Sequence alignment for CL0320

PF13670

Q0BXA6_HYPNA/7-95--------------------------------------------------------------------------------
Q0BXA5_HYPNA/6-84--------------------------------------------------------------------------------
Q0BY17_HYPNA/6-92--------------------------------------------------------------------------------
A4VHV2_PSEU5/30-109--------------------------------------------------------------------------------
A4XVH9_PSEMY/6-85--------------------------------------------------------------------------------
Q1QMT6_NITHX/5-85--------------------------------------------------------------------------------
B8EKV5_METSB/3-81--------------------------------------------------------------------------------
Q5LX53_RUEPO/50-129--------------------------------------------------------------------------------
B8IVF4_METNO/5-90--------------------------------------------------------------------------------
B3PI60_CELJU/2-85--------------------------------------------------------------------------------
C1DNM7_AZOVD/2-85--------------------------------------------------------------------------------
Q1LBN9_CUPMC/3-85--------------------------------------------------------------------------------
Q8XWW7_RALSO/3-85--------------------------------------------------------------------------------
A1K227_AZOSB/5-88--------------------------------------------------------------------------------
Q5P431_AROAE/5-88--------------------------------------------------------------------------------
Q5P432_AROAE/18-101--------------------------------------------------------------------------------
D0KWU4_HALNC/5-88--------------------------------------------------------------------------------
B0SVT0_CAUSK/5-90--------------------------------------------------------------------------------
A7IQ54_XANP2/6-90--------------------------------------------------------------------------------
B1Y4P0_LEPCP/3-85--------------------------------------------------------------------------------
B8IVE9_METNO/4-91--------------------------------------------------------------------------------
Q1QM54_NITHX/4-90--------------------------------------------------------------------------------
A1B769_PARDP/5-86--------------------------------------------------------------------------------
A1B772_PARDP/5-86--------------------------------------------------------------------------------
B6JDT2_OLICO/6-87--------------------------------------------------------------------------------
A1U059_MARHV/5-86--------------------------------------------------------------------------------
A1SRM1_PSYIN/5-86--------------------------------------------------------------------------------
B9K2Y3_AGRVS/4-85--------------------------------------------------------------------------------
A7IKT6_XANP2/6-87--------------------------------------------------------------------------------
A1B771_PARDP/5-86--------------------------------------------------------------------------------
Q0S079_RHOJR/10-95--------------------------------------------------------------------------------
A8LNS6_DINSH/4-81--------------------------------------------------------------------------------
B1M6N2_METRJ/3-84--------------------------------------------------------------------------------
A7HVA0_PARL1/7-87--------------------------------------------------------------------------------
C5AT97_METEA/7-83--------------------------------------------------------------------------------
G2J097_PSEUL/8-86--------------------------------------------------------------------------------
Q2YRI6_BRUA2/6-85--------------------------------------------------------------------------------
Q3J9Y2_NITOC/7-84--------------------------------------------------------------------------------
Q5F6R1_NEIG1/7-90--------------------------------------------------------------------------------

PF03413

Q9K7V1_BACHD/28-100--------------------------------------------------------------------------------
Q816W8_BACCR/30-100--------------------------------------------------------------------------------
Q8EP78_OCEIH/29-101--------------------------------------------------------------------------------
U5LGT7_9BACI/29-101--------------------------------------------------------------------------------
Q03RI8_LACBA/34-106--------------------------------------------------------------------------------
Q03GC8_PEDPA/34-106--------------------------------------------------------------------------------
Q82ZL5_ENTFA/37-109--------------------------------------------------------------------------------
Q5HNG3_STAEQ/33-102--------------------------------------------------------------------------------
B1YKF6_EXIS2/28-100--------------------------------------------------------------------------------
Q181V6_PEPD6/408-465--------------------------------------------------------------------------------
Q181V6_PEPD6/490-547--------------------------------------------------------------------------------
Q8TTA4_METAC/138-199--------------------------------------------------------------------------------
A8MEK6_ALKOO/172-230--------------------------------------------------------------------------------
A8MEK6_ALKOO/94-155--------------------------------------------------------------------------------
A8MEK5_ALKOO/294-355--------------------------------------------------------------------------------
Q5WGU9_BACSK/378-439--------------------------------------------------------------------------------
YPEB_BACSU/377-438--------------------------------------------------------------------------------
A8FEM8_BACP2/376-437--------------------------------------------------------------------------------
YPEB_BACHD/374-435--------------------------------------------------------------------------------
YPEB_OCEIH/373-434--------------------------------------------------------------------------------
A3DI39_CLOTH/391-452--------------------------------------------------------------------------------
A0Q324_CLONN/379-440--------------------------------------------------------------------------------
Q2RM03_MOOTA/386-447--------------------------------------------------------------------------------
A8MIH5_ALKOO/376-437--------------------------------------------------------------------------------
Q12WY7_METBU/120-186--------------------------------------------------------------------------------
Q6W134_SINFN/286-345--------------------------------------------------------------------------------
Q8ELE8_OCEIH/178-237--------------------------------------------------------------------------------
Q9KBS1_BACHD/273-331--------------------------------------------------------------------------------
Q5KVG3_GEOKA/282-341--------------------------------------------------------------------------------
Q9KE75_BACHD/288-347--------------------------------------------------------------------------------
A9B7B4_HERA2/311-370--------------------------------------------------------------------------------
Q3SKV5_THIDA/55-112--------------------------------------------------------------------------------
Q3JE96_NITOC/270-334--------------------------------------------------------------------------------
Q9A7E1_CAUCR/252-316--------------------------------------------------------------------------------
Q020P0_SOLUE/231-293--------------------------------------------------------------------------------
Q82WV7_NITEU/279-343--------------------------------------------------------------------------------
A4FCJ5_SACEN/417-477--------------------------------------------------------------------------------
Q9KE75_BACHD/74-132--------------------------------------------------------------------------------
Q5WLI5_BACSK/75-133--------------------------------------------------------------------------------
Q47KW9_THEFY/83-144--------------------------------------------------------------------------------
Q825U8_STRAW/84-147--------------------------------------------------------------------------------
A0R6J4_MYCS2/78-140--------------------------------------------------------------------------------
A1T724_MYCVP/79-141--------------------------------------------------------------------------------
Q6NKB0_CORDI/71-132--------------------------------------------------------------------------------
Q9KBS1_BACHD/60-118--------------------------------------------------------------------------------
Q8P606_XANCP/82-140--------------------------------------------------------------------------------
Q7CY41_AGRFC/75-132--------------------------------------------------------------------------------
Q2RPK6_RHORT/75-133--------------------------------------------------------------------------------
Q6W134_SINFN/75-133--------------------------------------------------------------------------------
Q1R143_CHRSD/68-125--------------------------------------------------------------------------------
Q7NVU2_CHRVO/229-292--------------------------------------------------------------------------------
Q8A623_BACTN/26-84--------------------------------------------------------------------------------
Q884E8_PSESM/67-126--------------------------------------------------------------------------------
Q9I178_PSEAE/60-119--------------------------------------------------------------------------------
Q1LJM8_CUPMC/260-324--------------------------------------------------------------------------------
Q82P05_STRAW/125-192--------------------------------------------------------------------------------
Q9L1F9_STRCO/146-216--------------------------------------------------------------------------------
Q82BN5_STRAW/115-187--------------------------------------------------------------------------------
Q9L2B8_STRCO/168-232--------------------------------------------------------------------------------
Q0AQU2_MARMM/109-177--------------------------------------------------------------------------------
E0THY6_PARBH/109-174--------------------------------------------------------------------------------
Q63MT4_BURPS/165-233--------------------------------------------------------------------------------
Q03XK6_LEUMM/140-199--------------------------------------------------------------------------------
Q9KC80_BACHD/94-154--------------------------------------------------------------------------------
Q5KXX8_GEOKA/94-154--------------------------------------------------------------------------------
Q1WU38_LACS1/104-164--------------------------------------------------------------------------------
A8FEH2_BACP2/99-159--------------------------------------------------------------------------------
Q6ANJ0_DESPS/50-117--------------------------------------------------------------------------------
Q8R5X9_FUSNN/10-69--------------------------------------------------------------------------------
Q8E0L6_STRA5/117-180--------------------------------------------------------------------------------
Q8RBF9_CALS4/109-184--------------------------------------------------------------------------------
B8I195_CLOCE/108-180--------------------------------------------------------------------------------
Q1D8Q2_MYXXD/168-239--------------------------------------------------------------------------------
Q81MX8_BACAN/145-217--------------------------------------------------------------------------------
Q5ZRA6_LEGPH/16-86--------------------------------------------------------------------------------
Q87I51_VIBPA/131-204--------------------------------------------------------------------------------
Q2FUX4_STAA8/118-192--------------------------------------------------------------------------------
PRTA_LISMO/121-194--------------------------------------------------------------------------------
Q97G52_CLOAB/161-230--------------------------------------------------------------------------------
Q97G51_CLOAB/153-222--------------------------------------------------------------------------------
Q97GS5_CLOAB/161-230--------------------------------------------------------------------------------
A5I1S2_CLOBH/148-212--------------------------------------------------------------------------------
Q81R73_BACAN/122-192--------------------------------------------------------------------------------
Q815U2_BACCR/146-219--------------------------------------------------------------------------------
NPRB_BACSU/145-217--------------------------------------------------------------------------------
Q8ESH1_OCEIH/143-217--------------------------------------------------------------------------------
B1YFR1_EXIS2/113-183--------------------------------------------------------------------------------
Q81I21_BACCR/151-220--------------------------------------------------------------------------------
Q8DVN1_STRMU/57-120--------------------------------------------------------------------------------
Q99YI6_STRP1/81-143--------------------------------------------------------------------------------
R6P3S5_9CLOT/179-241--------------------------------------------------------------------------------
Q8ESN0_OCEIH/32-90--------------------------------------------------------------------------------
A5G759_GEOUR/48-108--------------------------------------------------------------------------------
O27358_METTH/81-143--------------------------------------------------------------------------------
Q8ERG4_OCEIH/132-194--------------------------------------------------------------------------------
Q5WLC0_BACSK/58-117--------------------------------------------------------------------------------
Q82ZK1_ENTFA/63-122--------------------------------------------------------------------------------
Q5FIK1_LACAC/43-101--------------------------------------------------------------------------------
Q5FIK0_LACAC/62-121--------------------------------------------------------------------------------
Q74JH3_LACJO/49-108--------------------------------------------------------------------------------
Q8ERG4_OCEIH/56-114--------------------------------------------------------------------------------
Q186H8_PEPD6/62-121--------------------------------------------------------------------------------
Q9KFU6_BACHD/49-108--------------------------------------------------------------------------------
Q8ESM9_OCEIH/39-97--------------------------------------------------------------------------------
Q81R43_BACAN/43-101--------------------------------------------------------------------------------
Q8ELD0_OCEIH/32-90--------------------------------------------------------------------------------
Q4K807_PSEF5/38-102--------------------------------------------------------------------------------
C1DJ09_AZOVD/39-99--------------------------------------------------------------------------------
A4XTT8_PSEMY/39-99--------------------------------------------------------------------------------
Q0VNT9_ALCBS/52-112--------------------------------------------------------------------------------
Q0S7B7_RHOJR/138-198--------------------------------------------------------------------------------
Q5F637_NEIG1/47-105--------------------------------------------------------------------------------
Q1ARP9_RUBXD/67-126--------------------------------------------------------------------------------
Q9L126_STRCO/188-249--------------------------------------------------------------------------------
Q9L2B8_STRCO/83-152--------------------------------------------------------------------------------
A9C057_DELAS/120-179--------------------------------------------------------------------------------
Q8RD03_CALS4/115-173--------------------------------------------------------------------------------
A8FCD9_BACP2/110-169--------------------------------------------------------------------------------
YKOJ_BACSU/108-167--------------------------------------------------------------------------------
Q8ESM9_OCEIH/119-177--------------------------------------------------------------------------------
YKOI_BACSU/164-223--------------------------------------------------------------------------------
A8FCD8_BACP2/167-226--------------------------------------------------------------------------------
Q5WKR9_BACSK/175-233--------------------------------------------------------------------------------
Q9KFU7_BACHD/111-170--------------------------------------------------------------------------------
Q9KFU6_BACHD/130-191--------------------------------------------------------------------------------
Q5WKR8_BACSK/122-181--------------------------------------------------------------------------------
Q38Z32_LACSS/130-188--------------------------------------------------------------------------------
Q2G105_STAA8/129-187--------------------------------------------------------------------------------
Q5FIK0_LACAC/141-199--------------------------------------------------------------------------------
Q82ZK1_ENTFA/146-205--------------------------------------------------------------------------------
Q74LX8_LACJO/141-200--------------------------------------------------------------------------------
Q5FIK1_LACAC/119-178--------------------------------------------------------------------------------
Q74JH3_LACJO/126-184--------------------------------------------------------------------------------
Q186H8_PEPD6/144-202--------------------------------------------------------------------------------
Q5WLC0_BACSK/141-199--------------------------------------------------------------------------------
Q8R5X9_FUSNN/83-142--------------------------------------------------------------------------------
Q81R44_BACAN/99-158--------------------------------------------------------------------------------
Q0VNU0_ALCBS/63-123--------------------------------------------------------------------------------
Q3JBE9_NITOC/51-111--------------------------------------------------------------------------------
A4XTT9_PSEMY/41-101--------------------------------------------------------------------------------
Q0BZN8_HYPNA/53-112--------------------------------------------------------------------------------
A1B2L4_PARDP/40-99--------------------------------------------------------------------------------
Q9A8Q0_CAUCR/73-133--------------------------------------------------------------------------------
Q988S6_RHILO/46-105--------------------------------------------------------------------------------
A4YY21_BRASO/40-99--------------------------------------------------------------------------------
Q2RPG4_RHORT/72-131--------------------------------------------------------------------------------
V6F502_9PROT/38-95--------------------------------------------------------------------------------
Q0AR59_MARMM/55-114--------------------------------------------------------------------------------
A8LN27_DINSH/31-89--------------------------------------------------------------------------------
A5VEY7_SPHWW/24-82--------------------------------------------------------------------------------
Q8KFX7_CHLTE/45-103--------------------------------------------------------------------------------
B4E758_BURCJ/39-96--------------------------------------------------------------------------------
A9C057_DELAS/43-102--------------------------------------------------------------------------------
E0TIH6_PARBH/43-102--------------------------------------------------------------------------------
B0UCU3_METS4/66-129--------------------------------------------------------------------------------
A3QGG2_SHELP/47-105--------------------------------------------------------------------------------
Q7P204_CHRVO/118-188--------------------------------------------------------------------------------
ELAS_PSEAE/122-192--------------------------------------------------------------------------------
A1S2N2_SHEAM/113-188--------------------------------------------------------------------------------
Q2SJ90_HAHCH/129-208--------------------------------------------------------------------------------
B7VN56_VIBTL/116-190--------------------------------------------------------------------------------
F7YSQ2_VIBA7/118-194--------------------------------------------------------------------------------
HAPT_VIBCH/116-190--------------------------------------------------------------------------------
Q5ZZJ1_LEGPH/124-199--------------------------------------------------------------------------------
A1S4V2_SHEAM/92-162--------------------------------------------------------------------------------
Q211C9_RHOPB/96-155--------------------------------------------------------------------------------
Q89L62_BRADU/85-144--------------------------------------------------------------------------------
A4YNR6_BRASO/46-105--------------------------------------------------------------------------------
Q6N7G2_RHOPA/56-115--------------------------------------------------------------------------------
Q1H2G7_METFK/106-166--------------------------------------------------------------------------------
A2SEW0_METPP/117-177--------------------------------------------------------------------------------
Q1H2G7_METFK/31-90--------------------------------------------------------------------------------
A5N159_CLOK5/17-76--------------------------------------------------------------------------------
Q8DWU2_STRA5/78-136--------------------------------------------------------------------------------

PF11396

A0M0Q0_GRAFK/54-143--------------------------------------------------------------------------------
A0M1R1_GRAFK/70-160--------------------------------------------------------------------------------
A5FIF1_FLAJ1/58-140--------------------------------------------------------------------------------
A5FNS8_FLAJ1/62-144--------------------------------------------------------------------------------
A6L337_BACV8/61-143--------------------------------------------------------------------------------
A6L4L1_BACV8/60-142--------------------------------------------------------------------------------
A6LDA3_PARD8/62-144--------------------------------------------------------------------------------
A6LDA4_PARD8/55-146--------------------------------------------------------------------------------
A6LDE6_PARD8/58-149--------------------------------------------------------------------------------
C0QVH4_BRAHW/54-141--------------------------------------------------------------------------------
C0QYD0_BRAHW/35-117--------------------------------------------------------------------------------
C0R146_BRAHW/63-147--------------------------------------------------------------------------------
C0R148_BRAHW/33-123--------------------------------------------------------------------------------
Q5L9Y2_BACFN/49-143--------------------------------------------------------------------------------
Q5LD45_BACFN/83-177--------------------------------------------------------------------------------
Q7MWB3_PORGI/60-142--------------------------------------------------------------------------------
Q7MWB4_PORGI/55-145--------------------------------------------------------------------------------
Q89YQ4_BACTN/58-150--------------------------------------------------------------------------------
Q89YQ5_BACTN/61-144--------------------------------------------------------------------------------
Q8A994_BACTN/60-142--------------------------------------------------------------------------------
Q8YLV6_NOSS1/61-150--------------------------------------------------------------------------------
C7M630_CAPOD/59-141--------------------------------------------------------------------------------
D6D2V5_9BACE/45-136--------------------------------------------------------------------------------
D6D5W5_9BACE/49-143--------------------------------------------------------------------------------
D6D6Q4_9BACE/56-146--------------------------------------------------------------------------------
Q0P802_CAMJE/53-133--------------------------------------------------------------------------------
Q0P9P8_CAMJE/51-132--------------------------------------------------------------------------------
Q5LBR7_BACFN/55-146--------------------------------------------------------------------------------
Q5LBR8_BACFN/60-141--------------------------------------------------------------------------------
Q5LG06_BACFN/60-151--------------------------------------------------------------------------------
Q5LG07_BACFN/61-143--------------------------------------------------------------------------------
Q5LIE1_BACFN/72-153--------------------------------------------------------------------------------
R5U7Q0_9BACE/57-144--------------------------------------------------------------------------------
R6WQR9_9PORP/57-147--------------------------------------------------------------------------------
R6X3F2_9PORP/60-141--------------------------------------------------------------------------------
R6XCT8_9PORP/59-150--------------------------------------------------------------------------------
R7EFG1_9BACE/61-142--------------------------------------------------------------------------------
R7EJJ2_9BACE/58-149--------------------------------------------------------------------------------
R7EKK7_9BACE/52-145--------------------------------------------------------------------------------
R7ELA9_9BACE/58-149--------------------------------------------------------------------------------
R7ERW1_9BACE/60-141--------------------------------------------------------------------------------
R7JJR5_9BACT/78-154--------------------------------------------------------------------------------

PF11399

K7AKJ7_9ALTE/17-119----------------------------------------------------------SGCVISVDGDG.KYGH....HS
F5Z4M1_ALTNA/22-120----------------------------------------------------------..LVISVYPDK.......PENM
E1SS82_FERBD/33-127----------------------------------------------------------APAT..............PDNM
Q8EGJ0_SHEON/23-131----------------------------------------------------------SGCVVNVGDGE..SGW..DRSE
A1S8B9_SHEAM/20-120----------------------------------------------------------VAVVAIGYEPT.......PENM
K7AKJ0_9ALTE/22-120----------------------------------------------------------..AVITFYPDT.......PKDM
A3QGB8_SHELP/19-122----------------------------------------------------------SGCVLNVGEGD..KGW..STGN
Q15QZ2_PSEA6/17-119----------------------------------------------------------SGCVISVDGDG.HDGY....QS
Q07ZE7_SHEFN/20-120----------------------------------------------------------VAVVIFVYEPQ.......PEDR
Q47YB6_COLP3/19-119----------------------------------------------------------SGCVIKINDDGMDHGF....VG
Q8EGQ0_SHEON/20-120----------------------------------------------------------VAVVVLVYEPT.......PDEM
D4ZHG3_SHEVD/20-120----------------------------------------------------------VAVVVLVYEPT.......PDEM
D4ZHN7_SHEVD/34-137----------------------------------------------------------SGCVLNIGDGE..SGW..HGQE
E1STL4_FERBD/20-123----------------------------------------------------------SGCVIAVGDK....GWDAQSSA
Q47YA7_COLP3/20-123----------------------------------------------------------VALVMTFYDDS.......PDQM
Q085F9_SHEFN/19-126----------------------------------------------------------SGCVISVGDHE..SG...KSAD
Q15QY7_PSEA6/21-120----------------------------------------------------------.AAVLLFYPDN.......AQDM
Q12P24_SHEDO/19-126----------------------------------------------------------SGCVLNVGEH....GS..ARNS
Q5QW11_IDILO/20-120----------------------------------------------------------VGAVLMLYQAD.......PADL
Q3ICC6_PSEHT/21-122----------------------------------------------------------.TLVIVFYKDD.......PQAM
G4QLZ6_GLANF/37-143----------------------------------------------------------SGCVISIDDNY.EDGYDVSSGV
Q12L38_SHEDO/26-125----------------------------------------------------------.AVMFSSYDPL.......PGEK
A3QGM5_SHELP/20-120----------------------------------------------------------VAVVVLVYEPT.......PDDM
A1S4M5_SHEAM/18-116----------------------------------------------------------.GCVVNVGDGV..SGY.....Q

PF04355

Q5NL78_ZYMMO/17-93--------------------------------------------------------------------------------
Q5LQJ9_RUEPO/35-111--------------------------------------------------------------------------------
Q1LSR9_BAUCH/37-105--------------------------------------------------------------------------------
Q1LBA9_CUPMC/75-149--------------------------------------------------------------------------------
A5WGN5_PSYWF/35-114--------------------------------------------------------------------------------
Q9CJV5_PASMU/34-104--------------------------------------------------------------------------------
BAME_PSYIN/35-104--------------------------------------------------------------------------------
Q220P9_RHOFT/38-108--------------------------------------------------------------------------------
BAME_NEIMB/36-106--------------------------------------------------------------------------------
Q5NEF6_FRATT/34-106--------------------------------------------------------------------------------
BAME_VIBF1/35-105--------------------------------------------------------------------------------
A6VMF3_ACTSZ/34-104--------------------------------------------------------------------------------
Q7VRQ4_BLOFL/39-110--------------------------------------------------------------------------------
BAME_NITEU/35-105--------------------------------------------------------------------------------
Q0C315_HYPNA/29-105--------------------------------------------------------------------------------
Q47XI1_COLP3/29-101--------------------------------------------------------------------------------
Q47HJ0_DECAR/36-107--------------------------------------------------------------------------------
Q5FUN3_GLUOX/45-121--------------------------------------------------------------------------------
Q2SMN2_HAHCH/93-162--------------------------------------------------------------------------------
Q0A7D7_ALKEH/37-107--------------------------------------------------------------------------------
A1AX05_RUTMC/37-107--------------------------------------------------------------------------------
Q3SSS7_NITWN/53-129--------------------------------------------------------------------------------
Q2RTT3_RHORT/36-112--------------------------------------------------------------------------------
Q2NRT5_SODGM/28-97--------------------------------------------------------------------------------
A4VII8_PSEU5/29-97--------------------------------------------------------------------------------
A7I1H3_CAMHC/52-124--------------------------------------------------------------------------------
Q604C4_METCA/51-121--------------------------------------------------------------------------------
B0UR41_METS4/34-110--------------------------------------------------------------------------------
Q15V54_PSEA6/31-104--------------------------------------------------------------------------------
Q31FS2_THICR/36-107--------------------------------------------------------------------------------
A1WGT8_VEREI/51-121--------------------------------------------------------------------------------
A4SVD7_POLSQ/67-138--------------------------------------------------------------------------------
Q2NRZ9_SODGM/35-105--------------------------------------------------------------------------------
A1WCQ4_ACISJ/49-119--------------------------------------------------------------------------------
Q1LMT9_CUPMC/71-142--------------------------------------------------------------------------------
Q6FDQ3_ACIAD/30-107--------------------------------------------------------------------------------
Q7CZT7_AGRFC/48-124--------------------------------------------------------------------------------
Q0K704_CUPNH/51-122--------------------------------------------------------------------------------
Q21H32_SACD2/36-106--------------------------------------------------------------------------------
Q83C32_COXBU/30-100--------------------------------------------------------------------------------
A8GGW6_SERP5/28-97--------------------------------------------------------------------------------
A5FV68_ACICJ/239-315--------------------------------------------------------------------------------
Q3SJS3_THIDA/32-102--------------------------------------------------------------------------------
A0KI84_AERHH/30-100--------------------------------------------------------------------------------
Q3IE33_PSEHT/35-105--------------------------------------------------------------------------------
A6W2D6_MARMS/31-103--------------------------------------------------------------------------------
Q2G501_NOVAD/31-107--------------------------------------------------------------------------------
A7HX93_PARL1/37-112--------------------------------------------------------------------------------
Q983A2_RHILO/103-179--------------------------------------------------------------------------------
Q7NX33_CHRVO/32-104--------------------------------------------------------------------------------
Q2YBT7_NITMU/31-101--------------------------------------------------------------------------------
A2SC95_METPP/48-118--------------------------------------------------------------------------------
A1K8N9_AZOSB/69-139--------------------------------------------------------------------------------
A7INK8_XANP2/42-117--------------------------------------------------------------------------------
Q1QSW6_CHRSD/33-103--------------------------------------------------------------------------------
Q1H393_METFK/54-124--------------------------------------------------------------------------------
A3MZE6_ACTP2/34-104--------------------------------------------------------------------------------
B0T0T5_CAUSK/29-105--------------------------------------------------------------------------------
A1WX37_HALHL/38-106--------------------------------------------------------------------------------
Q11J87_CHESB/48-124--------------------------------------------------------------------------------
A4XUA2_PSEMY/28-96--------------------------------------------------------------------------------
Q28RF7_JANSC/34-109--------------------------------------------------------------------------------
Q5QXM4_IDILO/32-102--------------------------------------------------------------------------------
BAME_BUCAI/32-101--------------------------------------------------------------------------------
Q0BTE4_GRABC/35-111--------------------------------------------------------------------------------
Q2NDV7_ERYLH/16-92--------------------------------------------------------------------------------
Q122Q0_POLSJ/29-99--------------------------------------------------------------------------------
Q3JBU9_NITOC/42-112--------------------------------------------------------------------------------
Q7VM11_HAEDU/34-104--------------------------------------------------------------------------------
Q6D4H9_PECAS/28-96--------------------------------------------------------------------------------
A5V7M5_SPHWW/32-109--------------------------------------------------------------------------------
Q1GPC4_SPHAL/37-113--------------------------------------------------------------------------------
Q0VSU2_ALCBS/35-105--------------------------------------------------------------------------------
B0UU40_HISS2/52-121--------------------------------------------------------------------------------
B0UV53_HISS2/34-103--------------------------------------------------------------------------------
B7VJW3_VIBTL/77-145--------------------------------------------------------------------------------
C1DFM7_AZOVD/35-101--------------------------------------------------------------------------------
D4Z6S0_SPHJU/63-138--------------------------------------------------------------------------------
M1FIJ3_9ALTE/29-96--------------------------------------------------------------------------------
M9X398_MANHA/34-103--------------------------------------------------------------------------------
BAME_VIBCH/35-104--------------------------------------------------------------------------------
BAME_HAEIN/34-103--------------------------------------------------------------------------------
Q2KA05_RHIEC/31-105--------------------------------------------------------------------------------
Q2YNC3_BRUA2/49-124--------------------------------------------------------------------------------
Q3J361_RHOS4/40-116--------------------------------------------------------------------------------
BAME_PSYA2/52-130--------------------------------------------------------------------------------
Q5ZYK0_LEGPH/42-110--------------------------------------------------------------------------------
Q63LV3_BURPS/48-120--------------------------------------------------------------------------------
Q63QT2_BURPS/54-121--------------------------------------------------------------------------------
Q6LUB1_PHOPR/34-102--------------------------------------------------------------------------------
Q79GM4_BORPE/42-111--------------------------------------------------------------------------------
BAME_YERPE/38-107--------------------------------------------------------------------------------
BAME_SALTY/35-104--------------------------------------------------------------------------------
Q87RX9_VIBPA/35-104--------------------------------------------------------------------------------
Q87VN2_PSESM/31-98--------------------------------------------------------------------------------
Q88DH0_PSEPK/30-95--------------------------------------------------------------------------------
Q88DT8_PSEPK/35-101--------------------------------------------------------------------------------
BAME_SHEON/38-105--------------------------------------------------------------------------------
BAME_XANCP/28-99--------------------------------------------------------------------------------
Q8XVT1_RALSO/61-130--------------------------------------------------------------------------------
Q92KF5_RHIME/42-116--------------------------------------------------------------------------------
Q9HUT7_PSEAE/31-97--------------------------------------------------------------------------------
Q9JXT1_NEIMB/52-133--------------------------------------------------------------------------------
Q9PB00_XYLFA/44-114--------------------------------------------------------------------------------
V6F1L4_9PROT/28-103--------------------------------------------------------------------------------

PF12978

Q8DTX1_STRMU/47-205ENLDFRLSFNKIKVTTDQNHFSGGTSIEQLKQWFG.DPNKSEQRNAGNITLDSYTWVKDGAVINAQLYKNSTVARSISNF
B9DSB0_STRU0/47-205SHQDKRLAFEKIKVATAQEQFKGGTSIEELKELFG.EPSSFEQKPAGNVTLDHYTWTFDRVSIQVNLFENSTIVKSITNF
G2SNY8_LACRR/70-224KNAELRKKFDAIVVGDLMSNGDGGTSLTDVEKPLG.KPVSTSTTNLQNVKVKDETWTKDGVTVTVQFNDDKTVSKDITGF
Q8DZF2_STRA5/47-206DHEELRLKFNKVKLGVKANNFKGGTSLAELKQLFGGEPNEKFDTPAGNVTLKGYRWNVDDISITIQLLNDSSIVRSISNF
Q99ZC4_STRP1/47-204.HQDKRANFEKIKLATVDSSFTGGTSLEELISLFG.EPSQHDPKTAGEVTIDAYTWQFDQVTLTVNLYQNSSIVKTISNF

PF07467

Q9KJ90_STREX/2-185--------------------------------------------------------VKARIARTGISLVAAAAAVVATTS
B5GLC0_STRC2/2-181--------------------------------------------------------VK.KTWRSALALTAAAGAVLATAT
BLIP_STRCL/10-200--------------------------------------------------------VR.RLGRAVVMAAAVGGLVLGSAG

PF14172

C0Z8F5_BREBN/45-177--------------------------------------------------------------------------------
W0EAP8_9FIRM/51-184--------------------------------------------------------------------------------
YJGB_BACSU/51-188--------------------------------------------------------------------------------
C0Z6K8_BREBN/118-238--------------------------------------------------------------------------------
D3E8N0_GEOS4/57-196--------------------------------------------------------------------------------
U5MR07_CLOSA/75-209--------------------------------------------------------------------------------
R4K5N0_CLOPA/85-219--------------------------------------------------------------------------------
C6D3T6_PAESJ/51-191--------------------------------------------------------------------------------
I3VRL4_THESW/85-217--------------------------------------------------------------------------------
C8WQ55_ALIAD/107-238--------------------------------------------------------------------------------
M1MNJ5_9CLOT/77-211--------------------------------------------------------------------------------
I4D7B6_DESAJ/531-665--------------------------------------------------------------------------------
F6DUI9_DESRL/67-201--------------------------------------------------------------------------------
Q8XI71_CLOPE/88-217--------------------------------------------------------------------------------
Q24YP2_DESHY/79-213--------------------------------------------------------------------------------
A6LYS0_CLOB8/79-210--------------------------------------------------------------------------------
Q81PC7_BACAN/76-203--------------------------------------------------------------------------------
G7M4A2_9CLOT/93-227--------------------------------------------------------------------------------
A8MGG8_ALKOO/77-218--------------------------------------------------------------------------------
A8FAZ3_BACP2/47-191--------------------------------------------------------------------------------
C0Z6K8_BREBN/268-401--------------------------------------------------------------------------------
J7J151_DESMD/62-207--------------------------------------------------------------------------------
X4Z8J4_9BACL/92-219--------------------------------------------------------------------------------

PF13670

Q0BXA6_HYPNA/7-95----ASLALLM-IAT--P-----------A...PLALADDDDGARRTSGSE----RAYTL..TRA--------DAVGIAR
Q0BXA5_HYPNA/6-84----AALIAIA-LAA--P-----------A...PLALA..........QGT----TGDLL..TRE--------QALEIAS
Q0BY17_HYPNA/6-92----TGLMALI-IVT--A-----------ALSPAPALA.....QRGDDRSF----AGFQV..SRA--------TAVDIAR
A4VHV2_PSEU5/30-109----LTAAFAV-AIL--G-----------S...GAAFA.........ADKP----GADWI..TLE--------QAVEKAK
A4XVH9_PSEMY/6-85----LTTLLAG-GLL--L-----------A...GNAMA..........DRP----GGDWI..SIE--------DALSKAR
Q1QMT6_NITHX/5-85----HVAVATM-MLV--L-----------A...ATSFA........YADQP----GSDWM..PAD--------QVIQKLM
B8EKV5_METSB/3-81----RTILLAS-VLV--A-----------A...SATFA........FGDTP----GPDWI..SKE--------ALIKKLE
Q5LX53_RUEPO/50-129----PFALIAA-LAL--A-----------A...SPVLA.......LDLTTD----TQLGS..TPD--------EIRTSLK
B8IVF4_METNO/5-90----IMASALL-ATG--L-----------A...VPAMAD....GLDHRCSP----VADGRIVAAS--------EVSKGLE
B3PI60_CELJU/2-85----RKLLFIA-LAS--F-----------S...SLAIA.....GPQCTETD----KSQWL..DQA--------KFQEDLK
C1DNM7_AZOVD/2-85----RKIILLG-LAL--A-----------S...PLALA.....GPRCSEAD----KAQWQ..DPT--------KFQEQLK
Q1LBN9_CUPMC/3-85----KIAAFLV-AGV--F-----------S...TAAFA.....GANCSKHP----KSEWM..PEA--------DAKAKIQ
Q8XWW7_RALSO/3-85----KLTLAVL-ATA--C-----------S...ASAFA.....SANCTAHP----KNEWM..PEA--------EAQAKIK
A1K227_AZOSB/5-88----SAFVVLA-ACT--L-----------S...TVALA.....GPQCTEAP----KSQWL..PEE--------AMKQKIS
Q5P431_AROAE/5-88----NALLAVA-GLT--L-----------S...AVAFA.....GPQCTDMP----KSDWM..SEE--------AMKQKIA
Q5P432_AROAE/18-101----HLIVAAS-SVL--M-----------G...TAAFA.....GPACTETP----ESSWM..PQT--------TMLRKLV
D0KWU4_HALNC/5-88----YFFIGLT-AAF--M-----------S...TAAQA.....GPQCTQEP----RSAWM..PAD--------KVLAKAT
B0SVT0_CAUSK/5-90----LISATIA-AAT--L-----------SIAGAAVAG......PKCTTEP----KSKWL..TEA--------QMKAKIA
A7IQ54_XANP2/6-90----LLTTAAG-LCL--L-----------S...SAALA.....SPTCTKEP----QEKWL..SEE--------TMKQKIA
B1Y4P0_LEPCP/3-85----TFAAAAA-LTL--I-----------A...SAAFA......GPTCNVP----EDKWM..KES--------DFKSRLE
B8IVE9_METNO/4-91----LTMIAAA-IAV--L-----------GG.VSAAQASS..LGRPCTTAP----QSQWL..PVE--------TLKAKAE
Q1QM54_NITHX/4-90----IAILTIA-AVT--L-----------G..AATAQAGS..LGKPCTSAS----EAQWL..PVE--------QLQAKVE
A1B769_PARDP/5-86----LTILTFL-VVL--P-----------S...GAALA......GDDCAVP----LADWQ..PRS--------AVVRLAE
A1B772_PARDP/5-86----LIAVAAL-AVL--P-----------A...AGALA......GDDCHVP----RGAWQ..PRE--------AVMQAAA
B6JDT2_OLICO/6-87----VAASLLF-ALA--G-----------S...GAAMA......DDDCNVP----MNQWQ..SRE--------AVQKSAE
A1U059_MARHV/5-86----PIILSLS-LLL--L-----------S...GTAVA......DDDCDDP----VASWQ..PRE--------NLREKLE
A1SRM1_PSYIN/5-86----GLKIFTV-LSL--C-----------S...AVAQA......EVECRDP----VDKWQ..PQQ--------QLRQRLE
B9K2Y3_AGRVS/4-85----VLIALSI-TLA--L-----------A...GPLLA......GEKCAVP----LKEWQ..PRE--------SLQRKLE
A7IKT6_XANP2/6-87----AATLVFA-VCL--G-----------A...GPAVA......DRACTVP----LADWQ..PRD--------ALQKKLE
A1B771_PARDP/5-86----LTATAFA-LAI--P-----------A...GAALA......DEKCNVP----TENMQ..SWE--------ALVQVTD
Q0S079_RHOJR/10-95----AAAVGVA-VAI--G-----------T...GVAVA.....SSGDQETP----ITGDA...LT--------KASAAAL
A8LNS6_DINSH/4-81----ILAFTAA-MVV--A-----------....STGFA...........SE----VDEAT...EM--------KIMAMLA
B1M6N2_METRJ/3-84----LTTTLLA-LTL--I-----------A...GSSLA.....ARADEKLP----PDQ.....QA--------KVEAMLK
A7HVA0_PARL1/7-87----AAALLLA-VPA--T-----------S...LPALA.......TDDRAP----TAEE....RE--------RIEEVLR
C5AT97_METEA/7-83----LAAATLA-TGL--L-----------A...ASAHA..........DTP----GKDWM..PID--------QVLTKLA
G2J097_PSEUL/8-86----....ALI-AAV--A-----------A...PAAFA.....AAKCEQHP----KEQWI..KEA--------DFKQKLV
Q2YRI6_BRUA2/6-85----..TAAAL-VAL--S-----------A...TGAMA.....QKTQCDAK----PLDEK..SID--------ALVQLSN
Q3J9Y2_NITOC/7-84----.ISIVSV-LTI--L-----------P...TMVLA.........GDKP----PKDSK..PLS--------EIVKSLE
Q5F6R1_NEIG1/7-90----....AAV-VSL--N-----------A...ATAFAGD..SAERQIYGD----PHFEQ..NRT--------KAVKMLE

PF03413

Q9K7V1_BACHD/28-100----KLSPERA.LKL--A...........KRTFAP.......NMNI....T....GS.WI--H..--------MIPETLE
Q816W8_BACCR/30-100----.ISSEKA.LKM--V...........KQALSH.......KGEI....T....GS.WV--H..--------MVPETFE
Q8EP78_OCEIH/29-101----KITPEKA.LNQ--A...........KEMFKR.......KGPI....S....GS.WI--Y..--------MKPEEIE
U5LGT7_9BACI/29-101----AVSPEKA.LDQ--A...........KAAFKK.......NGPI....S....GS.WI--H..--------MQPEPYE
Q03RI8_LACBA/34-106----RLNPDDI.LEQ--V...........KRQFRE.......ESPI....E....GA.WI--E..--------KHAVPFQ
Q03GC8_PEDPA/34-106----KVRPQSA.LAR--V...........RRSFED.......DGPI....E....GA.WI--E..--------SKPSPLN
Q82ZL5_ENTFA/37-109----TISADLV.LEN--V...........KAAFLK.......EGPI....E....GS.WI--E..--------FEKKPLR
Q5HNG3_STAEQ/33-102----LYNAELL.LNE--V...........KTYF..........REV....K....GS.YI--V..--------QEPIVLE
B1YKF6_EXIS2/28-100----QLSAEEA.LEI--T...........KRTFSA.......KGRV....Q....GA.WI--S..--------ATPEAYA
Q181V6_PEPD6/408-465----NISLDKA.KSI--A...........LDA.............V....P....NG.NL--I..--------YCKYD..
Q181V6_PEPD6/490-547----IISAEKA.KSI--M...........LDK.............V....P....GG.KI--V..--------KFKYD..
Q8TTA4_METAC/138-199----YIGEEKA.KSI--A...........LEK.............V....S....GATES--DIR--------LYLDYE.
A8MEK6_ALKOO/172-230----VISEEQA.KKI--A...........LEK.............I....N....GK.VI--K..--------IELEYD.
A8MEK6_ALKOO/94-155----LISKEEA.KKI--A...........IAL.............I....N....GE.II--K..--------VKLDNIK
A8MEK5_ALKOO/294-355----KISKEEA.IRI--S...........LSL............TK....G....GT.II--S..--------MELDIDD
Q5WGU9_BACSK/378-439----KLTKEEA.QAK--V...........NKH.............V....E....IQ.ED--H..--------LAVIEND
YPEB_BACSU/377-438----AITEAEA.KSK--L...........NKN.............V....Q....VR.ET--R..--------LALITNE
A8FEM8_BACP2/376-437----KISQKEA.KKT--L...........NQH.............V....K....IE.DT--H..--------VAIVQND
YPEB_BACHD/374-435----ELTADEA.RER--L...........NPR.............L....E....VM.ED--H..--------IALIQND
YPEB_OCEIH/373-434----KISEDEA.RDN--V...........NST.............V....D....IQ.ES--H..--------LAIIDNN
A3DI39_CLOTH/391-452----KLTLEEA.RSK--I...........SSR.............M....Q....VL.SS--G..--------LAIIPTD
A0Q324_CLONN/379-440----KVSKETA.MSK--I...........GKN.............L....K....VQ.ST--K..--------LAIIPTE
Q2RM03_MOOTA/386-447----KLTPEQA.RAK--I...........NPG.............I....K....VE.GV--R..--------LALIPLP
A8MIH5_ALKOO/376-437----AISEDDA.RER--L...........SSS.............V....T....EQ.SV--R..--------LAMIPIP
Q12WY7_METBU/120-186----PYSVDEA.MTK--A...........KEI.............A....N....TK.YP--D..--------GKIKS..
Q6W134_SINFN/286-345----PIGLDEA.VAT--F...........DRL.......................GLHHG--Y..--------TVAIPA.
Q8ELE8_OCEIH/178-237----PVSVDEV.VNI--A...........DQQ.......................EIYPT--Y..--------EVIYPQ.
Q9KBS1_BACHD/273-331----.LAVEEV.VTI--A...........NRV..................G....MH.PT--Y..--------TIYLPR.
Q5KVG3_GEOKA/282-341----SLSLDDV.YAI--A...........EAK.......................KVKKP--F..--------TISLPQ.
Q9KE75_BACHD/288-347----PISLEDV.TYL--A...........ETR.......................EVNKP--Y..--------TISMPE.
A9B7B4_HERA2/311-370----PVTLDSV.IEV--A...........KAR.......................GVIAS--F..--------TVTPPD.
Q3SKV5_THIDA/55-112----RVAVADV.VAA--V...........QRA.............Y....P....AD.KP--F..--------AIRVPR.
Q3JE96_NITOC/270-334----PITIEQA.VAI--A...........NQV.............F....P....NA.EL--R..--------WLATPE.
Q9A7E1_CAUCR/252-316----RISVDQA.VAI--A...........QGA.............L....P....GA.RL--A..--------WIETPS.
Q020P0_SOLUE/231-293----PITPDQA.MQI--A...........AAA.............I....P....GT.FP--F..--------QIVMP..
Q82WV7_NITEU/279-343----SIGAEHA.WAI--A...........TEH.............Y....P....DG.KF--G..--------GMFMPG.
A4FCJ5_SACEN/417-477----RIGIDRA.LAV--A...........RAE.......................GL.TG--E..--------LVVTPPH
Q9KE75_BACHD/74-132----TLTPSAL.VAR--A...........KEA.............F....P....ES.PV--S..--------SVRFYD.
Q5WLI5_BACSK/75-133----PLSYSSQ.VEY--V...........LET.............Y....P....DA.TI--S..--------SVVIDD.
Q47KW9_THEFY/83-144----RIPLSLQ.VEA--A...........QEA.............H....P....EG.TL--H..--------AIRIG..
Q825U8_STRAW/84-147----ELPISQQ.VAA--A...........RKA.............H....P....EG.TL--T..--------AVRPSP.
A0R6J4_MYCS2/78-140----RLPLTDQ.IAA--A...........RAA.............H....P....EG.TV--A..--------SIRPPA.
A1T724_MYCVP/79-141----PLPLGDQ.IAA--A...........QEE.............F....P....GL.TV--S..--------GIRPPA.
Q6NKB0_CORDI/71-132----ELPLERI.VDI--A...........RAT.............H....P....DL.EL--A..--------GVRVG..
Q9KBS1_BACHD/60-118----RLSPDEQ.LEM--V...........HEQ.............Y....P....DS.VI--T..--------AYRPGE.
Q8P606_XANCP/82-140----RLPAQQL.VDA--A...........QRA.............Q....A....GT.VF--R..--------YTTPD..
Q7CY41_AGRFC/75-132----KALPSEI.IAA--A...........LAA.............V....P....GT.AV--K..--------YTTSA..
Q2RPK6_RHORT/75-133----LASPSAL.VAA--A...........LAN.............T....P....GT.AV--K..--------YTTPA..
Q6W134_SINFN/75-133----KATPSAM.VAA--A...........LAA.............H....P....GT.AV--K..--------FTDPA..
Q1R143_CHRSD/68-125----AVSPQQQ.LDA--A...........MAA.............H....P....GE.AF--R..--------YVPPA..
Q7NVU2_CHRVO/229-292----RLPLDAL.IAR--A...........GAA.............L....P....GA.RL--V..--------DIRY...
Q8A623_BACTN/26-84----PLPVDQL.LEK--V...........AAT.............L....P....DD.VS--V..--------SGVSISS
Q884E8_PSESM/67-126----RMNFEQI.RAT--I...........ERN.............E....P....DL.IV--G..--------TIMQPD.
Q9I178_PSEAE/60-119----PLSFSQV.LKA--I...........NEA.............Q....P....DL.LV--E..--------SIQRPD.
Q1LJM8_CUPMC/260-324----AITPAQA.MTA--A...........QKQ.............F....P....DA.AV--T..--------RISLPR.
Q82P05_STRAW/125-192----KLTPAQAEQKA--A...........AAA.............Q....G....DA.TE--A..--------ALVVDAR
Q9L1F9_STRCO/146-216----AKAEQQA.LSA--A...........KDA..................G....SS.KT--A..--------ADSAPRK
Q82BN5_STRAW/115-187----PKAADLA.TAA--L...........RAA.............N....T....GE.LL--K..--------KVTAKPQ
Q9L2B8_STRCO/168-232----KGASVDA.AEA--A...........KAA.............A....G....HG.TV--T..--------SVELDDD
Q0AQU2_MARMM/109-177----PISAELA.RNI--A...........LAR.............Q....N....GL.GE--I..--------SAINRIA
E0THY6_PARBH/109-174----PISEELA.RRV--A...........EYD.............F....A....GD.GH--V..--------STVRMLS
Q63MT4_BURPS/165-233----AVDEQQA.LDR--A...........RAY.............L....G....VG.GF--V..--------NVQSQLV
Q03XK6_LEUMM/140-199----IISLDSA.VNK--A...........KDA.............A....G....DG.SL--N..--------GWSLEKD
Q9KC80_BACHD/94-154----GISEEDV.RAI--I...........EKE.............L....A....VR.EL--V..--------AIRLGVE
Q5KXX8_GEOKA/94-154----GISEAEA.RAI--L...........QRD.............R....R....PR.RI--I..--------DATLGME
Q1WU38_LACS1/104-164----GISVNKA.KNI--V...........KV.............ER....D....PK.KI--T..--------KTSLGLV
A8FEH2_BACP2/99-159----GVTSNQA.VQA--V...........QKE.............N....T....VS.KL--K..--------DVQLARE
Q6ANJ0_DESPS/50-117----AQTQKTL.SQV--V...........EEQ.............A....K....KT.AA--T..--------VIEAELE
Q8R5X9_FUSNN/10-69----QVNYDDV.VDI--V...........LRN.............Y....P....QS.RV--T..--------KIEIFNY
Q8E0L6_STRA5/117-180----KISQEEA.KKI--A...........FKDA...........NI....E....ES.EV--S..--------NLKIKEE
Q8RBF9_CALS4/109-184----KYTREEA.RKV--AIEFL..QKITPEKF.............K....Q....TK.EI--V..--------PSYPLGA
B8I195_CLOCE/108-180----KYSKEQI.LKI--A...........EQF.............V....N....KI.NP--K..--------VMDHFKL
Q1D8Q2_MYXXD/168-239----KVSHSQA.LDI--A...........MKA.............F....D....GK.PD--R..--------QPNSERV
Q81MX8_BACAN/145-217----ILSEEDAKKQL--FKIYG..DNLTFVEE.............P....E....IK.QV--V..--------YVDENTN
Q5ZRA6_LEGPH/16-86----KLSPNDI.EQK--T...........LGKVTE.......PVKF....K....NL.KK--V..--------IYIDKGN
Q87I51_VIBPA/131-204----.LSLERI.RSK--VQKPYLDVGYHIEDQ.............Q....Q....GL.R.--...--------IYIDDKD
Q2FUX4_STAA8/118-192----TLSKDDA.ADK--A...........FKA.............V....K....ID.KN--K..--------AKNLKD.
PRTA_LISMO/121-194----KITEKNA.IEK--A...........FEAIGQSEAHVKSYVGN....P....VK.EK--E..--------IILNSR.
Q97G52_CLOAB/161-230----GVTATQA.ISI--A...........KKQ.............F....S....FKSLV--E..--------APRAQKQ
Q97G51_CLOAB/153-222----DISPNYA.ISI--A...........EKQ.............F....N....YKTLL--E..--------KPKAEKQ
Q97GS5_CLOAB/161-230----SINEEDA.VNI--A...........LKQF..........TYKTLENT....PK.AI--K..--------TILTDNN
A5I1S2_CLOBH/148-212----KLSKEDA.IAK--A...........KGD.............I....K....DQ.KS--N..--------SEKADLY
Q81R73_BACAN/122-192----KISEKDA.IQK--S...........MAY.............V....G....EA.SE--Q..--------NLWAPTE
Q815U2_BACCR/146-219----SITAEQA.ETI--A...........KAD.............I....E....KE.IG--K..--------VKSYDGV
NPRB_BACSU/145-217----.ISEKKA.IHT--A...........RRE.............L....E....AS.IG--K..--------IEYLDGE
Q8ESH1_OCEIH/143-217----PITESEI.IDI--F...........KRN.............L....E....EN.IG--T..--------VDQFDGK
B1YFR1_EXIS2/113-183----SLSEKKA.LKL--Y...........QKAIK.........ATEFEVAP....KA.EL--V..--------IYPVK.D
Q81I21_BACCR/151-220----.IEGAKA.IEI--A...........QQD.............L....G....VTPKY--E..--------VEPKADL
Q8DVN1_STRMU/57-120----KIFKEQA.KHI--A...........LKDAG........FTEK....E....VT.LL--T..--------VEQDID.
Q99YI6_STRP1/81-143----KLSEDKA.KSI--A...........LKDAS........VTEA....D....AQ.ML--S..--------VTQDNE.
R6P3S5_9CLOT/179-241----AITKDQA.KSI--A...........LKDAG.........VSE....S....AT.QF--V..--------WVKEDYD
Q8ESN0_OCEIH/32-90----KLSQEEI.KQL--V...........KEQ.............Y....P....GT.QN--E..--------PDLQLK.
A5G759_GEOUR/48-108----KISGEKA.TEI--A...........LKE.............V....P....GK.VT--S..--------VVIERK.
O27358_METTH/81-143----KISYSEA.KSI--A...........QTY.............I....K....QE.GA--A..--------AGTPRLL
Q8ERG4_OCEIH/132-194----YVSHEDA.LST--A...........SEVQE........VQDL....T....PT.SW--K..--------LEID...
Q5WLC0_BACSK/58-117----QVDMETA.VSE--F...........ENA.............Y....P....DASIS--S..--------IELEAE.
Q82ZK1_ENTFA/63-122----AVSLEKV.TTA--F...........EKK.............Y....P....EAKIT--S..--------LQLDTD.
Q5FIK1_LACAC/43-101----KVSQSSA.VKK--F...........QAK.............Y....N....AK.IK--S..--------INLEKE.
Q5FIK0_LACAC/62-121----KLSQQEA.IDK--F...........HNQ.............F....N....NKKIH--S..--------IDLKLE.
Q74JH3_LACJO/49-108----NLSQSDA.INK--F...........NEK.............Y....G....SKSIK--E..--------IGLKNK.
Q8ERG4_OCEIH/56-114----QLTSEEA.MQI--F...........TDT.............F....T....GA.AI--S..--------SIELDEH
Q186H8_PEPD6/62-121----KVPYTDA.INI--F...........KDK.............Y....K....DA.DI--V..--------DLSLERD
Q9KFU6_BACHD/49-108----GLTLAEA.SDI--A...........LER.............A....G....NGVVT--E..--------AEKDRD.
Q8ESM9_OCEIH/39-97----TLSSEDI.TSI--V...........NEQ.............Y....E....GD.IT--D..--------FELDRD.
Q81R43_BACAN/43-101----ELSPETA.KQI--A...........IEK.............V....N....GV.VE--E..--------IDVERM.
Q8ELD0_OCEIH/32-90----EISAEQA.LQT--A...........LKN.............T....E....GF.VQ--E..--------VDLSFE.
Q4K807_PSEF5/38-102----IMDLEKL.NQA--A...........LAQ.................HPGTTAAS.IT--D..--------TELEQTA
C1DJ09_AZOVD/39-99----IQPFETL.NAA--A...........QAK.............H....P....GSTIH--E..--------TELEEE.
A4XTT8_PSEMY/39-99----IKSFEQL.DEA--I...........LAQ.............H....P....GARIE--E..--------TELEDE.
Q0VNT9_ALCBS/52-112----IQSLDKL.DKV--A...........LDK.............H....P....DAKIT--D..--------TELENE.
Q0S7B7_RHOJR/138-198----AVTQQQA.EQI--A...........VAT.............V....P....GGTVA--N..--------AEQQQR.
Q5F637_NEIG1/47-105----IISRAQA.EKA--A...........WAR.............V....G....GK.IT--D..--------IDLEHD.
Q1ARP9_RUBXD/67-126----AISREEA.ERA--A...........LEN.............V....S....GT.VV--E..--------SGLDEE.
Q9L126_STRCO/188-249----KQTPEQA.VKA--A...........TAK.............A....K....GT.VT--H..--------VELGDND
Q9L2B8_STRCO/83-152----KVTAADA.VAA--A...........LAD.............T....P....GT.AV--S..--------AELDDED
A9C057_DELAS/120-179----KSTIEQA.IQA--A...........TRH.............T....P....GT.PV--S..--------AELDSH.
Q8RD03_CALS4/115-173----KITPDEA.KTA--A...........LKV.............V....P....GT.VE--K..--------VSLDNE.
A8FCD9_BACP2/110-169----KITKKQA.EQI--A...........LAK.............V....K....GT.VT--D..--------SDLDKE.
YKOJ_BACSU/108-167----AITKEEA.EEI--A...........LKQ..................T....GGTVT--E..--------SKLDED.
Q8ESM9_OCEIH/119-177----FIGDKKA.KEI--A...........LEQ.............F....S....GK.VV--E..--------FELDED.
YKOI_BACSU/164-223----PITKKEA.KTI--A...........ERK.............T....G....GT.AD--D..--------ADLEES.
A8FCD8_BACP2/167-226----KITVEEA.IRI--A...........VKE.............V....G....GT.VD--D..--------ADLETF.
Q5WKR9_BACSK/175-233----QISVEEA.KQI--A...........LEE.............L....N....GT.VV--D..--------SELDEE.
Q9KFU7_BACHD/111-170----MLTEEQA.IAI--A...........QQE.............V....E....GK.VD--D..--------IELEEE.
Q9KFU6_BACHD/130-191----VISMDEA.KEI--A...........LKE.............V....S....GK.ID--D..--------IELERE.
Q5WKR8_BACSK/122-181----ALSTDEA.IKR--A...........LEE.............V....D....GT.VS--E..--------VELDKE.
Q38Z32_LACSS/130-188----LMTLEAA.QKK--A...........QHY.............F....D....GD.VL--E..--------ATLEKD.
Q2G105_STAA8/129-187----AIDYKKA.IKE--G...........QKE.............F....D....GD.IK--E..--------WSLEKD.
Q5FIK0_LACAC/141-199----VISRDEA.STI--A...........EEH.............A....K....GT.SR--E..--------WNLEQE.
Q82ZK1_ENTFA/146-205----IISREQA.TTL--A...........EKA............AK....V....GQ.AT--D..--------WKLEKE.
Q74LX8_LACJO/141-200----TISRKEA.SEI--A...........EKE.............V....K....NSVAK--E..--------WDLKME.
Q5FIK1_LACAC/119-178----TISRSTA.TKI--A...........QKR.............V....S....GSKAI--E..--------WNLERE.
Q74JH3_LACJO/126-184----LISRSEA.TKL--A...........QTK.............A....S....GK.AV--K..--------WSLEMD.
Q186H8_PEPD6/144-202----IMTPQQA.MEI--A...........LKE.............Q....N....GI.VK--E..--------WSLDKD.
Q5WLC0_BACSK/141-199----IIDPQEA.VDI--A...........LSE.............A....E....GA.IS--S..--------WKLEKD.
Q8R5X9_FUSNN/83-142----PITFEQA.SRI--G...........LDN............SF....N....GK.VK--S..--------IELKNI.
Q81R44_BACAN/99-158----TITKEKA.EEM--A...........LQK.............V....Q....GE.IK--Y..--------TILEKR.
Q0VNU0_ALCBS/63-123----IVAFSSL.LET--L...........KLR.............Y....P....QGRVL--E..--------VELERD.
Q3JBE9_NITOC/51-111----ILPFEQI.LAR--A...........LKA.............Y....P....GAQLL--E..--------SELERE.
A4XTT9_PSEMY/41-101----IMPFEQL.MQH--V...........GQA.............Y....P....GSTLL--E..--------AELEEE.
Q0BZN8_HYPNA/53-112----ILPLEII.LGS--V...........LQQ.............Y....P....GE.LL--K..--------LELDED.
A1B2L4_PARDP/40-99----ILPLAEV.LAR--L...........HET.............Q....P....GR.VS--E..--------VELEEE.
Q9A8Q0_CAUCR/73-133----VLPLTRI.LAI--A...........AER.............A....P....GE.VI--E..--------VELEEAG
Q988S6_RHILO/46-105----IKGLANI.LDI--V...........RAK.............A....P....GD.VV--A..--------VDLIRQ.
A4YY21_BRASO/40-99----VLPLSQI.LPR--L...........RGR.............I....A....GD.VT--G..--------IDIERQ.
Q2RPG4_RHORT/72-131----ALPLSVI.LDR--A...........AAL.............V....D....GR.FL--E..--------AELESG.
V6F502_9PROT/38-95----.LPLGQI.LAR--A...........EAA.............Y....P....GQ.LI--E..--------AELEDE.
Q0AR59_MARMM/55-114----VVPALRV.ISE--V...........RRR.............Y....P....GADVL--D..--------AELEG..
A8LN27_DINSH/31-89----TIGMARA.VAI--A...........QEA.............R....P....GG.IL--E..--------AELDSD.
A5VEY7_SPHWW/24-82----LIGLTRA.IGV--A...........ERS.............L....S....AR.AI--E..--------GELETS.
Q8KFX7_CHLTE/45-103----AISLSQA.VNA--A...........ETF.............T....R....GR.AV--R..--------AELEKH.
B4E758_BURCJ/39-96----KIPLTQA.VTA--A...........EQH.............A....N....GK.AS--R..--------AEYENS.
A9C057_DELAS/43-102----KIPLEQA.VTR--A...........TQA.............V....P....GK.AI--E..--------AQLDDGD
E0TIH6_PARBH/43-102----KISLAEA.VAI--A...........EER.............T....G....GR.AA--E..--------AEFDVE.
B0UCU3_METS4/66-129----KIGLAQA.LAT--A...........ESQG...........GQ....G....GR.AI--D..--------ADFEKAK
A3QGG2_SHELP/47-105----VKNRQQA.TQM--V...........KGR.............Y....N....AK.VL--S..--------VQSSRV.
Q7P204_CHRVO/118-188----TLSSAQV.LSQ--A..........KALK.............A....N....GN.PT--Y..--------NDKAELV
ELAS_PSEAE/122-192----AVSAEQV.LAQ--A...........KSL............KA....Q....GR.KT--E..--------NDKVELV
A1S2N2_SHEAM/113-188----SLSKDKA.LEI--AKAA.....KGGHGL..................K....AG.KT--R..--------NDSAQPW
Q2SJ90_HAHCH/129-208----TISDKEA.LNI--AKN......NSGFTF.............V....N....AP.QF--R..--------NESSELM
B7VN56_VIBTL/116-190----KLNQEQA.IEA--A...........ISSHR........TFTV....G....KK.SI--E..--------NKNAKLM
F7YSQ2_VIBA7/118-194----..EQKQA.VSI--A...........LTHYQQQ.....NPSLT....S....ADLVT--E..--------NERAQLM
HAPT_VIBCH/116-190----.IESQQA.IAL--A...........VSHFG........EQHA....G....ESLPV--E..--------NESVQLM
Q5ZZJ1_LEGPH/124-199----AISAQQA.KEY--A...........KKS............YFQ.FSS....QS.NI--Q..--------QETAELQ
A1S4V2_SHEAM/92-162----ALTRGQA.IAA--L...........NKV.............Y....P....GA.VA--S..--------GHKDVEL
Q211C9_RHOPB/96-155----AISLRQA.MTI--A...........QQQ.............H....A....NSKIA--D..--------ISFDGS.
Q89L62_BRADU/85-144----SISISQA.MAL--A...........ESR.............H....A....GATTA--D..--------VSFDGA.
A4YNR6_BRASO/46-105----GVSLHQA.LRI--A...........EKM.............H....P....GSRTA--D..--------ISFEGG.
Q6N7G2_RHOPA/56-115----PVSLGQA.IGI--A...........EKR.............H....P....GTKSL--R..--------IETDVI.
Q1H2G7_METFK/106-166----KVSEAEA.RKT--A...........LAA.............H....P....GE.IV--E..--------VEYEIEE
A2SEW0_METPP/117-177----KVSETDA.TKT--A...........LAK.............H....P....GK.VE--R..--------VEYEVES
Q1H2G7_METFK/31-90----KVSLETC.LEA--A...........LKA.............K....P....GT.VV--K..--------VEYKLE.
A5N159_CLOK5/17-76----RINTETA.IQN--A...........LQR.............V....P....GQ.VL--R..--------VEMDVE.
Q8DWU2_STRA5/78-136----KIDYKTA.LET--A...........KKE.............A....R....SGFIS--Q..--------IELNTK.

PF11396

A0M0Q0_GRAFK/54-143----TEWEAEFKMNN--V-----------EYS-------------ANFLAN----GT-WQ--ETE........HEM.KTN
A0M1R1_GRAFK/70-160----GYWESHFKQDG--E-----------KYR-------------ADFNTD----GS-WV--ETE........NDI.KTE
A5FIF1_FLAJ1/58-140----KGYEVKLKDG.--.-----------.TE-------------VEFWKD----GS-YR--EVD.....GGDKPI.PTD
A5FNS8_FLAJ1/62-144----TEYKVQFDNQ.--.-----------.IE-------------IEFDKK----GN-WK--EVD.....GKNSKI.PKS
A6L337_BACV8/61-143----TSYDVKLADG.--.-----------.IE-------------LEFNSK----GE-WL--EID.....CKNKSV.PST
A6L4L1_BACV8/60-142----KSYDVIFTNG.--.-----------.DK-------------LEFDKK----GI-WT--EVN.....CKYSAV.PVA
A6LDA3_PARD8/62-144----SSYDVILTDG.--.-----------.TN-------------VEFNHK----GE-WK--EIK.....RHGLPI.PPA
A6LDA4_PARD8/55-146----GYVKAEFYTGS--Y-----------EAE-------------AWFDPQ----GN-WM--LTE........TDL.PYN
A6LDE6_PARD8/58-149----NYYVVDFNNGG--S-----------ETT-------------AWFTDQ----GI-WM--MEK........IDI.SFA
C0QVH4_BRAHW/54-141----GGYEVDIDFG.--.-----------.YK-------------FIFYNT----GL-WK--KISIINDETKNIGI.PRS
C0QYD0_BRAHW/35-117----EFYEVTFNDD.--.-----------.IV-------------IHFDLD----GY-WQ--EVS.....GNSSPI.PIN
C0R146_BRAHW/63-147----THYIVIFKGG.--.-----------.SS-------------INFNRK----GE-WT--SII.....GNRKII.QIS
C0R148_BRAHW/33-123----SSYSAVFKGG.--.-----------.SS-------------INFNTK----GE-WT--SII.....GNGNEI.PFN
Q5L9Y2_BACFN/49-143----GYYCADFMMNG--Y-----------EKN-------------VWFNAQ----GQ-WQ--MTQ........TEWGDTD
Q5LD45_BACFN/83-177----DYHIADIRVDG--R-----------ELN-------------VWFSDK----GK-WL--MTE........VDVETLE
Q7MWB3_PORGI/60-142----KTYDVVFTNG.--.-----------.NK-------------IEFDKK----GN-WK--EID.....CKYSRV.PSD
Q7MWB4_PORGI/55-145----EFRVAEFMNEG--V-----------KSE-------------AWFLRS----.I-WQ--YTE........IDI.PYS
Q89YQ4_BACTN/58-150----DYYVADCWVTG--D-----------ELD-------------VWFDAN----AN-WV--MTE........NELDSID
Q89YQ5_BACTN/61-144----AKYEVLLTDG.--.-----------.TE-------------IDFDSK----GN-WE--EVS....ASKGHAV.PAS
Q8A994_BACTN/60-142----KSYEVIFTNG.--.-----------.NK-------------VEFDKK----GN-WE--EVD.....CKHTSV.PVA
Q8YLV6_NOSS1/61-150----YGYEAVFTQNN--I-----------QYE-------------AEFSDS----GE-WL--ETE........YYV.TEK
C7M630_CAPOD/59-141----.EYTVIFRDG.--.-----------.LE-------------IEFNGD----GD-WK--ELK.....ARHGKV.PDH
D6D2V5_9BACE/45-136----.YYVADCWVSN--D-----------ELE-------------VWFDTN----AN-WV--MTE........NELNSID
D6D5W5_9BACE/49-143----GYYCANFVMNG--F-----------TKN-------------VWFNVR----GQ-WV--MTQ........TDLVSLD
D6D6Q4_9BACE/56-146----GYYVADFYDEY--.-----------EAS-------------AWFTQD----GK-WQ--MTE........TDI.PYS
Q0P802_CAMJE/53-133----DSYDVILNDG.--.-----------.TE-------------IDFMIN----GE-WK--EVD.....GKYKAL.PHT
Q0P9P8_CAMJE/51-132----NSYEVYLSDG.--.-----------.TE-------------LEFDID----GA-WK--EIE.....NKAFPF.DLD
Q5LBR7_BACFN/55-146----NYYIAEFRQQN--Y-----------ETS-------------AWFTPN----GI-WQ--MTE........TDL.PYQ
Q5LBR8_BACFN/60-141----KSYDVIFTDG.--.-----------.NK-------------VEFDKK----GN-WT--EVN.....CKFSVV.PQG
Q5LG06_BACFN/60-151----.YYVADCQADG--R-----------EKE-------------VWFDAN----AN-WL--MTE........TELNSIN
Q5LG07_BACFN/61-143----KKYDVLLTNA.--.-----------.TE-------------IDFDNR----GN-WI--EVD.....CKKAAV.PAT
Q5LIE1_BACFN/72-153----..YRVVFPNE.--.-----------.VK-------------VEFSEN----GG-WK--RLM.....IPDQKL.PGS
R5U7Q0_9BACE/57-144----GYYVADFYDGH--.-----------EAS-------------AWFTQE----GK-WV--LTS........WEV.HFN
R6WQR9_9PORP/57-147----.YLIVDFKQDK--V-----------EKE-------------AWFDNS----GT-WY--MTE........TDI.PFA
R6X3F2_9PORP/60-141----KKYEVIFANS.--.-----------.SK-------------VEFFKD----GT-WK--EVD.....CKYSTV.PEA
R6XCT8_9PORP/59-150----DYYVIDFENNS--L-----------DNT-------------AWFDHL----GV-WA--MIK........TDL.PLN
R7EFG1_9BACE/61-142----KKYEVLLTDR.--.-----------.TE-------------IDFDKK----GN-WL--EVD.....CKKSAV.PEA
R7EJJ2_9BACE/58-149----GYFVADCKVDG--Q-----------EKD-------------VWFNNQ----AE-WQ--LTE........TEL.LWN
R7EKK7_9BACE/52-145----.CYVAEFIADG--Q-----------EID-------------VWFNKQ----AE-WV--MTE........TDVESLE
R7ELA9_9BACE/58-149----.YYVADFHEDN--F-----------EKE-------------AWFTKD----GV-WQ--MTE........TDL.RYA
R7ERW1_9BACE/60-141----KSYDVVFTNG.--.-----------.EK-------------VEFDKS----GE-WK--EVR.....CRQSEV.PAQ
R7JJR5_9BACT/78-154----.TYKVVFADG.--.-----------.TQ-------------VKFRRN----GM-WR--EIK.....SRSRAV.PSV

PF11399

K7AKJ7_9ALTE/17-119DWKDKEHKNRKYISR--L-----------HQ.------------------.----G-TGY-------------EEILNRM
F5Z4M1_ALTNA/22-120DWKDREEYNRVQITK--L-----------KL.------------------.----G-STR-------------EEVLALL
E1SS82_FERBD/33-127DWDDRQKHNVAAIAT--L-----------EP.------------------.----G-LSK-------------AIVLERL
Q8EGJ0_SHEON/23-131SWEKVQDKNRSNLAK--L-----------SL.------------------.----G-MSK-------------DQVMTLM
A1S8B9_SHEAM/20-120DWEDRQVYNNKALAE--L-----------VI.------------------.----G-QDI-------------GSVRQLL
K7AKJ0_9ALTE/22-120DWKDREEYNKIQISK--L-----------EL.------------------.----G-LQK-------------KQVIELL
A3QGB8_SHELP/19-122SWERVQEQNRVNLSK--L-----------SL.------------------.----G-MTR-------------DQVMTLM
Q15QZ2_PSEA6/17-119DWQKKERSNRKEVAR--L-----------QP.------------------.----N-LST-------------GEVMDRM
Q07ZE7_SHEFN/20-120AWDDRQAFNLQKMSE--V-----------SF.------------------.----G-QSL-------------DEIRTLL
Q47YB6_COLP3/19-119DSEDRTYKNRKKIAK--V-----------QL.------------------.----G-TSF-------------MDIQENL
Q8EGQ0_SHEON/20-120DWEDRQVYNSQKLND--L-----------SL.------------------.----G-QDI-------------SEVKTLF
D4ZHG3_SHEVD/20-120HWEDRQAYNNAQLAD--I-----------II.------------------.----G-QSL-------------SDIKQRM
D4ZHN7_SHEVD/34-137GWEETQDLNRVSLAS--L-----------SL.------------------.----G-MTR-------------EQVTVLM
E1STL4_FERBD/20-123DWEKKQDSNRRKLEQ--I-----------EL.------------------.----G-MAL-------------SDVRSIM
Q47YA7_COLP3/20-123KWKDREAYNRQFIAK--V-----------ML.------------------D----N-FTF-------------EQALTQL
Q085F9_SHEFN/19-126YWQVQQDKNRDLLSK--L-----------SM.------------------.----G-MSS-------------DQVTTLM
Q15QY7_PSEA6/21-120DWKDREEYNKVQVAK--L-----------EL.------------------.----G-QTK-------------QQILALL
Q12P24_SHEDO/19-126DWEQQQQMNRDNIAK--L-----------SM.------------------.----G-MDA-------------QQVSLLM
Q5QW11_IDILO/20-120QWQERETYNARQIGQ--F-----------DL.------------------.----G-MSK-------------DSVIRVL
Q3ICC6_PSEHT/21-122IWQDREAYNKRYIEK--L-----------KIE------------------D----T-ATL-------------NSVLEYL
G4QLZ6_GLANF/37-143NWQKHEAKNRQFIAD--L-----------SP.------------------.----G-VSK-------------KSVIDQL
Q12L38_SHEDO/26-125DWDDRQAFNLQQLSH--I-----------KL.------------------.----G-QSL-------------DEIVTLM
A3QGM5_SHELP/20-120DWEDRQAYNNAKLTE--L-----------SI.------------------.----G-QPI-------------EQIRTLM
A1S4M5_SHEAM/18-116DWEKTQLDNREHLTQ--L-----------SL.------------------.----G-MDK-------------SQVLALM

PF04355

Q5NL78_ZYMMO/17-93----GYMVDKAMVQS--V-----------SP------------------------GVDNR-------------QSVEKTL
Q5LQJ9_RUEPO/35-111----GYVPTAEELAA--I-----------QV------------------------GVDTR-------------DSVVEAV
Q1LSR9_BAUCH/37-105----GNYLTKTDVDQ--I-----------HI------------------------G.MTK-------------QQVSNIL
Q1LBA9_CUPMC/75-149----GTFPNIDNLRM--L-----------AP------------------------G.MTK-------------SQRYPLL
A5WGN5_PSYWF/35-114----GTPITQSQAQQ--I-----------QP------------------------G.MTK-------------NQVLYYI
Q9CJV5_PASMU/34-104----GNYLEAATVKQ--L-----------QV------------------------G.MNA-------------AQVQYLL
BAME_PSYIN/35-104----GNYIEDEKLDQ--I-----------LL------------------------G.MSQ-------------EQVIFIL
Q220P9_RHOFT/38-108----GNFVSQEQAAA--V-----------TP------------------------G.MSR-------------VQVRDIL
BAME_NEIMB/36-106----GNELEPRAVAA--L-----------RP------------------------G.MTK-------------DQVLLLL
Q5NEF6_FRATT/34-106----GKEIKDKKLFE--I-----------KP------------------------N.MTK-------------SEVTYIL
BAME_VIBF1/35-105----GNYVEQEAVDK--L-----------RF------------------------G.MTK-------------QQVQFVM
A6VMF3_ACTSZ/34-104----GNYLEQSTVEQ--L-----------QV------------------------G.MTR-------------EQVKYLL
Q7VRQ4_BLOFL/39-110----GTYLTQKDIQK--I-----------KI------------------------G.MTK-------------SEILSCI
BAME_NITEU/35-105----GNVVTDEMVAK--L-----------KP------------------------G.MTR-------------SQVRFTL
Q0C315_HYPNA/29-105----GYIADEVQPID--I-----------KP------------------------GDDTR-------------STVLAQL
Q47XI1_COLP3/29-101----GNYLEQKSIDK--L-----------QV------------------------G.MTK-------------EQVKFIL
Q47HJ0_DECAR/36-107----GNVLSQEMVSQ--L-----------KP------------------------G.QTK-------------DQVRFLL
Q5FUN3_GLUOX/45-121----GSLIEKTDYAQ--L-----------VP------------------------GTSTR-------------TDVLDLL
Q2SMN2_HAHCH/93-162----GNIVEKEAVEQ--L-----------KV------------------------G.MNR-------------RQVQYLL
Q0A7D7_ALKEH/37-107----GNIMTQEMVDE--L-----------RV------------------------G.MSQ-------------QQVRTIM
A1AX05_RUTMC/37-107----GSVLERFKINQ--L-----------NL------------------------G.MSK-------------TQVQDLI
Q3SSS7_NITWN/53-129----GYILPPGALEQ--I-----------QI------------------------G.ASQ-------------DQVLIVM
Q2RTT3_RHORT/36-112----GNLPTTEALGQ--I-----------QE------------------------GVHTR-------------TDIQALL
Q2NRT5_SODGM/28-97----DSYVNKPVVSD--V-----------KK------------------------G.MTK-------------EQARAIG
A4VII8_PSEU5/29-97----ITYRDEPLVRD--V-----------ET------------------------G.MTQ-------------ARVLSIG
A7I1H3_CAMHC/52-124----ALSVNLENIRK--I-----------ET------------------------G.MSK-------------DEIRKLI
Q604C4_METCA/51-121----GNIVSQEMVDQ--L-----------KP------------------------G.MNR-------------RQVTFIM
B0UR41_METS4/34-110----GYLIDEAAVAQ--V-----------KP------------------------G.TSA-------------EQVLQLL
Q15V54_PSEA6/31-104----GNFLDERDVSK--L-----------RI------------------------N.MTK-------------EQVEYVL
Q31FS2_THICR/36-107----GTVISQEAINT--L-----------QP------------------------G.LTA-------------NQVKDIL
A1WGT8_VEREI/51-121----GNFVAREQVQA--L-----------QP------------------------G.MSR-------------QQVREIL
A4SVD7_POLSQ/67-138----GNFISSEQYAK--L-----------QL------------------------G.MSR-------------EQVRQIL
Q2NRZ9_SODGM/35-105----GNYLTAADVAK--I-----------HT------------------------G.MTK-------------QQVAYTL
A1WCQ4_ACISJ/49-119----GNFISREQVQM--L-----------QP------------------------G.MGR-------------QQVREIL
Q1LMT9_CUPMC/71-142----GNFVSREAVAQ--L-----------RP------------------------G.MTR-------------DQVSFLL
Q6FDQ3_ACIAD/30-107----GTPLTKAQASK--V-----------QV------------------------G.MSY-------------QQVRFLL
Q7CZT7_AGRFC/48-124----GYVMDDQSLQL--I-----------PE------------------------G.SSR-------------EQVLLTM
Q0K704_CUPNH/51-122----GNFVSREAVSQ--L-----------RE------------------------G.MTR-------------DQVKFLL
Q21H32_SACD2/36-106----GNYIEKKMVDQ--L-----------EV------------------------G.MTR-------------RQVQYVM
Q83C32_COXBU/30-100----GNVITDKDLGA--L-----------HK------------------------G.MTK-------------TKVESLL
A8GGW6_SERP5/28-97----ASYVQEPVVSD--V-----------KV------------------------G.MTK-------------QQVRAIA
A5FV68_ACICJ/239-315----GTAVTEAQLKQ--L-----------TP------------------------GVSTE-------------ADATALL
Q3SJS3_THIDA/32-102----GNALDQENVSR--L-----------KP------------------------G.LNR-------------SQVRFLL
A0KI84_AERHH/30-100----GNYVEQKQVDK--L-----------RQ------------------------G.MTR-------------EQVEFVL
Q3IE33_PSEHT/35-105----GNFLEQSDVDK--L-----------RV------------------------N.MTR-------------EQVIYVL
A6W2D6_MARMS/31-103----GNLVTKEQLSQ--L-----------QI------------------------G.MSE-------------SQVTYLL
Q2G501_NOVAD/31-107----GYIIDEALVAS--V-----------QP------------------------GVDNK-------------LSVERTL
A7HX93_PARL1/37-112----GYIFDPADLEK--L-----------QT------------------------G.ASK-------------EQVRSVM
Q983A2_RHILO/103-179----GYVYDQQAVDS--V-----------PV------------------------G.SSR-------------EQVLLAL
Q7NX33_CHRVO/32-104----GNYVTQDAVAK--L-----------KP------------------------G.MTR-------------AQVRFLL
Q2YBT7_NITMU/31-101----GNVITQEMVNK--L-----------KP------------------------G.MTR-------------SQVRFAL
A2SC95_METPP/48-118----GNVVTQEMAAA--V-----------KP------------------------G.MTR-------------AQVRDTL
A1K8N9_AZOSB/69-139----GNYVDQAMVSQ--L-----------KR------------------------G.MSR-------------EQVRFVL
A7INK8_XANP2/42-117----GYVLAEGALDQ--V-----------PV------------------------G.SSQ-------------EQVLLVL
Q1QSW6_CHRSD/33-103----GNLINQDMVSQ--L-----------ET------------------------G.MTK-------------EQVRYVM
Q1H393_METFK/54-124----GNVVTSKMMLQ--L-----------RP------------------------G.MTK-------------SQVRFIM
A3MZE6_ACTP2/34-104----GNYLEQEKIDQ--V-----------KV------------------------G.MDK-------------TQVQYLL
B0T0T5_CAUSK/29-105----GFQAIEAKPVD--M-----------KV------------------------GVDSK-------------STVTEKL
A1WX37_HALHL/38-106----GNLLEEEDIEQ--I-----------TV------------------------G.MSR-------------NQVRQRL
Q11J87_CHESB/48-124----GYVIDPQALEL--V-----------PV------------------------G.SSR-------------EQVLLAL
A4XUA2_PSEMY/28-96----VTFRDEPLVKQ--V-----------DH------------------------G.MTQ-------------EQVRTLG
Q28RF7_JANSC/34-109----GYVPPPELLSE--I-----------SI------------------------G.TSR-------------EQVAEIA
Q5QXM4_IDILO/32-102----GNYLEQDDVDK--L-----------RV------------------------G.MTE-------------EQVVFVL
BAME_BUCAI/32-101----ATHLNKNILNR--N-----------YV------------------------G.MTR-------------QQIVYIF
Q0BTE4_GRABC/35-111----GNKVDVDLLKE--L-----------TP------------------------GTSTQ-------------ADVASLL
Q2NDV7_ERYLH/16-92----GYVVDQLLLDR--V-----------QP------------------------GIDNR-------------QSVAATL
Q122Q0_POLSJ/29-99----GNFISSEQVEQ--L-----------RP------------------------G.MSR-------------DQVRAVL
Q3JBU9_NITOC/42-112----GNVITQEMLEK--L-----------SP------------------------G.MSK-------------QQVSFVL
Q7VM11_HAEDU/34-104----GNYLEQDKIDQ--V-----------KI------------------------G.MNK-------------TQVQYLL
Q6D4H9_PECAS/28-96----ESYVNEPVVKD--V-----------KV------------------------G.MTK-------------QQVQQLA
A5V7M5_SPHWW/32-109----GYVVDSTLINT--V-----------SP------------------------GVDNR-------------ESVEKTL
Q1GPC4_SPHAL/37-113----GYVVDPALTEA--I-----------TP------------------------GVDNR-------------ESVERTL
Q0VSU2_ALCBS/35-105----GNFVTEDMLSE--L-----------QP------------------------G.MTP-------------EQVRYVL
B0UU40_HISS2/52-121----GSWPNWDNLRM--V-----------ER------------------------G.MNK-------------DQLYNLL
B0UV53_HISS2/34-103----GNYLESTAVEQ--V-----------KV------------------------G.MNA-------------QQVQYLL
B7VJW3_VIBTL/77-145----GNYVEQEAVDQ--L-----------KF------------------------G.MTK-------------TQVRYVM
C1DFM7_AZOVD/35-101----GNVVTQDMIDQ--L-----------RP------------------------G.MTR-------------RQVRFVM
D4Z6S0_SPHJU/63-138----GYQVDKLLVDS--I-----------QP------------------------GIDNR-------------ASVEGTL
M1FIJ3_9ALTE/29-96----GNIVTNKELTA--L-----------TE------------------------G.MPR-------------SQVHAVM
M9X398_MANHA/34-103----GNYLEQDKIAQ--L-----------KV------------------------G.MTA-------------EQVEYLL
BAME_VIBCH/35-104----GNYVDQQSVDQ--L-----------KF------------------------G.MSK-------------DQVRFVL
BAME_HAEIN/34-103----GNYLEATTVAQ--V-----------KE------------------------G.MTA-------------QQVQYLL
Q2KA05_RHIEC/31-105----GYVVDQQSLNL--V-----------PE------------------------G.SSR-------------EQVLLSL
Q2YNC3_BRUA2/49-124----GYVLDQQALDS--V-----------PV------------------------G.SSR-------------EQVLLAL
Q3J361_RHOS4/40-116----GYVPTEIDLQR--I-----------EV------------------------GRDTR-------------DSVAEIV
BAME_PSYA2/52-130----GTPITQTQAQK--L-----------QV------------------------G.MNQ-------------NQVLYIL
Q5ZYK0_LEGPH/42-110----GNLLPQSKIAR--L-----------KT------------------------G.MSK-------------NDVAILM
Q63LV3_BURPS/48-120----GTFVNVENLRQ--I-----------GP------------------------G.LDK-------------NQVYALI
Q63QT2_BURPS/54-121----GNFVSQEKASQ--L-----------QV------------------------G.MSR-------------EQVRALL
Q6LUB1_PHOPR/34-102----GNYLEQSDIDT--L-----------RM------------------------G.MNK-------------EQVRYVL
Q79GM4_BORPE/42-111----GNWITKEQVAL--L-----------QQ------------------------G.MSR-------------EQVRFAL
BAME_YERPE/38-107----GNYLSPIDASK--I-----------HK------------------------G.MTQ-------------QQVAYTL
BAME_SALTY/35-104----GNYLTPTDVAK--V-----------RV------------------------G.MTQ-------------QQVAYAL
Q87RX9_VIBPA/35-104----GNYVEQSAVDK--L-----------KF------------------------G.MTK-------------AQVRFVL
Q87VN2_PSESM/31-98----.TYRNEPLVKQ--V-----------EN------------------------G.MTR-------------QQVLTIG
Q88DH0_PSEPK/30-95----.TYRDEPLVKQ--V-----------EN------------------------G.MTM-------------QKVIAIG
Q88DT8_PSEPK/35-101----GNVVTQDMIDQ--L-----------RP------------------------G.MTR-------------RQVRFIM
BAME_SHEON/38-105----GNYMEPQQVEK--L-----------RI------------------------D.MTK-------------EQAEYIL
BAME_XANCP/28-99----GNLIKQTAVEQ--L-----------QV------------------------G.QSK-------------QQVSALL
Q8XVT1_RALSO/61-130----GNFVSREQASQ--L-----------KE------------------------G.MTR-------------DQVRYVL
Q92KF5_RHIME/42-116----GYVVDQETLAL--V-----------PV------------------------G.SSR-------------EQVLLSL
Q9HUT7_PSEAE/31-97----.TFRNEPLVKD--V-----------EK------------------------G.MSQ-------------QEVLRIG
Q9JXT1_NEIMB/52-133----GTFPTYDELDQ--M-----------RP------------------------G.LTK-------------DDIYKIL
Q9PB00_XYLFA/44-114----GNLIKKEAVDQ--L-----------KV------------------------G.MNK-------------QEVALLL
V6F1L4_9PROT/28-103----GNLPHPEDLAK--I-----------TA------------------------GKTSR-------------EEVQALL

PF12978

Q8DTX1_STRMU/47-205SFSREAKIGKEDYDE--L-----------KI------------------------G-ESY-------------KKVVEKL
B9DSB0_STRU0/47-205AFNRDLNISLKDYNK--I-----------KK------------------------G-MSY-------------NEVTKIL
G2SNY8_LACRR/70-224KFTRSPKLDLKAFDS--I-----------AD------------------------G-ANY-------------DDVVKRY
Q8DZF2_STRA5/47-206KFIRDANITTKDYNS--L-----------KN------------------------G-MSY-------------NKVKELL
Q99ZC4_STRP1/47-204TFARELGLSQKEYQQ--L-----------QK------------------------G-MSY-------------EDVKKIL

PF07467

Q9KJ90_STREX/2-185SAQANSGFSAEKYEQ--I-----------QF------------------------G-MTF-------------DEVWEIG
B5GLC0_STRC2/2-181SAHAYTGFTPERYNK--I-----------QF------------------------G-MDR-------------TLVWQLA
BLIP_STRCL/10-200ASNAAGVMTGAKFTQ--I-----------QF------------------------G-MTR-------------QQVLDIA

PF14172

C0Z8F5_BREBN/45-177LEKVKNGQLEGVLIG...-----------...------------------I----GAT.K-------------KEVLDKI
W0EAP8_9FIRM/51-184LLNMRKSAEQGKVIN..S-----------DFA------------------V----KTAVL-------------EDVKKKW
YJGB_BACSU/51-188VKNLYNTAYKGEMPQQAQ-----------GLT------------------I----NKSTK-------------GDVHAAF
C0Z6K8_BREBN/118-238LSQIRSNAQEGRVIS..L-----------PFV------------------L----EKT.I-------------DDIEKGW
D3E8N0_GEOS4/57-196LNSFYKPALKGQFPGAVS-----------GLT------------------I----GKSTK-------------QDVYKAI
U5MR07_CLOSA/75-209LNDIKTLAQEGKIIN..S-----------EFA------------------D----KSSNI-------------SDAEGKL
R4K5N0_CLOPA/85-219LDNIIALSKQGKVFN..S-----------DFP------------------A----KDTNI-------------DSVESKW
C6D3T6_PAESJ/51-191LMSFYKPALNGQFPNF.H-----------GFT------------------I----GSTTH-------------ESVIKAI
I3VRL4_THESW/85-217INQIVSLAKEGKVIN..C-----------DFV------------------T----GKTTI-------------DDIEKVY
C8WQ55_ALIAD/107-238VRSVMQAALRGSLPG..V-----------PFA------------------D----GEN.I-------------DQVIKAW
M1MNJ5_9CLOT/77-211LKNIKTLAEEGKIIN..S-----------DFA------------------D----KSFNI-------------SDVEKKL
I4D7B6_DESAJ/531-665LANMMIMGQQGKVLF..S-----------DFP------------------V----KTTTI-------------EDIEKLW
F6DUI9_DESRL/67-201LNKIMQLARQGKVIN..C-----------EFT------------------A----NTTVI-------------ETVTGQW
Q8XI71_CLOPE/88-217LKDIKEKALKGEIID..Y-----------DFK------------------L----GDS.I-------------YDVIDKL
Q24YP2_DESHY/79-213LVSIRELAEKGKVIN..S-----------DFA------------------A----KLTVI-------------EDVEKKW
A6LYS0_CLOB8/79-210LDNIKKLSEEGKIIN..C-----------DFP------------------V----KTSTL-------------QDIEKKW
Q81PC7_BACAN/76-203VKNLFELAKEGKVPN..V-----------PFA------------------A----HTGDI-------------EEIEKAW
G7M4A2_9CLOT/93-227LNDIKTKAQEGKIIN..S-----------DYQ------------------A----GTSNI-------------QEVEEKL
A8MGG8_ALKOO/77-218KEKLLKSAYEGKIDG..I-----------EFG------------------I----GDK.G-------------TDIIGKM
A8FAZ3_BACP2/47-191LNTIYELAHKGQMPYYAK-----------GFK------------------I----GVQTK-------------KDVHHKL
C0Z6K8_BREBN/268-401LQSVRDLAGKGQVFG..S-----------QYR------------------L----EKDVF-------------DDAEKEL
J7J151_DESMD/62-207LLNIKGAAEQGKVIN..C-----------NFP------------------V----KTTVI-------------EDVKSQW
X4Z8J4_9BACL/92-219LQELLELAKQGKAPG..I-----------PFA------------------A----HTDLI-------------DDVKKAW

PF13670

Q0BXA6_HYPNA/7-95A---------------------.EGMTRVKEV------------------------------------------------
Q0BXA5_HYPNA/6-84K---------------------.QGMTHVLEA------------------------------------------------
Q0BY17_HYPNA/6-92A---------------------.QGMRDVMKV------------------------------------------------
A4VHV2_PSEU5/30-109A---------------------.AGYTELHGI------------------------------------------------
A4XVH9_PSEMY/6-85A---------------------.AGYTELHKI------------------------------------------------
Q1QMT6_NITHX/5-85E---------------------.KGYTDVSKL------------------------------------------------
B8EKV5_METSB/3-81G---------------------.QGY.SAIKA------------------------------------------------
Q5LX53_RUEPO/50-129D---------------------.LGY.DVRKI------------------------------------------------
B8IVF4_METNO/5-90V---------------------.LGY.RVDRV------------------------------------------------
B3PI60_CELJU/2-85S---------------------.QGY.DIKVF------------------------------------------------
C1DNM7_AZOVD/2-85A---------------------.QGY.EIRKF------------------------------------------------
Q1LBN9_CUPMC/3-85E---------------------.QGY.NIKKF------------------------------------------------
Q8XWW7_RALSO/3-85A---------------------.QGY.TIKKF------------------------------------------------
A1K227_AZOSB/5-88A---------------------.AGY.TVDKF------------------------------------------------
Q5P431_AROAE/5-88E---------------------.QGY.TVDKF------------------------------------------------
Q5P432_AROAE/18-101D---------------------.AGY.TLERF------------------------------------------------
D0KWU4_HALNC/5-88Q---------------------.EVP.KLKLF------------------------------------------------
B0SVT0_CAUSK/5-90A---------------------.LGYTKIKVF------------------------------------------------
A7IQ54_XANP2/6-90E---------------------.MGFKNIKVF------------------------------------------------
B1Y4P0_LEPCP/3-85A---------------------.QGY.QIKTF------------------------------------------------
B8IVE9_METNO/4-91A---------------------.QGY.KVQKA------------------------------------------------
Q1QM54_NITHX/4-90A---------------------.QGY.KVQKA------------------------------------------------
A1B769_PARDP/5-86E---------------------.NGW.VVRRI------------------------------------------------
A1B772_PARDP/5-86G---------------------.LGW.HVEKV------------------------------------------------
B6JDT2_OLICO/6-87A---------------------.HGW.KVDRI------------------------------------------------
A1U059_MARHV/5-86A---------------------.EGW.TVHRI------------------------------------------------
A1SRM1_PSYIN/5-86Q---------------------.KGW.QVKRI------------------------------------------------
B9K2Y3_AGRVS/4-85G---------------------.EGW.NVRSI------------------------------------------------
A7IKT6_XANP2/6-87G---------------------.EGW.TVLSI------------------------------------------------
A1B771_PARDP/5-86E---------------------.FGW.TISKM------------------------------------------------
Q0S079_RHOJR/10-95A---------------------HTGGGTVTGT------------------------------------------------
A8LNS6_DINSH/4-81E---------------------MECQMDADDI------------------------------------------------
B1M6N2_METRJ/3-84Q---------------------.EGFTKWKEI------------------------------------------------
A7HVA0_PARL1/7-87G---------------------.AGYVSWEEI------------------------------------------------
C5AT97_METEA/7-83E---------------------.AGYGTVRSI------------------------------------------------
G2J097_PSEUL/8-86K---------------------.EGY.QIKKF------------------------------------------------
Q2YRI6_BRUA2/6-85E---------------------.FTW.KISEM------------------------------------------------
Q3J9Y2_NITOC/7-84E---------------------.QGFKQISEI------------------------------------------------
Q5F6R1_NEIG1/7-90Q---------------------.RGY.QVYDV------------------------------------------------

PF03413

Q9K7V1_BACHD/28-100K---------------------..........------------------------------------------------
Q816W8_BACCR/30-100K---------------------..........------------------------------------------------
Q8EP78_OCEIH/29-101K---------------------..........------------------------------------------------
U5LGT7_9BACI/29-101K---------------------..........------------------------------------------------
Q03RI8_LACBA/34-106K---------------------..........------------------------------------------------
Q03GC8_PEDPA/34-106R---------------------..........------------------------------------------------
Q82ZL5_ENTFA/37-109K---------------------..........------------------------------------------------
Q5HNG3_STAEQ/33-102N---------------------..........------------------------------------------------
B1YKF6_EXIS2/28-100Y---------------------..........------------------------------------------------
Q181V6_PEPD6/408-465.---------------------..........------------------------------------------------
Q181V6_PEPD6/490-547.---------------------..........------------------------------------------------
Q8TTA4_METAC/138-199.---------------------..........------------------------------------------------
A8MEK6_ALKOO/172-230.---------------------..........------------------------------------------------
A8MEK6_ALKOO/94-155G---------------------..........------------------------------------------------
A8MEK5_ALKOO/294-355.---------------------..........------------------------------------------------
Q5WGU9_BACSK/378-439I---------------------..........------------------------------------------------
YPEB_BACSU/377-438L---------------------..........------------------------------------------------
A8FEM8_BACP2/376-437M---------------------..........------------------------------------------------
YPEB_BACHD/374-435L---------------------..........------------------------------------------------
YPEB_OCEIH/373-434A---------------------..........------------------------------------------------
A3DI39_CLOTH/391-452Y---------------------..........------------------------------------------------
A0Q324_CLONN/379-440S---------------------..........------------------------------------------------
Q2RM03_MOOTA/386-447G---------------------..........------------------------------------------------
A8MIH5_ALKOO/376-437G---------------------..........------------------------------------------------
Q12WY7_METBU/120-186.---------------------..........------------------------------------------------
Q6W134_SINFN/286-345.---------------------..........------------------------------------------------
Q8ELE8_OCEIH/178-237.---------------------..........------------------------------------------------
Q9KBS1_BACHD/273-331.---------------------..........------------------------------------------------
Q5KVG3_GEOKA/282-341.---------------------..........------------------------------------------------
Q9KE75_BACHD/288-347.---------------------..........------------------------------------------------
A9B7B4_HERA2/311-370.---------------------..........------------------------------------------------
Q3SKV5_THIDA/55-112.---------------------..........------------------------------------------------
Q3JE96_NITOC/270-334.---------------------..........------------------------------------------------
Q9A7E1_CAUCR/252-316.---------------------..........------------------------------------------------
Q020P0_SOLUE/231-293.---------------------..........------------------------------------------------
Q82WV7_NITEU/279-343.---------------------..........------------------------------------------------
A4FCJ5_SACEN/417-477.---------------------..........------------------------------------------------
Q9KE75_BACHD/74-132.---------------------..........------------------------------------------------
Q5WLI5_BACSK/75-133.---------------------..........------------------------------------------------
Q47KW9_THEFY/83-144.---------------------..........------------------------------------------------
Q825U8_STRAW/84-147.---------------------..........------------------------------------------------
A0R6J4_MYCS2/78-140.---------------------..........------------------------------------------------
A1T724_MYCVP/79-141.---------------------..........------------------------------------------------
Q6NKB0_CORDI/71-132.---------------------..........------------------------------------------------
Q9KBS1_BACHD/60-118.---------------------..........------------------------------------------------
Q8P606_XANCP/82-140.---------------------..........------------------------------------------------
Q7CY41_AGRFC/75-132.---------------------..........------------------------------------------------
Q2RPK6_RHORT/75-133.---------------------..........------------------------------------------------
Q6W134_SINFN/75-133.---------------------..........------------------------------------------------
Q1R143_CHRSD/68-125.---------------------..........------------------------------------------------
Q7NVU2_CHRVO/229-292.---------------------..........------------------------------------------------
Q8A623_BACTN/26-84.---------------------..........------------------------------------------------
Q884E8_PSESM/67-126.---------------------..........------------------------------------------------
Q9I178_PSEAE/60-119.---------------------..........------------------------------------------------
Q1LJM8_CUPMC/260-324.---------------------..........------------------------------------------------
Q82P05_STRAW/125-192D---------------------..........------------------------------------------------
Q9L1F9_STRCO/146-216V---------------------IW......AA------------------------------------------------
Q82BN5_STRAW/115-187L---------------------VVD.....AL------------------------------------------------
Q9L2B8_STRCO/168-232G---------------------D.........------------------------------------------------
Q0AQU2_MARMM/109-177E---------------------PP......RE------------------------------------------------
E0THY6_PARBH/109-174D---------------------PP......SE------------------------------------------------
Q63MT4_BURPS/165-233A---------------------FV.......D------------------------------------------------
Q03XK6_LEUMM/140-199.---------------------..........------------------------------------------------
Q9KC80_BACHD/94-154.---------------------..........------------------------------------------------
Q5KXX8_GEOKA/94-154.---------------------..........------------------------------------------------
Q1WU38_LACS1/104-164.---------------------..........------------------------------------------------
A8FEH2_BACP2/99-159.---------------------..........------------------------------------------------
Q6ANJ0_DESPS/50-117M---------------------KSL.....GL------------------------------------------------
Q8R5X9_FUSNN/10-69.---------------------..........------------------------------------------------
Q8E0L6_STRA5/117-180I---------------------..........------------------------------------------------
Q8RBF9_CALS4/109-184.---------------------..........------------------------------------------------
B8I195_CLOCE/108-180V---------------------DI.......D------------------------------------------------
Q1D8Q2_MYXXD/168-239I---------------------YK......DI------------------------------------------------
Q81MX8_BACAN/145-217.---------------------..........------------------------------------------------
Q5ZRA6_LEGPH/16-86.---------------------..........------------------------------------------------
Q87I51_VIBPA/131-204.---------------------..........------------------------------------------------
Q2FUX4_STAA8/118-192K---------------------VIKENKVEID------------------------------------------------
PRTA_LISMO/121-194.---------------------..........------------------------------------------------
Q97G52_CLOAB/161-230V---------------------IV.......K------------------------------------------------
Q97G51_CLOAB/153-222V---------------------II.......K------------------------------------------------
Q97GS5_CLOAB/161-230.---------------------..........------------------------------------------------
A5I1S2_CLOBH/148-212L---------------------YN.......F------------------------------------------------
Q81R73_BACAN/122-192K---------------------EFGY...IIE------------------------------------------------
Q815U2_BACCR/146-219K---------------------KDLF..VYEK------------------------------------------------
NPRB_BACSU/145-217P---------------------KGELY.IYPH------------------------------------------------
Q8ESH1_OCEIH/143-217I---------------------..........------------------------------------------------
B1YFR1_EXIS2/113-183.---------------------..........------------------------------------------------
Q81I21_BACCR/151-220Y---------------------VY......QN------------------------------------------------
Q8DVN1_STRMU/57-120.---------------------..........------------------------------------------------
Q99YI6_STRP1/81-143.---------------------..........------------------------------------------------
R6P3S5_9CLOT/179-241.---------------------..........------------------------------------------------
Q8ESN0_OCEIH/32-90.---------------------..........------------------------------------------------
A5G759_GEOUR/48-108.---------------------..........------------------------------------------------
O27358_METTH/81-143K---------------------..........------------------------------------------------
Q8ERG4_OCEIH/132-194.---------------------..........------------------------------------------------
Q5WLC0_BACSK/58-117.---------------------..........------------------------------------------------
Q82ZK1_ENTFA/63-122.---------------------..........------------------------------------------------
Q5FIK1_LACAC/43-101.---------------------..........------------------------------------------------
Q5FIK0_LACAC/62-121.---------------------..........------------------------------------------------
Q74JH3_LACJO/49-108.---------------------..........------------------------------------------------
Q8ERG4_OCEIH/56-114.---------------------..........------------------------------------------------
Q186H8_PEPD6/62-121.---------------------..........------------------------------------------------
Q9KFU6_BACHD/49-108.---------------------..........------------------------------------------------
Q8ESM9_OCEIH/39-97.---------------------..........------------------------------------------------
Q81R43_BACAN/43-101.---------------------..........------------------------------------------------
Q8ELD0_OCEIH/32-90.---------------------..........------------------------------------------------
Q4K807_PSEF5/38-102.---------------------..........------------------------------------------------
C1DJ09_AZOVD/39-99.---------------------..........------------------------------------------------
A4XTT8_PSEMY/39-99.---------------------..........------------------------------------------------
Q0VNT9_ALCBS/52-112.---------------------..........------------------------------------------------
Q0S7B7_RHOJR/138-198.---------------------..........------------------------------------------------
Q5F637_NEIG1/47-105.---------------------..........------------------------------------------------
Q1ARP9_RUBXD/67-126.---------------------..........------------------------------------------------
Q9L126_STRCO/188-249.---------------------..........------------------------------------------------
Q9L2B8_STRCO/83-152D---------------------DGD....DGD------------------------------------------------
A9C057_DELAS/120-179.---------------------..........------------------------------------------------
Q8RD03_CALS4/115-173.---------------------..........------------------------------------------------
A8FCD9_BACP2/110-169.---------------------..........------------------------------------------------
YKOJ_BACSU/108-167.---------------------..........------------------------------------------------
Q8ESM9_OCEIH/119-177.---------------------..........------------------------------------------------
YKOI_BACSU/164-223.---------------------..........------------------------------------------------
A8FCD8_BACP2/167-226.---------------------..........------------------------------------------------
Q5WKR9_BACSK/175-233.---------------------..........------------------------------------------------
Q9KFU7_BACHD/111-170.---------------------..........------------------------------------------------
Q9KFU6_BACHD/130-191.---------------------..........------------------------------------------------
Q5WKR8_BACSK/122-181.---------------------..........------------------------------------------------
Q38Z32_LACSS/130-188.---------------------..........------------------------------------------------
Q2G105_STAA8/129-187.---------------------..........------------------------------------------------
Q5FIK0_LACAC/141-199.---------------------..........------------------------------------------------
Q82ZK1_ENTFA/146-205.---------------------..........------------------------------------------------
Q74LX8_LACJO/141-200.---------------------..........------------------------------------------------
Q5FIK1_LACAC/119-178.---------------------..........------------------------------------------------
Q74JH3_LACJO/126-184.---------------------..........------------------------------------------------
Q186H8_PEPD6/144-202.---------------------..........------------------------------------------------
Q5WLC0_BACSK/141-199.---------------------..........------------------------------------------------
Q8R5X9_FUSNN/83-142.---------------------..........------------------------------------------------
Q81R44_BACAN/99-158.---------------------..........------------------------------------------------
Q0VNU0_ALCBS/63-123.---------------------..........------------------------------------------------
Q3JBE9_NITOC/51-111.---------------------..........------------------------------------------------
A4XTT9_PSEMY/41-101.---------------------..........------------------------------------------------
Q0BZN8_HYPNA/53-112.---------------------..........------------------------------------------------
A1B2L4_PARDP/40-99.---------------------..........------------------------------------------------
Q9A8Q0_CAUCR/73-133.---------------------..........------------------------------------------------
Q988S6_RHILO/46-105.---------------------..........------------------------------------------------
A4YY21_BRASO/40-99.---------------------..........------------------------------------------------
Q2RPG4_RHORT/72-131.---------------------..........------------------------------------------------
V6F502_9PROT/38-95.---------------------..........------------------------------------------------
Q0AR59_MARMM/55-114.---------------------..........------------------------------------------------
A8LN27_DINSH/31-89.---------------------..........------------------------------------------------
A5VEY7_SPHWW/24-82.---------------------..........------------------------------------------------
Q8KFX7_CHLTE/45-103.---------------------..........------------------------------------------------
B4E758_BURCJ/39-96.---------------------..........------------------------------------------------
A9C057_DELAS/43-102.---------------------..........------------------------------------------------
E0TIH6_PARBH/43-102.---------------------..........------------------------------------------------
B0UCU3_METS4/66-129.---------------------..........------------------------------------------------
A3QGG2_SHELP/47-105.---------------------..........------------------------------------------------
Q7P204_CHRVO/118-188V---------------------RL......NE------------------------------------------------
ELAS_PSEAE/122-192I---------------------RL......GE------------------------------------------------
A1S2N2_SHEAM/113-188I---------------------ILY.....GK------------------------------------------------
Q2SJ90_HAHCH/129-208I---------------------YFD.....QE------------------------------------------------
B7VN56_VIBTL/116-190V---------------------RL......DE------------------------------------------------
F7YSQ2_VIBA7/118-194V---------------------RL......DE------------------------------------------------
HAPT_VIBCH/116-190V---------------------RL......DD------------------------------------------------
Q5ZZJ1_LEGPH/124-199I---------------------RP......DH------------------------------------------------
A1S4V2_SHEAM/92-162V---------------------IL......AE------------------------------------------------
Q211C9_RHOPB/96-155.---------------------..........------------------------------------------------
Q89L62_BRADU/85-144.---------------------..........------------------------------------------------
A4YNR6_BRASO/46-105.---------------------..........------------------------------------------------
Q6N7G2_RHOPA/56-115.---------------------..........------------------------------------------------
Q1H2G7_METFK/106-166.---------------------..........------------------------------------------------
A2SEW0_METPP/117-177.---------------------..........------------------------------------------------
Q1H2G7_METFK/31-90.---------------------..........------------------------------------------------
A5N159_CLOK5/17-76.---------------------..........------------------------------------------------
Q8DWU2_STRA5/78-136.---------------------..........------------------------------------------------

PF11396

A0M0Q0_GRAFK/54-143D---------------------.........V------------------------------------------------
A0M1R1_GRAFK/70-160N---------------------.........L------------------------------------------------
A5FIF1_FLAJ1/58-140F---------------------.........I------------------------------------------------
A5FNS8_FLAJ1/62-144I---------------------.........I------------------------------------------------
A6L337_BACV8/61-143F---------------------.........I------------------------------------------------
A6L4L1_BACV8/60-142V---------------------.........V------------------------------------------------
A6LDA3_PARD8/62-144I---------------------.........I------------------------------------------------
A6LDA4_PARD8/55-146A---------------------.........L------------------------------------------------
A6LDE6_PARD8/58-149Q---------------------.........L------------------------------------------------
C0QVH4_BRAHW/54-141C---------------------.........I------------------------------------------------
C0QYD0_BRAHW/35-117F---------------------.........I------------------------------------------------
C0R146_BRAHW/63-147T---------------------AE.....KFI------------------------------------------------
C0R148_BRAHW/33-123I---------------------IEKLSEDNLI------------------------------------------------
Q5L9Y2_BACFN/49-143E---------------------.........L------------------------------------------------
Q5LD45_BACFN/83-177A---------------------.........V------------------------------------------------
Q7MWB3_PORGI/60-142L---------------------.........V------------------------------------------------
Q7MWB4_PORGI/55-145A---------------------.........L------------------------------------------------
Q89YQ4_BACTN/58-150Q---------------------.........L------------------------------------------------
Q89YQ5_BACTN/61-144V---------------------.........V------------------------------------------------
Q8A994_BACTN/60-142I---------------------.........I------------------------------------------------
Q8YLV6_NOSS1/61-150D---------------------.........F------------------------------------------------
C7M630_CAPOD/59-141V---------------------.........V------------------------------------------------
D6D2V5_9BACE/45-136Q---------------------.........L------------------------------------------------
D6D5W5_9BACE/49-143R---------------------.........L------------------------------------------------
D6D6Q4_9BACE/56-146A---------------------.........L------------------------------------------------
Q0P802_CAMJE/53-133I---------------------.........L------------------------------------------------
Q0P9P8_CAMJE/51-132F---------------------.........L------------------------------------------------
Q5LBR7_BACFN/55-146A---------------------.........L------------------------------------------------
Q5LBR8_BACFN/60-141I---------------------.........I------------------------------------------------
Q5LG06_BACFN/60-151N---------------------.........L------------------------------------------------
Q5LG07_BACFN/61-143I---------------------.........V------------------------------------------------
Q5LIE1_BACFN/72-153L---------------------D.......SL------------------------------------------------
R5U7Q0_9BACE/57-144T---------------------.........L------------------------------------------------
R6WQR9_9PORP/57-147Q---------------------.........L------------------------------------------------
R6X3F2_9PORP/60-141V---------------------.........I------------------------------------------------
R6XCT8_9PORP/59-150Q---------------------.........L------------------------------------------------
R7EFG1_9BACE/61-142L---------------------.........I------------------------------------------------
R7EJJ2_9BACE/58-149N---------------------.........L------------------------------------------------
R7EKK7_9BACE/52-145K---------------------.........V------------------------------------------------
R7ELA9_9BACE/58-149D---------------------.........L------------------------------------------------
R7ERW1_9BACE/60-141I---------------------.........V------------------------------------------------
R7JJR5_9BACT/78-154V---------------------.........V------------------------------------------------

PF11399

K7AKJ7_9ALTE/17-119G---------------------IADFN--ELH.....------------------------------------------.
F5Z4M1_ALTNA/22-120G---------------------SPDIT--EAK.....------------------------------------------.
E1SS82_FERBD/33-127G---------------------NPDFS--EAL.....------------------------------------------.
Q8EGJ0_SHEON/23-131G---------------------ASDLS--ESY.LQQS------------------------------------------A
A1S8B9_SHEAM/20-120G---------------------APDFS--EAK.....------------------------------------------.
K7AKJ0_9ALTE/22-120G---------------------SPDIT--EAK.....------------------------------------------.
A3QGB8_SHELP/19-122G---------------------TADFN--EAY.....------------------------------------------.
Q15QZ2_PSEA6/17-119G---------------------VADFS--EFV.....------------------------------------------.
Q07ZE7_SHEFN/20-120G---------------------SADFV--EAK.....------------------------------------------.
Q47YB6_COLP3/19-119G---------------------VSDFS--ETY.....------------------------------------------.
Q8EGQ0_SHEON/20-120G---------------------KADFS--EAK.....------------------------------------------.
D4ZHG3_SHEVD/20-120G---------------------KADFS--EAK.....------------------------------------------.
D4ZHN7_SHEVD/34-137G---------------------RADFN--EAY.....------------------------------------------.
E1STL4_FERBD/20-123G---------------------TADFN--ELY.....------------------------------------------.
Q47YA7_COLP3/20-123G---------------------SPDIT--EAR.....------------------------------------------.
Q085F9_SHEFN/19-126G---------------------TADFS--EAY.TKST------------------------------------------Q
Q15QY7_PSEA6/21-120G---------------------GPDIS--EAK.....------------------------------------------.
Q12P24_SHEDO/19-126G---------------------TADFS--EAFVTQAS------------------------------------------A
Q5QW11_IDILO/20-120G---------------------SPDIT--EAK.....------------------------------------------.
Q3ICC6_PSEHT/21-122G---------------------SPDLT--FAK.....------------------------------------------.
G4QLZ6_GLANF/37-143G---------------------AADFN--EMV.....------------------------------------------.
Q12L38_SHEDO/26-125G---------------------EADFV--EAK.....------------------------------------------.
A3QGM5_SHELP/20-120G---------------------KADFS--EAK.....------------------------------------------.
A1S4M5_SHEAM/18-116G---------------------KADFH--EAW.....------------------------------------------.

PF04355

Q5NL78_ZYMMO/17-93G---------------------RPTLA..GEF------------------------------------------------
Q5LQJ9_RUEPO/35-111G---------------------TPSSS..GLL------------------------------------------------
Q1LSR9_BAUCH/37-105G---------------------TPIFQ..DQN------------------------------------------------
Q1LBA9_CUPMC/75-149D---------------------RPHFN.EGFL------------------------------------------------
A5WGN5_PSYWF/35-114G---------------------SPAMR..DSL------------------------------------------------
Q9CJV5_PASMU/34-104G---------------------TPVLV..EPF------------------------------------------------
BAME_PSYIN/35-104G---------------------SPMLI..DQF------------------------------------------------
Q220P9_RHOFT/38-108G---------------------TPLLS..SIF------------------------------------------------
BAME_NEIMB/36-106G---------------------SPILR..DAF------------------------------------------------
Q5NEF6_FRATT/34-106G---------------------SPDII..DTF------------------------------------------------
BAME_VIBF1/35-105G---------------------SPMLV..ESG------------------------------------------------
A6VMF3_ACTSZ/34-104G---------------------TPALK..DPF------------------------------------------------
Q7VRQ4_BLOFL/39-110E---------------------SPPTL.KNIF------------------------------------------------
BAME_NITEU/35-105G---------------------TPLVM..DIF------------------------------------------------
Q0C315_HYPNA/29-105G---------------------SPSTE..GLF------------------------------------------------
Q47XI1_COLP3/29-101G---------------------SPVVV..DAF------------------------------------------------
Q47HJ0_DECAR/36-107G---------------------TPLVA..DIF------------------------------------------------
Q5FUN3_GLUOX/45-121G---------------------SPTAH..ATF------------------------------------------------
Q2SMN2_HAHCH/93-162G---------------------SPVLE..STL------------------------------------------------
Q0A7D7_ALKEH/37-107G---------------------PPAVV..DPF------------------------------------------------
A1AX05_RUTMC/37-107G---------------------SPSII..DSF------------------------------------------------
Q3SSS7_NITWN/53-129G---------------------TPSTV..ATL------------------------------------------------
Q2RTT3_RHORT/36-112G---------------------TPSAT..SMF------------------------------------------------
Q2NRT5_SODGM/28-97G---------------------VPATS.STMI------------------------------------------------
A4VII8_PSEU5/29-97G---------------------EPSRA.TART------------------------------------------------
A7I1H3_CAMHC/52-124G---------------------TPHFA.AGLA------------------------------------------------
Q604C4_METCA/51-121G---------------------SPLTV..SPF------------------------------------------------
B0UR41_METS4/34-110G---------------------TPTTV..STV------------------------------------------------
Q15V54_PSEA6/31-104G---------------------KPVVE..DSF------------------------------------------------
Q31FS2_THICR/36-107G---------------------PPLGQ..DPF------------------------------------------------
A1WGT8_VEREI/51-121G---------------------SPLLT..SLF------------------------------------------------
A4SVD7_POLSQ/67-138G---------------------TPLLA..SYF------------------------------------------------
Q2NRZ9_SODGM/35-105G---------------------TSMMK..DPF------------------------------------------------
A1WCQ4_ACISJ/49-119G---------------------TPLMV..SVF------------------------------------------------
Q1LMT9_CUPMC/71-142G---------------------TPLLT..DVF------------------------------------------------
Q6FDQ3_ACIAD/30-107G---------------------SPTIT..DPL------------------------------------------------
Q7CZT7_AGRFC/48-124G---------------------TPSTT..ATF------------------------------------------------
Q0K704_CUPNH/51-122G---------------------TPLLN..DVF------------------------------------------------
Q21H32_SACD2/36-106G---------------------SPLLE..DTF------------------------------------------------
Q83C32_COXBU/30-100G---------------------TPVLT..NMY------------------------------------------------
A8GGW6_SERP5/28-97G---------------------PPSTT.ATLV------------------------------------------------
A5FV68_ACICJ/239-315G---------------------SPTLR..ETF------------------------------------------------
Q3SJS3_THIDA/32-102G---------------------TPLVV..DPF------------------------------------------------
A0KI84_AERHH/30-100G---------------------SAMLR..DGF------------------------------------------------
Q3IE33_PSEHT/35-105G---------------------KPIAE..NAF------------------------------------------------
A6W2D6_MARMS/31-103G---------------------NPMLR..DTF------------------------------------------------
Q2G501_NOVAD/31-107G---------------------RPTFT..SQF------------------------------------------------
A7HX93_PARL1/37-112G---------------------SPSTV..STV------------------------------------------------
Q983A2_RHILO/103-179G---------------------TPSTT..ATF------------------------------------------------
Q7NX33_CHRVO/32-104G---------------------TPLLT..DPF------------------------------------------------
Q2YBT7_NITMU/31-101G---------------------SPMIS..DAF------------------------------------------------
A2SC95_METPP/48-118G---------------------SPLLA..DIF------------------------------------------------
A1K8N9_AZOSB/69-139G---------------------TPLVV..DIF------------------------------------------------
A7INK8_XANP2/42-117G---------------------TPSTV..ATV------------------------------------------------
Q1QSW6_CHRSD/33-103G---------------------SPLLK..GPF------------------------------------------------
Q1H393_METFK/54-124G---------------------SPLIQ..DSF------------------------------------------------
A3MZE6_ACTP2/34-104G---------------------TPMLK..DTF------------------------------------------------
B0T0T5_CAUSK/29-105G---------------------SPSAT..STF------------------------------------------------
A1WX37_HALHL/38-106G---------------------TPVLE..HAF------------------------------------------------
Q11J87_CHESB/48-124G---------------------TPSTT..ATF------------------------------------------------
A4XUA2_PSEMY/28-96G---------------------PPSSQ.FEHS------------------------------------------------
Q28RF7_JANSC/34-109G---------------------SPGTG..GVM------------------------------------------------
Q5QXM4_IDILO/32-102G---------------------TPVAQ..NSF------------------------------------------------
BAME_BUCAI/32-101G---------------------IPIIS..DSF------------------------------------------------
Q0BTE4_GRABC/35-111G---------------------SPTTK..ATF------------------------------------------------
Q2NDV7_ERYLH/16-92G---------------------RPTFE..SQF------------------------------------------------
Q122Q0_POLSJ/29-99G---------------------TPLMA..SLF------------------------------------------------
Q3JBU9_NITOC/42-112G---------------------SPLLI..DSF------------------------------------------------
Q7VM11_HAEDU/34-104G---------------------TPMLK..DIF------------------------------------------------
Q6D4H9_PECAS/28-96G---------------------SGMEK..RLV------------------------------------------------
A5V7M5_SPHWW/32-109G---------------------RPSFA..GQF------------------------------------------------
Q1GPC4_SPHAL/37-113G---------------------RPTFV..GQF------------------------------------------------
Q0VSU2_ALCBS/35-105G---------------------APTLV..DPF------------------------------------------------
B0UU40_HISS2/52-121G---------------------RPHFS.EGLY------------------------------------------------
B0UV53_HISS2/34-103G---------------------TPMLI..DPF------------------------------------------------
B7VJW3_VIBTL/77-145G---------------------SPMLI..ENG------------------------------------------------
C1DFM7_AZOVD/35-101G---------------------SPLIT..DTF------------------------------------------------
D4Z6S0_SPHJU/63-138G---------------------RPSFV..AQF------------------------------------------------
M1FIJ3_9ALTE/29-96G---------------------TPLML..NPV------------------------------------------------
M9X398_MANHA/34-103G---------------------TPMLK..NIF------------------------------------------------
BAME_VIBCH/35-104G---------------------SPMLV..ENG------------------------------------------------
BAME_HAEIN/34-103G---------------------TPVLV..DPY------------------------------------------------
Q2KA05_RHIEC/31-105G---------------------TPSTT..ATF------------------------------------------------
Q2YNC3_BRUA2/49-124G---------------------TPSTT..ATF------------------------------------------------
Q3J361_RHOS4/40-116G---------------------RPSAS..TLL------------------------------------------------
BAME_PSYA2/52-130G---------------------SPAIR..DTL------------------------------------------------
Q5ZYK0_LEGPH/42-110G---------------------TSIMS..PTF------------------------------------------------
Q63LV3_BURPS/48-120G---------------------EPHFS.EGII------------------------------------------------
Q63QT2_BURPS/54-121G---------------------TPLLT..DMF------------------------------------------------
Q6LUB1_PHOPR/34-102G---------------------SPMLV..EPS------------------------------------------------
Q79GM4_BORPE/42-111G---------------------SPTLT..SVL------------------------------------------------
BAME_YERPE/38-107G---------------------TPMLQ..DPF------------------------------------------------
BAME_SALTY/35-104G---------------------TPMMT..DPF------------------------------------------------
Q87RX9_VIBPA/35-104G---------------------SPMLI..ENG------------------------------------------------
Q87VN2_PSESM/31-98G---------------------EPSTTIERKV------------------------------------------------
Q88DH0_PSEPK/30-95G---------------------SPSSV.IDLP------------------------------------------------
Q88DT8_PSEPK/35-101G---------------------NPLIQ..DTF------------------------------------------------
BAME_SHEON/38-105G---------------------RPVLR..DSF------------------------------------------------
BAME_XANCP/28-99G---------------------TPSIP..DPF------------------------------------------------
Q8XVT1_RALSO/61-130G---------------------SPLLT..DMF------------------------------------------------
Q92KF5_RHIME/42-116G---------------------TPSTT..ATF------------------------------------------------
Q9HUT7_PSEAE/31-97G---------------------TPSGTQKRLM------------------------------------------------
Q9JXT1_NEIMB/52-133G---------------------RPHYD.ESMY------------------------------------------------
Q9PB00_XYLFA/44-114G---------------------TPSIS..DIF------------------------------------------------
V6F1L4_9PROT/28-103G---------------------TPSSV..MPY------------------------------------------------

PF12978

Q8DTX1_STRMU/47-205G---------------------EPDVLSQSMS------------------------------------------------
B9DSB0_STRU0/47-205T---------------------EPDDYSHASS------------------------------------------------
G2SNY8_LACRR/70-224G---------------------EPDNLNEMKI------------------------------------------------
Q8DZF2_STRA5/47-206G---------------------EPDDISQAVS------------------------------------------------
Q99ZC4_STRP1/47-204T---------------------EPDNYSQASS------------------------------------------------

PF07467

Q9KJ90_STREX/2-185GGEAACDTGGVIGDSILCFTE.SGDYAPYGGFSFTDE...GELWSKRNEYLYKAKTPSVKLSHYNRTALGMTEAQLWAAV
B5GLC0_STRC2/2-181GADQSCSDQ...VERIICYNN.PDHYGPQGHFFFNAA...DKLIHKRQMELFPAPKPTMRLATYNKTQTGMTEAQFWAAV
BLIP_STRCL/10-200GAE.NCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKFNQVTVGMTRAQVLATV

PF14172

C0Z8F5_BREBN/45-177G---------------------TPVKSGNSEY------------------------------------------------
W0EAP8_9FIRM/51-184G---------------------EPDKTDWVPA------------------------------------------------
YJGB_BACSU/51-188G---------------------EPERPVGGDN------------------------------------------------
C0Z6K8_BREBN/118-238G---------------------KPEKTY...T------------------------------------------------
D3E8N0_GEOS4/57-196G---------------------EPSVPGKDAD------------------------------------------------
U5MR07_CLOSA/75-209G---------------------KADKSEWVTD------------------------------------------------
R4K5N0_CLOPA/85-219G---------------------KADNSEWVAS------------------------------------------------
C6D3T6_PAESJ/51-191G---------------------EAESPAKDSD------------------------------------------------
I3VRL4_THESW/85-217G---------------------NPDKQEYISS------------------------------------------------
C8WQ55_ALIAD/107-238G---------------------SPSSQAY..A------------------------------------------------
M1MNJ5_9CLOT/77-211G---------------------KADNAEWVTD------------------------------------------------
I4D7B6_DESAJ/531-665G---------------------KADKTEYIPS------------------------------------------------
F6DUI9_DESRL/67-201G---------------------EPDTMDYVPQ------------------------------------------------
Q8XI71_CLOPE/88-217G---------------------KPSSENYVAE------------------------------------------------
Q24YP2_DESHY/79-213G---------------------KPDSVDWVAA------------------------------------------------
A6LYS0_CLOB8/79-210G---------------------KADKSDWVGE------------------------------------------------
Q81PC7_BACAN/76-203G---------------------KADKTE..QA------------------------------------------------
G7M4A2_9CLOT/93-227G---------------------KEDKSEWVAD------------------------------------------------
A8MGG8_ALKOO/77-218G---------------------EPDESDYFLG------------------------------------------------
A8FAZ3_BACP2/47-191G---------------------NP.YPETGQS------------------------------------------------
C0Z6K8_BREBN/268-401G---------------------KPDVVSFV..------------------------------------------------
J7J151_DESMD/62-207G---------------------EPEKVDWVAA------------------------------------------------
X4Z8J4_9BACL/92-219G---------------------EPEKEE..SA------------------------------------------------

PF13670

Q0BXA6_HYPNA/7-95-ER.DDGK...WE------LE---.GC-----------------------------------------------------
Q0BXA5_HYPNA/6-84-EL.DDGE...WE------IE---.GC-----------------------------------------------------
Q0BY17_HYPNA/6-92-EA.RRGV...WR------VE---.GR-----------------------------------------------------
A4VHV2_PSEU5/30-109-EADGDG....WE------GE---.GM-----------------------------------------------------
A4XVH9_PSEMY/6-85-EADSDGY...WE------GE---.GL-----------------------------------------------------
Q1QMT6_NITHX/5-85-EADDGRC...WE------AK---..A-----------------------------------------------------
B8EKV5_METSB/3-81-EADDGY....WE------GK---..A-----------------------------------------------------
Q5LX53_RUEPO/50-129-ED.EDGK...IE------AY---..V-----------------------------------------------------
B8IVF4_METNO/5-90-KAEDG.C...YE------VR---.AV-----------------------------------------------------
B3PI60_CELJU/2-85-KVTDGNC...YE------IY---.GW-----------------------------------------------------
C1DNM7_AZOVD/2-85-KVTDGNC...YE------IY---.GF-----------------------------------------------------
Q1LBN9_CUPMC/3-85-KV.DGNC...YE------IY---.GT-----------------------------------------------------
Q8XWW7_RALSO/3-85-KV.DGHC...YE------IY---.GT-----------------------------------------------------
A1K227_AZOSB/5-88-KVTSGNC...YE------IY---.GK-----------------------------------------------------
Q5P431_AROAE/5-88-KTTDGNC...YE------IY---.GK-----------------------------------------------------
Q5P432_AROAE/18-101-QVTKGNC...YE------LY---.GM-----------------------------------------------------
D0KWU4_HALNC/5-88-KVTDGNC...FE------IY---.GW-----------------------------------------------------
B0SVT0_CAUSK/5-90-QV.SGSC...YE------IY---.AM-----------------------------------------------------
A7IQ54_XANP2/6-90-KKTTSGC...YE------IY---.GY-----------------------------------------------------
B1Y4P0_LEPCP/3-85-KVSKGRC...YE------IY---.GF-----------------------------------------------------
B8IVE9_METNO/4-91-KIAKA.C...GE------IY---.AL-----------------------------------------------------
Q1QM54_NITHX/4-90-KLKNA.C...GE------FY---.TL-----------------------------------------------------
A1B769_PARDP/5-86-KIDDG.C...YE------IK---.GT-----------------------------------------------------
A1B772_PARDP/5-86-EADDG.C...WE------VK---.GR-----------------------------------------------------
B6JDT2_OLICO/6-87-KIDDG.C...YQ------IR---.GI-----------------------------------------------------
A1U059_MARHV/5-86-KVDDG.C...YE------VR---.GL-----------------------------------------------------
A1SRM1_PSYIN/5-86-KVDDN.C...YE------VK---.AL-----------------------------------------------------
B9K2Y3_AGRVS/4-85-RSGDG.C...YE------AH---.AV-----------------------------------------------------
A7IKT6_XANP2/6-87-RSDDG.C...YK------VR---.AT-----------------------------------------------------
A1B771_PARDP/5-86-ELDDG.C...YE------LN---.VI-----------------------------------------------------
Q0S079_RHOJR/10-95-EIGDEES..LYE------VE---.VT-----------------------------------------------------
A8LNS6_DINSH/4-81-EVEDDG....YD------LD---DVI-----------------------------------------------------
B1M6N2_METRJ/3-84-EL.DDGM...IE------VD---DAI-----------------------------------------------------
A7HVA0_PARL1/7-87-EF.DDNR...WE------VD---DAR-----------------------------------------------------
C5AT97_METEA/7-83-EA.DDGV...WK------AK---..A-----------------------------------------------------
G2J097_PSEUL/8-86-KV.DGNC...YE------LY---.GK-----------------------------------------------------
Q2YRI6_BRUA2/6-85-EI.DDGC...YE------LH---.VT-----------------------------------------------------
Q3J9Y2_NITOC/7-84-EFDDD.K...WE------VD---..V-----------------------------------------------------
Q5F6R1_NEIG1/7-90-DADDYWGKPVLE------VE---..A-----------------------------------------------------

PF03413

Q9K7V1_BACHD/28-100-DHLSYTV---YR.-----GG---.IS.......SSN-------------------------------------------
Q816W8_BACCR/30-100-YDVAYEV---YR.-----GG---.LT..T.....ML-------------------------------------------
Q8EP78_OCEIH/29-101-NGLLYDV---YR.-----GG---.VT.......RNI-------------------------------------------
U5LGT7_9BACI/29-101-HGLSYNV---YK.-----GG---.IS..R.....TA-------------------------------------------
Q03RI8_LACBA/34-106-FAVKSRV---YY.-----GG---.IN.......RYE-------------------------------------------
Q03GC8_PEDPA/34-106-YGLKASV---YY.-----GG---.IT.......KYE-------------------------------------------
Q82ZL5_ENTFA/37-109-FAIHSKT---YT.-----GG---.IC.......RIE-------------------------------------------
Q5HNG3_STAEQ/33-102-INHNQPI---YQ.-----GG---.IT.......VLK-------------------------------------------
B1YKF6_EXIS2/28-100-ESRDYQS---YK.-----GG---.IS.......VLE-------------------------------------------
Q181V6_PEPD6/408-465-..AEDNE---YE.-----AK---.VI..K.......-------------------------------------------
Q181V6_PEPD6/490-547-..EDDKE---YE.-----GE---.II..K.......-------------------------------------------
Q8TTA4_METAC/138-199-..DGMAV---YE.-----GS---IVF..........-------------------------------------------
A8MEK6_ALKOO/172-230-..DDTAE---YE.-----IE---ILK..........-------------------------------------------
A8MEK6_ALKOO/94-155-.HNDTSE---YE.-----IK---ILK..........-------------------------------------------
A8MEK5_ALKOO/294-355-.EEDEAK---YE.-----IK---ITE..........-------------------------------------------
Q5WGU9_BACSK/378-439-.NEEVFV---YE.-----FY---.GT..R.......-------------------------------------------
YPEB_BACSU/377-438-.GQEVLC---YE.-----ML---.GT..I.......-------------------------------------------
A8FEM8_BACP2/376-437-.SEEVLC---YE.-----FL---.GT..I.......-------------------------------------------
YPEB_BACHD/374-435-.GEEVLC---YE.-----FF---.GV..I.......-------------------------------------------
YPEB_OCEIH/373-434-.GEEVLT---YE.-----FL---.GI..M.......-------------------------------------------
A3DI39_CLOTH/391-452-.KTELFT---YE.-----FK---.GK..L.......-------------------------------------------
A0Q324_CLONN/379-440-.NKEILC---YE.-----VA---.GK..C.......-------------------------------------------
Q2RM03_MOOTA/386-447-.GQEKLT---YE.-----VK---.TK..M.......-------------------------------------------
A8MIH5_ALKOO/376-437-.GKEILT---YE.-----FK---.VK..F.......-------------------------------------------
Q12WY7_METBU/120-186-..TVMVV---YS.-----YP---.KV..GAMTTVKD-------------------------------------------
Q6W134_SINFN/286-345-..TPTGV---YT.-----GS---.VY..P.....DD-------------------------------------------
Q8ELE8_OCEIH/178-237-..TDDGV---YT.-----IS---.VF..P.....PK-------------------------------------------
Q9KBS1_BACHD/273-331-..EQDSV---YT.-----VS---.AY..P.....PR-------------------------------------------
Q5KVG3_GEOKA/282-341-..GPKGV---FT.-----VA---.TS..K.....TK-------------------------------------------
Q9KE75_BACHD/288-347-..GDTGV---YT.-----IA---.SS..H.....TK-------------------------------------------
A9B7B4_HERA2/311-370-..GEKGV---YT.-----IA---.AV..A.....ND-------------------------------------------
Q3SKV5_THIDA/55-112-..APQET---YL.-----VK---.LN..........-------------------------------------------
Q3JE96_NITOC/270-334-..GPEGV---YA.-----IE---.KR..QPGEANQR-------------------------------------------
Q9A7E1_CAUCR/252-316-..TDSGV---YR.-----LR---.LQ..T.....PG-------------------------------------------
Q020P0_SOLUE/231-293-..GPKGA---YQ.-----IR---.SR..FPEDLTPG-------------------------------------------
Q82WV7_NITEU/279-343-..NAEGV---Y..-----IV---.TQ..KHVPKLSA-------------------------------------------
A4FCJ5_SACEN/417-477-..GADGV---FS.-----VA---.ER..S....NGV-------------------------------------------
Q9KE75_BACHD/74-132-..DPQRT---TE.-----IS---.MM.........K-------------------------------------------
Q5WLI5_BACSK/75-133-..DPRRT---TE.-----FV---.IR.........E-------------------------------------------
Q47KW9_THEFY/83-144-..GPEDS---TR.-----VL---.FQ...V..DGLE-------------------------------------------
Q825U8_STRAW/84-147-..EADAT---TR.-----VL---.LS...GV.KGVD-------------------------------------------
A0R6J4_MYCS2/78-140-..EPTET---TQ.-----VQ---.LS...V..DDVP-------------------------------------------
A1T724_MYCVP/79-141-..GATES---TR.-----VY---.FV...D..PALD-------------------------------------------
Q6NKB0_CORDI/71-132-..NPDQA---TR.-----VM---.FN...D..PTLP-------------------------------------------
Q9KBS1_BACHD/60-118-..SSTRS---SE.-----VT---.LS.........T-------------------------------------------
Q8P606_XANCP/82-140-..RADAS---AE.-----IG---.VL..R......T-------------------------------------------
Q7CY41_AGRFC/75-132-..DPGAS---TE.-----IT---.VD.........T-------------------------------------------
Q2RPK6_RHORT/75-133-..QPDLS---AE.-----VT---.IK........TA-------------------------------------------
Q6W134_SINFN/75-133-..SPVSS---AE.-----IT---.VS........TE-------------------------------------------
Q1R143_CHRSD/68-125-..ASNLA---AE.-----VD---.IT.........T-------------------------------------------
Q7NVU2_CHRVO/229-292-..ESKPG---SP.-----LL---.LR..WKLPGELH-------------------------------------------
Q8A623_BACTN/26-84-..DPERT---YQ.-----VS---.LS..K.......-------------------------------------------
Q884E8_PSESM/67-126-..GDYFA---LS.-----VF---.VT........YP-------------------------------------------
Q9I178_PSEAE/60-119-..EEHFA---LT.-----AE---.VS........YP-------------------------------------------
Q1LJM8_CUPMC/260-324-..KPGDA---YE.-----VR---.LR...Q..EGEV-------------------------------------------
Q82P05_STRAW/125-192-.GGSALA---YQ.-----VR---.VT..D....SKT-------------------------------------------
Q9L1F9_STRCO/146-216-QGKPVLA---YE.-----..---.....TVVGGLQD-------------------------------------------
Q82BN5_STRAW/115-187-HGAPKLA---WR.-----TN---.VV..G....QDS-------------------------------------------
Q9L2B8_STRCO/168-232-HGDGRPA---WE.-----VE---.TR..A....SGE-------------------------------------------
Q0AQU2_MARMM/109-177-AGLSVPA---WR.-----ID---.FE..A.......-------------------------------------------
E0THY6_PARBH/109-174-YGPGGPV---WQ.-----VQ---.FD..D.......-------------------------------------------
Q63MT4_BURPS/165-233-GAGTHTA---WK.-----VS---.GR..P....QDS-------------------------------------------
Q03XK6_LEUMM/140-199-..DGRTY---WE.-----IS---.LK..D.......-------------------------------------------
Q9KC80_BACHD/94-154-..NEHPI---YE.-----VT---.YY..D.......-------------------------------------------
Q5KXX8_GEOKA/94-154-..KGVPL---WE.-----LT---.YI..D.......-------------------------------------------
Q1WU38_LACS1/104-164-..NNKPV---WE.-----VT---.YL..N.......-------------------------------------------
A8FEH2_BACP2/99-159-..GDVLL---WE.-----VT---.YL..N.......-------------------------------------------
Q6ANJ0_DESPS/50-117-SEQKQPV---YK.-----IV---.TY..K.......-------------------------------------------
Q8R5X9_FUSNN/10-69-..KDKTV---YE.-----..---..........GEA-------------------------------------------
Q8E0L6_STRA5/117-180-.ENGKSV---YD.-----ID---.FV..D.......-------------------------------------------
Q8RBF9_CALS4/109-184-..YYDAN---YS.-----FS---.FE..RIVNGISF-------------------------------------------
B8I195_CLOCE/108-180-TYGYNGG---YI.-----IN---.YV..REVNGIEY-------------------------------------------
Q1D8Q2_MYXXD/168-239-SGEYHSA---YR.-----VE---.VT..N....VDG-------------------------------------------
Q81MX8_BACAN/145-217-..KATNA---YQ.-----IT---.FS..A......S-------------------------------------------
Q5ZRA6_LEGPH/16-86-..KAHLA---YH.-----LS---.YY..S....NSE-------------------------------------------
Q87I51_VIBPA/131-204-..VAHLA---YE.-----IQ---.FF..ADS.EQAL-------------------------------------------
Q2FUX4_STAA8/118-192-GDSNKYV---YN.-----VE---.LI..T......V-------------------------------------------
PRTA_LISMO/121-194-..TKRLV---YN.-----IK---.LI..F......A-------------------------------------------
Q97G52_CLOAB/161-230-NGVATTV---YS.-----VN---.IH..Y......N-------------------------------------------
Q97G51_CLOAB/153-222-NATAILV---YS.-----VN---.IH..Y......T-------------------------------------------
Q97GS5_CLOAB/161-230-..KNYEV---FK.-----VN---.IY..Y.....TN-------------------------------------------
A5I1S2_CLOBH/148-212-EGKPYVV---YL.-----VN---.TM..T.......-------------------------------------------
Q81R73_BACAN/122-192-EGIARPV---YK.-----VV---.VH..S.......-------------------------------------------
Q815U2_BACCR/146-219-DGNYYLA---YL.-----VK---.AS..I......S-------------------------------------------
NPRB_BACSU/145-217-DGEYDLA---YL.-----VR---.LS..T......S-------------------------------------------
Q8ESH1_OCEIH/143-217-.EADPYI---YEY-----ED---EFYFTYLVTASTT-------------------------------------------
B1YFR1_EXIS2/113-183-..DAVYA---YK.-----VT---.ST..V.....LA-------------------------------------------
Q81I21_BACCR/151-220-GEETTYA---YV.-----VN---.LN..F.....L.-------------------------------------------
Q8DVN1_STRMU/57-120-..DGVTE---FE.-----VE---FTK..........-------------------------------------------
Q99YI6_STRP1/81-143-..DGKAV---YE.-----IE---.FQ..........-------------------------------------------
R6P3S5_9CLOT/179-241-..DGRLV---YE.-----VE---.FY..A.......-------------------------------------------
Q8ESN0_OCEIH/32-90-..DGEPV---YQ.-----IE---.VR..Q.......-------------------------------------------
A5G759_GEOUR/48-108-..RGKNV---YV.-----VE---IIE..........-------------------------------------------
O27358_METTH/81-143-.MDGKLV---YV.-----VP---.IE..M......G-------------------------------------------
Q8ERG4_OCEIH/132-194-..DGVAT---YE.-----IE---.FE..N.......-------------------------------------------
Q5WLC0_BACSK/58-117-..RGTWQ---YE.-----IQ---GLD..........-------------------------------------------
Q82ZK1_ENTFA/63-122-..FGRYF---YE.-----IE---GVD..........-------------------------------------------
Q5FIK1_LACAC/43-101-..NGRYV---YE.-----IE---GFS..........-------------------------------------------
Q5FIK0_LACAC/62-121-..GSQYI---YE.-----IE---GFD..........-------------------------------------------
Q74JH3_LACJO/49-108-..KNKYI---YE.-----VE---GFD..........-------------------------------------------
Q8ERG4_OCEIH/56-114-..NFEYT---YE.-----IE---............G-------------------------------------------
Q186H8_PEPD6/62-121-..LNKFV---YT.-----VE---............G-------------------------------------------
Q9KFU6_BACHD/49-108-..NGRVV---YE.-----IE---.VK..........-------------------------------------------
Q8ESM9_OCEIH/39-97-..DNQTH---YE.-----VE---VIN..........-------------------------------------------
Q81R43_BACAN/43-101-..DDKGV---YE.-----IE---.VE..........-------------------------------------------
Q8ELD0_OCEIH/32-90-..DEENY---YE.-----IE---.IE..S.......-------------------------------------------
Q4K807_PSEF5/38-102-..TGAYV---YQ.-----VE---.LR..D.......-------------------------------------------
C1DJ09_AZOVD/39-99-..YGRYI---YQ.-----VE---LRD..........-------------------------------------------
A4XTT8_PSEMY/39-99-..YGRYI---YQ.-----VD---LRD..........-------------------------------------------
Q0VNT9_ALCBS/52-112-..YGRYL---YQ.-----VE---LRD..........-------------------------------------------
Q0S7B7_RHOJR/138-198-..DGKTV---WH.-----IH---IRD..........-------------------------------------------
Q5F637_NEIG1/47-105-..DGRPH---YD.-----VE---IVK..........-------------------------------------------
Q1ARP9_RUBXD/67-126-..DGLLA---YK.-----VQ---ILD..........-------------------------------------------
Q9L126_STRCO/188-249-..DQQVV---WG.-----VD---VVD..........-------------------------------------------
Q9L2B8_STRCO/83-152-DRRERAA---WE.-----VD---VLA..........-------------------------------------------
A9C057_DELAS/120-179-..WGQTS---YQ.-----VE---VLQ..........-------------------------------------------
Q8RD03_CALS4/115-173-..NGYLV---YS.-----VE---IKT..........-------------------------------------------
A8FCD9_BACP2/110-169-..NGVYL---YE.-----VE---ITT..........-------------------------------------------
YKOJ_BACSU/108-167-..DGAYI---YE.-----ME---IQT..........-------------------------------------------
Q8ESM9_OCEIH/119-177-..DGKYV---YE.-----IE---VRD..........-------------------------------------------
YKOI_BACSU/164-223-..EGTLI---FE.-----VD---.VD..L.......-------------------------------------------
A8FCD8_BACP2/167-226-..SGMLV---FE.-----VE---LDL..........-------------------------------------------
Q5WKR9_BACSK/175-233-..DGLLV---YE.-----IE---IET..........-------------------------------------------
Q9KFU7_BACHD/111-170-..NGLHV---YE.-----IE---IEV..........-------------------------------------------
Q9KFU6_BACHD/130-191-..NGSLV---YE.-----VE---IES.........D-------------------------------------------
Q5WKR8_BACSK/122-181-..DGQYV---YE.-----IE---VET..........-------------------------------------------
Q38Z32_LACSS/130-188-..DGVVY---WE.-----IE---.GH..Q.......-------------------------------------------
Q2G105_STAA8/129-187-..DGKLV---YN.-----ID---.LK..........-------------------------------------------
Q5FIK0_LACAC/141-199-..HGKTY---WN.-----VE---VGE..........-------------------------------------------
Q82ZK1_ENTFA/146-205-..LGITY---WE.-----VK---VKE..........-------------------------------------------
Q74LX8_LACJO/141-200-..DGKAI---WE.-----VT---VES..........-------------------------------------------
Q5FIK1_LACAC/119-178-..NSRSV---WE.-----VT---VTK..........-------------------------------------------
Q74JH3_LACJO/126-184-..DQQPV---WK.-----VE---LKD..........-------------------------------------------
Q186H8_PEPD6/144-202-..LDVTF---YK.-----IR---IDK..........-------------------------------------------
Q5WLC0_BACSK/141-199-..DQVTY---YE.-----VT---VTN..........-------------------------------------------
Q8R5X9_FUSNN/83-142-..NKRAY---YI.-----VE---VKE..........-------------------------------------------
Q81R44_BACAN/99-158-..NEIEV---FV.-----IT---.VE..T......N-------------------------------------------
Q0VNU0_ALCBS/63-123-..DGQLI---YE.-----IE---LLT..........-------------------------------------------
Q3JBE9_NITOC/51-111-..DGLYV---YE.-----LE---ILT..........-------------------------------------------
A4XTT9_PSEMY/41-101-..DGILV---YE.-----VE---ILT..........-------------------------------------------
Q0BZN8_HYPNA/53-112-..DGYLI---YE.-----IE---VLT..........-------------------------------------------
A1B2L4_PARDP/40-99-..DGMTI---YE.-----IE---LVT..........-------------------------------------------
Q9A8Q0_CAUCR/73-133-..PGRLK---YD.-----LK---ILA..........-------------------------------------------
Q988S6_RHILO/46-105-..ADRWV---YR.-----FQ---.VV..G.......-------------------------------------------
A4YY21_BRASO/40-99-..RGRWR---YE.-----FR---VIG..........-------------------------------------------
Q2RPG4_RHORT/72-131-..HDGLV---YE.-----IT---.LV..S.......-------------------------------------------
V6F502_9PROT/38-95-..RGTLV---YE.-----LK---.VL..A.......-------------------------------------------
Q0AR59_MARMM/55-114-..GASPR---YV.-----IK---ILT..........-------------------------------------------
A8LN27_DINSH/31-89-..LGALV---YE.-----IE---IVS..........-------------------------------------------
A5VEY7_SPHWW/24-82-..GGRLV---YE.-----ID---LVR..........-------------------------------------------
Q8KFX7_CHLTE/45-103-..GGQPV---YD.-----VE---.VV..N.......-------------------------------------------
B4E758_BURCJ/39-96-..KQGWV---YD.-----VE---.VV..........-------------------------------------------
A9C057_DELAS/43-102-..GMGLR---YE.-----IE---VIT..........-------------------------------------------
E0TIH6_PARBH/43-102-..DNALL---WT.-----VE---TMT..R.......-------------------------------------------
B0UCU3_METS4/66-129-.SNNPAH---WE.-----IK---.VV..Y.......-------------------------------------------
A3QGG2_SHELP/47-105-..NGNPG---YR.-----AK---.LL..S.......-------------------------------------------
Q7P204_CHRVO/118-188-RNVAQLV---YL.-----VS---.FV...V..DGK.-------------------------------------------
ELAS_PSEAE/122-192-NNIAQLV---YN.-----VS---.YL..I.......-------------------------------------------
A1S2N2_SHEAM/113-188-AQEPRLV---YI.-----TS---.YV...V..DGD.-------------------------------------------
Q2SJ90_HAHCH/129-208-SEQAKLV---YV.-----VN---.YF..SEATKGAP-------------------------------------------
B7VN56_VIBTL/116-190-NQVAQVV---YL.-----VD---FFI..A.....SS-------------------------------------------
F7YSQ2_VIBA7/118-194-NQMAQMV---YL.-----VD---.FF..V....ATN-------------------------------------------
HAPT_VIBCH/116-190-NQQAQLV---YL.-----VD---.FF..V....ASE-------------------------------------------
Q5ZZJ1_LEGPH/124-199-NNQLKLV---YL.-----VS---.FK..SV..QQDG-------------------------------------------
A1S4V2_SHEAM/92-162-GDAPRLA---YR.-----VS---.FL..SEGVNEIS-------------------------------------------
Q211C9_RHOPB/96-155-..LDRPA---YK.-----VK---TLQ..........-------------------------------------------
Q89L62_BRADU/85-144-..SGVPV---YR.-----VK---TLH..........-------------------------------------------
A4YNR6_BRASO/46-105-..LDVPV---YK.-----VR---TLR..........-------------------------------------------
Q6N7G2_RHOPA/56-115-..AEGLV---YR.-----VR---AAR..........-------------------------------------------
Q1H2G7_METFK/106-166-..NGAAS---YE.-----FD---IKT..........-------------------------------------------
A2SEW0_METPP/117-177-..DGTPV---YE.-----FD---IEQ..........-------------------------------------------
Q1H2G7_METFK/31-90-..GETPV---YE.-----FD---.IE..S.......-------------------------------------------
A5N159_CLOK5/17-76-..DGLLV---YE.-----IH---.IR..T.......-------------------------------------------
Q8DWU2_STRA5/78-136-..GDTPF---YE.-----IK---.VI..D.......-------------------------------------------

PF11396

A0M0Q0_GRAFK/54-143-TQNILSS---LK------SN---.FPGY.EIEEVEI-------------------------------------------
A0M1R1_GRAFK/70-160-PEAIKKV---IK------EK---.YSDY.EITEVEH-------------------------------------------
A5FIF1_FLAJ1/58-140-PDNIKAY---VA------KN---.HPN....EKITH-------------------------------------------
A5FNS8_FLAJ1/62-144-PKKVASY---IK------EN---.FPK....EKVTK-------------------------------------------
A6L337_BACV8/61-143-PQAISKY---MK------AN---.YNG....HKTVK-------------------------------------------
A6L4L1_BACV8/60-142-PDAIKKY---VA------TN---.YPD....AKMLK-------------------------------------------
A6LDA3_PARD8/62-144-PEVIQDL---IK------KN---.YSS....NKVVK-------------------------------------------
A6LDA4_PARD8/55-146-PQTVKNS---FE------AS---LYAKW.KIDDVDM-------------------------------------------
A6LDE6_PARD8/58-149-PAAVSTA---FK------QS---FYSNW.TVDDTYA-------------------------------------------
C0QVH4_BRAHW/54-141-HKSMVNV---ID------NE---.YPH....SKITD-------------------------------------------
C0QYD0_BRAHW/35-117-DKKVLNT---VK------KT---.NPD....AAIIK-------------------------------------------
C0R146_BRAHW/63-147-DSKIMNI---IK------NK---.YT......SINN-------------------------------------------
C0R148_BRAHW/33-123-EKEIIKT---IK------NK---.YTD....FNIYR-------------------------------------------
Q5L9Y2_BACFN/49-143-SATVYNA---YA------SG---PYSGW.QVEDVTY-------------------------------------------
Q5LD45_BACFN/83-177-PAAVAKA---FM------QS---TMASM.QLEDVRI-------------------------------------------
Q7MWB3_PORGI/60-142-PAPILRH---IS------SQ---.YPD....LYIVQ-------------------------------------------
Q7MWB4_PORGI/55-145-PKAVRAA---FE------AS---EYAKW.KIEDIDK-------------------------------------------
Q89YQ4_BACTN/58-150-VPAVYTG---FR------NS---NYSSW.VVTDVFV-------------------------------------------
Q89YQ5_BACTN/61-144-PSFAVSY---LK------EH---NFT.....EPVTK-------------------------------------------
Q8A994_BACTN/60-142-PAAIQKY---VT------TN---.YPD....AKVLK-------------------------------------------
Q8YLV6_NOSS1/61-150-PPIVLKR---IN------QE---RPG.Y.IITKY.E-------------------------------------------
C7M630_CAPOD/59-141-PEKILAH---VR------AT---.FPF....ESIKE-------------------------------------------
D6D2V5_9BACE/45-136-VPAVYTA---FI------DS---KYNAW.VVTDVYV-------------------------------------------
D6D5W5_9BACE/49-143-SPAVYNA---FV------SG---PYASW.VVDNVTM-------------------------------------------
D6D6Q4_9BACE/56-146-PQAVKTS---FE------KS---EYASW.KQDDVDK-------------------------------------------
Q0P802_CAMJE/53-133-PN.VMKK---VS------AT---.QPN....AQILE-------------------------------------------
Q0P9P8_CAMJE/51-132-PQNLANI---IK------NE---.FPN....TKARE-------------------------------------------
Q5LBR7_BACFN/55-146-PAAVKSA---FE------SS---EYAKW.KVDDVDM-------------------------------------------
Q5LBR8_BACFN/60-141-PSPIQKY---TA------TN---.YPD....AKVLK-------------------------------------------
Q5LG06_BACFN/60-151-PPAVLTA---FM------ES---SYNNW.VVDDVVI-------------------------------------------
Q5LG07_BACFN/61-143-PDFVKEY---MK------AN---GYHS....EFVTQ-------------------------------------------
Q5LIE1_BACFN/72-153-WGKIIEY---VQ------QL---.FPD....DPFIG-------------------------------------------
R5U7Q0_9BACE/57-144-PDPVKNT---IH------AT---.YPGRVDDDDTEY-------------------------------------------
R6WQR9_9PORP/57-147-PDAVKTA---FQ------QG---EYSTW.KVDDVDM-------------------------------------------
R6X3F2_9PORP/60-141-PEAILRY---VK------AT---.YPD....HKVVK-------------------------------------------
R6XCT8_9PORP/59-150-PTAISND---IK------QG---KYAGW.KIEEADT-------------------------------------------
R7EFG1_9BACE/61-142-PVPVKEY---VK------AN---.FPR....EIITK-------------------------------------------
R7EJJ2_9BACE/58-149-PGTVQTS---FS------AS---EYAGW.KIEEIVL-------------------------------------------
R7EKK7_9BACE/52-145-PAPVAEA---FM------SS---TMTGM.RLRDIRI-------------------------------------------
R7ELA9_9BACE/58-149-PAPVRSS---YE------SS---TYYNVWKVEDVDK-------------------------------------------
R7ERW1_9BACE/60-141-PEAIRNY---VK------TN---.YPD....ARILQ-------------------------------------------
R7JJR5_9BACT/78-154-PAQIADY---VA------RN---.FPG....TFLVG-------------------------------------------

PF11399

K7AKJ7_9ALTE/17-119SKGDDT.Y---QVL-----YF---RTQRI-----DED---------------------------------GVTT------
F5Z4M1_ALTNA/22-120RQNENA.I---QVM-----FY---RTQHV-----RAD---------------------------------GLTT------
E1SS82_FERBD/33-127TDHDGHGI---QVL-----RY---RTHRT-----KGD---------------------------------GETT------
Q8EGJ0_SHEON/23-131GQADKE.V---LVL-----FY---RTQRS-----HSD---------------------------------GKTT------
A1S8B9_SHEAM/20-120SIKDSA.L---QVL-----FY---RTHHE-----KSD---------------------------------GVTT------
K7AKJ0_9ALTE/22-120RNDDKE.L---QVM-----FY---RTQHR-----QAD---------------------------------GITT------
A3QGB8_SHELP/19-122TKQDKT.I---NVL-----YY---RTQRT-----RED---------------------------------GTTT------
Q15QZ2_PSEA6/17-119KKGDDQ.Y---HVL-----YY---RTQRK-----DDD---------------------------------GVTT------
Q07ZE7_SHEFN/20-120TGIDGQ.Y---QVM-----YY---RTHHI-----KSD---------------------------------GETT------
Q47YB6_COLP3/19-119ADGDNT.V---RVL-----YY---RTQRK-----HKD---------------------------------GLTT------
Q8EGQ0_SHEON/20-120SLKDGQ.L---QVL-----FY---RTQHD-----KSD---------------------------------GVTT------
D4ZHG3_SHEVD/20-120VTGDDA.L---QVL-----FY---RTHHA-----QSD---------------------------------GKTT------
D4ZHN7_SHEVD/34-137IEKDKE.V---HVL-----FY---RTQRI-----KGD---------------------------------GKTT------
E1STL4_FERBD/20-123QQQEDQ.V---QVL-----YY---RTHRT-----RGD---------------------------------SKTT------
Q47YA7_COLP3/20-123TIDKIN.Y---QVM-----FY---RTQHV-----KSD---------------------------------GITT------
Q085F9_SHEFN/19-126NNAEQS.I---KVL-----FY---RTQWA-----EGD---------------------------------GKTT------
Q15QY7_PSEA6/21-120KTDGGM.Y---QVM-----FF---RTQHV-----KSD---------------------------------GITT------
Q12P24_SHEDO/19-126QDAEQQ.V---QVF-----FY---RTQWS-----KGD---------------------------------GKTT------
Q5QW11_IDILO/20-120ASSEGD.M---QVL-----FY---RTHHV-----TSD---------------------------------GITT------
Q3ICC6_PSEHT/21-122RDEDQV.W---QIV-----FY---RTQHK-----TSD---------------------------------GITT------
G4QLZ6_GLANF/37-143SSNGDA.V---QVL-----YY---RTQRV-----DDD---------------------------------GITT------
Q12L38_SHEDO/26-125TVTGTA.L---QIM-----YY---RTHHI-----KGD---------------------------------GITT------
A3QGM5_SHELP/20-120SSNQDT.L---QVL-----FY---RTHHS-----KSD---------------------------------GETT------
A1S4M5_SHEAM/18-116QADGKE.V---QVF-----FY---RTHRL-----HGD---------------------------------GSTT------

PF04355

Q5NL78_ZYMMO/17-93-DPN.V-W---Y.Y-----IS---TDTKQLVFSLPKA.-------------------------..........Y------
Q5LQJ9_RUEPO/35-111-NES.G-Y---Y.Y-----VA---SRMR......HYGA-------------------------RA.....PQVV------
Q1LSR9_BAUCH/37-105-N...T-W---Y.Y-----ID---RCKIN.....HQH.-------------------------..........L------
Q1LBA9_CUPMC/75-149-GVR.E-W---D.Y-----LF---NFRTG.....RAA.-------------------------.........PN------
A5WGN5_PSYWF/35-114-APN.R-W---D.Y-----IY---DYKPG.....TYGK-------------------------REG..KQIIKN------
Q9CJV5_PASMU/34-104-DQS.K-W---Y.Y-----VF---LQQKA.....YQK.-------------------------..........P------
BAME_PSYIN/35-104-DSS.K-W---Y.Y-----IR---YIKPG.....GEP.-------------------------..........I------
Q220P9_RHOFT/38-108-HAD.R-W---D.Y-----VF---TFKRQ.....GLA.-------------------------..........P------
BAME_NEIMB/36-106-HTD.R-W---D.Y-----TF---NTSRN.....GII.-------------------------..........K------
Q5NEF6_FRATT/34-106-NPN.Q-Y---V.Y-----IN---TYKRN.....MQD.-------------------------..........T------
BAME_VIBF1/35-105-YPN.T-W---Y.Y-----IY---HFTHG.....HEK.-------------------------..........S------
A6VMF3_ACTSZ/34-104-STQ.T-W---Y.Y-----VY---LQQRA.....YET.-------------------------..........P------
Q7VRQ4_BLOFL/39-110-GSN.T-W---Y.Y-----VY---HKCYS.....SKL.-------------------------..........L------
BAME_NITEU/35-105-HGD.R-W---D.Y-----IY---RTAPG.....GRV.-------------------------..........A------
Q0C315_HYPNA/29-105-DTN.I-W---F.Y-----YS---DIQE......RFAF-------------------------YR.....PKVV------
Q47XI1_COLP3/29-101-NND.T-W---N.Y-----VY---KLKSG.....RSK.-------------------------..........D------
Q47HJ0_DECAR/36-107-HQQ.R-W---D.Y-----VY---RYQNG.....QTG.-------------------------.........VV------
Q5FUN3_GLUOX/45-121-DDN.T-W---I.Y-----VS---MITS......PTPL-------------------------TF.....PSVK------
Q2SMN2_HAHCH/93-162-DPS.Y-D---T.Y-----FY---SIQLS.....GGK.-------------------------..........I------
Q0A7D7_ALKEH/37-107-RTD.R-W---D.Y-----VY---TMRPG.....GGS.-------------------------..........M------
A1AX05_RUTMC/37-107-HNN.Q-W---D.Y-----IN---YSTLH.....KKD.-------------------------..........N------
Q3SSS7_NITWN/53-129-NGE.V-F---Y.Y-----IS---QRAER.....KVAF-------------------------MP.....QKVI------
Q2RTT3_RHORT/36-112-GGE.T-W---F.Y-----IS---NETT......QVAF-------------------------FK.....PKEL------
Q2NRT5_SODGM/28-97-NARGT-C---DSY-----VL---GNRNG.....K...-------------------------...........------
A4VII8_PSEU5/29-97-VVPGL-C---HDY-----IL---NRDGK.........-------------------------...........------
A7I1H3_CAMHC/52-124-YVV.E-W---D.Y-----LF---NLKEK.....AAD.-------------------------...........------
Q604C4_METCA/51-121-HDD.R-W---D.Y-----VY---SNQPG.....GEE.-------------------------..........R------
B0UR41_METS4/34-110-GNK.S-W---Y.Y-----IS---QNTKR.....TVMF-------------------------LG.....ERAE------
Q15V54_PSEA6/31-104-DHD.T-W---Y.Y-----LY---QMKRGM..AKRGK.-------------------------..........D------
Q31FS2_THICR/36-107-NPY.H-W---E.Y-----VF---YTTDPD..FHPDA.-------------------------...........------
A1WGT8_VEREI/51-121-HAD.R-W---E.Y-----VF---TLKRP.....GEE.-------------------------..........L------
A4SVD7_POLSQ/67-138-HAN.R-W---D.Y-----VF---EFKRA.....GKR.-------------------------.........VG------
Q2NRZ9_SODGM/35-105-GSN.T-W---Y.Y-----IF---RREPG.....HEA.-------------------------..........V------
A1WCQ4_ACISJ/49-119-HSD.R-W---E.Y-----VF---TLKRP.....DFE.-------------------------..........V------
Q1LMT9_CUPMC/71-142-HAD.R-W---D.Y-----VF---TFRRG.....RRD.-------------------------.........IV------
Q6FDQ3_ACIAD/30-107-NPL.R-W---D.Y-----IY---NYIPG.....TYAK-------------------------KA....KIPAA------
Q7CZT7_AGRFC/48-124-GNE.V-F---Y.Y-----IS---QKRVR.....RAAF-------------------------LK.....PSLV------
Q0K704_CUPNH/51-122-HAN.R-W---D.Y-----VF---SFRRG.....NTP.-------------------------.........VV------
Q21H32_SACD2/36-106-NTD.R-W---D.Y-----LF---MVKRG.....GEV.-------------------------..........L------
Q83C32_COXBU/30-100-ADN.R-L---V.Y-----VY---IFKKG.....HHK.-------------------------..........M------
A8GGW6_SERP5/28-97-HAQGT-C---DTY-----AV---APRDG.....K...-------------------------...........------
A5FV68_ACICJ/239-315-HDH.D-W---L.Y-----VS---QVTK......PRIG-------------------------QT.....LGVE------
Q3SJS3_THIDA/32-102-RGD.R-W---D.Y-----VY---VYYKA.....GKL.-------------------------..........A------
A0KI84_AERHH/30-100-DPN.T-W---Y.Y-----LY---EFQPG.....RGE.-------------------------..........K------
Q3IE33_PSEHT/35-105-DNN.T-W---R.Y-----VY---SFNKG.....RSN.-------------------------..........E------
A6W2D6_MARMS/31-103-KPN.E-W---H.Y-----LY---TVLYA.....TPDT-------------------------........QKS------
Q2G501_NOVAD/31-107-GKQ.T-W---Y.Y-----VA---MNTK......QKPF-------------------------NR.....PKTD------
A7HX93_PARL1/37-112-DGE.A-W---Y.Y-----IS---SKFE......TVAF-------------------------YR.....PQEV------
Q983A2_RHILO/103-179-DNE.A-F---Y.Y-----IS---QTRKR.....YVAF-------------------------DK.....PRLV------
Q7NX33_CHRVO/32-104-HAD.R-W---D.Y-----KY---SDAKG.....G.KV-------------------------........DPS------
Q2YBT7_NITMU/31-101-HEN.R-W---D.Y-----LY---RFEQR.....GKL.-------------------------..........I------
A2SC95_METPP/48-118-HAD.R-W---D.Y-----VF---TIRRP.....GAA.-------------------------..........Y------
A1K8N9_AZOSB/69-139-RSN.R-W---D.Y-----VY---RFKPG.....NGE.-------------------------..........P------
A7INK8_XANP2/42-117-NGE.A-F---F.Y-----IS---QTAQ......KVAF-------------------------LK.....PEIT------
Q1QSW6_CHRSD/33-103-NED.R-W---D.Y-----VF---YLDEA.....YDD.-------------------------..........V------
Q1H393_METFK/54-124-HRD.R-W---D.Y-----FY---QMRKG.....GKV.-------------------------..........I------
A3MZE6_ACTP2/34-104-NQD.R-W---S.Y-----VY---IKREG.....YND.-------------------------..........P------
B0T0T5_CAUSK/29-105-DQN.A-W---Y.Y-----IS---QTTD......RVAF-------------------------YK.....PRVI------
A1WX37_HALHL/38-106-EDD.R-W---D.Y-----LY---ERRGS.....QEA.-------------------------...........------
Q11J87_CHESB/48-124-DNE.V-F---Y.Y-----IS---QKRVR.....GAAF-------------------------MN.....AKLV------
A4XUA2_PSEMY/28-96-LSGST-C---NNY-----VL---NVDGH.........-------------------------...........------
Q28RF7_JANSC/34-109-RDE.A-W---F.Y-----TQ---YRVR......NFTY-------------------------NA.....PDVI------
Q5QXM4_IDILO/32-102-DSD.R-W---V.Y-----LY---KMDPN.....SGE.-------------------------..........D------
BAME_BUCAI/32-101-DDI.Y-H---Y.Y-----LS---DSKNNN..VYP...-------------------------...........------
Q0BTE4_GRABC/35-111-DNN.Q-W---V.Y-----IT---QTTE......MQIA-------------------------GT.....NDIL------
Q2NDV7_ERYLH/16-92-GEP.T-W---Y.Y-----VS---SVTG......RRPF-------------------------VR.....PRIR------
Q122Q0_POLSJ/29-99-HAD.R-W---D.Y-----VF---TLKRQ.....GVD.-------------------------..........S------
Q3JBU9_NITOC/42-112-HPD.R-W---Y.Y-----IY---SFKPG.....NER.-------------------------..........R------
Q7VM11_HAEDU/34-104-HLE.R-W---N.Y-----VF---IKREG.....YND.-------------------------..........P------
Q6D4H9_PECAS/28-96-NAKGT-C---SDY-----LL---KNRDG.....T...-------------------------...........------
A5V7M5_SPHWW/32-109-DKERT-W---Y.Y-----VA---RDTR......QVGY-------------------------RT.....PKAV------
Q1GPC4_SPHAL/37-113-GTG.E-Y---Y.Y-----VS---RETR......QLAF-------------------------AK.....PRPI------
Q0VSU2_ALCBS/35-105-TPD.L-W---L.Y-----PM---TYRPG.....KGD.-------------------------..........K------
B0UU40_HISS2/52-121-GVR.E-W---D.Y-----AF---NYREN......GE.-------------------------..........H------
B0UV53_HISS2/34-103-SNQ.T-W---Y.Y-----VF---LQQKS.....YNA.-------------------------..........P------
B7VJW3_VIBTL/77-145-YPD.T-W---Y.Y-----IY---HHQKG.....HND.-------------------------..........P------
C1DFM7_AZOVD/35-101-HPD.R-W---D.Y-----LY---SIKPG.....GGQ.-------------------------..........R------
D4Z6S0_SPHJU/63-138-GDQ.D-W---Y.Y-----VS---RDMRSLAFSSPKP.-------------------------..........V------
M1FIJ3_9ALTE/29-96-DTS.R-E---Y.Y-----VY---TFQRA.....GGD.-------------------------..........I------
M9X398_MANHA/34-103-ETH.R-W---D.Y-----VF---IKREG.....YKD.-------------------------..........P------
BAME_VIBCH/35-104-YPD.T-W---Y.Y-----IY---HHTQG.....HND.-------------------------..........P------
BAME_HAEIN/34-103-NSQ.T-W---Y.Y-----VF---LQQRA.....YET.-------------------------..........P------
Q2KA05_RHIEC/31-105-DGE.V-F---Y.Y-----IS---QRRTR.....AVAF-------------------------QK.....LKVV------
Q2YNC3_BRUA2/49-124-DNE.V-F---Y.Y-----IS---QKRYR.....AAQF-------------------------MK.....PKVI------
Q3J361_RHOS4/40-116-NDS.G-W---Y.Y-----VQ---SRYRH.....YGAR-------------------------E......PQEV------
BAME_PSYA2/52-130-EPN.R-W---D.Y-----IY---DYQAG.....TEAR-------------------------RKG..IADVKN------
Q5ZYK0_LEGPH/42-110-NND.R-W---D.Y-----AY---TWRRG.....KGN.-------------------------..........L------
Q63LV3_BURPS/48-120-GVH.V-W---N.Y-----VF---NFRTG.....PGAS-------------------------.........DV------
Q63QT2_BURPS/54-121-HAD.R-W---D.Y-----LF---YFKRG.....STS.-------------------------.........VV------
Q6LUB1_PHOPR/34-102-YPD.T-W---Y.Y-----VY---YQQPG.....HEE.-------------------------..........S------
Q79GM4_BORPE/42-111-HAD.R-W---D.Y-----PY---YFKPG.....YGK.-------------------------..........A------
BAME_YERPE/38-107-GTQ.T-W---F.Y-----VF---RQQPG.....HEK.-------------------------..........I------
BAME_SALTY/35-104-GTN.T-W---F.Y-----VF---RQQPG.....HEN.-------------------------..........V------
Q87RX9_VIBPA/35-104-YPN.T-W---Y.Y-----IY---HHTPG.....HGD.-------------------------..........P------
Q87VN2_PSESM/31-98-NTG.T-C---NNY-----VM---NKDGH.........-------------------------...........------
Q88DH0_PSEPK/30-95-HGG.T-C---NDY-----IL---NHDGK.........-------------------------...........------
Q88DT8_PSEPK/35-101-NTN.R-W---D.Y-----LY---SLQPG.....GGK.-------------------------..........R------
BAME_SHEON/38-105-ADD.T-W---Y.Y-----VY---HYKSG.....RDA.-------------------------.........SI------
BAME_XANCP/28-99-HAQ.R-W---D.Y-----TS---TQRVD.....RLA.-------------------------.........RT------
Q8XVT1_RALSO/61-130-HGN.R-W---D.Y-----VF---SFKRG.....NTN.-------------------------.........VV------
Q92KF5_RHIME/42-116-DNE.V-F---Y.Y-----IS---QTRKR.....PVAF-------------------------MK.....PKII------
Q9HUT7_PSEAE/31-97-KPG.S-C---NSY-----IL---NKDGQ.........-------------------------...........------
Q9JXT1_NEIMB/52-133-GVR.E-W---D.Y-----LF---HFHTP.....GVGI-------------------------DPENTSGVEDV------
Q9PB00_XYLFA/44-114-HTD.R-W---D.Y-----TS---AQRID.....RIA.-------------------------.........HT------
V6F1L4_9PROT/28-103-GDE.S-W---Q.Y-----IS---AVFE......TTAF-------------------------FK.....PELK------

PF12978

Q8DTX1_STRMU/47-205-SDKEEMQ---TVW-----SS---GIKTK--------------------------------------------S------
B9DSB0_STRU0/47-205-SDKSQLQ---AIW-----VS---GLKTK--------------------------------------------T------
G2SNY8_LACRR/70-224-GGETTLN---ATW-----VT---GTKGG--------------------------------------------.------
Q8DZF2_STRA5/47-206-SDKEELQ---AAW-----IS---GIQSS--------------------------------------------D------
Q99ZC4_STRP1/47-204-SDHQTLQ---AIW-----VS---GLKTD--------------------------------------------T------

PF07467

Q9KJ90_STREX/2-185PKDSCVSQ---GES-----YP---NWPAKTGF--EEKY-------------------------YC.....AAAT------
B5GLC0_STRC2/2-181PSDTCSAL---AEQ-----YP---NWPATNGN--LREY-------------------------VC.....PSKA------
BLIP_STRCL/10-200GQGSCTTW---SEY-----YP---AYPSTAGV--TLSL-------------------------SCFDVDGYSST------

PF14172

C0Z8F5_BREBN/45-177-GFTVN-Y---EGFH...LQF....EDYAKSIDEVKDTSKVVLMNAEPK......TVGMTGKPEEIKRTLGEPS......
W0EAP8_9FIRM/51-184-AKG.T-Y---VTYSDQALVV...GFNKGMQIFEVRSF......DQKLQ......KVSL....AKTKEVYGAPA......
YJGB_BACSU/51-188-RFDLY-H---WNMGQPGYGF...SYHKDMTISEIRYFGTGVERQLNLG......GVTP....EVLQKQLGPVN......
C0Z6K8_BREBN/118-238-ANGLI-Y---SAYPKKEVVF...GYNKGMQLVDMHRT......DSRLQ......QISL....SAVEKIWGKPS......
D3E8N0_GEOS4/57-196-AFDVY-G---ANMGNPGYAF...SY.KLNKIREMRYFGTNVERQTNIG......GITM....KMLKKNWFAPD......
U5MR07_CLOSA/75-209-AKG.N-Y---STYSKYNVVF...GSNKGGRIFEVRSF......DSRLN......KISL....SMVKKYFGTPA......
R4K5N0_CLOPA/85-219-AKG.L-Y---STYSKHNIVF...GSNKGGQIFEVRSL......DKQLG......NIYL....SMVKDKLGTPQ......
C6D3T6_PAESJ/51-191-DFDVY-H---SEMGHPGYAI...SY.KLGKIKEMRYFGTNVERQTNLG......GISV....KMLVQHWGTPN......
I3VRL4_THESW/85-217-AKG.T-Y---TTFTKKDLVF...GFNKGMQVFETRSF......DPRLQ......AISR....SDIENVLGKAP......
C8WQ55_ALIAD/107-238-GSG.V-Y---FTYRAKDVAF...GLNKGEQIFDVRSY......AQALR......TLTY....HEIAGVLGAPG......
M1MNJ5_9CLOT/77-211-AKG.Y-Y---STYSKYKVVF...GSNKGGRIFEVRSF......DSSLN......NISL....SNVEKYFGSPN......
I4D7B6_DESAJ/531-665-ASG.Q-F---ATYSAHNIVF...GINKGDQIFEVRSY......DSRIK......GITL....KMAKQVLGTPA......
F6DUI9_DESRL/67-201-AKG.T-Y---ATYTKHHVVF...GFNKGSQIFDVRSY......DLEIK......KLTL....AEVKKTLGTPE......
Q8XI71_CLOPE/88-217-AKG.N-Y---FNFDSYNLSF...GCNKGDQIFEIRSL......NKDLK......SLDL....NNVENFFGKPD......
Q24YP2_DESHY/79-213-AKG.N-Y---AVYADHAMVF...GFNKGSQIFEVRSF......DKQLQ......NITL....SKVKNSFGTPA......
A6LYS0_CLOB8/79-210-AKG.N-Y---ATYSSKNVVF...GTNKGDQVFEVRSF......DSQLK......QISL....SDVKDFFGQPD......
Q81PC7_BACAN/76-203-GNG.M-Y---ATFTNKNVSF...GFNKGSQVFDVRSY......HAELK......SITL....QEIEKALGKPN......
G7M4A2_9CLOT/93-227-AKG.N-Y---STYSKNNVVF...GSNKGGRIFEIRSF......DQRLN......QISL....SMVEDFFGTPP......
A8MGG8_ALKOO/77-218-G...F-Y---LSYD..DIMFLTNGYDETGKVVSILFF......DKNAEVFGIKLGMTT....KEIEKVLGTAD......
A8FAZ3_BACP2/47-191-SFDLY-H---AEMGNPGFAF...HYDAKGKIDEIRYFGTNVEKETNIG......GMTP....SLLKKQLGQAD......
C0Z6K8_BREBN/268-401-.NGIT-Y---NTYRDLNLVF...AFNKGMQIVDIRSY......DPRLQ......AITL....AEVRKTLGEPT......
J7J151_DESMD/62-207-AKG.N-Y---ATYSKQAMVF...GFNKGSQIFEVRSF......DPQLQ......QLSM....AKTKELFGDPAYNAKTK
X4Z8J4_9BACL/92-219-GKG.I-Y---ATYNAKHVVI...GFNKGSLIFDVRSS......AADLQ......QLTL....KQIEEALGKPN......

PF13670

Q0BXA6_HYPNA/7-95-------------TRDGRE--IEI-----------D--IHG------------ASGA--ILELE-----
Q0BXA5_HYPNA/6-84-------------SADGRE--LDI-----------D--LHS------------RTGD--ILKYD-----
Q0BY17_HYPNA/6-92-------------DGSGQR--LVV-----------E--VDG------------FTGA--VVKVE-----
A4VHV2_PSEU5/30-109-------------KQDGKK--YEF-----------K--IDG------------RTGE--VTKDK-----
A4XVH9_PSEMY/6-85-------------KQDGRL--YEF-----------R--IDG------------KSGQ--VIRDQ-----
Q1QMT6_NITHX/5-85-------------MLNGVR--QKI-----------Y--LDP------------RSGE--VVGHK-----
B8EKV5_METSB/3-81-------------VKDGKI--IEF-----------N--ADP------------KTGE--ITKSE-----
Q5LX53_RUEPO/50-129-------------VKDGKM--AEV-----------Y--VDP------------KTGK--ISKIE-----
B8IVF4_METNO/5-90-------------NDSGLP--IKA-----------V--YAQ------------ATGE--LVRAW-----
B3PI60_CELJU/2-85-------------NKDKQK--VEI-----------Y--FDP------------VTGA--VVKEE-----
C1DNM7_AZOVD/2-85-------------DKDRRK--VEI-----------Y--FDP------------VSGR--AIKEN-----
Q1LBN9_CUPMC/3-85-------------TKDGKK--AEI-----------Y--FDT------------KTLE--IVKSE-----
Q8XWW7_RALSO/3-85-------------NQDGKK--VEI-----------Y--YDT------------KTLD--VVKSE-----
A1K227_AZOSB/5-88-------------DKDGKK--VEI-----------Y--YNP------------VDGS--VAREK-----
Q5P431_AROAE/5-88-------------DQDGKK--VEI-----------Y--FSP------------IDGS--VVKEK-----
Q5P432_AROAE/18-101-------------DKDGNK--VEI-----------Y--HNP------------VDGS--VVESK-----
D0KWU4_HALNC/5-88-------------GQAGEK--LEI-----------Y--YHP------------VTGE--VVKRG-----
B0SVT0_CAUSK/5-90-------------NKAGKK--AEV-----------Y--FNP------------VTGA--IVQDN-----
A7IQ54_XANP2/6-90-------------NKDGKK--AEV-----------Y--FNP------------VTGE--IVENN-----
B1Y4P0_LEPCP/3-85-------------DKANKK--VEI-----------Y--FDP------------ATAA--VLETK-----
B8IVE9_METNO/4-91-------------DQNNAR--TEL-----------F--VDP------------TSGE--IVAKE-----
Q1QM54_NITHX/4-90-------------DQNGNR--VEL-----------F--VDP------------TNGQ--VIGQI-----
A1B769_PARDP/5-86-------------DREGRR--IEA-----------T--VDP------------GTLQ--VIEVE-----
A1B772_PARDP/5-86-------------DAQGRR--IKA-----------K--LDP------------ATLQ--VVKLR-----
B6JDT2_OLICO/6-87-------------DETGQP--FKA-----------K--IDP------------GTLA--VVKMK-----
A1U059_MARHV/5-86-------------DADGVR--AEA-----------S--FAP------------ASLT--MMKWE-----
A1SRM1_PSYIN/5-86-------------DHQGNK--IEA-----------R--FGP------------AELD--ILELE-----
B9K2Y3_AGRVS/4-85-------------DSSGNA--IEA-----------Y--FDP------------KTFK--PIDQK-----
A7IKT6_XANP2/6-87-------------NTRGER--LKA-----------K--YDP------------ASLQ--RIPRT-----
A1B771_PARDP/5-86-------------DQGGNS--LKM-----------T--VDP------------GTLE--VIDGK-----
Q0S079_RHOJR/10-95-------------LPDGNQ--VDV-----------Q--LDQ------------NFTV--VGTKT-----
A8LNS6_DINSH/4-81-------------CKGGNQ--FDI-----------K--LDK------------EFNE--VSRRA-----
B1M6N2_METRJ/3-84-------------DASGKQ--FDL-----------K--LDP------------KTLA--IVKRK-----
A7HVA0_PARL1/7-87-------------DEKGRE--FDV-----------K--LDP------------ESYE--IVSTR-----
C5AT97_METEA/7-83-------------VRDGRS--VKV-----------Q--LDP------------QTGA--IVEK.-----
G2J097_PSEUL/8-86-------------NKDGKK--VEI-----------Y--YDT------------VSGK--PVKSE-----
Q2YRI6_BRUA2/6-85-------------DENGNV--LKV-----------K--VDP------------ETMK--VVAG.-----
Q3J9Y2_NITOC/7-84-------------YKDNQK--LEL-----------E--VDP------------SSGK--ILSNK-----
Q5F6R1_NEIG1/7-90-------------YKDGRE--YDI-----------V--LSY------------PDLK--IIKE.-----

PF03413

Q9K7V1_BACHD/28-100-------------EDDMTQ..FEF-----------L..IDA------------NTGT--VLEVN-----
Q816W8_BACCR/30-100-------------NDIQER..FEF-----------L..VDA------------KTGT--VLEV.-----
Q8EP78_OCEIH/29-101-------------DGDNKQ..YEF-----------Y..VDI------------ETGA--VIDTK-----
U5LGT7_9BACI/29-101-------------DGEVSQ..YEF-----------V..ADS------------RTGT--ILDAY-----
Q03RI8_LACBA/34-106-------------DDQLVQ..YQF-----------I..ADA------------ATGS--ILDIH-----
Q03GC8_PEDPA/34-106-------------NNELIQ..YEF-----------I..ADA------------YTGT--IIDIY-----
Q82ZL5_ENTFA/37-109-------------DDGIVQ..YEF-----------T..ADA------------YTGT--IIDIQ-----
Q5HNG3_STAEQ/33-102-------------NDHLIN..YEF-----------Y..ADA------------VSGQ--IIDII-----
B1YKF6_EXIS2/28-100-------------GDDEKT..YQF-----------T..VDA------------ETGA--LLEYA-----
Q181V6_PEPD6/408-465-------------..NKKT..YEL-----------E..ISA------------FDGR--IVDID-----
Q181V6_PEPD6/490-547-------------..GKTE..YEI-----------T..INA------------ITGK--ILEFE-----
Q8TTA4_METAC/138-199-------------..DSME..YEF-----------E..IDA------------TTGT--IVDWN-----
A8MEK6_ALKOO/172-230-------------..DGIK..YEI-----------E..MNA------------FTGN--IFNCE-----
A8MEK6_ALKOO/94-155-------------..DGNL..YEI-----------K..MDG------------YTGK--IKKIE-----
A8MEK5_ALKOO/294-355-------------..GKNV..YEI-----------E..LDA------------YTGN--VLEFD-----
Q5WGU9_BACSK/378-439-------------..DNDT..YRI-----------F..INA------------LTGE--EEKVE-----
YPEB_BACSU/377-438-------------..ENDT..FRM-----------Y..INA------------KDGS--EEKVE-----
A8FEM8_BACP2/376-437-------------..KNDT..YRM-----------F..INA------------DTGK--EERVD-----
YPEB_BACHD/374-435-------------..NDET..YRI-----------Y..INA------------EDGE--EEKVE-----
YPEB_OCEIH/373-434-------------..DDET..YRI-----------F..INA------------ENGQ--EELVE-----
A3DI39_CLOTH/391-452-------------..NDKD..FLV-----------Y..INA------------ETGK--EENIL-----
A0Q324_CLONN/379-440-------------..KDDE..FVV-----------Y..INA------------ETGY--EQRIL-----
Q2RM03_MOOTA/386-447-------------..DNTY..YLN-----------Y..INA------------LTGE--EEKVL-----
A8MIH5_ALKOO/376-437-------------..GKDT..YLV-----------Y..IDA------------ETGE--QRRML-----
Q12WY7_METBU/120-186-------------KATGEE..YRI-----------F..VDA------------YSLE--EVQDN-----
Q6W134_SINFN/286-345-------------LSQQRV..VH.-----------...LDQ------------YSGK--PLLDT-----
Q8ELE8_OCEIH/178-237-------------ARDEAT..MH.-----------...IDQ------------YTGA--ILADY-----
Q9KBS1_BACHD/273-331-------------AQDEAT..IH.-----------...IDQ------------YTGA--VLADY-----
Q5KVG3_GEOKA/282-341-------------PWDNAT..LH.-----------...IDQ------------YSGR--VLSDV-----
Q9KE75_BACHD/288-347-------------PGDNAT..IH.-----------...VDQ------------YSGA--ILSDV-----
A9B7B4_HERA2/311-370-------------PADEAT..IH.-----------...VDQ------------YSGA--ILADI-----
Q3SKV5_THIDA/55-112-------------NAHDRF..VY.-----------...VDP------------YDGS--ILGTH-----
Q3JE96_NITOC/270-334-------------RPRSK...VW.-----------...VEQ------------YSGE--VLAVE-----
Q9A7E1_CAUCR/252-316-------------DPSRRF..PHS-----------FVWITP------------ATGE--VLAMT-----
Q020P0_SOLUE/231-293-------------GRSRVI.....-----------...VDQ------------YTGN--VLYAE-----
Q82WV7_NITEU/279-343-------------FWSERQ..IA.-----------...IDQ------------YSGE--ILDVR-----
A4FCJ5_SACEN/417-477-------------PVQRDR..VA.-----------...VDP------------YSGK--VVERV-----
Q9KE75_BACHD/74-132-------------DGERIS..VY.-----------...VNP------------YNGE--VQGSL-----
Q5WLI5_BACSK/75-133-------------GEVSSS..VF.-----------...VNP------------YTGD--IQGKL-----
Q47KW9_THEFY/83-144-------------ESVRSS..VF.-----------...VDP------------YTGE--VLGTL-----
Q825U8_STRAW/84-147-------------EGHTLA..VF.-----------...VDP------------YTGK--VRGSL-----
A0R6J4_MYCS2/78-140-------------PDYSRT..VF.-----------...VDP------------YTAE--VRGAL-----
A1T724_MYCVP/79-141-------------EEKLRT..VF.-----------...VDP------------YTGR--VLGDE-----
Q6NKB0_CORDI/71-132-------------KSTTQA..VF.-----------...VNQ------------YTGD--ITGDM-----
Q9KBS1_BACHD/60-118-------------VNGPLT..VF.-----------...LDP------------YTGE--QLGTL-----
Q8P606_XANCP/82-140-------------DGAREV..VY.-----------...VDP------------YSGR--ALGML-----
Q7CY41_AGRFC/75-132-------------EDGKRA..VY.-----------...VNP------------YTAE--VAGSL-----
Q2RPK6_RHORT/75-133-------------AGDKRA..VY.-----------...VDP------------YRAQ--VLGTL-----
Q6W134_SINFN/75-133-------------AEGKLA..VY.-----------...VDP------------YSGK--VLGAL-----
Q1R143_CHRSD/68-125-------------ADGKQA..VY.-----------...VDP------------YTGE--VTGTI-----
Q7NVU2_CHRVO/229-292-------------PNGRSQ..VE.-----------...VDP------------YSGA--LLRVT-----
Q8A623_BACTN/26-84-------------.PRRSS..VY.-----------...VDQ------------YTGE--ITGKN-----
Q884E8_PSESM/67-126-------------DGRSVP..AY.-----------...VNP------------YTGV--IQGLT-----
Q9I178_PSEAE/60-119-------------GGSEAT..LY.-----------...INP------------YTGA--IQGES-----
Q1LJM8_CUPMC/260-324-------------RADTGA..TRL-----------W..LDA------------YTGR--PLAVR-----
Q82P05_STRAW/125-192-------------TEATGSRTVV.-----------...VDA------------VTGR--IRSNT-----
Q9L1F9_STRCO/146-216-------------DGTPNE..LHV-----------I..TDA------------DTGA--KLYEY-----
Q82BN5_STRAW/115-187-------------LGNPVA..RTV-----------L..TDA------------RSGK--QIDAW-----
Q9L2B8_STRCO/168-232-------------GGQDWR.....-----------...VDL------------KTGK--VTADR-----
Q0AQU2_MARMM/109-177-------------GDTTPP..VTF-----------Y..INS------------QTGE--LRAVR-----
E0THY6_PARBH/109-174-------------.DGNTR..LY.-----------...IDP------------DTGV--VRARR-----
Q63MT4_BURPS/165-233-------------LHGDWE..LI.-----------...IDA------------GSGE--VLRAQ-----
Q03XK6_LEUMM/140-199-------------..GNNN..VAV-----------K..LDA------------NSGQ--VIEKD-----
Q9KC80_BACHD/94-154-------------.EEGRL..SYY-----------Y..VSF------------YDGT--FIKRY-----
Q5KXX8_GEOKA/94-154-------------.AEGRY..SFY-----------Y..LHF------------ADGA--FLKRY-----
Q1WU38_LACS1/104-164-------------.NQNNI..CYD-----------L..ISF------------KTGK--IIKSI-----
A8FEH2_BACP2/99-159-------------.ENNQY..SFS-----------Y..VDF------------STGH--VEKNV-----
Q6ANJ0_DESPS/50-117-------------..KGGR..VKY-----------Y..IDS------------VTGK--VLLSK-----
Q8R5X9_FUSNN/10-69-------------FDKGQK..IEF-----------I..IDV------------NTGE--VFKIA-----
Q8E0L6_STRA5/117-180-------------LKNKNE..VDY-----------Q..IDA------------ETGK--IIE..-----
Q8RBF9_CALS4/109-184-------------PNNGLY..VY.-----------...VDK------------NTLK--VTSYF-----
B8I195_CLOCE/108-180-------------KSNYIT..VS.-----------...VNS------------YTGK--VMSYT-----
Q1D8Q2_MYXXD/168-239-------------TDNPRK..MNY-----------L..VDA------------NTGK--LFEQF-----
Q81MX8_BACAN/145-217-------------TPEYVS..GTV-----------L..IDA------------FVGD--LLKEL-----
Q5ZRA6_LEGPH/16-86-------------KKHV.N.APNY-----------L..IDA------------NSGE--ILKQW-----
Q87I51_VIBPA/131-204-------------NPTRPT..YL.-----------...VDA------------KSGE--VLLQY-----
Q2FUX4_STAA8/118-192-------------TPEISH..WKV-----------K..IDA------------QTGE--ILEKM-----
PRTA_LISMO/121-194-------------EPEVAS..WIV-----------Q..VDV------------ETGA--ILKK.-----
Q97G52_CLOAB/161-230-------------DPDIAN..WEV-----------L..IDA------------NSGK--IVRTL-----
Q97G51_CLOAB/153-222-------------DPHIAN..WEV-----------L..VDA------------KNGS--VIKIL-----
Q97GS5_CLOAB/161-230-------------.PTIGN..WDV-----------F..VDI------------SSGK--VIKTE-----
A5I1S2_CLOBH/148-212-------------..DSGN..WNV-----------F..VNA------------EDGS--IVNK.-----
Q81R73_BACAN/122-192-------------..NNPFGAWET-----------F..IDA------------ENGK--LIKK.-----
Q815U2_BACCR/146-219-------------KPAPGYWHYF.-----------...VDA------------TNGN--VIEKY-----
NPRB_BACSU/145-217-------------EPEPGY..WHY-----------F..IDA------------KNGK--VIES.-----
Q8ESH1_OCEIH/143-217-------------NPEVGF..WHY-----------F..IDA------------KSGE--VIDHF-----
B1YFR1_EXIS2/113-183-------------GKEPSR..WTY-----------F..IDA------------NSGK--VLNKY-----
Q81I21_BACCR/151-220-------------DPSPGN..YYY-----------F..IEA------------DSGK--VLNKY-----
Q8DVN1_STRMU/57-120-------------..DATE..YNY-----------T..INA------------DTGK--IISKE-----
Q99YI6_STRP1/81-143-------------.NKDQE..YSY-----------T..IDA------------NSGD--IVEK.-----
R6P3S5_9CLOT/179-241-------------..NGTE..YDY-----------D..IDQ------------ATGR--ILSS.-----
Q8ESN0_OCEIH/32-90-------------..ENGS..YKV-----------V..LDG------------NTGK--VLDIY-----
A5G759_GEOUR/48-108-------------KSSGGE..VDV-----------L..VDM------------KTGK--VLGTE-----
O27358_METTH/81-143-------------GKTVGE..IY.-----------...IDP------------MTGK--NLGGA-----
Q8ERG4_OCEIH/132-194-------------.DNQKD..VTV-----------V..IDA------------KTGE--QLTVE-----
Q5WLC0_BACSK/58-117-------------..DEKE..YEI-----------I..VDA------------KTQE--VTKER-----
Q82ZK1_ENTFA/63-122-------------..QQKE..YQV-----------E..VNA------------ETGE--FTKEK-----
Q5FIK1_LACAC/43-101-------------..STRE..YEM-----------K..INA------------SSGK--TISSH-----
Q5FIK0_LACAC/62-121-------------..TTHK..YSA-----------E..INA------------ETGH--ASSVH-----
Q74JH3_LACJO/49-108-------------..SEKE..YKV-----------K..IDA------------SSGK--ILKAK-----
Q8ERG4_OCEIH/56-114-------------FDDAKE..YKA-----------E..IDL------------EK.N--IINQE-----
Q186H8_PEPD6/62-121-------------VDDNNE..YKM-----------K..IDA------------NTKD--VLEDK-----
Q9KFU6_BACHD/49-108-------------.NDDDE..YDF-----------K..IDQ------------QTGE--ILKEK-----
Q8ESM9_OCEIH/39-97-------------..DDEE..YDL-----------E..IDA------------ETGE--IIKEN-----
Q81R43_BACAN/43-101-------------.TNKGE..EEI-----------Y..INK------------KNGN--IIAEK-----
Q8ELD0_OCEIH/32-90-------------..NDKE..YEF-----------N..IDA------------TTGE--ALGQE-----
Q4K807_PSEF5/38-102-------------.SKGIE..WDV-----------D..LDA------------KTGK--VLSNK-----
C1DJ09_AZOVD/39-99-------------.AQGLK..WDV-----------H..LDA------------SNGQ--VLKDH-----
A4XTT8_PSEMY/39-99-------------.AQGQQ..WDL-----------E..LDA------------STGE--ILKNH-----
Q0VNT9_ALCBS/52-112-------------.PQGVE..WEL-----------D..IDA------------SNGD--VLGEE-----
Q0S7B7_RHOJR/138-198-------------.TKGWD..YDV-----------N..VDA------------STGA--VLPDN-----
Q5F637_NEIG1/47-105-------------..NGQE..YKV-----------V..VDA------------RTGR--VISSR-----
Q1ARP9_RUBXD/67-126-------------.REGTL..HDL-----------Q..LDA------------RSGR--VLRHE-----
Q9L126_STRCO/188-249-------------KSNWNK..TTV-----------T..VDA------------ANGK--VLGQK-----
Q9L2B8_STRCO/83-152-------------.GDGTW..HSV-----------R..VDP------------ATGK--VLGSE-----
A9C057_DELAS/120-179-------------.ANGTL..MEV-----------K..IDA------------VGGE--VIRAK-----
Q8RD03_CALS4/115-173-------------..NSGV..VDV-----------K..VDA------------GNGA--VLAQD-----
A8FCD9_BACP2/110-169-------------.PNGEE..VDF-----------E..ISA------------KTGK--ILKQE-----
YKOJ_BACSU/108-167-------------.KQGTE..TEF-----------E..ISA------------KDGR--IIKQE-----
Q8ESM9_OCEIH/119-177-------------..GNKE..ADF-----------E..IDA------------VTGN--VLEMD-----
YKOI_BACSU/164-223-------------.PDNKEATVK.-----------...INA------------YTGK--VANIV-----
A8FCD8_BACP2/167-226-------------.PDGRE..AEV-----------L..VNA------------YTGD--IEGIT-----
Q5WKR9_BACSK/175-233-------------..DREE..GTI-----------V..VNA------------FTGA--IESVA-----
Q9KFU7_BACHD/111-170-------------.DDDTE..ATI-----------V..MNA------------YTGQ--ILSVT-----
Q9KFU6_BACHD/130-191-------------HYDDDD..VTV-----------Y..VDA------------MTGN--VLYVE-----
Q5WKR8_BACSK/122-181-------------.SKNDE..TTI-----------D..IAA------------VSGE--VLEVE-----
Q38Z32_LACSS/130-188-------------..KHQK..MQV-----------K..IDA------------TTGE--VVDTE-----
Q2G105_STAA8/129-187-------------.KGNKK..QEV-----------T..VDA------------KNGK--VLKSE-----
Q5FIK0_LACAC/141-199-------------..RYHS..SEV-----------K..IDA------------HSKK--VISVE-----
Q82ZK1_ENTFA/146-205-------------..GQQK..IEV-----------K..IDA------------HSGK--ILTTE-----
Q74LX8_LACJO/141-200-------------..GSTK..HEV-----------E..IDA------------SSKK--VIRSE-----
Q5FIK1_LACAC/119-178-------------..NGKK..SDV-----------K..INA------------LTKK--IISVE-----
Q74JH3_LACJO/126-184-------------..GNKE..TEV-----------K..IDA------------KSQK--ILKTK-----
Q186H8_PEPD6/144-202-------------..DKNE..YDI-----------K..VDS------------KKGT--VLKVE-----
Q5WLC0_BACSK/141-199-------------..AGND..YDI-----------K..LDA------------TNGE--VLGTD-----
Q8R5X9_FUSNN/83-142-------------..DKSE..KEI-----------R..IDA------------NSGK--VIGIK-----
Q81R44_BACAN/99-158-------------DKQSKV..VE.-----------...IEK------------TTGQ--IQLLE-----
Q0VNU0_ALCBS/63-123-------------.GDRVV..REI-----------E..MDA------------RTGQ--VLDDE-----
Q3JBE9_NITOC/51-111-------------.PAGVV..HEI-----------E..INA------------NNGQ--FIEDE-----
A4XTT9_PSEMY/41-101-------------.LQGVV..REL-----------E..LDA------------RNGN--ILKDE-----
Q0BZN8_HYPNA/53-112-------------.RRGTV..LEM-----------D..VDA------------RTGR--ILDIE-----
A1B2L4_PARDP/40-99-------------.PDGRL..IEV-----------E..IDA------------ASGR--ILALD-----
Q9A8Q0_CAUCR/73-133-------------.KNGRV..REL-----------E..LDA------------KTGA--TLKLE-----
Q988S6_RHILO/46-105-------------.ADGRR..KTV-----------D..VDA------------GAGA--IMRNG-----
A4YY21_BRASO/40-99-------------.RDGRM..REV-----------Y..IDA------------RSGE--IERVE-----
Q2RPG4_RHORT/72-131-------------.AGGRVTRLD.-----------...FDA------------ATGD--LIARR-----
V6F502_9PROT/38-95-------------.KDGRL..LKL-----------Y..YDA------------ATGE--VLKV.-----
Q0AR59_MARMM/55-114-------------.RDGRR..VDV-----------V..ADA------------RTGQ--ILFER-----
A8LN27_DINSH/31-89-------------..DGTI..HEA-----------V..IDA------------RSGE--LIELE-----
A5VEY7_SPHWW/24-82-------------..GQVL..HRA-----------L..IDA------------RTGK--LVSAV-----
Q8KFX7_CHLTE/45-103-------------..GAKV..LDV-----------R..VDK------------DNGR--ILAAN-----
B4E758_BURCJ/39-96-------------.SGAKV..FDV-----------R..VDA------------DKGT--VISS.-----
A9C057_DELAS/43-102-------------.PGGDS..VEV-----------W..VNA------------ITGQ--A.AQH-----
E0TIH6_PARBH/43-102-------------..DGAE..MEV-----------E..IDA------------VSGA--ILEVE-----
B0UCU3_METS4/66-129-------------.PDGKL..VEH-----------Y..INA------------DTGA--LIKSE-----
A3QGG2_SHELP/47-105-------------.KDGVV..FYV-----------A..IDA------------VTGQ--M.SRQ-----
Q7P204_CHRVO/118-188-------------EPSRPH..LI.-----------...IDA------------NSGQ--VLKQW-----
ELAS_PSEAE/122-192-------------.PGEGLSRPHF-----------V..IDA------------KTGE--VLDQW-----
A1S2N2_SHEAM/113-188-------------TPSRPF..TM.-----------...VDA------------HTGE--VLERW-----
Q2SJ90_HAHCH/129-208-------------DPKRPF..FI.-----------...IDA------------HSGD--VIKTW-----
B7VN56_VIBTL/116-190-------------MPERPF..YF.-----------...IDA------------TTGD--VIQKW-----
F7YSQ2_VIBA7/118-194-------------EPARPF..FF.-----------...IDA------------NSGD--VLQTW-----
HAPT_VIBCH/116-190-------------TPSRPF..YF.-----------...ISA------------ETGE--VLDQW-----
Q5ZZJ1_LEGPH/124-199-------------KPDWPF..FV.-----------...IDA------------QTGA--LIKQW-----
A1S4V2_SHEAM/92-162-------------RPAGL......-----------...VDA------------MTGE--VVRHW-----
Q211C9_RHOPB/96-155-------------..GDHV..LEQ-----------S..VDA------------ETGA--VFGGE-----
Q89L62_BRADU/85-144-------------..NDRI..WRH-----------T..INA------------ATGE--FVGGE-----
A4YNR6_BRASO/46-105-------------..SGQI..WEF-----------D..IDC------------STAK--VLNSV-----
Q6N7G2_RHOPA/56-115-------------..DGQV..WES-----------V..VSA------------ISGT--VLSDQ-----
Q1H2G7_METFK/106-166-------------.KDGKE..FKV-----------E..VDA------------STGK--IVEAN-----
A2SEW0_METPP/117-177-------------.DNGDD..VRV-----------E..VDA------------VTGK--LREAH-----
Q1H2G7_METFK/31-90-------------.SDSTA..WDV-----------E..CDA------------NTGK--IVEIE-----
A5N159_CLOK5/17-76-------------.TNGMV..YEV-----------T..IDA------------NTGE--ILEVD-----
Q8DWU2_STRA5/78-136-------------..NKIA..KKY-----------K..IDA------------NSGK--ILST.-----

PF11396

A0M0Q0_GRAFK/54-143-------------SETSK..GSFY-----------EFEIEKG..KIEMEVTLDSSGT--IIK-------
A0M1R1_GRAFK/70-160-------------VISAKK.GEFY-----------DVEFKQK..GKNKDVEFREDGT--ELN-------
A5FIF1_FLAJ1/58-140-------------IDYGH...KDL-----------DVDLTN.....KIDLEFTKDGK--ILK-------
A5FNS8_FLAJ1/62-144-------------IEIES...SGY-----------ETKLTN.....GLELKFSLKGD--FIK-------
A6L337_BACV8/61-143-------------IERNR...KGY-----------ELTLEN.....GLEVDFDQFGG--FLK-------
A6L4L1_BACV8/60-142-------------IERDK...HDY-----------EVKLSN.....GWEIKFDMQFN--VID-------
A6LDA3_PARD8/62-144-------------IEKEI...RDY-----------EIKLDN.....GLEMTFDLKGN--LID-------
A6LDA4_PARD8/55-146-------------LERPDA.GTIY-----------VLDVENG..EQDADLHYTEGGI--LIK-------
A6LDE6_PARD8/58-149-------------INRLNM.GIVY-----------KIEAEQS..NSEVDLYYSQYGN--LIK-------
C0QVH4_BRAHW/54-141-------------IERKD...KNF-----------IIKLDD.....KYLIEISGYGI--IIS-------
C0QYD0_BRAHW/35-117-------------IKKRW...NMY-----------VISLDN.....YINIFIDFAGM--LIG-------
C0R146_BRAHW/63-147-------------IYKRS...KGY-----------EFKVDD.....AYYIYIDYDGN--ILK-------
C0R148_BRAHW/33-123-------------IIKRK...NKY-----------EIEINS.....N.IIIIDIEGN--ILK-------
Q5L9Y2_BACFN/49-143-------------VEFPKW.QPII-----------VIKVGQQNVDIQYQLFYSPNGT--LLR-------
Q5LD45_BACFN/83-177-------------ITFPKQ.PAVI-----------VIEVEEYNTDTEFQLFYAPDGK--LLQ-------
Q7MWB3_PORGI/60-142-------------IDRDS...RDY-----------EVELNN.....GLELVFSLKGV--FKR-------
Q7MWB4_PORGI/55-145-------------VERNGT.EIFY-----------VIEVEKG..DQEVDLFYMPNGK--LIK-------
Q89YQ4_BACTN/58-150-------------LTYPQH.PTES-----------VIQVKQG..NLRFALYFSQEGG--LLH-------
Q89YQ5_BACTN/61-144-------------VERDR...KGY-----------EVELST.....GVSFKFDKKGK--FLK-------
Q8A994_BACTN/60-142-------------IERDK...KDY-----------EVKLSN.....RTELKFDLKFN--LID-------
Q8YLV6_NOSS1/61-150-------------IEITPN.GMFY-----------EVDITDG..ELEEELYLDSQGN--LQT-------
C7M630_CAPOD/59-141-------------VSRNLS.KKKY-----------EAELTD.....DQELKFDDKFN--FI.-------
D6D2V5_9BACE/45-136-------------LTFPQN.PMES-----------VIQVKQG..SQRYSLYFTQDGG--LIH-------
D6D5W5_9BACE/49-143-------------VEFPKW.QAII-----------VIKVGQDNVDIKYQLFYTPQGV--LLK-------
D6D6Q4_9BACE/56-146-------------LERTGV.ETIF-----------VIEVENQ..NQEIDLYYSADGT--LIK-------
Q0P802_CAMJE/53-133-------------VDKEI...NGY-----------KFKFNN.....NMEVYTDMQGN--IL.-------
Q0P9P8_CAMJE/51-132-------------IERKI...NHY-----------KIKLDN.....DIKILIDFNGT--IL.-------
Q5LBR7_BACFN/55-146-------------LERPDM.EKVY-----------VIEVESG..KQEFDLYYSEEGI--LVK-------
Q5LBR8_BACFN/60-141-------------IERDK...TDY-----------EVKLSN.....GWELKFDSKFN--LI.-------
Q5LG06_BACFN/60-151-------------LEYPNEPSTEF-----------VVTVEQG...KKVDLYFSEGGG--LLH-------
Q5LG07_BACFN/61-143-------------IERDR...KGY-----------EVELNT.....DLSLKFTKDGK--FR.-------
Q5LIE1_BACFN/72-153-------------IENAC...YGD-----------CVLLSS.....GKKIAFYYDGT--CI.-------
R5U7Q0_9BACE/57-144-------------VEEATG.VTYY-----------LIDIEN....SEIDVKIRADGQ--IL.-------
R6WQR9_9PORP/57-147-------------IERRDV.ETVY-----------VIETEQG..NSEVDLYYSPDGI--LVK-------
R6X3F2_9PORP/60-141-------------IEKED...RGY-----------EAKLAN.....GMKLEFDNKFN--LI.-------
R6XCT8_9PORP/59-150-------------IGRAGM.GTVY-----------KVEVEKA..EQETDLYYTLYGD--LIK-------
R7EFG1_9BACE/61-142-------------IERGR...TGV-----------EIELGN.....DYSLKFNKKGK--FV.-------
R7EJJ2_9BACE/58-149-------------LEYPVV.PMQF-----------VIEVEKG..NAEYQLFYSEEGG--LLQ-------
R7EKK7_9BACE/52-145-------------ITFPKH.PTVI-----------IIEVEQYNSDEEFQLFYAPDGK--LLQ-------
R7ELA9_9BACE/58-149-------------LERKEM.AVVY-----------IIEVEKG..NQEMDLYYSEDGI--LVK-------
R7ERW1_9BACE/60-141-------------IEYDD...NEY-----------EIKLSN.....RWEITFDSKMR--VI.-------
R7JJR5_9BACT/78-154-------------IEHTC...REW-----------EVKLNN.....TIELTFDDK..--...-------

PF11399

K7AKJ7_9ALTE/17-119-------------K--NEC--TPL-----------VFK---------------NSVL..VGWGESAYDA
F5Z4M1_ALTNA/22-120-------------Q--DEC--TPL-----------LFE---------------NEKL..IAWGDGAYSS
E1SS82_FERBD/33-127-------------P--DET--TPL-----------LFR---------------DGVL..FGWGETAFEQ
Q8EGJ0_SHEON/23-131-------------K--DEC--TPV-----------VLS---------------NHVL..MGWGDTAYNK
A1S8B9_SHEAM/20-120-------------K--DEC--TPL-----------LFK---------------DNQL..IAWGSDTYKQ
K7AKJ0_9ALTE/22-120-------------E--DEC--TAL-----------FFE---------------NNEL..IAWGDSAYQS
A3QGB8_SHELP/19-122-------------K--DEC--TPI-----------VIT---------------DNRV..VGWGEKAYHN
Q15QZ2_PSEA6/17-119-------------K--DEC--TPL-----------VIK---------------NDQL..VGWGDSALNM
Q07ZE7_SHEFN/20-120-------------K--EEC--TPL-----------LFR---------------DNLL..IAWGQDTEDQ
Q47YB6_COLP3/19-119-------------K--DEC--TFL-----------QFI---------------NGQL..VETGNGG...
Q8EGQ0_SHEON/20-120-------------K--EEC--TPL-----------MFK---------------DNKL..VAWGNDTYKQ
D4ZHG3_SHEVD/20-120-------------R--DEC--TPL-----------LFK---------------NQQL..IAWGSDTYDQ
D4ZHN7_SHEVD/34-137-------------K--DEC--TPV-----------VIS---------------NNAV..IGWGNMAYKN
E1STL4_FERBD/20-123-------------K--DEC--TPI-----------VLT---------------NGAV..TGWGNTALEN
Q47YA7_COLP3/20-123-------------Q--DEC--TFL-----------LFV---------------NGTLKEIGLGNNYPEQ
Q085F9_SHEFN/19-126-------------K--DEC--TPI-----------VFR---------------DDVL..VGWGDTAYRQ
Q15QY7_PSEA6/21-120-------------Q--DEC--TAL-----------LLQ---------------NDEL..IAWGDSAYQD
Q12P24_SHEDO/19-126-------------K--DEC--TPV-----------VLR---------------NNKL..IGWGDAAYKM
Q5QW11_IDILO/20-120-------------K--DEC--TPL-----------VFR---------------DNKL..IAWGNDSYRD
Q3ICC6_PSEHT/21-122-------------I--DEC--TGL-----------LFK---------------NGQL..ILWGPSAYDQ
G4QLZ6_GLANF/37-143-------------K--NEC--TPL-----------VFV---------------NDEL..KGWGELSLSK
Q12L38_SHEDO/26-125-------------K--DEC--TPL-----------LFD---------------NEKL..IAWGPDTYQQ
A3QGM5_SHELP/20-120-------------R--DEC--TPL-----------LFK---------------NNKL..IAWGQDTYQQ
A1S4M5_SHEAM/18-116-------------K--EEC--TPV-----------VLH---------------DNRL..VGWGETAYR.

PF04355

Q5NL78_ZYMMO/17-93-------------K..QNV--LAV-----------HFD---------------PRGN--VSRVE-----
Q5LQJ9_RUEPO/35-111-------------S..REL--VAI-----------SFD---------------QRGV--VRNIE-----
Q1LSR9_BAUCH/37-105-------------T..QKR--VIL-----------TFN---------------KSDI--LTNLD-----
Q1LBA9_CUPMC/75-149-------------DVVQCQ--MKV-----------VFD---------------KNEK--TRAYY-----
A5WGN5_PSYWF/35-114-------------A..SQH--LII-----------YFD---------------DADT--VIKVE-----
Q9CJV5_PASMU/34-104-------------E..QHT--LVV-----------NFD---------------QRGI--VTSFD-----
BAME_PSYIN/35-104-------------Q..QDK--VVF-----------TFD---------------N.LL--LTDIA-----
Q220P9_RHOFT/38-108-------------Q..ARK--VTV-----------FFK---------------DDAL--ERIEA-----
BAME_NEIMB/36-106-------------E..RSN--LTV-----------YFE---------------NGVL--VRTEG-----
Q5NEF6_FRATT/34-106-------------QFSESK--LIL-----------TFN---------------NQDR--LIGIS-----
BAME_VIBF1/35-105-------------I..QKN--LIV-----------HFD---------------DNGN--LTNME-----
A6VMF3_ACTSZ/34-104-------------E..QHT--LTV-----------NFN---------------QAGN--VTDFN-----
Q7VRQ4_BLOFL/39-110-------------D..YRT--IIL-----------QFD---------------SHDK--LITLK-----
BAME_NITEU/35-105-------------E..EKK--LTV-----------FFQ---------------DDRL--SHIQG-----
Q0C315_HYPNA/29-105-------------E..RSI--IAI-----------SFS---------------EDDA--VDEVV-----
Q47XI1_COLP3/29-101-------------FDMKKQ--FII-----------NFS---------------NDKL--VSASG-----
Q47HJ0_DECAR/36-107-------------E..SRK--FAV-----------FFD---------------TEGR--LERVD-----
Q5FUN3_GLUOX/45-121-------------K..QQV--VVL-----------NFD---------------NGGV--LRKMD-----
Q2SMN2_HAHCH/93-162-------------Y..RQN--ITL-----------EYE---------------NDIL--VN.IA-----
Q0A7D7_ALKEH/37-107-------------E..KKR--MTL-----------RFE---------------DGRL--VDISG-----
A1AX05_RUTMC/37-107-------------I..HYR--LVL-----------KFN---------------DDIL--VHINT-----
Q3SSS7_NITWN/53-129-------------D..QRV--IAI-----------YFD---------------NNRQ--VTRLA-----
Q2RTT3_RHORT/36-112-------------E..RTI--IAV-----------HFD---------------DNGR--VKGID-----
Q2NRT5_SODGM/28-97-------------...PIN--YFV-----------SYD---------------ETGK--VLNKG-----
A4VII8_PSEU5/29-97-------------...QQP--YYV-----------SFD---------------SAGR--VDGQG-----
A7I1H3_CAMHC/52-124-------------KDMICQ--YKI-----------VYD---------------FDTY--KAASI-----
Q604C4_METCA/51-121-------------V..QRR--ISL-----------LFD---------------HDEL--VGLQG-----
B0UR41_METS4/34-110-------------S..QRV--LAV-----------YFN---------------QGFK--VERVA-----
Q15V54_PSEA6/31-104-------------F..RKE--LTL-----------HFV---------------DNRV--SEVTG-----
Q31FS2_THICR/36-107-------------...VRH--LVV-----------NFD---------------SEQY--LDNWK-----
A1WGT8_VEREI/51-121-------------Q..ARK--LTV-----------FFK---------------GDVL--DRSEG-----
A4SVD7_POLSQ/67-138-------------D..ERH--VTV-----------FFD---------------GDKV--VKFEG-----
Q2NRZ9_SODGM/35-105-------------S..QQT--LTL-----------TFN---------------SSDI--LTHID-----
A1WCQ4_ACISJ/49-119-------------Q..TRK--LTV-----------FFK---------------DNVM--ERVEG-----
Q1LMT9_CUPMC/71-142-------------Q..QRR--LTA-----------YFA---------------GDRL--LRFDS-----
Q6FDQ3_ACIAD/30-107-------------H..GQH--LKI-----------YFN---------------ESGI--VKSIE-----
Q7CZT7_AGRFC/48-124-------------E..QNI--LAI-----------YFN---------------KDGV--IERKA-----
Q0K704_CUPNH/51-122-------------Q..QRR--FTV-----------FFE---------------GDRL--VKFSG-----
Q21H32_SACD2/36-106-------------V..DRR--FTV-----------YFD---------------GDSL--AKWET-----
Q83C32_COXBU/30-100-------------H..STR--LIV-----------YLR---------------DNRV--VSFWT-----
A8GGW6_SERP5/28-97-------------...VQT--YFV-----------SYS---------------DTGH--VMNKG-----
A5FV68_ACICJ/239-315-------------K..QQV--VVL-----------DFT---------------GNGV--LKSIR-----
Q3SJS3_THIDA/32-102-------------E..QKR--ITL-----------HFD---------------GDTL--ARIEG-----
A0KI84_AERHH/30-100-------------E..RKE--LTL-----------TFA---------------NDRL--ATVTG-----
Q3IE33_PSEHT/35-105-------------Q..YKS--LVI-----------NFE---------------NEKL--ASISG-----
A6W2D6_MARMS/31-103-------------D..AND--LVL-----------IF.---------------SDGV--LTQIK-----
Q2G501_NOVAD/31-107-------------N..QSI--LVV-----------DFD---------------ARGN--VSSLT-----
A7HX93_PARL1/37-112-------------E..RTV--AAV-----------YFD---------------ETQS--VQQIA-----
Q983A2_RHILO/103-179-------------D..QKV--LAV-----------YFG---------------ADGR--VTQIA-----
Q7NX33_CHRVO/32-104-------------T..DKL--LTI-----------HFK---------------GDAL--DRVEG-----
Q2YBT7_NITMU/31-101-------------E..QRK--LTI-----------FFE---------------DDHL--VRIDG-----
A2SC95_METPP/48-118-------------Q..QRR--VTV-----------LFD---------------GDTM--KSFEA-----
A1K8N9_AZOSB/69-139-------------E..QRV--FSV-----------FFV---------------DDKL--DHVEG-----
A7INK8_XANP2/42-117-------------E..QKV--LAI-----------YFD---------------KNKR--VSRVA-----
Q1QSW6_CHRSD/33-103-------------E..EKR--VTL-----------TFQ---------------NGRL--ADIDR-----
Q1H393_METFK/54-124-------------E..QRR--IIM-----------EFE---------------NDAL--KRVRG-----
A3MZE6_ACTP2/34-104-------------I..QHT--LFV-----------NFD---------------SKGL--VSNIT-----
B0T0T5_CAUSK/29-105-------------K..RDV--VAI-----------KFN---------------PADE--KVASI-----
A1WX37_HALHL/38-106-------------...RKR--LTL-----------HFD---------------GDEL--VEIED-----
Q11J87_CHESB/48-124-------------D..QQV--LAV-----------YFG---------------PDQR--VTQIA-----
A4XUA2_PSEMY/28-96-------------...EQP--YYV-----------NFD---------------VNGR--VDSKG-----
Q28RF7_JANSC/34-109-------------E..RDI--VAI-----------SFS---------------DAGR--VTNIE-----
Q5QXM4_IDILO/32-102-------------Y..RKE--LVL-----------TFN---------------DKRL--QDFKG-----
BAME_BUCAI/32-101-------------...KKM--LNL-----------YFK---------------DNKV--FKFNM-----
Q0BTE4_GRABC/35-111-------------Q..QNV--VTV-----------SFD---------------QNGV--LKNIK-----
Q2NDV7_ERYLH/16-92-------------T..HQV--LAV-----------RFD---------------QAGN--VIATD-----
Q122Q0_POLSJ/29-99-------------Q..TYK--YTV-----------FFN---------------GDQL--ERFAG-----
Q3JBU9_NITOC/42-112-------------K..QRT--ITM-----------WFE---------------EGKL--SYVGG-----
Q7VM11_HAEDU/34-104-------------V..QHT--LFI-----------YFD---------------KNGL--VKDIQ-----
Q6D4H9_PECAS/28-96-------------...AQN--YFV-----------SYN---------------DTGN--VLNKG-----
A5V7M5_SPHWW/32-109-------------S..QTV--LAV-----------HFD---------------DKGN--VASVE-----
Q1GPC4_SPHAL/37-113-------------A..QQV--LRI-----------RFD---------------AAGN--VAAVD-----
Q0VSU2_ALCBS/35-105-------------V..SQN--IAV-----------YFE---------------DGAY--RRYEG-----
B0UU40_HISS2/52-121-------------K..ICQ--YKI-----------LFD---------------KNMN--AQNF.-----
B0UV53_HISS2/34-103-------------E..QHT--FIV-----------NFD---------------RRGI--VTDV.-----
B7VJW3_VIBTL/77-145-------------I..QKN--LVV-----------NFD---------------ATGT--LVT..-----
C1DFM7_AZOVD/35-101-------------L..QER--VSL-----------VFD---------------TNDL--L....-----
D4Z6S0_SPHJU/63-138-------------S..QTV--LHV-----------RFD---------------AAGN--VVAV.-----
M1FIJ3_9ALTE/29-96-------------E..EQR--IIV-----------YYD---------------DDRF--SR...-----
M9X398_MANHA/34-103-------------E..QRN--LFI-----------YFD---------------AKGL--VSKI.-----
BAME_VIBCH/35-104-------------V..QKN--LIV-----------KFN---------------DGGK--LVNV.-----
BAME_HAEIN/34-103-------------V..QHT--FTV-----------KFD---------------QRGI--VTET.-----
Q2KA05_RHIEC/31-105-------------D..QSV--LAI-----------YFD---------------KDGV--VTR..-----
Q2YNC3_BRUA2/49-124-------------E..RQI--LAI-----------YFN---------------KDGK--VEHI.-----
Q3J361_RHOS4/40-116-------------D..RQV--VAI-----------TFN---------------PTGT--VRNIE-----
BAME_PSYA2/52-130-------------A..SQH--LKV-----------YFD---------------NNGI--VTGI.-----
Q5ZYK0_LEGPH/42-110-------------E..IRN--VVL-----------YFS---------------RGSL--VKI..-----
Q63LV3_BURPS/48-120-------------V..TCQ--YQI-----------QYD---------------KHYR--VKST.-----
Q63QT2_BURPS/54-121-------------Q..QRD--LVV-----------NFA---------------GDRL--A....-----
Q6LUB1_PHOPR/34-102-------------V..QKN--LIL-----------AFD---------------AQNK--LTG..-----
Q79GM4_BORPE/42-111-------------Q..ERQ--FTV-----------WFE---------------NDHL--VRWS.-----
BAME_YERPE/38-107-------------T..QQT--LTL-----------TFD---------------SSGV--LTDI.-----
BAME_SALTY/35-104-------------T..QQT--LTL-----------TFN---------------SSGV--LTNI.-----
Q87RX9_VIBPA/35-104-------------V..QKD--LVV-----------NFN---------------DQGT--LADI.-----
Q87VN2_PSESM/31-98-------------...KQV--YHV-----------SFN---------------SDGR--VTNKG-----
Q88DH0_PSEPK/30-95-------------...QQP--YYV-----------RFD---------------ATGH--VDAK.-----
Q88DT8_PSEPK/35-101-------------Q..QER--MSV-----------FFN---------------ESDQ--L....-----
BAME_SHEON/38-105-------------T..HKE--LIL-----------HFT---------------GNKL--S....-----
BAME_XANCP/28-99-------------D..VKN--FTV-----------FFE---------------NEQV--VRWEG-----
Q8XVT1_RALSO/61-130-------------Q..ERK--LTV-----------WFE---------------ADRL--AKW..-----
Q92KF5_RHIME/42-116-------------D..QSI--LAV-----------YFD---------------KEGT--VSQ..-----
Q9HUT7_PSEAE/31-97-------------...QQP--FYV-----------SFD---------------GSGK--VDGS.-----
Q9JXT1_NEIMB/52-133-------------T..TCQ--YKV-----------IFD---------------KDKF--ARSF.-----
Q9PB00_XYLFA/44-114-------------E..IKN--LTI-----------YFQ---------------NDLV--TRWE.-----
V6F1L4_9PROT/28-103-------------D..RKV--VSV-----------NFD---------------MAGI--VKTV.-----

PF12978

Q8DTX1_STRMU/47-205-------------S--SAT--IEL-----------YFE---------------NGLLKNKTQKDL----
B9DSB0_STRU0/47-205-------------R--GSH--ISL-----------LFE---------------NDQLIEMSQTGL----
G2SNY8_LACRR/70-224-------------.--..T--ATL-----------TFE---------------NGGMTSKTQVDL----
Q8DZF2_STRA5/47-206-------------S--DPG--INL-----------TFE---------------NDKLTNKQQHGL----
Q99ZC4_STRP1/47-204-------------S--GAN--ISL-----------VFE---------------NNQLTEMSQVGL----

PF07467

Q9KJ90_STREX/2-185-------------GLFPPS--ASF-----------HLT---------------DGVLTYRYQRSL----
B5GLC0_STRC2/2-181-------------ERFAPS--AYF-----------TFT---------------DGKLTSRSQSQL----
BLIP_STRCL/10-200-------------GFYRGS--AHL-----------WFT---------------DGVLQGKRQWDL----

PF14172

C0Z8F5_BREBN/45-177........REFMDDSGDHT--FIL...........EYENNGNLLRFTFDSKESP........VKYVTL.
W0EAP8_9FIRM/51-184......YDVKLN.G...EE--IIG......YTAGQEFK.....IELVFPEP..THNNPNPL.LDHYLV.
YJGB_BACSU/51-188......RVLTVP..FTDEI--DYV......YDTG.RYE.....LHFVIGTD..Q.......TADHVNL.
C0Z6K8_BREBN/118-238.........RIS.EFGDRT--IYT......YDVTSKYQ.....VKLIFQGT..KSTN............
D3E8N0_GEOS4/57-196......ATTTFKNGKTKQT--KLT......YHRG.AYK.....LEFIFNSS..TD.......LDHINLL
U5MR07_CLOSA/75-209......HDVTAN.G...EE--IIG......YVAGQEFK.....ILFVFKVP..KDSNDDPK.LDHYSVL
R4K5N0_CLOPA/85-219......HDVKVN.G...EE--IIG......YKMGNDFK.....ILFVFPEP..TNQHANPI.MSHYSVL
C6D3T6_PAESJ/51-191......ESVQIKSGKTVQK--KIT......YVRG.KYQ.....LEFIFDGTNGTN.......LNHINLV
I3VRL4_THESW/85-217......YKATVS.GTPNQT--VLG......YTMNSDYK.....LEFVISDT..TN.....L.VDHVNVL
C8WQ55_ALIAD/107-238.......SVRYT.Q..DSY--IYL......YPAGPDYQ.....LLWVFPRL..PSGHSGPT.VDHVSVF
M1MNJ5_9CLOT/77-211......HNVTVN.N...EK--ILG......YVAGADYK.....ILFVFKVG..ADSKEDPK.LDHYSVL
I4D7B6_DESAJ/531-665......YDTQIN.G...QE--IIG......YTTNSQFK.....VEMIFPQP..TSSNPNPV.IDHYNVL
F6DUI9_DESRL/67-201......MSRTYQ.G...QD--IIG......YRAGTDYK.....LLFIFPQA..TPEEANPY.VDHVNVF
Q8XI71_CLOPE/88-217......YTVTTK.S..KEK--IIG......YKITKDFK.....ILFVFNTS..TY.....K.LDHYSVL
Q24YP2_DESHY/79-213......YTATVG.E...ED--IIG......YTAGEEFK.....ILLVFPKA..TSANPDPA.LDHYSVL
A6LYS0_CLOB8/79-210......HDVTSN.G...ER--IIG......YKSGSEFK.....ILFVFK.....DSGNDPK.LYHYSVL
Q81PC7_BACAN/76-203.......SVKGN.G..EDK--IYV......YKVNKQFE.....LKFIIPKS..TG.....K.VNHISVF
G7M4A2_9CLOT/93-227......HDVTSS.G...EK--IIG......YVSGEDFK.....ILFVFKAP..SDSDNDPK.LDHYSVL
A8MGG8_ALKOO/77-218......EVISAK.DNEQSE--LYMDNWTTRYKLG.SYE.....LTFVHEDKDGP........VEWFSLW
A8FAZ3_BACP2/47-191......SVSTIP..QTKEK--KYV......YRTG.DYE.....LEFIVGHD..PDISQQKLTVLHINLV
C0Z6K8_BREBN/268-401......SKVTTG.G...QT--IYT......YKVTPDYE.....LKFIFSGI..MTDDPNTIYIDHVNIY
J7J151_DESMD/62-207VENGPFYDKKVN.G...EE--IIG......YTVSSEYK.....IEFVFPIP..TATDSNPM.MDHYLV.
X4Z8J4_9BACL/92-219.......DVKTS.G..NDS--IYI......YNAGAQYQ.....LKFVILKS..TG.....Q.VDHISVF

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window