Sequence alignment for CL0320

PF13670

Q0BXA6_HYPNA/7-95--------------------------------------------------------------------------------
Q0BXA5_HYPNA/6-84--------------------------------------------------------------------------------
Q0BY17_HYPNA/6-92--------------------------------------------------------------------------------
A4VHV2_PSEU5/30-109--------------------------------------------------------------------------------
A4XVH9_PSEMY/6-85--------------------------------------------------------------------------------
Q1QMT6_NITHX/5-85--------------------------------------------------------------------------------
B8EKV5_METSB/3-81--------------------------------------------------------------------------------
Q5LX53_RUEPO/50-129--------------------------------------------------------------------------------
B8IVF4_METNO/5-90--------------------------------------------------------------------------------
B3PI60_CELJU/2-85--------------------------------------------------------------------------------
C1DNM7_AZOVD/2-85--------------------------------------------------------------------------------
Q1LBN9_RALME/3-85--------------------------------------------------------------------------------
Q8XWW7_RALSO/3-85--------------------------------------------------------------------------------
A1K227_AZOSB/5-88--------------------------------------------------------------------------------
Q5P431_AROAE/5-88--------------------------------------------------------------------------------
Q5P432_AROAE/18-101--------------------------------------------------------------------------------
D0KWU4_HALNC/5-88--------------------------------------------------------------------------------
B0SVT0_CAUSK/5-90--------------------------------------------------------------------------------
A7IQ54_XANP2/6-90--------------------------------------------------------------------------------
B1Y4P0_LEPCP/3-85--------------------------------------------------------------------------------
B8IVE9_METNO/4-91--------------------------------------------------------------------------------
Q1QM54_NITHX/4-90--------------------------------------------------------------------------------
A1B769_PARDP/5-86--------------------------------------------------------------------------------
A1B772_PARDP/5-86--------------------------------------------------------------------------------
B6JDT2_OLICO/6-87--------------------------------------------------------------------------------
A1U059_MARHV/5-86--------------------------------------------------------------------------------
A1SRM1_PSYIN/5-86--------------------------------------------------------------------------------
B9K2Y3_AGRVS/4-85--------------------------------------------------------------------------------
A7IKT6_XANP2/6-87--------------------------------------------------------------------------------
A1B771_PARDP/5-86--------------------------------------------------------------------------------
Q0S079_RHOJR/10-95--------------------------------------------------------------------------------
A8LNS6_DINSH/4-81--------------------------------------------------------------------------------
B1M6N2_METRJ/3-84--------------------------------------------------------------------------------
A7HVA0_PARL1/7-87--------------------------------------------------------------------------------
C5AT97_METEA/7-83--------------------------------------------------------------------------------
G2J097_PSEUL/8-86--------------------------------------------------------------------------------
Q2YRI6_BRUA2/6-85--------------------------------------------------------------------------------
Q3J9Y2_NITOC/7-84--------------------------------------------------------------------------------
Q5F6R1_NEIG1/7-90--------------------------------------------------------------------------------

PF03413

Q9K7V1_BACHD/28-100--------------------------------------------------------------------------------
Q816W8_BACCR/30-100--------------------------------------------------------------------------------
Q8EP78_OCEIH/29-101--------------------------------------------------------------------------------
U5LGT7_9BACI/29-101--------------------------------------------------------------------------------
Q03RI8_LACBA/34-106--------------------------------------------------------------------------------
Q03GC8_PEDPA/34-106--------------------------------------------------------------------------------
Q82ZL5_ENTFA/37-109--------------------------------------------------------------------------------
Q5HNG3_STAEQ/33-102--------------------------------------------------------------------------------
B1YKF6_EXIS2/28-100--------------------------------------------------------------------------------
Q181V6_PEPD6/408-465--------------------------------------------------------------------------------
Q181V6_PEPD6/490-547--------------------------------------------------------------------------------
Q8TTA4_METAC/138-199--------------------------------------------------------------------------------
A8MEK6_ALKOO/172-230--------------------------------------------------------------------------------
A8MEK6_ALKOO/94-155--------------------------------------------------------------------------------
A8MEK5_ALKOO/294-355--------------------------------------------------------------------------------
Q5WGU9_BACSK/378-439--------------------------------------------------------------------------------
YPEB_BACSU/377-438--------------------------------------------------------------------------------
A8FEM8_BACP2/376-437--------------------------------------------------------------------------------
YPEB_BACHD/374-435--------------------------------------------------------------------------------
YPEB_OCEIH/373-434--------------------------------------------------------------------------------
A3DI39_CLOTH/391-452--------------------------------------------------------------------------------
A0Q324_CLONN/379-440--------------------------------------------------------------------------------
Q2RM03_MOOTA/386-447--------------------------------------------------------------------------------
A8MIH5_ALKOO/376-437--------------------------------------------------------------------------------
Q12WY7_METBU/120-186--------------------------------------------------------------------------------
Q6W134_RHISN/286-345--------------------------------------------------------------------------------
Q8ELE8_OCEIH/178-237--------------------------------------------------------------------------------
Q9KBS1_BACHD/273-331--------------------------------------------------------------------------------
Q5KVG3_GEOKA/282-341--------------------------------------------------------------------------------
Q9KE75_BACHD/288-347--------------------------------------------------------------------------------
A9B7B4_HERA2/311-370--------------------------------------------------------------------------------
Q3SKV5_THIDA/55-112--------------------------------------------------------------------------------
Q3JE96_NITOC/270-334--------------------------------------------------------------------------------
Q9A7E1_CAUCR/252-316--------------------------------------------------------------------------------
Q020P0_SOLUE/231-293--------------------------------------------------------------------------------
Q82WV7_NITEU/279-343--------------------------------------------------------------------------------
A4FCJ5_SACEN/417-477--------------------------------------------------------------------------------
Q9KE75_BACHD/74-132--------------------------------------------------------------------------------
Q5WLI5_BACSK/75-133--------------------------------------------------------------------------------
Q47KW9_THEFY/83-144--------------------------------------------------------------------------------
Q825U8_STRAW/84-147--------------------------------------------------------------------------------
A0R6J4_MYCS2/78-140--------------------------------------------------------------------------------
A1T724_MYCVP/79-141--------------------------------------------------------------------------------
Q6NKB0_CORDI/71-132--------------------------------------------------------------------------------
Q9KBS1_BACHD/60-118--------------------------------------------------------------------------------
Q8P606_XANCP/82-140--------------------------------------------------------------------------------
Q7CY41_AGRFC/75-132--------------------------------------------------------------------------------
Q2RPK6_RHORT/75-133--------------------------------------------------------------------------------
Q6W134_RHISN/75-133--------------------------------------------------------------------------------
Q1R143_CHRSD/68-125--------------------------------------------------------------------------------
Q7NVU2_CHRVO/229-292--------------------------------------------------------------------------------
Q8A623_BACTN/26-84--------------------------------------------------------------------------------
Q884E8_PSESM/67-126--------------------------------------------------------------------------------
Q9I178_PSEAE/60-119--------------------------------------------------------------------------------
Q1LJM8_RALME/260-324--------------------------------------------------------------------------------
Q82P05_STRAW/125-192--------------------------------------------------------------------------------
Q9L1F9_STRCO/146-216--------------------------------------------------------------------------------
Q82BN5_STRAW/115-187--------------------------------------------------------------------------------
Q9L2B8_STRCO/168-232--------------------------------------------------------------------------------
Q0AQU2_MARMM/109-177--------------------------------------------------------------------------------
E0THY6_PARBH/109-174--------------------------------------------------------------------------------
A7ZG54_CAMC1/58-115--------------------------------------------------------------------------------
Q63MT4_BURPS/165-233--------------------------------------------------------------------------------
A7ZEI5_CAMC1/100-159--------------------------------------------------------------------------------
Q03XK6_LEUMM/140-199--------------------------------------------------------------------------------
Q9KC80_BACHD/94-154--------------------------------------------------------------------------------
Q5KXX8_GEOKA/94-154--------------------------------------------------------------------------------
Q1WU38_LACS1/104-164--------------------------------------------------------------------------------
A8FEH2_BACP2/99-159--------------------------------------------------------------------------------
Q6ANJ0_DESPS/50-117--------------------------------------------------------------------------------
Q8R5X9_FUSNN/10-69--------------------------------------------------------------------------------
Q8E0L6_STRA5/117-180--------------------------------------------------------------------------------
Q8RBF9_CALS4/109-184--------------------------------------------------------------------------------
B8I195_CLOCE/108-180--------------------------------------------------------------------------------
Q1D8Q2_MYXXD/168-239--------------------------------------------------------------------------------
Q81MX8_BACAN/145-217--------------------------------------------------------------------------------
Q5ZRA6_LEGPH/16-86--------------------------------------------------------------------------------
Q87I51_VIBPA/131-204--------------------------------------------------------------------------------
Q2FUX4_STAA8/118-192--------------------------------------------------------------------------------
PRTA_LISMO/121-194--------------------------------------------------------------------------------
Q97G52_CLOAB/161-230--------------------------------------------------------------------------------
Q97G51_CLOAB/153-222--------------------------------------------------------------------------------
Q97GS5_CLOAB/161-230--------------------------------------------------------------------------------
A5I1S2_CLOBH/148-212--------------------------------------------------------------------------------
Q81R73_BACAN/122-192--------------------------------------------------------------------------------
Q815U2_BACCR/146-219--------------------------------------------------------------------------------
NPRB_BACSU/145-217--------------------------------------------------------------------------------
Q8ESH1_OCEIH/143-217--------------------------------------------------------------------------------
B1YFR1_EXIS2/113-183--------------------------------------------------------------------------------
NPRM_BACMD/153-222--------------------------------------------------------------------------------
Q81I21_BACCR/151-220--------------------------------------------------------------------------------
Q8DVN1_STRMU/57-120--------------------------------------------------------------------------------
Q99YI6_STRP1/81-143--------------------------------------------------------------------------------
R6P3S5_9CLOT/179-241--------------------------------------------------------------------------------
Q8ESN0_OCEIH/32-90--------------------------------------------------------------------------------
A5G759_GEOUR/48-108--------------------------------------------------------------------------------
O27358_METTH/81-143--------------------------------------------------------------------------------
Q8ERG4_OCEIH/132-194--------------------------------------------------------------------------------
Q5WLC0_BACSK/58-117--------------------------------------------------------------------------------
Q82ZK1_ENTFA/63-122--------------------------------------------------------------------------------
Q5FIK1_LACAC/43-101--------------------------------------------------------------------------------
Q5FIK0_LACAC/62-121--------------------------------------------------------------------------------
Q74JH3_LACJO/49-108--------------------------------------------------------------------------------
Q8ERG4_OCEIH/56-114--------------------------------------------------------------------------------
Q186H8_PEPD6/62-121--------------------------------------------------------------------------------
Q9KFU6_BACHD/49-108--------------------------------------------------------------------------------
Q8ESM9_OCEIH/39-97--------------------------------------------------------------------------------
A8AXQ2_STRGC/352-411--------------------------------------------------------------------------------
Q81R43_BACAN/43-101--------------------------------------------------------------------------------
Q8ELD0_OCEIH/32-90--------------------------------------------------------------------------------
Q4K807_PSEF5/38-102--------------------------------------------------------------------------------
C1DJ09_AZOVD/39-99--------------------------------------------------------------------------------
A4XTT8_PSEMY/39-99--------------------------------------------------------------------------------
Q0VNT9_ALCBS/52-112--------------------------------------------------------------------------------
Q0S7B7_RHOJR/138-198--------------------------------------------------------------------------------
Q5F637_NEIG1/47-105--------------------------------------------------------------------------------
Q1ARP9_RUBXD/67-126--------------------------------------------------------------------------------
Q9L126_STRCO/188-249--------------------------------------------------------------------------------
Q9L2B8_STRCO/83-152--------------------------------------------------------------------------------
A9C057_DELAS/120-179--------------------------------------------------------------------------------
Q8RD03_CALS4/115-173--------------------------------------------------------------------------------
A8FCD9_BACP2/110-169--------------------------------------------------------------------------------
YKOJ_BACSU/108-167--------------------------------------------------------------------------------
Q8ESM9_OCEIH/119-177--------------------------------------------------------------------------------
YKOI_BACSU/164-223--------------------------------------------------------------------------------
A8FCD8_BACP2/167-226--------------------------------------------------------------------------------
Q5WKR9_BACSK/175-233--------------------------------------------------------------------------------
Q9KFU7_BACHD/111-170--------------------------------------------------------------------------------
Q9KFU6_BACHD/130-191--------------------------------------------------------------------------------
Q5WKR8_BACSK/122-181--------------------------------------------------------------------------------
Q38Z32_LACSS/130-188--------------------------------------------------------------------------------
Q2G105_STAA8/129-187--------------------------------------------------------------------------------
Q5FIK0_LACAC/141-199--------------------------------------------------------------------------------
Q82ZK1_ENTFA/146-205--------------------------------------------------------------------------------
Q74LX8_LACJO/141-200--------------------------------------------------------------------------------
Q5FIK1_LACAC/119-178--------------------------------------------------------------------------------
Q74JH3_LACJO/126-184--------------------------------------------------------------------------------
Q186H8_PEPD6/144-202--------------------------------------------------------------------------------
Q5WLC0_BACSK/141-199--------------------------------------------------------------------------------
Q8R5X9_FUSNN/83-142--------------------------------------------------------------------------------
B1HY97_LYSSC/168-225--------------------------------------------------------------------------------
Q81R44_BACAN/99-158--------------------------------------------------------------------------------
Q0VNU0_ALCBS/63-123--------------------------------------------------------------------------------
Q3JBE9_NITOC/51-111--------------------------------------------------------------------------------
A4XTT9_PSEMY/41-101--------------------------------------------------------------------------------
Q0BZN8_HYPNA/53-112--------------------------------------------------------------------------------
A1B2L4_PARDP/40-99--------------------------------------------------------------------------------
Q9A8Q0_CAUCR/73-133--------------------------------------------------------------------------------
Q988S6_RHILO/46-105--------------------------------------------------------------------------------
A4YY21_BRASO/40-99--------------------------------------------------------------------------------
Q2RPG4_RHORT/72-131--------------------------------------------------------------------------------
V6F502_9PROT/38-95--------------------------------------------------------------------------------
Q0AR59_MARMM/55-114--------------------------------------------------------------------------------
A8LN27_DINSH/31-89--------------------------------------------------------------------------------
A5VEY7_SPHWW/24-82--------------------------------------------------------------------------------
Q8KFX7_CHLTE/45-103--------------------------------------------------------------------------------
B4E758_BURCJ/39-96--------------------------------------------------------------------------------
A9C057_DELAS/43-102--------------------------------------------------------------------------------
E0TIH6_PARBH/43-102--------------------------------------------------------------------------------
B0UCU3_METS4/66-129--------------------------------------------------------------------------------
A3QGG2_SHELP/47-105--------------------------------------------------------------------------------
Q7P204_CHRVO/118-188--------------------------------------------------------------------------------
ELAS_PSEAE/122-192--------------------------------------------------------------------------------
A1S2N2_SHEAM/113-188--------------------------------------------------------------------------------
Q2SJ90_HAHCH/129-208--------------------------------------------------------------------------------
B7VN56_VIBTL/116-190--------------------------------------------------------------------------------
F7YSQ2_VIBA7/118-194--------------------------------------------------------------------------------
HAPT_VIBCH/116-190--------------------------------------------------------------------------------
Q5ZZJ1_LEGPH/124-199--------------------------------------------------------------------------------
A1S4V2_SHEAM/92-162--------------------------------------------------------------------------------
Q211C9_RHOPB/96-155--------------------------------------------------------------------------------
Q89L62_BRADU/85-144--------------------------------------------------------------------------------
A4YNR6_BRASO/46-105--------------------------------------------------------------------------------
Q6N7G2_RHOPA/56-115--------------------------------------------------------------------------------
Q1H2G7_METFK/106-166--------------------------------------------------------------------------------
A2SEW0_METPP/117-177--------------------------------------------------------------------------------
Q1H2G7_METFK/31-90--------------------------------------------------------------------------------
A5N159_CLOK5/17-76--------------------------------------------------------------------------------
A7ZEI5_CAMC1/22-81--------------------------------------------------------------------------------
Q8DWU2_STRA5/78-136--------------------------------------------------------------------------------

PF11396

A0M0Q0_GRAFK/54-143--------------------------------------------------------------------------------
A0M1R1_GRAFK/70-160--------------------------------------------------------------------------------
A5FIF1_FLAJ1/58-140--------------------------------------------------------------------------------
A5FNS8_FLAJ1/62-144--------------------------------------------------------------------------------
A6L337_BACV8/61-143--------------------------------------------------------------------------------
A6L4L1_BACV8/60-142--------------------------------------------------------------------------------
A6LDA3_PARD8/62-144--------------------------------------------------------------------------------
A6LDA4_PARD8/55-146--------------------------------------------------------------------------------
A6LDE6_PARD8/58-149--------------------------------------------------------------------------------
C0QVH4_BRAHW/54-141--------------------------------------------------------------------------------
C0QYD0_BRAHW/35-117--------------------------------------------------------------------------------
C0R146_BRAHW/63-147--------------------------------------------------------------------------------
C0R148_BRAHW/33-123--------------------------------------------------------------------------------
Q5L9Y2_BACFN/49-143--------------------------------------------------------------------------------
Q5LD45_BACFN/83-177--------------------------------------------------------------------------------
Q7MWB3_PORGI/60-142--------------------------------------------------------------------------------
Q7MWB4_PORGI/55-145--------------------------------------------------------------------------------
Q89YQ4_BACTN/58-150--------------------------------------------------------------------------------
Q89YQ5_BACTN/61-144--------------------------------------------------------------------------------
Q8A994_BACTN/60-142--------------------------------------------------------------------------------
Q8YLV6_NOSS1/61-150--------------------------------------------------------------------------------
C7M630_CAPOD/59-141--------------------------------------------------------------------------------
D6D2V5_9BACE/45-136--------------------------------------------------------------------------------
D6D5W5_9BACE/49-143--------------------------------------------------------------------------------
D6D6Q4_9BACE/56-146--------------------------------------------------------------------------------
Q0P802_CAMJE/53-133--------------------------------------------------------------------------------
Q0P9P8_CAMJE/51-132--------------------------------------------------------------------------------
Q5LBR7_BACFN/55-146--------------------------------------------------------------------------------
Q5LBR8_BACFN/60-141--------------------------------------------------------------------------------
Q5LG06_BACFN/60-151--------------------------------------------------------------------------------
Q5LG07_BACFN/61-143--------------------------------------------------------------------------------
Q5LIE1_BACFN/72-153--------------------------------------------------------------------------------
R5U7Q0_9BACE/57-144--------------------------------------------------------------------------------
R6WQR9_9PORP/57-147--------------------------------------------------------------------------------
R6X3F2_9PORP/60-141--------------------------------------------------------------------------------
R6XCT8_9PORP/59-150--------------------------------------------------------------------------------
R7EFG1_9BACE/61-142--------------------------------------------------------------------------------
R7EJJ2_9BACE/58-149--------------------------------------------------------------------------------
R7EKK7_9BACE/52-145--------------------------------------------------------------------------------
R7ELA9_9BACE/58-149--------------------------------------------------------------------------------
R7ERW1_9BACE/60-141--------------------------------------------------------------------------------
R7JJR5_9BACT/78-154--------------------------------------------------------------------------------

PF11399

K7AKJ7_9ALTE/17-119----------------------------------------------------------SGCVISVDGDG.KYGH....HS
F5Z4M1_ALTSS/22-120----------------------------------------------------------..LVISVYPDK.......PENM
E1SS82_FERBD/33-127----------------------------------------------------------APAT..............PDNM
Q8EGJ0_SHEON/23-131----------------------------------------------------------SGCVVNVGDGE..SGW..DRSE
A1S8B9_SHEAM/20-120----------------------------------------------------------VAVVAIGYEPT.......PENM
K7AKJ0_9ALTE/22-120----------------------------------------------------------..AVITFYPDT.......PKDM
A3QGB8_SHELP/19-122----------------------------------------------------------SGCVLNVGEGD..KGW..STGN
Q15QZ2_PSEA6/17-119----------------------------------------------------------SGCVISVDGDG.HDGY....QS
Q07ZE7_SHEFN/20-120----------------------------------------------------------VAVVIFVYEPQ.......PEDR
Q47YB6_COLP3/19-119----------------------------------------------------------SGCVIKINDDGMDHGF....VG
B8CS66_SHEPW/20-120----------------------------------------------------------VAVIMVSYDPT.......PDEM
Q8EGQ0_SHEON/20-120----------------------------------------------------------VAVVVLVYEPT.......PDEM
D4ZHG3_SHEVD/20-120----------------------------------------------------------VAVVVLVYEPT.......PDEM
D4ZHN7_SHEVD/34-137----------------------------------------------------------SGCVLNIGDGE..SGW..HGQE
E1STL4_FERBD/20-123----------------------------------------------------------SGCVIAVGDK....GWDAQSSA
Q47YA7_COLP3/20-123----------------------------------------------------------VALVMTFYDDS.......PDQM
Q085F9_SHEFN/19-126----------------------------------------------------------SGCVISVGDHE..SG...KSAD
Q15QY7_PSEA6/21-120----------------------------------------------------------.AAVLLFYPDN.......AQDM
Q12P24_SHEDO/19-126----------------------------------------------------------SGCVLNVGEH....GS..ARNS
B8CQA1_SHEPW/19-122----------------------------------------------------------TGCVINVGDGE..SDW..DNNG
Q5QW11_IDILO/20-120----------------------------------------------------------VGAVLMLYQAD.......PADL
Q3ICC6_PSEHT/21-122----------------------------------------------------------.TLVIVFYKDD.......PQAM
G4QLZ6_GLANF/37-143----------------------------------------------------------SGCVISIDDNY.EDGYDVSSGV
Q12L38_SHEDO/26-125----------------------------------------------------------.AVMFSSYDPL.......PGEK
F2GBX8_ALTMD/17-118----------------------------------------------------------SGCVVSVGGGS.DSHY....GA
A3QGM5_SHELP/20-120----------------------------------------------------------VAVVVLVYEPT.......PDDM
A1S4M5_SHEAM/18-116----------------------------------------------------------.GCVVNVGDGV..SGY.....Q

PF04355

Q5NL78_ZYMMO/17-93--------------------------------------------------------------------------------
Q5LQJ9_RUEPO/35-111--------------------------------------------------------------------------------
Q1LSR9_BAUCH/37-105--------------------------------------------------------------------------------
Q1LBA9_RALME/75-149--------------------------------------------------------------------------------
A5WGN5_PSYWF/35-114--------------------------------------------------------------------------------
Q9CJV5_PASMU/34-104--------------------------------------------------------------------------------
BAME_PSYIN/35-104--------------------------------------------------------------------------------
Q220P9_RHOFT/38-108--------------------------------------------------------------------------------
BAME_NEIMB/36-106--------------------------------------------------------------------------------
Q5NEF6_FRATT/34-106--------------------------------------------------------------------------------
BAME_VIBF1/35-105--------------------------------------------------------------------------------
A6VMF3_ACTSZ/34-104--------------------------------------------------------------------------------
Q7VRQ4_BLOFL/39-110--------------------------------------------------------------------------------
BAME_NITEU/35-105--------------------------------------------------------------------------------
Q0C315_HYPNA/29-105--------------------------------------------------------------------------------
Q47XI1_COLP3/29-101--------------------------------------------------------------------------------
Q47HJ0_DECAR/36-107--------------------------------------------------------------------------------
Q5FUN3_GLUOX/45-121--------------------------------------------------------------------------------
Q2SMN2_HAHCH/93-162--------------------------------------------------------------------------------
Q0A7D7_ALKEH/37-107--------------------------------------------------------------------------------
A1AX05_RUTMC/37-107--------------------------------------------------------------------------------
Q3SSS7_NITWN/53-129--------------------------------------------------------------------------------
Q2RTT3_RHORT/36-112--------------------------------------------------------------------------------
Q2NRT5_SODGM/28-97--------------------------------------------------------------------------------
A4VII8_PSEU5/29-97--------------------------------------------------------------------------------
A7I1H3_CAMHC/52-124--------------------------------------------------------------------------------
Q604C4_METCA/51-121--------------------------------------------------------------------------------
B0UR41_METS4/34-110--------------------------------------------------------------------------------
Q15V54_PSEA6/31-104--------------------------------------------------------------------------------
Q31FS2_THICR/36-107--------------------------------------------------------------------------------
A1WGT8_VEREI/51-121--------------------------------------------------------------------------------
A4SVD7_POLSQ/67-138--------------------------------------------------------------------------------
Q2NRZ9_SODGM/35-105--------------------------------------------------------------------------------
A1WCQ4_ACISJ/49-119--------------------------------------------------------------------------------
Q1LMT9_RALME/71-142--------------------------------------------------------------------------------
Q6FDQ3_ACIAD/30-107--------------------------------------------------------------------------------
Q7CZT7_AGRFC/48-124--------------------------------------------------------------------------------
Q0K704_CUPNH/51-122--------------------------------------------------------------------------------
Q21H32_SACD2/36-106--------------------------------------------------------------------------------
Q83C32_COXBU/30-100--------------------------------------------------------------------------------
A8GGW6_SERP5/28-97--------------------------------------------------------------------------------
A5FV68_ACICJ/239-315--------------------------------------------------------------------------------
Q3SJS3_THIDA/32-102--------------------------------------------------------------------------------
A0KI84_AERHH/30-100--------------------------------------------------------------------------------
Q3IE33_PSEHT/35-105--------------------------------------------------------------------------------
A6W2D6_MARMS/31-103--------------------------------------------------------------------------------
Q2G501_NOVAD/31-107--------------------------------------------------------------------------------
A7HX93_PARL1/37-112--------------------------------------------------------------------------------
Q983A2_RHILO/103-179--------------------------------------------------------------------------------
Q7NX33_CHRVO/32-104--------------------------------------------------------------------------------
Q2YBT7_NITMU/31-101--------------------------------------------------------------------------------
A2SC95_METPP/48-118--------------------------------------------------------------------------------
A1K8N9_AZOSB/69-139--------------------------------------------------------------------------------
A7INK8_XANP2/42-117--------------------------------------------------------------------------------
Q1QSW6_CHRSD/33-103--------------------------------------------------------------------------------
Q1H393_METFK/54-124--------------------------------------------------------------------------------
A3MZE6_ACTP2/34-104--------------------------------------------------------------------------------
B0T0T5_CAUSK/29-105--------------------------------------------------------------------------------
A1WX37_HALHL/38-106--------------------------------------------------------------------------------
Q11J87_CHESB/48-124--------------------------------------------------------------------------------
A4XUA2_PSEMY/28-96--------------------------------------------------------------------------------
Q28RF7_JANSC/34-109--------------------------------------------------------------------------------
Q5QXM4_IDILO/32-102--------------------------------------------------------------------------------
BAME_BUCAI/32-101--------------------------------------------------------------------------------
Q0BTE4_GRABC/35-111--------------------------------------------------------------------------------
Q2NDV7_ERYLH/16-92--------------------------------------------------------------------------------
Q122Q0_POLSJ/29-99--------------------------------------------------------------------------------
Q3JBU9_NITOC/42-112--------------------------------------------------------------------------------
Q7VM11_HAEDU/34-104--------------------------------------------------------------------------------
Q6D4H9_PECAS/28-96--------------------------------------------------------------------------------
A5V7M5_SPHWW/32-109--------------------------------------------------------------------------------
Q1GPC4_SPHAL/37-113--------------------------------------------------------------------------------
Q0VSU2_ALCBS/35-105--------------------------------------------------------------------------------
B0UU40_HISS2/52-121--------------------------------------------------------------------------------
B0UV53_HISS2/34-103--------------------------------------------------------------------------------
B7VJW3_VIBTL/77-145--------------------------------------------------------------------------------
C1DFM7_AZOVD/35-101--------------------------------------------------------------------------------
D4Z6S0_SPHJU/63-138--------------------------------------------------------------------------------
M1FIJ3_9ALTE/29-96--------------------------------------------------------------------------------
M9X398_MANHA/34-103--------------------------------------------------------------------------------
BAME_VIBCH/35-104--------------------------------------------------------------------------------
BAME_HAEIN/34-103--------------------------------------------------------------------------------
Q2KA05_RHIEC/31-105--------------------------------------------------------------------------------
Q2YNC3_BRUA2/49-124--------------------------------------------------------------------------------
Q3J361_RHOS4/40-116--------------------------------------------------------------------------------
BAME_PSYA2/52-130--------------------------------------------------------------------------------
Q5ZYK0_LEGPH/42-110--------------------------------------------------------------------------------
Q63LV3_BURPS/48-120--------------------------------------------------------------------------------
Q63QT2_BURPS/54-121--------------------------------------------------------------------------------
Q6LUB1_PHOPR/34-102--------------------------------------------------------------------------------
Q79GM4_BORPE/42-111--------------------------------------------------------------------------------
BAME_YERPE/38-107--------------------------------------------------------------------------------
BAME_SALTY/35-104--------------------------------------------------------------------------------
Q87RX9_VIBPA/35-104--------------------------------------------------------------------------------
Q87VN2_PSESM/31-98--------------------------------------------------------------------------------
Q88DH0_PSEPK/30-95--------------------------------------------------------------------------------
Q88DT8_PSEPK/35-101--------------------------------------------------------------------------------
BAME_SHEON/38-105--------------------------------------------------------------------------------
BAME_XANCP/28-99--------------------------------------------------------------------------------
Q8XVT1_RALSO/61-130--------------------------------------------------------------------------------
Q92KF5_RHIME/42-116--------------------------------------------------------------------------------
Q9HUT7_PSEAE/31-97--------------------------------------------------------------------------------
Q9JXT1_NEIMB/52-133--------------------------------------------------------------------------------
Q9PB00_XYLFA/44-114--------------------------------------------------------------------------------
V6F1L4_9PROT/28-103--------------------------------------------------------------------------------

PF12978

Q8DTX1_STRMU/47-205ENLDFRLSFNKIKVTTDQNHFSGGTSIEQLKQWFG.DPNKSEQRNAGNITLDSYTWVKDGAVINAQLYKNSTVARSISNF
B9DSB0_STRU0/47-205SHQDKRLAFEKIKVATAQEQFKGGTSIEELKELFG.EPSSFEQKPAGNVTLDHYTWTFDRVSIQVNLFENSTIVKSITNF
G2SNY8_LACRR/70-224KNAELRKKFDAIVVGDLMSNGDGGTSLTDVEKPLG.KPVSTSTTNLQNVKVKDETWTKDGVTVTVQFNDDKTVSKDITGF
Q8DZF2_STRA5/47-206DHEELRLKFNKVKLGVKANNFKGGTSLAELKQLFGGEPNEKFDTPAGNVTLKGYRWNVDDISITIQLLNDSSIVRSISNF
Q99ZC4_STRP1/47-204.HQDKRANFEKIKLATVDSSFTGGTSLEELISLFG.EPSQHDPKTAGEVTIDAYTWQFDQVTLTVNLYQNSSIVKTISNF

PF07467

Q9KJ90_STREX/2-185--------------------------------------------------------VKARIARTGISLVAAAAAVVATTS
B5GLC0_STRC2/2-181--------------------------------------------------------VK.KTWRSALALTAAAGAVLATAT
BLIP_STRCL/10-200--------------------------------------------------------VR.RLGRAVVMAAAVGGLVLGSAG

PF13670

Q0BXA6_HYPNA/7-95----ASLALLM-IATP-----------A...PLALADDDDGARRTSGSE----RAYTL..TRA--------DAVGIARA-
Q0BXA5_HYPNA/6-84----AALIAIA-LAAP-----------A...PLALA..........QGT----TGDLL..TRE--------QALEIASK-
Q0BY17_HYPNA/6-92----TGLMALI-IVTA-----------ALSPAPALA.....QRGDDRSF----AGFQV..SRA--------TAVDIARA-
A4VHV2_PSEU5/30-109----LTAAFAV-AILG-----------S...GAAFA.........ADKP----GADWI..TLE--------QAVEKAKA-
A4XVH9_PSEMY/6-85----LTTLLAG-GLLL-----------A...GNAMA..........DRP----GGDWI..SIE--------DALSKARA-
Q1QMT6_NITHX/5-85----HVAVATM-MLVL-----------A...ATSFA........YADQP----GSDWM..PAD--------QVIQKLME-
B8EKV5_METSB/3-81----RTILLAS-VLVA-----------A...SATFA........FGDTP----GPDWI..SKE--------ALIKKLEG-
Q5LX53_RUEPO/50-129----PFALIAA-LALA-----------A...SPVLA.......LDLTTD----TQLGS..TPD--------EIRTSLKD-
B8IVF4_METNO/5-90----IMASALL-ATGL-----------A...VPAMAD....GLDHRCSP----VADGRIVAAS--------EVSKGLEV-
B3PI60_CELJU/2-85----RKLLFIA-LASF-----------S...SLAIA.....GPQCTETD----KSQWL..DQA--------KFQEDLKS-
C1DNM7_AZOVD/2-85----RKIILLG-LALA-----------S...PLALA.....GPRCSEAD----KAQWQ..DPT--------KFQEQLKA-
Q1LBN9_RALME/3-85----KIAAFLV-AGVF-----------S...TAAFA.....GANCSKHP----KSEWM..PEA--------DAKAKIQE-
Q8XWW7_RALSO/3-85----KLTLAVL-ATAC-----------S...ASAFA.....SANCTAHP----KNEWM..PEA--------EAQAKIKA-
A1K227_AZOSB/5-88----SAFVVLA-ACTL-----------S...TVALA.....GPQCTEAP----KSQWL..PEE--------AMKQKISA-
Q5P431_AROAE/5-88----NALLAVA-GLTL-----------S...AVAFA.....GPQCTDMP----KSDWM..SEE--------AMKQKIAE-
Q5P432_AROAE/18-101----HLIVAAS-SVLM-----------G...TAAFA.....GPACTETP----ESSWM..PQT--------TMLRKLVD-
D0KWU4_HALNC/5-88----YFFIGLT-AAFM-----------S...TAAQA.....GPQCTQEP----RSAWM..PAD--------KVLAKATQ-
B0SVT0_CAUSK/5-90----LISATIA-AATL-----------SIAGAAVAG......PKCTTEP----KSKWL..TEA--------QMKAKIAA-
A7IQ54_XANP2/6-90----LLTTAAG-LCLL-----------S...SAALA.....SPTCTKEP----QEKWL..SEE--------TMKQKIAE-
B1Y4P0_LEPCP/3-85----TFAAAAA-LTLI-----------A...SAAFA......GPTCNVP----EDKWM..KES--------DFKSRLEA-
B8IVE9_METNO/4-91----LTMIAAA-IAVL-----------GG.VSAAQASS..LGRPCTTAP----QSQWL..PVE--------TLKAKAEA-
Q1QM54_NITHX/4-90----IAILTIA-AVTL-----------G..AATAQAGS..LGKPCTSAS----EAQWL..PVE--------QLQAKVEA-
A1B769_PARDP/5-86----LTILTFL-VVLP-----------S...GAALA......GDDCAVP----LADWQ..PRS--------AVVRLAEE-
A1B772_PARDP/5-86----LIAVAAL-AVLP-----------A...AGALA......GDDCHVP----RGAWQ..PRE--------AVMQAAAG-
B6JDT2_OLICO/6-87----VAASLLF-ALAG-----------S...GAAMA......DDDCNVP----MNQWQ..SRE--------AVQKSAEA-
A1U059_MARHV/5-86----PIILSLS-LLLL-----------S...GTAVA......DDDCDDP----VASWQ..PRE--------NLREKLEA-
A1SRM1_PSYIN/5-86----GLKIFTV-LSLC-----------S...AVAQA......EVECRDP----VDKWQ..PQQ--------QLRQRLEQ-
B9K2Y3_AGRVS/4-85----VLIALSI-TLAL-----------A...GPLLA......GEKCAVP----LKEWQ..PRE--------SLQRKLEG-
A7IKT6_XANP2/6-87----AATLVFA-VCLG-----------A...GPAVA......DRACTVP----LADWQ..PRD--------ALQKKLEG-
A1B771_PARDP/5-86----LTATAFA-LAIP-----------A...GAALA......DEKCNVP----TENMQ..SWE--------ALVQVTDE-
Q0S079_RHOJR/10-95----AAAVGVA-VAIG-----------T...GVAVA.....SSGDQETP----ITGDA...LT--------KASAAALA-
A8LNS6_DINSH/4-81----ILAFTAA-MVVA-----------....STGFA...........SE----VDEAT...EM--------KIMAMLAE-
B1M6N2_METRJ/3-84----LTTTLLA-LTLI-----------A...GSSLA.....ARADEKLP----PDQ.....QA--------KVEAMLKQ-
A7HVA0_PARL1/7-87----AAALLLA-VPAT-----------S...LPALA.......TDDRAP----TAEE....RE--------RIEEVLRG-
C5AT97_METEA/7-83----LAAATLA-TGLL-----------A...ASAHA..........DTP----GKDWM..PID--------QVLTKLAE-
G2J097_PSEUL/8-86----....ALI-AAVA-----------A...PAAFA.....AAKCEQHP----KEQWI..KEA--------DFKQKLVK-
Q2YRI6_BRUA2/6-85----..TAAAL-VALS-----------A...TGAMA.....QKTQCDAK----PLDEK..SID--------ALVQLSNE-
Q3J9Y2_NITOC/7-84----.ISIVSV-LTIL-----------P...TMVLA.........GDKP----PKDSK..PLS--------EIVKSLEE-
Q5F6R1_NEIG1/7-90----....AAV-VSLN-----------A...ATAFAGD..SAERQIYGD----PHFEQ..NRT--------KAVKMLEQ-

PF03413

Q9K7V1_BACHD/28-100----KLSPERA.LKLA...........KRTFAP.......NMNI....T....GS.WI--H..--------MIPETLEK-
Q816W8_BACCR/30-100----.ISSEKA.LKMV...........KQALSH.......KGEI....T....GS.WV--H..--------MVPETFEK-
Q8EP78_OCEIH/29-101----KITPEKA.LNQA...........KEMFKR.......KGPI....S....GS.WI--Y..--------MKPEEIEK-
U5LGT7_9BACI/29-101----AVSPEKA.LDQA...........KAAFKK.......NGPI....S....GS.WI--H..--------MQPEPYEK-
Q03RI8_LACBA/34-106----RLNPDDI.LEQV...........KRQFRE.......ESPI....E....GA.WI--E..--------KHAVPFQK-
Q03GC8_PEDPA/34-106----KVRPQSA.LARV...........RRSFED.......DGPI....E....GA.WI--E..--------SKPSPLNR-
Q82ZL5_ENTFA/37-109----TISADLV.LENV...........KAAFLK.......EGPI....E....GS.WI--E..--------FEKKPLRK-
Q5HNG3_STAEQ/33-102----LYNAELL.LNEV...........KTYF..........REV....K....GS.YI--V..--------QEPIVLEN-
B1YKF6_EXIS2/28-100----QLSAEEA.LEIT...........KRTFSA.......KGRV....Q....GA.WI--S..--------ATPEAYAY-
Q181V6_PEPD6/408-465----NISLDKA.KSIA...........LDA.............V....P....NG.NL--I..--------YCKYD...-
Q181V6_PEPD6/490-547----IISAEKA.KSIM...........LDK.............V....P....GG.KI--V..--------KFKYD...-
Q8TTA4_METAC/138-199----YIGEEKA.KSIA...........LEK.............V....S....GATES--DIR--------LYLDYE..-
A8MEK6_ALKOO/172-230----VISEEQA.KKIA...........LEK.............I....N....GK.VI--K..--------IELEYD..-
A8MEK6_ALKOO/94-155----LISKEEA.KKIA...........IAL.............I....N....GE.II--K..--------VKLDNIKG-
A8MEK5_ALKOO/294-355----KISKEEA.IRIS...........LSL............TK....G....GT.II--S..--------MELDIDD.-
Q5WGU9_BACSK/378-439----KLTKEEA.QAKV...........NKH.............V....E....IQ.ED--H..--------LAVIENDI-
YPEB_BACSU/377-438----AITEAEA.KSKL...........NKN.............V....Q....VR.ET--R..--------LALITNEL-
A8FEM8_BACP2/376-437----KISQKEA.KKTL...........NQH.............V....K....IE.DT--H..--------VAIVQNDM-
YPEB_BACHD/374-435----ELTADEA.RERL...........NPR.............L....E....VM.ED--H..--------IALIQNDL-
YPEB_OCEIH/373-434----KISEDEA.RDNV...........NST.............V....D....IQ.ES--H..--------LAIIDNNA-
A3DI39_CLOTH/391-452----KLTLEEA.RSKI...........SSR.............M....Q....VL.SS--G..--------LAIIPTDY-
A0Q324_CLONN/379-440----KVSKETA.MSKI...........GKN.............L....K....VQ.ST--K..--------LAIIPTES-
Q2RM03_MOOTA/386-447----KLTPEQA.RAKI...........NPG.............I....K....VE.GV--R..--------LALIPLPG-
A8MIH5_ALKOO/376-437----AISEDDA.RERL...........SSS.............V....T....EQ.SV--R..--------LAMIPIPG-
Q12WY7_METBU/120-186----PYSVDEA.MTKA...........KEI.............A....N....TK.YP--D..--------GKIKS...-
Q6W134_RHISN/286-345----PIGLDEA.VATF...........DRL.......................GLHHG--Y..--------TVAIPA..-
Q8ELE8_OCEIH/178-237----PVSVDEV.VNIA...........DQQ.......................EIYPT--Y..--------EVIYPQ..-
Q9KBS1_BACHD/273-331----.LAVEEV.VTIA...........NRV..................G....MH.PT--Y..--------TIYLPR..-
Q5KVG3_GEOKA/282-341----SLSLDDV.YAIA...........EAK.......................KVKKP--F..--------TISLPQ..-
Q9KE75_BACHD/288-347----PISLEDV.TYLA...........ETR.......................EVNKP--Y..--------TISMPE..-
A9B7B4_HERA2/311-370----PVTLDSV.IEVA...........KAR.......................GVIAS--F..--------TVTPPD..-
Q3SKV5_THIDA/55-112----RVAVADV.VAAV...........QRA.............Y....P....AD.KP--F..--------AIRVPR..-
Q3JE96_NITOC/270-334----PITIEQA.VAIA...........NQV.............F....P....NA.EL--R..--------WLATPE..-
Q9A7E1_CAUCR/252-316----RISVDQA.VAIA...........QGA.............L....P....GA.RL--A..--------WIETPS..-
Q020P0_SOLUE/231-293----PITPDQA.MQIA...........AAA.............I....P....GT.FP--F..--------QIVMP...-
Q82WV7_NITEU/279-343----SIGAEHA.WAIA...........TEH.............Y....P....DG.KF--G..--------GMFMPG..-
A4FCJ5_SACEN/417-477----RIGIDRA.LAVA...........RAE.......................GL.TG--E..--------LVVTPPH.-
Q9KE75_BACHD/74-132----TLTPSAL.VARA...........KEA.............F....P....ES.PV--S..--------SVRFYD..-
Q5WLI5_BACSK/75-133----PLSYSSQ.VEYV...........LET.............Y....P....DA.TI--S..--------SVVIDD..-
Q47KW9_THEFY/83-144----RIPLSLQ.VEAA...........QEA.............H....P....EG.TL--H..--------AIRIG...-
Q825U8_STRAW/84-147----ELPISQQ.VAAA...........RKA.............H....P....EG.TL--T..--------AVRPSP..-
A0R6J4_MYCS2/78-140----RLPLTDQ.IAAA...........RAA.............H....P....EG.TV--A..--------SIRPPA..-
A1T724_MYCVP/79-141----PLPLGDQ.IAAA...........QEE.............F....P....GL.TV--S..--------GIRPPA..-
Q6NKB0_CORDI/71-132----ELPLERI.VDIA...........RAT.............H....P....DL.EL--A..--------GVRVG...-
Q9KBS1_BACHD/60-118----RLSPDEQ.LEMV...........HEQ.............Y....P....DS.VI--T..--------AYRPGE..-
Q8P606_XANCP/82-140----RLPAQQL.VDAA...........QRA.............Q....A....GT.VF--R..--------YTTPD...-
Q7CY41_AGRFC/75-132----KALPSEI.IAAA...........LAA.............V....P....GT.AV--K..--------YTTSA...-
Q2RPK6_RHORT/75-133----LASPSAL.VAAA...........LAN.............T....P....GT.AV--K..--------YTTPA...-
Q6W134_RHISN/75-133----KATPSAM.VAAA...........LAA.............H....P....GT.AV--K..--------FTDPA...-
Q1R143_CHRSD/68-125----AVSPQQQ.LDAA...........MAA.............H....P....GE.AF--R..--------YVPPA...-
Q7NVU2_CHRVO/229-292----RLPLDAL.IARA...........GAA.............L....P....GA.RL--V..--------DIRY....-
Q8A623_BACTN/26-84----PLPVDQL.LEKV...........AAT.............L....P....DD.VS--V..--------SGVSISS.-
Q884E8_PSESM/67-126----RMNFEQI.RATI...........ERN.............E....P....DL.IV--G..--------TIMQPD..-
Q9I178_PSEAE/60-119----PLSFSQV.LKAI...........NEA.............Q....P....DL.LV--E..--------SIQRPD..-
Q1LJM8_RALME/260-324----AITPAQA.MTAA...........QKQ.............F....P....DA.AV--T..--------RISLPR..-
Q82P05_STRAW/125-192----KLTPAQAEQKAA...........AAA.............Q....G....DA.TE--A..--------ALVVDARD-
Q9L1F9_STRCO/146-216----AKAEQQA.LSAA...........KDA..................G....SS.KT--A..--------ADSAPRKV-
Q82BN5_STRAW/115-187----PKAADLA.TAAL...........RAA.............N....T....GE.LL--K..--------KVTAKPQL-
Q9L2B8_STRCO/168-232----KGASVDA.AEAA...........KAA.............A....G....HG.TV--T..--------SVELDDDG-
Q0AQU2_MARMM/109-177----PISAELA.RNIA...........LAR.............Q....N....GL.GE--I..--------SAINRIAE-
E0THY6_PARBH/109-174----PISEELA.RRVA...........EYD.............F....A....GD.GH--V..--------STVRMLSD-
A7ZG54_CAMC1/58-115----NLSLSEI.LAKA...........KSE.............I....K....FD.TL--E..--------NVQIG...-
Q63MT4_BURPS/165-233----AVDEQQA.LDRA...........RAY.............L....G....VG.GF--V..--------NVQSQLVA-
A7ZEI5_CAMC1/100-159----ALSIDEA.VAKA...........QAL.............E....A....GW.SL--D..--------EAELDNK.-
Q03XK6_LEUMM/140-199----IISLDSA.VNKA...........KDA.............A....G....DG.SL--N..--------GWSLEKD.-
Q9KC80_BACHD/94-154----GISEEDV.RAII...........EKE.............L....A....VR.EL--V..--------AIRLGVE.-
Q5KXX8_GEOKA/94-154----GISEAEA.RAIL...........QRD.............R....R....PR.RI--I..--------DATLGME.-
Q1WU38_LACS1/104-164----GISVNKA.KNIV...........KV.............ER....D....PK.KI--T..--------KTSLGLV.-
A8FEH2_BACP2/99-159----GVTSNQA.VQAV...........QKE.............N....T....VS.KL--K..--------DVQLARE.-
Q6ANJ0_DESPS/50-117----AQTQKTL.SQVV...........EEQ.............A....K....KT.AA--T..--------VIEAELEM-
Q8R5X9_FUSNN/10-69----QVNYDDV.VDIV...........LRN.............Y....P....QS.RV--T..--------KIEIFNY.-
Q8E0L6_STRA5/117-180----KISQEEA.KKIA...........FKDA...........NI....E....ES.EV--S..--------NLKIKEEI-
Q8RBF9_CALS4/109-184----KYTREEA.RKVAIEFL..QKITPEKF.............K....Q....TK.EI--V..--------PSYPLGA.-
B8I195_CLOCE/108-180----KYSKEQI.LKIA...........EQF.............V....N....KI.NP--K..--------VMDHFKLV-
Q1D8Q2_MYXXD/168-239----KVSHSQA.LDIA...........MKA.............F....D....GK.PD--R..--------QPNSERVI-
Q81MX8_BACAN/145-217----ILSEEDAKKQLFKIYG..DNLTFVEE.............P....E....IK.QV--V..--------YVDENTN.-
Q5ZRA6_LEGPH/16-86----KLSPNDI.EQKT...........LGKVTE.......PVKF....K....NL.KK--V..--------IYIDKGN.-
Q87I51_VIBPA/131-204----.LSLERI.RSKVQKPYLDVGYHIEDQ.............Q....Q....GL.R.--...--------IYIDDKD.-
Q2FUX4_STAA8/118-192----TLSKDDA.ADKA...........FKA.............V....K....ID.KN--K..--------AKNLKD.K-
PRTA_LISMO/121-194----KITEKNA.IEKA...........FEAIGQSEAHVKSYVGN....P....VK.EK--E..--------IILNSR..-
Q97G52_CLOAB/161-230----GVTATQA.ISIA...........KKQ.............F....S....FKSLV--E..--------APRAQKQV-
Q97G51_CLOAB/153-222----DISPNYA.ISIA...........EKQ.............F....N....YKTLL--E..--------KPKAEKQV-
Q97GS5_CLOAB/161-230----SINEEDA.VNIA...........LKQF..........TYKTLENT....PK.AI--K..--------TILTDNN.-
A5I1S2_CLOBH/148-212----KLSKEDA.IAKA...........KGD.............I....K....DQ.KS--N..--------SEKADLYL-
Q81R73_BACAN/122-192----KISEKDA.IQKS...........MAY.............V....G....EA.SE--Q..--------NLWAPTEK-
Q815U2_BACCR/146-219----SITAEQA.ETIA...........KAD.............I....E....KE.IG--K..--------VKSYDGVK-
NPRB_BACSU/145-217----.ISEKKA.IHTA...........RRE.............L....E....AS.IG--K..--------IEYLDGEP-
Q8ESH1_OCEIH/143-217----PITESEI.IDIF...........KRN.............L....E....EN.IG--T..--------VDQFDGKI-
B1YFR1_EXIS2/113-183----SLSEKKA.LKLY...........QKAIK.........ATEFEVAP....KA.EL--V..--------IYPVK.D.-
NPRM_BACMD/153-222----.VDSKKA.IQAA...........EKD.............L....G....FK.PT--Y..--------EKSPSSEL-
Q81I21_BACCR/151-220----.IEGAKA.IEIA...........QQD.............L....G....VTPKY--E..--------VEPKADLY-
Q8DVN1_STRMU/57-120----KIFKEQA.KHIA...........LKDAG........FTEK....E....VT.LL--T..--------VEQDID..-
Q99YI6_STRP1/81-143----KLSEDKA.KSIA...........LKDAS........VTEA....D....AQ.ML--S..--------VTQDNE..-
R6P3S5_9CLOT/179-241----AITKDQA.KSIA...........LKDAG.........VSE....S....AT.QF--V..--------WVKEDYD.-
Q8ESN0_OCEIH/32-90----KLSQEEI.KQLV...........KEQ.............Y....P....GT.QN--E..--------PDLQLK..-
A5G759_GEOUR/48-108----KISGEKA.TEIA...........LKE.............V....P....GK.VT--S..--------VVIERK..-
O27358_METTH/81-143----KISYSEA.KSIA...........QTY.............I....K....QE.GA--A..--------AGTPRLLK-
Q8ERG4_OCEIH/132-194----YVSHEDA.LSTA...........SEVQE........VQDL....T....PT.SW--K..--------LEID....-
Q5WLC0_BACSK/58-117----QVDMETA.VSEF...........ENA.............Y....P....DASIS--S..--------IELEAE..-
Q82ZK1_ENTFA/63-122----AVSLEKV.TTAF...........EKK.............Y....P....EAKIT--S..--------LQLDTD..-
Q5FIK1_LACAC/43-101----KVSQSSA.VKKF...........QAK.............Y....N....AK.IK--S..--------INLEKE..-
Q5FIK0_LACAC/62-121----KLSQQEA.IDKF...........HNQ.............F....N....NKKIH--S..--------IDLKLE..-
Q74JH3_LACJO/49-108----NLSQSDA.INKF...........NEK.............Y....G....SKSIK--E..--------IGLKNK..-
Q8ERG4_OCEIH/56-114----QLTSEEA.MQIF...........TDT.............F....T....GA.AI--S..--------SIELDEH.-
Q186H8_PEPD6/62-121----KVPYTDA.INIF...........KDK.............Y....K....DA.DI--V..--------DLSLERD.-
Q9KFU6_BACHD/49-108----GLTLAEA.SDIA...........LER.............A....G....NGVVT--E..--------AEKDRD..-
Q8ESM9_OCEIH/39-97----TLSSEDI.TSIV...........NEQ.............Y....E....GD.IT--D..--------FELDRD..-
A8AXQ2_STRGC/352-411----EFSQDQA.LAVA...........LKD.............L....G....LG.EK--D..--------IKDLKIV.-
Q81R43_BACAN/43-101----ELSPETA.KQIA...........IEK.............V....N....GV.VE--E..--------IDVERM..-
Q8ELD0_OCEIH/32-90----EISAEQA.LQTA...........LKN.............T....E....GF.VQ--E..--------VDLSFE..-
Q4K807_PSEF5/38-102----IMDLEKL.NQAA...........LAQ.................HPGTTAAS.IT--D..--------TELEQTA.-
C1DJ09_AZOVD/39-99----IQPFETL.NAAA...........QAK.............H....P....GSTIH--E..--------TELEEE..-
A4XTT8_PSEMY/39-99----IKSFEQL.DEAI...........LAQ.............H....P....GARIE--E..--------TELEDE..-
Q0VNT9_ALCBS/52-112----IQSLDKL.DKVA...........LDK.............H....P....DAKIT--D..--------TELENE..-
Q0S7B7_RHOJR/138-198----AVTQQQA.EQIA...........VAT.............V....P....GGTVA--N..--------AEQQQR..-
Q5F637_NEIG1/47-105----IISRAQA.EKAA...........WAR.............V....G....GK.IT--D..--------IDLEHD..-
Q1ARP9_RUBXD/67-126----AISREEA.ERAA...........LEN.............V....S....GT.VV--E..--------SGLDEE..-
Q9L126_STRCO/188-249----KQTPEQA.VKAA...........TAK.............A....K....GT.VT--H..--------VELGDND.-
Q9L2B8_STRCO/83-152----KVTAADA.VAAA...........LAD.............T....P....GT.AV--S..--------AELDDEDD-
A9C057_DELAS/120-179----KSTIEQA.IQAA...........TRH.............T....P....GT.PV--S..--------AELDSH..-
Q8RD03_CALS4/115-173----KITPDEA.KTAA...........LKV.............V....P....GT.VE--K..--------VSLDNE..-
A8FCD9_BACP2/110-169----KITKKQA.EQIA...........LAK.............V....K....GT.VT--D..--------SDLDKE..-
YKOJ_BACSU/108-167----AITKEEA.EEIA...........LKQ..................T....GGTVT--E..--------SKLDED..-
Q8ESM9_OCEIH/119-177----FIGDKKA.KEIA...........LEQ.............F....S....GK.VV--E..--------FELDED..-
YKOI_BACSU/164-223----PITKKEA.KTIA...........ERK.............T....G....GT.AD--D..--------ADLEES..-
A8FCD8_BACP2/167-226----KITVEEA.IRIA...........VKE.............V....G....GT.VD--D..--------ADLETF..-
Q5WKR9_BACSK/175-233----QISVEEA.KQIA...........LEE.............L....N....GT.VV--D..--------SELDEE..-
Q9KFU7_BACHD/111-170----MLTEEQA.IAIA...........QQE.............V....E....GK.VD--D..--------IELEEE..-
Q9KFU6_BACHD/130-191----VISMDEA.KEIA...........LKE.............V....S....GK.ID--D..--------IELERE..-
Q5WKR8_BACSK/122-181----ALSTDEA.IKRA...........LEE.............V....D....GT.VS--E..--------VELDKE..-
Q38Z32_LACSS/130-188----LMTLEAA.QKKA...........QHY.............F....D....GD.VL--E..--------ATLEKD..-
Q2G105_STAA8/129-187----AIDYKKA.IKEG...........QKE.............F....D....GD.IK--E..--------WSLEKD..-
Q5FIK0_LACAC/141-199----VISRDEA.STIA...........EEH.............A....K....GT.SR--E..--------WNLEQE..-
Q82ZK1_ENTFA/146-205----IISREQA.TTLA...........EKA............AK....V....GQ.AT--D..--------WKLEKE..-
Q74LX8_LACJO/141-200----TISRKEA.SEIA...........EKE.............V....K....NSVAK--E..--------WDLKME..-
Q5FIK1_LACAC/119-178----TISRSTA.TKIA...........QKR.............V....S....GSKAI--E..--------WNLERE..-
Q74JH3_LACJO/126-184----LISRSEA.TKLA...........QTK.............A....S....GK.AV--K..--------WSLEMD..-
Q186H8_PEPD6/144-202----IMTPQQA.MEIA...........LKE.............Q....N....GI.VK--E..--------WSLDKD..-
Q5WLC0_BACSK/141-199----IIDPQEA.VDIA...........LSE.............A....E....GA.IS--S..--------WKLEKD..-
Q8R5X9_FUSNN/83-142----PITFEQA.SRIG...........LDN............SF....N....GK.VK--S..--------IELKNI..-
B1HY97_LYSSC/168-225----IITEQQA.IDIA...........LQQ.............L....T....GK.VD--S..--------VDFEDT..-
Q81R44_BACAN/99-158----TITKEKA.EEMA...........LQK.............V....Q....GE.IK--Y..--------TILEKR..-
Q0VNU0_ALCBS/63-123----IVAFSSL.LETL...........KLR.............Y....P....QGRVL--E..--------VELERD..-
Q3JBE9_NITOC/51-111----ILPFEQI.LARA...........LKA.............Y....P....GAQLL--E..--------SELERE..-
A4XTT9_PSEMY/41-101----IMPFEQL.MQHV...........GQA.............Y....P....GSTLL--E..--------AELEEE..-
Q0BZN8_HYPNA/53-112----ILPLEII.LGSV...........LQQ.............Y....P....GE.LL--K..--------LELDED..-
A1B2L4_PARDP/40-99----ILPLAEV.LARL...........HET.............Q....P....GR.VS--E..--------VELEEE..-
Q9A8Q0_CAUCR/73-133----VLPLTRI.LAIA...........AER.............A....P....GE.VI--E..--------VELEEAG.-
Q988S6_RHILO/46-105----IKGLANI.LDIV...........RAK.............A....P....GD.VV--A..--------VDLIRQ..-
A4YY21_BRASO/40-99----VLPLSQI.LPRL...........RGR.............I....A....GD.VT--G..--------IDIERQ..-
Q2RPG4_RHORT/72-131----ALPLSVI.LDRA...........AAL.............V....D....GR.FL--E..--------AELESG..-
V6F502_9PROT/38-95----.LPLGQI.LARA...........EAA.............Y....P....GQ.LI--E..--------AELEDE..-
Q0AR59_MARMM/55-114----VVPALRV.ISEV...........RRR.............Y....P....GADVL--D..--------AELEG...-
A8LN27_DINSH/31-89----TIGMARA.VAIA...........QEA.............R....P....GG.IL--E..--------AELDSD..-
A5VEY7_SPHWW/24-82----LIGLTRA.IGVA...........ERS.............L....S....AR.AI--E..--------GELETS..-
Q8KFX7_CHLTE/45-103----AISLSQA.VNAA...........ETF.............T....R....GR.AV--R..--------AELEKH..-
B4E758_BURCJ/39-96----KIPLTQA.VTAA...........EQH.............A....N....GK.AS--R..--------AEYENS..-
A9C057_DELAS/43-102----KIPLEQA.VTRA...........TQA.............V....P....GK.AI--E..--------AQLDDGD.-
E0TIH6_PARBH/43-102----KISLAEA.VAIA...........EER.............T....G....GR.AA--E..--------AEFDVE..-
B0UCU3_METS4/66-129----KIGLAQA.LATA...........ESQG...........GQ....G....GR.AI--D..--------ADFEKAK.-
A3QGG2_SHELP/47-105----VKNRQQA.TQMV...........KGR.............Y....N....AK.VL--S..--------VQSSRV..-
Q7P204_CHRVO/118-188----TLSSAQV.LSQA..........KALK.............A....N....GN.PT--Y..--------NDKAELVV-
ELAS_PSEAE/122-192----AVSAEQV.LAQA...........KSL............KA....Q....GR.KT--E..--------NDKVELVI-
A1S2N2_SHEAM/113-188----SLSKDKA.LEIAKAA.....KGGHGL..................K....AG.KT--R..--------NDSAQPWI-
Q2SJ90_HAHCH/129-208----TISDKEA.LNIAKN......NSGFTF.............V....N....AP.QF--R..--------NESSELMI-
B7VN56_VIBTL/116-190----KLNQEQA.IEAA...........ISSHR........TFTV....G....KK.SI--E..--------NKNAKLMV-
F7YSQ2_VIBA7/118-194----..EQKQA.VSIA...........LTHYQQQ.....NPSLT....S....ADLVT--E..--------NERAQLMV-
HAPT_VIBCH/116-190----.IESQQA.IALA...........VSHFG........EQHA....G....ESLPV--E..--------NESVQLMV-
Q5ZZJ1_LEGPH/124-199----AISAQQA.KEYA...........KKS............YFQ.FSS....QS.NI--Q..--------QETAELQI-
A1S4V2_SHEAM/92-162----ALTRGQA.IAAL...........NKV.............Y....P....GA.VA--S..--------GHKDVELV-
Q211C9_RHOPB/96-155----AISLRQA.MTIA...........QQQ.............H....A....NSKIA--D..--------ISFDGS..-
Q89L62_BRADU/85-144----SISISQA.MALA...........ESR.............H....A....GATTA--D..--------VSFDGA..-
A4YNR6_BRASO/46-105----GVSLHQA.LRIA...........EKM.............H....P....GSRTA--D..--------ISFEGG..-
Q6N7G2_RHOPA/56-115----PVSLGQA.IGIA...........EKR.............H....P....GTKSL--R..--------IETDVI..-
Q1H2G7_METFK/106-166----KVSEAEA.RKTA...........LAA.............H....P....GE.IV--E..--------VEYEIEE.-
A2SEW0_METPP/117-177----KVSETDA.TKTA...........LAK.............H....P....GK.VE--R..--------VEYEVES.-
Q1H2G7_METFK/31-90----KVSLETC.LEAA...........LKA.............K....P....GT.VV--K..--------VEYKLE..-
A5N159_CLOK5/17-76----RINTETA.IQNA...........LQR.............V....P....GQ.VL--R..--------VEMDVE..-
A7ZEI5_CAMC1/22-81----AITSKEA.LNIA...........EKN.............F....P....GSSVK--D..--------IEMNVK..-
Q8DWU2_STRA5/78-136----KIDYKTA.LETA...........KKE.............A....R....SGFIS--Q..--------IELNTK..-

PF11396

A0M0Q0_GRAFK/54-143----TEWEAEFKMNNV-----------EYS-------------ANFLAN----GT-WQ--ETE........HEM.KTND-
A0M1R1_GRAFK/70-160----GYWESHFKQDGE-----------KYR-------------ADFNTD----GS-WV--ETE........NDI.KTEN-
A5FIF1_FLAJ1/58-140----KGYEVKLKDG..-----------.TE-------------VEFWKD----GS-YR--EVD.....GGDKPI.PTDF-
A5FNS8_FLAJ1/62-144----TEYKVQFDNQ..-----------.IE-------------IEFDKK----GN-WK--EVD.....GKNSKI.PKSI-
A6L337_BACV8/61-143----TSYDVKLADG..-----------.IE-------------LEFNSK----GE-WL--EID.....CKNKSV.PSTF-
A6L4L1_BACV8/60-142----KSYDVIFTNG..-----------.DK-------------LEFDKK----GI-WT--EVN.....CKYSAV.PVAV-
A6LDA3_PARD8/62-144----SSYDVILTDG..-----------.TN-------------VEFNHK----GE-WK--EIK.....RHGLPI.PPAI-
A6LDA4_PARD8/55-146----GYVKAEFYTGSY-----------EAE-------------AWFDPQ----GN-WM--LTE........TDL.PYNA-
A6LDE6_PARD8/58-149----NYYVVDFNNGGS-----------ETT-------------AWFTDQ----GI-WM--MEK........IDI.SFAQ-
C0QVH4_BRAHW/54-141----GGYEVDIDFG..-----------.YK-------------FIFYNT----GL-WK--KISIINDETKNIGI.PRSC-
C0QYD0_BRAHW/35-117----EFYEVTFNDD..-----------.IV-------------IHFDLD----GY-WQ--EVS.....GNSSPI.PINF-
C0R146_BRAHW/63-147----THYIVIFKGG..-----------.SS-------------INFNRK----GE-WT--SII.....GNRKII.QIST-
C0R148_BRAHW/33-123----SSYSAVFKGG..-----------.SS-------------INFNTK----GE-WT--SII.....GNGNEI.PFNI-
Q5L9Y2_BACFN/49-143----GYYCADFMMNGY-----------EKN-------------VWFNAQ----GQ-WQ--MTQ........TEWGDTDE-
Q5LD45_BACFN/83-177----DYHIADIRVDGR-----------ELN-------------VWFSDK----GK-WL--MTE........VDVETLEA-
Q7MWB3_PORGI/60-142----KTYDVVFTNG..-----------.NK-------------IEFDKK----GN-WK--EID.....CKYSRV.PSDL-
Q7MWB4_PORGI/55-145----EFRVAEFMNEGV-----------KSE-------------AWFLRS----.I-WQ--YTE........IDI.PYSA-
Q89YQ4_BACTN/58-150----DYYVADCWVTGD-----------ELD-------------VWFDAN----AN-WV--MTE........NELDSIDQ-
Q89YQ5_BACTN/61-144----AKYEVLLTDG..-----------.TE-------------IDFDSK----GN-WE--EVS....ASKGHAV.PASV-
Q8A994_BACTN/60-142----KSYEVIFTNG..-----------.NK-------------VEFDKK----GN-WE--EVD.....CKHTSV.PVAI-
Q8YLV6_NOSS1/61-150----YGYEAVFTQNNI-----------QYE-------------AEFSDS----GE-WL--ETE........YYV.TEKD-
C7M630_CAPOD/59-141----.EYTVIFRDG..-----------.LE-------------IEFNGD----GD-WK--ELK.....ARHGKV.PDHV-
D6D2V5_9BACE/45-136----.YYVADCWVSND-----------ELE-------------VWFDTN----AN-WV--MTE........NELNSIDQ-
D6D5W5_9BACE/49-143----GYYCANFVMNGF-----------TKN-------------VWFNVR----GQ-WV--MTQ........TDLVSLDR-
D6D6Q4_9BACE/56-146----GYYVADFYDEY.-----------EAS-------------AWFTQD----GK-WQ--MTE........TDI.PYSA-
Q0P802_CAMJE/53-133----DSYDVILNDG..-----------.TE-------------IDFMIN----GE-WK--EVD.....GKYKAL.PHTI-
Q0P9P8_CAMJE/51-132----NSYEVYLSDG..-----------.TE-------------LEFDID----GA-WK--EIE.....NKAFPF.DLDF-
Q5LBR7_BACFN/55-146----NYYIAEFRQQNY-----------ETS-------------AWFTPN----GI-WQ--MTE........TDL.PYQA-
Q5LBR8_BACFN/60-141----KSYDVIFTDG..-----------.NK-------------VEFDKK----GN-WT--EVN.....CKFSVV.PQGI-
Q5LG06_BACFN/60-151----.YYVADCQADGR-----------EKE-------------VWFDAN----AN-WL--MTE........TELNSINN-
Q5LG07_BACFN/61-143----KKYDVLLTNA..-----------.TE-------------IDFDNR----GN-WI--EVD.....CKKAAV.PATI-
Q5LIE1_BACFN/72-153----..YRVVFPNE..-----------.VK-------------VEFSEN----GG-WK--RLM.....IPDQKL.PGSL-
R5U7Q0_9BACE/57-144----GYYVADFYDGH.-----------EAS-------------AWFTQE----GK-WV--LTS........WEV.HFNT-
R6WQR9_9PORP/57-147----.YLIVDFKQDKV-----------EKE-------------AWFDNS----GT-WY--MTE........TDI.PFAQ-
R6X3F2_9PORP/60-141----KKYEVIFANS..-----------.SK-------------VEFFKD----GT-WK--EVD.....CKYSTV.PEAV-
R6XCT8_9PORP/59-150----DYYVIDFENNSL-----------DNT-------------AWFDHL----GV-WA--MIK........TDL.PLNQ-
R7EFG1_9BACE/61-142----KKYEVLLTDR..-----------.TE-------------IDFDKK----GN-WL--EVD.....CKKSAV.PEAL-
R7EJJ2_9BACE/58-149----GYFVADCKVDGQ-----------EKD-------------VWFNNQ----AE-WQ--LTE........TEL.LWNN-
R7EKK7_9BACE/52-145----.CYVAEFIADGQ-----------EID-------------VWFNKQ----AE-WV--MTE........TDVESLEK-
R7ELA9_9BACE/58-149----.YYVADFHEDNF-----------EKE-------------AWFTKD----GV-WQ--MTE........TDL.RYAD-
R7ERW1_9BACE/60-141----KSYDVVFTNG..-----------.EK-------------VEFDKS----GE-WK--EVR.....CRQSEV.PAQI-
R7JJR5_9BACT/78-154----.TYKVVFADG..-----------.TQ-------------VKFRRN----GM-WR--EIK.....SRSRAV.PSVV-

PF11399

K7AKJ7_9ALTE/17-119DWKDKEHKNRKYISRL-----------HQ.------------------.----G-TGY-------------EEILNRMG-
F5Z4M1_ALTSS/22-120DWKDREEYNRVQITKL-----------KL.------------------.----G-STR-------------EEVLALLG-
E1SS82_FERBD/33-127DWDDRQKHNVAAIATL-----------EP.------------------.----G-LSK-------------AIVLERLG-
Q8EGJ0_SHEON/23-131SWEKVQDKNRSNLAKL-----------SL.------------------.----G-MSK-------------DQVMTLMG-
A1S8B9_SHEAM/20-120DWEDRQVYNNKALAEL-----------VI.------------------.----G-QDI-------------GSVRQLLG-
K7AKJ0_9ALTE/22-120DWKDREEYNKIQISKL-----------EL.------------------.----G-LQK-------------KQVIELLG-
A3QGB8_SHELP/19-122SWERVQEQNRVNLSKL-----------SL.------------------.----G-MTR-------------DQVMTLMG-
Q15QZ2_PSEA6/17-119DWQKKERSNRKEVARL-----------QP.------------------.----N-LST-------------GEVMDRMG-
Q07ZE7_SHEFN/20-120AWDDRQAFNLQKMSEV-----------SF.------------------.----G-QSL-------------DEIRTLLG-
Q47YB6_COLP3/19-119DSEDRTYKNRKKIAKV-----------QL.------------------.----G-TSF-------------MDIQENLG-
B8CS66_SHEPW/20-120DWEDRQAYNRAQMTEL-----------AI.------------------.----G-QSI-------------DEIKAMFG-
Q8EGQ0_SHEON/20-120DWEDRQVYNSQKLNDL-----------SL.------------------.----G-QDI-------------SEVKTLFG-
D4ZHG3_SHEVD/20-120HWEDRQAYNNAQLADI-----------II.------------------.----G-QSL-------------SDIKQRMG-
D4ZHN7_SHEVD/34-137GWEETQDLNRVSLASL-----------SL.------------------.----G-MTR-------------EQVTVLMG-
E1STL4_FERBD/20-123DWEKKQDSNRRKLEQI-----------EL.------------------.----G-MAL-------------SDVRSIMG-
Q47YA7_COLP3/20-123KWKDREAYNRQFIAKV-----------ML.------------------D----N-FTF-------------EQALTQLG-
Q085F9_SHEFN/19-126YWQVQQDKNRDLLSKL-----------SM.------------------.----G-MSS-------------DQVTTLMG-
Q15QY7_PSEA6/21-120DWKDREEYNKVQVAKL-----------EL.------------------.----G-QTK-------------QQILALLG-
Q12P24_SHEDO/19-126DWEQQQQMNRDNIAKL-----------SM.------------------.----G-MDA-------------QQVSLLMG-
B8CQA1_SHEPW/19-122SWQKTQEINRGNLAKI-----------SL.------------------.----G-MSK-------------DQVTTLMG-
Q5QW11_IDILO/20-120QWQERETYNARQIGQF-----------DL.------------------.----G-MSK-------------DSVIRVLG-
Q3ICC6_PSEHT/21-122IWQDREAYNKRYIEKL-----------KIE------------------D----T-ATL-------------NSVLEYLG-
G4QLZ6_GLANF/37-143NWQKHEAKNRQFIADL-----------SP.------------------.----G-VSK-------------KSVIDQLG-
Q12L38_SHEDO/26-125DWDDRQAFNLQQLSHI-----------KL.------------------.----G-QSL-------------DEIVTLMG-
F2GBX8_ALTMD/17-118DWEDREFNNRKHIANL-----------ET.------------------.----G-TSY-------------ESVLRKMG-
A3QGM5_SHELP/20-120DWEDRQAYNNAKLTEL-----------SI.------------------.----G-QPI-------------EQIRTLMG-
A1S4M5_SHEAM/18-116DWEKTQLDNREHLTQL-----------SL.------------------.----G-MDK-------------SQVLALMG-

PF04355

Q5NL78_ZYMMO/17-93----GYMVDKAMVQSV-----------SP------------------------GVDNR-------------QSVEKTLG-
Q5LQJ9_RUEPO/35-111----GYVPTAEELAAI-----------QV------------------------GVDTR-------------DSVVEAVG-
Q1LSR9_BAUCH/37-105----GNYLTKTDVDQI-----------HI------------------------G.MTK-------------QQVSNILG-
Q1LBA9_RALME/75-149----GTFPNIDNLRML-----------AP------------------------G.MTK-------------SQRYPLLD-
A5WGN5_PSYWF/35-114----GTPITQSQAQQI-----------QP------------------------G.MTK-------------NQVLYYIG-
Q9CJV5_PASMU/34-104----GNYLEAATVKQL-----------QV------------------------G.MNA-------------AQVQYLLG-
BAME_PSYIN/35-104----GNYIEDEKLDQI-----------LL------------------------G.MSQ-------------EQVIFILG-
Q220P9_RHOFT/38-108----GNFVSQEQAAAV-----------TP------------------------G.MSR-------------VQVRDILG-
BAME_NEIMB/36-106----GNELEPRAVAAL-----------RP------------------------G.MTK-------------DQVLLLLG-
Q5NEF6_FRATT/34-106----GKEIKDKKLFEI-----------KP------------------------N.MTK-------------SEVTYILG-
BAME_VIBF1/35-105----GNYVEQEAVDKL-----------RF------------------------G.MTK-------------QQVQFVMG-
A6VMF3_ACTSZ/34-104----GNYLEQSTVEQL-----------QV------------------------G.MTR-------------EQVKYLLG-
Q7VRQ4_BLOFL/39-110----GTYLTQKDIQKI-----------KI------------------------G.MTK-------------SEILSCIE-
BAME_NITEU/35-105----GNVVTDEMVAKL-----------KP------------------------G.MTR-------------SQVRFTLG-
Q0C315_HYPNA/29-105----GYIADEVQPIDI-----------KP------------------------GDDTR-------------STVLAQLG-
Q47XI1_COLP3/29-101----GNYLEQKSIDKL-----------QV------------------------G.MTK-------------EQVKFILG-
Q47HJ0_DECAR/36-107----GNVLSQEMVSQL-----------KP------------------------G.QTK-------------DQVRFLLG-
Q5FUN3_GLUOX/45-121----GSLIEKTDYAQL-----------VP------------------------GTSTR-------------TDVLDLLG-
Q2SMN2_HAHCH/93-162----GNIVEKEAVEQL-----------KV------------------------G.MNR-------------RQVQYLLG-
Q0A7D7_ALKEH/37-107----GNIMTQEMVDEL-----------RV------------------------G.MSQ-------------QQVRTIMG-
A1AX05_RUTMC/37-107----GSVLERFKINQL-----------NL------------------------G.MSK-------------TQVQDLIG-
Q3SSS7_NITWN/53-129----GYILPPGALEQI-----------QI------------------------G.ASQ-------------DQVLIVMG-
Q2RTT3_RHORT/36-112----GNLPTTEALGQI-----------QE------------------------GVHTR-------------TDIQALLG-
Q2NRT5_SODGM/28-97----DSYVNKPVVSDV-----------KK------------------------G.MTK-------------EQARAIGG-
A4VII8_PSEU5/29-97----ITYRDEPLVRDV-----------ET------------------------G.MTQ-------------ARVLSIGG-
A7I1H3_CAMHC/52-124----ALSVNLENIRKI-----------ET------------------------G.MSK-------------DEIRKLIG-
Q604C4_METCA/51-121----GNIVSQEMVDQL-----------KP------------------------G.MNR-------------RQVTFIMG-
B0UR41_METS4/34-110----GYLIDEAAVAQV-----------KP------------------------G.TSA-------------EQVLQLLG-
Q15V54_PSEA6/31-104----GNFLDERDVSKL-----------RI------------------------N.MTK-------------EQVEYVLG-
Q31FS2_THICR/36-107----GTVISQEAINTL-----------QP------------------------G.LTA-------------NQVKDILG-
A1WGT8_VEREI/51-121----GNFVAREQVQAL-----------QP------------------------G.MSR-------------QQVREILG-
A4SVD7_POLSQ/67-138----GNFISSEQYAKL-----------QL------------------------G.MSR-------------EQVRQILG-
Q2NRZ9_SODGM/35-105----GNYLTAADVAKI-----------HT------------------------G.MTK-------------QQVAYTLG-
A1WCQ4_ACISJ/49-119----GNFISREQVQML-----------QP------------------------G.MGR-------------QQVREILG-
Q1LMT9_RALME/71-142----GNFVSREAVAQL-----------RP------------------------G.MTR-------------DQVSFLLG-
Q6FDQ3_ACIAD/30-107----GTPLTKAQASKV-----------QV------------------------G.MSY-------------QQVRFLLG-
Q7CZT7_AGRFC/48-124----GYVMDDQSLQLI-----------PE------------------------G.SSR-------------EQVLLTMG-
Q0K704_CUPNH/51-122----GNFVSREAVSQL-----------RE------------------------G.MTR-------------DQVKFLLG-
Q21H32_SACD2/36-106----GNYIEKKMVDQL-----------EV------------------------G.MTR-------------RQVQYVMG-
Q83C32_COXBU/30-100----GNVITDKDLGAL-----------HK------------------------G.MTK-------------TKVESLLG-
A8GGW6_SERP5/28-97----ASYVQEPVVSDV-----------KV------------------------G.MTK-------------QQVRAIAG-
A5FV68_ACICJ/239-315----GTAVTEAQLKQL-----------TP------------------------GVSTE-------------ADATALLG-
Q3SJS3_THIDA/32-102----GNALDQENVSRL-----------KP------------------------G.LNR-------------SQVRFLLG-
A0KI84_AERHH/30-100----GNYVEQKQVDKL-----------RQ------------------------G.MTR-------------EQVEFVLG-
Q3IE33_PSEHT/35-105----GNFLEQSDVDKL-----------RV------------------------N.MTR-------------EQVIYVLG-
A6W2D6_MARMS/31-103----GNLVTKEQLSQL-----------QI------------------------G.MSE-------------SQVTYLLG-
Q2G501_NOVAD/31-107----GYIIDEALVASV-----------QP------------------------GVDNK-------------LSVERTLG-
A7HX93_PARL1/37-112----GYIFDPADLEKL-----------QT------------------------G.ASK-------------EQVRSVMG-
Q983A2_RHILO/103-179----GYVYDQQAVDSV-----------PV------------------------G.SSR-------------EQVLLALG-
Q7NX33_CHRVO/32-104----GNYVTQDAVAKL-----------KP------------------------G.MTR-------------AQVRFLLG-
Q2YBT7_NITMU/31-101----GNVITQEMVNKL-----------KP------------------------G.MTR-------------SQVRFALG-
A2SC95_METPP/48-118----GNVVTQEMAAAV-----------KP------------------------G.MTR-------------AQVRDTLG-
A1K8N9_AZOSB/69-139----GNYVDQAMVSQL-----------KR------------------------G.MSR-------------EQVRFVLG-
A7INK8_XANP2/42-117----GYVLAEGALDQV-----------PV------------------------G.SSQ-------------EQVLLVLG-
Q1QSW6_CHRSD/33-103----GNLINQDMVSQL-----------ET------------------------G.MTK-------------EQVRYVMG-
Q1H393_METFK/54-124----GNVVTSKMMLQL-----------RP------------------------G.MTK-------------SQVRFIMG-
A3MZE6_ACTP2/34-104----GNYLEQEKIDQV-----------KV------------------------G.MDK-------------TQVQYLLG-
B0T0T5_CAUSK/29-105----GFQAIEAKPVDM-----------KV------------------------GVDSK-------------STVTEKLG-
A1WX37_HALHL/38-106----GNLLEEEDIEQI-----------TV------------------------G.MSR-------------NQVRQRLG-
Q11J87_CHESB/48-124----GYVIDPQALELV-----------PV------------------------G.SSR-------------EQVLLALG-
A4XUA2_PSEMY/28-96----VTFRDEPLVKQV-----------DH------------------------G.MTQ-------------EQVRTLGG-
Q28RF7_JANSC/34-109----GYVPPPELLSEI-----------SI------------------------G.TSR-------------EQVAEIAG-
Q5QXM4_IDILO/32-102----GNYLEQDDVDKL-----------RV------------------------G.MTE-------------EQVVFVLG-
BAME_BUCAI/32-101----ATHLNKNILNRN-----------YV------------------------G.MTR-------------QQIVYIFG-
Q0BTE4_GRABC/35-111----GNKVDVDLLKEL-----------TP------------------------GTSTQ-------------ADVASLLG-
Q2NDV7_ERYLH/16-92----GYVVDQLLLDRV-----------QP------------------------GIDNR-------------QSVAATLG-
Q122Q0_POLSJ/29-99----GNFISSEQVEQL-----------RP------------------------G.MSR-------------DQVRAVLG-
Q3JBU9_NITOC/42-112----GNVITQEMLEKL-----------SP------------------------G.MSK-------------QQVSFVLG-
Q7VM11_HAEDU/34-104----GNYLEQDKIDQV-----------KI------------------------G.MNK-------------TQVQYLLG-
Q6D4H9_PECAS/28-96----ESYVNEPVVKDV-----------KV------------------------G.MTK-------------QQVQQLAG-
A5V7M5_SPHWW/32-109----GYVVDSTLINTV-----------SP------------------------GVDNR-------------ESVEKTLG-
Q1GPC4_SPHAL/37-113----GYVVDPALTEAI-----------TP------------------------GVDNR-------------ESVERTLG-
Q0VSU2_ALCBS/35-105----GNFVTEDMLSEL-----------QP------------------------G.MTP-------------EQVRYVLG-
B0UU40_HISS2/52-121----GSWPNWDNLRMV-----------ER------------------------G.MNK-------------DQLYNLLG-
B0UV53_HISS2/34-103----GNYLESTAVEQV-----------KV------------------------G.MNA-------------QQVQYLLG-
B7VJW3_VIBTL/77-145----GNYVEQEAVDQL-----------KF------------------------G.MTK-------------TQVRYVMG-
C1DFM7_AZOVD/35-101----GNVVTQDMIDQL-----------RP------------------------G.MTR-------------RQVRFVMG-
D4Z6S0_SPHJU/63-138----GYQVDKLLVDSI-----------QP------------------------GIDNR-------------ASVEGTLG-
M1FIJ3_9ALTE/29-96----GNIVTNKELTAL-----------TE------------------------G.MPR-------------SQVHAVMG-
M9X398_MANHA/34-103----GNYLEQDKIAQL-----------KV------------------------G.MTA-------------EQVEYLLG-
BAME_VIBCH/35-104----GNYVDQQSVDQL-----------KF------------------------G.MSK-------------DQVRFVLG-
BAME_HAEIN/34-103----GNYLEATTVAQV-----------KE------------------------G.MTA-------------QQVQYLLG-
Q2KA05_RHIEC/31-105----GYVVDQQSLNLV-----------PE------------------------G.SSR-------------EQVLLSLG-
Q2YNC3_BRUA2/49-124----GYVLDQQALDSV-----------PV------------------------G.SSR-------------EQVLLALG-
Q3J361_RHOS4/40-116----GYVPTEIDLQRI-----------EV------------------------GRDTR-------------DSVAEIVG-
BAME_PSYA2/52-130----GTPITQTQAQKL-----------QV------------------------G.MNQ-------------NQVLYILG-
Q5ZYK0_LEGPH/42-110----GNLLPQSKIARL-----------KT------------------------G.MSK-------------NDVAILMG-
Q63LV3_BURPS/48-120----GTFVNVENLRQI-----------GP------------------------G.LDK-------------NQVYALIG-
Q63QT2_BURPS/54-121----GNFVSQEKASQL-----------QV------------------------G.MSR-------------EQVRALLG-
Q6LUB1_PHOPR/34-102----GNYLEQSDIDTL-----------RM------------------------G.MNK-------------EQVRYVLG-
Q79GM4_BORPE/42-111----GNWITKEQVALL-----------QQ------------------------G.MSR-------------EQVRFALG-
BAME_YERPE/38-107----GNYLSPIDASKI-----------HK------------------------G.MTQ-------------QQVAYTLG-
BAME_SALTY/35-104----GNYLTPTDVAKV-----------RV------------------------G.MTQ-------------QQVAYALG-
Q87RX9_VIBPA/35-104----GNYVEQSAVDKL-----------KF------------------------G.MTK-------------AQVRFVLG-
Q87VN2_PSESM/31-98----.TYRNEPLVKQV-----------EN------------------------G.MTR-------------QQVLTIGG-
Q88DH0_PSEPK/30-95----.TYRDEPLVKQV-----------EN------------------------G.MTM-------------QKVIAIGG-
Q88DT8_PSEPK/35-101----GNVVTQDMIDQL-----------RP------------------------G.MTR-------------RQVRFIMG-
BAME_SHEON/38-105----GNYMEPQQVEKL-----------RI------------------------D.MTK-------------EQAEYILG-
BAME_XANCP/28-99----GNLIKQTAVEQL-----------QV------------------------G.QSK-------------QQVSALLG-
Q8XVT1_RALSO/61-130----GNFVSREQASQL-----------KE------------------------G.MTR-------------DQVRYVLG-
Q92KF5_RHIME/42-116----GYVVDQETLALV-----------PV------------------------G.SSR-------------EQVLLSLG-
Q9HUT7_PSEAE/31-97----.TFRNEPLVKDV-----------EK------------------------G.MSQ-------------QEVLRIGG-
Q9JXT1_NEIMB/52-133----GTFPTYDELDQM-----------RP------------------------G.LTK-------------DDIYKILG-
Q9PB00_XYLFA/44-114----GNLIKKEAVDQL-----------KV------------------------G.MNK-------------QEVALLLG-
V6F1L4_9PROT/28-103----GNLPHPEDLAKI-----------TA------------------------GKTSR-------------EEVQALLG-

PF12978

Q8DTX1_STRMU/47-205SFSREAKIGKEDYDEL-----------KI------------------------G-ESY-------------KKVVEKLG-
B9DSB0_STRU0/47-205AFNRDLNISLKDYNKI-----------KK------------------------G-MSY-------------NEVTKILT-
G2SNY8_LACRR/70-224KFTRSPKLDLKAFDSI-----------AD------------------------G-ANY-------------DDVVKRYG-
Q8DZF2_STRA5/47-206KFIRDANITTKDYNSL-----------KN------------------------G-MSY-------------NKVKELLG-
Q99ZC4_STRP1/47-204TFARELGLSQKEYQQL-----------QK------------------------G-MSY-------------EDVKKILT-

PF07467

Q9KJ90_STREX/2-185SAQANSGFSAEKYEQI-----------QF------------------------G-MTF-------------DEVWEIGGG
B5GLC0_STRC2/2-181SAHAYTGFTPERYNKI-----------QF------------------------G-MDR-------------TLVWQLAGA
BLIP_STRCL/10-200ASNAAGVMTGAKFTQI-----------QF------------------------G-MTR-------------QQVLDIAGA

PF13670

Q0BXA6_HYPNA/7-95--------------------.EGMTRVKEV-------------------------------------------------E
Q0BXA5_HYPNA/6-84--------------------.QGMTHVLEA-------------------------------------------------E
Q0BY17_HYPNA/6-92--------------------.QGMRDVMKV-------------------------------------------------E
A4VHV2_PSEU5/30-109--------------------.AGYTELHGI-------------------------------------------------E
A4XVH9_PSEMY/6-85--------------------.AGYTELHKI-------------------------------------------------E
Q1QMT6_NITHX/5-85--------------------.KGYTDVSKL-------------------------------------------------E
B8EKV5_METSB/3-81--------------------.QGY.SAIKA-------------------------------------------------E
Q5LX53_RUEPO/50-129--------------------.LGY.DVRKI-------------------------------------------------E
B8IVF4_METNO/5-90--------------------.LGY.RVDRV-------------------------------------------------K
B3PI60_CELJU/2-85--------------------.QGY.DIKVF-------------------------------------------------K
C1DNM7_AZOVD/2-85--------------------.QGY.EIRKF-------------------------------------------------K
Q1LBN9_RALME/3-85--------------------.QGY.NIKKF-------------------------------------------------K
Q8XWW7_RALSO/3-85--------------------.QGY.TIKKF-------------------------------------------------K
A1K227_AZOSB/5-88--------------------.AGY.TVDKF-------------------------------------------------K
Q5P431_AROAE/5-88--------------------.QGY.TVDKF-------------------------------------------------K
Q5P432_AROAE/18-101--------------------.AGY.TLERF-------------------------------------------------Q
D0KWU4_HALNC/5-88--------------------.EVP.KLKLF-------------------------------------------------K
B0SVT0_CAUSK/5-90--------------------.LGYTKIKVF-------------------------------------------------Q
A7IQ54_XANP2/6-90--------------------.MGFKNIKVF-------------------------------------------------K
B1Y4P0_LEPCP/3-85--------------------.QGY.QIKTF-------------------------------------------------K
B8IVE9_METNO/4-91--------------------.QGY.KVQKA-------------------------------------------------K
Q1QM54_NITHX/4-90--------------------.QGY.KVQKA-------------------------------------------------K
A1B769_PARDP/5-86--------------------.NGW.VVRRI-------------------------------------------------K
A1B772_PARDP/5-86--------------------.LGW.HVEKV-------------------------------------------------E
B6JDT2_OLICO/6-87--------------------.HGW.KVDRI-------------------------------------------------K
A1U059_MARHV/5-86--------------------.EGW.TVHRI-------------------------------------------------K
A1SRM1_PSYIN/5-86--------------------.KGW.QVKRI-------------------------------------------------K
B9K2Y3_AGRVS/4-85--------------------.EGW.NVRSI-------------------------------------------------R
A7IKT6_XANP2/6-87--------------------.EGW.TVLSI-------------------------------------------------R
A1B771_PARDP/5-86--------------------.FGW.TISKM-------------------------------------------------E
Q0S079_RHOJR/10-95--------------------HTGGGTVTGT-------------------------------------------------E
A8LNS6_DINSH/4-81--------------------MECQMDADDI-------------------------------------------------E
B1M6N2_METRJ/3-84--------------------.EGFTKWKEI-------------------------------------------------E
A7HVA0_PARL1/7-87--------------------.AGYVSWEEI-------------------------------------------------E
C5AT97_METEA/7-83--------------------.AGYGTVRSI-------------------------------------------------E
G2J097_PSEUL/8-86--------------------.EGY.QIKKF-------------------------------------------------K
Q2YRI6_BRUA2/6-85--------------------.FTW.KISEM-------------------------------------------------E
Q3J9Y2_NITOC/7-84--------------------.QGFKQISEI-------------------------------------------------E
Q5F6R1_NEIG1/7-90--------------------.RGY.QVYDV-------------------------------------------------D

PF03413

Q9K7V1_BACHD/28-100--------------------..........-------------------------------------------------D
Q816W8_BACCR/30-100--------------------..........-------------------------------------------------Y
Q8EP78_OCEIH/29-101--------------------..........-------------------------------------------------N
U5LGT7_9BACI/29-101--------------------..........-------------------------------------------------H
Q03RI8_LACBA/34-106--------------------..........-------------------------------------------------F
Q03GC8_PEDPA/34-106--------------------..........-------------------------------------------------Y
Q82ZL5_ENTFA/37-109--------------------..........-------------------------------------------------F
Q5HNG3_STAEQ/33-102--------------------..........-------------------------------------------------I
B1YKF6_EXIS2/28-100--------------------..........-------------------------------------------------E
Q181V6_PEPD6/408-465--------------------..........-------------------------------------------------.
Q181V6_PEPD6/490-547--------------------..........-------------------------------------------------.
Q8TTA4_METAC/138-199--------------------..........-------------------------------------------------.
A8MEK6_ALKOO/172-230--------------------..........-------------------------------------------------.
A8MEK6_ALKOO/94-155--------------------..........-------------------------------------------------.
A8MEK5_ALKOO/294-355--------------------..........-------------------------------------------------.
Q5WGU9_BACSK/378-439--------------------..........-------------------------------------------------.
YPEB_BACSU/377-438--------------------..........-------------------------------------------------.
A8FEM8_BACP2/376-437--------------------..........-------------------------------------------------.
YPEB_BACHD/374-435--------------------..........-------------------------------------------------.
YPEB_OCEIH/373-434--------------------..........-------------------------------------------------.
A3DI39_CLOTH/391-452--------------------..........-------------------------------------------------.
A0Q324_CLONN/379-440--------------------..........-------------------------------------------------.
Q2RM03_MOOTA/386-447--------------------..........-------------------------------------------------.
A8MIH5_ALKOO/376-437--------------------..........-------------------------------------------------.
Q12WY7_METBU/120-186--------------------..........-------------------------------------------------.
Q6W134_RHISN/286-345--------------------..........-------------------------------------------------.
Q8ELE8_OCEIH/178-237--------------------..........-------------------------------------------------.
Q9KBS1_BACHD/273-331--------------------..........-------------------------------------------------.
Q5KVG3_GEOKA/282-341--------------------..........-------------------------------------------------.
Q9KE75_BACHD/288-347--------------------..........-------------------------------------------------.
A9B7B4_HERA2/311-370--------------------..........-------------------------------------------------.
Q3SKV5_THIDA/55-112--------------------..........-------------------------------------------------.
Q3JE96_NITOC/270-334--------------------..........-------------------------------------------------.
Q9A7E1_CAUCR/252-316--------------------..........-------------------------------------------------.
Q020P0_SOLUE/231-293--------------------..........-------------------------------------------------.
Q82WV7_NITEU/279-343--------------------..........-------------------------------------------------.
A4FCJ5_SACEN/417-477--------------------..........-------------------------------------------------.
Q9KE75_BACHD/74-132--------------------..........-------------------------------------------------.
Q5WLI5_BACSK/75-133--------------------..........-------------------------------------------------.
Q47KW9_THEFY/83-144--------------------..........-------------------------------------------------.
Q825U8_STRAW/84-147--------------------..........-------------------------------------------------.
A0R6J4_MYCS2/78-140--------------------..........-------------------------------------------------.
A1T724_MYCVP/79-141--------------------..........-------------------------------------------------.
Q6NKB0_CORDI/71-132--------------------..........-------------------------------------------------.
Q9KBS1_BACHD/60-118--------------------..........-------------------------------------------------.
Q8P606_XANCP/82-140--------------------..........-------------------------------------------------.
Q7CY41_AGRFC/75-132--------------------..........-------------------------------------------------.
Q2RPK6_RHORT/75-133--------------------..........-------------------------------------------------.
Q6W134_RHISN/75-133--------------------..........-------------------------------------------------.
Q1R143_CHRSD/68-125--------------------..........-------------------------------------------------.
Q7NVU2_CHRVO/229-292--------------------..........-------------------------------------------------.
Q8A623_BACTN/26-84--------------------..........-------------------------------------------------.
Q884E8_PSESM/67-126--------------------..........-------------------------------------------------.
Q9I178_PSEAE/60-119--------------------..........-------------------------------------------------.
Q1LJM8_RALME/260-324--------------------..........-------------------------------------------------.
Q82P05_STRAW/125-192--------------------..........-------------------------------------------------.
Q9L1F9_STRCO/146-216--------------------IW......AA-------------------------------------------------Q
Q82BN5_STRAW/115-187--------------------VVD.....AL-------------------------------------------------H
Q9L2B8_STRCO/168-232--------------------D.........-------------------------------------------------H
Q0AQU2_MARMM/109-177--------------------PP......RE-------------------------------------------------A
E0THY6_PARBH/109-174--------------------PP......SE-------------------------------------------------Y
A7ZG54_CAMC1/58-115--------------------..........-------------------------------------------------.
Q63MT4_BURPS/165-233--------------------FV.......D-------------------------------------------------G
A7ZEI5_CAMC1/100-159--------------------..........-------------------------------------------------.
Q03XK6_LEUMM/140-199--------------------..........-------------------------------------------------.
Q9KC80_BACHD/94-154--------------------..........-------------------------------------------------.
Q5KXX8_GEOKA/94-154--------------------..........-------------------------------------------------.
Q1WU38_LACS1/104-164--------------------..........-------------------------------------------------.
A8FEH2_BACP2/99-159--------------------..........-------------------------------------------------.
Q6ANJ0_DESPS/50-117--------------------KSL.....GL-------------------------------------------------S
Q8R5X9_FUSNN/10-69--------------------..........-------------------------------------------------.
Q8E0L6_STRA5/117-180--------------------..........-------------------------------------------------.
Q8RBF9_CALS4/109-184--------------------..........-------------------------------------------------.
B8I195_CLOCE/108-180--------------------DI.......D-------------------------------------------------T
Q1D8Q2_MYXXD/168-239--------------------YK......DI-------------------------------------------------S
Q81MX8_BACAN/145-217--------------------..........-------------------------------------------------.
Q5ZRA6_LEGPH/16-86--------------------..........-------------------------------------------------.
Q87I51_VIBPA/131-204--------------------..........-------------------------------------------------.
Q2FUX4_STAA8/118-192--------------------VIKENKVEID-------------------------------------------------G
PRTA_LISMO/121-194--------------------..........-------------------------------------------------.
Q97G52_CLOAB/161-230--------------------IV.......K-------------------------------------------------N
Q97G51_CLOAB/153-222--------------------II.......K-------------------------------------------------N
Q97GS5_CLOAB/161-230--------------------..........-------------------------------------------------.
A5I1S2_CLOBH/148-212--------------------YN.......F-------------------------------------------------E
Q81R73_BACAN/122-192--------------------EFGY...IIE-------------------------------------------------E
Q815U2_BACCR/146-219--------------------KDLF..VYEK-------------------------------------------------D
NPRB_BACSU/145-217--------------------KGELY.IYPH-------------------------------------------------D
Q8ESH1_OCEIH/143-217--------------------..........-------------------------------------------------.
B1YFR1_EXIS2/113-183--------------------..........-------------------------------------------------.
NPRM_BACMD/153-222--------------------YVY.....QN-------------------------------------------------G
Q81I21_BACCR/151-220--------------------VY......QN-------------------------------------------------G
Q8DVN1_STRMU/57-120--------------------..........-------------------------------------------------.
Q99YI6_STRP1/81-143--------------------..........-------------------------------------------------.
R6P3S5_9CLOT/179-241--------------------..........-------------------------------------------------.
Q8ESN0_OCEIH/32-90--------------------..........-------------------------------------------------.
A5G759_GEOUR/48-108--------------------..........-------------------------------------------------.
O27358_METTH/81-143--------------------..........-------------------------------------------------.
Q8ERG4_OCEIH/132-194--------------------..........-------------------------------------------------.
Q5WLC0_BACSK/58-117--------------------..........-------------------------------------------------.
Q82ZK1_ENTFA/63-122--------------------..........-------------------------------------------------.
Q5FIK1_LACAC/43-101--------------------..........-------------------------------------------------.
Q5FIK0_LACAC/62-121--------------------..........-------------------------------------------------.
Q74JH3_LACJO/49-108--------------------..........-------------------------------------------------.
Q8ERG4_OCEIH/56-114--------------------..........-------------------------------------------------.
Q186H8_PEPD6/62-121--------------------..........-------------------------------------------------.
Q9KFU6_BACHD/49-108--------------------..........-------------------------------------------------.
Q8ESM9_OCEIH/39-97--------------------..........-------------------------------------------------.
A8AXQ2_STRGC/352-411--------------------..........-------------------------------------------------.
Q81R43_BACAN/43-101--------------------..........-------------------------------------------------.
Q8ELD0_OCEIH/32-90--------------------..........-------------------------------------------------.
Q4K807_PSEF5/38-102--------------------..........-------------------------------------------------.
C1DJ09_AZOVD/39-99--------------------..........-------------------------------------------------.
A4XTT8_PSEMY/39-99--------------------..........-------------------------------------------------.
Q0VNT9_ALCBS/52-112--------------------..........-------------------------------------------------.
Q0S7B7_RHOJR/138-198--------------------..........-------------------------------------------------.
Q5F637_NEIG1/47-105--------------------..........-------------------------------------------------.
Q1ARP9_RUBXD/67-126--------------------..........-------------------------------------------------.
Q9L126_STRCO/188-249--------------------..........-------------------------------------------------.
Q9L2B8_STRCO/83-152--------------------DGD....DGD-------------------------------------------------D
A9C057_DELAS/120-179--------------------..........-------------------------------------------------.
Q8RD03_CALS4/115-173--------------------..........-------------------------------------------------.
A8FCD9_BACP2/110-169--------------------..........-------------------------------------------------.
YKOJ_BACSU/108-167--------------------..........-------------------------------------------------.
Q8ESM9_OCEIH/119-177--------------------..........-------------------------------------------------.
YKOI_BACSU/164-223--------------------..........-------------------------------------------------.
A8FCD8_BACP2/167-226--------------------..........-------------------------------------------------.
Q5WKR9_BACSK/175-233--------------------..........-------------------------------------------------.
Q9KFU7_BACHD/111-170--------------------..........-------------------------------------------------.
Q9KFU6_BACHD/130-191--------------------..........-------------------------------------------------.
Q5WKR8_BACSK/122-181--------------------..........-------------------------------------------------.
Q38Z32_LACSS/130-188--------------------..........-------------------------------------------------.
Q2G105_STAA8/129-187--------------------..........-------------------------------------------------.
Q5FIK0_LACAC/141-199--------------------..........-------------------------------------------------.
Q82ZK1_ENTFA/146-205--------------------..........-------------------------------------------------.
Q74LX8_LACJO/141-200--------------------..........-------------------------------------------------.
Q5FIK1_LACAC/119-178--------------------..........-------------------------------------------------.
Q74JH3_LACJO/126-184--------------------..........-------------------------------------------------.
Q186H8_PEPD6/144-202--------------------..........-------------------------------------------------.
Q5WLC0_BACSK/141-199--------------------..........-------------------------------------------------.
Q8R5X9_FUSNN/83-142--------------------..........-------------------------------------------------.
B1HY97_LYSSC/168-225--------------------..........-------------------------------------------------.
Q81R44_BACAN/99-158--------------------..........-------------------------------------------------.
Q0VNU0_ALCBS/63-123--------------------..........-------------------------------------------------.
Q3JBE9_NITOC/51-111--------------------..........-------------------------------------------------.
A4XTT9_PSEMY/41-101--------------------..........-------------------------------------------------.
Q0BZN8_HYPNA/53-112--------------------..........-------------------------------------------------.
A1B2L4_PARDP/40-99--------------------..........-------------------------------------------------.
Q9A8Q0_CAUCR/73-133--------------------..........-------------------------------------------------.
Q988S6_RHILO/46-105--------------------..........-------------------------------------------------.
A4YY21_BRASO/40-99--------------------..........-------------------------------------------------.
Q2RPG4_RHORT/72-131--------------------..........-------------------------------------------------.
V6F502_9PROT/38-95--------------------..........-------------------------------------------------.
Q0AR59_MARMM/55-114--------------------..........-------------------------------------------------.
A8LN27_DINSH/31-89--------------------..........-------------------------------------------------.
A5VEY7_SPHWW/24-82--------------------..........-------------------------------------------------.
Q8KFX7_CHLTE/45-103--------------------..........-------------------------------------------------.
B4E758_BURCJ/39-96--------------------..........-------------------------------------------------.
A9C057_DELAS/43-102--------------------..........-------------------------------------------------.
E0TIH6_PARBH/43-102--------------------..........-------------------------------------------------.
B0UCU3_METS4/66-129--------------------..........-------------------------------------------------.
A3QGG2_SHELP/47-105--------------------..........-------------------------------------------------.
Q7P204_CHRVO/118-188--------------------RL......NE-------------------------------------------------R
ELAS_PSEAE/122-192--------------------RL......GE-------------------------------------------------N
A1S2N2_SHEAM/113-188--------------------ILY.....GK-------------------------------------------------A
Q2SJ90_HAHCH/129-208--------------------YFD.....QE-------------------------------------------------S
B7VN56_VIBTL/116-190--------------------RL......DE-------------------------------------------------N
F7YSQ2_VIBA7/118-194--------------------RL......DE-------------------------------------------------N
HAPT_VIBCH/116-190--------------------RL......DD-------------------------------------------------N
Q5ZZJ1_LEGPH/124-199--------------------RP......DH-------------------------------------------------N
A1S4V2_SHEAM/92-162--------------------IL......AE-------------------------------------------------G
Q211C9_RHOPB/96-155--------------------..........-------------------------------------------------.
Q89L62_BRADU/85-144--------------------..........-------------------------------------------------.
A4YNR6_BRASO/46-105--------------------..........-------------------------------------------------.
Q6N7G2_RHOPA/56-115--------------------..........-------------------------------------------------.
Q1H2G7_METFK/106-166--------------------..........-------------------------------------------------.
A2SEW0_METPP/117-177--------------------..........-------------------------------------------------.
Q1H2G7_METFK/31-90--------------------..........-------------------------------------------------.
A5N159_CLOK5/17-76--------------------..........-------------------------------------------------.
A7ZEI5_CAMC1/22-81--------------------..........-------------------------------------------------.
Q8DWU2_STRA5/78-136--------------------..........-------------------------------------------------.

PF11396

A0M0Q0_GRAFK/54-143--------------------.........V-------------------------------------------------T
A0M1R1_GRAFK/70-160--------------------.........L-------------------------------------------------P
A5FIF1_FLAJ1/58-140--------------------.........I-------------------------------------------------P
A5FNS8_FLAJ1/62-144--------------------.........I-------------------------------------------------P
A6L337_BACV8/61-143--------------------.........I-------------------------------------------------P
A6L4L1_BACV8/60-142--------------------.........V-------------------------------------------------P
A6LDA3_PARD8/62-144--------------------.........I-------------------------------------------------P
A6LDA4_PARD8/55-146--------------------.........L-------------------------------------------------P
A6LDE6_PARD8/58-149--------------------.........L-------------------------------------------------P
C0QVH4_BRAHW/54-141--------------------.........I-------------------------------------------------H
C0QYD0_BRAHW/35-117--------------------.........I-------------------------------------------------D
C0R146_BRAHW/63-147--------------------AE.....KFI-------------------------------------------------D
C0R148_BRAHW/33-123--------------------IEKLSEDNLI-------------------------------------------------E
Q5L9Y2_BACFN/49-143--------------------.........L-------------------------------------------------S
Q5LD45_BACFN/83-177--------------------.........V-------------------------------------------------P
Q7MWB3_PORGI/60-142--------------------.........V-------------------------------------------------P
Q7MWB4_PORGI/55-145--------------------.........L-------------------------------------------------P
Q89YQ4_BACTN/58-150--------------------.........L-------------------------------------------------V
Q89YQ5_BACTN/61-144--------------------.........V-------------------------------------------------P
Q8A994_BACTN/60-142--------------------.........I-------------------------------------------------P
Q8YLV6_NOSS1/61-150--------------------.........F-------------------------------------------------P
C7M630_CAPOD/59-141--------------------.........V-------------------------------------------------P
D6D2V5_9BACE/45-136--------------------.........L-------------------------------------------------V
D6D5W5_9BACE/49-143--------------------.........L-------------------------------------------------S
D6D6Q4_9BACE/56-146--------------------.........L-------------------------------------------------P
Q0P802_CAMJE/53-133--------------------.........L-------------------------------------------------P
Q0P9P8_CAMJE/51-132--------------------.........L-------------------------------------------------P
Q5LBR7_BACFN/55-146--------------------.........L-------------------------------------------------P
Q5LBR8_BACFN/60-141--------------------.........I-------------------------------------------------P
Q5LG06_BACFN/60-151--------------------.........L-------------------------------------------------P
Q5LG07_BACFN/61-143--------------------.........V-------------------------------------------------P
Q5LIE1_BACFN/72-153--------------------D.......SL-------------------------------------------------W
R5U7Q0_9BACE/57-144--------------------.........L-------------------------------------------------P
R6WQR9_9PORP/57-147--------------------.........L-------------------------------------------------P
R6X3F2_9PORP/60-141--------------------.........I-------------------------------------------------P
R6XCT8_9PORP/59-150--------------------.........L-------------------------------------------------P
R7EFG1_9BACE/61-142--------------------.........I-------------------------------------------------P
R7EJJ2_9BACE/58-149--------------------.........L-------------------------------------------------P
R7EKK7_9BACE/52-145--------------------.........V-------------------------------------------------P
R7ELA9_9BACE/58-149--------------------.........L-------------------------------------------------P
R7ERW1_9BACE/60-141--------------------.........V-------------------------------------------------P
R7JJR5_9BACT/78-154--------------------.........V-------------------------------------------------P

PF11399

K7AKJ7_9ALTE/17-119--------------------IADFN--ELH.....------------------------------------------.SK
F5Z4M1_ALTSS/22-120--------------------SPDIT--EAK.....------------------------------------------.RQ
E1SS82_FERBD/33-127--------------------NPDFS--EAL.....------------------------------------------.TD
Q8EGJ0_SHEON/23-131--------------------ASDLS--ESY.LQQS------------------------------------------AGQ
A1S8B9_SHEAM/20-120--------------------APDFS--EAK.....------------------------------------------.SI
K7AKJ0_9ALTE/22-120--------------------SPDIT--EAK.....------------------------------------------.RN
A3QGB8_SHELP/19-122--------------------TADFN--EAY.....------------------------------------------.TK
Q15QZ2_PSEA6/17-119--------------------VADFS--EFV.....------------------------------------------.KK
Q07ZE7_SHEFN/20-120--------------------SADFV--EAK.....------------------------------------------.TG
Q47YB6_COLP3/19-119--------------------VSDFS--ETY.....------------------------------------------.AD
B8CS66_SHEPW/20-120--------------------KADFS--EAK.....------------------------------------------.IS
Q8EGQ0_SHEON/20-120--------------------KADFS--EAK.....------------------------------------------.SL
D4ZHG3_SHEVD/20-120--------------------KADFS--EAK.....------------------------------------------.VT
D4ZHN7_SHEVD/34-137--------------------RADFN--EAY.....------------------------------------------.IE
E1STL4_FERBD/20-123--------------------TADFN--ELY.....------------------------------------------.QQ
Q47YA7_COLP3/20-123--------------------SPDIT--EAR.....------------------------------------------.TI
Q085F9_SHEFN/19-126--------------------TADFS--EAY.TKST------------------------------------------QNN
Q15QY7_PSEA6/21-120--------------------GPDIS--EAK.....------------------------------------------.KT
Q12P24_SHEDO/19-126--------------------TADFS--EAFVTQAS------------------------------------------AQD
B8CQA1_SHEPW/19-122--------------------TADFN--EAY.....------------------------------------------.IQ
Q5QW11_IDILO/20-120--------------------SPDIT--EAK.....------------------------------------------.AS
Q3ICC6_PSEHT/21-122--------------------SPDLT--FAK.....------------------------------------------.RD
G4QLZ6_GLANF/37-143--------------------AADFN--EMV.....------------------------------------------.SS
Q12L38_SHEDO/26-125--------------------EADFV--EAK.....------------------------------------------.TV
F2GBX8_ALTMD/17-118--------------------VADFN--ELF.....------------------------------------------.EK
A3QGM5_SHELP/20-120--------------------KADFS--EAK.....------------------------------------------.SS
A1S4M5_SHEAM/18-116--------------------KADFH--EAW.....------------------------------------------.QA

PF04355

Q5NL78_ZYMMO/17-93--------------------RPTLA..GEF-------------------------------------------------D
Q5LQJ9_RUEPO/35-111--------------------TPSSS..GLL-------------------------------------------------N
Q1LSR9_BAUCH/37-105--------------------TPIFQ..DQN-------------------------------------------------N
Q1LBA9_RALME/75-149--------------------RPHFN.EGFL-------------------------------------------------G
A5WGN5_PSYWF/35-114--------------------SPAMR..DSL-------------------------------------------------A
Q9CJV5_PASMU/34-104--------------------TPVLV..EPF-------------------------------------------------D
BAME_PSYIN/35-104--------------------SPMLI..DQF-------------------------------------------------D
Q220P9_RHOFT/38-108--------------------TPLLS..SIF-------------------------------------------------H
BAME_NEIMB/36-106--------------------SPILR..DAF-------------------------------------------------H
Q5NEF6_FRATT/34-106--------------------SPDII..DTF-------------------------------------------------N
BAME_VIBF1/35-105--------------------SPMLV..ESG-------------------------------------------------Y
A6VMF3_ACTSZ/34-104--------------------TPALK..DPF-------------------------------------------------S
Q7VRQ4_BLOFL/39-110--------------------SPPTL.KNIF-------------------------------------------------G
BAME_NITEU/35-105--------------------TPLVM..DIF-------------------------------------------------H
Q0C315_HYPNA/29-105--------------------SPSTE..GLF-------------------------------------------------D
Q47XI1_COLP3/29-101--------------------SPVVV..DAF-------------------------------------------------N
Q47HJ0_DECAR/36-107--------------------TPLVA..DIF-------------------------------------------------H
Q5FUN3_GLUOX/45-121--------------------SPTAH..ATF-------------------------------------------------D
Q2SMN2_HAHCH/93-162--------------------SPVLE..STL-------------------------------------------------D
Q0A7D7_ALKEH/37-107--------------------PPAVV..DPF-------------------------------------------------R
A1AX05_RUTMC/37-107--------------------SPSII..DSF-------------------------------------------------H
Q3SSS7_NITWN/53-129--------------------TPSTV..ATL-------------------------------------------------N
Q2RTT3_RHORT/36-112--------------------TPSAT..SMF-------------------------------------------------G
Q2NRT5_SODGM/28-97--------------------VPATS.STMI-------------------------------------------------N
A4VII8_PSEU5/29-97--------------------EPSRA.TART-------------------------------------------------V
A7I1H3_CAMHC/52-124--------------------TPHFA.AGLA-------------------------------------------------Y
Q604C4_METCA/51-121--------------------SPLTV..SPF-------------------------------------------------H
B0UR41_METS4/34-110--------------------TPTTV..STV-------------------------------------------------G
Q15V54_PSEA6/31-104--------------------KPVVE..DSF-------------------------------------------------D
Q31FS2_THICR/36-107--------------------PPLGQ..DPF-------------------------------------------------N
A1WGT8_VEREI/51-121--------------------SPLLT..SLF-------------------------------------------------H
A4SVD7_POLSQ/67-138--------------------TPLLA..SYF-------------------------------------------------H
Q2NRZ9_SODGM/35-105--------------------TSMMK..DPF-------------------------------------------------G
A1WCQ4_ACISJ/49-119--------------------TPLMV..SVF-------------------------------------------------H
Q1LMT9_RALME/71-142--------------------TPLLT..DVF-------------------------------------------------H
Q6FDQ3_ACIAD/30-107--------------------SPTIT..DPL-------------------------------------------------N
Q7CZT7_AGRFC/48-124--------------------TPSTT..ATF-------------------------------------------------G
Q0K704_CUPNH/51-122--------------------TPLLN..DVF-------------------------------------------------H
Q21H32_SACD2/36-106--------------------SPLLE..DTF-------------------------------------------------N
Q83C32_COXBU/30-100--------------------TPVLT..NMY-------------------------------------------------A
A8GGW6_SERP5/28-97--------------------PPSTT.ATLV-------------------------------------------------H
A5FV68_ACICJ/239-315--------------------SPTLR..ETF-------------------------------------------------H
Q3SJS3_THIDA/32-102--------------------TPLVV..DPF-------------------------------------------------R
A0KI84_AERHH/30-100--------------------SAMLR..DGF-------------------------------------------------D
Q3IE33_PSEHT/35-105--------------------KPIAE..NAF-------------------------------------------------D
A6W2D6_MARMS/31-103--------------------NPMLR..DTF-------------------------------------------------K
Q2G501_NOVAD/31-107--------------------RPTFT..SQF-------------------------------------------------G
A7HX93_PARL1/37-112--------------------SPSTV..STV-------------------------------------------------D
Q983A2_RHILO/103-179--------------------TPSTT..ATF-------------------------------------------------D
Q7NX33_CHRVO/32-104--------------------TPLLT..DPF-------------------------------------------------H
Q2YBT7_NITMU/31-101--------------------SPMIS..DAF-------------------------------------------------H
A2SC95_METPP/48-118--------------------SPLLA..DIF-------------------------------------------------H
A1K8N9_AZOSB/69-139--------------------TPLVV..DIF-------------------------------------------------R
A7INK8_XANP2/42-117--------------------TPSTV..ATV-------------------------------------------------N
Q1QSW6_CHRSD/33-103--------------------SPLLK..GPF-------------------------------------------------N
Q1H393_METFK/54-124--------------------SPLIQ..DSF-------------------------------------------------H
A3MZE6_ACTP2/34-104--------------------TPMLK..DTF-------------------------------------------------N
B0T0T5_CAUSK/29-105--------------------SPSAT..STF-------------------------------------------------D
A1WX37_HALHL/38-106--------------------TPVLE..HAF-------------------------------------------------E
Q11J87_CHESB/48-124--------------------TPSTT..ATF-------------------------------------------------D
A4XUA2_PSEMY/28-96--------------------PPSSQ.FEHS-------------------------------------------------L
Q28RF7_JANSC/34-109--------------------SPGTG..GVM-------------------------------------------------R
Q5QXM4_IDILO/32-102--------------------TPVAQ..NSF-------------------------------------------------D
BAME_BUCAI/32-101--------------------IPIIS..DSF-------------------------------------------------D
Q0BTE4_GRABC/35-111--------------------SPTTK..ATF-------------------------------------------------D
Q2NDV7_ERYLH/16-92--------------------RPTFE..SQF-------------------------------------------------G
Q122Q0_POLSJ/29-99--------------------TPLMA..SLF-------------------------------------------------H
Q3JBU9_NITOC/42-112--------------------SPLLI..DSF-------------------------------------------------H
Q7VM11_HAEDU/34-104--------------------TPMLK..DIF-------------------------------------------------H
Q6D4H9_PECAS/28-96--------------------SGMEK..RLV-------------------------------------------------N
A5V7M5_SPHWW/32-109--------------------RPSFA..GQF-------------------------------------------------D
Q1GPC4_SPHAL/37-113--------------------RPTFV..GQF-------------------------------------------------G
Q0VSU2_ALCBS/35-105--------------------APTLV..DPF-------------------------------------------------T
B0UU40_HISS2/52-121--------------------RPHFS.EGLY-------------------------------------------------G
B0UV53_HISS2/34-103--------------------TPMLI..DPF-------------------------------------------------S
B7VJW3_VIBTL/77-145--------------------SPMLI..ENG-------------------------------------------------Y
C1DFM7_AZOVD/35-101--------------------SPLIT..DTF-------------------------------------------------H
D4Z6S0_SPHJU/63-138--------------------RPSFV..AQF-------------------------------------------------G
M1FIJ3_9ALTE/29-96--------------------TPLML..NPV-------------------------------------------------D
M9X398_MANHA/34-103--------------------TPMLK..NIF-------------------------------------------------E
BAME_VIBCH/35-104--------------------SPMLV..ENG-------------------------------------------------Y
BAME_HAEIN/34-103--------------------TPVLV..DPY-------------------------------------------------N
Q2KA05_RHIEC/31-105--------------------TPSTT..ATF-------------------------------------------------D
Q2YNC3_BRUA2/49-124--------------------TPSTT..ATF-------------------------------------------------D
Q3J361_RHOS4/40-116--------------------RPSAS..TLL-------------------------------------------------N
BAME_PSYA2/52-130--------------------SPAIR..DTL-------------------------------------------------E
Q5ZYK0_LEGPH/42-110--------------------TSIMS..PTF-------------------------------------------------N
Q63LV3_BURPS/48-120--------------------EPHFS.EGII-------------------------------------------------G
Q63QT2_BURPS/54-121--------------------TPLLT..DMF-------------------------------------------------H
Q6LUB1_PHOPR/34-102--------------------SPMLV..EPS-------------------------------------------------Y
Q79GM4_BORPE/42-111--------------------SPTLT..SVL-------------------------------------------------H
BAME_YERPE/38-107--------------------TPMLQ..DPF-------------------------------------------------G
BAME_SALTY/35-104--------------------TPMMT..DPF-------------------------------------------------G
Q87RX9_VIBPA/35-104--------------------SPMLI..ENG-------------------------------------------------Y
Q87VN2_PSESM/31-98--------------------EPSTTIERKV-------------------------------------------------N
Q88DH0_PSEPK/30-95--------------------SPSSV.IDLP-------------------------------------------------H
Q88DT8_PSEPK/35-101--------------------NPLIQ..DTF-------------------------------------------------N
BAME_SHEON/38-105--------------------RPVLR..DSF-------------------------------------------------A
BAME_XANCP/28-99--------------------TPSIP..DPF-------------------------------------------------H
Q8XVT1_RALSO/61-130--------------------SPLLT..DMF-------------------------------------------------H
Q92KF5_RHIME/42-116--------------------TPSTT..ATF-------------------------------------------------D
Q9HUT7_PSEAE/31-97--------------------TPSGTQKRLM-------------------------------------------------K
Q9JXT1_NEIMB/52-133--------------------RPHYD.ESMY-------------------------------------------------G
Q9PB00_XYLFA/44-114--------------------TPSIS..DIF-------------------------------------------------H
V6F1L4_9PROT/28-103--------------------TPSSV..MPY-------------------------------------------------G

PF12978

Q8DTX1_STRMU/47-205--------------------EPDVLSQSMS-------------------------------------------------S
B9DSB0_STRU0/47-205--------------------EPDDYSHASS-------------------------------------------------S
G2SNY8_LACRR/70-224--------------------EPDNLNEMKI-------------------------------------------------G
Q8DZF2_STRA5/47-206--------------------EPDDISQAVS-------------------------------------------------S
Q99ZC4_STRP1/47-204--------------------EPDNYSQASS-------------------------------------------------S

PF07467

Q9KJ90_STREX/2-185EAACDTGGVIGDSILCFTE.SGDYAPYGGFSFTDE...GELWSKRNEYLYKAKTPSVKLSHYNRTALGMTEAQLWAAVPK
B5GLC0_STRC2/2-181DQSCSDQ...VERIICYNN.PDHYGPQGHFFFNAA...DKLIHKRQMELFPAPKPTMRLATYNKTQTGMTEAQFWAAVPS
BLIP_STRCL/10-200E.NCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKFNQVTVGMTRAQVLATVGQ

PF13670

Q0BXA6_HYPNA/7-95R.DD-GK...WE-LE.G-----C----------TRDGRE--IEID--IHG------------ASGAI--LELE------
Q0BXA5_HYPNA/6-84L.DD-GE...WE-IE.G-----C----------SADGRE--LDID--LHS------------RTGDI--LKYD------
Q0BY17_HYPNA/6-92A.RR-GV...WR-VE.G-----R----------DGSGQR--LVVE--VDG------------FTGAV--VKVE------
A4VHV2_PSEU5/30-109ADGD-G....WE-GE.G-----M----------KQDGKK--YEFK--IDG------------RTGEV--TKDK------
A4XVH9_PSEMY/6-85ADSD-GY...WE-GE.G-----L----------KQDGRL--YEFR--IDG------------KSGQV--IRDQ------
Q1QMT6_NITHX/5-85ADDG-RC...WE-AK..-----A----------MLNGVR--QKIY--LDP------------RSGEV--VGHK------
B8EKV5_METSB/3-81ADDG-Y....WE-GK..-----A----------VKDGKI--IEFN--ADP------------KTGEI--TKSE------
Q5LX53_RUEPO/50-129D.ED-GK...IE-AY..-----V----------VKDGKM--AEVY--VDP------------KTGKI--SKIE------
B8IVF4_METNO/5-90AEDG-.C...YE-VR.A-----V----------NDSGLP--IKAV--YAQ------------ATGEL--VRAW------
B3PI60_CELJU/2-85VTDG-NC...YE-IY.G-----W----------NKDKQK--VEIY--FDP------------VTGAV--VKEE------
C1DNM7_AZOVD/2-85VTDG-NC...YE-IY.G-----F----------DKDRRK--VEIY--FDP------------VSGRA--IKEN------
Q1LBN9_RALME/3-85V.DG-NC...YE-IY.G-----T----------TKDGKK--AEIY--FDT------------KTLEI--VKSE------
Q8XWW7_RALSO/3-85V.DG-HC...YE-IY.G-----T----------NQDGKK--VEIY--YDT------------KTLDV--VKSE------
A1K227_AZOSB/5-88VTSG-NC...YE-IY.G-----K----------DKDGKK--VEIY--YNP------------VDGSV--AREK------
Q5P431_AROAE/5-88TTDG-NC...YE-IY.G-----K----------DQDGKK--VEIY--FSP------------IDGSV--VKEK------
Q5P432_AROAE/18-101VTKG-NC...YE-LY.G-----M----------DKDGNK--VEIY--HNP------------VDGSV--VESK------
D0KWU4_HALNC/5-88VTDG-NC...FE-IY.G-----W----------GQAGEK--LEIY--YHP------------VTGEV--VKRG------
B0SVT0_CAUSK/5-90V.SG-SC...YE-IY.A-----M----------NKAGKK--AEVY--FNP------------VTGAI--VQDN------
A7IQ54_XANP2/6-90KTTS-GC...YE-IY.G-----Y----------NKDGKK--AEVY--FNP------------VTGEI--VENN------
B1Y4P0_LEPCP/3-85VSKG-RC...YE-IY.G-----F----------DKANKK--VEIY--FDP------------ATAAV--LETK------
B8IVE9_METNO/4-91IAKA-.C...GE-IY.A-----L----------DQNNAR--TELF--VDP------------TSGEI--VAKE------
Q1QM54_NITHX/4-90LKNA-.C...GE-FY.T-----L----------DQNGNR--VELF--VDP------------TNGQV--IGQI------
A1B769_PARDP/5-86IDDG-.C...YE-IK.G-----T----------DREGRR--IEAT--VDP------------GTLQV--IEVE------
A1B772_PARDP/5-86ADDG-.C...WE-VK.G-----R----------DAQGRR--IKAK--LDP------------ATLQV--VKLR------
B6JDT2_OLICO/6-87IDDG-.C...YQ-IR.G-----I----------DETGQP--FKAK--IDP------------GTLAV--VKMK------
A1U059_MARHV/5-86VDDG-.C...YE-VR.G-----L----------DADGVR--AEAS--FAP------------ASLTM--MKWE------
A1SRM1_PSYIN/5-86VDDN-.C...YE-VK.A-----L----------DHQGNK--IEAR--FGP------------AELDI--LELE------
B9K2Y3_AGRVS/4-85SGDG-.C...YE-AH.A-----V----------DSSGNA--IEAY--FDP------------KTFKP--IDQK------
A7IKT6_XANP2/6-87SDDG-.C...YK-VR.A-----T----------NTRGER--LKAK--YDP------------ASLQR--IPRT------
A1B771_PARDP/5-86LDDG-.C...YE-LN.V-----I----------DQGGNS--LKMT--VDP------------GTLEV--IDGK------
Q0S079_RHOJR/10-95IGDE-ES..LYE-VE.V-----T----------LPDGNQ--VDVQ--LDQ------------NFTVV--GTKT------
A8LNS6_DINSH/4-81VEDD-G....YD-LDDV-----I----------CKGGNQ--FDIK--LDK------------EFNEV--SRRA------
B1M6N2_METRJ/3-84L.DD-GM...IE-VDDA-----I----------DASGKQ--FDLK--LDP------------KTLAI--VKRK------
A7HVA0_PARL1/7-87F.DD-NR...WE-VDDA-----R----------DEKGRE--FDVK--LDP------------ESYEI--VSTR------
C5AT97_METEA/7-83A.DD-GV...WK-AK..-----A----------VRDGRS--VKVQ--LDP------------QTGAI--VEK.------
G2J097_PSEUL/8-86V.DG-NC...YE-LY.G-----K----------NKDGKK--VEIY--YDT------------VSGKP--VKSE------
Q2YRI6_BRUA2/6-85I.DD-GC...YE-LH.V-----T----------DENGNV--LKVK--VDP------------ETMKV--VAG.------
Q3J9Y2_NITOC/7-84FDDD-.K...WE-VD..-----V----------YKDNQK--LELE--VDP------------SSGKI--LSNK------
Q5F6R1_NEIG1/7-90ADDY-WGKPVLE-VE..-----A----------YKDGRE--YDIV--LSY------------PDLKI--IKE.------

PF03413

Q9K7V1_BACHD/28-100HLSY-TV---YR.GG.I-----S.......SSNEDDMTQ..FEFL..IDA------------NTGTV--LEVN------
Q816W8_BACCR/30-100DVAY-EV---YR.GG.L-----T..T.....MLNDIQER..FEFL..VDA------------KTGTV--LEV.------
Q8EP78_OCEIH/29-101GLLY-DV---YR.GG.V-----T.......RNIDGDNKQ..YEFY..VDI------------ETGAV--IDTK------
U5LGT7_9BACI/29-101GLSY-NV---YK.GG.I-----S..R.....TADGEVSQ..YEFV..ADS------------RTGTI--LDAY------
Q03RI8_LACBA/34-106AVKS-RV---YY.GG.I-----N.......RYEDDQLVQ..YQFI..ADA------------ATGSI--LDIH------
Q03GC8_PEDPA/34-106GLKA-SV---YY.GG.I-----T.......KYENNELIQ..YEFI..ADA------------YTGTI--IDIY------
Q82ZL5_ENTFA/37-109AIHS-KT---YT.GG.I-----C.......RIEDDGIVQ..YEFT..ADA------------YTGTI--IDIQ------
Q5HNG3_STAEQ/33-102NHNQ-PI---YQ.GG.I-----T.......VLKNDHLIN..YEFY..ADA------------VSGQI--IDII------
B1YKF6_EXIS2/28-100SRDY-QS---YK.GG.I-----S.......VLEGDDEKT..YQFT..VDA------------ETGAL--LEYA------
Q181V6_PEPD6/408-465.AED-NE---YE.AK.V-----I..K.........NKKT..YELE..ISA------------FDGRI--VDID------
Q181V6_PEPD6/490-547.EDD-KE---YE.GE.I-----I..K.........GKTE..YEIT..INA------------ITGKI--LEFE------
Q8TTA4_METAC/138-199.DGM-AV---YE.GSIV-----F............DSME..YEFE..IDA------------TTGTI--VDWN------
A8MEK6_ALKOO/172-230.DDT-AE---YE.IEIL-----K............DGIK..YEIE..MNA------------FTGNI--FNCE------
A8MEK6_ALKOO/94-155HNDT-SE---YE.IKIL-----K............DGNL..YEIK..MDG------------YTGKI--KKIE------
A8MEK5_ALKOO/294-355EEDE-AK---YE.IKIT-----E............GKNV..YEIE..LDA------------YTGNV--LEFD------
Q5WGU9_BACSK/378-439NEEV-FV---YE.FY.G-----T..R.........DNDT..YRIF..INA------------LTGEE--EKVE------
YPEB_BACSU/377-438GQEV-LC---YE.ML.G-----T..I.........ENDT..FRMY..INA------------KDGSE--EKVE------
A8FEM8_BACP2/376-437SEEV-LC---YE.FL.G-----T..I.........KNDT..YRMF..INA------------DTGKE--ERVD------
YPEB_BACHD/374-435GEEV-LC---YE.FF.G-----V..I.........NDET..YRIY..INA------------EDGEE--EKVE------
YPEB_OCEIH/373-434GEEV-LT---YE.FL.G-----I..M.........DDET..YRIF..INA------------ENGQE--ELVE------
A3DI39_CLOTH/391-452KTEL-FT---YE.FK.G-----K..L.........NDKD..FLVY..INA------------ETGKE--ENIL------
A0Q324_CLONN/379-440NKEI-LC---YE.VA.G-----K..C.........KDDE..FVVY..INA------------ETGYE--QRIL------
Q2RM03_MOOTA/386-447GQEK-LT---YE.VK.T-----K..M.........DNTY..YLNY..INA------------LTGEE--EKVL------
A8MIH5_ALKOO/376-437GKEI-LT---YE.FK.V-----K..F.........GKDT..YLVY..IDA------------ETGEQ--RRML------
Q12WY7_METBU/120-186.TVM-VV---YS.YP.K-----V..GAMTTVKDKATGEE..YRIF..VDA------------YSLEE--VQDN------
Q6W134_RHISN/286-345.TPT-GV---YT.GS.V-----Y..P.....DDLSQQRV..VH....LDQ------------YSGKP--LLDT------
Q8ELE8_OCEIH/178-237.TDD-GV---YT.IS.V-----F..P.....PKARDEAT..MH....IDQ------------YTGAI--LADY------
Q9KBS1_BACHD/273-331.EQD-SV---YT.VS.A-----Y..P.....PRAQDEAT..IH....IDQ------------YTGAV--LADY------
Q5KVG3_GEOKA/282-341.GPK-GV---FT.VA.T-----S..K.....TKPWDNAT..LH....IDQ------------YSGRV--LSDV------
Q9KE75_BACHD/288-347.GDT-GV---YT.IA.S-----S..H.....TKPGDNAT..IH....VDQ------------YSGAI--LSDV------
A9B7B4_HERA2/311-370.GEK-GV---YT.IA.A-----V..A.....NDPADEAT..IH....VDQ------------YSGAI--LADI------
Q3SKV5_THIDA/55-112.APQ-ET---YL.VK.L-----N..........NAHDRF..VY....VDP------------YDGSI--LGTH------
Q3JE96_NITOC/270-334.GPE-GV---YA.IE.K-----R..QPGEANQRRPRSK...VW....VEQ------------YSGEV--LAVE------
Q9A7E1_CAUCR/252-316.TDS-GV---YR.LR.L-----Q..T.....PGDPSRRF..PHSFVWITP------------ATGEV--LAMT------
Q020P0_SOLUE/231-293.GPK-GA---YQ.IR.S-----R..FPEDLTPGGRSRVI........VDQ------------YTGNV--LYAE------
Q82WV7_NITEU/279-343.NAE-GV---Y..IV.T-----Q..KHVPKLSAFWSERQ..IA....IDQ------------YSGEI--LDVR------
A4FCJ5_SACEN/417-477.GAD-GV---FS.VA.E-----R..S....NGVPVQRDR..VA....VDP------------YSGKV--VERV------
Q9KE75_BACHD/74-132.DPQ-RT---TE.IS.M-----M.........KDGERIS..VY....VNP------------YNGEV--QGSL------
Q5WLI5_BACSK/75-133.DPR-RT---TE.FV.I-----R.........EGEVSSS..VF....VNP------------YTGDI--QGKL------
Q47KW9_THEFY/83-144.GPE-DS---TR.VL.F-----Q...V..DGLEESVRSS..VF....VDP------------YTGEV--LGTL------
Q825U8_STRAW/84-147.EAD-AT---TR.VL.L-----S...GV.KGVDEGHTLA..VF....VDP------------YTGKV--RGSL------
A0R6J4_MYCS2/78-140.EPT-ET---TQ.VQ.L-----S...V..DDVPPDYSRT..VF....VDP------------YTAEV--RGAL------
A1T724_MYCVP/79-141.GAT-ES---TR.VY.F-----V...D..PALDEEKLRT..VF....VDP------------YTGRV--LGDE------
Q6NKB0_CORDI/71-132.NPD-QA---TR.VM.F-----N...D..PTLPKSTTQA..VF....VNQ------------YTGDI--TGDM------
Q9KBS1_BACHD/60-118.SST-RS---SE.VT.L-----S.........TVNGPLT..VF....LDP------------YTGEQ--LGTL------
Q8P606_XANCP/82-140.RAD-AS---AE.IG.V-----L..R......TDGAREV..VY....VDP------------YSGRA--LGML------
Q7CY41_AGRFC/75-132.DPG-AS---TE.IT.V-----D.........TEDGKRA..VY....VNP------------YTAEV--AGSL------
Q2RPK6_RHORT/75-133.QPD-LS---AE.VT.I-----K........TAAGDKRA..VY....VDP------------YRAQV--LGTL------
Q6W134_RHISN/75-133.SPV-SS---AE.IT.V-----S........TEAEGKLA..VY....VDP------------YSGKV--LGAL------
Q1R143_CHRSD/68-125.ASN-LA---AE.VD.I-----T.........TADGKQA..VY....VDP------------YTGEV--TGTI------
Q7NVU2_CHRVO/229-292.ESK-PG---SP.LL.L-----R..WKLPGELHPNGRSQ..VE....VDP------------YSGAL--LRVT------
Q8A623_BACTN/26-84.DPE-RT---YQ.VS.L-----S..K........PRRSS..VY....VDQ------------YTGEI--TGKN------
Q884E8_PSESM/67-126.GDY-FA---LS.VF.V-----T........YPDGRSVP..AY....VNP------------YTGVI--QGLT------
Q9I178_PSEAE/60-119.EEH-FA---LT.AE.V-----S........YPGGSEAT..LY....INP------------YTGAI--QGES------
Q1LJM8_RALME/260-324.KPG-DA---YE.VR.L-----R...Q..EGEVRADTGA..TRLW..LDA------------YTGRP--LAVR------
Q82P05_STRAW/125-192GGSA-LA---YQ.VR.V-----T..D....SKTTEATGSRTVV....VDA------------VTGRI--RSNT------
Q9L1F9_STRCO/146-216GKPV-LA---YE.....-----...TVVGGLQDDGTPNE..LHVI..TDA------------DTGAK--LYEY------
Q82BN5_STRAW/115-187GAPK-LA---WR.TN.V-----V..G....QDSLGNPVA..RTVL..TDA------------RSGKQ--IDAW------
Q9L2B8_STRCO/168-232GDGR-PA---WE.VE.T-----R..A....SGEGGQDWR........VDL------------KTGKV--TADR------
Q0AQU2_MARMM/109-177GLSV-PA---WR.ID.F-----E..A.......GDTTPP..VTFY..INS------------QTGEL--RAVR------
E0THY6_PARBH/109-174GPGG-PV---WQ.VQ.F-----D..D........DGNTR..LY....IDP------------DTGVV--RARR------
A7ZG54_CAMC1/58-115.GEN-KA---YS.IS.V-----T..K.........DKKL..LNFF..IDP------------RNGEV--ISED------
Q63MT4_BURPS/165-233AGTH-TA---WK.VS.G-----R..P....QDSLHGDWE..LI....IDA------------GSGEV--LRAQ------
A7ZEI5_CAMC1/100-159.NGA-WI---YK.VE.L-----K..R.......DRSEKK..VI....INA------------QTGEI--IDNY------
Q03XK6_LEUMM/140-199.DGR-TY---WE.IS.L-----K..D.........GNNN..VAVK..LDA------------NSGQV--IEKD------
Q9KC80_BACHD/94-154.NEH-PI---YE.VT.Y-----Y..D........EEGRL..SYYY..VSF------------YDGTF--IKRY------
Q5KXX8_GEOKA/94-154.KGV-PL---WE.LT.Y-----I..D........AEGRY..SFYY..LHF------------ADGAF--LKRY------
Q1WU38_LACS1/104-164.NNK-PV---WE.VT.Y-----L..N........NQNNI..CYDL..ISF------------KTGKI--IKSI------
A8FEH2_BACP2/99-159.GDV-LL---WE.VT.Y-----L..N........ENNQY..SFSY..VDF------------STGHV--EKNV------
Q6ANJ0_DESPS/50-117EQKQ-PV---YK.IV.T-----Y..K.........KGGR..VKYY..IDS------------VTGKV--LLSK------
Q8R5X9_FUSNN/10-69.KDK-TV---YE.....-----........GEAFDKGQK..IEFI..IDV------------NTGEV--FKIA------
Q8E0L6_STRA5/117-180ENGK-SV---YD.ID.F-----V..D.......LKNKNE..VDYQ..IDA------------ETGKI--IE..------
Q8RBF9_CALS4/109-184.YYD-AN---YS.FS.F-----E..RIVNGISFPNNGLY..VY....VDK------------NTLKV--TSYF------
B8I195_CLOCE/108-180YGYN-GG---YI.IN.Y-----V..REVNGIEYKSNYIT..VS....VNS------------YTGKV--MSYT------
Q1D8Q2_MYXXD/168-239GEYH-SA---YR.VE.V-----T..N....VDGTDNPRK..MNYL..VDA------------NTGKL--FEQF------
Q81MX8_BACAN/145-217.KAT-NA---YQ.IT.F-----S..A......STPEYVS..GTVL..IDA------------FVGDL--LKEL------
Q5ZRA6_LEGPH/16-86.KAH-LA---YH.LS.Y-----Y..S....NSEKKHV.N.APNYL..IDA------------NSGEI--LKQW------
Q87I51_VIBPA/131-204.VAH-LA---YE.IQ.F-----F..ADS.EQALNPTRPT..YL....VDA------------KSGEV--LLQY------
Q2FUX4_STAA8/118-192DSNK-YV---YN.VE.L-----I..T......VTPEISH..WKVK..IDA------------QTGEI--LEKM------
PRTA_LISMO/121-194.TKR-LV---YN.IK.L-----I..F......AEPEVAS..WIVQ..VDV------------ETGAI--LKK.------
Q97G52_CLOAB/161-230GVAT-TV---YS.VN.I-----H..Y......NDPDIAN..WEVL..IDA------------NSGKI--VRTL------
Q97G51_CLOAB/153-222ATAI-LV---YS.VN.I-----H..Y......TDPHIAN..WEVL..VDA------------KNGSV--IKIL------
Q97GS5_CLOAB/161-230.KNY-EV---FK.VN.I-----Y..Y.....TN.PTIGN..WDVF..VDI------------SSGKV--IKTE------
A5I1S2_CLOBH/148-212GKPY-VV---YL.VN.T-----M..T.........DSGN..WNVF..VNA------------EDGSI--VNK.------
Q81R73_BACAN/122-192GIAR-PV---YK.VV.V-----H..S.........NNPFGAWETF..IDA------------ENGKL--IKK.------
Q815U2_BACCR/146-219GNYY-LA---YL.VK.A-----S..I......SKPAPGYWHYF....VDA------------TNGNV--IEKY------
NPRB_BACSU/145-217GEYD-LA---YL.VR.L-----S..T......SEPEPGY..WHYF..IDA------------KNGKV--IES.------
Q8ESH1_OCEIH/143-217EADP-YI---YEYEDEF-----YFTYLVTASTTNPEVGF..WHYF..IDA------------KSGEV--IDHF------
B1YFR1_EXIS2/113-183.DAV-YA---YK.VT.S-----T..V.....LAGKEPSR..WTYF..IDA------------NSGKV--LNKY------
NPRM_BACMD/153-222SDTT-YA---YV.VN.L-----N..F.....LS.PEPGN..YYYF..VDA------------ISGKV--LDKY------
Q81I21_BACCR/151-220EETT-YA---YV.VN.L-----N..F.....L.DPSPGN..YYYF..IEA------------DSGKV--LNKY------
Q8DVN1_STRMU/57-120.DGV-TE---FE.VEFT-----K............DATE..YNYT..INA------------DTGKI--ISKE------
Q99YI6_STRP1/81-143.DGK-AV---YE.IE.F-----Q...........NKDQE..YSYT..IDA------------NSGDI--VEK.------
R6P3S5_9CLOT/179-241.DGR-LV---YE.VE.F-----Y..A.........NGTE..YDYD..IDQ------------ATGRI--LSS.------
Q8ESN0_OCEIH/32-90.DGE-PV---YQ.IE.V-----R..Q.........ENGS..YKVV..LDG------------NTGKV--LDIY------
A5G759_GEOUR/48-108.RGK-NV---YV.VEII-----E..........KSSGGE..VDVL..VDM------------KTGKV--LGTE------
O27358_METTH/81-143MDGK-LV---YV.VP.I-----E..M......GGKTVGE..IY....IDP------------MTGKN--LGGA------
Q8ERG4_OCEIH/132-194.DGV-AT---YE.IE.F-----E..N........DNQKD..VTVV..IDA------------KTGEQ--LTVE------
Q5WLC0_BACSK/58-117.RGT-WQ---YE.IQGL-----D............DEKE..YEII..VDA------------KTQEV--TKER------
Q82ZK1_ENTFA/63-122.FGR-YF---YE.IEGV-----D............QQKE..YQVE..VNA------------ETGEF--TKEK------
Q5FIK1_LACAC/43-101.NGR-YV---YE.IEGF-----S............STRE..YEMK..INA------------SSGKT--ISSH------
Q5FIK0_LACAC/62-121.GSQ-YI---YE.IEGF-----D............TTHK..YSAE..INA------------ETGHA--SSVH------
Q74JH3_LACJO/49-108.KNK-YI---YE.VEGF-----D............SEKE..YKVK..IDA------------SSGKI--LKAK------
Q8ERG4_OCEIH/56-114.NFE-YT---YE.IE..-----..........GFDDAKE..YKAE..IDL------------EK.NI--INQE------
Q186H8_PEPD6/62-121.LNK-FV---YT.VE..-----..........GVDDNNE..YKMK..IDA------------NTKDV--LEDK------
Q9KFU6_BACHD/49-108.NGR-VV---YE.IE.V-----K...........NDDDE..YDFK..IDQ------------QTGEI--LKEK------
Q8ESM9_OCEIH/39-97.DNQ-TH---YE.VEVI-----N............DDEE..YDLE..IDA------------ETGEI--IKEN------
A8AXQ2_STRGC/352-411.RDK-DN---YQ.IY.F-----S..H.........GQTV..HEVL..INA------------NNGKV--LKSK------
Q81R43_BACAN/43-101.DDK-GV---YE.IE.V-----E...........TNKGE..EEIY..INK------------KNGNI--IAEK------
Q8ELD0_OCEIH/32-90.DEE-NY---YE.IE.I-----E..S.........NDKE..YEFN..IDA------------TTGEA--LGQE------
Q4K807_PSEF5/38-102.TGA-YV---YQ.VE.L-----R..D........SKGIE..WDVD..LDA------------KTGKV--LSNK------
C1DJ09_AZOVD/39-99.YGR-YI---YQ.VELR-----D...........AQGLK..WDVH..LDA------------SNGQV--LKDH------
A4XTT8_PSEMY/39-99.YGR-YI---YQ.VDLR-----D...........AQGQQ..WDLE..LDA------------STGEI--LKNH------
Q0VNT9_ALCBS/52-112.YGR-YL---YQ.VELR-----D...........PQGVE..WELD..IDA------------SNGDV--LGEE------
Q0S7B7_RHOJR/138-198.DGK-TV---WH.IHIR-----D...........TKGWD..YDVN..VDA------------STGAV--LPDN------
Q5F637_NEIG1/47-105.DGR-PH---YD.VEIV-----K............NGQE..YKVV..VDA------------RTGRV--ISSR------
Q1ARP9_RUBXD/67-126.DGL-LA---YK.VQIL-----D...........REGTL..HDLQ..LDA------------RSGRV--LRHE------
Q9L126_STRCO/188-249.DQQ-VV---WG.VDVV-----D..........KSNWNK..TTVT..VDA------------ANGKV--LGQK------
Q9L2B8_STRCO/83-152RRER-AA---WE.VDVL-----A...........GDGTW..HSVR..VDP------------ATGKV--LGSE------
A9C057_DELAS/120-179.WGQ-TS---YQ.VEVL-----Q...........ANGTL..MEVK..IDA------------VGGEV--IRAK------
Q8RD03_CALS4/115-173.NGY-LV---YS.VEIK-----T............NSGV..VDVK..VDA------------GNGAV--LAQD------
A8FCD9_BACP2/110-169.NGV-YL---YE.VEIT-----T...........PNGEE..VDFE..ISA------------KTGKI--LKQE------
YKOJ_BACSU/108-167.DGA-YI---YE.MEIQ-----T...........KQGTE..TEFE..ISA------------KDGRI--IKQE------
Q8ESM9_OCEIH/119-177.DGK-YV---YE.IEVR-----D............GNKE..ADFE..IDA------------VTGNV--LEMD------
YKOI_BACSU/164-223.EGT-LI---FE.VD.V-----D..L........PDNKEATVK....INA------------YTGKV--ANIV------
A8FCD8_BACP2/167-226.SGM-LV---FE.VELD-----L...........PDGRE..AEVL..VNA------------YTGDI--EGIT------
Q5WKR9_BACSK/175-233.DGL-LV---YE.IEIE-----T............DREE..GTIV..VNA------------FTGAI--ESVA------
Q9KFU7_BACHD/111-170.NGL-HV---YE.IEIE-----V...........DDDTE..ATIV..MNA------------YTGQI--LSVT------
Q9KFU6_BACHD/130-191.NGS-LV---YE.VEIE-----S.........DHYDDDD..VTVY..VDA------------MTGNV--LYVE------
Q5WKR8_BACSK/122-181.DGQ-YV---YE.IEVE-----T...........SKNDE..TTID..IAA------------VSGEV--LEVE------
Q38Z32_LACSS/130-188.DGV-VY---WE.IE.G-----H..Q.........KHQK..MQVK..IDA------------TTGEV--VDTE------
Q2G105_STAA8/129-187.DGK-LV---YN.ID.L-----K...........KGNKK..QEVT..VDA------------KNGKV--LKSE------
Q5FIK0_LACAC/141-199.HGK-TY---WN.VEVG-----E............RYHS..SEVK..IDA------------HSKKV--ISVE------
Q82ZK1_ENTFA/146-205.LGI-TY---WE.VKVK-----E............GQQK..IEVK..IDA------------HSGKI--LTTE------
Q74LX8_LACJO/141-200.DGK-AI---WE.VTVE-----S............GSTK..HEVE..IDA------------SSKKV--IRSE------
Q5FIK1_LACAC/119-178.NSR-SV---WE.VTVT-----K............NGKK..SDVK..INA------------LTKKI--ISVE------
Q74JH3_LACJO/126-184.DQQ-PV---WK.VELK-----D............GNKE..TEVK..IDA------------KSQKI--LKTK------
Q186H8_PEPD6/144-202.LDV-TF---YK.IRID-----K............DKNE..YDIK..VDS------------KKGTV--LKVE------
Q5WLC0_BACSK/141-199.DQV-TY---YE.VTVT-----N............AGND..YDIK..LDA------------TNGEV--LGTD------
Q8R5X9_FUSNN/83-142.NKR-AY---YI.VEVK-----E............DKSE..KEIR..IDA------------NSGKV--IGIK------
B1HY97_LYSSC/168-225.AEG-GY---YL.VE.I-----E..T.......EHEEAT..FQ....IHA------------VSGKV--LSV.------
Q81R44_BACAN/99-158.NEI-EV---FV.IT.V-----E..T......NDKQSKV..VE....IEK------------TTGQI--QLLE------
Q0VNU0_ALCBS/63-123.DGQ-LI---YE.IELL-----T...........GDRVV..REIE..MDA------------RTGQV--LDDE------
Q3JBE9_NITOC/51-111.DGL-YV---YE.LEIL-----T...........PAGVV..HEIE..INA------------NNGQF--IEDE------
A4XTT9_PSEMY/41-101.DGI-LV---YE.VEIL-----T...........LQGVV..RELE..LDA------------RNGNI--LKDE------
Q0BZN8_HYPNA/53-112.DGY-LI---YE.IEVL-----T...........RRGTV..LEMD..VDA------------RTGRI--LDIE------
A1B2L4_PARDP/40-99.DGM-TI---YE.IELV-----T...........PDGRL..IEVE..IDA------------ASGRI--LALD------
Q9A8Q0_CAUCR/73-133.PGR-LK---YD.LKIL-----A...........KNGRV..RELE..LDA------------KTGAT--LKLE------
Q988S6_RHILO/46-105.ADR-WV---YR.FQ.V-----V..G........ADGRR..KTVD..VDA------------GAGAI--MRNG------
A4YY21_BRASO/40-99.RGR-WR---YE.FRVI-----G...........RDGRM..REVY..IDA------------RSGEI--ERVE------
Q2RPG4_RHORT/72-131.HDG-LV---YE.IT.L-----V..S........AGGRVTRLD....FDA------------ATGDL--IARR------
V6F502_9PROT/38-95.RGT-LV---YE.LK.V-----L..A........KDGRL..LKLY..YDA------------ATGEV--LKV.------
Q0AR59_MARMM/55-114.GAS-PR---YV.IKIL-----T...........RDGRR..VDVV..ADA------------RTGQI--LFER------
A8LN27_DINSH/31-89.LGA-LV---YE.IEIV-----S............DGTI..HEAV..IDA------------RSGEL--IELE------
A5VEY7_SPHWW/24-82.GGR-LV---YE.IDLV-----R............GQVL..HRAL..IDA------------RTGKL--VSAV------
Q8KFX7_CHLTE/45-103.GGQ-PV---YD.VE.V-----V..N.........GAKV..LDVR..VDK------------DNGRI--LAAN------
B4E758_BURCJ/39-96.KQG-WV---YD.VE.V-----V...........SGAKV..FDVR..VDA------------DKGTV--ISS.------
A9C057_DELAS/43-102.GMG-LR---YE.IEVI-----T...........PGGDS..VEVW..VNA------------ITGQA--.AQH------
E0TIH6_PARBH/43-102.DNA-LL---WT.VETM-----T..R.........DGAE..MEVE..IDA------------VSGAI--LEVE------
B0UCU3_METS4/66-129SNNP-AH---WE.IK.V-----V..Y........PDGKL..VEHY..INA------------DTGAL--IKSE------
A3QGG2_SHELP/47-105.NGN-PG---YR.AK.L-----L..S........KDGVV..FYVA..IDA------------VTGQM--.SRQ------
Q7P204_CHRVO/118-188NVAQ-LV---YL.VS.F-----V...V..DGK.EPSRPH..LI....IDA------------NSGQV--LKQW------
ELAS_PSEAE/122-192NIAQ-LV---YN.VS.Y-----L..I........PGEGLSRPHFV..IDA------------KTGEV--LDQW------
A1S2N2_SHEAM/113-188QEPR-LV---YI.TS.Y-----V...V..DGD.TPSRPF..TM....VDA------------HTGEV--LERW------
Q2SJ90_HAHCH/129-208EQAK-LV---YV.VN.Y-----F..SEATKGAPDPKRPF..FI....IDA------------HSGDV--IKTW------
B7VN56_VIBTL/116-190QVAQ-VV---YL.VDFF-----I..A.....SSMPERPF..YF....IDA------------TTGDV--IQKW------
F7YSQ2_VIBA7/118-194QMAQ-MV---YL.VD.F-----F..V....ATNEPARPF..FF....IDA------------NSGDV--LQTW------
HAPT_VIBCH/116-190QQAQ-LV---YL.VD.F-----F..V....ASETPSRPF..YF....ISA------------ETGEV--LDQW------
Q5ZZJ1_LEGPH/124-199NQLK-LV---YL.VS.F-----K..SV..QQDGKPDWPF..FV....IDA------------QTGAL--IKQW------
A1S4V2_SHEAM/92-162DAPR-LA---YR.VS.F-----L..SEGVNEISRPAGL.........VDA------------MTGEV--VRHW------
Q211C9_RHOPB/96-155.LDR-PA---YK.VKTL-----Q............GDHV..LEQS..VDA------------ETGAV--FGGE------
Q89L62_BRADU/85-144.SGV-PV---YR.VKTL-----H............NDRI..WRHT..INA------------ATGEF--VGGE------
A4YNR6_BRASO/46-105.LDV-PV---YK.VRTL-----R............SGQI..WEFD..IDC------------STAKV--LNSV------
Q6N7G2_RHOPA/56-115.AEG-LV---YR.VRAA-----R............DGQV..WESV..VSA------------ISGTV--LSDQ------
Q1H2G7_METFK/106-166.NGA-AS---YE.FDIK-----T...........KDGKE..FKVE..VDA------------STGKI--VEAN------
A2SEW0_METPP/117-177.DGT-PV---YE.FDIE-----Q...........DNGDD..VRVE..VDA------------VTGKL--REAH------
Q1H2G7_METFK/31-90.GET-PV---YE.FD.I-----E..S........SDSTA..WDVE..CDA------------NTGKI--VEIE------
A5N159_CLOK5/17-76.DGL-LV---YE.IH.I-----R..T........TNGMV..YEVT..IDA------------NTGEI--LEVD------
A7ZEI5_CAMC1/22-81.KGV-TF---YK.IESF-----K............DGVK..QEIK..IDA------------NSGQI--VKVE------
Q8DWU2_STRA5/78-136.GDT-PF---YE.IK.V-----I..D.........NKIA..KKYK..IDA------------NSGKI--LST.------

PF11396

A0M0Q0_GRAFK/54-143QNIL-SS---LK-SN.F-----PGY.EIEEVEISETSK..GSFYEFEIEKG..KIEMEVTLDSSGTI--IK--------
A0M1R1_GRAFK/70-160EAIK-KV---IK-EK.Y-----SDY.EITEVEHVISAKK.GEFYDVEFKQK..GKNKDVEFREDGTE--LN--------
A5FIF1_FLAJ1/58-140DNIK-AY---VA-KN.H-----PN....EKITHIDYGH...KDLDVDLTN.....KIDLEFTKDGKI--LK--------
A5FNS8_FLAJ1/62-144KKVA-SY---IK-EN.F-----PK....EKVTKIEIES...SGYETKLTN.....GLELKFSLKGDF--IK--------
A6L337_BACV8/61-143QAIS-KY---MK-AN.Y-----NG....HKTVKIERNR...KGYELTLEN.....GLEVDFDQFGGF--LK--------
A6L4L1_BACV8/60-142DAIK-KY---VA-TN.Y-----PD....AKMLKIERDK...HDYEVKLSN.....GWEIKFDMQFNV--ID--------
A6LDA3_PARD8/62-144EVIQ-DL---IK-KN.Y-----SS....NKVVKIEKEI...RDYEIKLDN.....GLEMTFDLKGNL--ID--------
A6LDA4_PARD8/55-146QTVK-NS---FE-ASLY-----AKW.KIDDVDMLERPDA.GTIYVLDVENG..EQDADLHYTEGGIL--IK--------
A6LDE6_PARD8/58-149AAVS-TA---FK-QSFY-----SNW.TVDDTYAINRLNM.GIVYKIEAEQS..NSEVDLYYSQYGNL--IK--------
C0QVH4_BRAHW/54-141KSMV-NV---ID-NE.Y-----PH....SKITDIERKD...KNFIIKLDD.....KYLIEISGYGII--IS--------
C0QYD0_BRAHW/35-117KKVL-NT---VK-KT.N-----PD....AAIIKIKKRW...NMYVISLDN.....YINIFIDFAGML--IG--------
C0R146_BRAHW/63-147SKIM-NI---IK-NK.Y-----T......SINNIYKRS...KGYEFKVDD.....AYYIYIDYDGNI--LK--------
C0R148_BRAHW/33-123KEII-KT---IK-NK.Y-----TD....FNIYRIIKRK...NKYEIEINS.....N.IIIIDIEGNI--LK--------
Q5L9Y2_BACFN/49-143ATVY-NA---YA-SGPY-----SGW.QVEDVTYVEFPKW.QPIIVIKVGQQNVDIQYQLFYSPNGTL--LR--------
Q5LD45_BACFN/83-177AAVA-KA---FM-QSTM-----ASM.QLEDVRIITFPKQ.PAVIVIEVEEYNTDTEFQLFYAPDGKL--LQ--------
Q7MWB3_PORGI/60-142APIL-RH---IS-SQ.Y-----PD....LYIVQIDRDS...RDYEVELNN.....GLELVFSLKGVF--KR--------
Q7MWB4_PORGI/55-145KAVR-AA---FE-ASEY-----AKW.KIEDIDKVERNGT.EIFYVIEVEKG..DQEVDLFYMPNGKL--IK--------
Q89YQ4_BACTN/58-150PAVY-TG---FR-NSNY-----SSW.VVTDVFVLTYPQH.PTESVIQVKQG..NLRFALYFSQEGGL--LH--------
Q89YQ5_BACTN/61-144SFAV-SY---LK-EHNF-----T.....EPVTKVERDR...KGYEVELST.....GVSFKFDKKGKF--LK--------
Q8A994_BACTN/60-142AAIQ-KY---VT-TN.Y-----PD....AKVLKIERDK...KDYEVKLSN.....RTELKFDLKFNL--ID--------
Q8YLV6_NOSS1/61-150PIVL-KR---IN-QERP-----G.Y.IITKY.EIEITPN.GMFYEVDITDG..ELEEELYLDSQGNL--QT--------
C7M630_CAPOD/59-141EKIL-AH---VR-AT.F-----PF....ESIKEVSRNLS.KKKYEAELTD.....DQELKFDDKFNF--I.--------
D6D2V5_9BACE/45-136PAVY-TA---FI-DSKY-----NAW.VVTDVYVLTFPQN.PMESVIQVKQG..SQRYSLYFTQDGGL--IH--------
D6D5W5_9BACE/49-143PAVY-NA---FV-SGPY-----ASW.VVDNVTMVEFPKW.QAIIVIKVGQDNVDIKYQLFYTPQGVL--LK--------
D6D6Q4_9BACE/56-146QAVK-TS---FE-KSEY-----ASW.KQDDVDKLERTGV.ETIFVIEVENQ..NQEIDLYYSADGTL--IK--------
Q0P802_CAMJE/53-133N.VM-KK---VS-AT.Q-----PN....AQILEVDKEI...NGYKFKFNN.....NMEVYTDMQGNI--L.--------
Q0P9P8_CAMJE/51-132QNLA-NI---IK-NE.F-----PN....TKAREIERKI...NHYKIKLDN.....DIKILIDFNGTI--L.--------
Q5LBR7_BACFN/55-146AAVK-SA---FE-SSEY-----AKW.KVDDVDMLERPDM.EKVYVIEVESG..KQEFDLYYSEEGIL--VK--------
Q5LBR8_BACFN/60-141SPIQ-KY---TA-TN.Y-----PD....AKVLKIERDK...TDYEVKLSN.....GWELKFDSKFNL--I.--------
Q5LG06_BACFN/60-151PAVL-TA---FM-ESSY-----NNW.VVDDVVILEYPNEPSTEFVVTVEQG...KKVDLYFSEGGGL--LH--------
Q5LG07_BACFN/61-143DFVK-EY---MK-ANGY-----HS....EFVTQIERDR...KGYEVELNT.....DLSLKFTKDGKF--R.--------
Q5LIE1_BACFN/72-153GKII-EY---VQ-QL.F-----PD....DPFIGIENAC...YGDCVLLSS.....GKKIAFYYDGTC--I.--------
R5U7Q0_9BACE/57-144DPVK-NT---IH-AT.Y-----PGRVDDDDTEYVEEATG.VTYYLIDIEN....SEIDVKIRADGQI--L.--------
R6WQR9_9PORP/57-147DAVK-TA---FQ-QGEY-----STW.KVDDVDMIERRDV.ETVYVIETEQG..NSEVDLYYSPDGIL--VK--------
R6X3F2_9PORP/60-141EAIL-RY---VK-AT.Y-----PD....HKVVKIEKED...RGYEAKLAN.....GMKLEFDNKFNL--I.--------
R6XCT8_9PORP/59-150TAIS-ND---IK-QGKY-----AGW.KIEEADTIGRAGM.GTVYKVEVEKA..EQETDLYYTLYGDL--IK--------
R7EFG1_9BACE/61-142VPVK-EY---VK-AN.F-----PR....EIITKIERGR...TGVEIELGN.....DYSLKFNKKGKF--V.--------
R7EJJ2_9BACE/58-149GTVQ-TS---FS-ASEY-----AGW.KIEEIVLLEYPVV.PMQFVIEVEKG..NAEYQLFYSEEGGL--LQ--------
R7EKK7_9BACE/52-145APVA-EA---FM-SSTM-----TGM.RLRDIRIITFPKH.PTVIIIEVEQYNSDEEFQLFYAPDGKL--LQ--------
R7ELA9_9BACE/58-149APVR-SS---YE-SSTY-----YNVWKVEDVDKLERKEM.AVVYIIEVEKG..NQEMDLYYSEDGIL--VK--------
R7ERW1_9BACE/60-141EAIR-NY---VK-TN.Y-----PD....ARILQIEYDD...NEYEIKLSN.....RWEITFDSKMRV--I.--------
R7JJR5_9BACT/78-154AQIA-DY---VA-RN.F-----PG....TFLVGIEHTC...REWEVKLNN.....TIELTFDDK...--..--------

PF11399

K7AKJ7_9ALTE/17-119GDDT.YQVLYFR-TQRI-----DED--------GVTTK--NECTP--LVF------------KNSVL..VGWGESAYDA
F5Z4M1_ALTSS/22-120NENA.IQVMFYR-TQHV-----RAD--------GLTTQ--DECTP--LLF------------ENEKL..IAWGDGAYSS
E1SS82_FERBD/33-127HDGHGIQVLRYR-THRT-----KGD--------GETTP--DETTP--LLF------------RDGVL..FGWGETAFEQ
Q8EGJ0_SHEON/23-131ADKE.VLVLFYR-TQRS-----HSD--------GKTTK--DECTP--VVL------------SNHVL..MGWGDTAYNK
A1S8B9_SHEAM/20-120KDSA.LQVLFYR-THHE-----KSD--------GVTTK--DECTP--LLF------------KDNQL..IAWGSDTYKQ
K7AKJ0_9ALTE/22-120DDKE.LQVMFYR-TQHR-----QAD--------GITTE--DECTA--LFF------------ENNEL..IAWGDSAYQS
A3QGB8_SHELP/19-122QDKT.INVLYYR-TQRT-----RED--------GTTTK--DECTP--IVI------------TDNRV..VGWGEKAYHN
Q15QZ2_PSEA6/17-119GDDQ.YHVLYYR-TQRK-----DDD--------GVTTK--DECTP--LVI------------KNDQL..VGWGDSALNM
Q07ZE7_SHEFN/20-120IDGQ.YQVMYYR-THHI-----KSD--------GETTK--EECTP--LLF------------RDNLL..IAWGQDTEDQ
Q47YB6_COLP3/19-119GDNT.VRVLYYR-TQRK-----HKD--------GLTTK--DECTF--LQF------------INGQL..VETGNGG...
B8CS66_SHEPW/20-120NQQN.LQILFYR-THHK-----ESD--------GETTK--EECTP--LLF------------KQGSL..VAWGEDTYQQ
Q8EGQ0_SHEON/20-120KDGQ.LQVLFYR-TQHD-----KSD--------GVTTK--EECTP--LMF------------KDNKL..VAWGNDTYKQ
D4ZHG3_SHEVD/20-120GDDA.LQVLFYR-THHA-----QSD--------GKTTR--DECTP--LLF------------KNQQL..IAWGSDTYDQ
D4ZHN7_SHEVD/34-137KDKE.VHVLFYR-TQRI-----KGD--------GKTTK--DECTP--VVI------------SNNAV..IGWGNMAYKN
E1STL4_FERBD/20-123QEDQ.VQVLYYR-THRT-----RGD--------SKTTK--DECTP--IVL------------TNGAV..TGWGNTALEN
Q47YA7_COLP3/20-123DKIN.YQVMFYR-TQHV-----KSD--------GITTQ--DECTF--LLF------------VNGTLKEIGLGNNYPEQ
Q085F9_SHEFN/19-126AEQS.IKVLFYR-TQWA-----EGD--------GKTTK--DECTP--IVF------------RDDVL..VGWGDTAYRQ
Q15QY7_PSEA6/21-120DGGM.YQVMFFR-TQHV-----KSD--------GITTQ--DECTA--LLL------------QNDEL..IAWGDSAYQD
Q12P24_SHEDO/19-126AEQQ.VQVFFYR-TQWS-----KGD--------GKTTK--DECTP--VVL------------RNNKL..IGWGDAAYKM
B8CQA1_SHEPW/19-122QDKE.VHVLFYR-TQRL-----KGD--------GKTTK--DECTP--VVI------------SNNIL..VGWGEMAYSK
Q5QW11_IDILO/20-120SEGD.MQVLFYR-THHV-----TSD--------GITTK--DECTP--LVF------------RDNKL..IAWGNDSYRD
Q3ICC6_PSEHT/21-122EDQV.WQIVFYR-TQHK-----TSD--------GITTI--DECTG--LLF------------KNGQL..ILWGPSAYDQ
G4QLZ6_GLANF/37-143NGDA.VQVLYYR-TQRV-----DDD--------GITTK--NECTP--LVF------------VNDEL..KGWGELSLSK
Q12L38_SHEDO/26-125TGTA.LQIMYYR-THHI-----KGD--------GITTK--DECTP--LLF------------DNEKL..IAWGPDTYQQ
F2GBX8_ALTMD/17-118QDGT.YRVLYYR-TQKT-----MGD--------GITTK--DECTP--LVF------------RNSEL..VGWGDSAYS.
A3QGM5_SHELP/20-120NQDT.LQVLFYR-THHS-----KSD--------GETTR--DECTP--LLF------------KNNKL..IAWGQDTYQQ
A1S4M5_SHEAM/18-116DGKE.VQVFFYR-THRL-----HGD--------GSTTK--EECTP--VVL------------HDNRL..VGWGETAYR.

PF04355

Q5NL78_ZYMMO/17-93PN.V-WY.YIST-DTKQLVFSLPKA...........YK..QNVLA--VHF------------DPRGN--VSRVE-----
Q5LQJ9_RUEPO/35-111ES.G-YY.YVAS-RMR......HYGARA.....PQVVS..RELVA--ISF------------DQRGV--VRNIE-----
Q1LSR9_BAUCH/37-105...T-WY.YIDR-CKIN.....HQH...........LT..QKRVI--LTF------------NKSDI--LTNLD-----
Q1LBA9_RALME/75-149VR.E-WD.YLFN-FRTG.....RAA..........PNDVVQCQMK--VVF------------DKNEK--TRAYY-----
A5WGN5_PSYWF/35-114PN.R-WD.YIYD-YKPG.....TYGKREG..KQIIKNA..SQHLI--IYF------------DDADT--VIKVE-----
Q9CJV5_PASMU/34-104QS.K-WY.YVFL-QQKA.....YQK...........PE..QHTLV--VNF------------DQRGI--VTSFD-----
BAME_PSYIN/35-104SS.K-WY.YIRY-IKPG.....GEP...........IQ..QDKVV--FTF------------DN.LL--LTDIA-----
Q220P9_RHOFT/38-108AD.R-WD.YVFT-FKRQ.....GLA...........PQ..ARKVT--VFF------------KDDAL--ERIEA-----
BAME_NEIMB/36-106TD.R-WD.YTFN-TSRN.....GII...........KE..RSNLT--VYF------------ENGVL--VRTEG-----
Q5NEF6_FRATT/34-106PN.Q-YV.YINT-YKRN.....MQD...........TQFSESKLI--LTF------------NNQDR--LIGIS-----
BAME_VIBF1/35-105PN.T-WY.YIYH-FTHG.....HEK...........SI..QKNLI--VHF------------DDNGN--LTNME-----
A6VMF3_ACTSZ/34-104TQ.T-WY.YVYL-QQRA.....YET...........PE..QHTLT--VNF------------NQAGN--VTDFN-----
Q7VRQ4_BLOFL/39-110SN.T-WY.YVYH-KCYS.....SKL...........LD..YRTII--LQF------------DSHDK--LITLK-----
BAME_NITEU/35-105GD.R-WD.YIYR-TAPG.....GRV...........AE..EKKLT--VFF------------QDDRL--SHIQG-----
Q0C315_HYPNA/29-105TN.I-WF.YYSD-IQE......RFAFYR.....PKVVE..RSIIA--ISF------------SEDDA--VDEVV-----
Q47XI1_COLP3/29-101ND.T-WN.YVYK-LKSG.....RSK...........DFDMKKQFI--INF------------SNDKL--VSASG-----
Q47HJ0_DECAR/36-107QQ.R-WD.YVYR-YQNG.....QTG..........VVE..SRKFA--VFF------------DTEGR--LERVD-----
Q5FUN3_GLUOX/45-121DN.T-WI.YVSM-ITS......PTPLTF.....PSVKK..QQVVV--LNF------------DNGGV--LRKMD-----
Q2SMN2_HAHCH/93-162PS.Y-DT.YFYS-IQLS.....GGK...........IY..RQNIT--LEY------------ENDIL--VN.IA-----
Q0A7D7_ALKEH/37-107TD.R-WD.YVYT-MRPG.....GGS...........ME..KKRMT--LRF------------EDGRL--VDISG-----
A1AX05_RUTMC/37-107NN.Q-WD.YINY-STLH.....KKD...........NI..HYRLV--LKF------------NDDIL--VHINT-----
Q3SSS7_NITWN/53-129GE.V-FY.YISQ-RAER.....KVAFMP.....QKVID..QRVIA--IYF------------DNNRQ--VTRLA-----
Q2RTT3_RHORT/36-112GE.T-WF.YISN-ETT......QVAFFK.....PKELE..RTIIA--VHF------------DDNGR--VKGID-----
Q2NRT5_SODGM/28-97ARGT-CDSYVLG-NRNG.....K.................PINYF--VSY------------DETGK--VLNKG-----
A4VII8_PSEU5/29-97VPGL-CHDYILN-RDGK.......................QQPYY--VSF------------DSAGR--VDGQG-----
A7I1H3_CAMHC/52-124VV.E-WD.YLFN-LKEK.....AAD............KDMICQYK--IVY------------DFDTY--KAASI-----
Q604C4_METCA/51-121DD.R-WD.YVYS-NQPG.....GEE...........RV..QRRIS--LLF------------DHDEL--VGLQG-----
B0UR41_METS4/34-110NK.S-WY.YISQ-NTKR.....TVMFLG.....ERAES..QRVLA--VYF------------NQGFK--VERVA-----
Q15V54_PSEA6/31-104HD.T-WY.YLYQ-MKRGM..AKRGK...........DF..RKELT--LHF------------VDNRV--SEVTG-----
Q31FS2_THICR/36-107PY.H-WE.YVFY-TTDPD..FHPDA...............VRHLV--VNF------------DSEQY--LDNWK-----
A1WGT8_VEREI/51-121AD.R-WE.YVFT-LKRP.....GEE...........LQ..ARKLT--VFF------------KGDVL--DRSEG-----
A4SVD7_POLSQ/67-138AN.R-WD.YVFE-FKRA.....GKR..........VGD..ERHVT--VFF------------DGDKV--VKFEG-----
Q2NRZ9_SODGM/35-105SN.T-WY.YIFR-REPG.....HEA...........VS..QQTLT--LTF------------NSSDI--LTHID-----
A1WCQ4_ACISJ/49-119SD.R-WE.YVFT-LKRP.....DFE...........VQ..TRKLT--VFF------------KDNVM--ERVEG-----
Q1LMT9_RALME/71-142AD.R-WD.YVFT-FRRG.....RRD..........IVQ..QRRLT--AYF------------AGDRL--LRFDS-----
Q6FDQ3_ACIAD/30-107PL.R-WD.YIYN-YIPG.....TYAKKA....KIPAAH..GQHLK--IYF------------NESGI--VKSIE-----
Q7CZT7_AGRFC/48-124NE.V-FY.YISQ-KRVR.....RAAFLK.....PSLVE..QNILA--IYF------------NKDGV--IERKA-----
Q0K704_CUPNH/51-122AN.R-WD.YVFS-FRRG.....NTP..........VVQ..QRRFT--VFF------------EGDRL--VKFSG-----
Q21H32_SACD2/36-106TD.R-WD.YLFM-VKRG.....GEV...........LV..DRRFT--VYF------------DGDSL--AKWET-----
Q83C32_COXBU/30-100DN.R-LV.YVYI-FKKG.....HHK...........MH..STRLI--VYL------------RDNRV--VSFWT-----
A8GGW6_SERP5/28-97AQGT-CDTYAVA-PRDG.....K.................VQTYF--VSY------------SDTGH--VMNKG-----
A5FV68_ACICJ/239-315DH.D-WL.YVSQ-VTK......PRIGQT.....LGVEK..QQVVV--LDF------------TGNGV--LKSIR-----
Q3SJS3_THIDA/32-102GD.R-WD.YVYV-YYKA.....GKL...........AE..QKRIT--LHF------------DGDTL--ARIEG-----
A0KI84_AERHH/30-100PN.T-WY.YLYE-FQPG.....RGE...........KE..RKELT--LTF------------ANDRL--ATVTG-----
Q3IE33_PSEHT/35-105NN.T-WR.YVYS-FNKG.....RSN...........EQ..YKSLV--INF------------ENEKL--ASISG-----
A6W2D6_MARMS/31-103PN.E-WH.YLYT-VLYA.....TPDT........QKSD..ANDLV--LIF------------.SDGV--LTQIK-----
Q2G501_NOVAD/31-107KQ.T-WY.YVAM-NTK......QKPFNR.....PKTDN..QSILV--VDF------------DARGN--VSSLT-----
A7HX93_PARL1/37-112GE.A-WY.YISS-KFE......TVAFYR.....PQEVE..RTVAA--VYF------------DETQS--VQQIA-----
Q983A2_RHILO/103-179NE.A-FY.YISQ-TRKR.....YVAFDK.....PRLVD..QKVLA--VYF------------GADGR--VTQIA-----
Q7NX33_CHRVO/32-104AD.R-WD.YKYS-DAKG.....G.KV........DPST..DKLLT--IHF------------KGDAL--DRVEG-----
Q2YBT7_NITMU/31-101EN.R-WD.YLYR-FEQR.....GKL...........IE..QRKLT--IFF------------EDDHL--VRIDG-----
A2SC95_METPP/48-118AD.R-WD.YVFT-IRRP.....GAA...........YQ..QRRVT--VLF------------DGDTM--KSFEA-----
A1K8N9_AZOSB/69-139SN.R-WD.YVYR-FKPG.....NGE...........PE..QRVFS--VFF------------VDDKL--DHVEG-----
A7INK8_XANP2/42-117GE.A-FF.YISQ-TAQ......KVAFLK.....PEITE..QKVLA--IYF------------DKNKR--VSRVA-----
Q1QSW6_CHRSD/33-103ED.R-WD.YVFY-LDEA.....YDD...........VE..EKRVT--LTF------------QNGRL--ADIDR-----
Q1H393_METFK/54-124RD.R-WD.YFYQ-MRKG.....GKV...........IE..QRRII--MEF------------ENDAL--KRVRG-----
A3MZE6_ACTP2/34-104QD.R-WS.YVYI-KREG.....YND...........PI..QHTLF--VNF------------DSKGL--VSNIT-----
B0T0T5_CAUSK/29-105QN.A-WY.YISQ-TTD......RVAFYK.....PRVIK..RDVVA--IKF------------NPADE--KVASI-----
A1WX37_HALHL/38-106DD.R-WD.YLYE-RRGS.....QEA...............RKRLT--LHF------------DGDEL--VEIED-----
Q11J87_CHESB/48-124NE.V-FY.YISQ-KRVR.....GAAFMN.....AKLVD..QQVLA--VYF------------GPDQR--VTQIA-----
A4XUA2_PSEMY/28-96SGST-CNNYVLN-VDGH.......................EQPYY--VNF------------DVNGR--VDSKG-----
Q28RF7_JANSC/34-109DE.A-WF.YTQY-RVR......NFTYNA.....PDVIE..RDIVA--ISF------------SDAGR--VTNIE-----
Q5QXM4_IDILO/32-102SD.R-WV.YLYK-MDPN.....SGE...........DY..RKELV--LTF------------NDKRL--QDFKG-----
BAME_BUCAI/32-101DI.Y-HY.YLSD-SKNNN..VYP.................KKMLN--LYF------------KDNKV--FKFNM-----
Q0BTE4_GRABC/35-111NN.Q-WV.YITQ-TTE......MQIAGT.....NDILQ..QNVVT--VSF------------DQNGV--LKNIK-----
Q2NDV7_ERYLH/16-92EP.T-WY.YVSS-VTG......RRPFVR.....PRIRT..HQVLA--VRF------------DQAGN--VIATD-----
Q122Q0_POLSJ/29-99AD.R-WD.YVFT-LKRQ.....GVD...........SQ..TYKYT--VFF------------NGDQL--ERFAG-----
Q3JBU9_NITOC/42-112PD.R-WY.YIYS-FKPG.....NER...........RK..QRTIT--MWF------------EEGKL--SYVGG-----
Q7VM11_HAEDU/34-104LE.R-WN.YVFI-KREG.....YND...........PV..QHTLF--IYF------------DKNGL--VKDIQ-----
Q6D4H9_PECAS/28-96AKGT-CSDYLLK-NRDG.....T.................AQNYF--VSY------------NDTGN--VLNKG-----
A5V7M5_SPHWW/32-109KERT-WY.YVAR-DTR......QVGYRT.....PKAVS..QTVLA--VHF------------DDKGN--VASVE-----
Q1GPC4_SPHAL/37-113TG.E-YY.YVSR-ETR......QLAFAK.....PRPIA..QQVLR--IRF------------DAAGN--VAAVD-----
Q0VSU2_ALCBS/35-105PD.L-WL.YPMT-YRPG.....KGD...........KV..SQNIA--VYF------------EDGAY--RRYEG-----
B0UU40_HISS2/52-121VR.E-WD.YAFN-YREN......GE...........HK..ICQYK--ILF------------DKNMN--AQNF.-----
B0UV53_HISS2/34-103NQ.T-WY.YVFL-QQKS.....YNA...........PE..QHTFI--VNF------------DRRGI--VTDV.-----
B7VJW3_VIBTL/77-145PD.T-WY.YIYH-HQKG.....HND...........PI..QKNLV--VNF------------DATGT--LVT..-----
C1DFM7_AZOVD/35-101PD.R-WD.YLYS-IKPG.....GGQ...........RL..QERVS--LVF------------DTNDL--L....-----
D4Z6S0_SPHJU/63-138DQ.D-WY.YVSR-DMRSLAFSSPKP...........VS..QTVLH--VRF------------DAAGN--VVAV.-----
M1FIJ3_9ALTE/29-96TS.R-EY.YVYT-FQRA.....GGD...........IE..EQRII--VYY------------DDDRF--SR...-----
M9X398_MANHA/34-103TH.R-WD.YVFI-KREG.....YKD...........PE..QRNLF--IYF------------DAKGL--VSKI.-----
BAME_VIBCH/35-104PD.T-WY.YIYH-HTQG.....HND...........PV..QKNLI--VKF------------NDGGK--LVNV.-----
BAME_HAEIN/34-103SQ.T-WY.YVFL-QQRA.....YET...........PV..QHTFT--VKF------------DQRGI--VTET.-----
Q2KA05_RHIEC/31-105GE.V-FY.YISQ-RRTR.....AVAFQK.....LKVVD..QSVLA--IYF------------DKDGV--VTR..-----
Q2YNC3_BRUA2/49-124NE.V-FY.YISQ-KRYR.....AAQFMK.....PKVIE..RQILA--IYF------------NKDGK--VEHI.-----
Q3J361_RHOS4/40-116DS.G-WY.YVQS-RYRH.....YGARE......PQEVD..RQVVA--ITF------------NPTGT--VRNIE-----
BAME_PSYA2/52-130PN.R-WD.YIYD-YQAG.....TEARRKG..IADVKNA..SQHLK--VYF------------DNNGI--VTGI.-----
Q5ZYK0_LEGPH/42-110ND.R-WD.YAYT-WRRG.....KGN...........LE..IRNVV--LYF------------SRGSL--VKI..-----
Q63LV3_BURPS/48-120VH.V-WN.YVFN-FRTG.....PGAS.........DVV..TCQYQ--IQY------------DKHYR--VKST.-----
Q63QT2_BURPS/54-121AD.R-WD.YLFY-FKRG.....STS..........VVQ..QRDLV--VNF------------AGDRL--A....-----
Q6LUB1_PHOPR/34-102PD.T-WY.YVYY-QQPG.....HEE...........SV..QKNLI--LAF------------DAQNK--LTG..-----
Q79GM4_BORPE/42-111AD.R-WD.YPYY-FKPG.....YGK...........AQ..ERQFT--VWF------------ENDHL--VRWS.-----
BAME_YERPE/38-107TQ.T-WF.YVFR-QQPG.....HEK...........IT..QQTLT--LTF------------DSSGV--LTDI.-----
BAME_SALTY/35-104TN.T-WF.YVFR-QQPG.....HEN...........VT..QQTLT--LTF------------NSSGV--LTNI.-----
Q87RX9_VIBPA/35-104PN.T-WY.YIYH-HTPG.....HGD...........PV..QKDLV--VNF------------NDQGT--LADI.-----
Q87VN2_PSESM/31-98TG.T-CNNYVMN-KDGH.......................KQVYH--VSF------------NSDGR--VTNKG-----
Q88DH0_PSEPK/30-95GG.T-CNDYILN-HDGK.......................QQPYY--VRF------------DATGH--VDAK.-----
Q88DT8_PSEPK/35-101TN.R-WD.YLYS-LQPG.....GGK...........RQ..QERMS--VFF------------NESDQ--L....-----
BAME_SHEON/38-105DD.T-WY.YVYH-YKSG.....RDA..........SIT..HKELI--LHF------------TGNKL--S....-----
BAME_XANCP/28-99AQ.R-WD.YTST-QRVD.....RLA..........RTD..VKNFT--VFF------------ENEQV--VRWEG-----
Q8XVT1_RALSO/61-130GN.R-WD.YVFS-FKRG.....NTN..........VVQ..ERKLT--VWF------------EADRL--AKW..-----
Q92KF5_RHIME/42-116NE.V-FY.YISQ-TRKR.....PVAFMK.....PKIID..QSILA--VYF------------DKEGT--VSQ..-----
Q9HUT7_PSEAE/31-97PG.S-CNSYILN-KDGQ.......................QQPFY--VSF------------DGSGK--VDGS.-----
Q9JXT1_NEIMB/52-133VR.E-WD.YLFH-FHTP.....GVGIDPENTSGVEDVT..TCQYK--VIF------------DKDKF--ARSF.-----
Q9PB00_XYLFA/44-114TD.R-WD.YTSA-QRID.....RIA..........HTE..IKNLT--IYF------------QNDLV--TRWE.-----
V6F1L4_9PROT/28-103DE.S-WQ.YISA-VFE......TTAFFK.....PELKD..RKVVS--VNF------------DMAGI--VKTV.-----

PF12978

Q8DTX1_STRMU/47-205DKEEMQTVWSSG-IKTK-------------------SS--SATIE--LYF------------ENGLLKNKTQKDL----
B9DSB0_STRU0/47-205DKSQLQAIWVSG-LKTK-------------------TR--GSHIS--LLF------------ENDQLIEMSQTGL----
G2SNY8_LACRR/70-224GETTLNATWVTG-TKGG-------------------..--..TAT--LTF------------ENGGMTSKTQVDL----
Q8DZF2_STRA5/47-206DKEELQAAWISG-IQSS-------------------DS--DPGIN--LTF------------ENDKLTNKQQHGL----
Q99ZC4_STRP1/47-204DHQTLQAIWVSG-LKTD-------------------TS--GANIS--LVF------------ENNQLTEMSQVGL----

PF07467

Q9KJ90_STREX/2-185DSCVSQGESYPN-WPAKTGF--EEKYYC.....AAATGLFPPSAS--FHL------------TDGVLTYRYQRSL----
B5GLC0_STRC2/2-181DTCSALAEQYPN-WPATNGN--LREYVC.....PSKAERFAPSAY--FTF------------TDGKLTSRSQSQL----
BLIP_STRCL/10-200GSCTTWSEYYPA-YPSTAGV--TLSLSCFDVDGYSSTGFYRGSAH--LWF------------TDGVLQGKRQWDL----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window