDA/21-80---------------------QD-A.ARG---SALF.Q.T....-----------------------QCS.R.CH.----
A6UL88_SINMW/71-147---------------------GP-T.YNG---YRRY.H.A....-----------------------SCS.H.CH.----
C7RBR8_KANKD/70-157---------------------NR-L.LVG---GADY.N.D....-----------------------MCS.G.CHL----
A6CBQ2_9PLAN/55-123---------------------SN-P.KTG---AAIY.R.K....-----------------------LCI.E.CH.----
B8KVD8_9GAMM/610-683---------------------EV-V.EQG---RQLY.V.M....-----------------------FCG.G.CH.----
Q89MF2_BRAJA/61-136---------------------RT-A.EEG---HRLA.Q.A....-----------------------WCQ.T.CH.----
Q46TV3_CUPPJ/26-98---------------------GR-L.ERG---HANY.V.L....-----------------------HCS.G.CH.----
D2R7R9_PIRSD/50-127---------------------NE-YRTEI---VPLI.K.K....-----------------------FCI.E.CH.----
A5V502_SPHWW/612-686---------------------GD-P.DAG---MAEY.D.R....-----------------------TCT.V.CH.----
A3ZQN4_9PLAN/34-103---------------------AE-Q.PHG---AVIF.K.K....-----------------------LCV.D.CH.----
C6BWV7_DESAD/28-93---------------------GN-A.RKG---KFLY.R.K....-----------------------HCR.S.CH.----
B1Y5Y6_LEPCP/37-112---------------------GD-V.RRG---WAAL.R.A...F-----------------------DCA.R.CH.----
D5W8B0_BURSC/32-103---------------------YN-A.AAA---REAW.V.L....-----------------------NCM.G.CH.----
A8EWG4_ARCB4/134-211---------------------EA-K.VDA---QNIY.V.N....-----------------------QCQ.T.CH.----
Q5P5Q6_AROAE/31-96---------------------LA-T.ASG---EALV.N.S....-----------------------KCA.A.CH.----

PF14495

CY550_SYNY3/26-160---------------TTTLTARQ-F-TNG---QKIFVD-----------------------------TCT-Q-CH-----
A0YIA2_LYNSP/27-163---------------PTVLSLKE-I-KQG---KQLFNY-----------------------------ACA-Q-CH-----
B5W3Z1_SPIMA/27-163---------------TAVLSLKE-I-KKG---QQVFNA-----------------------------ACA-Q-CH-----
D8FTU7_9CYAN/26-162---------------TVVLSLKQ-V-KEG---KRLFNS-----------------------------ACA-Q-CH-----
CY550_TRIEI/26-161---------------EVVLTIKE-Y-TQG---KREFTN-----------------------------VCS-Q-CH-----
B4VPE5_9CYAN/41-177---------------TTVLSLEE-V-AKG---KRLFND-----------------------------SCS-Q-CH-----
CY550_APHHA/27-163---------------EVVISIKE-A-ERG---KRLFND-----------------------------TCA-Q-CH-----
CY550_PHATC/27-163---------------TIVLTPEQ-V-KRG---KRLFNA-----------------------------TCG-A-CH-----
A6MVU4_RHDSA/27-161---------------TVVLTTEQ-V-K.G---KRLFNS-----------------------------SCG-N-CH-----
B7T207_VAULI/27-163---------------TIVLSPEQ-V-KRG---KRLFLA-----------------------------TCS-T-CH-----
D1GJF7_FUCVE/25-161---------------TTILTPEQ-V-KRG---KRLFNS-----------------------------SCG-Q-CH-----
C6KIN7_AURAN/27-162---------------TVVLTPEQ-V-KRG---KRLFNA-----------------------------SCG-T-CH-----
CY550_CYAPA/27-162---------------TVVLTPEQ-V-KRG---KRLFNS-----------------------------TCG-I-CH-----
CY550_PORYE/27-163---------------TVILTPEQ-V-KRG---KRLFNN-----------------------------SCA-I-CH-----
D4NY78_GALSU/31-167---------------TITLTTEQ-V-KKG---KRLFNS-----------------------------NCA-Q-CH-----
CY550_CYAME/17-150---------------KVEVNADQ-L-KRG---KRLFNT-----------------------------HCS-A-CH-----
C550A_CYACA/28-164---------------SLTLNEEQ-I-KKG---KRLFNS-----------------------------HCG-S-CH-----
D9IXN9_9ALVE/21-157---------------SVTLTLEQ-V-KRG---KRLFNA-----------------------------SCS-T-CH-----
CY550_EMIHU/28-164---------------TVVLSVEQ-I-KRG---KRLFNN-----------------------------ACA-I-CH-----
A0YIA1_LYNSP/32-167---------------TQQFLPED-I-NTG---KMLFEA-----------------------------SCL-N-CH-----
D8FTU8_9CYAN/31-167---------------TRLFSGED-L-SAG---KRLFGQ-----------------------------NCL-N-CH-----
B0C732_ACAM1/13-153---------------TQLFSPEE-L-SDG---KRLFDD-----------------------------NCK-N-CH-----
B8HUH8_CYAP4/28-165---------------TQLFSPEE-L-TLG---KQLFDQ-----------------------------NCK-N-CH-----
PSBV2_THEEB/36-172---------------TKTFTAVD-L-TRG---KRLFEE-----------------------------NCK-N-CH-----
PSBV2_SYNJB/38-165---------------TLTFTPEQ-L-TDG---KNRFQS-----------------------------ACL-N-CH-----
C5501_GLOVI/39-173---------------LQTFSPQQ-I-YAG---KKLFES-----------------------------NCQ-N-CH-----
C5502_GLOVI/28-166---------------LSNFSTAD-L-KQA---KKLFQA-----------------------------ECG-R-CH-----
CY550_SYNJB/41-180---------------SITFTEAQ-L-AKG---KKLFNT-----------------------------ACA-Q-CH-----
D9IXJ6_9ALVE/24-160---------------KAIITPNE-L-GRG---KVLFAK-----------------------------TCS-A-CH-----
CY550_PROM3/34-170---------------QVTFSESE-I-KSA---SKLFKS-----------------------------NCA-T-CH-----
A3YVH4_9SYNE/47-183---------------LVTFSEAE-I-KGG---RKLFND-----------------------------SCG-T-CH-----
A4CRA5_SYNPV/34-170---------------TVTFTEQQ-V-KAG---RKVFNT-----------------------------SCG-T-CH-----
Q064V6_9SYNE/27-163---------------EVTFTDRE-I-NAG---RKVFNT-----------------------------SCG-T-CH-----
B1X599_PAUCH/44-180---------------QVTFTEEE-F-KSG---RKIFNA-----------------------------SCG-T-CH-----
A5GV34_SYNR3/45-181---------------TVTFTESE-I-KAG---RKVFNN-----------------------------SCG-E-CH-----
A3INJ0_9CHRO/27-161---------------TTTLSSEQ-I-TNG---QRLFIR-----------------------------ECT-Q-CH-----
CY550_CYAP8/26-160---------------TTIVTSKQ-I-TNG---QRLFVQ-----------------------------ECT-Q-CH-----
A8YI71_MICAE/27-161---------------SVTLTSEQ-A-TEG---QKLFVA-----------------------------NCT-K-CH-----
B7KBF5_CYAP7/27-161---------------TTTLTSKQ-A-TNG---QRLFNL-----------------------------ECT-Q-CH-----
CY550_SYNP2/35-170---------------TVVLSDQQ-V-AKG---ERIFIN-----------------------------TCS-T-CH-----
CY550_ACAM1/27-162---------------TVTLSTQQ-A-KEG---QRLFNF-----------------------------ACA-N-CH-----
B4WKJ4_9SYNE/35-171---------------QVTFSTRQ-L-MQG---QRKFNG-----------------------------SCA-Q-CH-----
CY550_CYAP4/26-162---------------NITLSRRQ-V-EDG---QRLFNE-----------------------------ACA-S-CH-----
CY550_THEEB/27-163---------------TITLTEKQ-Y-LEG---KRLFQY-----------------------------ACA-S-CH-----
B4WI32_9SYNE/35-171---------------TVTLSLEE-F-TRG---QQKFNN-----------------------------ACA-I-CH-----
CY550_SYNE7/31-167---------------NVTLSLKQ-V-AEG---KQLFAY-----------------------------ACG-Q-CH-----
A0ZF54_NODSP/27-163---------------TVVLSLKQ-V-KEG---KRLFQF-----------------------------ACA-Q-CH-----
D4TF74_9NOST/7-143---------------TIVISPKQ-L-QEG---KRLFQD-----------------------------TCA-Q-CH-----
D7E275_NOSA0/27-163---------------TVVISVPQ-L-AQG---KKLFND-----------------------------TCA-Q-CH-----

PF09098

Q2BKZ1_9GAMM/29-197--------------------------ADA---ESIIKK-----------------------------NCL-A-CH-----
A1K4V1_AZOSB/28-193--------------------------AAG---DALIAE-----------------------------KCL-V-CH-----
Q8VUT0_PARDE/24-190--------------------------VTG---EEVLQN-----------------------------ACA-A-CH-----
A8ES16_ARCB4/28-194--------------------------QKG---KEVIES-----------------------------KCI-A-CH-----
A0NPA8_9RHOB/27-192--------------------------QDG---ATLLEE-----------------------------NCS-G-CH-----
Q4K966_PSEF5/31-196--------------------------RDA---QSILKE-----------------------------TCQ-G-CH-----
Q5P5Q6_AROAE/34-200--------------------------ASG---EALVNS-----------------------------KCA-A-CH-----
Q2BHT3_9GAMM/23-191--------------------------IDG---PQIIKE-----------------------------NCL-L-CH-----
B1J9N8_PSEPW/50-215--------------------------EQG---ATLLQN-----------------------------KCM-G-CH-----
Q5P0U9_AROAE/48-212--------------------------VAA---QQLLEA-----------------------------KCG-A-CH-----
Q3KBY9_PSEPF/28-193--------------------------QKG---EQVLNT-----------------------------MCA-G-CH-----

PF02167

CY1_RHOCB/30-274---------------FGKYDQAQ-L-RRG---FQVYNE-----------------------------VCS-A-CH-----
A9W5T2_METEP/36-282---------------FGRFDQAQ-L-QRG---FQVYKE-----------------------------VCA-S-CH-----
B7WUZ9_COMTE/27-250---------------VNTSNTAS-L-QNG---AKIFVN-----------------------------YCL-S-CH-----
B1KHU2_SHEWM/26-232---------------IDLHDKES-L-QRG---LDSFQH-----------------------------YCA-G-CH-----
A8LMT4_DINSH/33-254---------------FGSYDTQQ-L-QRG---LQVYTE-----------------------------VCA-A-CH-----
B0UHS1_METS4/35-283---------------FGTFDQAQ-L-QRG---YQVYRE-----------------------------VCS-N-CH-----
A3WER2_9SPHN/55-280---------------LGTWDYAQ-L-QRG---YQVYKE-----------------------------VCS-A-CH-----
CY1_SCHPO/77-295---------------LSGFDHAS-L-RRG---FQVYRE-----------------------------VCS-A-CH-----
Q47HW4_DECAR/24-238---------------GSVSDKAS-L-QNG---AKLFVN-----------------------------YCL-N-CH-----
Q1YLW6_MOBAS/60-298---------------FGHYDLGQ-L-QRG---LKVYKE-----------------------------VCA-S-CH-----
Q2VZT2_MAGSA/444-663---------------FGKHDKAA-L-KRG---WQVFHD-----------------------------VCS-N-CH-----
Q18853_CAEEL/49-266---------------FSSFDIAS-V-RRG---YEVYKQ-----------------------------VCA-A-CH-----
Q3R1J0_XYLFA/35-252---------------NDVSDRMS-L-QRG---VQLYMN-----------------------------YCV-G-CH-----
Q21AU1_RHOPB/449-689---------------FGKFDRAQ-L-QRG---YQVYKE-----------------------------VCA-T-CH-----
Q309Z8_TOXGO/165-383---------------FHSHDIPS-V-RRG---YEVYRK-----------------------------VCA-T-CH-----
Q4FPG7_PELUB/34-255---------------FGKFDRGS-L-QRG---YQVYTE-----------------------------VCA-S-CH-----
Q1HQ62_BOMMO/77-295---------------FSSLDHAS-V-RRG---YEVYKQ-----------------------------VCK-A-CH-----
Q29BY0_DROPS/78-297---------------LSALDKEA-V-RRG---YQVYKE-----------------------------VCS-S-CH-----
A7URV6_ANOGA/67-285---------------LDSLDHAS-V-RRG---YEVYKQ-----------------------------VCA-A-CH-----
Q1NGI3_9SPHN/50-278---------------FGRYDRQQ-L-QRG---FQVFKE-----------------------------VCS-A-CH-----
A0L4I9_MAGSM/37-276---------------FGKFDKAQ-I-KRG---IQVATE-----------------------------VCM-G-CH-----
A5CCC9_ORITB/37-255---------------LGQLDVQA-A-QRG---FKVYKE-----------------------------VCS-A-CH-----
Q0BIV2_BURCM/32-251---------------DNTENLVS-L-QHG---AQLFVN-----------------------------YCL-N-CH-----
A3S9Z7_9RHOB/34-275---------------FGSFDANQ-L-QRG---LQIYTE-----------------------------VCS-A-CH-----
Q15PI7_PSEA6/25-243---------------YDLTDKAS-L-QNG---AKIFQN-----------------------------YCL-G-CH-----
Q9VAM8_DROME/80-299---------------LSALDKES-V-RRG---YTVYKE-----------------------------VCS-S-CH-----
C6BF85_RALP1/28-246---------------NQSSDTSA-L-QRG---AKLFVN-----------------------------YCL-N-CH-----
Q8I6U9_PLAF7/163-381---------------FHSHDIPS-V-RRG---YEVYRQ-----------------------------ICA-T-CH-----
Q6NAJ2_RHOPA/447-687---------------FGTYDRAQ-L-QRG---FKIYKE-----------------------------VCS-N-CH-----
Q5LX54_SILPO/35-282---------------FGTYDQNQ-L-QRG---LQVYTE-----------------------------VCA-A-CH-----
Q3SHU9_THIDA/27-240---------------VNLSDHES-L-QRG---ARTFVN-----------------------------YCL-N-CH-----
Q0ARQ6_MARMM/35-267---------------FGTYDTSA-V-QRG---YQIYQE-----------------------------VCA-S-CH-----
CY1_RHOVI/37-277---------------FGQYDKAQ-L-RRG---FQVFQN-----------------------------VCV-S-CH-----
CY1_DICDI/48-266---------------WQSYDHAA-I-RRG---HQVYTQ-----------------------------VCS-T-CH-----
A6FK74_9RHOB/51-273---------------FGKFDQNQ-L-QRG---LKVYTQ-----------------------------VCA-A-CH-----
A4U106_9PROT/35-254---------------FGRYDQAE-L-KRG---FEVFNQ-----------------------------VCS-N-CH-----
A6WZD7_OCHA4/50-288---------------FGTYDKGQ-L-QRG---LKVYKE-----------------------------VCS-A-CH-----
A3V2K9_9RHOB/36-283---------------FGQFDQMQ-L-QRG---LQVYTE-----------------------------ICA-A-CH-----
A0NYN7_9RHOB/37-292---------------FGFYDRGQ-L-QRG---FKVYRE-----------------------------VCS-S-CH-----
Q31GY5_THICR/28-217---------------NSLEDKDS-L-KRG---AILFSE-----------------------------YCM-A-CH-----
Q2YAB5_NITMU/27-244---------------IKPRDMTS-L-QRG---AKTFVN-----------------------------YCL-S-CH-----
Q21U76_RHOFD/33-256---------------NKTNDMGA-L-QNG---AKIFVN-----------------------------YCL-N-CH-----
Q0FDH4_9RHOB/32-255---------------FGKFDQYQ-L-QRG---LQVYTE-----------------------------VCS-A-CH-----
A3VZ49_9RHOB/36-277---------------FGKFDQNQ-L-QRG---LKVYTQ-----------------------------VCA-A-CH-----
Q12FB3_POLSJ/31-254---------------GKVNDMAT-L-QSG---ARLFVN-----------------------------YCL-S-CH-----
Q98HU6_RHILO/45-283---------------FGTYDKAQ-L-QRG---LKVYKE-----------------------------VCS-A-CH-----
Q0G7X2_9RHIZ/70-308---------------FGHWDVGQ-L-QRG---YKVYRE-----------------------------VCA-A-CH-----
Q9JXH1_NEIMB/34-265---------------IDLRDQVS-L-QHG---AQIFTN-----------------------------YCL-S-CH-----
Q606Q5_METCA/25-239---------------VDVFDKES-L-RRG---AVTYAN-----------------------------YCQ-G-CH-----
Q0FQ99_9RHOB/36-259---------------FGAFDQDQ-L-QRG---LQVYTE-----------------------------VCS-A-CH-----
A4C8A1_9GAMM/30-248---------------NDITDKAS-L-QRG---AKLFLN-----------------------------YCL-G-CH-----
Q5KFT4_CRYNJ/84-302---------------LETFNHSA-I-RRG---YQVYRE-----------------------------VCA-A-CH-----
Q7W082_BORPE/27-281---------------DRINDVAS-L-QNG---AKLFVN-----------------------------YCL-N-CH-----
Q2N670_ERYLH/52-277---------------LGRWDVAQ-L-QRG---LKVYDE-----------------------------VCS-A-CH-----
A5P9W2_9SPHN/52-278---------------FGKWDQQQ-L-QRG---LKVYDE-----------------------------VCA-A-CH-----
Q0C5B1_HYPNA/36-317---------------TGQFDKAS-V-QRG---YQVYKQ-----------------------------VCS-S-CH-----
Q4P5I2_USTMA/273-491---------------FETFDHAS-I-RRG---YQVYRE-----------------------------VCS-S-CH-----
Q4U9S9_THEAN/164-382---------------LHGHDIPS-V-RRG---YEVYRQ-----------------------------VCA-T-CH-----
Q5P7F4_AROAE/32-250---------------.VSSDPAA-L-QNG---AKLFVN-----------------------------YCL-S-CH-----
A4A5E3_9GAMM/447-675---------------MDISNKSS-L-QNG---AKVYMN-----------------------------YCM-G-CH-----
Q1V4G5_VIBAL/25-244---------------VDLTDKAS-L-QNG---AKLFMN-----------------------------YCF-A-CH-----
A3JUZ2_9RHOB/42-267---------------FGSYDDYQ-L-QRG---LQIYSE-----------------------------VCS-A-CH-----
A3JXC6_9RHOB/41-283---------------FGAYDQMQ-L-QRG---LKVYTE-----------------------------ICS-A-CH-----
Q5NNX8_ZYMMO/54-279---------------TGHFDKKQ-L-RRG---FTVFQA-----------------------------VCA-S-CH-----
A4G9H2_HERAR/27-253---------------DHTKDLAA-L-QNG---ARLFVN-----------------------------YCL-S-CH-----
Q2GGU6_EHRCR/34-249---------------LGSFDKQS-I-QRG---YQVYRE-----------------------------VCS-S-CH-----
Q3IY11_RHOS4/33-277---------------FGTFDQHQ-L-QRG---LQVYTE-----------------------------VCA-A-CH-----
A7TQ32_VANPO/62-281---------------FETFDHAS-I-RRG---YQVYRE-----------------------------VCA-A-CH-----
Q2S9X6_HAHCH/27-251---------------VDIRDKPS-L-QRG---AAMFTN-----------------------------YCM-G-CH-----
A3UG74_9RHOB/36-266---------------FGTFDRAQ-L-QRG---FLVYQQ-----------------------------VCS-A-CH-----
Q11GB9_MESSB/42-280---------------FGTYDKGQ-L-QRG---FKVYRE-----------------------------VCS-A-CH-----
Q5ZS16_LEGPH/27-245---------------VDINDKES-L-QRG---AKMFMN-----------------------------YCS-G-CH-----
E0TH88_PARBH/38-318---------------FGSYDQAQ-L-QRG---FQVYQQ-----------------------------VCS-S-CH-----
Q6VBC1_TIGCA/46-264---------------IDSFDHAS-I-RRG---YQVYKQ-----------------------------VCA-A-CH-----
A1B4F4_PARDP/220-443---------------FGKFDQHQ-L-QRG---LQVYTE-----------------------------VCS-A-CH-----
Q9AAW8_CAUCR/34-279---------------FGKFDQVQ-L-QRG---YKVYRE-----------------------------VCA-S-CH-----
A7T224_NEMVE/42-238---------------FNSIDHDS-I-RRG---FQVYRQ-----------------------------VCA-A-CH-----
A3JAB5_9ALTE/26-250---------------TDHTDKAS-L-QRG---VAMFTN-----------------------------YCM-G-CH-----
Q2LZL6_DROPS/77-295---------------FSSLDHQS-V-RRG---YEVYKQ-----------------------------VCS-A-CH-----
Q2GDE1_NEOSM/33-247---------------LGTFDKQA-I-KRG---LKVYQQ-----------------------------VCA-A-CH-----
Q2URC0_ASPOR/83-302---------------NKTFDHAA-L-RRG---FQVYRE-----------------------------VCA-S-CH-----
Q5GRL2_WOLTR/34-249---------------TGFFDRES-I-QRG---YKVYKE-----------------------------VCA-A-CH-----
A1WPT3_VEREI/29-252---------------GKTNDLAS-L-QNG---AKLFVN-----------------------------YCL-S-CH-----
Q3JEC0_NITOC/27-239---------------ININDKAS-L-QRG---AQVFMN-----------------------------YCL-S-CH-----
Q16CM3_ROSDO/34-256---------------FGTYDQNQ-L-QRG---LQVYTE-----------------------------VCA-A-CH-----
A4YPL3_BRASO/446-686---------------FGKFDRGA-V-QRG---LKIYKE-----------------------------VCS-N-CH-----
A4HT63_LEIIN/13-246---------------WHSLDWPS-V-RRG---RQIYTE-----------------------------VFA-P-CH-----
Q2GAK0_NOVAD/50-270---------------FGRFDKQQ-L-QRG---FQVYKE-----------------------------VCA-T-CH-----
Q82W83_NITEU/27-233---------------IDRADKES-L-QRG---AKGFVE-----------------------------YCL-T-CH-----
A2SE24_METPP/27-254---------------NKMTDVAS-L-QHG---AKLFVN-----------------------------YCL-N-CH-----
A6GMB1_9BURK/25-251---------------DLTNDLAA-L-QRG---AKLFSN-----------------------------YCL-N-CH-----
A0YES0_9GAMM/447-692---------------VDATNQAS-L-QRG---AQVYMN-----------------------------YCM-G-CH-----
Q1QAE1_PSYCK/46-236---------------IDFTNKGS-L-QNG---AKTFMN-----------------------------YCA-G-CH-----
CY1_NEUCR/85-304---------------LKTFDHQA-L-RRG---FQVYRE-----------------------------VCA-S-CH-----
A8AFY8_CITK8/31-265---------------TGHYDKEQ-L-RRG---LQVYEE-----------------------------KCR-A-CH-----
Q1GTG5_SPHAL/45-267---------------MPHWDLAQ-L-QRG---MQVYKE-----------------------------VCS-A-CH-----
A3VGU9_9RHOB/36-257---------------FGTYDQQQ-L-QRG---FKVYMD-----------------------------VCR-A-CH-----
A3U3Y9_9RHOB/34-257---------------FGAFDQMQ-L-QRG---LQVYTE-----------------------------VCS-A-CH-----
CY1_EUGGR/11-231---------------FQGLDWRS-V-RRG---KEVYEQ-----------------------------VFA-P-CH-----
Q28VL8_JANSC/34-258---------------FGTFDQDQ-L-QRG---LQVYTE-----------------------------VCA-G-CH-----
Q59ZJ2_CANAL/57-276---------------FETFDHAS-I-RRG---FQVYRE-----------------------------VCA-A-CH-----
Q1RIA3_RICBR/32-250---------------RGSVDREA-A-QRG---FQVYKE-----------------------------VCS-V-CH-----
Q5PAG3_ANAMM/36-251---------------FGSFDRSA-I-QRG---YQVYKE-----------------------------VCS-S-CH-----
Q2KTR9_BORA1/20-275---------------DQTNDLAS-L-QNG---AKLFIN-----------------------------YCL-N-CH-----
A7ATE9_BABBO/165-383---------------FHGHDIGS-V-RRG---YEVYRQ-----------------------------VCA-T-CH-----
Q3SPC2_NITWN/446-686---------------FGKFDQGQ-L-QRG---YKVYKE-----------------------------VCA-A-CH-----
Q6P4K0_XENTR/80-298---------------LSSLDHAS-I-RRG---YQVYKQ-----------------------------VCA-A-CH-----
A5CY14_VESOH/30-219---------------TNINDKKS-L-RRG---AKLFMN-----------------------------YCS-G-CH-----
A0Z7E2_9GAMM/447-675---------------TDASDQPS-L-QRG---AALYTN-----------------------------YCM-G-CH-----
A1K424_AZOSB/32-250---------------.VSKDPAA-L-QHG---AKIFVN-----------------------------YCL-N-CH-----
A7HVC5_PARL1/42-261---------------FGTYDRDA-L-RRG---YKVYKE-----------------------------VCA-V-CH-----
A4S995_OSTLU/22-240---------------FSSYDHAS-V-RRG---HQVYTQ-----------------------------VCA-A-CH-----
A1SA15_SHEAM/26-231---------------IDLNDKES-L-VRG---LDLFQH-----------------------------YCS-G-CH-----
Q2GKU3_ANAPZ/33-248---------------FGTFDRPA-V-QRG---YQVYRE-----------------------------VCS-S-CH-----
A5V642_SPHWW/50-278---------------LGKFDRQQ-L-QRG---FQVYKE-----------------------------VCS-A-CH-----
A3SIH3_9RHOB/34-256---------------FGKFDQNQ-L-QRG---LKVYTE-----------------------------VCS-A-CH-----
Q0K6A7_CUPNH/29-246---------------VNTADLSS-L-QRG---AKLFVN-----------------------------YCL-N-CH-----
Q1ZGW4_9GAMM/24-243---------------YDLSDKSS-L-QRG---AKLFMN-----------------------------YCF-A-CH-----
Q2CK81_9RHOB/36-287---------------FGSYDTFQ-L-QRG---LQIYTE-----------------------------VCA-S-CH-----
Q9FQ96_CHLRE/85-303---------------LDSYDHAA-I-RRG---HKVYQQ-----------------------------VCA-A-CH-----
A4F0J5_9RHOB/34-257---------------FGAYDPNQ-L-QRG---LQIYTE-----------------------------VCA-A-CH-----
CY1_ALLVD/26-243---------------IDLRDQAS-L-QRG---AKYFMN-----------------------------YCT-G-CH-----
CY1_RHORU/36-270---------------FGRYDQPQ-L-QRG---FQVFHE-----------------------------VCS-T-CH-----
Q92PE8_RHIME/52-289---------------FGHYDKGQ-L-QRG---LKVYTE-----------------------------VCS-A-CH-----

PF09086

A0L4E9_MAGSM/25-120---------------PAA....N-L-LAG---QQLWSQPGITKNQ.------------------LQRRCA-T-CH-----
B2JWN6_BURP8/39-134---------------QSGNAEPD-P-SRG---QQFFGASHG.....------------------HEWRCA-S-CH-----
Q3SMF4_THIDA/32-129---------------VAA.STLS-P-ARG---EAFYRLERAHPAG.------------------AKRSCA-G-CH-----
Q8E911_SHEON/48-141---------------QGA.GPFS-A-DAG---QALWLQQS......------------------EDRSCT-S-CH-----
SHP_RHOS4/29-126---------------AAG.APAD-A-ERG---RALFLSTQTGGKP.------------------DTPSCT-T-CH-----
Q2WAX9_MAGSA/178-275---------------AGF.AGFS-A-ERG---RALFESRNSA.SP.------------------DYASCT-T-CH-----
A1VMG8_POLNA/41-135---------------QAG.APAV-P-ARG---QQFFNTRHG.....------------------REWSCA-S-CH-----
Q47C89_DECAR/34-130---------------SGF.AP.S-A-KRG---EALFRQRFAI.ND.------------------KMPGCT-S-CH-----
A0RN71_CAMFF/40-138---------------RNF.KDFD-A-DRG---EAIFKTKSIGKNG.------------------QNISCE-S-CH-----
Q220Q7_RHOFD/37-130---------------AAF.KDFT-V-AAG---QKLYGTKG......------------------AELSCA-S-CH-----
A3CZ63_SHEB5/52-145---------------QGA.GPFT-A-AAG---QKLWLQDM......------------------DGRSCA-S-CH-----
A0YHK9_9GAMM/35-128---------------TAA.EVLS-A-ERG---AALWVRDF......------------------DGRSCT-T-CH-----
Q5NXN7_AROAE/38-135---------------PSF.VGFS-A-ARG---ETLHRTQHNMGKA.------------------DTPACT-S-CH-----
Q0F2E5_9PROT/30-129---------------QGA.GDFD-A-ARG---QTLWQQEHMQVKLG------------------KQVNCA-S-CH-----
Q21RT6_RHOFD/35-128---------------PAF.QDFS-A-TAG---RRLYTTRV......------------------GELACA-S-CH-----
CYCA_METME/38-136---------------PMY.EAPS-I-TDG---KIFFNRKFKTPSG.------------------KEAACA-S-CH-----
Q2RPG6_RHORT/198-295---------------GAF.AGFD-S-RRG---EALYRALSTN.DP.------------------ELTSCA-A-CH-----

PF02433

A0LA61_MAGSM/3-235...............EGIRPYTP-LELRG---RDIYVR-E---------------------------GCY-N-CH-----
A7HTB7_PARL1/7-232...............KGVRPYSP-LELAG---RNIYLR-E---------------------------GCY-N-CH-----
Q1NF35_9SPHN/8-233...............EGMRPYTP-LELAG---RNIYIR-E---------------------------GCY-N-CH-----
A3WG87_9SPHN/19-244...............DGMRPYTP-LELVG---RDIYIR-E---------------------------GCY-T-CH-----
Q57EZ8_BRUAB/7-232...............EGMRPYSP-LELAG---RDIYVR-E---------------------------GCY-L-CH-----
Q8KLH6_RHIEC/8-233...............EGMRPYTP-LELAG---RNIYIR-E---------------------------GCY-L-CH-----
Q989I1_RHILO/7-232...............EGMRPYSP-LELAG---RNIYVR-E---------------------------GCY-L-CH-----
Q1YNS2_MOBAS/30-255...............EGMRPYSP-LELAG---RNIYIR-E---------------------------GCY-A-CH-----
A1B350_PARDP/7-231...............QGMRPYTP-LELKG---RDIYVR-E---------------------------GCY-V-CH-----
O30728_RHOCA/7-232...............EGMRPYTP-LELTG---RDIYIR-E---------------------------GCY-V-CH-----
A3XC97_9RHOB/7-232...............EGMRPYTP-LEMAG---REVYIR-E---------------------------GCY-T-CH-----
A3K3E9_9RHOB/7-243...............EGMRPYTP-LELAG---REVYLR-E---------------------------GCY-V-CH-----
Q16AS6_ROSDO/7-231...............EGMRPYSP-LELTG---RDIYIR-E---------------------------GCY-V-CH-----
Q3J013_RHOS4/7-231...............EGVRPYTP-LELAG---RDIYIR-E---------------------------GCY-V-CH-----
A3U175_9RHOB/44-268...............EGMRPYSP-LELAG---REIYVR-E---------------------------GCY-V-CH-----
Q28KI9_JANSC/7-230...............EGVRPYSP-LELAG---REIYIR-E---------------------------GCT-V-CH-----
A3JT80_9RHOB/7-231...............KGMRPYSP-LELTG---RDIYVR-E---------------------------GCY-T-CH-----
A4EEP6_9RHOB/18-243...............DGVRPYSP-LELAG---RDVYVR-E---------------------------GCY-V-CH-----
A3VER1_9RHOB/7-237...............EGVRPYSP-LEMEG---RNIYIR-E---------------------------GCY-V-CH-----
Q3SLW1_THIDA/7-235...............DGVRPYTP-LEQRG---RDIYQR-E---------------------------GCY-T-CH-----
Q1H3N7_METFK/3-231...............DGVRPYTP-LEQRG---RDIYVR-E---------------------------GCY-L-CH-----
A1AV86_RUTMC/11-234.......TLSNWAPGDGVRPLTA-LELAG---RDIYQR-E---------------------------GCY-L-CH-----
Q0EVT5_9PROT/4-204...............DSIRPYTA-LELEG---RDVYIR-E---------------------------GCY-L-CH-----
Q31E69_THICR/11-267QDRNGNWVIADWKAGDGVRPYTP-LELAG---RDIYLR-E---------------------------GCY-I-CH-----
A1ZN78_9BACT/487-705...............AAVKPYTP-LELEG---RDLYIR-E---------------------------GCV-G-CH-----
A3HZP0_9BACT/489-703...............SSVKPYTP-LELEG---RDLYIA-N---------------------------GCV-G-CH-----
A2U1I4_9FLAO/488-721...............SSIKPYTP-LELEG---RDIYIR-E---------------------------GCV-G-CH-----
Q26FM8_FLABB/488-721...............SSVKPYTP-LELEG---RDIYIR-E---------------------------GCV-G-CH-----
Q1VRL1_9FLAO/488-721...............STVKPYTP-LELEG---RDLYIR-E---------------------------GCV-S-CH-----
A0M1B2_GRAFK/488-721...............SSVKPYTP-LELEG---RDLYIR-E---------------------------GCV-S-CH-----
A4CGK1_ROBBH/488-721...............TSVTPYTP-LELEG---RDLYIR-E---------------------------GCV-S-CH-----
A4AMY4_MARSH/488-718...............TSVKPYTP-LELEG---RDLYIR-E---------------------------GCV-G-CH-----
A5FGW0_FLAJ1/488-722...............SSVKPYTP-LELEG---RDLYIR-E---------------------------GCV-G-CH-----
Q11W03_CYTH3/490-704...............RSVKPYTP-LELEG---RDIYIR-E---------------------------GCN-N-CH-----
Q9ZMT5_HELPJ/2-225...............EGLRPYTV-LETAG---RQIYIQ-E---------------------------GCY-H-CH-----
Q7VGR3_HELHP/2-236...............EGLKPYSL-LETAG---RQVYIA-E---------------------------GCY-N-CH-----
A0Y5P3_9GAMM/10-224...............DGLRPLNA-LEMEG---RDIYVR-E---------------------------GCY-N-CH-----
Q483P2_COLP3/5-214...............DNLKPYTA-LQMEG---RDIYIR-E---------------------------GCS-N-CH-----
A4ESJ1_9RHOB/5-232...............EGMRPYTP-LELAG---RDIYVR-E---------------------------GCY-A-CH-----
A5V795_SPHWW/5-231...............PKMRVYTP-LELAG---RNIYIR-E---------------------------GCY-A-CH-----
Q11G34_MESSB/5-232...............ADMRVYTP-LELAG---RNIYIR-E---------------------------GCY-A-CH-----
A6ULT7_SINMW/6-233...............EDMRLYTP-LELAG---RNIYIR-E---------------------------GCY-A-CH-----
A3W3T8_9RHOB/5-231...............DDLRPHTP-LELAG---REIYIR-E---------------------------GCY-A-CH-----
A4YQT8_BRASO/12-238...............DGVRPYTP-LELAG---RNIYVR-E---------------------------GCY-L-CH-----
Q6NDT6_RHOPA/7-233...............DGVRPYTP-LELAG---RNIYIR-E---------------------------GCY-L-CH-----
Q43943_AZOCA/10-235...............DGVRPYTP-LELAG---RNIYLR-E---------------------------GCY-L-CH-----
B0UQJ0_METS4/14-238...............EGVRPYTP-LELAG---RNIYVR-E---------------------------GCY-L-CH-----
A0NRD9_9RHOB/7-233...............EGMRPYTP-LELAG---RNIYIR-E---------------------------GCY-L-CH-----
Q9A8F2_CAUCR/7-234...............QGVRTYTP-LELAG---RDIYVR-E---------------------------GCY-L-CH-----
Q0AQJ4_MARMM/13-239...............DGMRPYTP-LEQLG---RDIYIR-E---------------------------GCY-N-CH-----
A3UHC8_9RHOB/13-239...............EGVRPYSP-LALMG---RDIYIR-E---------------------------GCY-N-CH-----
Q0C2U4_HYPNA/7-242...............QGMRPYTP-LELKG---KNIYVR-E---------------------------GCY-T-CH-----
Q2RP20_RHORT/7-234...............EGVRPYTP-LELAG---RNIYVR-E---------------------------GCY-N-CH-----
Q6N0B7_9PROT/7-232...............EGVRPYSP-LEQAG---RDIYVR-E---------------------------GCY-N-CH-----
Q2VZ08_MAGSA/22-246...............DGVRPYSP-LEQKG---RDIYIR-E---------------------------GCY-N-CH-----
Q9ZHR6_AZOBR/10-234...............DGVRPYSP-LELAG---QNIYFR-E---------------------------GCY-N-CH-----

PF03150

Q8F0I4_LEPIN/51-203-------------------TPER.I-LLG---KTLFFDPIVSGS....-------------...NWISCA-S-CHN.PG.
C6BNA1_RALP1/79-264-------------------VPAM.A-ALG---KALFFDPALSAS....-------------...GKQACA-S-CHS.PT.
A6BYG0_YERPE/178-330-------------------DNQK.V-ALG---SRLFHDPRLSGD....-------------...NSISCA-S-CHL.LN.
Q1YWH3_PHOPR/28-184-------------------LTSQ.V-ELG---RYLFNDVRLSKF....-------------...GNRSCG-L-CHS.SD.
A6F840_9GAMM/555-713-------------------SELK.V-SLG---EKLFFDPFLSRA....-------------...GDVSCS-T-CHD.PK.
Q8F892_LEPIN/52-219-------------------TPEL.I-QLG---EKLYFEKKLSAN....-------------...DTQSCN-S-CHN.VV.
Q484C5_COLP3/54-237-------------------SETK.E-RLG---ELLFWDPILSGD....-------------...KDTSCA-S-CHH.PD.
Q3INL9_NATPD/73-234-------------------TEEK.I-ELG---EQLFLDPRISET....-------------...GTISCN-T-CHN.VM.
A3UWY1_VIBSP/13-162-------------------DPAQ.A-ELG---KRLFFDTRLSGD....-------------...DSISCS-S-CHI.PS.
Q1GKQ2_SILST/33-249-------------------DMAA.V-ELG---QLLFYDPILSGN....-------------...RNIACS-T-CHH.PR.
Q486C9_COLP3/49-204-------------------TSAL.I-NLG---KKLYFETALSIN....-------------...HSQSCN-S-CHN.LN.
A6Q197_NITSB/55-208-------------------TKEK.V-ELG---KKLYFDPRLSRS....-------------...GLISCN-T-CHN.LS.
Q5F5Z9_NEIG1/87-240-------------------TEEQ.V-KLG---HQLWYEPRLSKG....-------------...NTVSCN-S-CHN.LA.
A6GX50_FLAPJ/292-445-------------------TPEK.I-ELG---KLLFNDPILSSN....-------------...NTRSCA-S-CHH.SE.
Q8TLV0_METAC/32-221-------------------LIGE.E-QLG---KKIFFD.KISDP....-------------...DSMSCA-D-CHS.PQ.
A1K8M4_AZOSB/40-192-------------------NLGM.V-ELG---KKLYFDPRLSKS....-------------...GFISCN-S-CHN.LS.
B7KRA1_METC4/52-210-------------------RAAK.A-ELG---RALFFEPVLSRD....-------------...SDRTCA-T-CHV.PG.
Q11XQ6_CYTH3/64-216-------------------TKNR.I-ELG---RMLFFDPILSRD....-------------...SSVSCS-T-CHQ.TD.
Q2SJ93_HAHCH/58-238-------------------NEEA.A-ELG---RKLFFDRSLSGN....-------------...GQISCA-Q-CHN.PQ.
A3Y8E4_9GAMM/70-220-------------------NALA.Q-TLG---KTLFFDSNLSAK....-------------...KGVSCA-S-CHQ.PN.
Q4KAL8_PSEF5/75-229-------------------TQQK.A-DLG---RRLFFDPRLSRS....-------------...GQIACA-S-CHE.PD.
A3W5C9_9RHOB/42-195-------------------TDEK.I-DLG---KALFFDPRMSAS....-------------...GVFSCN-S-CHN.LA.
Q30U36_SULDN/51-205-------------------SEKK.V-ELG---KKLYFDPRLSKS....-------------...GFISCN-S-CHN.LS.
Q1GGR1_SILST/23-201-------------------YQTA.E-DLG---EALFFETDLSLN....-------------...RSQSCA-T-CHD.PA.
Q5GYD6_XANOR/64-215-------------------DSRK.V-ALG---ALLFNDRRLSGD....-------------...NRLACT-S-CHR.LS.
Q1D085_MYXXD/13-165-------------------DEKAWA-SLG---AALFIDTSLSAD....-------------...GKVACA-T-CHP.PD.
A3Y6T1_9GAMM/42-187-------------------NKEK.F-ALG---ELLFHDTRLSKD....-------------...KVTSCH-S-CHN.L..
Q1M6A3_RHIL3/38-225-------------------AEML.T-ALG---RKIFSDPSLSAS....-------------...GLQACA-S-CHD.PS.
Q1W080_9FLAO/85-237-------------------SKEK.A-ELG---EQLFFEKRLSQS....-------------...GQIACA-S-CHD.PS.
A6END5_9BACT/315-468-------------------SEAL.R-DLG---EMLFFDPILSED....-------------...KTMSCA-S-CHK.PA.
A6E6T8_9SPHI/51-203-------------------TKQG.V-YLG---RRLFYESRLSAN....-------------...NTISCG-S-CHM.QE.
A6DF01_9PROT/28-180-------------------DKQK.A-RLG---KLLFFDPILSKD....-------------...KKISCA-S-CHK.PN.
A6Q435_NITSB/36-186-------------------LTPK.E-ILG---KKLFFDPNLSVT....-------------...KKVSCA-S-CHD.LK.
A6E9L0_9SPHI/56-209-------------------TKEG.F-ELG---RALFYEPRLSRN....-------------...NTITCG-S-CHI.QS.
A6Q2F2_NITSB/73-226-------------------TKEK.I-LLG---KMLFFDPSLSKD....-------------...RTISCA-S-CHD.LD.
A6FB20_9GAMM/75-301-------------------DSPL.A-NLG---KKLFFSQSLGGD....-------------...LDSACA-S-CHH.PT.
Q89RR6_BRAJA/62-213-------------------DPLK.V-ALG---EKLFGDRRVSHD....-------------...NSRACQ-S-CHD.IA.
A1ZHU0_9BACT/93-247-------------------TDLG.S-TLG---RVLFYDKNLSAN....-------------...NTIACG-S-CHL.QS.
A5ERS8_BRASB/105-228-------------------EAEL.A-AKG---LQLFNDASLSGG....-------------...SKASCA-T-CH..FS.
A3SUF2_9RHOB/36-255-------------------DLDE.A-ILG---QLLFYDPILSGN....-------------...RNIACA-T-CHH.PD.
A3U6U9_CROAH/70-271-------------------TAEK.V-ALG---KLLLHETALGGNPKMD-------------EMNGQYTCA-T-CHPVAS.
A4YL27_BRASO/71-223-------------------TPEK.A-ALG---KKLYFDTRLSVS....-------------...MAQSCG-S-CHS.PS.
Q2S6C9_SALRD/73-225-------------------LESL.T-TLG---KKLFFDPRLSSS....-------------...NQISCS-S-CHD.PA.
A5KWD9_9GAMM/77-226-------------------DHDL.A-KIG---WVLFKDPNLSSN....-------------...RSVSCE-T-CHS.LQ.
A2TYR9_9FLAO/54-208-------------------TEEG.V-ALG---KKLFFDRILSGN....-------------...QTQSCA-H-CHK.LQ.
A5FEK6_FLAJ1/64-216-------------------SKEK.E-SLG---KILFFDPRLSRS....-------------...GQIACA-S-CHN.PE.
A4CLH8_ROBBH/253-405-------------------TDAQ.V-LLG---EKLFYDPNLSKS....-------------...GTMSCA-S-CHL.PE.
Q01SD6_SOLUE/44-196-------------------SAAK.V-ELG---KLLYFDRRLSAD....-------------...GTVSCA-S-CHD.PK.
A4JDM2_BURVG/79-265-------------------VKQM.T-ALG---KQLFFDPSLSGS....-------------...GKLACA-S-CHS.PD.
A0RR40_CAMFF/59-212-------------------TDAK.A-ELG---KKLYLEPRLSKS....-------------...GIISCN-T-CHN.LG.
A5FLX5_FLAJ1/76-228-------------------TEEK.A-ELG---KVLFFDPRLSKS....-------------...GQISCA-N-CHD.PE.
Q8TLW5_METAC/28-207-------------------LSQK.E-ELG---KLLFFDESLSMP....-------------...RGQSCA-S-CHD.PD.
A0Z6X4_9GAMM/73-225-------------------TPQQ.I-DLG---RYLFFDPLLSKN....-------------...GEVACS-T-CHD.PA.
Q21KC7_SACD2/61-220-------------------TVEK.V-ELG---RHLFYEKQLSGN....-------------...GLQSCA-S-CHQ.QE.
Q121U4_POLSJ/49-200-------------------DPAR.A-DIG---RLLFRDARLSGN....-------------...GRVSCA-S-CHD.LG.
A4BSR1_9GAMM/48-206-------------------TPAL.I-ALG---KRLYFDKQLSIN....-------------...GSQSCN-T-CHR.LD.
A3YTD3_CAMJU/32-183-------------------DKEK.A-KLG---KSLYMDKSLSKD....-------------...GKVSCN-T-CHR.LD.
A5V5J3_SPHWW/45-199-------------------SAAK.V-ELG---RRLFHDADLSID....-------------...GTMACA-T-CHE.QR.
Q01N94_SOLUE/45-264-------------------YHQI.T-LLG---KIIFYDRNLSVR....-------------...RNEACA-F-CHM.PE.
A7ZB45_CAMC1/30-178-------------------NEKQ.A-YIG---KKLFFDKRLSTT....-------------...ENYSCE-T-CHN.LY.
Q04R97_LEPBJ/67-226-------------------TQEK.V-DLG---RFLFYDKRLSGN....-------------...QTQSCA-S-CHN.QS.
A1ZDI4_9BACT/73-277-------------------TLAK.V-KLG---QMLFHETALAIKPKKE-------------VGVNTYSCS-S-CHHAGA.
A3J636_9FLAO/49-202-------------------TEEG.F-QLG---RNLFYDPILSRD....-------------...NTISCA-S-CHL.QQ.
Q5NNF0_ZYMMO/185-337-------------------DKEK.I-ALG---ERLFFDKQLSGD....-------------...GTLNCA-S-CHG.LN.
A4TW02_9PROT/47-197-------------------DPAE.I-MLG---RALFHDALLSRD....-------------...GSLSCA-S-CHP.LD.
Q5LKV8_SILPO/68-222-------------------TEAK.I-ELG---RKLFFDRRLSIN....-------------...RTMSCA-M-CHV.PE.
A3U8R2_CROAH/307-460-------------------SELL.T-SLG---KSLFYDTKLSTT....-------------...NTVSCA-S-CHN.PK.
A3VKF2_9RHOB/37-253-------------------DIQQ.A-MLG---QSLFFDPILAGN....-------------...KNIACS-T-CHH.PT.
A5FH16_FLAJ1/294-447-------------------TKEK.A-ILG---EKLFYDKSLSKN....-------------...NDRSCA-T-CHN.PE.
Q6LS42_PHOPR/21-257-------------------LLIL.E-EFG---KRLFFE.NISDP....-------------...KRMACA-S-CHS.PD.
B1Z920_METPB/50-202-------------------APQT.A-TLG---KMLFFDPRLSGK....-------------...QNLSCA-S-CHN.PS.
A9AMB6_BURM1/46-234-------------------AREM.A-ALG---KLMFFDPSLSAS....-------------...GRMSCA-T-CHS.PA.
Q62D58_BURMA/144-354-------------------LSAV.A-QLG---RALFFDPALSAS....-------------...GRQSCA-S-CHS.PD.
Q1ZQE5_PHOAS/27-183-------------------QQAQ.I-TLG---RYLFNDVRLSKL....-------------...GNRSCA-L-CHA.VD.
A1ZVL2_9BACT/84-236-------------------TQAG.V-DLG---RHLFFDKRLSST....-------------...NQVSCA-S-CHQ.PA.
A0RRL9_CAMFF/20-163-------------------NKQK.A-DLG---KELFRDKRLSKD....-------------...KTISCE-T-CHN.LE.
A6Q5I5_NITSB/29-181-------------------NKQK.A-LLG---KYLFFDPILSKN....-------------...RKISCS-S-CHD.FN.
Q1MY71_9GAMM/424-576-------------------SPEK.V-RLG---KALFFDKNLSKQ....-------------...RNIACS-S-CHI.PD.
Q938I4_BACFG/172-325-------------------DMRK.V-ILG---DMLYHDTRLSAD....-------------...NTVSCA-S-CHG.LN.
A6VSB8_MARMS/53-213-------------------SEEK.V-TLG---QRLFYDANLSGP....-------------...GYMSCS-T-CHM.PE.
A1VWA4_POLNA/64-241-------------------RAEA.A-ALG---RALFNDTRLSKN....-------------...GQVACA-S-CHA.AD.
A0LBU5_MAGSM/40-191-------------------QTDK.A-QLG---GQLFHDPRFSED....-------------...NTVSCA-T-CHP.LE.
A4BKK3_9GAMM/76-230-------------------SPQV.I-DLG---RYLFFDPVLSVN....-------------...GTQSCA-T-CHD.PS.
A6QAR8_SULNB/32-183-------------------DRKK.V-VLG---HKLFFDPRLSQD....-------------...GTVSCA-S-CHD.LE.
Q6MPF1_BDEBA/65-218-------------------SSAQ.I-ELG---RKIFFDYRLSKD....-------------...GSTTCV-R-CHQ.PQ.
A3ZYH2_9PLAN/519-671-------------------SDAK.E-QLG---KALFFDPRLSGS....-------------...GQIACA-S-CHD.PD.
Q82T06_NITEU/25-227-------------------RSEE.I-MLG---ELIFKDKNLSLN....-------------...RNQSCE-T-CHS.LSP
A3YE98_9GAMM/33-212-------------------DDPK.A-ILG---SQLYFDVNLSLN....-------------...RNQSCA-T-CHN.PA.
Q88IQ6_PSEPK/53-204-------------------APGR.V-ELG---RQLFNDPRLSHN....-------------...GTLSCA-S-CHR.LD.
Q1D0X2_MYXXD/73-227-------------------TDAQ.V-ALG---RMLYFEPRLSKN....-------------...HDVSCN-T-CHG.LT.
A8ET72_ARCB4/31-181-------------------DKNK.V-NLG---KELFFDKRLSKD....-------------...ETISCH-S-CHS.FS.
Q0AFW6_NITEC/38-192-------------------NVAL.I-ALG---KKLYLDPRLSID....-------------...DTISCN-S-CHQ.LD.
Q1DDN5_MYXXD/52-212-------------------TEEK.V-QLG---RRLFFDVRLSRN....-------------...ETQSCA-S-CHD.PA.
A6C5X2_9PLAN/104-250-------------------TRAK.I-ELG---RQLYFDPRLSAD....-------------...NTISCA-S-CHH.PD.
Q1VW26_9FLAO/46-199-------------------TEKG.F-ELG---KKLFYDGKLSST....-------------...GVISCG-F-CHV.QE.
MAUG_METFK/45-197-------------------TIEK.A-ALG---KTLFFDPRLSRD....-------------...GSMSCA-T-CHN.PG.
A6GX61_FLAPJ/52-205-------------------TEKG.F-ELG---KKIFYDGRLSSD....-------------...GLISCG-F-CHI.QE.
Q2SPL2_HAHCH/45-264-------------------APAK.Y-ELG---RMLFFDKIMSGN....-------------...RNISCA-T-CHN.PL.
Q9RYL1_DEIRA/48-199-------------------EAAR.A-ALG---RELFYAPVLSSD....-------------...GKVSCS-S-CHQ.QS.
A4A162_9PLAN/44-195-------------------TPGK.V-ELG---RRLFFDTQLSRD....-------------...RSISCS-S-CHD.PE.
A6VXU4_MARMS/42-221-------------------VDPK.A-MLG---AQLFFDTNLSKE....-------------...RNQSCG-T-CHD.IA.
A3N227_ACTP2/179-330-------------------DPHK.V-ALG---EGLYFDGRLSDD....-------------...GTIQCH-T-CHQ.LA.
Q091L5_STIAD/54-206-------------------TPEK.V-SLG---EKLFLDPRLSAD....-------------...NTVSCS-T-CHE.PA.
Q1JXK4_DESAC/56-210-------------------FEEK.V-ALG---QRLFFDPRLSLS....-------------...QTVSCH-S-CHN.LS.
A4AM30_MARSH/56-242-------------------SFEK.I-ELG---RLLFFDPILSGN....-------------...KDVACA-T-CHH.PS.
A3XL95_LEEBM/37-190-------------------SEAK.I-ALG---KCLFFDKNFSKG....-------------...KDMACV-T-CHD.PK.
A6CUR1_9VIBR/67-217-------------------DKNK.A-QLG---LQLFLDPRLSSN....-------------...QQVSCE-S-CHH.IF.
Q1GMK7_SILST/17-169-------------------SPQR.A-ALG---KMLFFDARLSGA....-------------...INMSCA-T-CHN.PS.
B7L1U1_METC4/64-217-------------------TPEK.V-ALG---KALFFDPRLSRS....-------------...GSVSCA-T-CHN.PS.
Q64SV6_BACFR/27-200-------------------GSEK.E-ALG---KLLFHDTSLSEP....-------------...PGQSCA-T-CHA.SS.
A6EQ79_9BACT/52-205-------------------TEAG.F-ELG---KSLFYEGRLSSN....-------------...DAIACA-F-CHE.QA.
A6G5S3_9DELT/86-242-------------------TKAK.V-DLG---RMLYYDGRLSVN....-------------...GEISCN-S-CHV.LS.
Q3JEU9_NITOC/75-294-------------------DPAK.F-QLG---KFLFFDKILSGN....-------------...QNISCA-T-CHH.PL.
Q5H6P7_XANOR/39-192-------------------RQAT.V-ALG---NTLFQDTTLSAR....-------------...RTLACS-S-CHD.PS.
Q2W7Z9_MAGSA/128-283-------------------TPAK.V-ALG---ERLFHDKDLSLD....-------------...HTVSCA-S-CHDLLG.
Q1GLZ0_SILST/44-260-------------------DPAK.A-ELG---RLLFYDKILSGN....-------------...RNISCG-T-CHH.PR.
Q47YZ2_COLP3/18-196-------------------TAIL.V-NLG---NLLYHDTNLSNP....-------------...IGQSCA-S-CHD.LN.
Q74CY3_GEOSL/25-235-------------------LTVK.E-QLG---KDIFFDTNLSIN....-------------...GNQSCA-D-CHA.PE.
Q0F178_9PROT/60-216-------------------SAAK.V-ALG---HQLAFDTRLSKN....-------------...DSISCA-G-CHL.PF.
B1KR19_SHEWM/62-291-------------------SSPL.A-VLG---MQLFYSQALSGD....-------------...MDTACV-S-CHH.PK.
A7HE20_ANADF/128-282-------------------TPEK.V-RLG---RWLFYDARLSAD....-------------...GTISCA-T-CHR.PE.
A7IKZ8_XANP2/69-220-------------------SSPE.A-ELG---GRLFRDPLLSAD....-------------...GRVACA-S-CHD.LA.
Q606V7_METCA/33-209-------------------LSKK.A-RLG---QKLFFDTNLSTP....-------------...PGQACS-S-CHD.PA.
A1K4Z1_AZOSB/76-228-------------------HPAR.V-ALG---QRLFHEPLLSRD....-------------...RTLACA-S-CHN.LS.
Q0A4P3_ALHEH/58-212-------------------TKEK.I-ELG---KMLFFEPRISSS....-------------...GVISCA-T-CHN.PA.
A6D4V3_9VIBR/37-189-------------------DQQK.V-DLG---KALWFEPRLSAS....-------------...NTISCN-S-CHN.VA.
Q13JY9_BURXL/50-232-------------------LSAA.A-QVG---QQLFFDQNLSGN....-------------...KNMSCA-T-CHS.PQ.
A3XYQ2_9VIBR/47-199-------------------TPEK.I-ELG---KVLFYDGRLSGD....-------------...TTSPCA-G-CHI.QS.
A1ZPE3_9BACT/58-212-------------------TKEG.F-LLG---RRLFFDPLLSKD....-------------...GSVSCN-N-CHI.QS.
Q3M2C9_ANAVT/55-215-------------------SSPK.V-ELG---RHLFYEKRLSIT....-------------...GEFSCA-S-CHI.QS.
Q60BW8_METCA/39-193-------------------TPAK.V-ELG---KMLYLDPRLSST....-------------...GTVSCN-S-CHN.VM.
A0L7Q4_MAGSM/41-193-------------------NKQQ.V-ALG---ELLYHDTRLSGD....-------------...GTLSCA-S-CHP.VN.
A6G0M7_9DELT/82-298-------------------DEAK.F-ELG---RLLFFDKELSGP....-------------...RNISCA-T-CHH.PL.
Q1MNM9_LAWIP/176-328-------------------NKQK.A-ALG---EKLFNDRRLSHD....-------------...NTIRCA-S-CHV.TS.
Q1YU87_9GAMM/90-243-------------------SPEQ.I-DLG---RLLFFDPVLSAD....-------------...QSVSCA-S-CHN.PS.
Q5FS76_GLUOX/63-272-------------------LSQM.A-QIG---RMLFYDRALSGS....-------------...GKLSCA-S-CHD.PA.
A6GBH1_9DELT/56-265-------------------RPEL.V-ELG---RSLAFDKELSGN....-------------...RNIACL-S-CHH.PE.
Q2IRT9_RHOP2/49-200-------------------DADK.V-ALG---RMLFGDSILSRT....-------------...RAIACT-S-CHD.LA.
A3XAJ8_9RHOB/31-209-------------------PLGL.E-KLG---EALFHDENLSMN....-------------...RTQSCA-S-CHS.PA.
A3P679_BURP0/161-346-------------------DPAL.A-ALG---KRVFFDPALSEP....-------------...RGTSCA-S-CHD.PG.
Q0F3R5_9PROT/49-201-------------------TPAK.V-ELG---KQLYLDPALSKS....-------------...GNISCN-S-CHN.LG.
Q2BPT8_9GAMM/97-252-------------------TPAK.I-ELG---KKLFFDKNLSAD....-------------...RSLSCA-S-CHALEA.
A6AZ99_VIBPA/42-192-------------------DVTL.A-RIG---WHLFRDPNLSSN....-------------...GKVSCE-S-CHN.LQ.
A5UZD3_ROSS1/64-224-------------------PRAM.I-ELG---RWLFYDRRLSAN....-------------...ERIACA-T-CHR.QE.
A3EU40_9BACT/46-198-------------------TKDK.I-ALG---KKLFFDPRLSVN....-------------...GSISCA-F-CHV.PT.
Q60BZ4_METCA/291-445-------------------TPAK.I-ALG---RKLFYDRRLSLN....-------------...QTFSCA-M-CHI.PE.
Q28L23_JANSC/50-267-------------------SEAL.F-ALG---RDLFFDPILSGN....-------------...RNISCG-T-CHD.PA.
A1ZIW5_9BACT/23-173-------------------SNQG.I-SLG---RRLFFDPILSKD....-------------...SSIACG-S-CHH.PS.
A8EVL6_ARCB4/21-201-------------------DMKK.E-DLG---RILFFDVNLSKN....-------------...RTQSCA-T-CHN.PN.
A6E9K8_9SPHI/43-196-------------------TLEG.I-ELG---RKLFYDVRLSGS....-------------...NRISCA-S-CHR.QD.
A6GDF5_9DELT/70-296-------------------RPEL.V-ELG---RALFHDKILSGS....-------------...HDVSCG-T-CHN.PT.
MAUG_PARDP/27-206-------------------DDAL.A-ALG---AQLFVDPALSRN....-------------...ATQSCA-T-CHD.PA.
Q26B23_FLABB/305-451-------------------DNSQ.I-ELG---KRLFHDTNLSTG....-------------...GAISCA-T-CHI.EK.
Q8XRW3_RALSO/38-214-------------------LSPM.A-QVG---KAIFFDPALSAS....-------------...GKQSCA-S-CHD.PA.
Q3J7P6_NITOC/62-215-------------------PPER.V-SLG---KRLFFDPRLSAD....-------------...GMISCA-T-CHR.PA.
Q3IJA1_PSEHT/69-222-------------------SAAK.M-RLG---EQLFNDPKLSRS....-------------...GQVACA-S-CHD.RD.
Q1CW97_MYXXD/58-212-------------------LARA.E-ALG---DVLFHDSGLSRC....-------------...GTVSCA-S-CH..GG.
Q72TP5_LEPIC/49-197-------------------NKDK.V-ELG---KLLYFDKRLSLK....-------------...GDTNCA-I-CH..SV.
A4C4S6_9GAMM/59-282-------------------SDPI.A-QLG---KKLFFTKNLGGN....-------------...QTAACA-S-CHH.PL.
Q7P1B3_CHRVO/44-196-------------------TPAK.A-ALG---EKLFFDARLSRN....-------------...NRIACA-S-CHD.PA.
Q4KBF2_PSEF5/51-202-------------------DPQR.V-ELG---RQLFNEPRLSQD....-------------...HSLSCA-S-CHR.LD.
Q5LL75_SILPO/53-202-------------------TPQQ.I-DLG---RYLFFDPILSSG....-------------...GDLSCA-S-CHD.PA.
A2TWF3_9FLAO/304-456-------------------TATQ.I-ALG---KKLFFDDKLSAN....-------------...GTMACA-T-CHV.PE.
Q17ZF1_HELAH/64-218-------------------TPAQ.V-ELG---KMLYFDPRISTS....-------------...YLVSCN-T-CHN.LG.
Q607J0_METCA/30-226-------------------LTPG.E-LLG---KALFFDPSLSTP....-------------...PGQSCA-D-CHD.PK.
Q1NTA5_9DELT/76-227-------------------ERDK.A-RLG---QDLFSDPILSLD....-------------...RTVSCA-S-CHD.LD.
B1KFB6_SHEWM/53-205-------------------TSEK.I-ALG---KMLFFDPRLSGD....-------------...SNMSCA-T-CHN.PM.
B1KCX7_SHEWM/52-211-------------------SQAK.V-ELG---RYLFYDKALSAN....-------------...QTQSCA-S-CHI.QS.
Q89U67_BRAJA/52-204-------------------TVPK.A-ALG---ERLFFDALLSKS....-------------...RTRSCA-T-CHN.PS.
A9BZD0_DELAS/66-225-------------------TAEK.A-ELG---RFLFYDRRLSGN....-------------...GTQACA-S-CHI.QS.
A6ELS0_9BACT/56-210-------------------TEEG.I-ALG---KRLFYDTRLSLD....-------------...NSISCA-S-CHK.PQ.
A6CFU9_9PLAN/55-206-------------------TVEK.I-ALG---KQLYFDKRLSRD....-------------...NTISCA-S-CHS.PV.
Q6LRX8_PHOPR/43-267-------------------LTYL.E-EMG---KRLFFE.KISLS....-------------...RNMSCS-T-CHT.AD.

PF07635

A3HTU3_9BACT/51-114--------------------------------------------------------------------CF-A-CH-----
A3I118_9BACT/44-102--------------------------------------------------------------------CI-S-CH-----
A3ZLZ4_9PLAN/50-109--------------------------------------------------------------------CY-E-CH-----
A3ZMN5_9PLAN/39-92--------------------------------------------------------------------CL-K-CH-----
A3ZMT3_9PLAN/37-98--------------------------------------------------------------------CF-A-CH-----
A3ZN17_9PLAN/43-103--------------------------------------------------------------------CF-H-CH-----
A3ZPP8_9PLAN/38-93--------------------------------------------------------------------CF-H-CH-----
A3ZQC7_9PLAN/440-498--------------------------------------------------------------------CF-R-CH-----
A3ZR06_9PLAN/44-104--------------------------------------------------------------------CS-E-CH-----
A3ZR51_9PLAN/42-99--------------------------------------------------------------------CF-S-CH-----
A3ZT41_9PLAN/44-99--------------------------------------------------------------------CF-F-CH-----
A3ZUT4_9PLAN/48-105--------------------------------------------------------------------CL-A-CH-----
A3ZV10_9PLAN/45-100--------------------------------------------------------------------CY-T-CH-----
A3ZVC0_9PLAN/58-116--------------------------------------------------------------------CI-D-CH-----
A3ZW90_9PLAN/38-95--------------------------------------------------------------------CA-G-CH-----
A3ZWB8_9PLAN/50-104--------------------------------------------------------------------CS-T-CH-----
A3ZX73_9PLAN/28-83--------------------------------------------------------------------CF-Q-CH-----
A3ZYK0_9PLAN/49-110--------------------------------------------------------------------CF-A-CH-----
A3ZYU8_9PLAN/40-98--------------------------------------------------------------------CQ-G-CH-----
A4A0H7_9PLAN/47-103--------------------------------------------------------------------CF-E-CH-----
A4A1D3_9PLAN/53-112--------------------------------------------------------------------CY-S-CH-----
A4A1F2_9PLAN/45-92--------------------------------------------------------------------CI-R-CH-----
A4AN48_MARSH/194-253--------------------------------------------------------------------CY-Q-CH-----
A4ANE2_MARSH/5-66--------------------------------------------------------------------CY-L-CH-----
A4AUD4_MARSH/59-122--------------------------------------------------------------------CY-T-CH-----
A4AVR7_MARSH/60-123--------------------------------------------------------------------CF-K-CH-----
A4GIC2_9BACT/10-57--------------------------------------------------------------------CY-E-CH-----
A6BYQ2_9PLAN/45-102--------------------------------------------------------------------CL-G-CH-----
A6BZQ8_9PLAN/61-119--------------------------------------------------------------------CY-D-CH-----
A6C0V1_9PLAN/46-101--------------------------------------------------------------------CL-H-CH-----
A6C0V3_9PLAN/50-106--------------------------------------------------------------------CL-E-CH-----
A6C253_9PLAN/40-94--------------------------------------------------------------------CV-A-CH-----
A6C2C1_9PLAN/47-102--------------------------------------------------------------------CF-D-CH-----
A6C3K8_9PLAN/50-108--------------------------------------------------------------------CY-S-CH-----
A6C3N6_9PLAN/40-98--------------------------------------------------------------------CY-E-CH-----
A6C4F3_9PLAN/58-119--------------------------------------------------------------------CF-H-CH-----
A6C550_9PLAN/57-115--------------------------------------------------------------------CY-E-CH-----
A6C5R3_9PLAN/48-105--------------------------------------------------------------------CY-D-CH-----
A6C5R9_9PLAN/53-113--------------------------------------------------------------------CY-D-CH-----
A6C5S7_9PLAN/325-383--------------------------------------------------------------------CF-N-CH-----
A6C5W3_9PLAN/52-111--------------------------------------------------------------------CA-D-CH-----
A6C5W8_9PLAN/40-100--------------------------------------------------------------------CF-H-CH-----
A6C622_9PLAN/59-115--------------------------------------------------------------------CQ-D-CH-----
A6C6I6_9PLAN/53-108--------------------------------------------------------------------CF-F-CH-----
A6C6P1_9PLAN/45-102--------------------------------------------------------------------CE-G-CH-----
A6C707_9PLAN/40-97--------------------------------------------------------------------CF-A-CH-----
A6C7F0_9PLAN/56-114--------------------------------------------------------------------CY-E-CH-----
A6C7K1_9PLAN/611-669--------------------------------------------------------------------CF-R-CH-----
A6C7M1_9PLAN/51-111--------------------------------------------------------------------CY-E-CH-----
A6C7N1_9PLAN/54-114--------------------------------------------------------------------CL-H-CH-----
A6C812_9PLAN/61-120--------------------------------------------------------------------CL-S-CH-----
A6C929_9PLAN/45-102--------------------------------------------------------------------CY-D-CH-----
A6C976_9PLAN/50-110--------------------------------------------------------------------CF-S-CH-----
A6C9B1_9PLAN/15-74--------------------------------------------------------------------CF-H-CH-----
A6C9P5_9PLAN/51-105--------------------------------------------------------------------CL-D-CH-----
A6CA77_9PLAN/47-103--------------------------------------------------------------------CW-S-CH-----
A6CAH7_9PLAN/56-117--------------------------------------------------------------------CL-G-CH-----
A6CAJ5_9PLAN/47-107--------------------------------------------------------------------CF-Q-CH-----
A6CBB4_9PLAN/40-94--------------------------------------------------------------------CL-S-CH-----
A6CBB4_9PLAN/139-193--------------------------------------------------------------------CV-V-CH-----
A6CBL4_9PLAN/65-123--------------------------------------------------------------------CH-A-CH-----
A6CBW0_9PLAN/43-100--------------------------------------------------------------------CF-A-CH-----
A6CD10_9PLAN/48-105--------------------------------------------------------------------CF-A-CH-----
A6CD54_9PLAN/60-118--------------------------------------------------------------------CY-S-CH-----
A6CD74_9PLAN/45-105--------------------------------------------------------------------CF-Q-CH-----
A6CE68_9PLAN/33-92--------------------------------------------------------------------CY-S-CH-----
A6CEL5_9PLAN/57-116--------------------------------------------------------------------CQ-D-CH-----
A6CFD0_9PLAN/52-109--------------------------------------------------------------------CY-E-CH-----
A6CGM6_9PLAN/53-112--------------------------------------------------------------------CF-G-CH-----
A6DFA4_9BACT/35-98--------------------------------------------------------------------CF-H-CH-----
A6DFA7_9BACT/32-95--------------------------------------------------------------------CF-H-CH-----
A6DGI5_9BACT/49-112--------------------------------------------------------------------CF-H-CH-----
A6DGX0_9BACT/52-122--------------------------------------------------------------------CY-H-CH-----
A6DHV4_9BACT/41-111--------------------------------------------------------------------CF-N-CH-----
A6DI37_9BACT/32-90--------------------------------------------------------------------CE-S-CH-----
A6DJ39_9BACT/57-117--------------------------------------------------------------------CI-K-CH-----
A6DKV0_9BACT/48-111--------------------------------------------------------------------CF-H-CH-----
A6DLB5_9BACT/38-96--------------------------------------------------------------------CY-R-CH-----
A6DNW9_9BACT/37-95--------------------------------------------------------------------CS-E-CH-----
A6DP48_9BACT/33-92--------------------------------------------------------------------CI-K-CH-----
A6DRU3_9BACT/38-108--------------------------------------------------------------------CY-A-CH-----
A6DSN3_9BACT/36-92--------------------------------------------------------------------CF-A-CH-----
Q01SA1_SOLUE/36-93--------------------------------------------------------------------CV-V-CH-----
Q01T04_SOLUE/35-89--------------------------------------------------------------------CF-A-CH-----
Q01TA8_SOLUE/38-98--------------------------------------------------------------------CY-G-CH-----
Q01Z91_SOLUE/33-90--------------------------------------------------------------------CY-P-CH-----
Q01ZJ6_SOLUE/36-90--------------------------------------------------------------------CF-T-CH-----
Q02A24_SOLUE/42-96--------------------------------------------------------------------CF-G-CH-----
Q02AF0_SOLUE/46-106--------------------------------------------------------------------CF-T-CH-----
Q02AQ9_SOLUE/48-104--------------------------------------------------------------------CY-S-CH-----
Q15XP5_PSEA6/55-117--------------------------------------------------------------------CY-L-CH-----
Q6SI19_9BACT/67-123--------------------------------------------------------------------CW-S-CH-----
Q7UDW3_RHOBA/42-94--------------------------------------------------------------------CV-A-CH-----
Q7UEL0_RHOBA/42-101--------------------------------------------------------------------CL-E-CH-----
Q7UFP2_RHOBA/55-111--------------------------------------------------------------------CF-A-CH-----
Q7UGA7_RHOBA/63-110--------------------------------------------------------------------CI-D-CH-----
Q7UGC1_RHOBA/103-163--------------------------------------------------------------------CF-H-CH-----
Q7UGF7_RHOBA/41-98--------------------------------------------------------------------CT-G-CH-----
Q7UGR4_RHOBA/53-99--------------------------------------------------------------------CS-E-CH-----
Q7UH44_RHOBA/41-89--------------------------------------------------------------------CF-D-CH-----
Q7UH72_RHOBA/60-118--------------------------------------------------------------------CH-E-CH-----
Q7UHK6_RHOBA/101-159--------------------------------------------------------------------CF-E-CH-----
Q7UIF4_RHOBA/87-145--------------------------------------------------------------------CG-A-CH-----
Q7UIH1_RHOBA/55-102--------------------------------------------------------------------CL-E-CH-----
Q7UJ37_RHOBA/52-108--------------------------------------------------------------------CF-L-CH-----
Q7UJ53_RHOBA/68-113--------------------------------------------------------------------CF-A-CH-----
Q7UJ65_RHOBA/61-123--------------------------------------------------------------------CL-G-CH-----
Q7UJH8_RHOBA/111-158--------------------------------------------------------------------CV-D-CH-----
Q7UKM7_RHOBA/187-247--------------------------------------------------------------------CF-H-CH-----
Q7UKQ6_RHOBA/43-90--------------------------------------------------------------------CI-D-CH-----
Q7UKX0_RHOBA/43-92--------------------------------------------------------------------CY-F-CH-----
Q7ULB8_RHOBA/63-119--------------------------------------------------------------------CV-A-CH-----
Q7ULJ5_RHOBA/82-135--------------------------------------------------------------------CL-E-CH-----
Q7UM61_RHOBA/92-148--------------------------------------------------------------------CT-S-CH-----
Q7UN57_RHOBA/80-138--------------------------------------------------------------------CY-E-CH-----
Q7UP09_RHOBA/72-127--------------------------------------------------------------------CF-H-CH-----
Q7UPC3_RHOBA/72-119--------------------------------------------------------------------CY-D-CH-----
Q7UPJ6_RHOBA/57-104--------------------------------------------------------------------CI-D-CH-----
Q7UQ28_RHOBA/63-123--------------------------------------------------------------------CY-E-CH-----
Q7UQA7_RHOBA/309-363--------------------------------------------------------------------CL-E-CH-----
Q7UQJ4_RHOBA/66-125--------------------------------------------------------------------CY-S-CH-----
Q7UQW0_RHOBA/87-145--------------------------------------------------------------------CY-E-CH-----
Q7UR32_RHOBA/62-120--------------------------------------------------------------------CL-N-CH-----
Q7URV8_RHOBA/55-114--------------------------------------------------------------------CV-Y-CH-----
Q7US10_RHOBA/125-181--------------------------------------------------------------------CI-Q-CH-----
Q7USY1_RHOBA/92-151--------------------------------------------------------------------CL-G-CH-----
Q7UTM0_RHOBA/601-659--------------------------------------------------------------------CF-R-CH-----
Q7UUL3_RHOBA/116-163--------------------------------------------------------------------CI-D-CH-----
Q7UUV9_RHOBA/53-98--------------------------------------------------------------------CI-D-CH-----
Q7UV66_RHOBA/143-201--------------------------------------------------------------------CY-E-CH-----
Q7UVE2_RHOBA/77-133--------------------------------------------------------------------CV-A-CH-----
Q7UVE4_RHOBA/90-150--------------------------------------------------------------------CF-H-CH-----
Q7UW71_RHOBA/71-130--------------------------------------------------------------------CF-G-CH-----
Q7UY38_RHOBA/55-113--------------------------------------------------------------------CY-E-CH-----
Q7UYC9_RHOBA/78-136--------------------------------------------------------------------CF-A-CH-----
Q7UYG9_RHOBA/121-173--------------------------------------------------------------------CH-R-CH-----
Q7UYH7_RHOBA/577-628--------------------------------------------------------------------CL-D-CH-----
Q7UYJ9_RHOBA/45-104--------------------------------------------------------------------CI-D-CH-----
Q7UYR6_RHOBA/54-108--------------------------------------------------------------------CF-A-CH-----
Q7UYT2_RHOBA/60-107--------------------------------------------------------------------CR-D-CH-----
Q7UZ36_RHOBA/89-145--------------------------------------------------------------------CY-F-CH-----

PF06537

Q09ED4_STIAD/244-768YNYSNEPVHLFKQMATNLAPVNAQPFVEG---RRLHHTDFGTGAHSESGNPVFTAQQNKLGPAYIARSCI-S-CHPHNGR
A9L399_SHEB9/43-541FDAGNSG.HGFSTPSVNLTATELALHMAG---DKFFETSFTTAPNAEH......PELDGLGPVFNNANCN-A-CHQRDGR
Q12RB3_SHEDO/50-548FDAGNSG.HGFSTPAPNLGAAELAQHLEG---DANFEMSFTTAPNAAH......PELDGLGPVFNNADCN-S-CHQRDGR
A3QAQ1_SHELP/45-543FDASSSG.HGYSTPALNLNQTQLAQHLSG---DLNFETAFTTAPNEEH......PELDGLGPVFNNADCN-S-CHQRDGR
Q488R9_COLP3/44-538VSASDSG.HGFSTPMPNLTTEQLTKHLAG---DAHFETAFTTAPNSEH......PELDGLGPVFNNQDCN-S-CHQRDGR
A8H0B2_SHEPA/53-551FDASESG.HGFSTPAPNLSDEELALHLEG---DLSFETAFTTAPNSAH......PELDGLGPVFNNADCN-S-CHQRDGR

PF00034

A3HYX9_9BACT/875-956------------K------EA------E---------A-----S------------------------------------
A3HZ82_9BACT/43-133------------R------LD------T---------K-----L------------------------------------
C1DG42_AZOVD/275-353------------Q------PT------G---------E-----G------------------------------------
B7WXJ0_COMTE/360-430------------G------TA------I---------Q-----Q------------------------------------
B9CBC2_9BURK/27-112------------G------AK------L---------N-----Q------------------------------------
A9AXG3_HERA2/43-143------------G------LA------G---------E-----G------------------------------------
C1DFA7_AZOVD/306-383------------S------AT------P---------S-----S------------------------------------
A8LM31_DINSH/328-405------------A------RE------P---------L-----W------------------------------------
B0T7F6_CAUSK/26-116------------T------AT------G---------K-----G------------------------------------
B2JCS4_BURP8/352-440------------G------EH------G---------E-----G------------------------------------
B5EHP5_GEOBB/212-284------------G------EE------L---------K-----G------------------------------------
B8G4P7_CHLAD/50-144------------T------TS------K---------E-----V------------------------------------
B1ZB08_METPB/335-412------------A------AE------P---------V-----W------------------------------------
B1KHG1_SHEWM/32-108------------G------ND------G---------S-----S------------------------------------
A9VUA5_BACWK/254-346------------A------VG------S---------N-----D------------------------------------
A8LFE5_FRASN/80-157------------G------LN------A---------Q-----G------------------------------------
B7L1L9_METC4/220-312------------N------AG------S---------K-----V------------------------------------
F2G8F3_ALTMD/346-423------------S------RT------P---------T-----D------------------------------------
B3EQ05_CHLPB/58-152------------S------MR------P---------P-----A------------------------------------
B0T8R9_CAUSK/311-388------------A------AV------P---------T-----H------------------------------------
A8ZSU7_DESOH/195-276------------D------AN------V---------I-----E------------------------------------
A8LLC8_DINSH/31-128------------G------AQ------L---------E-----G------------------------------------
A3NRU4_BURP0/284-372------------A------VR------G---------T-----G------------------------------------
Q88K14_PSEPK/301-386------------R------WD------G---------T-----G------------------------------------
A4TY13_9PROT/152-228------------A------RD------G---------L-----G------------------------------------
A1BJ75_CHLPD/29-111------------K------DG------I---------M-----G------------------------------------
A3J8G6_9ALTE/27-106------------G------QN------G---------I-----A------------------------------------
A1WG03_VEREI/332-402------------G------AQ------.---------.-----.------------------------------------
A4XW00_PSEMY/347-424------------S------AS------P---------T-----S------------------------------------
Q39AI6_BURS3/179-260------------G------PG------G---------L-----G------------------------------------
A1B9M0_PARDP/46-156------------Q------IG------A---------L-----P------------------------------------
Q39YV3_GEOMG/27-115------------T------VG------G---------G-----D------------------------------------
A7BUA8_9GAMM/389-471------------G------KE------A---------Q-----T------------------------------------
A3QA98_SHELP/222-305------------G------EN------G---------E-----G------------------------------------
A2SE78_METPP/627-702------------S------AG------A---------V-----S------------------------------------
A4JP31_BURVG/324-409------------Q------MQ------G---------K-----G------------------------------------
Q4ZHS4_9BACT/51-134------------G------KD------G---------K-----A------------------------------------
Q30UG6_SULDN/232-306------------G------ED------G---------K-----G------------------------------------
Q8PDT1_XANCP/89-171------------T------TG------V---------G-----K------------------------------------
A1WG32_VEREI/45-122------------M------AD------G---------K-----G------------------------------------
A5EDI9_BRASB/315-392------------A------TE------P---------V-----W------------------------------------
Q1YG19_MOBAS/332-409------------A------DE------P---------L-----W------------------------------------
Q2Y5C4_NITMU/429-515------------G------LQ------G---------K-----G------------------------------------
Q0B3A9_BURCM/317-403------------G------PA------A---------P-----M------------------------------------
A3STM9_9RHOB/325-402------------A------AE------P---------A-----W------------------------------------
Q31AG8_PROM9/56-128------------G------IT------A---------R-----G------------------------------------
Q082F6_SHEFN/243-322------------G------MD------A---------K-----G------------------------------------
Q12DL3_POLSJ/329-399------------G------EQ------.---------.-----.------------------------------------
A1SVU2_PSYIN/325-409------------Y------SS------D---------Q-----L------------------------------------
A0RN17_CAMFF/82-164------------G------DK------G---------T-----S------------------------------------
A1ZL74_9BACT/89-171------------G------AT------G---------K-----G------------------------------------
Q9A473_CAUCR/33-122------------A------VS------D---------L-----K------------------------------------
C550A_CYACA/53-150------------V------GG------I---------T-----K------------------------------------
A1TL76_ACIAC/329-399------------G------EQ------.---------.-----.------------------------------------
A5FYU3_ACICJ/37-115------------M------TN------L---------S-----G------------------------------------
A6F0E0_9ALTE/24-101------------G------QG------G---------A-----K------------------------------------
A4BD02_9GAMM/317-394------------A------TT------P---------S-----S------------------------------------
A0Y0T7_9GAMM/320-397------------S------ET------P---------T-----S------------------------------------
A6FFR6_9GAMM/239-315------------G------AD------L---------S-----G------------------------------------
Q0HNQ4_SHESM/21-99------------S------MG------V---------A-----G------------------------------------
A1VJ52_POLNA/329-399------------N------AQ------.---------.-----.------------------------------------
A4VP34_PSEU5/326-403------------S------AN------P---------S-----S------------------------------------
Q0EVT7_9PROT/77-155------------G------SG------G---------Q-----G------------------------------------
A7ZBK3_CAMC1/105-210------------G------IE------A---------A-----G------------------------------------
Q6SFP3_9BACT/26-105------------G------PA------G---------K-----G------------------------------------
A6Q6Z1_SULNB/20-100------------H------QT------A---------V-----A------------------------------------
Q04SS0_LEPBJ/86-170------------G------LT------G---------Q-----G------------------------------------
A5K1I5_PLAVS/17-115------------T------IN------K---------G-----G------------------------------------
A3TK92_9MICO/47-131------------G------VN------A---------E-----G------------------------------------
Q39TS3_GEOMG/180-272------------Q------ID------G---------Q-----G------------------------------------
Q8RMH3_9PROT/68-146------------G------HL------A---------E-----G------------------------------------
A6VC11_PSEA7/299-387------------G------GE------G---------E-----G------------------------------------
A5W506_PSEP1/78-158------------G------LE------A---------K-----S------------------------------------
A0M192_GRAFK/78-166------------K------PT------K---------K-----F------------------------------------
A7IKI0_XANP2/328-405------------A------SE------P---------L-----Y------------------------------------
A3K2E0_9RHOB/327-404------------A------AE------P---------G-----Y------------------------------------
Q2S8A0_HAHCH/192-278------------Q------IN------G---------Q-----G------------------------------------
Q13JV0_BURXL/306-383------------G------PD------L---------Q-----G------------------------------------
Q3SUK3_NITWN/142-233------------S------SG------G---------L-----G------------------------------------
A7HE13_ANADF/168-247------------A------LG------A---------E-----G------------------------------------
A4YQB5_BRASO/168-249------------G------LQ------L---------T-----G------------------------------------
A6Q697_SULNB/29-123------------G------KD------G---------K-----Q------------------------------------
A1SRC3_PSYIN/67-145------------A------TG------V---------L-----G------------------------------------
Q027S6_SOLUE/288-368------------Y------GG------T---------N-----G------------------------------------
A6FD45_9GAMM/307-378------------A------TS------G---------V-----.------------------------------------
Q28P34_JANSC/328-406------------A------RE------P---------V-----W------------------------------------
Q11EG2_MESSB/324-401------------A------AE------P---------G-----Y------------------------------------
A6D1T6_9VIBR/37-123------------G------SK------G---------H-----G------------------------------------
Q0KCW9_CUPNH/320-395------------A------EQ------P---------K-----.------------------------------------
Q31FA6_THICR/38-130------------G------EE------A---------Q-----G------------------------------------
A1K4P5_AZOSB/315-391------------A------AQ------P---------S-----W------------------------------------
Q2SWV4_BURTA/320-395------------S------AK------P---------T-----.------------------------------------
Q7MS60_WOLSU/370-444------------S------LE------K---------T-----G------------------------------------
A3NRU1_BURP0/368-455------------G------AD------G---------A-----G------------------------------------
Q1IUL0_KORVE/174-268------------G------PL------G---------R-----S------------------------------------
A1VKK0_POLNA/125-213------------G------AN------F---------S-----Q------------------------------------
CYC6_CYAME/23-100------------A------GG------N---------N-----V------------------------------------
A4TVI5_9PROT/25-101------------G------TD------G---------H-----S------------------------------------
Q2W8Y8_MAGSA/39-118------------G------EL------G---------N-----G------------------------------------
Q0JYV8_CUPNH/22-98------------G------AD------R---------L-----G------------------------------------
A3YDZ4_9GAMM/322-399------------A------AK------P---------T-----S------------------------------------
Q01VF3_SOLUE/20-94------------G------SD------G---------N-----G------------------------------------
A6DS70_9BACT/760-855------------S------LD------G---------S-----Q------------------------------------
A3PPU8_RHOS1/325-402------------A------AE------P---------G-----W------------------------------------
A5V793_SPHWW/210-289------------G------DQ------G---------H-----G------------------------------------
Q2KU03_BORA1/330-418------------R------TD------G---------K-----G------------------------------------
O67504_AQUAE/17-104------------Q------AN------V---------D-----T------------------------------------
A5V688_SPHWW/48-125------------G------AD------M---------T-----G------------------------------------
A2WG67_9BURK/51-122------------T------AT------G---------G-----G------------------------------------
A6CZ52_9VIBR/337-414------------S------AT------P---------T-----H------------------------------------
CY553_BACPA/21-92------------G------GD------L---------T-----G------------------------------------
A6DJL4_9BACT/1100-1184------------G------ED------F---------A-----G------------------------------------
A1SUP1_PSYIN/38-121------------G------ID------G---------Q-----G------------------------------------
Q7UVI8_RHOBA/1468-1558------------Q------VA------G---------K-----G------------------------------------
A6EYI6_9ALTE/46-122------------G------LD------G---------I-----A------------------------------------
A3JCN8_9ALTE/330-406------------S------WD------P---------T-----S------------------------------------
A6FWD1_9RHOB/160-234------------Q------SD------G---------N-----D------------------------------------
Q7TU05_RHOBA/860-991------------R------LE------D---------R-----G------------------------------------
Q2CDA3_9RHOB/327-404------------A------RE------P---------V-----W------------------------------------
Q0A972_ALHEH/46-123------------G------VE------G---------R-----R------------------------------------
Q6LKC1_PHOPR/276-367------------S------LN------G---------N-----P------------------------------------
A7GN62_BACCN/180-253------------G------DN------L---------Q-----G------------------------------------
A3EV82_9BACT/32-116------------G------VD------G---------R-----G------------------------------------
A6GFL8_9DELT/29-119------------G------ED------G---------S-----G------------------------------------
A6DKH0_9BACT/26-110------------A------PN------G---------G-----G------------------------------------
QCRC_COREF/69-147------------G------MN------L---------Q-----G------------------------------------
Q01PC8_SOLUE/140-223------------G------PD------G---------R-----G------------------------------------
QCRC_COREF/179-255------------N------FT------G---------R-----G------------------------------------
Q15T42_PSEA6/326-403------------S------AK------P---------T-----D------------------------------------
A6Q613_NITSB/296-399------------R------WK------G---------A-----E------------------------------------
Q7BPS0_CAMJU/19-100------------G------AN------A---------D-----K------------------------------------
CCOP_HELPX/207-288------------G------ND------G---------K-----G------------------------------------
Q054F0_LEPBL/30-116------------G------EA------A---------D-----G------------------------------------
Q8F0C5_LEPIN/50-137------------G------EK------G---------A-----G------------------------------------
A3RXZ0_RALSL/335-410------------S------AH------P---------T-----.------------------------------------
Q1YZR8_PHOPR/320-397------------S------AA------P---------T-----H------------------------------------
Q605U5_METCA/34-112------------D------HG------K---------D-----G------------------------------------
Q07QU5_RHOP5/38-117------------A------ID------H---------K-----S------------------------------------
Q2SN04_HAHCH/322-399------------A------AK------P---------T-----Q------------------------------------
Q98CI0_RHILO/338-415------------A------QE------P---------V-----Y------------------------------------
A6EZ12_9ALTE/336-412------------S------KQ------P---------E-----N------------------------------------
Q07M26_RHOP5/79-165------------G------EF------G---------Q-----G------------------------------------
A7Z6T4_BACA2/49-120------------G------EN------Y---------E-----G------------------------------------
Q8XPY3_RALSO/395-482------------Q------SN------G---------T-----G------------------------------------
A2SDV3_METPP/323-393------------N------AQ------.---------.-----.------------------------------------
A8EWF8_ARCB4/105-206------------S------IE------S---------K-----G------------------------------------
Q0AG80_NITEC/32-122------------G------AD------R---------D-----G------------------------------------
Q5HXC2_CAMJR/201-289------------G------ER------G---------L-----G------------------------------------
A0KNP1_AERHH/188-300------------G------VA------I---------G-----G------------------------------------
A3V1B1_9RHOB/326-403------------A------RE------P---------V-----W------------------------------------
A4ASX0_MARSH/13-99------------M------PN------G---------E-----G------------------------------------
A4VQ99_PSEU5/49-133------------S------LL------G---------E-----G------------------------------------
A7HD95_ANADF/221-299------------S------ED------G---------E-----G------------------------------------
A3RTX2_RALSL/32-112------------H------AD------T---------A-----P------------------------------------
Q0BSR0_GRABC/318-393------------S------AH------P---------T-----.------------------------------------
A5G2Z9_ACICJ/97-183------------G------GF------G---------E-----G------------------------------------
A4CGX1_ROBBH/51-134------------G------AK------G---------K-----G------------------------------------
Q1Q9F9_PSYCK/370-446------------A------AQ------P---------T-----Q------------------------------------
Q12E68_POLSJ/29-109------------G------IK------G---------Y-----Q------------------------------------
Q1Q1H2_9BACT/481-562------------P------IG------D---------K-----N------------------------------------
A1B8Y6_PARDP/329-406------------A------RE------P---------S-----Y------------------------------------
Q4ZVH0_PSEU2/347-424------------S------AT------P---------T-----S------------------------------------
Q6MR17_BDEBA/74-159------------G------NE------G---------K-----G------------------------------------
A3ERB9_9BACT/32-118------------G------MN------G---------D-----G------------------------------------
A5WG96_PSYWF/180-265------------G------ST------A---------Q-----G------------------------------------
Q89WT8_BRAJA/117-197------------T------DT------Y---------A-----G------------------------------------
Q9ZGF8_HELMO/122-196------------G------PN------G---------E-----G------------------------------------
Q87H21_VIBPA/33-131------------Q------FE------P---------N-----G------------------------------------
A4BKK2_9GAMM/119-205------------G------AF------A---------E-----G------------------------------------
Q9I3K0_PSEAE/342-419------------S------AK------P---------T-----S------------------------------------
A7GWI4_CAMC5/119-196------------G------IT------G---------D-----G------------------------------------
CY552_THIFE/53-134------------G------MT------G---------R-----D------------------------------------
Q01YB9_SOLUE/516-640------------S------MG------E---------G-----A------------------------------------
Q0FDI4_9RHOB/329-406------------A------RE------P---------V-----W------------------------------------
Q026L5_SOLUE/59-136------------G------SD------A---------R-----G------------------------------------
A6GWL6_FLAPJ/97-178------------G------EK------G---------D-----G------------------------------------
Q1CR68_HELPH/53-154------------G------IK------S---------Q-----N------------------------------------
Q1GLL6_SILST/329-406------------A------RE------P---------Y-----Y------------------------------------
Q83NH4_TROW8/156-232------------N------VA------G---------A-----G------------------------------------
Q747D3_GEOSL/26-104------------K------VK------G---------A-----G------------------------------------
A3K6G3_9RHOB/40-143------------H------AP------D---------S-----E------------------------------------
Q2G890_NOVAD/22-106------------A------AG------P---------G-----H------------------------------------
A6V5K9_PSEA7/33-113------------D------DD------G---------N-----G------------------------------------
Q1N1Q9_9GAMM/312-388------------A------QE------P---------S-----H------------------------------------
A6D951_9VIBR/49-129------------G------PR------G---------N-----G------------------------------------
Q7ULK4_RHOBA/434-513------------S------AD------P---------A-----S------------------------------------
A5W1M7_PSEP1/806-907------------T------VG------G---------G-----K------------------------------------
A0NUW4_9RHOB/329-406------------A------RE------P---------F-----Y------------------------------------
Q396U3_BURS3/183-262------------G------GI------D---------H-----Q------------------------------------
A0YHE8_9GAMM/124-210------------G------GQ------G---------Q-----G------------------------------------
Q7MS08_WOLSU/78-158------------G------VN------A---------E-----.------------------------------------
A6SZ46_JANMA/140-225------------G------AT------G---------R-----G------------------------------------
Q1V738_VIBAL/19-98------------G------QD------G---------M-----G------------------------------------
A6DG27_9BACT/331-408------------G------DT------S---------K-----E------------------------------------
A6DK49_9BACT/120-205------------G------DS------A---------Q-----G------------------------------------
A8FUN2_SHESH/19-100------------G------EN------G---------V-----S------------------------------------
A4A383_9GAMM/316-393------------A------AN------P---------S-----D------------------------------------
Q30P22_SULDN/23-102------------G------PN------L---------E-----G------------------------------------
A3Z583_9SYNE/27-105------------P------HG------G---------N-----I------------------------------------
Q3KFL1_PSEPF/354-431------------S------AK------P---------T-----S------------------------------------
A5EUE1_BRASB/49-132------------G------ER------G---------A-----G------------------------------------
Q5LV33_SILPO/328-405------------A------RE------P---------V-----W------------------------------------
A5FJF1_FLAJ1/53-143------------K------LD------A---------K-----S------------------------------------
Q7VG08_HELHP/17-100------------G------PD------A---------K-----K------------------------------------
Q92UI9_RHIME/326-403------------A------AE------P---------A-----Y------------------------------------
Q1IN35_KORVE/21-100------------G------AD------G---------A-----G------------------------------------
Q1D0X4_MYXXD/25-115------------.------TV------G---------E-----G------------------------------------
Q2IUP4_RHOP2/578-669------------G------QN------G---------E-----G------------------------------------
Q926I1_RHIME/24-103------------A------VL------T---------G-----Q------------------------------------
A6SVA7_JANMA/330-407------------A------AQ------P---------T-----H------------------------------------
Q160K5_ROSDO/328-405------------A------RE------P---------V-----W------------------------------------
A3WTY2_9BRAD/141-221------------G------EK------G---------E-----G------------------------------------
Q02BQ9_SOLUE/215-307------------R------ED------N---------T-----G------------------------------------
A3U177_9RHOB/111-198------------G------AG------A---------G-----G------------------------------------
Q11G47_MESSB/29-108------------A------VS------R---------D-----D------------------------------------
Q820S2_NITEU/123-211------------S------PN------G---------Q-----G------------------------------------
A5FXN1_ACICJ/320-395------------S------AH------P---------T-----.------------------------------------
Q3BPP2_XANC5/46-123------------M------PA------G---------R-----G------------------------------------
Q748S1_GEOSL/109-203------------R------LL------T---------A-----G------------------------------------
Q47UL0_COLP3/316-393------------S------EA------P---------T-----D------------------------------------
Q5LL42_SILPO/110-197------------R------VD------L---------A-----G------------------------------------
Q1ID54_PSEE4/176-262------------R------FN------G---------A-----G------------------------------------
Q92VB2_RHIME/326-403------------A------RE------P---------G-----W------------------------------------
A3YPD8_CAMJU/105-208------------G------VK------E---------D-----G------------------------------------
A6DPC1_9BACT/868-958------------G------TD------A---------K-----G------------------------------------
Q1MG21_RHIL3/50-141------------H------DA------G---------N-----V------------------------------------
A3Z568_9SYNE/45-127------------M------GG------G---------N-----V------------------------------------
A1VA32_DESVV/62-133------------T------AG------T---------T-----G------------------------------------
Q1LCS0_RALME/54-132------------A------LD------T---------V-----K------------------------------------
Q0G167_9RHIZ/327-404------------A------RE------P---------L-----W------------------------------------
A6Q8D3_SULNB/21-109------------N------IM------G---------M-----K------------------------------------
Q1DDJ6_MYXXD/17-102------------G------GD------G---------K-----A------------------------------------
Q1V125_PELUQ/30-111------------G------VS------G---------K-----A------------------------------------
A3VMV9_9RHOB/328-405------------A------RE------P---------G-----W------------------------------------
Q2VZK6_MAGSA/61-138------------G------VL------R---------K-----G------------------------------------
A6DM55_9BACT/1011-1091------------T------RP------E---------E-----T------------------------------------
Q11XM0_CYTH3/38-121------------V------SD------Y---------T-----L------------------------------------

PF13442

A0K328_BURCH/75-153------------G......TG......A---------A.....G------------------------------------
A0K328_BURCH/215-290------------A......AG......V---------L.....G------------------------------------
B1JSZ9_BURCC/75-153------------G......TG......A---------A.....G------------------------------------
B1JSZ9_BURCC/215-290------------A......AG......V---------L.....G------------------------------------
Q1BRF5_BURCA/75-153------------G......TG......A---------A.....G------------------------------------
Q1BRF5_BURCA/215-290------------A......AG......V---------L.....G------------------------------------
A2VU33_9BURK/75-153------------G......TG......A---------A.....G------------------------------------
A2VU33_9BURK/215-290------------A......AG......V---------L.....G------------------------------------
B4EF33_BURCJ/75-153------------G......TG......A---------A.....G------------------------------------
B4EF33_BURCJ/215-290------------A......AG......V---------L.....G------------------------------------
C5A8N1_BURGB/76-154------------G......TG......A---------A.....G------------------------------------
C5A8N1_BURGB/220-295------------A......TG......V---------L.....G------------------------------------
A3MQQ2_BURM7/51-129------------G......TG......A---------A.....G------------------------------------
A3MQQ2_BURM7/195-270------------A......TG......V---------L.....N------------------------------------
A4LN20_BURPE/51-129------------G......TG......A---------A.....G------------------------------------
A4LN20_BURPE/195-270------------A......TG......V---------L.....N------------------------------------
A5J5U3_BURML/51-129------------G......TG......A---------A.....G------------------------------------
A5J5U3_BURML/195-270------------A......TG......V---------L.....N------------------------------------
A5XRS8_BURML/51-129------------G......TG......A---------A.....G------------------------------------
A5XRS8_BURML/195-270------------A......TG......V---------L.....N------------------------------------
A8EGW2_BURPE/51-129------------G......TG......A---------A.....G------------------------------------
A8EGW2_BURPE/195-270------------A......TG......V---------L.....N------------------------------------
A8KF95_BURPE/51-129------------G......TG......A---------A.....G------------------------------------
A8KF95_BURPE/195-270------------A......TG......V---------L.....N------------------------------------
B2H915_BURPE/51-129------------G......TG......A---------A.....G------------------------------------
B2H915_BURPE/195-270------------A......TG......V---------L.....N------------------------------------
C0XW58_BURPE/51-129------------G......TG......A---------A.....G------------------------------------
C0XW58_BURPE/195-270------------A......TG......V---------L.....N------------------------------------
C4KXQ3_BURPE/51-129------------G......TG......A---------A.....G------------------------------------
C4KXQ3_BURPE/195-270------------A......TG......V---------L.....N------------------------------------
C5ZFF6_BURPE/51-129------------G......TG......A---------A.....G------------------------------------
C5ZFF6_BURPE/195-270------------A......TG......V---------L.....N------------------------------------
C6U0W3_BURPE/51-129------------G......TG......A---------A.....G------------------------------------
C6U0W3_BURPE/195-270------------A......TG......V---------L.....N------------------------------------
B7CVC2_BURPE/51-129------------G......TG......A---------A.....G------------------------------------
B7CVC2_BURPE/195-270------------A......TG......V---------L.....N------------------------------------
A1V8M8_BURMS/75-153------------G......TG......A---------A.....G------------------------------------
A1V8M8_BURMS/219-294------------A......TG......V---------L.....N------------------------------------
A2S6E6_BURM9/75-153------------G......TG......A---------A.....G------------------------------------
A2S6E6_BURM9/219-294------------A......TG......V---------L.....N------------------------------------
A3P0T7_BURP0/75-153------------G......TG......A---------A.....G------------------------------------
A3P0T7_BURP0/219-294------------A......TG......V---------L.....N------------------------------------
A5TIA4_BURML/75-153------------G......TG......A---------A.....G------------------------------------
A5TIA4_BURML/219-294------------A......TG......V---------L.....N------------------------------------
A9K196_BURML/75-153------------G......TG......A---------A.....G------------------------------------
A9K196_BURML/219-294------------A......TG......V---------L.....N------------------------------------
B1HAC1_BURPE/75-153------------G......TG......A---------A.....G------------------------------------
B1HAC1_BURPE/219-294------------A......TG......V---------L.....N------------------------------------
C5NBD6_BURML/75-153------------G......TG......A---------A.....G------------------------------------
C5NBD6_BURML/219-294------------A......TG......V---------L.....N------------------------------------
Q3JY17_BURP1/75-153------------G......TG......A---------A.....G------------------------------------
Q3JY17_BURP1/219-294------------A......TG......V---------L.....N------------------------------------
Q62FM1_BURMA/75-153------------G......TG......A---------A.....G------------------------------------
Q62FM1_BURMA/219-294------------A......TG......V---------L.....N------------------------------------
Q63PM0_BURPS/75-153------------G......TG......A---------A.....G------------------------------------
Q63PM0_BURPS/219-294------------A......TG......V---------L.....N------------------------------------
Q2Y8Z1_NITMU/39-105------------E.......G......Q---------V.....G------------------------------------
A3NEY9_BURP6/75-153------------G......TG......A---------A.....G------------------------------------
A3NEY9_BURP6/219-294------------A......TG......V---------L.....N------------------------------------
Q13SS3_BURXL/75-153------------A......SG......A---------A.....G------------------------------------
Q13SS3_BURXL/218-293------------A.......A......G---------VL...NA------------------------------------
Q2STJ4_BURTA/75-153------------G......TG......A---------A.....G------------------------------------
Q2STJ4_BURTA/220-295------------A......TG......V---------L.....N------------------------------------
B2T7I2_BURPP/75-153------------A......SG......A---------A.....G------------------------------------
B2T7I2_BURPP/220-295------------A.......A......G---------VL...NA------------------------------------
A1TJ54_ACIAC/76-151------------A......TG......A---------A.....G------------------------------------
A1TJ54_ACIAC/219-294------------A......AG......V---------A.....G------------------------------------
A3RTQ6_RALSL/78-156------------A......AG......V---------A.....G------------------------------------
A3RTQ6_RALSL/215-290------------A......AG......V---------A.....G------------------------------------
B5SK16_RALSL/78-156------------A......AG......V---------A.....G------------------------------------
B5SK16_RALSL/215-290------------A......AG......V---------A.....G------------------------------------
B5RZE1_RALSL/78-156------------A......AG......V---------A.....G------------------------------------
B5RZE1_RALSL/215-290------------A......AG......V---------A.....G------------------------------------
B2UFB9_RALPJ/78-156------------A......AG......V---------A.....G------------------------------------
B2UFB9_RALPJ/217-292------------A......AG......V---------A.....G------------------------------------
A5II84_LEGPC/352-429------------Q......DN......K---------M.....G------------------------------------
Q5WSR4_LEGPL/352-429------------Q......DN......K---------M.....G------------------------------------
Q5X0Y3_LEGPA/352-429------------Q......DN......K---------M.....G------------------------------------
Q5ZRI3_LEGPH/352-429------------K......DN......K---------M.....G------------------------------------
C6BG20_RALP1/78-156------------A......AG......V---------A.....G------------------------------------
C6BG20_RALP1/218-293------------A......AG......V---------A.....G------------------------------------
F0Q4K8_ACIAP/76-151------------A......TG......A---------A.....G------------------------------------
F0Q4K8_ACIAP/219-294------------A......AG......V---------A.....G------------------------------------
Q8XUU9_RALSO/78-156------------A......AG......V---------A.....G------------------------------------
Q8XUU9_RALSO/214-289------------A......AG......V---------A.....G------------------------------------
A1VIW0_POLNA/80-155------------G......TG......A---------A.....G------------------------------------
A1VIW0_POLNA/213-288------------G......AG......V---------A.....G------------------------------------
B3EB84_GEOLS/352-421------------T......VG......G---------F.....N------------------------------------
B3EB84_GEOLS/436-501------------S......AE......S---------I.....K------------------------------------
B3EB84_GEOLS/512-577------------S......LD......Q---------V.....K------------------------------------
Q12GP1_POLSJ/80-155------------A......AG......A---------A.....G------------------------------------
Q12GP1_POLSJ/208-283------------A......AG......V---------A.....N------------------------------------
Q0AFI2_NITEC/44-110------------D.......T......G---------I.....G------------------------------------
C6WTZ7_METML/211-287------------A......AG......L---------M.....N------------------------------------
Q82WE5_NITEU/35-101------------E.......A......N---------V.....G------------------------------------
A1VU04_POLNA/31-97------------E.......A......G---------T.....G------------------------------------
C6JUF9_PSEFL/35-101------------E.......N......K---------V.....G------------------------------------
C6JUF4_PSEFL/35-101------------E.......N......K---------V.....G------------------------------------
A3X1R5_9BRAD/34-102------------AP.....NV......G---------V.....G------------------------------------
Q8KP42_PSEME/35-101------------E.......K......Q---------V.....G------------------------------------
B1ZRL1_OPITP/34-103------------GG.....EA......G---------L.....G------------------------------------
D0J2D1_COMT2/26-92------------E.......A......G---------I.....G------------------------------------
C8N731_9GAMM/102-179------------G......SG......L---------M.....G------------------------------------
Q3J8I0_NITOC/35-102------------E......GG......I---------I.....G------------------------------------
Q2G427_NOVAD/30-96------------G.......R......N---------V.....G------------------------------------
Q2G7T2_NOVAD/31-97------------G.......H......N---------V.....G------------------------------------
C5BNC6_TERTT/224-296------------G......AM......G---------E.....G------------------------------------
A3ZY52_9PLAN/1756-1835------------RMT...EPD.......---------Q.....E------------------------------------
Q0F3R3_9PROT/335-410------------ASQ...LMG......A---------P.....G------------------------------------
A4XEH7_NOVAD/35-101------------L.......T......G---------V.....G------------------------------------
A0RN00_CAMFF/205-280------------G......DD......G---------K.....G------------------------------------
C4ZM80_THASP/26-92------------D.......K......G---------V.....G------------------------------------
B4AKK7_BACPU/178-249------------GDN..MQGG......A---------A.....G------------------------------------
A8FEI8_BACP2/178-249------------GDN..MQGG......A---------A.....G------------------------------------
Q89GY7_BRAJA/40-112------------GP....NLM......N---------S.....G------------------------------------
Q7UL60_RHOBA/230-305------------GT.....VD......E---------P.....G------------------------------------
Q1NJ28_9DELT/211-281------------GEN...LTG......G---------F.....A------------------------------------
B5EHM0_GEOBB/34-103------------GG.....EK......G---------L.....G------------------------------------
Q1K0H2_DESAC/350-419------------T......LD......G---------I.....N------------------------------------
Q8EQC7_OCEIH/180-249------------GGE...LEG......G---------A.....G------------------------------------
Q11NE0_CYTH3/154-225------------GK.....DGRL..QLN---------G.....A------------------------------------
A5WD19_PSYWF/136-211------------G......SG......V---------L.....G------------------------------------
D0VWQ8_ALCXX/7-82------------A......SG.....VA---------N.....A------------------------------------
D6XW92_BACIE/51-118------------GEN...LDG......G---------V.....G------------------------------------
P95552_PSEST/32-106------------GVN...RLG......G---------A.....G------------------------------------
A4BV27_9GAMM/79-153------------T......AQ.....FM---------N.....A------------------------------------
C5BK07_TERTT/25-100------------GAD...MNQ......G---------L.....G------------------------------------
A2SCL5_METPP/36-107------------GV....NMV......S---------N.....G------------------------------------
C5CN75_VARPS/92-168------------GA.....PG......I---------P.....G------------------------------------
Q5WGR1_BACSK/178-250------------GDQ..MTGG......A---------G.....A------------------------------------
A2SLQ6_METPP/84-159------------A......AG......V---------A.....G------------------------------------
D2R455_PIRSD/244-319------------GT.....KE......R---------P.....G------------------------------------
B2A017_OPITP/98-173------------SAK...LTG......G---------I.....G------------------------------------
A4B9A6_9GAMM/56-132------------A......SG......A---------L.....N------------------------------------
B3T2H7_9ZZZZ/21-95------------TLQAAGSAG......N---------I.....G------------------------------------
A5IAJ3_LEGPC/61-138------------K......DG......L---------A.....G------------------------------------
Q1QDL1_PSYCK/145-220------------A......SG......L---------L.....G------------------------------------
D3G0J4_BACPE/179-251------------GDT..MAGG......S---------G.....G------------------------------------
B6EP52_ALISL/55-131------------S......TG......A---------A.....G------------------------------------
A0RBX8_BACAH/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B0AM87_BACAN/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B0Q297_BACAN/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B0QG91_BACAN/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B1EYK7_BACAN/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B1GFJ8_BACAN/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B1UMW0_BACAN/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B3JAQ8_BACAN/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B3YRF3_BACCE/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B3Z7J4_BACCE/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B3ZTY1_BACCE/178-249------------GDN..LQGG......A---------A.....A------------------------------------
B7JH09_BACC0/178-249------------GDN..LQGG......A---------A.....A------------------------------------
C1EN21_BACC3/178-249------------GDN..LQGG......A---------A.....A------------------------------------
C2NF71_BACCE/178-249------------GDN..LQGG......A---------A.....A------------------------------------
C2TEA4_BACCE/178-249------------GDN..LQGG......A---------A.....A------------------------------------
C3EZD1_BACT