Sequence alignment for CL0320

PF13670

Q0BXA6_HYPNA/7-95------------------------------------------------------------------------ASL--ALL
Q0BXA5_HYPNA/6-84------------------------------------------------------------------------AAL--IAI
A3WRM0_9BRAD/6-83------------------------------------------------------------------------VSL--AAA
Q0BY17_HYPNA/6-92------------------------------------------------------------------------TGL--MAL
A4VHV2_PSEU5/30-109------------------------------------------------------------------------LTA--AFA
A4XVH9_PSEMY/6-85------------------------------------------------------------------------LTT--LLA
Q3KD49_PSEPF/7-87------------------------------------------------------------------------AAC--VAT
B1ZL54_METPB/14-93------------------------------------------------------------------------VAR--LAA
C7CAP4_METED/4-84------------------------------------------------------------------------LKT--LAA
A3WVM1_9BRAD/4-83------------------------------------------------------------------------RFA--AVA
Q1QMT6_NITHX/5-85------------------------------------------------------------------------HVA--VAT
Q07QG0_RHOP5/5-84------------------------------------------------------------------------MSA--ALA
B8EKV5_METSB/3-81------------------------------------------------------------------------RTI--LLA
Q3BZQ4_XANC5/7-87------------------------------------------------------------------------KTA--LIG
D8JU49_HYPDA/7-90------------------------------------------------------------------------LPA--IAM
Q0FJR3_9RHOB/4-79------------------------------------------------------------------------SIA--AAL
B6B6G1_9RHOB/5-81------------------------------------------------------------------------LKL--LAL
A3X8K5_9RHOB/6-81------------------------------------------------------------------------VQI--LAL
A4F198_9RHOB/68-143------------------------------------------------------------------------FSL--LAL
B9QWG8_9RHOB/19-97------------------------------------------------------------------------GAA--LGT
Q5LX53_SILPO/50-129------------------------------------------------------------------------PFA--LIA
A3JXM1_9RHOB/4-83------------------------------------------------------------------------HLV--LAL
B1G434_9BURK/9-91------------------------------------------------------------------------CAA--VAV
B8IVF4_METNO/5-90------------------------------------------------------------------------IMA--SAL
A5EBJ8_BRASB/4-90------------------------------------------------------------------------IRI--MVV
Q1I4X8_PSEE4/3-87------------------------------------------------------------------------RTL--ILP
B3PI60_CELJU/2-85------------------------------------------------------------------------RKL--LFI
C1DNM7_AZOVD/2-85------------------------------------------------------------------------RKI--ILL
A3WIS1_9GAMM/4-89------------------------------------------------------------------------SIA--VAS
Q1LBN9_RALME/3-85------------------------------------------------------------------------KIA--AFL
Q46SM0_CUPPJ/3-85------------------------------------------------------------------------KIL--AFA
Q8XWW7_RALSO/3-85------------------------------------------------------------------------KLT--LAV
B9YYZ8_9NEIS/4-86------------------------------------------------------------------------LVL--TAL
A1K227_AZOSB/5-88------------------------------------------------------------------------SAF--VVL
Q5P431_AROAE/5-88------------------------------------------------------------------------NAL--LAV
Q5P432_AROAE/18-101------------------------------------------------------------------------HLI--VAA
D0KWU4_HALNC/5-88------------------------------------------------------------------------YFF--IGL
B0SVT0_CAUSK/5-90------------------------------------------------------------------------LIS--ATI
B3PS83_RHIE6/3-88------------------------------------------------------------------------MLK--AII
A7IQ54_XANP2/6-90------------------------------------------------------------------------LLT--TAA
Q8D5M1_VIBVU/5-90------------------------------------------------------------------------LLL--TTI
D2YV68_VIBMI/5-91------------------------------------------------------------------------SVS--RLF
B1Y4P0_LEPCP/3-85------------------------------------------------------------------------TFA--AAA
B8IVE9_METNO/4-91------------------------------------------------------------------------LTM--IAA
Q07GW2_RHOP5/24-110------------------------------------------------------------------------IVL--LTA
Q1QM54_NITHX/4-90------------------------------------------------------------------------IAI--LTI
A9DGE5_9RHIZ/5-87------------------------------------------------------------------------LII--ATL
C9X3G7_NEIM8/6-91------------------------------------------------------------------------LAA--VVS
C5TKZ2_NEIFL/6-91------------------------------------------------------------------------LTA--IVA
B6BXY0_9GAMM/6-84------------------------------------------------------------------------IIS--IVS
B4X0R3_9GAMM/21-99------------------------------------------------------------------------LVV--MVG
Q2C6V1_9GAMM/7-89------------------------------------------------------------------------VLS--VST
A1B769_PARDP/5-86------------------------------------------------------------------------LTI--LTF
A3W5R2_9RHOB/5-86------------------------------------------------------------------------LTI--LSF
A6FVG6_9RHOB/5-86------------------------------------------------------------------------LTI--LGF
A6FVG8_9RHOB/5-87------------------------------------------------------------------------LIA--LTL
A1B772_PARDP/5-86------------------------------------------------------------------------LIA--VAA
A1UW16_BURMS/12-98------------------------------------------------------------------------LAA--LAS
Q46QS0_CUPPJ/12-98------------------------------------------------------------------------GLA--LTM
Q1MGZ9_RHIL3/5-86------------------------------------------------------------------------TLP--ILA
B6JDT2_OLICO/6-87------------------------------------------------------------------------VAA--SLL
A5VTX2_BRUO2/5-87------------------------------------------------------------------------ILM--TAL
A1U059_MARAV/5-86------------------------------------------------------------------------PII--LSL
A1SRM1_PSYIN/5-86------------------------------------------------------------------------GLK--IFT
C8RZP8_9RHOB/6-87------------------------------------------------------------------------LVA--GVL
A6UM17_SINMW/4-85------------------------------------------------------------------------III--ALS
B9K2Y3_AGRVS/4-85------------------------------------------------------------------------VLI--ALS
A7IKT6_XANP2/6-87------------------------------------------------------------------------AAT--LVF
A1B771_PARDP/5-86------------------------------------------------------------------------LTA--TAF
B2S782_BRUA1/5-86------------------------------------------------------------------------ITA--AAL
Q0AG96_NITEC/6-89------------------------------------------------------------------------GAA--IFT
A6T0P1_JANMA/11-102------------------------------------------------------------------------VIA--IIA
Q0S079_RHOSR/10-95------------------------------------------------------------------------AAA--VGV
D0DC31_9RHOB/4-83------------------------------------------------------------------------LAI--GLV
A8LNS6_DINSH/4-81------------------------------------------------------------------------ILA--FTA
A3PJ37_RHOS1/4-81------------------------------------------------------------------------LAT--LAI
Q0G655_9RHIZ/24-110------------------------------------------------------------------------MKR--LLL
D8JXS4_HYPDA/4-89------------------------------------------------------------------------VSR--FAR
D8JRG1_HYPDA/7-86------------------------------------------------------------------------ASA--IFA
A5VRY8_BRUO2/10-90------------------------------------------------------------------------AGA--AMF
B1ZIF7_METPB/6-84------------------------------------------------------------------------LAA--ALL
B1M6N2_METRJ/3-84------------------------------------------------------------------------LTT--TLL
A7HVA0_PARL1/7-87------------------------------------------------------------------------AAA--LLL

PF03413

Q4K807_PSEF5/38-102------------------------------------------------------------------------IMD..LEK
Q8D7W4_VIBVU/128-189------------------------------------------------------------------------KLK..AET
Q9KC80_BACHD/94-154------------------------------------------------------------------------GIS..EED
Q9K7V1_BACHD/28-100------------------------------------------------------------------------KLS..PER
Q6W134_RHISN/286-345------------------------------------------------------------------------PIG..LDE
A8FCD9_BACP2/110-169------------------------------------------------------------------------KIT..KKQ
A5UQY0_ROSS1/111-167------------------------------------------------------------------------PIS..TEQ
A5MW77_STRPN/106-160------------------------------------------------------------------------GVS..QEK
Q8E8L7_SHEON/45-99------------------------------------------------------------------------VNS..PDQ
Q03RI8_LACBA/34-106------------------------------------------------------------------------RLN..PDD
Q6GFW2_STAAR/32-101------------------------------------------------------------------------RYN..PVK
Q38Z32_LACSS/130-188------------------------------------------------------------------------LMT..LEA
Q0VNU0_ALCBS/63-123------------------------------------------------------------------------IVA..FSS
A0REW6_BACAH/375-436------------------------------------------------------------------------KLT..AAE
Q186H8_CLOD6/144-202------------------------------------------------------------------------IMT..PQQ
Q3ETC3_BACTI/150-220------------------------------------------------------------------------KIE..GAK
Q5WGU9_BACSK/378-439------------------------------------------------------------------------KLT..KEE
Q3DSW2_STRAG/153-213------------------------------------------------------------------------SKD..IQT
Q6EA99_LISMN/121-195------------------------------------------------------------------------KIT..EKN
A0REU8_BACAH/162-234------------------------------------------------------------------------NLS..KDE
Q8KFX7_CHLTE/45-103------------------------------------------------------------------------AIS..LSQ
Q8TLV5_METAC/114-171------------------------------------------------------------------------VEN..IDE
Q6ANJ0_DESPS/50-117------------------------------------------------------------------------AQT..QKT
Q5KVG3_GEOKA/282-341------------------------------------------------------------------------SLS..LDD
Q9A4R3_CAUCR/50-105------------------------------------------------------------------------LVP..LSR
NPRM_BACME/152-222------------------------------------------------------------------------QVD..SKK
Q8RBF9_THETN/464-522------------------------------------------------------------------------VIT..LDE
Q7P204_CHRVO/118-188------------------------------------------------------------------------TLS..SAQ
A3HZ45_9BACT/55-116------------------------------------------------------------------------VLP..PSQ
Q72M70_LEPIC/153-248------------------------------------------------------------------------KLS..ESE
Q5WLC0_BACSK/141-199------------------------------------------------------------------------IID..PQE
Q8ERG4_OCEIH/132-194------------------------------------------------------------------------YVS..HED
Q8E690_STRA3/31-94------------------------------------------------------------------------QKT..TNQ
Q8R5X9_FUSNN/83-142------------------------------------------------------------------------PIT..FEQ
A3UR63_VIBSP/116-190------------------------------------------------------------------------KLN..QEQ
Q8PEF5_XANCP/86-141------------------------------------------------------------------------KMS..EAD
Q93J57_STRCO/330-390------------------------------------------------------------------------GLT..VDQ
A7GDD3_CLOBL/148-213------------------------------------------------------------------------KLS..KDN
C3NWD2_VIBCJ/115-190------------------------------------------------------------------------DIE..SQQ
Q1Q7U9_PSYCK/44-104------------------------------------------------------------------------KIS..LEQ
Q15RY9_PSEA6/32-87------------------------------------------------------------------------KID..KNQ
A0KRR6_SHESA/27-86------------------------------------------------------------------------VLP..FDT
Q6HZB7_BACAN/163-222------------------------------------------------------------------------KVT..EEQ
Q8TTA4_METAC/138-199------------------------------------------------------------------------YIG..EEK
Q5X972_LEGPA/122-197------------------------------------------------------------------------AIS..AQQ
Q9L1F9_STRCO/146-216------------------------------------------------------------------------AKA..EQQ
A1S2N2_SHEAM/113-188------------------------------------------------------------------------SLS..KDK
Q9L126_STRCO/81-167------------------------------------------------------------------------KVT..WDK
A3D9D2_SHEB5/116-190------------------------------------------------------------------------TLT..ANK
A8MEK6_ALKOO/172-230------------------------------------------------------------------------VIS..EEQ
C1DJ09_AZOVD/39-99------------------------------------------------------------------------IQP..FET
Q1QQG0_NITHX/28-83------------------------------------------------------------------------LLS..MQE
A5G759_GEOUR/48-108------------------------------------------------------------------------KIS..GEK
A7Z7T0_BACA2/28-100------------------------------------------------------------------------YIS..SEK
Q0AQU2_MARMM/109-177------------------------------------------------------------------------PIS..AEL
A1S4V2_SHEAM/92-162------------------------------------------------------------------------ALT..RGQ
A6P1K3_9FIRM/263-321------------------------------------------------------------------------YIG..LEK
A3YDS2_9GAMM/122-191------------------------------------------------------------------------DLS..EKE
Q2MG71_MICEC/79-138------------------------------------------------------------------------KVD..RKR
Q825U8_STRAW/286-346------------------------------------------------------------------------GVG..LDK
A5EBU9_BRASB/13-71------------------------------------------------------------------------HVP..LSR
Q181V6_CLOD6/408-465------------------------------------------------------------------------NIS..LDK
A3IDB5_9BACI/37-95------------------------------------------------------------------------ILS..MQE
A5W1K1_PSEP1/32-87------------------------------------------------------------------------KVT..KDQ
Q8ESN0_OCEIH/32-90------------------------------------------------------------------------KLS..QEE
A4XTT8_PSEMY/39-99------------------------------------------------------------------------IKS..FEQ
A7N0D3_VIBHB/111-186------------------------------------------------------------------------MIS..ANQ
A4JUZ6_BURVG/39-97------------------------------------------------------------------------KIP..LTQ
Q9R9S7_AERPU/113-179------------------------------------------------------------------------ALS..PAD
Q9A8Q0_CAUCR/73-133------------------------------------------------------------------------VLP..LTR
Q81R43_BACAN/43-101------------------------------------------------------------------------ELS..PET
Q1MKW1_RHIL3/284-343------------------------------------------------------------------------PIG..LDK
Q5FIK0_LACAC/141-199------------------------------------------------------------------------VIS..RDE
Q3KIR7_PSEPF/283-342------------------------------------------------------------------------TIR..LQD
Q6GJS7_STAAR/52-111------------------------------------------------------------------------KTS..PED
Q5WLC0_BACSK/58-117------------------------------------------------------------------------QVD..MET
Q884E8_PSESM/260-320------------------------------------------------------------------------TIS..LEK
Q5FIK1_LACAC/43-101------------------------------------------------------------------------KVS..QSS
A7VSV8_9CLOT/98-161------------------------------------------------------------------------AIT..KDQ
Q9L7Z4_STACR/122-196------------------------------------------------------------------------ALS..KED
Q8RTZ9_9GAMM/126-201------------------------------------------------------------------------ALN..KKK
A6AL37_VIBHA/130-204------------------------------------------------------------------------SLK..AGE
Q3D1Y5_STRAG/117-182------------------------------------------------------------------------KIS..QEE
Q4ZPX1_PSEU2/38-99------------------------------------------------------------------------LGD..FEQ
Q8RBF9_THETN/109-184------------------------------------------------------------------------KYT..REE
Q4MVM1_BACCE/29-101------------------------------------------------------------------------HIS..SEK
A9VL27_BACWK/39-104------------------------------------------------------------------------NYT..EKQ
C2SHN7_BACCE/94-163------------------------------------------------------------------------GIS..EKD
B1KR36_SHEWM/116-189------------------------------------------------------------------------KLS..PQQ
Q6HDI2_BACHK/430-497------------------------------------------------------------------------KVT..KEE
Q8KI45_ENTFL/35-92------------------------------------------------------------------------KVS..LQQ
Q9KE75_BACHD/74-132------------------------------------------------------------------------TLT..PSA
Q1JAF1_STRPB/81-144------------------------------------------------------------------------KLS..EDK
Q4EQU7_LISMN/131-191------------------------------------------------------------------------GIT..EQQ
Q4JLE6_LACRE/76-135------------------------------------------------------------------------KID..QQA
Q9L126_STRCO/188-249------------------------------------------------------------------------KQT..PEQ
Q8P606_XANCP/82-140------------------------------------------------------------------------RLP..AQQ
A5W5R7_PSEP1/39-99------------------------------------------------------------------------IKS..LDE
Q181V6_CLOD6/490-547------------------------------------------------------------------------IIS..AEK
Q2FUX4_STAA8/118-192------------------------------------------------------------------------TLS..KDD
Q3DA42_STRAG/78-137------------------------------------------------------------------------KID..YKT
A7G9N1_CLOBL/383-444------------------------------------------------------------------------KVS..QKE
B0KBH9_THEP3/371-432------------------------------------------------------------------------KLT..EKE
Q1IC64_PSEE4/41-101------------------------------------------------------------------------ILP..LEQ
Q0HTI7_SHESR/103-173------------------------------------------------------------------------GIS..QGQ
Q82ND7_STRAW/171-257------------------------------------------------------------------------ALA..VER
B9LEH7_CHLSY/84-135------------------------------------------------------------------------RLS..ADE
Q97G52_CLOAB/161-230------------------------------------------------------------------------GVT..ATQ
Q5M069_STRT1/87-141------------------------------------------------------------------------GIS..KSV
A6V146_PSEA7/122-192------------------------------------------------------------------------AVS..AEQ
A7FTW6_CLOB1/148-213------------------------------------------------------------------------KLS..KED
Q8U1R9_PYRFU/327-383------------------------------------------------------------------------EYL..VGK
Q1H2G7_METFK/106-166------------------------------------------------------------------------KVS..EAE
B8G477_CHLAD/218-274------------------------------------------------------------------------PIG..EDQ
Q5UKQ5_9BACI/139-216------------------------------------------------------------------------KLS..ANQ
Q5GXB5_XANOR/79-137------------------------------------------------------------------------RMP..AQQ
NPRE_PAEPO/214-283------------------------------------------------------------------------KIE..AVE
Q1ARP9_RUBXD/67-126------------------------------------------------------------------------AIS..REE
Q2B384_9BACI/29-101------------------------------------------------------------------------AVS..PEK
A6NW01_9FIRM/193-253------------------------------------------------------------------------VIT..AEQ
Q97GS5_CLOAB/161-230------------------------------------------------------------------------SIN..EED
A5WGS1_PSYWF/34-90------------------------------------------------------------------------QIN..LNQ
Q6HZB7_BACAN/33-91------------------------------------------------------------------------ILS..EKQ
Q46237_CLOPF/161-230------------------------------------------------------------------------AIS..SSS
A3QGG2_SHELP/47-105------------------------------------------------------------------------VKN..RQQ
A3UN73_VIBSP/32-105------------------------------------------------------------------------LIN..AKQ
A0M3G0_GRAFK/62-119------------------------------------------------------------------------FIA..PSK
Q2SJ90_HAHCH/129-208------------------------------------------------------------------------TIS..DKE
YPEB_BACSU/377-438------------------------------------------------------------------------AIT..EAE
A6P1K3_9FIRM/443-502------------------------------------------------------------------------ALD..EEG
Q047A4_LACGA/60-119------------------------------------------------------------------------KLS..QTE
Q3K852_PSEPF/38-98------------------------------------------------------------------------IKS..LES
Q7A1T8_STAAW/129-187------------------------------------------------------------------------AID..YKK
Q884E8_PSESM/67-126------------------------------------------------------------------------RMN..FEQ
B3XMM9_LACRE/153-213------------------------------------------------------------------------AIS..RDE
A9VSE9_BACWK/148-221------------------------------------------------------------------------FLS..KNE
Q211C9_RHOPB/96-155------------------------------------------------------------------------AIS..LRQ
A8MEK5_ALKOO/294-355------------------------------------------------------------------------KIS..KEE
A6FBW4_9GAMM/126-204------------------------------------------------------------------------SIT..TVN
Q5X0P7_LEGPA/120-190------------------------------------------------------------------------KLS..PND
YKOI_BACSU/164-223------------------------------------------------------------------------PIT..KKE
Q8EP78_OCEIH/29-101------------------------------------------------------------------------KIT..PEK
Q541Q2_VIBAN/116-194------------------------------------------------------------------------QVE..QKQ
Q81R44_BACAN/99-158------------------------------------------------------------------------TIT..KEK
Q9I178_PSEAE/60-119------------------------------------------------------------------------PLS..FSQ
Q5KXX8_GEOKA/94-154------------------------------------------------------------------------GIS..EAE
Q7NNP8_GLOVI/232-295------------------------------------------------------------------------AIG..ADA
Q7CY41_AGRT5/75-132------------------------------------------------------------------------KAL..PSE
Q47KW9_THEFY/83-144------------------------------------------------------------------------RIP..LSL
Q9KFU6_BACHD/49-108------------------------------------------------------------------------GLT..LAE
Q825U8_STRAW/84-147------------------------------------------------------------------------ELP..ISQ
Q4EUP2_LISMN/142-200------------------------------------------------------------------------IKS..PKE
Q2NX96_XANOM/33-88------------------------------------------------------------------------ALT..CVE
A7ZG54_CAMC1/58-115------------------------------------------------------------------------NLS..LSE
YPEB_BACHD/374-435------------------------------------------------------------------------ELT..ADE
Q82ZK1_ENTFA/63-122------------------------------------------------------------------------AVS..LEK
Q47MU5_THEFY/138-194------------------------------------------------------------------------ARS..LDT
Q3K994_PSEPF/60-119------------------------------------------------------------------------LLG..YDQ
THER_BACCL/139-214------------------------------------------------------------------------AIS..IQQ
Q82BN5_STRAW/115-187------------------------------------------------------------------------PKA..ADL
Q71Z55_LISMF/29-101------------------------------------------------------------------------TIS..GDV
A8MEK6_ALKOO/94-155------------------------------------------------------------------------LIS..KEE
Q4MSV8_BACCE/94-162------------------------------------------------------------------------GIS..EKE
Q82US0_NITEU/41-96------------------------------------------------------------------------GIS..EQR
Q3JE96_NITOC/270-334------------------------------------------------------------------------PIT..IEQ
F2MNH6_ENTFO/119-186------------------------------------------------------------------------AIG..EEG
Q0BZN8_HYPNA/53-112------------------------------------------------------------------------ILP..LEI
A6T0P0_JANMA/40-97------------------------------------------------------------------------ILP..LSK
Q0AR59_MARMM/55-114------------------------------------------------------------------------VVP..ALR
Q1J2R6_DEIGD/90-144------------------------------------------------------------------------KIT..PQQ
A4BGK8_9GAMM/17-91------------------------------------------------------------------------RLS..SQQ
Q8R5Y9_FUSNN/99-158------------------------------------------------------------------------KIS..SDK
Q72M68_LEPIC/155-250------------------------------------------------------------------------KLS..ESE
A0RG40_BACAH/171-259------------------------------------------------------------------------KIT..KET
A6AYE9_VIBPA/130-204------------------------------------------------------------------------QLN..LER
A6C2A1_9PLAN/247-311------------------------------------------------------------------------RIE..VSQ
Q9L2B8_STRCO/83-152------------------------------------------------------------------------KVT..AAD
Q8ERG4_OCEIH/56-114------------------------------------------------------------------------QLT..SEE
Q725B7_LISMF/59-118------------------------------------------------------------------------DMS..YED
A3DI39_CLOTH/391-452------------------------------------------------------------------------KLT..LEE
Q9L2B8_STRCO/168-232------------------------------------------------------------------------KGA..SVD
B8G480_CHLAD/109-162------------------------------------------------------------------------LLT..PQE
Q815U2_BACCR/146-219------------------------------------------------------------------------SIT..AEQ
A6NW01_9FIRM/109-172------------------------------------------------------------------------YIG..VDK
A6CLW5_9BACI/159-247------------------------------------------------------------------------EIN..QDE
Q186H8_CLOD6/62-121------------------------------------------------------------------------KVP..YTD
Q5ZZ46_LEGPH/35-90------------------------------------------------------------------------TVK..LST
E0THY6_PARBH/109-174------------------------------------------------------------------------PIS..EEL
Q8PQ63_XANAC/120-190------------------------------------------------------------------------GID..AAT
A5WGS1_PSYWF/109-165------------------------------------------------------------------------KID..LVK
A8LN27_DINSH/31-89------------------------------------------------------------------------TIG..MAR
Q48DF8_PSE14/60-118------------------------------------------------------------------------RLT..ADE
Q5HNG3_STAEQ/33-102------------------------------------------------------------------------LYN..AEL
A4B9Z5_9GAMM/151-215------------------------------------------------------------------------AIP..SKE
Q988S6_RHILO/46-105------------------------------------------------------------------------IKG..LAN
Q8VLQ5_PSEO7/125-198------------------------------------------------------------------------KLN..AKM
A4CC52_9GAMM/131-201------------------------------------------------------------------------AMS..AG.
Q3J9Y2_NITOC/30-84------------------------------------------------------------------------SKP..LSE
Q391Q3_BURS3/71-131------------------------------------------------------------------------RLD..ADA
Q8ESM9_OCEIH/39-97------------------------------------------------------------------------TLS..SED
A6CTU8_9BACI/147-221------------------------------------------------------------------------KLK..SKE
A6AP50_VIBHA/116-190------------------------------------------------------------------------KLN..RAD
Q74LX8_LACJO/141-200------------------------------------------------------------------------TIS..RKE
Q7X5N6_9BACL/163-236------------------------------------------------------------------------TLS..LAQ
B2TDF6_BURPP/75-135------------------------------------------------------------------------KLP..EEA
Q020P0_SOLUE/231-293------------------------------------------------------------------------PIT..PDQ
Q97G51_CLOAB/153-222------------------------------------------------------------------------DIS..PNY
A7ZEI5_CAMC1/22-81------------------------------------------------------------------------AIT..SKE
Q6NKB0_CORDI/71-132------------------------------------------------------------------------ELP..LER
A3WUT4_9BRAD/64-123------------------------------------------------------------------------PVP..LSK
A8AXQ2_STRGC/352-411------------------------------------------------------------------------EFS..QDQ
E0TIH6_PARBH/43-102------------------------------------------------------------------------KIS..LAE
A5W9M7_PSEP1/60-118------------------------------------------------------------------------RQG..ADT
Q82WV7_NITEU/279-343------------------------------------------------------------------------SIG..AEH
Q12WY7_METBU/120-186------------------------------------------------------------------------PYS..VDE
B7WSK7_COMTE/118-177------------------------------------------------------------------------RIT..LAQ
A3TLC9_9MICO/123-187------------------------------------------------------------------------KLS..PGQ
A5VEY7_SPHWW/24-82------------------------------------------------------------------------LIG..LTR
Q0VNT9_ALCBS/52-112------------------------------------------------------------------------IQS..LDK
Q474Y4_CUPPJ/260-324------------------------------------------------------------------------PLG..AAQ
A6DY87_9RHOB/293-357------------------------------------------------------------------------PVT..IDT
Q8ELD0_OCEIH/32-90------------------------------------------------------------------------EIS..AEQ
Q3JBE9_NITOC/51-111------------------------------------------------------------------------ILP..FEQ
A4XTT9_PSEMY/41-101------------------------------------------------------------------------IMP..FEQ
A5TS99_FUSNP/24-83------------------------------------------------------------------------AIS..EQQ
A6GN46_9BURK/40-99------------------------------------------------------------------------ILS..LEQ
A0Q324_CLONN/379-440------------------------------------------------------------------------KVS..KET
A7B3W1_RUMGN/132-193------------------------------------------------------------------------AIS..EEE
O27358_METTH/81-143------------------------------------------------------------------------KIS..YSE
Q48H34_PSE14/39-99------------------------------------------------------------------------LQS..AEK
Q1D8Q2_MYXXD/168-239------------------------------------------------------------------------KVS..HSQ
Q07JR2_RHOP5/48-107------------------------------------------------------------------------IKP..LAE
Q8R5X9_FUSNN/10-69------------------------------------------------------------------------QVN..YDD
A6GN43_9BURK/49-110------------------------------------------------------------------------LIN..AEQ
A5W119_PSEP1/60-119------------------------------------------------------------------------LLT..YDQ
YKOI_BACSU/98-153------------------------------------------------------------------------AMT..EKE
Q03GC8_PEDPA/34-106------------------------------------------------------------------------KVR..PQS
Q9KE75_BACHD/288-347------------------------------------------------------------------------PIS..LED
Q2RPG4_RHORT/72-131------------------------------------------------------------------------ALP..LSV
YCDB_BACSU/416-471------------------------------------------------------------------------AIS..VEQ
A9KIB6_CLOPH/218-275------------------------------------------------------------------------KIS..KEQ
Q1D188_MYXXD/208-277------------------------------------------------------------------------RVS..PDA
A9KIB6_CLOPH/317-399------------------------------------------------------------------------LIT..KEQ
Q6SFP6_9BACT/100-160------------------------------------------------------------------------KIS..ESE
A9C057_DELAS/120-179------------------------------------------------------------------------KST..IEQ
A4VTY9_STRSY/109-163------------------------------------------------------------------------GIS..QEE
Q8RBF9_THETN/290-362------------------------------------------------------------------------YIS..KDK
A2SEW0_METPP/117-177------------------------------------------------------------------------KVS..ETD
Q2JP28_SYNJB/29-85------------------------------------------------------------------------GIP..IKE
Q5WKR8_BACSK/122-181------------------------------------------------------------------------ALS..TDE
Q6R6B9_LISSE/121-195------------------------------------------------------------------------KIT..EKT
A4TZD4_9PROT/37-96------------------------------------------------------------------------ILP..LGQ
Q63MT4_BURPS/165-233------------------------------------------------------------------------AVD..EQQ
Q6N7G2_RHOPA/56-115------------------------------------------------------------------------PVS..LGQ
A5W1V5_PSEP1/63-122------------------------------------------------------------------------RMS..FQQ
A6CHW0_9BACI/149-219------------------------------------------------------------------------KIN..ANK
Q3EVA2_BACTI/125-196------------------------------------------------------------------------KIS..EKD
A6GPB0_9BURK/65-125------------------------------------------------------------------------KVT..LIQ
A8FCD8_BACP2/167-226------------------------------------------------------------------------KIT..VEE
Q49X11_STAS1/141-216------------------------------------------------------------------------KIS..AVD
A4YY21_BRASO/40-99------------------------------------------------------------------------VLP..LSQ
A7Z5Y9_BACA2/99-159------------------------------------------------------------------------GIS..SGK
Q8D5E6_VIBVU/113-191------------------------------------------------------------------------SVN..LDQ
A7HRL7_PARL1/62-117------------------------------------------------------------------------VIS..PGQ
A1T724_MYCVP/79-141------------------------------------------------------------------------PLP..LGD
Q8A623_BACTN/26-84------------------------------------------------------------------------PLP..VDQ
Q1H2G7_METFK/31-90------------------------------------------------------------------------KVS..LET
A3IDB5_9BACI/115-169------------------------------------------------------------------------LIS..KEK
Q5F637_NEIG1/47-105------------------------------------------------------------------------IIS..RAQ
A5N159_CLOK5/17-76------------------------------------------------------------------------RIN..TET
Q82ZK1_ENTFA/146-205------------------------------------------------------------------------IIS..REQ
Q2RM03_MOOTA/386-447------------------------------------------------------------------------KLT..PEQ
A4YNR6_BRASO/46-105------------------------------------------------------------------------GVS..LHQ
Q9KFU7_BACHD/111-170------------------------------------------------------------------------MLT..EEQ
Q74JH3_LACJO/126-184------------------------------------------------------------------------LIS..RSE
B8G477_CHLAD/152-208------------------------------------------------------------------------AVS..PEQ
Q4QZ38_BACIU/144-218------------------------------------------------------------------------SIS..EKK
Q9RC54_BACHO/24-83------------------------------------------------------------------------PLA..VEE
Q1LJM8_RALME/260-324------------------------------------------------------------------------AIT..PAQ
A7ZEI5_CAMC1/100-159------------------------------------------------------------------------ALS..IDE
B8G9I4_CHLAD/116-172------------------------------------------------------------------------AIS..EQQ
Q8ESM9_OCEIH/119-177------------------------------------------------------------------------FIG..DKK
Q0S7B7_RHOSR/138-198------------------------------------------------------------------------AVT..QQQ
NPRS_GEOSE/147-222------------------------------------------------------------------------KLS..EKQ
A8MIH5_ALKOO/376-437------------------------------------------------------------------------AIS..EDD
B0UCU3_METS4/66-129------------------------------------------------------------------------KIG..LAQ
YPEB_OCEIH/373-434------------------------------------------------------------------------KIS..EDE
Q82ZL5_ENTFA/37-109------------------------------------------------------------------------TIS..ADL
B1YFR1_EXIS2/113-183------------------------------------------------------------------------SLS..EKK
Q5HKU0_STAEQ/128-202------------------------------------------------------------------------AIS..KES
Q8RD03_THETN/115-173------------------------------------------------------------------------KIT..PDE
Q1ARP9_RUBXD/144-202------------------------------------------------------------------------RID..RER
Q6W134_RHISN/75-133------------------------------------------------------------------------KAT..PSA
B4SM17_STRM5/23-78------------------------------------------------------------------------PLG..MAQ
A0Q1L3_CLONN/59-118------------------------------------------------------------------------AIP..VEQ
A3IDB6_9BACI/160-218------------------------------------------------------------------------IIT..EQQ
Q2RPK6_RHORT/75-133------------------------------------------------------------------------LAS..PSA
Q8PWA1_METMA/60-123------------------------------------------------------------------------VIT..LDR
Q8DVN1_STRMU/57-120------------------------------------------------------------------------KIF..KEQ
Q7NVU2_CHRVO/229-292------------------------------------------------------------------------RLP..LDA
B1YKF6_EXIS2/28-100------------------------------------------------------------------------QLS..AEE
A9B7B4_HERA2/311-370------------------------------------------------------------------------PVT..LDS
Q70B12_ACTTI/120-189------------------------------------------------------------------------TVS..ESA
Q82P05_STRAW/125-192------------------------------------------------------------------------KLT..PAQ
Q72UE2_LEPIC/159-252------------------------------------------------------------------------NLS..KED
Q1Q7U9_PSYCK/123-181------------------------------------------------------------------------KVS..LSQ
A3X073_9BRAD/44-103------------------------------------------------------------------------LLG..YDQ
Q5FIK0_LACAC/62-121------------------------------------------------------------------------KLS..QQE
Q9A7E1_CAUCR/252-316------------------------------------------------------------------------RIS..VDQ
A0R6J4_MYCS2/78-140------------------------------------------------------------------------RLP..LTD
B8I195_CLOCE/108-180------------------------------------------------------------------------KYS..KEQ
MSPA_LEGLO/128-199------------------------------------------------------------------------VQN..ADK
Q81MX8_BACAN/145-217------------------------------------------------------------------------ILS..EED
Q1WU38_LACS1/104-164------------------------------------------------------------------------GIS..VNK
Q3SKV5_THIDA/55-112------------------------------------------------------------------------RVA..VAD
Q03XK6_LEUMM/140-199------------------------------------------------------------------------IIS..LDS
Q06DP6_9GAMM/118-194------------------------------------------------------------------------ALD..SLD
Q5FIK1_LACAC/119-178------------------------------------------------------------------------TIS..RST
A8FEM8_BACP2/376-437------------------------------------------------------------------------KIS..QKE
Q8ESH1_OCEIH/143-217------------------------------------------------------------------------PIT..ESE
Q8ELE8_OCEIH/178-237------------------------------------------------------------------------PVS..VDE
Q89L62_BRAJA/85-144------------------------------------------------------------------------SIS..ISQ
Q11VT5_CYTH3/217-280------------------------------------------------------------------------YVE..LSE
Q5WLI5_BACSK/75-133------------------------------------------------------------------------PLS..YSS
Q9KBS1_BACHD/60-118------------------------------------------------------------------------RLS..PDE
A5FLJ5_FLAJ1/130-219------------------------------------------------------------------------ALS..PQE
A4FCJ5_SACEN/417-477------------------------------------------------------------------------RIG..IDR
Q8FUC0_COREF/86-161------------------------------------------------------------------------GVATETQT
A0AXS1_BURCH/321-380------------------------------------------------------------------------PLP..LAR
Q1NCJ5_9SPHN/62-120------------------------------------------------------------------------SLP..ASR
Q8CK35_STRCO/128-197------------------------------------------------------------------------RIK..SGQ
Q09A13_STIAD/60-114------------------------------------------------------------------------RLP..VDE
A9C057_DELAS/43-102------------------------------------------------------------------------KIP..LEQ
NPRE_BREBE/144-218------------------------------------------------------------------------KLN..EQK
Q74JH3_LACJO/49-108------------------------------------------------------------------------NLS..QSD
YKOJ_BACSU/108-167------------------------------------------------------------------------AIT..KEE
O26402_METTH/29-126------------------------------------------------------------------------IIE..RAQ
A3UNN0_VIBSP/116-195------------------------------------------------------------------------SIN..SSQ
A4QG45_CORGB/37-98------------------------------------------------------------------------ALP..VRE
Q1R143_CHRSD/68-125------------------------------------------------------------------------AVS..PQQ
A7VSV8_9CLOT/179-240------------------------------------------------------------------------VIS..VDK
Q9KFU6_BACHD/130-191------------------------------------------------------------------------VIS..MDE
A8FEH2_BACP2/99-159------------------------------------------------------------------------GVT..SNQ
Q181V6_CLOD6/337-394------------------------------------------------------------------------KIS..LIQ
A7K2T9_VIBSE/115-189------------------------------------------------------------------------RLS..LSQ
Q5WKR9_BACSK/175-233------------------------------------------------------------------------QIS..VEE
A9AUX6_HERA2/135-191------------------------------------------------------------------------AIS..PDR
A1B2L4_PARDP/40-99------------------------------------------------------------------------ILP..LAE

PF11396

C6W664_DYAFD/240-302--------------------------------------------------------------------FYY.DVKELPGK
A6L510_BACV8/38-96--------------------------------------------------------------------TPI.EVKDLPAA
B9XID0_9BACT/98-160--------------------------------------------------------------------MEV.DLNEVPAV
Q7MWB4_PORGI/302-359--------------------------------------------------------------------DDN.IPAHIKAK
A7LSF7_BACOV/156-219--------------------------------------------------------------------TEH.LPVQLTEA
Q4HPP5_CAMUP/21-74--------------------------------------------------------------------IVI.SPAQLPNN
Q7MWB4_PORGI/160-216--------------------------------------------------------------------NPV.....IPAG
A6LDA4_PARD8/215-276--------------------------------------------------------------------WEI.RSSQVPDI
A6L1R4_BACV8/91-153--------------------------------------------------------------------TDV.RYENLPEP
A6LDA4_PARD8/22-79--------------------------------------------------------------------DDD.DDKFTPES
Q8A9N6_BACTN/42-103--------------------------------------------------------------------TKI.EVKDLPEA
A7VAB9_BACUN/24-82--------------------------------------------------------------------ITQ.DTKQLPLT
Q609W9_METCA/25-85--------------------------------------------------------------------EDL.TEQEVPKA
A6EC49_9SPHI/80-140--------------------------------------------------------------------QDL.RTDQLPEV
A7V913_BACUN/87-150--------------------------------------------------------------------TDL.RCADLPAP
Q11R11_CYTH3/84-141--------------------------------------------------------------------VKL.KDEEVPKT
A6EBA3_9SPHI/40-102--------------------------------------------------------------------TPV.ELKDLPDA
Q64Q98_BACFR/42-103--------------------------------------------------------------------TKI.EVKDLPAA
A3U576_CROAH/46-104--------------------------------------------------------------------KAI.TAEKLPQA
Q8A9P3_BACTN/16-71--------------------------------------------------------------------SAF.AI.LPPGN
Q5L9Y2_BACFN/77-142--------------------------------------------------------------------TEWGDTDELSAT
Q5LBR7_BACFN/156-212--------------------------------------------------------------------ENY.LPAEIPAA
A1ZPX0_9BACT/161-219--------------------------------------------------------------------ESI.AATDLPQP
A7V913_BACUN/224-284--------------------------------------------------------------------WDI.SKRHLEDV
A0LZK7_GRAFK/81-141--------------------------------------------------------------------KDI.METDLPEA
C0QYD0_BRAHW/7-56--------------------------------------------------------------------NNL.....LPEK
Q89YQ5_BACTN/90-143--------------------------------------------------------------------HAV.PASVVPSF
A5ZCE1_9BACE/25-80--------------------------------------------------------------------NDD.ESIAVPVE
B0MTD2_9BACT/41-98--------------------------------------------------------------------RAV.APQELPGE
B9KG60_CAMLR/21-74--------------------------------------------------------------------MVV.GVNALPAN
A3U577_CROAH/47-105--------------------------------------------------------------------VEI.KATDLPQE
Q7MWB4_PORGI/235-292--------------------------------------------------------------------ENN.IPANIKAL
A0M1R1_GRAFK/98-159--------------------------------------------------------------------NDI.KTENLPEA
D5UB28_BRAM5/1-54--------------------------------------------------------------------MDIIPYQKLPEK
B9KG75_CAMLR/19-71--------------------------------------------------------------------IVI.APDSLPVN
A6LDM3_PARD8/41-102--------------------------------------------------------------------YPI.EVTDMPQV
A6L4L1_BACV8/88-141--------------------------------------------------------------------SAV.PVAVVPDA
A6L4Q2_BACV8/76-141--------------------------------------------------------------------TDLQTTDQLTPN
B9KE59_CAMLR/80-133--------------------------------------------------------------------KGI.PTGFIPKE
A7M5Y9_BACOV/86-149--------------------------------------------------------------------NELNSIDQLVPA
Q89YQ4_BACTN/86-149--------------------------------------------------------------------NELDSIDQLVPA
B3JHE8_9BACE/293-346--------------------------------------------------------------------FVI.QISQIQEF
Q1VZW6_9FLAO/27-87--------------------------------------------------------------------KRV.KEDEIPNQ
Q5HUF8_CAMJR/79-132--------------------------------------------------------------------FPF.DLDFLPQN
A6LDE6_PARD8/86-148--------------------------------------------------------------------IDI.SFAQLPAA
A5FMA0_FLAJ1/39-96--------------------------------------------------------------------TEV.TTDAVPAA
A6L4L1_BACV8/24-81--------------------------------------------------------------------KPI.QVNQLPQT
A7AB56_9PORP/24-80--------------------------------------------------------------------NEP.VPGYVSAE
Q26DS8_FLABB/19-76--------------------------------------------------------------------CQE.QSDKVPQV
A6EC48_9SPHI/26-83--------------------------------------------------------------------KVV.GQDELHAN
B9KG75_CAMLR/77-130--------------------------------------------------------------------SSL.NYAILPLA
A6L337_BACV8/89-142--------------------------------------------------------------------KSV.PSTFIPQA
D5U9R1_BRAM5/24-79--------------------------------------------------------------------QSL.TENSLPLK
A0M1R1_GRAFK/37-94--------------------------------------------------------------------KDS.NKSEVPEA
B3JHE8_9BACE/30-87--------------------------------------------------------------------EEVVSVQDVPSD
Q7MWB4_PORGI/82-144--------------------------------------------------------------------IDI.PYSALPKA
A6LDA3_PARD8/25-83--------------------------------------------------------------------ITS.DTNILPVS
Q8A995_BACTN/24-79--------------------------------------------------------------------DDD.ESIAVPTP
A7LSF8_BACOV/24-81--------------------------------------------------------------------KPI.QVTQMPQP
A6LDE6_PARD8/216-277--------------------------------------------------------------------WAM.SEQEVPQI
Q025C3_SOLUE/32-92--------------------------------------------------------------------SGL.QLKDLPAA
Q64WW2_BACFR/25-83--------------------------------------------------------------------DDD.DTGYLPPS
A7LSF7_BACOV/83-145--------------------------------------------------------------------TDI.PYNALPQA
A7LSF7_BACOV/24-79--------------------------------------------------------------------DDD.GSIAVPAE
A0M0Q0_GRAFK/82-142--------------------------------------------------------------------HEM.KTNDVTQN
A7V913_BACUN/163-220--------------------------------------------------------------------EDY.LPSDISAA
Q1PYA3_9BACT/240-300--------------------------------------------------------------------EKV.DIAKVPAV
A6L1R4_BACV8/226-288--------------------------------------------------------------------WDV.QVANLPEA
Q4HEV5_CAMCO/79-132--------------------------------------------------------------------FPF.DLNFLPPN
Q7MWB3_PORGI/88-141--------------------------------------------------------------------SRV.PSDLVPAP
A7AAP4_9PORP/39-100--------------------------------------------------------------------VKI.EVKELPQA
Q8A995_BACTN/83-145--------------------------------------------------------------------TDI.PYTALPDP
D5UB30_BRAM5/29-82--------------------------------------------------------------------INFIPYTSLPIN
A5FIF1_FLAJ1/22-79--------------------------------------------------------------------KKI.EVTELPKP
A6LDA3_PARD8/90-143--------------------------------------------------------------------LPI.PPAIIPEV
A6LDA0_PARD8/28-84--------------------------------------------------------------------QGF.DDKSVSQA
A7VAB9_BACUN/89-142--------------------------------------------------------------------SAV.PEALIPVP
A7V913_BACUN/27-83--------------------------------------------------------------------DDN.DGISVPAE
A7UZY2_BACUN/47-109--------------------------------------------------------------------KPI.DIKELPQA
A7V2B6_BACUN/24-81--------------------------------------------------------------------KPI.EVSQLPAK
A6ERM3_9BACT/45-103--------------------------------------------------------------------EAV.DLKDVPAP
Q2Y6A1_NITMU/95-160--------------------------------------------------------------------EKI.EWSDVPAE
A6L337_BACV8/24-82--------------------------------------------------------------------VTR.DVNKLPVA
Q1PYA3_9BACT/45-105--------------------------------------------------------------------QIV.DIAQIPAV
B9KE59_CAMLR/20-73--------------------------------------------------------------------VIV.SPSALPQK
A6LDE6_PARD8/26-82--------------------------------------------------------------------DDHQGIIPLPP.
A7M5Y9_BACOV/25-82--------------------------------------------------------------------NDD.DDTFVPPS
Q4HEV5_CAMCO/20-72--------------------------------------------------------------------III.SPDELPSI
A7ABZ7_9PORP/218-279--------------------------------------------------------------------WKV.SEQEVPTV
Q606T7_METCA/26-86--------------------------------------------------------------------KEL.SAKQVPRA
A6LDA4_PARD8/83-145--------------------------------------------------------------------TDL.PYNALPQT
A1ZPX0_9BACT/82-140--------------------------------------------------------------------NGI.ELTALPQT
A5FNS8_FLAJ1/26-83--------------------------------------------------------------------TVI.KKEALPAN
D8ICV0_BRAP9/18-73--------------------------------------------------------------------QDI.TEASLPLQ
Q4HTG4_CAMUP/18-70--------------------------------------------------------------------IIL.SPQNLPNA
A5ZCE1_9BACE/84-144--------------------------------------------------------------------WEV.HFNTLPDP
A0M5V4_GRAFK/44-104--------------------------------------------------------------------ASV.EVMALPQA
A3J6C3_9FLAO/78-139--------------------------------------------------------------------SPT.TFVQLPAK
Q8A994_BACTN/88-141--------------------------------------------------------------------TSV.PVAIIPAA
Q11R11_CYTH3/24-80--------------------------------------------------------------------EKV.ADKDVPAT
B9KDT7_CAMLR/39-93--------------------------------------------------------------------PYAQNYYGLSKP
Q8YLV6_NOSS1/89-149--------------------------------------------------------------------YYV.TEKDFPPI
A4ANN1_MARSH/103-168--------------------------------------------------------------------ERF.EDVKLPTA
A5FM86_FLAJ1/39-96--------------------------------------------------------------------TEI.KLEELPAP
A3XQ60_LEEBM/44-103--------------------------------------------------------------------TKI.DVADLPDT
Q4HTG4_CAMUP/77-130--------------------------------------------------------------------TAI.SYEVLPPH
C0QVH4_BRAHW/20-75--------------------------------------------------------------------QTM.TENSLPLR
Q64UH5_BACFR/42-103--------------------------------------------------------------------TKI.DAKKLSDA
A6LDA4_PARD8/155-211--------------------------------------------------------------------NEH.RPSVTPSA
E4MSA5_CAPOC/22-79--------------------------------------------------------------------KKV.TFNDLPAD
Q64SP0_BACFR/83-145--------------------------------------------------------------------TDL.PYQALPAA
Q4HE98_CAMCO/48-102--------------------------------------------------------------------PPQDYFNGLPKN
B9KG60_CAMLR/81-134--------------------------------------------------------------------RPI.DTSFLSPN
Q5LEW1_BACFN/42-107--------------------------------------------------------------------TQI.AAKELPAA
Q8YLV6_NOSS1/29-85--------------------------------------------------------------------PNQKQSVIVPPS
C0R146_BRAHW/31-84--------------------------------------------------------------------IQFIPYTSLPSN
C0R148_BRAHW/1-54--------------------------------------------------------------------MDILSLKSLPQK
A0LZK7_GRAFK/21-77--------------------------------------------------------------------DDK.ANSEIPSV
A2TPA4_9FLAO/87-148--------------------------------------------------------------------VSI.DKDELPKA
A7AB56_9PORP/84-146--------------------------------------------------------------------TDI.PFAQLPDA
A3YT26_CAMJU/21-74--------------------------------------------------------------------MVV.PASELPNN
Q64TS2_BACFR/42-107--------------------------------------------------------------------TKI.TVKELPQV
A6E8W6_9SPHI/40-102--------------------------------------------------------------------TPV.ELKDLPEP
B3JHE8_9BACE/156-216--------------------------------------------------------------------VEV.GEEYLSEK
Q8A995_BACTN/230-292--------------------------------------------------------------------WEV.RRNELPTA
A0M0Q0_GRAFK/20-78--------------------------------------------------------------------FTSENKDKVPQV
A5ZGS8_9BACE/87-150--------------------------------------------------------------------NELESIDSLVPA
A6EC48_9SPHI/89-142--------------------------------------------------------------------KQL.PDSVIPVS
Q1PY86_9BACT/10-70--------------------------------------------------------------------KNI.NIAQVPAV
A5FMA1_FLAJ1/39-96--------------------------------------------------------------------TEV.TADAVPAA
A7V329_BACUN/79-144--------------------------------------------------------------------TDVESLEKVPAP
Q5LBR7_BACFN/23-79--------------------------------------------------------------------DDD.HLSSVPTE
Q4HPP5_CAMUP/81-134--------------------------------------------------------------------KAI.PLGFLPST
A5FNS8_FLAJ1/90-143--------------------------------------------------------------------SKI.PKSIIPKK
Q606T7_METCA/90-152--------------------------------------------------------------------EEI.KPTELPEP
A7ABZ7_9PORP/87-149--------------------------------------------------------------------TDL.PLNQLPTA
Q89YQ5_BACTN/24-82--------------------------------------------------------------------ITK.DMNQLPLP
Q64SP0_BACFR/216-278--------------------------------------------------------------------WDV.RRNELPET
A7AB55_9PORP/91-144--------------------------------------------------------------------STV.PEAVIPEA
A5FM85_FLAJ1/39-96--------------------------------------------------------------------TEV.ALTEVPAA
A4CIV2_ROBBH/43-101--------------------------------------------------------------------TEI.AVDELPAA
A4JEG0_BURVG/34-94--------------------------------------------------------------------ETV.AIAQVPAA
Q64WW2_BACFR/87-150--------------------------------------------------------------------TELNSINNLPPA
A6L1R4_BACV8/162-222--------------------------------------------------------------------EED.YDDYLPQP
Q0P9P8_CAMJE/20-72--------------------------------------------------------------------III.SADNLPNV
A7AB55_9PORP/27-84--------------------------------------------------------------------RPV.RFDQLPAK
A2TZP8_9FLAO/26-85--------------------------------------------------------------------YRV.NKTLIPQK
A6KXD7_BACV8/38-100--------------------------------------------------------------------TPI.EVKDLPAA
A5FBY0_FLAJ1/85-146--------------------------------------------------------------------LQI.PLSQLPVK
A5FM84_FLAJ1/39-94--------------------------------------------------------------------KEV...DAVPAA
A7V329_BACUN/19-75--------------------------------------------------------------------SAF.AEGRLPAN
Q11P99_CYTH3/20-76--------------------------------------------------------------------QDI.AQKDVPAV
D8IF52_BRAP9/11-64--------------------------------------------------------------------NSI.LLDDLPEN
A7VAB8_BACUN/86-148--------------------------------------------------------------------TEL.LWNNLPGT
Q8ABX7_BACTN/27-89--------------------------------------------------------------------KPI.EVKDLPQA
Q64ZG0_BACFR/31-91--------------------------------------------------------------------GTI.EMNQLPGT
A6E8W7_9SPHI/39-101--------------------------------------------------------------------TPV.EIKDLPEA
Q11P99_CYTH3/80-140--------------------------------------------------------------------QEI.AVSDLPSA
Q2Y9L0_NITMU/27-92--------------------------------------------------------------------EEV.QWDDVPPA
Q5LD45_BACFN/111-176--------------------------------------------------------------------VDVETLEAVPAA
A6LDA0_PARD8/88-149--------------------------------------------------------------------FDI.HAEDVPVD
A7AKE6_9PORP/56-112--------------------------------------------------------------------QKT.PAENVATP
A7AKE6_9PORP/116-177--------------------------------------------------------------------WEI.STRDVPVA
Q64WW3_BACFR/89-143--------------------------------------------------------------------AAV.PATIVPDF
Q4HFB7_CAMCO/81-132--------------------------------------------------------------------KAL.PNSILPN.
A7VAB8_BACUN/26-82--------------------------------------------------------------------DDK.DDVKVPEA
Q7MWB3_PORGI/24-81--------------------------------------------------------------------RII.PLNRIPQK
Q2Y7C4_NITMU/25-90--------------------------------------------------------------------KKI.PWADVPPA
A6LAS6_PARD8/41-101--------------------------------------------------------------------VKV.EVKDLPGV
A3ZG36_CAMJU/81-133--------------------------------------------------------------------KAL.PHTILPN.
A7LSF7_BACOV/223-284--------------------------------------------------------------------WEI.RQNELPEA
Q5LG07_BACFN/24-82--------------------------------------------------------------------ITK.DAMKLPLP
A7AB56_9PORP/219-280--------------------------------------------------------------------TEL.RITALPDA
A7LXE2_BACOV/77-142--------------------------------------------------------------------TDLVSLDRLTPT
A5FIF1_FLAJ1/86-139--------------------------------------------------------------------KPI.PTDFIPDN
A7V158_BACUN/77-142--------------------------------------------------------------------TDWETMDEVPPA
Q26DS8_FLABB/80-141--------------------------------------------------------------------NSI.KKSEIPEA
A6EC49_9SPHI/20-76--------------------------------------------------------------------QNL.KAKNVPSI
A7UZJ9_BACUN/42-107--------------------------------------------------------------------TKV.EVKDLPQA
Q64SP1_BACFR/24-81--------------------------------------------------------------------KPI.QVSQMPQK
A7V2B6_BACUN/88-141--------------------------------------------------------------------SEV.PVQIVPEA

PF14620

Q3ACX8_CARHZ/13-371LLV.GLFIWGYDQSQ.......KKNRLYWELNSQYRRAFEELYGHSKTLEAQVGKTLVSMSLQQNL..KQAAKGWRQAYA
A3DI39_CLOTH/26-388AIS.AVALWGFYQYK.......HAADLRQELDNQYNRAFYEMVGYVNNVEVLLLKSLICNSPEKTA..QTMQEAWRQSNL
Q736X0_BACC1/13-372GVV.GTGYWGYKEHQ.......EKNAVLIRAENSYQRAFHDLAYEVDLLHDKIGTTLAMNSRASLS..PALADVWRLTSE
C6CU97_PAESJ/16-375FLI.GSVYWGYQEHQ.......EKNSILIKAENQYQRAFHDLTYHVEQLHQQLGNTLAVNSTSQSYHRKGLVNVWRLTSQ
Q8R774_THETN/13-368LVL.ALGAWGYRQYL.......EKISYHRYLQAQYDRSFYQLISNVENIETSMGKLMVASSDKTTI..SILDEIWREAFS
D5DRI0_BACMQ/13-373GVV.GVGYWGYSEHQ.......EKDAVLLQAENTYQRAFHDLSYQLDLLNDKIGGTLAMSSRDQLS..PALAEVWRLTSE
D5W1I7_CLOB2/17-379IVV.FSSTFAILMTL.......ERNDYRNYLQGEYSKSLHELITSVQNIRVNLSKASIIGSRDQEI..VTFEEIFKYSSM
C6PVF7_9CLOT/17-378IVV.FSSTFAILMTL.......ERTDYRNYLQGEYSKNMYDLINSVQNIRVDLGKANVVGSREQSI..VVFEDIFRYSAI
E0RD66_PAEP6/16-382LMI.GAFVWGYRESQMRKQVSLQAKSMSIKAENQYQRAFHDLSFHMDQLHSQLGNAVAVHNTSHAMHRKCLMNVWRITSE
D3G027_BACPE/13-376AVI.ALGYWGFQEQE.......QKQVLSINAENNYQRAFHDLTFHLDQIEDELGATLAMNTRRQLT..PALAEVWRITSL
B8D1J1_HALOH/6-366LVAGAIGYWGYDQYR.......DRQQLEIYLGNKYQQAFYELVERVEQLQVLLGKTMVSSSPRQNI..LILTDVWNHATT
B8I3U7_CLOCE/26-387ALV.GVSLWGYYQNR.......QLKRLQVLMTNQYNRAFVDLSDYVDNVETLMAKSLVTSTPVSTS..KMLEEVWRQANL
B1C6Q7_9FIRM/13-365VVV.TLGVFSYTGTK.......ASGSLETAVTNNYEKSLSSLLESFEQMNSRLSKLSVSNDDKFIK..KELVNLYGLNLS
E8SXZ7_GEOS2/13-373AVV.GTGYWGYREHQ.......EKNAILIHAENNYQRAFHDLAYQIDLLHDKLGATLAMNSHASLS..PALAEVWKIASE
A4J9E3_DESRM/15-376ILT.AIGFWGYKEYQ.......DRIVLENYLNNRYQMSFYNLINRVQNMEVLLGKTLAVSGDTDNT..LIFSEIWLQAEG
D9TFB8_CALOO/29-390ILV.IVALWGVNQYK.......GKANYHNYLTNMWHRAFFDMVGYVQNIQALLSKAEVSGDDRQRA..VLYTEVWRNAFA
A6NSM3_9FIRM/22-381AFA.VTGGAALKSHA.......RAEAYRNIVNNTYQHAFAELTTAVAEMDAALQKSAYATSESLLA..QLCTELFGRAMS
D5N4Y3_BACPN/13-374AIV.GTGYWGYKEHQ.......EKDAVLLHAENNYQRAFHELTYQMDQLHDKIGTTLAMNSQKSLS..PALIDVWRITSE
D9QUD9_ACEAZ/13-381ALA.AVGYWGFKNNK.......ILAKWELQTENQYRNAFAELNNNLNSLEDELATALVTKSNERRS..VKLNNIWRDAFA
B0MLG6_9FIRM/17-370AVSVAAGISATLNMN.......SSVRYKRSFEQSMTRNVEDLSAEIDNIKNTLYKGMYAGTPEMMT..QLSSKLWSDAST
C5VNR0_CLOBO/15-376IVV.FSTTFAILMTL.......ERKDYKNYLQGEYSKSMYQLIDSVKNLKSNLAKSAIVNSKEGNI..ITFGNISKYADI
A5CYA9_PELTS/14-376VLT.AVGLWGYGQHQ.......ANRSLENFLNNKYRRAFYDMTGQVQSLEVLLSKSLVASDPHLDK..ALLMEIRQQAAF
Q67K56_SYMTH/19-394AVA.VWAAWTANLNE.......HNRLLANALEAERQRNFVDMVHHVEQIQALLGKGLATGSERQNM..RYMADVHRHASA
E5YVT8_9BACL/16-375LLI.GALVWGYQENK.......EKNAILINAENQYQRAFHDLSYNMDRIHAELGNTLAVSSTSQGMHRKGLMNVWRLTSE
B1I6Q9_DESAP/14-380VLA.VVSAWAFEQWS.......ARRHLENLLNAEYQRSFFDTVLNVRGLEVLLGKVLVGDGSPQDA..DLLGETWREAVL
Q67QG8_SYMTH/1-374MLA.VWGAWTVHLYR.......QYQALAYELEAERQRNFAEMISHVEAMRGLMGKSLAAGSTRQNA..LYMGEVYRRASL
YPEB_BACHD/13-371AVI.ATGYWGFQEQQ.......QSQILTVQAENGYQRAFHELAYHIDQIEDQLGATMAMNTRRQLT..PSLAEVWRLTSL
D5XDM3_THEPJ/19-379LLA.GTGYWGYTQHQ.......HKQRLLTYLNNRNQKAFFEMVSQVENMEVLLAKSIASGSPHQRS..LLFSNLWMQANG
E9SE89_RUMAL/27-377AVT.ALSVKSYKLMK.......KADAAERSVNNNYTAAVEELAHSCDSLSNVLEKQLYAGSGQVQQ..TLAVDLYREAAT
F0K5G1_CLOAE/18-380IVV.FSTSYAILMTL.......ERTDYRNYLQGEYDKSMYQLIDSVENIGADLSKVPILGSREQNT..LVLGDIYRYSTI
Q898Z6_CLOTE/17-379IVV.FSSTFAILMTL.......ERTDYRNYLQAQYSKNMYELMDSVQNIRVNLSKAAVVGSREQNI..IVFDEIFRHATN
Q65I06_BACLD/13-374AIV.GTSYWGYKEHQ.......EKDAVLLHAENNYQRAFHDLTYQVDQLHDKIGSTLAMNSKKTLS..PALAEVWKTTSE
A7VNV5_9CLOT/20-375LCV.FLGVGALINYQ.......AAQRYRQNSEYGYQRALSDLSDSVSNLEVALEKGVYANTAPQQQ..GIAAKLLKESSD
Q67JA4_SYMTH/1-357MGF......GAYQTR.......LKNQYLREAENKYMAAFHKLKWTSENIEERMAKLMATNDPRLQE..SLLADLRVFSAQ
D5WQ69_BACT2/16-374ALV.ITGFWGYREHR.......QKQAVLLKAENQYQRAFHDLTAHVDQLQDELGKAMAINSVRQQT..PCMTNIWRLAFA
E6U685_ETHHY/20-373AFC.LAVIAGISGYV.......MAYKYRMSIEYGYQRALTELSEHVDNIDIALQKAQYASTSAQLS..GLSAEIWANAGA
C6J414_9BACL/16-377LLI.GALVWGYQENQ.......EKNSILIKAENQYQRAFHDLSYHVDKLHTELGNTLAVNSASTGAQRKGLVNVWRITSE
F0DLG0_9FIRM/14-375ILA.AVSIWGYRQYQ.......DRVALQNYLSNKYHLAFYNLTGRVQNMEVLLGKTLAVAGQPDDT..VLFSEIWLQSEG
Q2RM03_MOOTA/13-383ALL.LAIGWGLWERA.......NRLTLANAVEAGGQRDFYNLLNYVEQAQVSMGKTLASSSPRQQA..VHLTEAWNQAAA
B4AKG7_BACPU/13-373AVI.STGYWGYKEHQ.......EKDAVLLHAENNYQRAFHDLTYQVDQLHDKLGATLAMNSQSSIS..PALADVWRMSSE
B9DX91_CLOK1/17-380IVV.FSSTFAVLMTL.......ERNDYRNYLQGEYGKSMYELIDAVENIRVNLTKAAIVGSREQKI..AVFEEIFRHSAV
B7GHM6_ANOFW/13-372GIA.GTAYWGYREHQ.......QKNAILIHAENNYQRAFHDLTYQIDLLHDQIGTTLAMNSRQSLS..PALAEVWRLASE
E6TZD5_BACCJ/13-373AIV.GTGFWGYKEHQ.......EKNAILIKSENNYQRAFHELTYNIDLLHDELGSTLAMNSRERLS..PSLAEVWRITSE
C8VVD3_DESAS/16-378AIL.GLGYWGFKEQQ.......TRKMAEAYVNNNYQRSFYNLADHVQNMEVLLSKSLLVSEKKYDG..KVYSDIWQHASA
E6UCG1_RUMA7/18-368AIT.ALSVKNVLLTK.......RADTAQRAVNNSYSAAVEELAGSCENISNSLEKQLYSASGQVQQ..AIAADLCRDASA
D9TPL0_THETC/12-368LLL.VVGAWGYNQYM.......QKVSYHRYLQAQYDRSFYQLVNSIENIETSTGKLMVSSQENTTI..PILSDVWRQAFE
Q2B634_9BACI/13-372GAA.GAGFWGYQEHR.......EKNAILINAENSYQRAFHDLTYQTDLLHDKIGTTLAMNSRESLS..PALADVWKITST
A8MIH5_ALKOO/13-373AMV.AVLGWGIYQYN.......EKNDYHTYLDIQFQRQFYELIGHVENAQVNLSKAMASGSNKDIV..KFLNDTVQHSYM
B0TAV0_HELMI/41-428TTA.LFGYLGYQQYV.......QNQAYQMAVENRYQRAFADLSSNVENMELEMSRLLASNSPNQAV..MGLQQVSRQASE
E5WI28_9BACI/13-372GVA.GTAFWGYQEHR.......EKNAILINAENNYQRAFHDLTYQIDLLHDKIGTTLAMNSRASLS..PELAEVWRLTSE
C0GK90_9FIRM/17-388LLV.ISGVLINYQYR.......QITQMQSQIGGEIQSNFTQMGLTVRDMRIKSGSVMAGEDR......QLLENI..NPNS
C0EB21_9CLOT/19-374ALALLLGTGWYSSHR.......KAEEYRRQLEAGYMRAVDELTSYLEDLHTDLTKSMYTGTPLQLS..KLSSRIYQQAGL
D8GKX4_CLOLD/17-380IVV.FSSTFAVLMTL.......ERNDYRNYLQGEYGKSMYELIDAVQNIRTNLTKAAIVGSREQQI..VVFDEIFRYSAI
YPEB_OCEIH/13-370AVI.GTAVWGYNEYS.......EKNEIKIQAENEYQRSFHELTYYMDLLNDEIGTALAMNSKERLS..PQFVDIWRLTSQ
B0PG38_9FIRM/20-373AFG.VAAGIAIQQHA.......VARDYRSQLENTYTRALGDLSSYLVNISNDLEKGRYVGTSEQFA..LMAARIWRESGG
C0ZCA7_BREBN/17-378ALI.GAGVWGYQEHN.......EKNSVLIKAENSYQRAFHDLTYHVDKLHDELGKSLVVNSRRQMT..PILTSVWRLSYA
A6TN00_ALKMQ/13-373ALV.ATAVWGYYQYG.......ERNDYHTYLDIQFQRQFYDMIGHVENLQVDLAKAMVSGSNPETI..KHLNSTVQQAYL
D9S297_THEOJ/14-374TIV.LIALALWSMGS.......RAYSAENLLEANYQKGFFNLVDDVNTLNILLSKSLVTSSDSQRI..IILTSIWHEAEN
A0Q324_CLONN/15-376IVV.FSTTFAFLMTL.......ERRDYKNYLQGEYTKSMYQLIDSVKNLKGSLAKSAIVNSREANI..VTFNNISKYADI
A6CR99_9BACI/13-371GVA.GTAYWGYQEHQ.......EKNAILINAENNYQRAFHELTFQIDLLHDKIGTTLAMNSKKSLS..PELADVWRLTSQ
E0ICB3_9BACL/16-375LCI.GSFYWGYQEHQ.......EKNSILIKAENQYQRAFHDLSYHVEQVHQQLGNTLAVNSKSQAYHRKGLVNVWRLTSE
Q5WGU9_BACSK/13-375AVV.GTGVWGYQQKQ.......EKNQLQITANNTYQRAFHDLTYHIDQIEDELGKTLAMNTQRQLT..PSLADVWRVTSL

PF11399

Q085F9_SHEFN/19-127---------------------------------------SGCVISVGDHESGKSADY.....WQV.........QQDKNR
A4C487_9GAMM/27-130---------------------------------------ASLVIIFYQDDPTTMN.......WQD.........REAFNN
A6WL17_SHEB8/20-121---------------------------------------VAVVVLVYEPTPEDMN.......WED.........RQAYNS
A8FY56_SHESH/14-118---------------------------------------TGCVLNVGDSESGWDNQAS....WEK.........SQTKNR
Q15QY7_PSEA6/20-121---------------------------------------VAAVLLFYPDNAQDMD.......WKD.........REEYNK
B1KNV8_SHEWM/19-120---------------------------------------SGCVINLGEGDSDWNH.......WEK.........TQSANR
Q8EGJ0_SHEON/23-132---------------------------------------SGCVVNVGDGESGWDRSES....WEK.........VQDKNR
B1KQX2_SHEWM/20-121---------------------------------------VAVVVLVYDPTPDEMD.......WED.........RQEYIN
A1S8B9_SHEAM/20-121---------------------------------------VAVVAIGYEPTPENMD.......WED.........RQVYNN
Q07ZE7_SHEFN/20-121---------------------------------------VAVVIFVYEPQPEDRA.......WDD.........RQAFNL
Q15QZ2_PSEA6/17-120---------------------------------------SGCVISVDGDGHDGYQSD.....WQK.........KERSNR
Q12L38_SHEDO/25-126---------------------------------------VAVMFSSYDPLPGEKD.......WDD.........RQAFNL
Q3ICC6_PSEHT/20-123---------------------------------------ATLVIVFYKDDPQAMI.......WQD.........REAYNK
A4C4D7_9GAMM/17-125---------------------------------------TGCVVAVSDGEVDSHWASSNTSSWEK.........QHENNR
A1S4M5_SHEAM/17-118---------------------------------------GGCVVNVGDGVSGYQD.......WEK.........TQLDNR
Q47YB6_COLP3/19-124---------------------------------------SGCVIKINDDGMDHGFVGD....SED.........RTYKNR
F2GBX2_ALTMD/20-121---------------------------------------VFMVIAFYPDKPENMD.......WKD.........REEYNR
A6WL90_SHEB8/24-135---------------------------------------SGCVVNVGDGESGWDSSES....WEK.........VQDKNR
A3QGB8_SHELP/19-123---------------------------------------SGCVLNVGEGDKGWSTGNS....WER.........VQEQNR
Q8EGQ0_SHEON/20-121---------------------------------------VAVVVLVYEPTPDEMD.......WED.........RQVYNS
A8H6M9_SHEPA/19-123---------------------------------------TGCVVNLGDGESGWDNNGS....WEK.........VQEKNR
A4Y4Y3_SHEPC/20-121---------------------------------------VAVIVLVYEPTPDEMN.......WED.........RQAYLN
Q12P24_SHEDO/19-127---------------------------------------SGCVLNVGEHGSARNSD......WEQ.........QQQMNR
A0Y2J8_9GAMM/16-124---------------------------------------TGCVIAVSDGEAETHWAGNDSTSWQT.........KHKNNR
Q47YA7_COLP3/20-124---------------------------------------VALVMTFYDDSPDQMK.......WKD.........REAYNR
Q5QW11_IDILO/20-121---------------------------------------VGAVLMLYQADPADLQ.......WQE.........RETYNA
A4A742_9GAMM/18-118---------------------------------------SGCVFI..DGKYVDHND......WRD.........DQRDNR
A3WM12_9GAMM/19-120---------------------------------------LGLVKVFYQADPADMK.......WQE.........RETYNA
A3WM05_9GAMM/20-124---------------------------------------SGCIVVSEPS.............WDKDDPQYDQIHDERGNR
A3QGM5_SHELP/20-121---------------------------------------VAVVVLVYEPTPDDMD.......WED.........RQAYNN
F2GBX8_ALTMD/17-120---------------------------------------SGCVVSVGGGSDSHYGAD.....WED.........REFNNR
A8H6V7_SHEPA/20-121---------------------------------------VAVIMLTYEPTPDEMD.......WED.........RQAYNK

PF04355

Q5NL78_ZYMMO/17-93--------------------------------------------------------------------------GYMVDK
Q5LQJ9_SILPO/35-111--------------------------------------------------------------------------GYVPTA
Q1LSR9_BAUCH/37-105--------------------------------------------------------------------------GNYLTK
Q5PHB7_SALPA/28-97--------------------------------------------------------------------------KDQFVE
A4N7P6_HAEIF/34-104--------------------------------------------------------------------------GNYLEA
Q1MIT0_RHIL3/42-118--------------------------------------------------------------------------GYVADQ
Q1LBA9_RALME/75-149--------------------------------------------------------------------------GTFPNI
A3YB50_9GAMM/31-104--------------------------------------------------------------------------GNVLEL
A3XVL9_9VIBR/35-105--------------------------------------------------------------------------GNYVEQ
Q2SZ95_BURTA/41-112--------------------------------------------------------------------------GNFVSQ
A5WGN5_PSYWF/35-114--------------------------------------------------------------------------GTPITQ
Q9CJV5_PASMU/34-104--------------------------------------------------------------------------GNYLEA
BAME_PSYIN/35-104--------------------------------------------------------------------------GNYIED
B0KU54_PSEPG/23-91--------------------------------------------------------------------------AQYQDQ
A0YHQ3_9GAMM/36-106--------------------------------------------------------------------------GNVITQ
Q1ZJZ5_PHOAS/34-104--------------------------------------------------------------------------GNYVEQ
Q0HGH3_SHESM/49-120--------------------------------------------------------------------------GNYMEP
Q220P9_RHOFD/38-108--------------------------------------------------------------------------GNFVSQ
Q3BVC3_XANC5/28-99--------------------------------------------------------------------------GNLIKQ
BAME_NEIMB/36-106--------------------------------------------------------------------------GNELEP
Q5NEF6_FRATT/34-106--------------------------------------------------------------------------GKEIKD
A4TNU9_YERPP/35-105--------------------------------------------------------------------------GNYLSP
Q7WYE0_ACIHA/30-99--------------------------------------------------------------------------GTPLTK
Q1N393_9GAMM/29-99--------------------------------------------------------------------------GNIVTQ
BAME_VIBF1/35-105--------------------------------------------------------------------------GNYVEQ
Q8G1E5_BRUSU/49-125--------------------------------------------------------------------------GYVLDQ
A5ZZI3_VIBCL/52-122--------------------------------------------------------------------------GNYVDQ
A6VMF3_ACTSZ/34-104--------------------------------------------------------------------------GNYLEQ
Q7VRQ4_BLOFL/39-110--------------------------------------------------------------------------GTYLTQ
BAME_NITEU/35-105--------------------------------------------------------------------------GNVVTD
Q0C315_HYPNA/29-105--------------------------------------------------------------------------GYIADE
Q47XI1_COLP3/29-101--------------------------------------------------------------------------GNYLEQ
Q7P9U9_RICSI/27-103--------------------------------------------------------------------------GQSIDD
A4TZI9_9PROT/28-104--------------------------------------------------------------------------GNLPHP
Q47HJ0_DECAR/36-107--------------------------------------------------------------------------GNVLSQ
Q4ZMZ6_PSEU2/30-98--------------------------------------------------------------------------VTYRNE
B0KIS9_PSEPG/35-105--------------------------------------------------------------------------GNVVTQ
Q5FUN3_GLUOX/45-121--------------------------------------------------------------------------GSLIEK
Q2SMN2_HAHCH/93-162--------------------------------------------------------------------------GNIVEK
Q2BRB3_9GAMM/31-102--------------------------------------------------------------------------GNVVTQ
Q0A7D7_ALHEH/37-107--------------------------------------------------------------------------GNIMTQ
A1AX05_RUTMC/37-107--------------------------------------------------------------------------GSVLER
Q3SSS7_NITWN/53-129--------------------------------------------------------------------------GYILPP
A5W9P3_PSEP1/29-96--------------------------------------------------------------------------VTYRDE
Q2RTT3_RHORT/36-112--------------------------------------------------------------------------GNLPTT
Q5X816_LEGPA/32-102--------------------------------------------------------------------------GNLLPQ
A6D2W0_9VIBR/35-105--------------------------------------------------------------------------GNFVEQ
Q46NU4_CUPPJ/65-139--------------------------------------------------------------------------GTFPNL
Q2NRT5_SODGM/28-97--------------------------------------------------------------------------DSYVNK
O85277_PASHA/57-127--------------------------------------------------------------------------GSWPNW
A4VII8_PSEU5/29-97--------------------------------------------------------------------------ITYRDE
A5PER7_9SPHN/21-97--------------------------------------------------------------------------GYVVDS
A7I1H3_CAMHC/52-124--------------------------------------------------------------------------ALSVNL
A6FB83_9GAMM/42-112--------------------------------------------------------------------------GNYVED
A3J973_9ALTE/29-99--------------------------------------------------------------------------GNIVTN
Q6G003_BARQU/42-118--------------------------------------------------------------------------GYILDK
Q8KTI1_AZOVI/35-105--------------------------------------------------------------------------GNVVTQ
Q5PFG5_SALPA/21-91--------------------------------------------------------------------------GNYLTP
A4WTT5_RHOS5/40-116--------------------------------------------------------------------------GYVPTE
Q604C4_METCA/51-121--------------------------------------------------------------------------GNIVSQ
B0UR41_METS4/34-110--------------------------------------------------------------------------GYLIDE
Q15V54_PSEA6/31-104--------------------------------------------------------------------------GNFLDE
Q492C5_BLOPB/40-110--------------------------------------------------------------------------GNRLNE
Q3R3Z3_XYLFA/29-77--------------------------------------------------------------------------GNLIKK
Q1N9S5_9SPHN/44-120--------------------------------------------------------------------------GYQVDK
Q31FS2_THICR/36-107--------------------------------------------------------------------------GTVISQ
A4BRW9_9GAMM/48-119--------------------------------------------------------------------------GTVLSA
Q3R9M0_XYLFA/29-100--------------------------------------------------------------------------GNLIKK
A6U7Q1_SINMW/42-118--------------------------------------------------------------------------GYVVDQ
A1IQ08_NEIMA/52-134--------------------------------------------------------------------------GTFPTY
A3RS11_RALSL/104-175--------------------------------------------------------------------------GNFVSR
A1WGT8_VEREI/51-121--------------------------------------------------------------------------GNFVAR
A4SVD7_POLSQ/67-138--------------------------------------------------------------------------GNFISS
Q2NRZ9_SODGM/35-105--------------------------------------------------------------------------GNYLTA
A1WCQ4_ACISJ/49-119--------------------------------------------------------------------------GNFISR
B1ZKI2_METPB/33-109--------------------------------------------------------------------------GYQIDQ
A1TVV3_ACIAC/48-118--------------------------------------------------------------------------GNFVSR
Q1LMT9_RALME/71-142--------------------------------------------------------------------------GNFVSR
Q6FDQ3_ACIAD/30-107--------------------------------------------------------------------------GTPLTK
Q7CZT7_AGRT5/48-124--------------------------------------------------------------------------GYVMDD
Q0K704_CUPNH/51-122--------------------------------------------------------------------------GNFVSR
Q2T565_BURTA/70-143--------------------------------------------------------------------------GTFVNA
Q21H32_SACD2/36-106--------------------------------------------------------------------------GNYIEK
A3UCC7_9RHOB/30-106--------------------------------------------------------------------------GFRYPD
Q7W511_BORPA/42-112--------------------------------------------------------------------------GNWITK
Q83C32_COXBU/30-100--------------------------------------------------------------------------GNVITD
A8GGW6_SERP5/28-97--------------------------------------------------------------------------ASYVQE
A7JT78_PASHA/34-104--------------------------------------------------------------------------GNYLEQ
A5FV68_ACICJ/239-315--------------------------------------------------------------------------GTAVTE
Q3SJS3_THIDA/32-102--------------------------------------------------------------------------GNALDQ
A0KI84_AERHH/30-100--------------------------------------------------------------------------GNYVEQ
Q1ZGE3_9GAMM/45-115--------------------------------------------------------------------------GNYIDT
Q3IE33_PSEHT/35-105--------------------------------------------------------------------------GNFLEQ
Q1YIM3_MOBAS/35-111--------------------------------------------------------------------------GYVIDE
A6W2D6_MARMS/31-103--------------------------------------------------------------------------GNLVTK
A4A5R9_9GAMM/32-102--------------------------------------------------------------------------GNLVTQ
A3TX83_9RHOB/22-98--------------------------------------------------------------------------GYVPEE
Q2G501_NOVAD/31-107--------------------------------------------------------------------------GYIIDE
A7HX93_PARL1/37-112--------------------------------------------------------------------------GYIFDP
A3WGB0_9SPHN/35-111--------------------------------------------------------------------------GFVNDA
A3WPM9_9GAMM/35-105--------------------------------------------------------------------------GNYLEQ
Q983A2_RHILO/103-179--------------------------------------------------------------------------GYVYDQ
Q7NX33_CHRVO/32-104--------------------------------------------------------------------------GNYVTQ
A4EML3_9RHOB/35-111--------------------------------------------------------------------------GFIPPE
A3XBH2_9RHOB/39-115--------------------------------------------------------------------------GYVPTE
Q2YBT7_NITMU/31-101--------------------------------------------------------------------------GNVITQ
A2SC95_METPP/48-118--------------------------------------------------------------------------GNVVTQ
Q1QE29_PSYCK/52-131--------------------------------------------------------------------------GTPITQ
Q3ZU02_ECOLX/52-122--------------------------------------------------------------------------GSWPLP
A1K8N9_AZOSB/69-139--------------------------------------------------------------------------GNYVDQ
A7INK8_XANP2/42-117--------------------------------------------------------------------------GYVLAE
Q1QSW6_CHRSD/33-103--------------------------------------------------------------------------GNLINQ
A6AQ89_VIBHA/35-105--------------------------------------------------------------------------GNYVEQ
A0NMF1_9RHOB/29-104--------------------------------------------------------------------------GHVITS
Q1H393_METFK/54-124--------------------------------------------------------------------------GNVVTS
A4CD42_9GAMM/31-101--------------------------------------------------------------------------GNFLEQ
Q1Z300_PHOPR/34-104--------------------------------------------------------------------------GNYLEQ
Q0G6I2_9RHIZ/46-123--------------------------------------------------------------------------GYVIDE
Q0I1R6_HAES1/25-95--------------------------------------------------------------------------GNYLES
A3MZE6_ACTP2/34-104--------------------------------------------------------------------------GNYLEQ
B0T0T5_CAUSK/29-105--------------------------------------------------------------------------GFQAIE
A0Z1I1_9GAMM/51-121--------------------------------------------------------------------------GNIITP
Q1YQK7_9GAMM/34-104--------------------------------------------------------------------------GNIVDQ
A6GNF7_9BURK/49-119--------------------------------------------------------------------------GNFITQ
A1WX37_HALHL/38-106--------------------------------------------------------------------------GNLLEE
Q0FTJ6_9RHOB/18-94--------------------------------------------------------------------------GYVPSE
Q0I3M4_HAES1/52-122--------------------------------------------------------------------------GSWPNW
A7C6T6_9GAMM/33-103--------------------------------------------------------------------------GNLVTQ
Q11J87_MESSB/48-124--------------------------------------------------------------------------GYVIDP
A4XUA2_PSEMY/28-96--------------------------------------------------------------------------VTFRDE
Q28RF7_JANSC/34-109--------------------------------------------------------------------------GYVPPP
Q5QXM4_IDILO/32-102--------------------------------------------------------------------------GNYLEQ
BAME_BUCAI/32-101--------------------------------------------------------------------------ATHLNK
Q0B235_BURCM/41-111--------------------------------------------------------------------------GTFVNV
A9AMY8_BURM1/53-123--------------------------------------------------------------------------GTFVNV
Q0BTE4_GRABC/35-111--------------------------------------------------------------------------GNKVDV
Q2NDV7_ERYLH/16-92--------------------------------------------------------------------------GYVVDQ
Q122Q0_POLSJ/29-99--------------------------------------------------------------------------GNFISS
Q3JBU9_NITOC/42-112--------------------------------------------------------------------------GNVITQ
Q7VM11_HAEDU/34-104--------------------------------------------------------------------------GNYLEQ
Q6D4H9_ERWCT/28-96--------------------------------------------------------------------------ESYVNE
A6VCY4_PSEA7/30-98--------------------------------------------------------------------------ITFRDE
A5V7M5_SPHWW/32-109--------------------------------------------------------------------------GYVVDS
Q1GPC4_SPHAL/37-113--------------------------------------------------------------------------GYVVDP
A6EYM2_9ALTE/29-99--------------------------------------------------------------------------GNILTD
Q0VSU2_ALCBS/35-105--------------------------------------------------------------------------GNFVTE

PF07467

Q9KJ90_STREX/2-185---------------------------------------VKARIARTGISLVAAAAAVVATTSSAQA-------NSGFSA
P97062_STRCL/2-181---------------------------------------VK.KTWRSALALTAAAGAVLATATSAHA-------YTGFTP
BLIP_STRCL/10-200---------------------------------------VR.RLGRAVVMAAAVGGLVLGSAGASNA-------AGVMTG

PF12978

Q8DTX1_STRMU/47-205--------------------------------------------------------------------------ENLDFR
Q3CZX6_STRAG/47-206--------------------------------------------------------------------------DHEELR
E7FPD9_9LACO/70-224--------------------------------------------------------------------------KNAELR
B9DSB0_STRU0/47-205--------------------------------------------------------------------------SHQDKR
C2LUW8_STRSL/44-203--------------------------------------------------------------------------KHGNVR
Q044U3_LACGA/47-206--------------------------------------------------------------------------QNKELR
A9D9J1_9VIRU/47-206--------------------------------------------------------------------------QNKELR
C0ME71_STRS7/45-203--------------------------------------------------------------------------EHQDIR
A2RE59_STRPG/46-204--------------------------------------------------------------------------AHQDKR

PF13670

Q0BXA6_HYPNA/7-95----M-IATP------------A...PLALA.DDDDGARRTSGS-------E----RAY-TL..TR--------------
Q0BXA5_HYPNA/6-84----A-LAAP------------A...PLALA...........QG-------T----TGD-LL..TR--------------
A3WRM0_9BRAD/6-83----A-FLGA------------A...TPALA............Y-------D----SGS-LL..SM--------------
Q0BY17_HYPNA/6-92----I-IVTA------------ALSPAPALA......QRGDDRS-------F----AGF-QV..SR--------------
A4VHV2_PSEU5/30-109----V-AILG------------S...GAAFA..........ADK-------P----GAD-WI..TL--------------
A4XVH9_PSEMY/6-85----G-GLLL------------A...GNAMA...........DR-------P----GGD-WI..SI--------------
Q3KD49_PSEPF/7-87----A-SLLS------------A...GAALA...........DR-------P----GAG-WI..TI--------------
B1ZL54_METPB/14-93----A-TLIA------------GLA.APALA...........DA-------P----GKD-WM..PI--------------
C7CAP4_METED/4-84----A-TLAT------------GLLAASAHA...........DT-------P----GKD-WM..PI--------------
A3WVM1_9BRAD/4-83----T-AWVL------------A...ASGLA.........HADQ-------P----GTD-WI..PA--------------
Q1QMT6_NITHX/5-85----M-MLVL------------A...ATSFA.........YADQ-------P----GSD-WM..PA--------------
Q07QG0_RHOP5/5-84----A-GLIV------------G...SASLA.........SADQ-------P----GAD-WM..PA--------------
B8EKV5_METSB/3-81----S-VLVA------------A...SATFA.........FGDT-------P----GPD-WI..SK--------------
Q3BZQ4_XANC5/7-87----A-LALL------------S...QGALA........QAADK-------P----AKA-LT...S--------------
D8JU49_HYPDA/7-90----A-FALT------------....TSAHA....GHDGPRLNV-------P----ADK-WL..SV--------------
Q0FJR3_9RHOB/4-79----T-ALAL------------A...GPAFA.........SPDV-------D----AAT-.....Q--------------
B6B6G1_9RHOB/5-81----A-LTLP------------A...AAAFA.........SDSA-------P----SAE-T....Q--------------
A3X8K5_9RHOB/6-81----A-TLIP------------....VAALA.........SSDK-------P----SPD-V....E--------------
A4F198_9RHOB/68-143----A-IALP------------....AAAFA.........SGLS-------P----KAE-D....Q--------------
B9QWG8_9RHOB/19-97----A-VMLA------------A...GSALA.........AVAV-------G----DTL-GT..KV--------------
Q5LX53_SILPO/50-129----A-LALA------------A...SPVLA........LDLTT-------D----TQL-GS..TP--------------
A3JXM1_9RHOB/4-83----S-LALT------------P...AIAFA.........MPSV-------G----DVV-GT..NP--------------
B1G434_9BURK/9-91----A-AIAL------------P...LSAQAT......GSCTTE-------P----KAK-WM..QD--------------
B8IVF4_METNO/5-90----L-ATGL------------A...VPAMA.....DGLDHRCS-------P----VAD-GRIVAA--------------
A5EBJ8_BRASB/4-90----A-LAAA------------AASGSVALA....DGYKDCTKL-------D----KAS-WK..TV--------------
Q1I4X8_PSEE4/3-87----I-LLLT------------S...TAAFA.....AEPKCTTA-------D----KAT-WQ..DA--------------
B3PI60_CELJU/2-85----A-LASF------------S...SLAIAG......PQCTET-------D----KSQ-WL..DQ--------------
C1DNM7_AZOVD/2-85----G-LALA------------S...PLALAG......PRCSEA-------D----KAQ-WQ..DP--------------
A3WIS1_9GAMM/4-89----G-TLLL------------S...ACSAE....ESHTQCTSA-------P----QSE-WI..DQ--------------
Q1LBN9_RALME/3-85----V-AGVF------------S...TAAFAG......ANCSKH-------P----KSE-WM..PE--------------
Q46SM0_CUPPJ/3-85----V-AAAF------------S...TGALAS......AKCVAH-------P----KAE-WM..KE--------------
Q8XWW7_RALSO/3-85----L-ATAC------------S...ASAFAS......ANCTAH-------P----KNE-WM..PE--------------
B9YYZ8_9NEIS/4-86----I-AAVA------------A...PAAFAA......AKCEQH-------P----KEQ-WI..KE--------------
A1K227_AZOSB/5-88----A-ACTL------------S...TVALAG......PQCTEA-------P----KSQ-WL..PE--------------
Q5P431_AROAE/5-88----A-GLTL------------S...AVAFAG......PQCTDM-------P----KSD-WM..SE--------------
Q5P432_AROAE/18-101----S-SVLM------------G...TAAFAG......PACTET-------P----ESS-WM..PQ--------------
D0KWU4_HALNC/5-88----T-AAFM------------S...TAAQAG......PQCTQE-------P----RSA-WM..PA--------------
B0SVT0_CAUSK/5-90----A-AATL------------SIAGAAVAG.......PKCTTE-------P----KSK-WL..TE--------------
B3PS83_RHIE6/3-88----A-VAIV------------ALAPALAFAS......PSCTKE-------P----KSK-WM..SE--------------
A7IQ54_XANP2/6-90----G-LCLL------------S...SAALAS......PTCTKE-------P----QEK-WL..SE--------------
Q8D5M1_VIBVU/5-90----A-LISM------------G.SATSALA......DPQCTNA-------P----ESQ-WI..NF--------------
D2YV68_VIBMI/5-91----A-ITSL------------GLVSAAAFA......DPTCTKE-------P----ESS-WI..PF--------------
B1Y4P0_LEPCP/3-85----A-LTLI------------A...SAAFA.......GPTCNV-------P----EDK-WM..KE--------------
B8IVE9_METNO/4-91----A-IAVL------------GGV.SAAQA...SSLGRPCTTA-------P----QSQ-WL..PV--------------
Q07GW2_RHOP5/24-110----A-ALLA------------GI..TAANA...DSWGKPCTSA-------P----ESQ-WL..SV--------------
Q1QM54_NITHX/4-90----A-AVTL------------GA..ATAQA...GSLGKPCTSA-------S----EAQ-WL..PV--------------
A9DGE5_9RHIZ/5-87----I-ATFA------------P...AAAFAT......DDCPSV-------P----RDQ-WL..SV--------------
C9X3G7_NEIM8/6-91----L-SA..------------....ATAFA...DDSAERQIYG-------D----PHF-EQ..NR--------------
C5TKZ2_NEIFL/6-91----L-SA..------------....ATAGA...SDYIEHKIYS-------D----KNF-EQ..NR--------------
B6BXY0_9GAMM/6-84----V-LTIL------------P...TMVLA.........GDKP-------P----KDS-KP...L--------------
B4X0R3_9GAMM/21-99----A-SLGL------------S...PLSLA..........DER-------P----PEG-AK..PI--------------
Q2C6V1_9GAMM/7-89----M-SLFF------------M...STAHA.........DPIE-------K----SSD-VI..SI--------------
A1B769_PARDP/5-86----L-VVLP------------S...GAALA.......GDDCAV-------P----LAD-WQ..PR--------------
A3W5R2_9RHOB/5-86----L-ALIP------------A...GTALA.......SDDCFV-------P----MAD-WQ..PR--------------
A6FVG6_9RHOB/5-86----I-AVLP------------A...GAALA.......DDDCYA-------P----MAD-WQ..PR--------------
A6FVG8_9RHOB/5-87----F-ATLP------------A...GAVLA......DDDDCFV-------P----RDQ-WQ..PQ--------------
A1B772_PARDP/5-86----L-AVLP------------A...AGALA.......GDDCHV-------P----RGA-WQ..PR--------------
A1UW16_BURMS/12-98----L-VLGG------------ALGIRAAMA.....DDGDDCRA-------P----LAD-WK..PR--------------
Q46QS0_CUPPJ/12-98----V-ALVG------------AAGIHPALA.....HDNDDCEA-------P----VNA-WK..PR--------------
Q1MGZ9_RHIL3/5-86----L-AVMA------------V...TSAQA.......RDDCDV-------P----ISN-WK..TH--------------
B6JDT2_OLICO/6-87----F-ALAG------------S...GAAMA.......DDDCNV-------P----MNQ-WQ..SR--------------
A5VTX2_BRUO2/5-87----I-AAIA------------AP..QAALA.......DNDCNV-------P----MDK-WQ..SR--------------
A1U059_MARAV/5-86----S-LLLL------------S...GTAVA.......DDDCDD-------P----VAS-WQ..PR--------------
A1SRM1_PSYIN/5-86----V-LSLC------------S...AVAQA.......EVECRD-------P----VDK-WQ..PQ--------------
C8RZP8_9RHOB/6-87----V-AGLL------------A...TAAYP.......GDDCTA-------P----MST-WQ..PR--------------
A6UM17_SINMW/4-85----L-AAAF------------G...GTALA.......SEKCNA-------A----MAD-WK..PR--------------
B9K2Y3_AGRVS/4-85----I-TLAL------------A...GPLLA.......GEKCAV-------P----LKE-WQ..PR--------------
A7IKT6_XANP2/6-87----A-VCLG------------A...GPAVA.......DRACTV-------P----LAD-WQ..PR--------------
A1B771_PARDP/5-86----A-LAIP------------A...GAALA.......DEKCNV-------P----TEN-MQ..SW--------------
B2S782_BRUA1/5-86----V-ALSA------------T...GAMAQ.......KTQCDA-------K----PLD-EK..SI--------------
Q0AG96_NITEC/6-89----A-TMFF------------SF..NSAFA.........GNEG-------L----PAD-QV...I--------------
A6T0P1_JANMA/11-102----A-LAFA------------AQAGPAAAQ..TTAVATQGKLA-------P----IAT-GATLSY--------------
Q0S079_RHOSR/10-95----A-VAIG------------T...GVAVA......SSGDQET-------P----ITG-DA...L--------------
D0DC31_9RHOB/4-83----A-LCLA------------....APAMA...........DD-------M----VSD-EA...K--------------
A8LNS6_DINSH/4-81----A-MVVA------------....STGFA............S-------E----VDE-AT...E--------------
A3PJ37_RHOS1/4-81----V-LAAT------------T...TGAVA............Q-------E----VDE-AT...V--------------
Q0G655_9RHIZ/24-110----A-SLFA------------AGS.TMAFA....QDGDDTVEE-------M----ASE-EE...T--------------
D8JXS4_HYPDA/4-89----R-AFAV------------A...AMAFA.......MSAPVL-------A----GHD-VVRDDP--------------
D8JRG1_HYPDA/7-86----S-TALF------------A...GAAFA.........DGRP-------P----TAE-E....T--------------
A5VRY8_BRUO2/10-90----G-TVIS------------A...GTALA..........GRH-------P----QPD-E....R--------------
B1ZIF7_METPB/6-84----G-VALL------------S...GPALA.........DEKL-------P----PDQ-.....Q--------------
B1M6N2_METRJ/3-84----A-LTLI------------A...GSSLA......ARADEKL-------P----PDQ-.....Q--------------
A7HVA0_PARL1/7-87----A-VPAT------------S...LPALA........TDDRA-------P----TAE-E....R--------------

PF03413

Q4K807_PSEF5/38-102----L.NQAA........---.L---AQ................H......PGTTAAS.-ITD...--------------
Q8D7W4_VIBVU/128-189----A.KGIV........---.M---MKI..............G......GH....GR.-WTT...--------------
Q9KC80_BACHD/94-154----V.RAII........---.E---KE...............L.......A....VR.-ELV...--------------
Q9K7V1_BACHD/28-100----A.LKLA........---.K---RTFAP.........NMNI.......T....GS.-WIH...--------------
Q6W134_RHISN/286-345----A.VATF........---.D---RL............................GLH-HGY...--------------
A8FCD9_BACP2/110-169----A.EQIA........---.L---AK...............V.......K....GT.-VTD...--------------
A5UQY0_ROSS1/111-167----A.QTIA........---.L---SL...............A.......N....GA.-TLT...--------------
A5MW77_STRPN/106-160----A.ETVS........---.K---EK.......................G....AG.-EID...--------------
Q8E8L7_SHEON/45-99----A.VAMA........---.Q---RQ...............Y.......R....GK.-VLS...--------------
Q03RI8_LACBA/34-106----I.LEQV........---.K---RQFRE.........ESPI.......E....GA.-WIE...--------------
Q6GFW2_STAAR/32-101----V.LNEV........---.K---SYFM............NV.......K....GS.-YIV...--------------
Q38Z32_LACSS/130-188----A.QKKA........---.Q---HY...............F.......D....GD.-VLE...--------------
Q0VNU0_ALCBS/63-123----L.LETL........---.K---LR...............Y.......P....QGR-VLE...--------------
A0REW6_BACAH/375-436----A.RKKI........---.N---PD...............V.......K....VM.-EER...--------------
Q186H8_CLOD6/144-202----A.MEIA........---.L---KE...............Q.......N....GI.-VKE...--------------
Q3ETC3_BACTI/150-220----A.IEIA........---.Q---QDLG...........VTP.KY.EVEP....KA.-DLY...--------------
Q5WGU9_BACSK/378-439----A.QAKV........---.N---KH...............V.......E....IQ.-EDH...--------------
Q3DSW2_STRAG/153-213----A.LQAI........---.Q---AK...............Y.......K....NA.-KIK...--------------
Q6EA99_LISMN/121-195----A.IEKA........---.F---EAIGQSEAHVKSYIGNPV.......K....EK.-EII...--------------
A0REU8_BACAH/162-234----ATQYIYTKYGNDIN---FI---SE...............P.......E....VK.-EVI...--------------
Q8KFX7_CHLTE/45-103----A.VNAA........---.E---TF...............T.......R....GR.-AVR...--------------
Q8TLV5_METAC/114-171----A.LEIA........---.Q---DE...............................-......--------------
Q6ANJ0_DESPS/50-117----L.SQVV........---.E---EQ...............A.......K....KT.-AAT...--------------
Q5KVG3_GEOKA/282-341----V.YAIA........---.E---AK............................KVK-KPF...--------------
Q9A4R3_CAUCR/50-105----V.IEMI........---.G---RR...............V.......P....GR.-VLD...--------------
NPRM_BACME/152-222----A.IQAA........---.E---KDLG...........FKP.TY.EKSP....SS.-ELY...--------------
Q8RBF9_THETN/464-522----A.YKIL........---.L---DN...............Y.......E....MK.-LNY...--------------
Q7P204_CHRVO/118-188----V.LSQA........---KA---LK...............A.......N....GN.-PTY...--------------
A3HZ45_9BACT/55-116----I.SEIA........---.Q---DV...............Y.......P....EGH-LHAILY--------------
Q72M70_LEPIC/153-248----A.FSKA........---.L---KH...............F.......G....AK.-KYI...--------------
Q5WLC0_BACSK/141-199----A.VDIA........---.L---SE...............A.......E....GA.-ISS...--------------
Q8ERG4_OCEIH/132-194----A.LSTA........---.S---EVQEV..........QDL.......T....PT.-SWK...--------------
Q8E690_STRA3/31-94----A.LAIA........---.Y---KD...............A.......K....VA.-KKD...--------------
Q8R5X9_FUSNN/83-142----A.SRIG........---.L---DNS..............F.......N....GK.-VKS...--------------
A3UR63_VIBSP/116-190----A.IEAALS....AH---RS---FT...............V.......G....KK.-SIE...--------------
Q8PEF5_XANCP/86-141----I.RAAL........---.S---TK...............................-......--------------
Q93J57_STRCO/330-390----V.LEKA........---.R---AA............................GLD-GPV...--------------
A7GDD3_CLOBL/148-213----A.IAKA........---.K---ND...............I.......E....DE.-KAT...--------------
C3NWD2_VIBCJ/115-190----A.IALAVSHFGEQH---AG---.........................E....SL.-PVE...--------------
Q1Q7U9_PSYCK/44-104----A.LVLA........---.N---KA...............V.......K....GD.-IIS...--------------
Q15RY9_PSEA6/32-87----A.AQKA........---.Q---QQ...............V.......Q....GR.-VLK...--------------
A0KRR6_SHESA/27-86----I.MQRY........---.E---SR...............L.......K....GR.-LLD...--------------
Q6HZB7_BACAN/163-222----A.KDIA........---.V---QQ...............V.......P....GN.-EKG...--------------
Q8TTA4_METAC/138-199----A.KSIA........---.L---EK...............V.......S....GAT-ESDI..--------------
Q5X972_LEGPA/122-197----A.KEYAKKSYFQFS---PQ---...............................S.-NIQ...--------------
Q9L1F9_STRCO/146-216----A.LSAA........---.K---DA.......................G....SS.-KTA...--------------
A1S2N2_SHEAM/113-188----A.LEIAKAA...KG---GH---GL.......................K....AG.-KTR...--------------
Q9L126_STRCO/81-167----A.ADTA........---.V---KE...............V.......P....EGK-LVDLEL--------------
A3D9D2_SHEB5/116-190----A.LDIAIRGKSEKA---VA---GL.......................K....A..-..E...--------------
A8MEK6_ALKOO/172-230----A.KKIA........---.L---EK...............I.......N....GK.-VIK...--------------
C1DJ09_AZOVD/39-99----L.NAAA........---.Q---AK...............H.......P....GST-IHE...--------------
Q1QQG0_NITHX/28-83----A.LAVA........---.T---DI............................GL.-......--------------
A5G759_GEOUR/48-108----A.TEIA........---.L---KE...............V.......P....GK.-VTS...--------------
A7Z7T0_BACA2/28-100----A.LRIV........---.K---AAFKQ.........RGPI.......D....GS.-WIY...--------------
Q0AQU2_MARMM/109-177----A.RNIA........---.L---AR...............Q.......N....GL.-GEI...--------------
A1S4V2_SHEAM/92-162----A.IAAL........---.N---KV...............Y.......P....GA.-VAS...--------------
A6P1K3_9FIRM/263-321----A.REIA........---.L---AQ...............L.......P....GAT-LKE...--------------
A3YDS2_9GAMM/122-191----A.IAIALRKDGLTK---P.---.................................-..E...--------------
Q2MG71_MICEC/79-138----A.EEIA........---.L---AK...............A.......G....GGR-VVE...--------------
Q825U8_STRAW/286-346----I.LAAA........---.R---AK............................GLG-DPV...--------------
A5EBU9_BRASB/13-71----A.MAIA........---.E---RL...............H.......E....GSR-TTD...--------------
Q181V6_CLOD6/408-465----A.KSIA........---.L---DA...............V.......P....NG.-NLI...--------------
A3IDB5_9BACI/37-95----I.EKKA........---.L---AV...............V.......D....GT.-VAD...--------------
A5W1K1_PSEP1/32-87----A.EATL........---.K---GA...............................-......--------------
Q8ESN0_OCEIH/32-90----I.KQLV........---.K---EQ...............Y.......P....GT.-QNE...--------------
A4XTT8_PSEMY/39-99----L.DEAI........---.L---AQ...............H.......P....GAR-IEE...--------------
A7N0D3_VIBHB/111-186----A.IEIATG....TE---QG---FA...............S.......N....ES.-PEN...--------------
A4JUZ6_BURVG/39-97----A.VTVA........---.E---QH...............A.......N....GK.-ASR...--------------
Q9R9S7_AERPU/113-179----A.....AL....KA---RA---GA.......................K....G..-..S...--------------
Q9A8Q0_CAUCR/73-133----I.LAIA........---.A---ER...............A.......P....GE.-VIE...--------------
Q81R43_BACAN/43-101----A.KQIA........---.I---EK...............V.......N....GV.-VEE...--------------
Q1MKW1_RHIL3/284-343----A.AEIA........---.K---RL............................GMA-PGF...--------------
Q5FIK0_LACAC/141-199----A.STIA........---.E---EH...............A.......K....GT.-SRE...--------------
Q3KIR7_PSEPF/283-342----V.QNIA........---.V---ER............................KVE-PGY...--------------
Q6GJS7_STAAR/52-111----A.VKKA........---.E---ET...............Y.......K....GQ.-KLK...--------------
Q5WLC0_BACSK/58-117----A.VSEF........---.E---NA...............Y.......P....DAS-ISS...--------------
Q884E8_PSESM/260-320----A.VAIA........---.K---ER...............I.......P....GL.-EAS...--------------
Q5FIK1_LACAC/43-101----A.VKKF........---.Q---AK...............Y.......N....AK.-IKS...--------------
A7VSV8_9CLOT/98-161----A.KSIA........---.L---KDAG...........VSE.......S....ATQ-FVW...--------------
Q9L7Z4_STACR/122-196----A.LNNA........---.F---KA...............V.......K....MT.-RNE...--------------
Q8RTZ9_9GAMM/126-201----A.MAKGLANSPAAI---KS---VG...............L.......K....K..-..H...--------------
A6AL37_VIBHA/130-204----A.KSKVQ.......---KQ---FV...............I.......D....GY.-QIE...--------------
Q3D1Y5_STRAG/117-182----A.KKIA........---.F---KDANI..........EES.......E....VS.-NLK...--------------
Q4ZPX1_PSEU2/38-99----F.NKQA........---.V---AK...............H.......T....GFT-VHD...--------------
Q8RBF9_THETN/109-184----A.RKVAIEFLQKIT---PE---KF...............K.......Q....TK.-EIV...--------------
Q4MVM1_BACCE/29-101----A.LKMV........---.K---QALSH.........KGEI.......T....GS.-WVH...--------------
A9VL27_BACWK/39-104----V.REIS........---.L---AH...............T.......N....GE.-IIN...--------------
C2SHN7_BACCE/94-163----A....L........---.Q---RTIEQVGD...ESKEPKS.......K....PK.-EIL...--------------
B1KR36_SHEWM/116-189----A...IAASI...KG---KN---GL...............A.......K....SA.-KRH...--------------
Q6HDI2_BACHK/430-497----A.LEIY........---.R---DA...............I.......R....VK.-LEW...--------------
Q8KI45_ENTFL/35-92----A.AEIY........---.E---KE...............A.......G....NS.-KPL...--------------
Q9KE75_BACHD/74-132----L.VARA........---.K---EA...............F.......P....ES.-PVS...--------------
Q1JAF1_STRPB/81-144----A.KSIA........---.L---KDASV..........TEA.......D....AQ.-MLS...--------------
Q4EQU7_LISMN/131-191----A.RDKV........---.T---K.E..............K.......K....PK.-KIL...--------------
Q4JLE6_LACRE/76-135----A.IDQF........---.N---KK...............Y.......P....DKH-LNE...--------------
Q9L126_STRCO/188-249----A.VKAA........---.T---AK...............A.......K....GT.-VTH...--------------
Q8P606_XANCP/82-140----L.VDAA........---.Q---RA...............Q.......A....GT.-VFR...--------------
A5W5R7_PSEP1/39-99----L.KAAA........---.V---AK...............H.......P....GAT-VTD...--------------
Q181V6_CLOD6/490-547----A.KSIM........---.L---DK...............V.......P....GG.-KIV...--------------
Q2FUX4_STAA8/118-192----A.ADKA........---.F---KA...............V.......K....ID.-KNK...--------------
Q3DA42_STRAG/78-137----A.LETA........---.K---KE...............A.......R....SGF-ISQ...--------------
A7G9N1_CLOBL/383-444----A.QKKV........---.G---KN...............L.......N....IT.-NIR...--------------
B0KBH9_THEP3/371-432----A.EQKV........---.N---KN...............L.......K....IE.-GRK...--------------
Q1IC64_PSEE4/41-101----L.LEAA........---.L---GR...............Y.......P....GAR-LLE...--------------
Q0HTI7_SHESR/103-173----A.IAAL........---.N---RL...............Y.......P....GS.-AAT...--------------
Q82ND7_STRAW/171-257----A.VDAV........---.L---AR...............L.......G....AE.-KFT...--------------
B9LEH7_CHLSY/84-135----A.AQIA........---.L---SV...............R.......G....GE.-IRE...--------------
Q97G52_CLOAB/161-230----A.ISIA........---.K---KQ...............F.......S....FKS-LVE...--------------
Q5M069_STRT1/87-141----A.KKAA........---.K---AY.......................G....AK.-DIA...--------------
A6V146_PSEA7/122-192----V.LAQA........---KS---LK...............A.......Q....GR.-KTE...--------------
A7FTW6_CLOB1/148-213----A.IAKA........---.K---GD...............I.......K....DQ.-KSN...--------------
Q8U1R9_PYRFU/327-383----V.KEIV........---.V---EK...............................-......--------------
Q1H2G7_METFK/106-166----A.RKTA........---.L---AA...............H.......P....GE.-IVE...--------------
B8G477_CHLAD/218-274----A.IAAA........---.V---SY...............L.......G....GGT-VAK...--------------
Q5UKQ5_9BACI/139-216----A.LDHA........---.F---KA...............I.......G....KSP-EAVSNG--------------
Q5GXB5_XANOR/79-137----L.VAAA........---.Q---QR...............Y.......G....GS.-LFV...--------------
NPRE_PAEPO/214-283----A.EKSS........---.I---AK...............I.......A....NL.-QPE...--------------
Q1ARP9_RUBXD/67-126----A.ERAA........---.L---EN...............V.......S....GT.-VVE...--------------
Q2B384_9BACI/29-101----A.LDQA........---.K---AAFKK.........NGPI.......S....GS.-WIH...--------------
A6NW01_9FIRM/193-253----A.KAIA........---.K---AKA..............P.......S....TAT-VVK...--------------
Q97GS5_CLOAB/161-230----A.VNIA........---.L---KQFT............YK.TL..ENT....PK.-AIK...--------------
A5WGS1_PSYWF/34-90----A.ITIA........---.K---QK...............A.......Q....GK.-VKS...--------------
Q6HZB7_BACAN/33-91----I.QSIV........---.S---EQ...............Y.......P....GK.-IKS...--------------
Q46237_CLOPF/161-230----A.IEIA........---.K---SS...............K.......S....YD.-ILS...--------------
A3QGG2_SHELP/47-105----A.TQMV........---.K---GR...............Y.......N....AK.-VLS...--------------
A3UN73_VIBSP/32-105----A.VEIAKS....KH---KG---IA...............A.............A.-TIR...--------------
A0M3G0_GRAFK/62-119----I.KNIV........---.Q---ER...............Y.......P....GTT-DDF...--------------
Q2SJ90_HAHCH/129-208----A.LNIAKN....NS---GF---TF...............V.......N....AP.-QFR...--------------
YPEB_BACSU/377-438----A.KSKL........---.N---KN...............V.......Q....VR.-ETR...--------------
A6P1K3_9FIRM/443-502----A.RALV........---.L---AR...............V.......P....GAT-IVE...--------------
Q047A4_LACGA/60-119----A.INKF........---.D---KK...............Y.......S....DKK-LKE...--------------
Q3K852_PSEPF/38-98----M.NEQA........---.L---KL...............H.......P....GAT-ITD...--------------
Q7A1T8_STAAW/129-187----A.IKEG........---.Q---KE...............F.......D....GD.-IKE...--------------
Q884E8_PSESM/67-126----I.RATI........---.E---RN...............E.......P....DL.-IVG...--------------
B3XMM9_LACRE/153-213----A.SQIA........---.E---KA...............A.......K....KGS-AIE...--------------
A9VSE9_BACWK/148-221----V.KSKLRNILQIPS---DA---TE...............T.......E....FS.-SET...--------------
Q211C9_RHOPB/96-155----A.MTIA........---.Q---QQ...............H.......A....NSK-IAD...--------------
A8MEK5_ALKOO/294-355----A.IRIS........---.L---SLT..............K.......G....GT.-IIS...--------------
A6FBW4_9GAMM/126-204----A.LRQAKRLSRPAT---PL---AE...............N.......K....SV.-ATE...--------------
Q5X0P7_LEGPA/120-190----I.EQKI........---.L---GK...............V.......A....EP.-VKF...--------------
YKOI_BACSU/164-223----A.KTIA........---.E---RK...............T.......G....GT.-ADD...--------------
Q8EP78_OCEIH/29-101----A.LNQA........---.K---EMFKR.........KGPI.......S....GS.-WIY...--------------
Q541Q2_VIBAN/116-194----A.VSIALTHYQQQN---PS---LT...............S.......A....DL.-VTE...--------------
Q81R44_BACAN/99-158----A.EEMA........---.L---QK...............V.......Q....GE.-IKY...--------------
Q9I178_PSEAE/60-119----V.LKAI........---.N---EA...............Q.......P....DL.-LVE...--------------
Q5KXX8_GEOKA/94-154----A.RAIL........---.Q---RD...............R.......R....PR.-RII...--------------
Q7NNP8_GLOVI/232-295----A.VEKA........---.L---PA...............L...............-......--------------
Q7CY41_AGRT5/75-132----I.IAAA........---.L---AA...............V.......P....GT.-AVK...--------------
Q47KW9_THEFY/83-144----Q.VEAA........---.Q---EA...............H.......P....EG.-TLH...--------------
Q9KFU6_BACHD/49-108----A.SDIA........---.L---ER...............A.......G....NGV-VTE...--------------
Q825U8_STRAW/84-147----Q.VAAA........---.R---KA...............H.......P....EG.-TLT...--------------
Q4EUP2_LISMN/142-200----A.MDKA........---.V---SE...............Q.......A....GD.-VTS...--------------
Q2NX96_XANOM/33-88----V.TSML........---.T---AK...............................-......--------------
A7ZG54_CAMC1/58-115----I.LAKA........---.K---SE...............I.......K....FD.-TLE...--------------
YPEB_BACHD/374-435----A.RERL........---.N---PR...............L.......E....VM.-EDH...--------------
Q82ZK1_ENTFA/63-122----V.TTAF........---.E---KK...............Y.......P....EAK-ITS...--------------
Q47MU5_THEFY/138-194----A.VRVA........---.L---DD...............S.......G....GSE-ATE...--------------
Q3K994_PSEPF/60-119----I.ISAI........---.K---TA...............E.......P....QL.-LVE...--------------
THER_BACCL/139-214----A.EMIA........---.K---QD...............V.......A....DA.-VTK...--------------
Q82BN5_STRAW/115-187----A.TAAL........---.R---AA...............N.......T....GE.-LLK...--------------
Q71Z55_LISMF/29-101----I.LEKV........---.K---DAFKQ.........EGPI.......E....GS.-WIQ...--------------
A8MEK6_ALKOO/94-155----A.KKIA........---.I---AL...............I.......N....GE.-IIK...--------------
Q4MSV8_BACCE/94-162----ALQKLA........---.E---QASGKG.......DEPKP.......K....PK.-EIT...--------------
Q82US0_NITEU/41-96----A.IAIA........---.Q---QH...............F.......S....GR.-VLA...--------------
Q3JE96_NITOC/270-334----A.VAIA........---.N---QV...............F.......P....NA.-ELR...--------------
F2MNH6_ENTFO/119-186----V.KKIV........---.A---SD...............N.......P....ET.-KDL...--------------
Q0BZN8_HYPNA/53-112----I.LGSV........---.L---QQ...............Y.......P....GE.-LLK...--------------
A6T0P0_JANMA/40-97----I.LAQT........---.A---TQ...............V.......S....GE.-VIK...--------------
Q0AR59_MARMM/55-114----V.ISEV........---.R---RR...............Y.......P....GAD-VLD...--------------
Q1J2R6_DEIGD/90-144----A.SQAA........---.Q---AA...............V.......P....GT.-VSS...--------------
A4BGK8_9GAMM/17-91----I.NQMV........---.E---RGELISVVSLQERYPALL.......G....GR.-WLD...--------------
Q8R5Y9_FUSNN/99-158----A.KEIA........---.L---KN...............S.......K....NG.-KFK...--------------
Q72M68_LEPIC/155-250----A.LSKT........---.L---KH...............I.......G....AK.-KYI...--------------
A0RG40_BACAH/171-259----A.LSNA........---.W---KHIKLTKSDTLVKMDGNA.......L....DQI-KENLES--------------
A6AYE9_VIBPA/130-204----I.RSKVQ.......---KP---YL...............D.......V....GY.-HIE...--------------
A6C2A1_9PLAN/247-311----A.TAIA........---.R---SL...............F.......P....DA.-EFK...--------------
Q9L2B8_STRCO/83-152----A.VAAA........---.L---AD...............T.......P....GT.-AVS...--------------
Q8ERG4_OCEIH/56-114----A.MQIF........---.T---DT...............F.......T....GA.-AIS...--------------
Q725B7_LISMF/59-118----A.INAF........---.K---DK...............H.......S....DA.-EIS...--------------
A3DI39_CLOTH/391-452----A.RSKI........---.S---SR...............M.......Q....VL.-SSG...--------------
Q9L2B8_STRCO/168-232----A.AEAA........---.K---AA...............A.......G....HG.-TVT...--------------
B8G480_CHLAD/109-162----A.RRIA........---.L---AA...............R.......N....GE.-IKS...--------------
Q815U2_BACCR/146-219----A.ETIA........---.K---AD...............I.......E....KE.-IGK...--------------
A6NW01_9FIRM/109-172----A.KSIA........---.L---SDAGV..........NAA.......D....AV.-FLK...--------------
A6CLW5_9BACI/159-247----A.VSLA........---.W---NYIELDESQTVTPEEETF.......A....AA.-KKSKVK--------------
Q186H8_CLOD6/62-121----A.INIF........---.K---DK...............Y.......K....DA.-DIV...--------------
Q5ZZ46_LEGPH/35-90----I.LQQL........---.S---DQ...............................-......--------------
E0THY6_PARBH/109-174----A.RRVA........---.E---YD...............F.......A....GD.-GHV...--------------
Q8PQ63_XANAC/120-190----A.LRVA........---.G---SHFDVAQDAAPRASLALY.......A....RQ.-G.....--------------
A5WGS1_PSYWF/109-165----A.IQIA........---.A---GH............................GQ.-VLE...--------------
A8LN27_DINSH/31-89----A.VAIA........---.Q---EA...............R.......P....GG.-ILE...--------------
Q48DF8_PSE14/60-118----L.QQRV........---.K---SA...............Y.......P....QA.-AIG...--------------
Q5HNG3_STAEQ/33-102----L.LNEV........---.K---TYFR............EV.......K....GS.-YIV...--------------
A4B9Z5_9GAMM/151-215----A.LQKM........---L.---...............................L.-SAE...--------------
Q988S6_RHILO/46-105----I.LDIV........---.R---AK...............A.......P....GD.-VVA...--------------
Q8VLQ5_PSEO7/125-198----A.LSQFEKQSLSAD---KK---.................L.......K....K..-..H...--------------
A4CC52_9GAMM/131-201----....QLSSIEGVAD---AK---EQ...............D.......K....K..-......--------------
Q3J9Y2_NITOC/30-84----I.VKSL........---.E---EQ.......................G....FKQ-ISE...--------------
Q391Q3_BURS3/71-131----L.LASA........---.R---TA...............M.......P....AG.-ATP...--------------
Q8ESM9_OCEIH/39-97----I.TSIV........---.N---EQ...............Y.......E....GD.-ITD...--------------
A6CTU8_9BACI/147-221----A.VSIG........---.E---KDLVS.........TVGSQPDYEYAP....MS.-EKI...--------------
A6AP50_VIBHA/116-190----A.LKVASKNLQDKG---FA---VK...............................-FLR...--------------
Q74LX8_LACJO/141-200----A.SEIA........---.E---KE...............V.......K....NSV-AKE...--------------
Q7X5N6_9BACL/163-236----A.LNKA........---.K---AS...............V.......G....VA.-NVS...--------------
B2TDF6_BURPP/75-135----L.LARA........---.R---AA...............M.......P....PT.-ALA...--------------
Q020P0_SOLUE/231-293----A.MQIA........---.A---AA...............I.......P....GT.-FPF...--------------
Q97G51_CLOAB/153-222----A.ISIA........---.E---KQ...............F.......N....YKT-LLE...--------------
A7ZEI5_CAMC1/22-81----A.LNIA........---.E---KN...............F.......P....GSS-VKD...--------------
Q6NKB0_CORDI/71-132----I.VDIA........---.R---AT...............H.......P....DL.-ELA...--------------
A3WUT4_9BRAD/64-123----M.AEAA........---.V---AV...............Y.......P....GG.-KVT...--------------
A8AXQ2_STRGC/352-411----A.LAVA........---.L---KD...............L.......G....LG.-EKD...--------------
E0TIH6_PARBH/43-102----A.VAIA........---.E---ER...............T.......G....GR.-AAE...--------------
A5W9M7_PSEP1/60-118----M.LAEV........---.R---QA...............Y.......P....KG.-HIA...--------------
Q82WV7_NITEU/279-343----A.WAIA........---.T---EH...............Y.......P....DG.-KFG...--------------
Q12WY7_METBU/120-186----A.MTKA........---.K---EI...............A.......N....TK.-YPD...--------------
B7WSK7_COMTE/118-177----A.VDAA........---.V---AS...............L.......P....GK.-PLE...--------------
A3TLC9_9MICO/123-187----A.RSAA........---.K---AA...............G.......Q....DV.-SSL...--------------
A5VEY7_SPHWW/24-82----A.IGVA........---.E---RS...............L.......S....AR.-AIE...--------------
Q0VNT9_ALCBS/52-112----L.DKVA........---.L---DK...............H.......P....DAK-ITD...--------------
Q474Y4_CUPPJ/260-324----I.MATA........---.Q---AE...............Y.......P....DA.-TVT...--------------
A6DY87_9RHOB/293-357----L.DALA........---.R---DI............................GFD-ARY...--------------
Q8ELD0_OCEIH/32-90----A.LQTA........---.L---KN...............T.......E....GF.-VQE...--------------
Q3JBE9_NITOC/51-111----I.LARA........---.L---KA...............Y.......P....GAQ-LLE...--------------
A4XTT9_PSEMY/41-101----L.MQHV........---.G---QA...............Y.......P....GST-LLE...--------------
A5TS99_FUSNP/24-83----A.KDIV........---.K---KE...............A.......P....NGQ-ITK...--------------
A6GN46_9BURK/40-99----I.FDRA........---.R---KV...............K.......P....GR.-IVD...--------------
A0Q324_CLONN/379-440----A.MSKI........---.G---KN...............L.......K....VQ.-STK...--------------
A7B3W1_RUMGN/132-193----A.TNLA........---.L---ER...............V.......P....GAS-AQDL..--------------
O27358_METTH/81-143----A.KSIA........---.Q---TY...............I.......K....QE.-GAA...--------------
Q48H34_PSE14/39-99----L.DANA........---.L---SK...............H.......P....GAS-ILD...--------------
Q1D8Q2_MYXXD/168-239----A.LDIA........---.M---KA...............F.......D....GK.-PDR...--------------
Q07JR2_RHOP5/48-107----L.LKLV........---.G---DQ...............M.......P....GE.-VTG...--------------
Q8R5X9_FUSNN/10-69----V.VDIV........---.L---RN...............Y.......P....QS.-RVT...--------------
A6GN43_9BURK/49-110----A.REIA........---.L---KE...............A.......P....GV.-VTE...--------------
A5W119_PSEP1/60-119----V.LKAL........---.R---EA...............R.......P....DL.-DVQ...--------------
YKOI_BACSU/98-153----A.EHLA........---.L---ER...............V.......P....GT.-......--------------
Q03GC8_PEDPA/34-106----A.LARV........---.R---RSFED.........DGPI.......E....GA.-WIE...--------------
Q9KE75_BACHD/288-347----V.TYLA........---.E---TR............................EVN-KPY...--------------
Q2RPG4_RHORT/72-131----I.LDRA........---.A---AL...............V.......D....GR.-FLE...--------------
YCDB_BACSU/416-471----A.KSIF........---.W---QH...............F.......K....VE.-LGW...--------------
A9KIB6_CLOPH/218-275----A.TEKI........---.K---KQ...............V.......S....MEL-KYL...--------------
Q1D188_MYXXD/208-277----A.MAAA........---..---.................V.......N....GL.-PDM...--------------
A9KIB6_CLOPH/317-399----A.IDKV........---.V---KNKYLLMDANIKAISASL.......S....GY.-RLY...--------------
Q6SFP6_9BACT/100-160----A.EKIA........---.L---KK...............Y.......N....GK.-IVD...--------------
A9C057_DELAS/120-179----A.IQAA........---.T---RH...............T.......P....GT.-PVS...--------------
A4VTY9_STRSY/109-163----A.QAIA........---.K---KN.......................G....AS.-QVE...--------------
Q8RBF9_THETN/290-362----A.LEIA........---.K---NS...............L.......P....FS.-LEG...--------------
A2SEW0_METPP/117-177----A.TKTA........---.L---AK...............H.......P....GK.-VER...--------------
Q2JP28_SYNJB/29-85----A.IRIA........---.R---SA...............V.......P....NAV-IKE...--------------
Q5WKR8_BACSK/122-181----A.IKRA........---.L---EE...............V.......D....GT.-VSE...--------------
Q6R6B9_LISSE/121-195----A.IEKA........---.F---EAIGRSQDNVISYSGNVI.......K....QK.-EIL...--------------
A4TZD4_9PROT/37-96----I.LARA........---.E---AA...............Y.......P....GQ.-LIE...--------------
Q63MT4_BURPS/165-233----A.LDRA........---.R---AY...............L.......G....VG.-GFV...--------------
Q6N7G2_RHOPA/56-115----A.IGIA........---.E---KR...............H.......P....GTK-SLR...--------------
A5W1V5_PSEP1/63-122----V.LEAL........---.N---KA...............E.......P....DM.-VVE...--------------
A6CHW0_9BACI/149-219----A.ADVA........---.L---ADLG...........FQP.EL.EQPV....KP.-EMV...--------------
Q3EVA2_BACTI/125-196----A.IQKS........---.M---AY.......................V....GE.-ASEQNL--------------
A6GPB0_9BURK/65-125----A.IAAA........---.E---QH...............A.......G....GK.-AVQ...--------------
A8FCD8_BACP2/167-226----A.IRIA........---.V---KE...............V.......G....GT.-VDD...--------------
Q49X11_STAS1/141-216----A.ENSA........---.F---KA...............I.......G....KN.-KAD...--------------
A4YY21_BRASO/40-99----I.LPRL........---.R---GR...............I.......A....GD.-VTG...--------------
A7Z5Y9_BACA2/99-159----A.AKIV........---.R---DE...............G.......L....VS.-KLN...--------------
Q8D5E6_VIBVU/113-191----Q.QAIALGKLRHQA---QH---AN...............A.......K....AL.-NTE...--------------
A7HRL7_PARL1/62-117----A.KQAA........---.L---SR...............Y.......P....GR.-FLD...--------------
A1T724_MYCVP/79-141----Q.IAAA........---.Q---EE...............F.......P....GL.-TVS...--------------
Q8A623_BACTN/26-84----L.LEKV........---.A---AT...............L.......P....DD.-VSV...--------------
Q1H2G7_METFK/31-90----C.LEAA........---.L---KA...............K.......P....GT.-VVK...--------------
A3IDB5_9BACI/115-169----A.IEAA........---.L---TK...............A.......K....GT.-VTK...--------------
Q5F637_NEIG1/47-105----A.EKAA........---.W---AR...............V.......G....GK.-ITD...--------------
A5N159_CLOK5/17-76----A.IQNA........---.L---QR...............V.......P....GQ.-VLR...--------------
Q82ZK1_ENTFA/146-205----A.TTLA........---.E---KAA..............K.......V....GQ.-ATD...--------------
Q2RM03_MOOTA/386-447----A.RAKI........---.N---PG...............I.......K....VE.-GVR...--------------
A4YNR6_BRASO/46-105----A.LRIA........---.E---KM...............H.......P....GSR-TAD...--------------
Q9KFU7_BACHD/111-170----A.IAIA........---.Q---QE...............V.......E....GK.-VDD...--------------
Q74JH3_LACJO/126-184----A.TKLA........---.Q---TK...............A.......S....GK.-AVK...--------------
B8G477_CHLAD/152-208----A.QAIA........---.I---AN...............A.......G....GA.-TLM...--------------
Q4QZ38_BACIU/144-218----A.IHAA........---.R---RE...............L.......E....AS.-IGK...--------------
Q9RC54_BACHO/24-83----V.VTIA........---.N---RV............................GMH-PTY...--------------
Q1LJM8_RALME/260-324----A.MTAA........---.Q---KQ...............F.......P....DA.-AVT...--------------
A7ZEI5_CAMC1/100-159----A.VAKA........---.Q---AL...............E.......A....GW.-SLD...--------------
B8G9I4_CHLAD/116-172----A.VATA........---.L---AA...............N.......P....GAT-MVK...--------------
Q8ESM9_OCEIH/119-177----A.KEIA........---.L---EQ...............F.......S....GK.-VVE...--------------
Q0S7B7_RHOSR/138-198----A.EQIA........---.V---AT...............V.......P....GGT-VAN...--------------
NPRS_GEOSE/147-222----A.RDIA........---.E---KDLVAN........VTKEVPEYEQGK....DT.-EFV...--------------
A8MIH5_ALKOO/376-437----A.RERL........---.S---SS...............V.......T....EQ.-SVR...--------------
B0UCU3_METS4/66-129----A.LATA........---.E---SQG.............GQ.......G....GR.-AID...--------------
YPEB_OCEIH/373-434----A.RDNV........---.N---ST...............V.......D....IQ.-ESH...--------------
Q82ZL5_ENTFA/37-109----V.LENV........---.K---AAFLK.........EGPI.......E....GS.-WIE...--------------
B1YFR1_EXIS2/113-183----A.LKLY........---.Q---KAIK...........ATE.FE..VAP....KA.-ELV...--------------
Q5HKU0_STAEQ/128-202----A.TDKA........---.F---EA...............I.......K....ID.-RQK...--------------
Q8RD03_THETN/115-173----A.KTAA........---.L---KV...............V.......P....GT.-VEK...--------------
Q1ARP9_RUBXD/144-202----A.AEIA........---.R---PA.......................G....SGR-VVG...--------------
Q6W134_RHISN/75-133----M.VAAA........---.L---AA...............H.......P....GT.-AVK...--------------
B4SM17_STRM5/23-78----V.EQTL........---.R---KA...............................-......--------------
A0Q1L3_CLONN/59-118----V.IKTS........---.M---DL.......................K....NE.-NLKTLK--------------
A3IDB6_9BACI/160-218----A.VDIA........---.L---QQ...............L.......T....GK.-VDS...--------------
Q2RPK6_RHORT/75-133----L.VAAA........---.L---AN...............T.......P....GT.-AVK...--------------
Q8PWA1_METMA/60-123----A.KEIA........---.L---AHAGL..........EET.......D....VT.-FVK...--------------
Q8DVN1_STRMU/57-120----A.KHIA........---.L---KDAGF..........TEK.......E....VT.-LLT...--------------
Q7NVU2_CHRVO/229-292----L.IARA........---.G---AA...............L.......P....GA.-RLV...--------------
B1YKF6_EXIS2/28-100----A.LEIT........---.K---RTFSA.........KGRV.......Q....GA.-WIS...--------------
A9B7B4_HERA2/311-370----V.IEVA........---.K---AR............................GVI-ASF...--------------
Q70B12_ACTTI/120-189----A.IATA........---.K---KQ...............L.......K....SV.-TSV...--------------
Q82P05_STRAW/125-192----AEQKAA........---.A---AA...............Q.......G....DA.-TEA...--------------
Q72UE2_LEPIC/159-252----A.LSKA........---.L---VH...............F.......G....AK.-KYL...--------------
Q1Q7U9_PSYCK/123-181----A.IKKA........---.N---QT...............L.......K....GK.-VLE...--------------
A3X073_9BRAD/44-103----I.MAAV........---.E---RE...............V.......P....GA.-RVR...--------------
Q5FIK0_LACAC/62-121----A.IDKF........---.H---NQ...............F.......N....NKK-IHS...--------------
Q9A7E1_CAUCR/252-316----A.VAIA........---.Q---GA...............L.......P....GA.-RLA...--------------
A0R6J4_MYCS2/78-140----Q.IAAA........---.R---AA...............H.......P....EG.-TVA...--------------
B8I195_CLOCE/108-180----I.LKIA........---.E---QF...............V.......N....KI.-NPK...--------------
MSPA_LEGLO/128-199----A.LQQF........---.K---AK...............Y.......A....NQN-VGD...--------------
Q81MX8_BACAN/145-217----AKKQLFKIYGDNLT---FV---EE...............P.......E....IK.-QVV...--------------
Q1WU38_LACS1/104-164----A.KNIV........---.K---V.E..............R.......D....PK.-KIT...--------------
Q3SKV5_THIDA/55-112----V.VAAV........---.Q---RA...............Y.......P....AD.-KPF...--------------
Q03XK6_LEUMM/140-199----A.VNKA........---.K---DA...............A.......G....DG.-SLN...--------------
Q06DP6_9GAMM/118-194----A.LGAAKAHFTQSQ---TT---LT............................AA.-PFE...--------------
Q5FIK1_LACAC/119-178----A.TKIA........---.Q---KR...............V.......S....GSK-AIE...--------------
A8FEM8_BACP2/376-437----A.KKTL........---.N---QH...............V.......K....IE.-DTH...--------------
Q8ESH1_OCEIH/143-217----I.IDIF........---.K---RN...............L.......E....EN.-IGT...--------------
Q8ELE8_OCEIH/178-237----V.VNIA........---.D---QQ............................EIY-PTY...--------------
Q89L62_BRAJA/85-144----A.MALA........---.E---SR...............H.......A....GAT-TAD...--------------
Q11VT5_CYTH3/217-280----QEQQFL........---.N---YS...............T.......P....GI.-KQI...--------------
Q5WLI5_BACSK/75-133----Q.VEYV........---.L---ET...............Y.......P....DA.-TIS...--------------
Q9KBS1_BACHD/60-118----Q.LEMV........---.H---EQ...............Y.......P....DS.-VIT...--------------
A5FLJ5_FLAJ1/130-219----A.FNRA........---.V---SH...............T.......H....AS.-EYL...--------------
A4FCJ5_SACEN/417-477----A.LAVA........---.R---AE............................GL.-TGE...--------------
Q8FUC0_COREF/86-161----A.VSDA........---.D---ATADRDIVFDAIDLVMAE.......H....AD.-GII...--------------
A0AXS1_BURCH/321-380----A.IAIV........---.A---GL............................GVT-SGY...--------------
Q1NCJ5_9SPHN/62-120----I.VAAA........---.Q---AR...............A.......G....AT.-ATQ...--------------
Q8CK35_STRCO/128-197----A.VRTS........---.R---ER...............L.......A....NV.-DEV...--------------
Q09A13_STIAD/60-114----L.IARV........---.R---AA...............R.......P....EA.-QPS...--------------
A9C057_DELAS/43-102----A.VTRA........---.T---QA...............V.......P....GK.-AIE...--------------
NPRE_BREBE/144-218----A.VKQA........---.I---KDVEG.........EVGEKPDFIQDP....EA.-KLY...--------------
Q74JH3_LACJO/49-108----A.INKF........---.N---EK...............Y.......G....SKS-IKE...--------------
YKOJ_BACSU/108-167----A.EEIA........---.L---KQ.......................T....GGT-VTE...--------------
O26402_METTH/29-126----A.TALA........---.Q---DY...............L.......D....SK.-GLP...--------------
A3UNN0_VIBSP/116-195----A.VELASKDLKVQG---LT---SK...............................-SLD...--------------
A4QG45_CORGB/37-98----Q.VSIA........---.Q---EL...............H.......P....DL.-DLS...--------------
Q1R143_CHRSD/68-125----Q.LDAA........---.M---AA...............H.......P....GE.-AFR...--------------
A7VSV8_9CLOT/179-240----A.RSIA........---.L---AK...............V.......P....GAS-ANDI..--------------
Q9KFU6_BACHD/130-191----A.KEIA........---.L---KE...............V.......S....GK.-IDD...--------------
A8FEH2_BACP2/99-159----A.VQAV........---.Q---KE...............N.......T....VS.-KLK...--------------
Q181V6_CLOD6/337-394----A.KEIL........---.K---QA...............L.......P....GSN-ILV...--------------
A7K2T9_VIBSE/115-189----V.MSSTQ.......---KP---YR...............E.......N....GY.-QIE...--------------
Q5WKR9_BACSK/175-233----A.KQIA........---.L---EE...............L.......N....GT.-VVD...--------------
A9AUX6_HERA2/135-191----A.GQLA........---.L---AA...............A.......P....GA.-SLL...--------------
A1B2L4_PARDP/40-99----V.LARL........---.H---ET...............Q.......P....GR.-VSE...--------------

PF11396

C6W664_DYAFD/240-302....M-QTFI------------Q---NS-------------PAF-------S----GMK.IAE...--------------
A6L510_BACV8/38-96....V-TEAI------------A---KN-------------..F-------A----EST.VKE...--------------
B9XID0_9BACT/98-160....P-QKAI------------R---AQ-------------..L-------G----NGT.IDS...--------------
Q7MWB4_PORGI/302-359....I-INYV------------N---RN-------------..Y-------P----GAF.IKD...--------------
A7LSF7_BACOV/156-219....M-KNFI------------N---EK-------------..Y-------P----NAR.IME...--------------
Q4HPP5_CAMUP/21-74....A-QSFL------------S---TH-------------..F-------K----GVN.IGL...--------------
Q7MWB4_PORGI/160-216VMNTI-KAYI------------A---SN-------------..Y-------P----NAT.ILE...--------------
A6LDA4_PARD8/215-276....V-MTAF------------K---AS-------------A.Y-------A----SYQ.IDD...--------------
A6L1R4_BACV8/91-153....V-LAAH------------K---AG-------------K.Y-------A----DWR.VDD...--------------
A6LDA4_PARD8/22-79I...V-TKAF------------D---TK-------------..Y-------P----DAQ.RVS...--------------
Q8A9N6_BACTN/42-103....V-TQAI------------T---KS-------------..Y-------E----DAT.IKE...--------------
A7VAB9_BACUN/24-82....A-RNFI------------N---QY-------------..F-------S----KPH.ISH...--------------
Q609W9_METCA/25-85....V-LNAF------------K---TV-------------..Y-------P----AAT.DVE...--------------
A6EC49_9SPHI/80-140....V-RNGA------------K---KY-------------..F-------A----GYR.VDE...--------------
A7V913_BACUN/87-150....V-RSSY------------E---SS-------------TYY-------N----VWK.VED...--------------
Q11R11_CYTH3/84-141....V-SDYV------------N---KN-------------..H-------K----DAV.NKE...--------------
A6EBA3_9SPHI/40-102....V-KTTL------------A---SD-------------T.Y-------K----EWT.ATA...--------------
Q64Q98_BACFR/42-103....V-TEAL------------G---KA-------------..Y-------P----EST.IKE...--------------
A3U576_CROAH/46-104....V-KEAF------------A---SD-------------..F-------K----GAT.LTK...--------------
Q8A9P3_BACTN/16-71....I-QAAF------------K---KM-------------..Y-------P----KAN.GIA...--------------
Q5L9Y2_BACFN/77-142....V-YNAY------------A---SG-------------P.Y-------S----GWQ.VED...--------------
Q5LBR7_BACFN/156-212....I-ETFI------------K---KQ-------------..Y-------P----NAR.LVE...--------------
A1ZPX0_9BACT/161-219....A-QDYI------------A---AN-------------..Y-------A----DQV.SAE...--------------
A7V913_BACUN/224-284....V-KNAV------------T---AA-------------..H-------P----GYV.IDD...--------------
A0LZK7_GRAFK/81-141....V-RTAL------------Q---NE-------------..F-------S----DKK.FDD...--------------
C0QYD0_BRAHW/7-56....S-VNFI------------N---DY-------------..F-------N----YDD.IIN...--------------
Q89YQ5_BACTN/90-143....A-VSYL------------K---EH-------------..N-------F----TEP.VTK...--------------
A5ZCE1_9BACE/25-80....L-QSTF------------S---AK-------------..Y-------P----NAT.NVE...--------------
B0MTD2_9BACT/41-98....A-RSFI------------A---QH-------------..Y-------P----EENPVLV...--------------
B9KG60_CAMLR/21-74....S-KNFI------------Q---KH-------------..F-------T----GSN.IAL...--------------
A3U577_CROAH/47-105....V-QTAL------------S---KD-------------..F-------E----GAT.LNK...--------------
Q7MWB4_PORGI/235-292....I-ISYV------------N---QN-------------..Y-------P----GAV.IHS...--------------
A0M1R1_GRAFK/98-159....I-KKVI------------K---EK-------------..Y-------S----DYE.ITE...--------------
D5UB28_BRAM5/1-54....V-KNFI------------E---TY-------------..F-------N----DYY.VFK...--------------
B9KG75_CAMLR/19-71....I-KQFI------------K---DY-------------..F-------N----AE..IGL...--------------
A6LDM3_PARD8/41-102....L-RDAV------------N---TS-------------..Y-------E----GCM.VKS...--------------
A6L4L1_BACV8/88-141....I-KKYV------------A---TN-------------..Y-------P----DAK.MLK...--------------
A6L4Q2_BACV8/76-141....V-YNDF------------T---LS-------------P.Y-------A----MWT.ATN...--------------
B9KE59_CAMLR/80-133....V-ITKV------------Q---AA-------------..Q-------P----NAA.IVE...--------------
A7M5Y9_BACOV/86-149....V-YTAF------------M---DS-------------K.Y-------N----AWV.VTD...--------------
Q89YQ4_BACTN/86-149....V-YTGF------------R---NS-------------N.Y-------S----SWV.VTD...--------------
B3JHE8_9BACE/293-346....L-KNYF------------T---EV-------------..Y-------Q----MKI.SWN...--------------
Q1VZW6_9FLAO/27-87....A-KEWL------------E---DA-------------..F-------E----QQR.RTK...--------------
Q5HUF8_CAMJR/79-132....L-ANII------------K---NE-------------..F-------P----NTK.ARE...--------------
A6LDE6_PARD8/86-148....V-STAF------------K---QS-------------F.Y-------S----NWT.VDD...--------------
A5FMA0_FLAJ1/39-96....V-KTAL------------Q---TA-------------..Y-------P----NAK.LVK...--------------
A6L4L1_BACV8/24-81....A-QTFI------------K---TH-------------..F-------P----DNK.VAM...--------------
A7AB56_9PORP/24-80....T-KAAF------------D---EK-------------..Y-------P----AAK.DVE...--------------
Q26DS8_FLABB/19-76....V-LNAF------------Q---TK-------------..Y-------P----GEN.DPD...--------------
A6EC48_9SPHI/26-83....A-KTYI------------N---TH-------------..F-------G----DAT.ITR...--------------
B9KG75_CAMLR/77-130....V-QNTI------------K---NI-------------..Y-------P----NTA.IIE...--------------
A6L337_BACV8/89-142....I-SKYM------------K---AN-------------..Y-------N----GHK.TVK...--------------
D5U9R1_BRAM5/24-79....A-RNFI------------N---LN-------------..F-------P----GNN.IET...--------------
A0M1R1_GRAFK/37-94....V-AMAF------------Q---KK-------------..Y-------P----GEN.DPD...--------------
B3JHE8_9BACE/30-87....I-SLFV------------S---AW-------------..F-------P----GAM.IEQ...--------------
Q7MWB4_PORGI/82-144....V-RAAF------------E---AS-------------E.Y-------A----KWK.IED...--------------
A6LDA3_PARD8/25-83....S-RQFI------------S---DH-------------..F-------K----DIP.VSH...--------------
Q8A995_BACTN/24-79....L-QEAF------------S---TR-------------..Y-------P----NVK.NVK...--------------
A7LSF8_BACOV/24-81....A-QQFI------------K---QH-------------..F-------A----DSK.VAL...--------------
A6LDE6_PARD8/216-277....V-MQGF------------E---SS-------------A.Y-------A----SDK.VQS...--------------
Q025C3_SOLUE/32-92....V-QKTV------------Q---EQ-------------..T-------K----GAG.IKS...--------------
Q64WW2_BACFR/25-83QA..I-QDAL------------K---KL-------------..Y-------P----NAT.AIK...--------------
A7LSF7_BACOV/83-145....V-KTSF------------E---SS-------------E.Y-------A----SWK.RDD...--------------
A7LSF7_BACOV/24-79....L-QSAF------------S---SK-------------..F-------P----NAA.NVK...--------------
A0M0Q0_GRAFK/82-142....I-LSSL------------K---SN-------------..F-------P----GYE.IEE...--------------
A7V913_BACUN/163-220....I-KDFI------------A---EK-------------..Y-------P----NAR.IVD...--------------
Q1PYA3_9BACT/240-300....V-KAAI------------E---KE-------------..I-------A----GGT.VKG...--------------
A6L1R4_BACV8/226-288....V-KKSV------------M---EK-------------..Y-------S----DYV.IDD...--------------
Q4HEV5_CAMCO/79-132....L-TNII------------Q---NK-------------..F-------P----NTK.ARE...--------------
Q7MWB3_PORGI/88-141....I-LRHI------------S---SQ-------------..Y-------P----DLY.IVQ...--------------
A7AAP4_9PORP/39-100....V-QDAI------------A---KS-------------..Y-------E----GST.VKE...--------------
Q8A995_BACTN/83-145....V-KSAF------------E---AS-------------D.Y-------K----TWK.RDD...--------------
D5UB30_BRAM5/29-82....I-QEFV------------N---KY-------------..F-------K----DYK.VYR...--------------
A5FIF1_FLAJ1/22-79....A-QEFL------------K---KH-------------..F-------S----HTL.IEK...--------------
A6LDA3_PARD8/90-143....I-QDLI------------K---KN-------------..Y-------S----SNK.VVK...--------------
A6LDA0_PARD8/28-84....I-QKVI------------Q---IK-------------..Y-------P----GAT.ITD...--------------
A7VAB9_BACUN/89-142....V-KEYV------------K---AN-------------..F-------P----REI.ITK...--------------
A7V913_BACUN/27-83....L-SNAL------------A---KE-------------..H-------P----NAQ.RIE...--------------
A7UZY2_BACUN/47-109....V-QDAI------------K---KD-------------..Y-------A----EST.IKE...--------------
A7V2B6_BACUN/24-81....A-QTFI------------K---TY-------------..F-------K----DHK.VAM...--------------
A6ERM3_9BACT/45-103....V-VKAL------------E---TD-------------..F-------K----DAK.IAK...--------------
Q2Y6A1_NITMU/95-160....V-QKTI------------T---EN-------------..G-------G----SGN.IEE...--------------
A6L337_BACV8/24-82....A-REMI------------G---KH-------------..F-------S----QTK.VAY...--------------
Q1PYA3_9BACT/45-105....V-KAAI------------E---KE-------------..T-------A----GGT.VKS...--------------
B9KE59_CAMLR/20-73....A-QEFL------------N---AH-------------..F-------K----GVN.VGY...--------------
A6LDE6_PARD8/26-82....V-ENAF------------Q---EK-------------..Y-------P----DAK.NPV...--------------
A7M5Y9_BACOV/25-82N...I-TEAL------------K---QV-------------..Y-------P----AAQ.NIE...--------------
Q4HEV5_CAMCO/20-72....S-KEFL------------K---NN-------------..F-------Q----AP..IGI...--------------
A7ABZ7_9PORP/218-279....I-MDAF------------K---AS-------------E.Y-------G----NDQ.VES...--------------
Q606T7_METCA/26-86....V-HEAF------------Q---KA-------------..Y-------P----AAK.ETK...--------------
A6LDA4_PARD8/83-145....V-KNSF------------E---AS-------------L.Y-------A----KWK.IDD...--------------
A1ZPX0_9BACT/82-140....M-SDYI------------A---TH-------------..Y-------A----GAN.VVK...--------------
A5FNS8_FLAJ1/26-83....A-QTFL------------K---TH-------------..F-------G----SKK.PSY...--------------
D8ICV0_BRAP9/18-73....A-KNFI------------N---LN-------------..L-------E----GDS.VDT...--------------
Q4HTG4_CAMUP/18-70....I-KEFL------------Q---KN-------------..F-------K----AQ..VSL...--------------
A5ZCE1_9BACE/84-144....V-KNTI------------H---AT-------------..Y-------P----GRVDDDD...--------------
A0M5V4_GRAFK/44-104....V-KDAV------------M---TD-------------..Y-------N----GAV.ASE...--------------
A3J6C3_9FLAO/78-139....V-QNTF------------N---TS-------------..H-------K----GAK.IKA...--------------
Q8A994_BACTN/88-141....I-QKYV------------T---TN-------------..Y-------P----DAK.VLK...--------------
Q11R11_CYTH3/24-80....V-VGTF------------E---SN-------------..H-------P----NAK.MVS...--------------
B9KDT7_CAMLR/39-93....I-MDKI------------Q---SS-------------..Y-------P----GAF.IVD...--------------
Q8YLV6_NOSS1/89-149....V-LKRI------------N---QE-------------..R-------P----GYI.ITK...--------------
A4ANN1_MARSH/103-168....V-RNAV------------A---ER-------------..F-------P----KWK.VVNDVY--------------
A5FM86_FLAJ1/39-96....I-VEAL------------K---KA-------------..Y-------P----DAV.ITK...--------------
A3XQ60_LEEBM/44-103....V-TKAV------------A---ED-------------..K-------E----GAK.VTE...--------------
Q4HTG4_CAMUP/77-130....I-VSIL------------K---NE-------------..F-------K----ENA.IKE...--------------
C0QVH4_BRAHW/20-75....A-KNFL------------N---IN-------------..F-------P----GNN.IES...--------------
Q64UH5_BACFR/42-103....V-MNAL------------A---KS-------------..Y-------E----GAS.IKE...--------------
A6LDA4_PARD8/155-211....I-KELI------------S---EM-------------..Y-------P----GAT.ILE...--------------
E4MSA5_CAPOC/22-79....A-INFV------------R---EH-------------..F-------L----VDH.IAS...--------------
Q64SP0_BACFR/83-145....V-KSAF------------E---SS-------------E.Y-------A----KWK.VDD...--------------
Q4HE98_CAMCO/48-102....I-NSQI------------Q---NL-------------..H-------P----GAF.IVD...--------------
B9KG60_CAMLR/81-134....V-LATI------------K---KM-------------..H-------P----NAS.IIK...--------------
Q5LEW1_BACFN/42-107....V-INAL------------A---KD-------------..Y-------E----GAS.IKE...--------------
Q8YLV6_NOSS1/29-85....V-KAAF------------Q---AK-------------..Y-------P----D...IPH...--------------
C0R146_BRAHW/31-84....I-QEFV------------N---TY-------------..F-------N----EYE.VYS...--------------
C0R148_BRAHW/1-54....A-RDFI------------E---TY-------------..F-------S----DYY.VFK...--------------
A0LZK7_GRAFK/21-77....V-LNAF------------E---SR-------------..F-------D----NPT.NTD...--------------
A2TPA4_9FLAO/87-148....I-KKAI------------K---RD-------------..Y-------S----HEK.ITE...--------------
A7AB56_9PORP/84-146....V-KTAF------------Q---QG-------------E.Y-------S----TWK.VDD...--------------
A3YT26_CAMJU/21-74....A-KEFI------------S---KN-------------..F-------K----TAQ.IGL...--------------
Q64TS2_BACFR/42-107....V-KSTL------------S---KD-------------..Y-------E----GTI.VKE...--------------
A6E8W6_9SPHI/40-102....V-KATL------------Q---TE-------------P.V-------K----QWT.PTA...--------------
B3JHE8_9BACE/156-216....I-KNYI------------L---QA-------------..F-------P----GRE.ITRIII--------------
Q8A995_BACTN/230-292....V-TNAI------------S---TE-------------..Y-------A----GYQ.MDD...--------------
A0M0Q0_GRAFK/20-78....V-KNAF------------A---KK-------------..F-------P----TAK.KVE...--------------
A5ZGS8_9BACE/87-150....V-YTAF------------N---NT-------------K.Y-------S----SWV.VTD...--------------
A6EC48_9SPHI/89-142....I-LTYV------------Q---AN-------------..Y-------P----DQY.IIE...--------------
Q1PY86_9BACT/10-70....V-KAAI------------E---KE-------------..T-------A----GCT.IKK...--------------
A5FMA1_FLAJ1/39-96....V-KSTI------------E---KS-------------..F-------P----GTK.LEK...--------------
A7V329_BACUN/79-144....V-AEAF------------M---SS-------------T.M-------T----GMR.LRD...--------------
Q5LBR7_BACFN/23-79....L-KNAF------------T---EK-------------..Y-------P----SVS.NEK...--------------
Q4HPP5_CAMUP/81-134....L-VAKV------------Q---VS-------------..Q-------P----NAQ.IFK...--------------
A5FNS8_FLAJ1/90-143....V-ASYI------------K---EN-------------..F-------P----KEK.VTK...--------------
Q606T7_METCA/90-152....V-VSAI------------K---KA-------------..H-------P----GAT.VKE...--------------
A7ABZ7_9PORP/87-149....I-SNDI------------K---QG-------------K.Y-------A----GWK.IEE...--------------
Q89YQ5_BACTN/24-82....A-RNFI------------N---RH-------------..F-------T----KPQ.VAH...--------------
Q64SP0_BACFR/216-278....V-THAI------------A---SS-------------EKY-------A----GYQ.IDD...--------------
A7AB55_9PORP/91-144....I-LRYV------------K---AT-------------..Y-------P----DHK.VVK...--------------
A5FM85_FLAJ1/39-96....V-TDAL------------K---KA-------------..Y-------P----DAV.LNK...--------------
A4CIV2_ROBBH/43-101....V-QEAV------------S---TN-------------..Y-------P----SAT.ISK...--------------
A4JEG0_BURVG/34-94....V-KATI------------D---RQ-------------..S-------Q----GGS.VKE...--------------
Q64WW2_BACFR/87-150....V-LTAF------------M---ES-------------S.Y-------N----NWV.VDD...--------------
A6L1R4_BACV8/162-222DANGI-IAIV------------K---QK-------------..Y-------P----NAT.IVE...--------------
Q0P9P8_CAMJE/20-72....S-KEFL------------Q---HN-------------..F-------K----AP..IGI...--------------
A7AB55_9PORP/27-84....A-QAYV------------K---KY-------------..F-------P----QEK.VAL...--------------
A2TZP8_9FLAO/26-85....S-LSFI------------D---AL-------------..H-------F----KKK.IKW...--------------
A6KXD7_BACV8/38-100....V-QEAI------------T---KN-------------..Y-------A----EAT.IKE...--------------
A5FBY0_FLAJ1/85-146....A-QTYL------------K---KN-------------..Y-------A----AKA.IKE...--------------
A5FM84_FLAJ1/39-94....I-KKSL------------D---DA-------------..Y-------P----GVK.LEK...--------------
A7V329_BACUN/19-75....I-QTAF------------Q---TL-------------..Y-------P----QAT.DVE...--------------
Q11P99_CYTH3/20-76....V-VNAF------------Q---QK-------------..F-------P----QQS.VVE...--------------
D8IF52_BRAP9/11-64....S-KIFI------------E---NN-------------..F-------N----NTS.IKT...--------------
A7VAB8_BACUN/86-148....V-QTSF------------S---AS-------------E.Y-------A----GWK.IEE...--------------
Q8ABX7_BACTN/27-89....V-QDTI------------K---KD-------------..F-------A----DLT.IKE...--------------
Q64ZG0_BACFR/31-91....A-QSFL------------S---NY-------------..F-------P----GQT.PEK...--------------
A6E8W7_9SPHI/39-101....V-KTTL------------K---AD-------------P.Y-------K----EWT.PTA...--------------
Q11P99_CYTH3/80-140....V-TASI------------Q---KN-------------..F-------S----GYK.VDD...--------------
Q2Y9L0_NITMU/27-92....V-QKTI------------T---EN-------------..M-------N----GGI.IEE...--------------
Q5LD45_BACFN/111-176....V-AKAF------------M---QS-------------T.M-------A----SMQ.LED...--------------
A6LDA0_PARD8/88-149....I-MDNL------------T---NS-------------A.Y-------H----EYK.IDE...--------------
A7AKE6_9PORP/56-112....I-RNFL------------K---QK-------------..Y-------P----AAT.ILK...--------------
A7AKE6_9PORP/116-177....V-MDAL------------Q---SS-------------A.Y-------N----QYK.IED...--------------
Q64WW3_BACFR/89-143....V-KEYM------------K---AN-------------G.Y-------H----SEF.VTQ...--------------
Q4HFB7_CAMCO/81-132....I-MPKI------------S---AS-------------...-------S----NAQ.IIE...--------------
A7VAB8_BACUN/26-82....M-SQAL------------K---SK-------------..Y-------P----SAI.HVE...--------------
Q7MWB3_PORGI/24-81....A-QAVV------------A---KH-------------..F-------A----GAK.VSY...--------------
Q2Y7C4_NITMU/25-90....V-QKTI------------T---EN-------------..A-------E----GGK.IEE...--------------
A6LAS6_PARD8/41-101....V-TQSI------------E---KS-------------..Y-------P----DSV.IQE...--------------
A3ZG36_CAMJU/81-133....V-MKKV------------S---AT-------------..Q-------P----NAQ.ILE...--------------
A7LSF7_BACOV/223-284....V-NNTL------------N---NQ-------------..Y-------G----EYR.FDE...--------------
Q5LG07_BACFN/24-82....A-RNFI------------N---RH-------------..F-------S----NPQ.ISH...--------------
A7AB56_9PORP/219-280....V-MAAI------------K---AS-------------Q.Y-------A----TYR.IDD...--------------
A7LXE2_BACOV/77-142....V-YNAF------------V---SG-------------P.Y-------A----NWV.VDN...--------------
A5FIF1_FLAJ1/86-139....I-KAYV------------A---KN-------------..H-------P----NEK.ITH...--------------
A7V158_BACUN/77-142....V-YNAF------------A---AS-------------E.Y-------S----GGM.VQN...--------------
Q26DS8_FLABB/80-141....I-QEAI------------E---RE-------------..F-------P----DRK.ITE...--------------
A6EC49_9SPHI/20-76....V-INSM------------N---KA-------------..F-------P----KAE.KVE...--------------
A7UZJ9_BACUN/42-107....V-MNVL------------A---KD-------------..Y-------E----GAV.IKE...--------------
Q64SP1_BACFR/24-81....A-QQFI------------K---QH-------------..F-------A----GSN.IAM...--------------
A7V2B6_BACUN/88-141....I-RNYV------------K---TN-------------..Y-------P----DAR.ILQ...--------------

PF14620

Q3ACX8_CARHZ/13-371----VVEDLGQLPVTTFS...LE---KTKAFYNQLGDFTYTVAIKDTEGK.SLSPEERKTLATYYN--------------
A3DI39_CLOTH/26-388----AQSNLGQLPITPEV...LS---NTSKFLTQVGDLAYSINNQNMSGK.GLTEEQYKLIEQLHG--------------
Q736X0_BACC1/13-372----ARSDVGQLPLTLMP...FN---KTEEFLANIGDFSYRAAIRDLEKE.PLNDQEYKTLQTLYS--------------
C6CU97_PAESJ/16-375----AQNEINQLPLTILP...FN---EAEDFLSHISNFAYKTSVRDLTKQ.PLSQDEFKTLKTLYA--------------
Q8R774_THETN/13-368----GQEHLSQLPIGQPE...ID---NTSKFLVQVGDYAYSLTKKIASGG.KLSDKDLKTITTLHN--------------
D5DRI0_BACMQ/13-373----AHNNVGQLPLSLLP...FN---KTEEFLSDVGDFTYKVAVRDLSKS.PLTDKEYKTLNSLYD--------------
D5W1I7_CLOB2/17-379----ANDKLHSLPIDQNT...IA---NTSKFLSQVGDFSNGLGKSIVKNN.NLSKKDYENIERLKK--------------
C6PVF7_9CLOT/17-378----ANDKLHSLPISQQV...IG---DTSKFISQVGDFCYTLAKVSSEGR.ELNEQDYNTIDRLKN--------------
E0RD66_PAEP6/16-382----AQNEVNQLPLNVMP...FN---HAKDLLSHVSTFSYQTAVRDLDHE.PLNEKEISNLKTLYK--------------
D3G027_BACPE/13-376----AQAELGQLPLNSLQ...LG---KTEEFLYKIGKFSYQTSIRDLDKE.PLTDKEYETLNKLYD--------------
B8D1J1_HALOH/6-366----AQEQLNRLPLSNQA...AF---RAAKFLNQTGDYAHVLAQKNAEGK.VLTAENRKKLVELRQ--------------
B8I3U7_CLOCE/26-387----AQTNMGQLPIAPPI...LE---KTSNFLTQAGDMAYSLNNKTMNGI.PLNDKEYGALQKLHG--------------
B1C6Q7_9FIRM/13-365----INENINSLPINHSA...VV---EASKFLNKTTNYYYSLITANK....KITSKNKADIKNIYT--------------
E8SXZ7_GEOS2/13-373----AHTDVGQLPLSLLP...FN---KTQEFLSKIGEFSYRTAVRDLEKE.PLTEEEHKTLEALYK--------------
A4J9E3_DESRM/15-376----ARENLTQLPLTSSM...VG---RTAKFLAQSGDFARVQANKITSGQ.ILTEEEYSTLNSLYR--------------
D9TFB8_CALOO/29-390----AQENLSQLPIENNVA..LE---KTAKYLTQVGDLSFSLSKQLMSGK.KETLLQRQQLKKLRT--------------
A6NSM3_9FIRM/22-381----AQMAIGELPYGNVE...LA---QTASFVAKVGDYAAALSRSNASGG.GTTEEEKESLRALAA--------------
D5N4Y3_BACPN/13-374----AHNSVSQLPLTLMP...FN---KTEELLSKIGDFSYKTSVRDLEQK.PLDKNEYTSLNKLYQ--------------
D9QUD9_ACEAZ/13-381----AQKDLGELPIAGIS...LT---KFKDLLAKIESYTYQLSQDNINED..LSAEDWDNLNQLHS--------------
B0MLG6_9FIRM/17-370----AKASLAELPVSELH...LE---NTYKFLSQVGNFSKSLAKRYSNGE.TLTEDDRKSLKTLGE--------------
C5VNR0_CLOBO/15-376----ANDKIHSIPVSEQY...VD---GTSKFLAQVGDFAHTLSRSSFEDK.ALGEEDYKKIESLKD--------------
A5CYA9_PELTS/14-376----AQSNLGQLPLNDVL...AG---RTAKFLTQVANYAESLARQLDGGG.AIDGGHWETLNNLYE--------------
Q67K56_SYMTH/19-394----AMTAFSSLPLPTEV...SS---TTGKFLQQVGDFAYALLRDEAAGR.SLTEAERAELQRLRE--------------
E5YVT8_9BACL/16-375----AQNEISQLPLTLLP...FN---KTEEFLSRISNFAYKTGVRDFTKE.PLSDNEVKTLKSLYA--------------
B1I6Q9_DESAP/14-380----AQRELSQLPVQPAV...IG---RTSQFLNQVGEFTNVLMRQVAAGR.PPSPDQWNTLEELHR--------------
Q67QG8_SYMTH/1-374----AAANFMALPLPEEL...GA---ATGKFLNQIGDFAYSVVRHEAAGR.TMDEAQRQELARLYQ--------------
YPEB_BACHD/13-371----ASEEIGQLPLGIVD...LS---KTEEFLHHLGTFSYKTSIRDLDKE.PLTDEEYEKLEKFHD--------------
D5XDM3_THEPJ/19-379----AQNNLGTLPLAHFQ...VA---RTAKFLNQVGDFAYALAKKDPDKQ.QITASEERKLAQLHR--------------
E9SE89_RUMAL/27-377----AKAALARLPVAKLG...LE---NTNKFLSQVGNYSLALSKKLENGE.ELTNEEYSNIARLSE--------------
F0K5G1_CLOAE/18-380----ANDKLHSMPIAQEQ...LQ---GTSKFISQLGDFCYVLENKSAKGE.ELSASDISQVERLRN--------------
Q898Z6_CLOTE/17-379----ANDRLHSLPLSQDT...IE---NTSRFLSQVGDFCYTLGKTTSEGT.QLQDKDYKNIEDLKN--------------
Q65I06_BACLD/13-374----AHNNVSQLPLTLMP...FN---KTEEFLAKVGDFSYKAAVRDLDKE.PLNKKEYASLNQLYE--------------
A7VNV5_9CLOT/20-375----AKIYLAELPLSYEE...LS---NVNKFISQVGDFSLYLSGKISKGQ.EITDQEMDSFITLGE--------------
Q67JA4_SYMTH/1-357----AVEHMATLPFTTMN...TP---RITNFLNTLRAQSDEKHHKLNTGQ.GLTDEDWNQLMELRH--------------
D5WQ69_BACT2/16-374----AQSDVGQLPLTLMP...FH---KTQEFLNNIGQFSYRLGVKD.PQK.PLGAEDWATLKNLYG--------------
E6U685_ETHHY/20-373----AQTDIAQMPLSTVN...LS---NTNKFLSQSGDYANSLTKQLNTDQ.AITDEQRNTIASLHG--------------
C6J414_9BACL/16-377----AQNEINQLPLTLLP...FN---KTEEFLSRIAKFSYQTAIRDLTKQ.PLTKNEMKNLKELYK--------------
F0DLG0_9FIRM/14-375----ARENLTQLPVNSQV...VG---RTAKFLAQVGDYARVKAREINNGE.TLTEEEFKTLNNLYR--------------
Q2RM03_MOOTA/13-383----AQHSLTQLPTPGFK...PV---NTSKFLSQTSDYSNYLAQKLARGE.EMTPQERQQLASLRE--------------
B4AKG7_BACPU/13-373----AHNNVSQLPLTLMP...FN---KTEEFLANVGDFSYKSSVKSLSDE.PLNKNTHKTITSLYQ--------------
B9DX91_CLOK1/17-380----ASDKLHSLPVSQPT...IS---DTSKFLTQTGDFCYSLAKSSTEGN.QLTDEDYKNIEELKK--------------
B7GHM6_ANOFW/13-372----AHATVGQLPLSLLP...FN---KTEEFLSNIGSFSYRAAIRDLDKQ.PLNAEEYKALQQLYK--------------
E6TZD5_BACCJ/13-373----AQNDLGQLPLALMP...FS---KTEEYLYKIGEFSYRHAIRDLNQD.PLSEDEYEALQSLYE--------------
C8VVD3_DESAS/16-378----AQENLTQLPVNQSI...VG---RTSKFLTQVGDYSRMMAAGAGSDT.EISSDKWKTLNKLYL--------------
E6UCG1_RUMA7/18-368----ARSALARLPVSQLD...LE---NTNKFLSQVGNYSMALSKKLQDGE.KLTSEEYSSISDLCR--------------
D9TPL0_THETC/12-368----AQENLSQLPIGQPE...LD---NTSKFLSQIGDYSYSLSKNVADGG.KLTDKDYKTISELHN--------------
Q2B634_9BACI/13-372----AHSDVGQLPLTLMP...FN---KTEDFLAKIGDFSYRTAVRDLDKE.PLSDKEYKALQGLYK--------------
A8MIH5_ALKOO/13-373----AQEKLTQLPFHHGG...IR---GIEKFLSQLGDYSTAMLNKSLEGV.VLEEKELNTMVELHD--------------
B0TAV0_HELMI/41-428----ASANMGQLPLATLL...LS---RTHRFINTVDDFSTTLAERKVDGKAALTAAEKKTLGELHR--------------
E5WI28_9BACI/13-372----AHSDVGQLPLSLLP...FN---KTEEFLSNIGDFSYRTAVRDLEKE.PLSDKEYQALKQLYK--------------
C0GK90_9FIRM/17-388----ASGSLSYLPRHSNKPFYFY---NLQYFLEYVESGLYYIGSKDD....PLSDEDFAYLRKVHD--------------
C0EB21_9CLOT/19-374----AKNSLEQIPTSGMN...LS---NTYKFLSQAGDYALSLAHKTAAGD.PLSNEERASLKQLDN--------------
D8GKX4_CLOLD/17-380----ASDKLHSLPVSQST...IS---DTSKFLTQVGDFCYSLGRSSTEGK.QLSEKDYNDIERLKK--------------
YPEB_OCEIH/13-370----AHSNVGQLPLGLLP...FH---KTEQFLSDIGEFTYQTAVRNLDDN.PLTEEETQKLKDYYD--------------
B0PG38_9FIRM/20-373----AKSALSTLPVSDLH...MD---NTYKFLSQVGDYAMALSKKAAAGG.EPSAEEAENAEALRN--------------
C0ZCA7_BREBN/17-378----AQADVGQLPLTLMA...FN---KTEEMLSRVADFSYRVAVRDLDKQ.PLSQSEYKTLKSLHT--------------
A6TN00_ALKMQ/13-373----AQEKMTQLPFYHGA...IR---RTEEFLSQLGDYTTAMVNKSLEGQ.HLEPDEMQTLEELHQ--------------
D9S297_THEOJ/14-374----ARSNLASLPLGSRD...MT---NLQKFFAQMGDFSHTLAKKVSLGE.QISDKEWDTLEQFKK--------------
A0Q324_CLONN/15-376----ANDKIHSIPVSQEY...VD---GTSKFLAQIGDFAHRLSRSSFENE.KLTDKDYETIESLKD--------------
A6CR99_9BACI/13-371----AHSDVGQLPLTLLP...FN---KTEEFLANIGDFSYRVAVRDLDKE.PLSDEEYKNLKQLYE--------------
E0ICB3_9BACL/16-375----AQNEVNQLPLTLLP...FN---TTEEFLSRISNFAYKTAVRDLSKN.PLTDDEFKTMKTLYD--------------
Q5WGU9_BACSK/13-375----AEKSLAELPVQELN...MD---DTEKYLFKIGDFTYRTSVRDLNKE.PLTDKEYETLTQLYE--------------

PF11399

Q085F9_SHEFN/19-127----DLLSKL----------------SM-----------------------G-M..SSDQVTTLMG--------------
A4C487_9GAMM/27-130----RFIDKL----------------KP-----------------------A-QKLSSESVLEQLG--------------
A6WL17_SHEB8/20-121----QKMNDL----------------TL-----------------------G-Q..NIGSVKELLG--------------
A8FY56_SHESH/14-118----ANLARL----------------SL-----------------------G-M..SRDQVQVLMG--------------
Q15QY7_PSEA6/20-121----VQVAKL----------------EL-----------------------G-Q..TKQQILALLG--------------
B1KNV8_SHEWM/19-120----DNLTKL----------------NL-----------------------G-M..SQDQVKVLMG--------------
Q8EGJ0_SHEON/23-132----SNLAKL----------------SL-----------------------G-M..SKDQVMTLMG--------------
B1KQX2_SHEWM/20-121----AKLTEI----------------SL-----------------------G-Q..SITQIKSLLG--------------
A1S8B9_SHEAM/20-121----KALAEL----------------VI-----------------------G-Q..DIGSVRQLLG--------------
Q07ZE7_SHEFN/20-121----QKMSEV----------------SF-----------------------G-Q..SLDEIRTLLG--------------
Q15QZ2_PSEA6/17-120----KEVARL----------------QP-----------------------N-L..STGEVMDRMG--------------
Q12L38_SHEDO/25-126----QQLSHI----------------KL-----------------------G-Q..SLDEIVTLMG--------------
Q3ICC6_PSEHT/20-123----RYIEKL----------------KI-----------------------E-DTATLNSVLEYLG--------------
A4C4D7_9GAMM/17-125----NKIANL----------------QL-----------------------S-Q..TYQTVLNTLG--------------
A1S4M5_SHEAM/17-118----EHLTQL----------------SL-----------------------G-M..DKSQVLALMG--------------
Q47YB6_COLP3/19-124----KKIAKV----------------QL-----------------------G-T..SFMDIQENLG--------------
F2GBX2_ALTMD/20-121----VQITKL----------------KL-----------------------G-S..TREEVLALLG--------------
A6WL90_SHEB8/24-135----TNLTKL----------------SL-----------------------G-M..PKDQVMILMG--------------
A3QGB8_SHELP/19-123----VNLSKL----------------SL-----------------------G-M..TRDQVMTLMG--------------
Q8EGQ0_SHEON/20-121----QKLNDL----------------SL-----------------------G-Q..DISEVKTLFG--------------
A8H6M9_SHEPA/19-123----ANLSKI----------------SL-----------------------G-M..SKDQVVTLMG--------------
A4Y4Y3_SHEPC/20-121----QKVNDL----------------TL-----------------------G-Q..DITEVRAMLG--------------
Q12P24_SHEDO/19-127----DNIAKL----------------SM-----------------------G-M..DAQQVSLLMG--------------
A0Y2J8_9GAMM/16-124----EAISEL----------------KM-----------------------D-S..SYQSVLTTLK--------------
Q47YA7_COLP3/20-124----QFIAKV----------------ML-----------------------D-N.FTFEQALTQLG--------------
Q5QW11_IDILO/20-121----RQIGQF----------------DL-----------------------G-M..SKDSVIRVLG--------------
A4A742_9GAMM/18-118----AMISKL----------------EI-----------------------G-A..SRDGVVDSLG--------------
A3WM12_9GAMM/19-120----MQIGQL----------------EL-----------------------G-M..SKDQVIRMLG--------------
A3WM05_9GAMM/20-124----QTIAQL----------------NL-----------------------N-A..DFESVRNKLG--------------
A3QGM5_SHELP/20-121----AKLTEL----------------SI-----------------------G-Q..PIEQIRTLMG--------------
F2GBX8_ALTMD/17-120----KHIANL----------------ET-----------------------G-T..SYESVLRKMG--------------
A8H6V7_SHEPA/20-121----AMMTEV----------------VI-----------------------G-Q..NIDEIKTLFG--------------

PF04355

Q5NL78_ZYMMO/17-93----AMVQSV----------------SP-----------------------GVD--NRQSVEKTLG--------------
Q5LQJ9_SILPO/35-111----EELAAI----------------QV-----------------------GVD--TRDSVVEAVG--------------
Q1LSR9_BAUCH/37-105----TDVDQI----------------HI-----------------------G.M--TKQQVSNILG--------------
Q5PHB7_SALPA/28-97----PVVKDV----------------KK-----------------------G.M--SRAQVAQIAG--------------
A4N7P6_HAEIF/34-104----TTVAQV----------------KE-----------------------G.M--TAQQVQYLLG--------------
Q1MIT0_RHIL3/42-118----QSLNLV----------------PE-----------------------G.S--SREQVLLSLG--------------
Q1LBA9_RALME/75-149----DNLRML----------------AP-----------------------G.M--TKSQRYPLLD--------------
A3YB50_9GAMM/31-104----QQVNQL----------------EL-----------------------G.M--TESQVKYLVG--------------
A3XVL9_9VIBR/35-105----EAVDQL----------------KF-----------------------G.M--TKTQVRYVMG--------------
Q2SZ95_BURTA/41-112----EKASQL----------------QV-----------------------G.M--SREQVRALLG--------------
A5WGN5_PSYWF/35-114----SQAQQI----------------QP-----------------------G.M--TKNQVLYYIG--------------
Q9CJV5_PASMU/34-104----ATVKQL----------------QV-----------------------G.M--NAAQVQYLLG--------------
BAME_PSYIN/35-104----EKLDQI----------------LL-----------------------G.M--SQEQVIFILG--------------
B0KU54_PSEPG/23-91----PLVAKV----------------GT-----------------------G.M--SKDQVVQIGG--------------
A0YHQ3_9GAMM/36-106----DMVDQL----------------KP-----------------------G.M--SMEQVEYVMG--------------
Q1ZJZ5_PHOAS/34-104----KSVDML----------------RV-----------------------G.M--TKAQVQYVLG--------------
Q0HGH3_SHESM/49-120----QQVEKL----------------RI-----------------------D.M--TKEQAEYILG--------------
Q220P9_RHOFD/38-108----EQAAAV----------------TP-----------------------G.M--SRVQVRDILG--------------
Q3BVC3_XANC5/28-99----NAVEQL----------------QV-----------------------G.Q--SKQQVSALLG--------------
BAME_NEIMB/36-106----RAVAAL----------------RP-----------------------G.M--TKDQVLLLLG--------------
Q5NEF6_FRATT/34-106----KKLFEI----------------KP-----------------------N.M--TKSEVTYILG--------------
A4TNU9_YERPP/35-105----IDASKI----------------HK-----------------------G.M--TQQQVAYTLG--------------
Q7WYE0_ACIHA/30-99----AQAAQV----------------QV-----------------------G.M--SFQQVRFLLG--------------
Q1N393_9GAMM/29-99----DMLEKL----------------KP-----------------------G.M--NQRQVAYVMG--------------
BAME_VIBF1/35-105----EAVDKL----------------RF-----------------------G.M--TKQQVQFVMG--------------
Q8G1E5_BRUSU/49-125----QALDSV----------------PV-----------------------G.S--SREQVLLALG--------------
A5ZZI3_VIBCL/52-122----QSVDQL----------------KF-----------------------G.M--SKEQVRFVLG--------------
A6VMF3_ACTSZ/34-104----STVEQL----------------QV-----------------------G.M--TREQVKYLLG--------------
Q7VRQ4_BLOFL/39-110----KDIQKI----------------KI-----------------------G.M--TKSEILSCIE--------------
BAME_NITEU/35-105----EMVAKL----------------KP-----------------------G.M--TRSQVRFTLG--------------
Q0C315_HYPNA/29-105----VQPIDI----------------KP-----------------------GDD--TRSTVLAQLG--------------
Q47XI1_COLP3/29-101----KSIDKL----------------QV-----------------------G.M--TKEQVKFILG--------------
Q7P9U9_RICSI/27-103----SALVKL----------------ES-----------------------KKL--NKTEVVELIG--------------
A4TZI9_9PROT/28-104----EDLAKI----------------TA-----------------------GKT--SREEVQALLG--------------
Q47HJ0_DECAR/36-107----EMVSQL----------------KP-----------------------G.Q--TKDQVRFLLG--------------
Q4ZMZ6_PSEU2/30-98----PLVKQV----------------EN-----------------------G.M--TRQQVLTIGG--------------
B0KIS9_PSEPG/35-105----DMIDQL----------------RP-----------------------G.M--TRRQVRFIMG--------------
Q5FUN3_GLUOX/45-121----TDYAQL----------------VP-----------------------GTS--TRTDVLDLLG--------------
Q2SMN2_HAHCH/93-162----EAVEQL----------------KV-----------------------G.M--NRRQVQYLLG--------------
Q2BRB3_9GAMM/31-102----DMVDKL----------------RP-----------------------G.M--TESQVRFIMG--------------
Q0A7D7_ALHEH/37-107----EMVDEL----------------RV-----------------------G.M--SQQQVRTIMG--------------
A1AX05_RUTMC/37-107----FKINQL----------------NL-----------------------G.M--SKTQVQDLIG--------------
Q3SSS7_NITWN/53-129----GALEQI----------------QI-----------------------G.A--SQDQVLIVMG--------------
A5W9P3_PSEP1/29-96----PLVKQV----------------EN-----------------------G.M--TMQKVIAIGG--------------
Q2RTT3_RHORT/36-112----EALGQI----------------QE-----------------------GVH--TRTDIQALLG--------------
Q5X816_LEGPA/32-102----SKIARL----------------KT-----------------------G.M--SKNDVAILMG--------------
A6D2W0_9VIBR/35-105----TAVEQL----------------RF-----------------------G.M--TKEQVRFVLG--------------
Q46NU4_CUPPJ/65-139----DSLRLL----------------QP-----------------------G.M--TKDQHYALIG--------------
Q2NRT5_SODGM/28-97----PVVSDV----------------KK-----------------------G.M--TKEQARAIGG--------------
O85277_PASHA/57-127----ENVRQI----------------EK-----------------------G.M--NKDQLYNLIG--------------
A4VII8_PSEU5/29-97----PLVRDV----------------ET-----------------------G.M--TQARVLSIGG--------------
A5PER7_9SPHN/21-97----VLLNTV----------------QP-----------------------GID--NQRSVEMTLG--------------
A7I1H3_CAMHC/52-124----ENIRKI----------------ET-----------------------G.M--SKDEIRKLIG--------------
A6FB83_9GAMM/42-112----RQVDKL----------------RV-----------------------D.M--TKEQVTFVLG--------------
A3J973_9ALTE/29-99----KELTAL----------------TE-----------------------G.M--PRNQVHAVMG--------------
Q6G003_BARQU/42-118----NVFDSI----------------SI-----------------------G.S--SQKQVILALG--------------
Q8KTI1_AZOVI/35-105----DMIDQL----------------RP-----------------------G.M--TRRQVRFVMG--------------
Q5PFG5_SALPA/21-91----TDVAKV----------------RV-----------------------G.M--TQQQVAYALG--------------
A4WTT5_RHOS5/40-116----IDLRQI----------------EV-----------------------GRD--TRDTVAEIVG--------------
Q604C4_METCA/51-121----EMVDQL----------------KP-----------------------G.M--NRRQVTFIMG--------------
B0UR41_METS4/34-110----AAVAQV----------------KP-----------------------G.T--SAEQVLQLLG--------------
Q15V54_PSEA6/31-104----RDVSKL----------------RI-----------------------N.M--TKEQVEYVLG--------------
Q492C5_BLOPB/40-110----YDIKKI----------------RL-----------------------G.M--TKLEISSNIG--------------
Q3R3Z3_XYLFA/29-77----EAVDQL----------------KI-----------------------G.M--NKQEVAMLLG--------------
Q1N9S5_9SPHN/44-120----LLVDSV----------------QP-----------------------GID--NRASVEGTLG--------------
Q31FS2_THICR/36-107----EAINTL----------------QP-----------------------G.L--TANQVKDILG--------------
A4BRW9_9GAMM/48-119----DKIKQL----------------RP-----------------------G.M--TPQQVQFLLG--------------
Q3R9M0_XYLFA/29-100----EAVDQL----------------KI-----------------------G.M--NKQEVAMLLG--------------
A6U7Q1_SINMW/42-118----ETLALV----------------PV-----------------------G.S--SREQVLLSLG--------------
A1IQ08_NEIMA/52-134----DELDQM----------------RP-----------------------G.L--TKDDIYKILG--------------
A3RS11_RALSL/104-175----EQASQL----------------KE-----------------------G.M--TRDQVRYVLG--------------
A1WGT8_VEREI/51-121----EQVQAL----------------QP-----------------------G.M--SRQQVREILG--------------
A4SVD7_POLSQ/67-138----EQYAKL----------------QL-----------------------G.M--SREQVRQILG--------------
Q2NRZ9_SODGM/35-105----ADVAKI----------------HT-----------------------G.M--TKQQVAYTLG--------------
A1WCQ4_ACISJ/49-119----EQVQML----------------QP-----------------------G.M--GRQQVREILG--------------
B1ZKI2_METPB/33-109----AALATV----------------KP-----------------------G.M--GAEQVLQILG--------------
A1TVV3_ACIAC/48-118----EQVEAL----------------QP-----------------------G.M--SRQQVKEILG--------------
Q1LMT9_RALME/71-142----EAVAQL----------------RP-----------------------G.M--TRDQVSFLLG--------------
Q6FDQ3_ACIAD/30-107----AQASKV----------------QV-----------------------G.M--SYQQVRFLLG--------------
Q7CZT7_AGRT5/48-124----QSLQLI----------------PE-----------------------G.S--SREQVLLTMG--------------
Q0K704_CUPNH/51-122----EAVSQL----------------RE-----------------------G.M--TRDQVKFLLG--------------
Q2T565_BURTA/70-143----ENLRQI----------------GP-----------------------G.L--DKNQVYALIG--------------
Q21H32_SACD2/36-106----KMVDQL----------------EV-----------------------G.M--TRRQVQYVMG--------------
A3UCC7_9RHOB/30-106----GEVPEL----------------TV-----------------------GVD--SQSTVLATLG--------------
Q7W511_BORPA/42-112----EQVALL----------------QQ-----------------------G.M--SREQVRFALG--------------
Q83C32_COXBU/30-100----KDLGAL----------------HK-----------------------G.M--TKTKVESLLG--------------
A8GGW6_SERP5/28-97----PVVSDV----------------KV-----------------------G.M--TKQQVRAIAG--------------
A7JT78_PASHA/34-104----DKIAQL----------------KV-----------------------G.M--TAEQVEYLLG--------------
A5FV68_ACICJ/239-315----AQLKQL----------------TP-----------------------GVS--TEADATALLG--------------
Q3SJS3_THIDA/32-102----ENVSRL----------------KP-----------------------G.L--NRSQVRFLLG--------------
A0KI84_AERHH/30-100----KQVDKL----------------RQ-----------------------G.M--TREQVEFVLG--------------
Q1ZGE3_9GAMM/45-115----QKMAQL----------------EL-----------------------G.M--DQQQVIFLLG--------------
Q3IE33_PSEHT/35-105----SDVDKL----------------RV-----------------------N.M--TREQVIYVLG--------------
Q1YIM3_MOBAS/35-111----KTVELV----------------PV-----------------------G.S--SREQVLLALG--------------
A6W2D6_MARMS/31-103----EQLSQL----------------QI-----------------------G.M--SESQVTYLLG--------------
A4A5R9_9GAMM/32-102----DMIEQL----------------QP-----------------------G.M--SRRQVRFIMG--------------
A3TX83_9RHOB/22-98----EDLQQI----------------TV-----------------------GVD--TRDTVAEVLG--------------
Q2G501_NOVAD/31-107----ALVASV----------------QP-----------------------GVD--NKLSVERTLG--------------
A7HX93_PARL1/37-112----ADLEKL----------------QT-----------------------G.A--SKEQVRSVMG--------------
A3WGB0_9SPHN/35-111----VLVNSV----------------QP-----------------------GID--NRRSVEGMLG--------------
A3WPM9_9GAMM/35-105----RDVDKL----------------RV-----------------------G.M--SQEQVAYVLG--------------
Q983A2_RHILO/103-179----QAVDSV----------------PV-----------------------G.S--SREQVLLALG--------------
Q7NX33_CHRVO/32-104----DAVAKL----------------KP-----------------------G.M--TRAQVRFLLG--------------
A4EML3_9RHOB/35-111----EELATL----------------NV-----------------------GST--TKAEVIALFG--------------
A3XBH2_9RHOB/39-115----EQLAEV----------------VV-----------------------GVD--TKDSVAETVG--------------
Q2YBT7_NITMU/31-101----EMVNKL----------------KP-----------------------G.M--TRSQVRFALG--------------
A2SC95_METPP/48-118----EMAAAV----------------KP-----------------------G.M--TRAQVRDTLG--------------
Q1QE29_PSYCK/52-131----TQAQKL----------------QV-----------------------G.M--NQNQVLYLLG--------------
Q3ZU02_ECOLX/52-122----EKLRQI----------------KA-----------------------G.M--NKDQIYQLAG--------------
A1K8N9_AZOSB/69-139----AMVSQL----------------KR-----------------------G.M--SREQVRFVLG--------------
A7INK8_XANP2/42-117----GALDQV----------------PV-----------------------G.S--SQEQVLLVLG--------------
Q1QSW6_CHRSD/33-103----DMVSQL----------------ET-----------------------G.M--TKEQVRYVMG--------------
A6AQ89_VIBHA/35-105----SAVDKL----------------KF-----------------------G.M--TKAQVRYVLG--------------
A0NMF1_9RHOB/29-104----DMLNQV----------------QV-----------------------G.S--SREQVELVLG--------------
Q1H393_METFK/54-124----KMMLQL----------------RP-----------------------G.M--TKSQVRFIMG--------------
A4CD42_9GAMM/31-101----KDIDKL----------------RV-----------------------E.M--TREQVIYVLG--------------
Q1Z300_PHOPR/34-104----SDIDTL----------------RM-----------------------G.M--NKEQVRYVLG--------------
Q0G6I2_9RHIZ/46-123----QMLQLV----------------PE-----------------------G.S--SREQVELALG--------------
Q0I1R6_HAES1/25-95----AAVEQV----------------KV-----------------------G.M--NAQQVQYLLG--------------
A3MZE6_ACTP2/34-104----EKIDQV----------------KV-----------------------G.M--DKTQVQYLLG--------------
B0T0T5_CAUSK/29-105----AKPVDM----------------KV-----------------------GVD--SKSTVTEKLG--------------
A0Z1I1_9GAMM/51-121----EMIEQL----------------QP-----------------------G.M--TRRQVRFVMG--------------
Q1YQK7_9GAMM/34-104----EMIDKL----------------LP-----------------------G.M--TKSQVRFVLG--------------
A6GNF7_9BURK/49-119----QDVARL----------------QV-----------------------G.M--SKEQVRFILG--------------
A1WX37_HALHL/38-106----EDIEQI----------------TV-----------------------G.M--SRNQVRQRLG--------------
Q0FTJ6_9RHOB/18-94----EDLQEI----------------VP-----------------------GID--TRGTVEDVIG--------------
Q0I3M4_HAES1/52-122----DNLRMV----------------ER-----------------------G.M--NKDQLYNLLG--------------
A7C6T6_9GAMM/33-103----EMLARL----------------EL-----------------------N.M--PAKKVRLIMG--------------
Q11J87_MESSB/48-124----QALELV----------------PV-----------------------G.S--SREQVLLALG--------------
A4XUA2_PSEMY/28-96----PLVKQV----------------DH-----------------------G.M--TQEQVRTLGG--------------
Q28RF7_JANSC/34-109----ELLSEI----------------SI-----------------------G.T--SREQVAEIAG--------------
Q5QXM4_IDILO/32-102----DDVDKL----------------RV-----------------------G.M--TEEQVVFVLG--------------
BAME_BUCAI/32-101----NILNRN----------------YV-----------------------G.M--TRQQIVYIFG--------------
Q0B235_BURCM/41-111----DNLRNV----------------AP-----------------------G.L--NKDQMYDLLG--------------
A9AMY8_BURM1/53-123----ANLRNV----------------ST-----------------------G.L--NKDQLYDLIG--------------
Q0BTE4_GRABC/35-111----DLLKEL----------------TP-----------------------GTS--TQADVASLLG--------------
Q2NDV7_ERYLH/16-92----LLLDRV----------------QP-----------------------GID--NRQSVAATLG--------------
Q122Q0_POLSJ/29-99----EQVEQL----------------RP-----------------------G.M--SRDQVRAVLG--------------
Q3JBU9_NITOC/42-112----EMLEKL----------------SP-----------------------G.M--SKQQVSFVLG--------------
Q7VM11_HAEDU/34-104----DKIDQV----------------KI-----------------------G.M--NKTQVQYLLG--------------
Q6D4H9_ERWCT/28-96----PVVKDV----------------KV-----------------------G.M--TKQQVQQLAG--------------
A6VCY4_PSEA7/30-98----PLVKNV----------------EK-----------------------G.M--SQQEVLRIGG--------------
A5V7M5_SPHWW/32-109----TLINTV----------------SP-----------------------GVD--NRESVEKTLG--------------
Q1GPC4_SPHAL/37-113----ALTEAI----------------TP-----------------------GVD--NRESVERTLG--------------
A6EYM2_9ALTE/29-99----EELTSL----------------AE-----------------------G.M--SRSQVHSLLG--------------
Q0VSU2_ALCBS/35-105----DMLSEL----------------QP-----------------------G.M--TPEQVRYVLG--------------

PF07467

Q9KJ90_STREX/2-185----EKYEQI----------------QF-----------------------G-M--TFDEVWEIGGGEAACDTGGVIGDS
P97062_STRCL/2-181----ERYNKI----------------QF-----------------------G-M--DRTLVWQLAGADQSCSDQ...VER
BLIP_STRCL/10-200----AKFTQI----------------QF-----------------------G-M--TRQQVLDIAGAE.NCETGGSFGDS

PF12978

Q8DTX1_STRMU/47-205----LSFNKI----------------KV---------------TTDQNHFSGGT--SIEQLKQWFG.DPNKSEQRNAGNI
Q3CZX6_STRAG/47-206----LKFNKV----------------KL---------------GVKANNFKGGT--SLAELKQLFGGEPNEKFDTPAGNV
E7FPD9_9LACO/70-224----KKFDAI----------------VV---------------GYLMSNGDGGT--SLTDVEKSLG.KPVSTSTTNLQNV
B9DSB0_STRU0/47-205----LAFEKI----------------KV---------------ATAQEQFKGGT--SIEELKELFG.EPSSFEQKPAGNV
C2LUW8_STRSL/44-203----QNFDKI----------------TM---------------ANASQEFSGGS--NLDSLKGWFG.EPSSTSQEQAGDA
Q044U3_LACGA/47-206----EKFDQI----------------KV---------------GELSNHGEGGS--TIQDVEKLLG.KANTTDTTTVDSY
A9D9J1_9VIRU/47-206----EKFDQI----------------KV---------------GNFLSQGEGGS--TIDEVKQLLG.SPTSTTTTSSNGV
C0ME71_STRS7/45-203----ANMEKV----------------KL---------------ATASTDFKGGS--SLEELIAIFG.QPSQHEEKAAGSV
A2RE59_STRPG/46-204----ANFEKI----------------KL---------------ATVDSSFTGGT--SLEELISLFG.EPNQHDPKTAGEV

PF13670

Q0BXA6_HYPNA/7-95----------------------------------------ADAVGIARA.------------------------------
Q0BXA5_HYPNA/6-84----------------------------------------EQALEIASK.------------------------------
A3WRM0_9BRAD/6-83----------------------------------------QEALGVAVE.------------------------------
Q0BY17_HYPNA/6-92----------------------------------------ATAVDIARA.------------------------------
A4VHV2_PSEU5/30-109----------------------------------------EQAVEKAKA.------------------------------
A4XVH9_PSEMY/6-85----------------------------------------EDALSKARA.------------------------------
Q3KD49_PSEPF/7-87----------------------------------------EKAIEIVKTK------------------------------
B1ZL54_METPB/14-93----------------------------------------DQVLTKLSE.------------------------------
C7CAP4_METED/4-84----------------------------------------DQVLTKLAE.------------------------------
A3WVM1_9BRAD/4-83----------------------------------------DQVIQKLTG.------------------------------
Q1QMT6_NITHX/5-85----------------------------------------DQVIQKLME.------------------------------
Q07QG0_RHOP5/5-84----------------------------------------EQVKQKLTQ.------------------------------
B8EKV5_METSB/3-81----------------------------------------EALIKKLEG.------------------------------
Q3BZQ4_XANC5/7-87----------------------------------------GEVTSMLTA.------------------------------
D8JU49_HYPDA/7-90----------------------------------------SEVIQKLKA.------------------------------
Q0FJR3_9RHOB/4-79----------------------------------------SQIRGKLTA.------------------------------
B6B6G1_9RHOB/5-81----------------------------------------AKIRDLLTG.------------------------------
A3X8K5_9RHOB/6-81----------------------------------------AKIRATLTE.------------------------------
A4F198_9RHOB/68-143----------------------------------------AKIHEILSG.------------------------------
B9QWG8_9RHOB/19-97----------------------------------------SEIAGQLED.------------------------------
Q5LX53_SILPO/50-129----------------------------------------DEIRTSLKD.------------------------------
A3JXM1_9RHOB/4-83----------------------------------------EDATAALAS.------------------------------
B1G434_9BURK/9-91----------------------------------------NEVSKQLEK.------------------------------
B8IVF4_METNO/5-90----------------------------------------SEVSKGLEV.------------------------------
A5EBJ8_BRASB/4-90----------------------------------------ADAEAKAKS.------------------------------
Q1I4X8_PSEE4/3-87----------------------------------------DQFQAKLKD.------------------------------
B3PI60_CELJU/2-85----------------------------------------AKFQEDLKS.------------------------------
C1DNM7_AZOVD/2-85----------------------------------------TKFQEQLKA.------------------------------
A3WIS1_9GAMM/4-89----------------------------------------AEFQQGLEE.------------------------------
Q1LBN9_RALME/3-85----------------------------------------ADAKAKIQE.------------------------------
Q46SM0_CUPPJ/3-85----------------------------------------ADARAKIEA.------------------------------
Q8XWW7_RALSO/3-85----------------------------------------AEAQAKIKA.------------------------------
B9YYZ8_9NEIS/4-86----------------------------------------ADFKQKLVK.------------------------------
A1K227_AZOSB/5-88----------------------------------------EAMKQKISA.------------------------------
Q5P431_AROAE/5-88----------------------------------------EAMKQKIAE.------------------------------
Q5P432_AROAE/18-101----------------------------------------TTMLRKLVD.------------------------------
D0KWU4_HALNC/5-88----------------------------------------DKVLAKATQ.------------------------------
B0SVT0_CAUSK/5-90----------------------------------------AQMKAKIAA.------------------------------
B3PS83_RHIE6/3-88----------------------------------------EAMKAKIGA.------------------------------
A7IQ54_XANP2/6-90----------------------------------------ETMKQKIAE.------------------------------
Q8D5M1_VIBVU/5-90----------------------------------------EQAKSQVEA.------------------------------
D2YV68_VIBMI/5-91----------------------------------------EQAQQQVEE.------------------------------
B1Y4P0_LEPCP/3-85----------------------------------------SDFKSRLEA.------------------------------
B8IVE9_METNO/4-91----------------------------------------ETLKAKAEA.------------------------------
Q07GW2_RHOP5/24-110----------------------------------------QALQAKLES.------------------------------
Q1QM54_NITHX/4-90----------------------------------------EQLQAKVEA.------------------------------
A9DGE5_9RHIZ/5-87----------------------------------------AAITAKAEK.------------------------------
C9X3G7_NEIM8/6-91----------------------------------------TKAVKMLEQ.------------------------------
C5TKZ2_NEIFL/6-91----------------------------------------AKAVKMLEQ.------------------------------
B6BXY0_9GAMM/6-84----------------------------------------SEIVKSLEE.------------------------------
B4X0R3_9GAMM/21-99----------------------------------------SELAKMIEE.------------------------------
Q2C6V1_9GAMM/7-89----------------------------------------PQAMKILEK.------------------------------
A1B769_PARDP/5-86----------------------------------------SAVVRLAEE.------------------------------
A3W5R2_9RHOB/5-86----------------------------------------DAVARLAAE.------------------------------
A6FVG6_9RHOB/5-86----------------------------------------ETVARLAAE.------------------------------
A6FVG8_9RHOB/5-87----------------------------------------ETAMQLARQ.------------------------------
A1B772_PARDP/5-86----------------------------------------EAVMQAAAG.------------------------------
A1UW16_BURMS/12-98----------------------------------------DAVRALAQQ.------------------------------
Q46QS0_CUPPJ/12-98----------------------------------------DAVRTVARQ.------------------------------
Q1MGZ9_RHIL3/5-86----------------------------------------AAVRAMAGQ.------------------------------
B6JDT2_OLICO/6-87----------------------------------------EAVQKSAEA.------------------------------
A5VTX2_BRUO2/5-87----------------------------------------DAVQQMAAS.------------------------------
A1U059_MARAV/5-86----------------------------------------ENLREKLEA.------------------------------
A1SRM1_PSYIN/5-86----------------------------------------QQLRQRLEQ.------------------------------
C8RZP8_9RHOB/6-87----------------------------------------EVLAEKVRA.------------------------------
A6UM17_SINMW/4-85----------------------------------------EALQTKLEG.------------------------------
B9K2Y3_AGRVS/4-85----------------------------------------ESLQRKLEG.------------------------------
A7IKT6_XANP2/6-87----------------------------------------DALQKKLEG.------------------------------
A1B771_PARDP/5-86----------------------------------------EALVQVTDE.------------------------------
B2S782_BRUA1/5-86----------------------------------------DALVQLSNE.------------------------------
Q0AG96_NITEC/6-89----------------------------------------SAIQAAVAAN------------------------------
A6T0P1_JANMA/11-102----------------------------------------EELERRVTA.------------------------------
Q0S079_RHOSR/10-95----------------------------------------TKASAAALAH------------------------------
D0DC31_9RHOB/4-83----------------------------------------EKIAAKLTEM------------------------------
A8LNS6_DINSH/4-81----------------------------------------MKIMAMLAEM------------------------------
A3PJ37_RHOS1/4-81----------------------------------------GKINAMLTEM------------------------------
Q0G655_9RHIZ/24-110----------------------------------------QMVQETLSK.------------------------------
D8JXS4_HYPDA/4-89----------------------------------------GVVSERLNR.------------------------------
D8JRG1_HYPDA/7-86----------------------------------------TAVTAALTK.------------------------------
A5VRY8_BRUO2/10-90----------------------------------------AALERVLTQ.------------------------------
B1ZIF7_METPB/6-84----------------------------------------AKVEDVLKK.------------------------------
B1M6N2_METRJ/3-84----------------------------------------AKVEAMLKQ.------------------------------
A7HVA0_PARL1/7-87----------------------------------------ERIEEVLRG.------------------------------

PF03413

Q4K807_PSEF5/38-102----------------------------------------.TELEQTA................----------------
Q8D7W4_VIBVU/128-189----------------------------------------.NLFINPS................----------------
Q9KC80_BACHD/94-154----------------------------------------.AIRLGVE................----------------
Q9K7V1_BACHD/28-100----------------------------------------.MIPETLEK...............----------------
Q6W134_RHISN/286-345----------------------------------------.TVAIPA.................----------------
A8FCD9_BACP2/110-169----------------------------------------.SDLDKE.................----------------
A5UQY0_ROSS1/111-167----------------------------------------.KPAELVR................----------------
A5MW77_STRPN/106-160----------------------------------------.KITFGRY................----------------
Q8E8L7_SHEON/45-99----------------------------------------.VQ.....................----------------
Q03RI8_LACBA/34-106----------------------------------------.KHAVPFQK...............----------------
Q6GFW2_STAAR/32-101----------------------------------------.YEPFVHPE...............----------------
Q38Z32_LACSS/130-188----------------------------------------.ATLEKD.................----------------
Q0VNU0_ALCBS/63-123----------------------------------------.VELERD.................----------------
A0REW6_BACAH/375-436----------------------------------------.KAVVVNDL...............----------------
Q186H8_CLOD6/144-202----------------------------------------.WSLDKD.................----------------
Q3ETC3_BACTI/150-220----------------------------------------.VYQNG.E................----------------
Q5WGU9_BACSK/378-439----------------------------------------.LAVIENDI...............----------------
Q3DSW2_STRAG/153-213----------------------------------------.EISLANN................----------------
Q6EA99_LISMN/121-195----------------------------------------.INSR...................----------------
A0REU8_BACAH/162-234----------------------------------------.FVDENNG................----------------
Q8KFX7_CHLTE/45-103----------------------------------------.AELEKH.................----------------
Q8TLV5_METAC/114-171----------------------------------------.IDEDI..................----------------
Q6ANJ0_DESPS/50-117----------------------------------------.VIEAELEMKSL............----------------
Q5KVG3_GEOKA/282-341----------------------------------------.TISLPQ.................----------------
Q9A4R3_CAUCR/50-105----------------------------------------.AG.....................----------------
NPRM_BACME/152-222----------------------------------------.VYQNA.S................----------------
Q8RBF9_THETN/464-522----------------------------------------.ILDYDYKSPD.............----------------
Q7P204_CHRVO/118-188----------------------------------------.NDKAELVVRL.............----------------
A3HZ45_9BACT/55-116----------------------------------------PTKEKSAQAIF.............----------------
Q72M70_LEPIC/153-248----------------------------------------.WESPEREEAFKKKQDDPSATNFP----------------
Q5WLC0_BACSK/141-199----------------------------------------.WKLEKD.................----------------
Q8ERG4_OCEIH/132-194----------------------------------------.LEID...................----------------
Q8E690_STRA3/31-94----------------------------------------.VIHQKIDKE..............----------------
Q8R5X9_FUSNN/83-142----------------------------------------.IELKNI.................----------------
A3UR63_VIBSP/116-190----------------------------------------.NKNAKLMVRL.............----------------
Q8PEF5_XANCP/86-141----------------------------------------........................----------------
Q93J57_STRCO/330-390----------------------------------------.EISTPA.................----------------
A7GDD3_CLOBL/148-213----------------------------------------.SKKTDLYLYN.............----------------
C3NWD2_VIBCJ/115-190----------------------------------------.NESVQLMVRL.............----------------
Q1Q7U9_PSYCK/44-104----------------------------------------.ADFDQEY................----------------
Q15RY9_PSEA6/32-87----------------------------------------.VD.....................----------------
A0KRR6_SHESA/27-86----------------------------------------.LEVEQK.................----------------
Q6HZB7_BACAN/163-222----------------------------------------.IRLEQK.................----------------
Q8TTA4_METAC/138-199----------------------------------------RLYLDYE.................----------------
Q5X972_LEGPA/122-197----------------------------------------.QETAELQIRP.............----------------
Q9L1F9_STRCO/146-216----------------------------------------.ADSAPRKVIW.............----------------
A1S2N2_SHEAM/113-188----------------------------------------.NDSAQPWIILY............----------------
Q9L126_STRCO/81-167----------------------------------------KRVKADATASPTGSPTGT......----------------
A3D9D2_SHEB5/116-190----------------------------------------.NKQAKLWLYL.............----------------
A8MEK6_ALKOO/172-230----------------------------------------.IELEYD.................----------------
C1DJ09_AZOVD/39-99----------------------------------------.TELEEE.................----------------
Q1QQG0_NITHX/28-83----------------------------------------.VTVSDAE................----------------
A5G759_GEOUR/48-108----------------------------------------.VVIERK.................----------------
A7Z7T0_BACA2/28-100----------------------------------------.TEPEPYQV...............----------------
Q0AQU2_MARMM/109-177----------------------------------------.SAINRIAEPP.............----------------
A1S4V2_SHEAM/92-162----------------------------------------.GHKDVELVIL.............----------------
A6P1K3_9FIRM/263-321----------------------------------------.IDFDYD.................----------------
A3YDS2_9GAMM/122-191----------------------------------------.RSSADLIIWL.............----------------
Q2MG71_MICEC/79-138----------------------------------------.VEAEKE.................----------------
Q825U8_STRAW/286-346----------------------------------------.EIVPPA.................----------------
A5EBU9_BRASB/13-71----------------------------------------.INFDI..................----------------
Q181V6_CLOD6/408-465----------------------------------------.YCKYD..................----------------
A3IDB5_9BACI/37-95----------------------------------------.IELDQN.................----------------
A5W1K1_PSEP1/32-87----------------------------------------........................----------------
Q8ESN0_OCEIH/32-90----------------------------------------.PDLQLK.................----------------
A4XTT8_PSEMY/39-99----------------------------------------.TELEDE.................----------------
A7N0D3_VIBHB/111-186----------------------------------------.DARAELMVWL.............----------------
A4JUZ6_BURVG/39-97----------------------------------------.AEYENS.................----------------
Q9R9S7_AERPU/113-179----------------------------------------.NEQVKLFVIQ.............----------------
Q9A8Q0_CAUCR/73-133----------------------------------------.VELEEAG................----------------
Q81R43_BACAN/43-101----------------------------------------.IDVERM.................----------------
Q1MKW1_RHIL3/284-343----------------------------------------.DVAIPS.................----------------
Q5FIK0_LACAC/141-199----------------------------------------.WNLEQE.................----------------
Q3KIR7_PSEPF/283-342----------------------------------------.SITMPT.................----------------
Q6GJS7_STAAR/52-111----------------------------------------.GISFENS................----------------
Q5WLC0_BACSK/58-117----------------------------------------.IELEAE.................----------------
Q884E8_PSESM/260-320----------------------------------------.FITPPFNAYS.............----------------
Q5FIK1_LACAC/43-101----------------------------------------.INLEKE.................----------------
A7VSV8_9CLOT/98-161----------------------------------------.VKEDYD.................----------------
Q9L7Z4_STACR/122-196----------------------------------------.AKNGKD.QVVKSN..........----------------
Q8RTZ9_9GAMM/126-201----------------------------------------.NEQSRLAIWL.............----------------
A6AL37_VIBHA/130-204----------------------------------------.DQKQALTIYV.............----------------
Q3D1Y5_STRAG/117-182----------------------------------------.IKEEIE.................----------------
Q4ZPX1_PSEU2/38-99----------------------------------------.TELDKDR................----------------
Q8RBF9_THETN/109-184----------------------------------------.PSYPLGA................----------------
Q4MVM1_BACCE/29-101----------------------------------------.MVPETFEK...............----------------
A9VL27_BACWK/39-104----------------------------------------.VKKEFELEDD.............----------------
C2SHN7_BACCE/94-163----------------------------------------.KAKLGFE................----------------
B1KR36_SHEWM/116-189----------------------------------------.NEQADLWVYQ.............----------------
Q6HDI2_BACHK/430-497----------------------------------------.SIDHD..................----------------
Q8KI45_ENTFL/35-92----------------------------------------.VNVQFDT................----------------
Q9KE75_BACHD/74-132----------------------------------------.SVRFYD.................----------------
Q1JAF1_STRPB/81-144----------------------------------------.VTQDNE.................----------------
Q4EQU7_LISMN/131-191----------------------------------------.HVNLGME................----------------
Q4JLE6_LACRE/76-135----------------------------------------.VELESD.................----------------
Q9L126_STRCO/188-249----------------------------------------.VELGDND................----------------
Q8P606_XANCP/82-140----------------------------------------.YTTPD..................----------------
A5W5R7_PSEP1/39-99----------------------------------------.SELEDE.................----------------
Q181V6_CLOD6/490-547----------------------------------------.KFKYD..................----------------
Q2FUX4_STAA8/118-192----------------------------------------.AKNLKD.KVIKEN..........----------------
Q3DA42_STRAG/78-137----------------------------------------.IELNTK.................----------------
A7G9N1_CLOBL/383-444----------------------------------------.LSIIPTEA...............----------------
B0KBH9_THEP3/371-432----------------------------------------.LTLIPLES...............----------------
Q1IC64_PSEE4/41-101----------------------------------------.AELEEK.................----------------
Q0HTI7_SHESR/103-173----------------------------------------.GKKDVQLVIL.............----------------
Q82ND7_STRAW/171-257----------------------------------------.AYGEDDEGKKDATPLTG......----------------
B9LEH7_CHLSY/84-135----------------------------------------.VKL....................----------------
Q97G52_CLOAB/161-230----------------------------------------.APRAQKQVIV.............----------------
Q5M069_STRT1/87-141----------------------------------------.YVHLGKY................----------------
A6V146_PSEA7/122-192----------------------------------------.NEKVELVIRL.............----------------
A7FTW6_CLOB1/148-213----------------------------------------.SEKADLYLYN.............----------------
Q8U1R9_PYRFU/327-383----------------------------------------........................----------------
Q1H2G7_METFK/106-166----------------------------------------.VEYEIEE................----------------
B8G477_CHLAD/218-274----------------------------------------.VKREYE.................----------------
Q5UKQ5_9BACI/139-216----------------------------------------NVANKNKAELKAA...........----------------
Q5GXB5_XANOR/79-137----------------------------------------.YITPK..................----------------
NPRE_PAEPO/214-283----------------------------------------.VDPKAELYYY.............----------------
Q1ARP9_RUBXD/67-126----------------------------------------.SGLDEE.................----------------
Q2B384_9BACI/29-101----------------------------------------.MQPEPYEK...............----------------
A6NW01_9FIRM/193-253----------------------------------------.CELDED.................----------------
Q97GS5_CLOAB/161-230----------------------------------------.TILTDNN................----------------
A5WGS1_PSYWF/34-90----------------------------------------.IDFD...................----------------
Q6HZB7_BACAN/33-91----------------------------------------.MKLINK.................----------------
Q46237_CLOPF/161-230----------------------------------------.EEPKAENYIY.............----------------
A3QGG2_SHELP/47-105----------------------------------------.VQSSRV.................----------------
A3UN73_VIBSP/32-105----------------------------------------.DPNTELVIWL.............----------------
A0M3G0_GRAFK/62-119----------------------------------------.VLYTGKD................----------------
Q2SJ90_HAHCH/129-208----------------------------------------.NESSELMIYFD............----------------
YPEB_BACSU/377-438----------------------------------------.LALITNEL...............----------------
A6P1K3_9FIRM/443-502----------------------------------------.FERDSD.................----------------
Q047A4_LACGA/60-119----------------------------------------.IDLKLD.................----------------
Q3K852_PSEPF/38-98----------------------------------------.TDLDNH.................----------------
Q7A1T8_STAAW/129-187----------------------------------------.WSLEKD.................----------------
Q884E8_PSESM/67-126----------------------------------------.TIMQPD.................----------------
B3XMM9_LACRE/153-213----------------------------------------.WKLEQEK................----------------
A9VSE9_BACWK/148-221----------------------------------------.VVYKKK.................----------------
Q211C9_RHOPB/96-155----------------------------------------.ISFDGS.................----------------
A8MEK5_ALKOO/294-355----------------------------------------.MELDIDD................----------------
A6FBW4_9GAMM/126-204----------------------------------------.NETSRLAVWL.............----------------
Q5X0P7_LEGPA/120-190----------------------------------------.KNLKKVIYID.............----------------
YKOI_BACSU/164-223----------------------------------------.ADLEES.................----------------
Q8EP78_OCEIH/29-101----------------------------------------.MKPEEIEK...............----------------
Q541Q2_VIBAN/116-194----------------------------------------.NERAQLMVRL.............----------------
Q81R44_BACAN/99-158----------------------------------------.TILEKR.................----------------
Q9I178_PSEAE/60-119----------------------------------------.SIQRPD.................----------------
Q5KXX8_GEOKA/94-154----------------------------------------.DATLGME................----------------
Q7NNP8_GLOVI/232-295----------------------------------------........................----------------
Q7CY41_AGRT5/75-132----------------------------------------.YTTSA..................----------------
Q47KW9_THEFY/83-144----------------------------------------.AIRIG..................----------------
Q9KFU6_BACHD/49-108----------------------------------------.AEKDRD.................----------------
Q825U8_STRAW/84-147----------------------------------------.AVRPSP.................----------------
Q4EUP2_LISMN/142-200----------------------------------------.WKIERE.................----------------
Q2NX96_XANOM/33-88----------------------------------------........................----------------
A7ZG54_CAMC1/58-115----------------------------------------.NVQIG..................----------------
YPEB_BACHD/374-435----------------------------------------.IALIQNDL...............----------------
Q82ZK1_ENTFA/63-122----------------------------------------.LQLDTD.................----------------
Q47MU5_THEFY/138-194----------------------------------------.ASLDKE.................----------------
Q3K994_PSEPF/60-119----------------------------------------.RISRPD.................----------------
THER_BACCL/139-214----------------------------------------.ERPAAEEGKPTRL..........----------------
Q82BN5_STRAW/115-187----------------------------------------.KVTAKPQLVVD............----------------
Q71Z55_LISMF/29-101----------------------------------------.LKKQHYKK...............----------------
A8MEK6_ALKOO/94-155----------------------------------------.VKLDNIKG...............----------------
Q4MSV8_BACCE/94-162----------------------------------------.KVKLGAQ................----------------
Q82US0_NITEU/41-96----------------------------------------.IS.....................----------------
Q3JE96_NITOC/270-334----------------------------------------.WLATPE.................----------------
F2MNH6_ENTFO/119-186----------------------------------------.VFLAIDKRV..............----------------
Q0BZN8_HYPNA/53-112----------------------------------------.LELDED.................----------------
A6T0P0_JANMA/40-97----------------------------------------.VELD...................----------------
Q0AR59_MARMM/55-114----------------------------------------.AELEG..................----------------
Q1J2R6_DEIGD/90-144----------------------------------------.VKLEDE.................----------------
A4BGK8_9GAMM/17-91----------------------------------------.IELEQE.................----------------
Q8R5Y9_FUSNN/99-158----------------------------------------.EIELKHK................----------------
Q72M68_LEPIC/155-250----------------------------------------.WESVEREAALKRKKNDPNASYFP----------------
A0RG40_BACAH/171-259----------------------------------------TNETADLVVYE.............----------------
A6AYE9_VIBPA/130-204----------------------------------------.DQQQGLRIYI.............----------------
A6C2A1_9PLAN/247-311----------------------------------------.RVKLPS.................----------------
Q9L2B8_STRCO/83-152----------------------------------------.AELDDEDDDGD............----------------
Q8ERG4_OCEIH/56-114----------------------------------------.SIELDEH................----------------
Q725B7_LISMF/59-118----------------------------------------.SVELEKS................----------------
A3DI39_CLOTH/391-452----------------------------------------.LAIIPTDY...............----------------
Q9L2B8_STRCO/168-232----------------------------------------.SVELDDDGD..............----------------
B8G480_CHLAD/109-162----------------------------------------.VKLK...................----------------
Q815U2_BACCR/146-219----------------------------------------.VKSYDGVKKDLF...........----------------
A6NW01_9FIRM/109-172----------------------------------------.ARLDRD.................----------------
A6CLW5_9BACI/159-247----------------------------------------NTNVKKDLVVH.............----------------
Q186H8_CLOD6/62-121----------------------------------------.DLSLERD................----------------
Q5ZZ46_LEGPH/35-90----------------------------------------........................----------------
E0THY6_PARBH/109-174----------------------------------------.STVRMLSDPP.............----------------
Q8PQ63_XANAC/120-190----------------------------------------........................----------------
A5WGS1_PSYWF/109-165----------------------------------------.AEFDID.................----------------
A8LN27_DINSH/31-89----------------------------------------.AELDSD.................----------------
Q48DF8_PSE14/60-118----------------------------------------.KYFPPL.................----------------
Q5HNG3_STAEQ/33-102----------------------------------------.QEPIVLEN...............----------------
A4B9Z5_9GAMM/151-215----------------------------------------.NKQQKLWVRL.............----------------
Q988S6_RHILO/46-105----------------------------------------.VDLIRQ.................----------------
Q8VLQ5_PSEO7/125-198----------------------------------------.NEKSRLAIWL.............----------------
A4CC52_9GAMM/131-201----------------------------------------.DKKTRLAIWV.............----------------
Q3J9Y2_NITOC/30-84----------------------------------------.IEFDDD.................----------------
Q391Q3_BURS3/71-131----------------------------------------.VSVQVST................----------------
Q8ESM9_OCEIH/39-97----------------------------------------.FELDRD.................----------------
A6CTU8_9BACI/147-221----------------------------------------.VFVKD.G................----------------
A6AP50_VIBHA/116-190----------------------------------------.NVEDELFIYQ.............----------------
Q74LX8_LACJO/141-200----------------------------------------.WDLKME.................----------------
Q7X5N6_9BACL/163-236----------------------------------------.KFDIQKGKLHVY...........----------------
B2TDF6_BURPP/75-135----------------------------------------.LTAVVAN................----------------
Q020P0_SOLUE/231-293----------------------------------------.QIVMP..................----------------
Q97G51_CLOAB/153-222----------------------------------------.KPKAEKQVII.............----------------
A7ZEI5_CAMC1/22-81----------------------------------------.IEMNVK.................----------------
Q6NKB0_CORDI/71-132----------------------------------------.GVRVG..................----------------
A3WUT4_9BRAD/64-123----------------------------------------.RIDTPR.................----------------
A8AXQ2_STRGC/352-411----------------------------------------.IKDLKIV................----------------
E0TIH6_PARBH/43-102----------------------------------------.AEFDVE.................----------------
A5W9M7_PSEP1/60-118----------------------------------------.QYLPPL.................----------------
Q82WV7_NITEU/279-343----------------------------------------.GMFMPG.................----------------
Q12WY7_METBU/120-186----------------------------------------.GKIKS..................----------------
B7WSK7_COMTE/118-177----------------------------------------.AQLDSD.................----------------
A3TLC9_9MICO/123-187----------------------------------------.VVFAGEA................----------------
A5VEY7_SPHWW/24-82----------------------------------------.GELETS.................----------------
Q0VNT9_ALCBS/52-112----------------------------------------.TELENE.................----------------
Q474Y4_CUPPJ/260-324----------------------------------------.RISFPR.................----------------
A6DY87_9RHOB/293-357----------------------------------------.QLNLPK.................----------------
Q8ELD0_OCEIH/32-90----------------------------------------.VDLSFE.................----------------
Q3JBE9_NITOC/51-111----------------------------------------.SELERE.................----------------
A4XTT9_PSEMY/41-101----------------------------------------.AELEEE.................----------------
A5TS99_FUSNP/24-83----------------------------------------.FKLDRE.................----------------
A6GN46_9BURK/40-99----------------------------------------.VDLDKD.................----------------
A0Q324_CLONN/379-440----------------------------------------.LAIIPTES...............----------------
A7B3W1_RUMGN/132-193----------------------------------------RIQLEFD.................----------------
O27358_METTH/81-143----------------------------------------.AGTPRLLK...............----------------
Q48H34_PSE14/39-99----------------------------------------.TQFKNI.................----------------
Q1D8Q2_MYXXD/168-239----------------------------------------.QPNSERVIYK.............----------------
Q07JR2_RHOP5/48-107----------------------------------------.IDIERK.................----------------
Q8R5X9_FUSNN/10-69----------------------------------------.KIEIFNY................----------------
A6GN43_9BURK/49-110----------------------------------------.LELDDRD................----------------
A5W119_PSEP1/60-119----------------------------------------.YIMRPD.................----------------
YKOI_BACSU/98-153----------------------------------------.VKKQTRQ................----------------
Q03GC8_PEDPA/34-106----------------------------------------.SKPSPLNR...............----------------
Q9KE75_BACHD/288-347----------------------------------------.TISMPE.................----------------
Q2RPG4_RHORT/72-131----------------------------------------.AELESG.................----------------
YCDB_BACSU/416-471----------------------------------------.EREYGDDE...............----------------
A9KIB6_CLOPH/218-275----------------------------------------.TKWSEDG................----------------
Q1D188_MYXXD/208-277----------------------------------------.KSMG...................----------------
A9KIB6_CLOPH/317-399----------------------------------------.GNEK...................----------------
Q6SFP6_9BACT/100-160----------------------------------------.REYSIE.................----------------
A9C057_DELAS/120-179----------------------------------------.AELDSH.................----------------
A4VTY9_STRSY/109-163----------------------------------------.RTILGLR................----------------
Q8RBF9_THETN/290-362----------------------------------------.YKLESAS................----------------
A2SEW0_METPP/117-177----------------------------------------.VEYEVES................----------------
Q2JP28_SYNJB/29-85----------------------------------------.VELERE.................----------------
Q5WKR8_BACSK/122-181----------------------------------------.VELDKE.................----------------
Q6R6B9_LISSE/121-195----------------------------------------.INSR...................----------------
A4TZD4_9PROT/37-96----------------------------------------.AELEDE.................----------------
Q63MT4_BURPS/165-233----------------------------------------.NVQSQLVAFV.............----------------
Q6N7G2_RHOPA/56-115----------------------------------------.IETDVI.................----------------
A5W1V5_PSEP1/63-122----------------------------------------.RLSQPD.................----------------
A6CHW0_9BACI/149-219----------------------------------------.VYTVD.D................----------------
Q3EVA2_BACTI/125-196----------------------------------------WAPTEKEFGYI.............----------------
A6GPB0_9BURK/65-125----------------------------------------.VELEQQT................----------------
A8FCD8_BACP2/167-226----------------------------------------.ADLETF.................----------------
Q49X11_STAS1/141-216----------------------------------------.VNNIKGYDIVNKN..........----------------
A4YY21_BRASO/40-99----------------------------------------.IDIERQ.................----------------
A7Z5Y9_BACA2/99-159----------------------------------------.GVHPARE................----------------
Q8D5E6_VIBVU/113-191----------------------------------------.NETAQLMVRL.............----------------
A7HRL7_PARL1/62-117----------------------------------------.MS.....................----------------
A1T724_MYCVP/79-141----------------------------------------.GIRPPA.................----------------
Q8A623_BACTN/26-84----------------------------------------.SGVSISS................----------------
Q1H2G7_METFK/31-90----------------------------------------.VEYKLE.................----------------
A3IDB5_9BACI/115-169----------------------------------------.IKLDDG.................----------------
Q5F637_NEIG1/47-105----------------------------------------.IDLEHD.................----------------
A5N159_CLOK5/17-76----------------------------------------.VEMDVE.................----------------
Q82ZK1_ENTFA/146-205----------------------------------------.WKLEKE.................----------------
Q2RM03_MOOTA/386-447----------------------------------------.LALIPLPG...............----------------
A4YNR6_BRASO/46-105----------------------------------------.ISFEGG.................----------------
Q9KFU7_BACHD/111-170----------------------------------------.IELEEE.................----------------
Q74JH3_LACJO/126-184----------------------------------------.WSLEMD.................----------------
B8G477_CHLAD/152-208----------------------------------------.RAPELVS................----------------
Q4QZ38_BACIU/144-218----------------------------------------.IEYLDGEPKGELY..........----------------
Q9RC54_BACHO/24-83----------------------------------------.TIYLPR.................----------------
Q1LJM8_RALME/260-324----------------------------------------.RISLPR.................----------------
A7ZEI5_CAMC1/100-159----------------------------------------.EAELDNK................----------------
B8G9I4_CHLAD/116-172----------------------------------------.VSLDDE.................----------------
Q8ESM9_OCEIH/119-177----------------------------------------.FELDED.................----------------
Q0S7B7_RHOSR/138-198----------------------------------------.AEQQQR.................----------------
NPRS_GEOSE/147-222----------------------------------------.VYVNG.D................----------------
A8MIH5_ALKOO/376-437----------------------------------------.LAMIPIPG...............----------------
B0UCU3_METS4/66-129----------------------------------------.ADFEKAK................----------------
YPEB_OCEIH/373-434----------------------------------------.LAIIDNNA...............----------------
Q82ZL5_ENTFA/37-109----------------------------------------.FEKKPLRK...............----------------
B1YFR1_EXIS2/113-183----------------------------------------.IYPVK.D................----------------
Q5HKU0_STAEQ/128-202----------------------------------------.AKNLKS.DVIKTN..........----------------
Q8RD03_THETN/115-173----------------------------------------.VSLDNE.................----------------
Q1ARP9_RUBXD/144-202----------------------------------------.VSLTDA.................----------------
Q6W134_RHISN/75-133----------------------------------------.FTDPA..................----------------
B4SM17_STRM5/23-78----------------------------------------........................----------------
A0Q1L3_CLONN/59-118----------------------------------------DIKRVEFH................----------------
A3IDB6_9BACI/160-218----------------------------------------.VDFEDT.................----------------
Q2RPK6_RHORT/75-133----------------------------------------.YTTPA..................----------------
Q8PWA1_METMA/60-123----------------------------------------.SWLETD.................----------------
Q8DVN1_STRMU/57-120----------------------------------------.VEQDID.................----------------
Q7NVU2_CHRVO/229-292----------------------------------------.DIRY...................----------------
B1YKF6_EXIS2/28-100----------------------------------------.ATPEAYAY...............----------------
A9B7B4_HERA2/311-370----------------------------------------.TVTPPD.................----------------
Q70B12_ACTTI/120-189----------------------------------------.EATRLVVVAA.............----------------
Q82P05_STRAW/125-192----------------------------------------.ALVVDARD...............----------------
Q72UE2_LEPIC/159-252----------------------------------------.WESPEREDRLRSIKGDSKATYFP----------------
Q1Q7U9_PSYCK/123-181----------------------------------------.VGFDMD.................----------------
A3X073_9BRAD/44-103----------------------------------------.FISRPV.................----------------
Q5FIK0_LACAC/62-121----------------------------------------.IDLKLE.................----------------
Q9A7E1_CAUCR/252-316----------------------------------------.WIETPS.................----------------
A0R6J4_MYCS2/78-140----------------------------------------.SIRPPA.................----------------
B8I195_CLOCE/108-180----------------------------------------.VMDHFKLVDI.............----------------
MSPA_LEGLO/128-199----------------------------------------.EKVIPMVYID.............----------------
Q81MX8_BACAN/145-217----------------------------------------.YVDENTN................----------------
Q1WU38_LACS1/104-164----------------------------------------.KTSLGLV................----------------
Q3SKV5_THIDA/55-112----------------------------------------.AIRVPR.................----------------
Q03XK6_LEUMM/140-199----------------------------------------.GWSLEKD................----------------
Q06DP6_9GAMM/118-194----------------------------------------.NENTKLVVQL.............----------------
Q5FIK1_LACAC/119-178----------------------------------------.WNLERE.................----------------
A8FEM8_BACP2/376-437----------------------------------------.VAIVQNDM...............----------------
Q8ESH1_OCEIH/143-217----------------------------------------.VDQFDGKI...............----------------
Q8ELE8_OCEIH/178-237----------------------------------------.EVIYPQ.................----------------
Q89L62_BRAJA/85-144----------------------------------------.VSFDGA.................----------------
Q11VT5_CYTH3/217-280----------------------------------------.YYIDDKLV...............----------------
Q5WLI5_BACSK/75-133----------------------------------------.SVVIDD.................----------------
Q9KBS1_BACHD/60-118----------------------------------------.AYRPGE.................----------------
A5FLJ5_FLAJ1/130-219----------------------------------------.WDKPQDAKEIGYEKPVGELVL..----------------
A4FCJ5_SACEN/417-477----------------------------------------.LVVTPPH................----------------
Q8FUC0_COREF/86-161----------------------------------------.IDIDRE.................----------------
A0AXS1_BURCH/321-380----------------------------------------.TLALPS.................----------------
Q1NCJ5_9SPHN/62-120----------------------------------------.VMRPA..................----------------
Q8CK35_STRCO/128-197----------------------------------------.D......................----------------
Q09A13_STIAD/60-114----------------------------------------.AVTEYP.................----------------
A9C057_DELAS/43-102----------------------------------------.AQLDDGD................----------------
NPRE_BREBE/144-218----------------------------------------.IYVHE.D................----------------
Q74JH3_LACJO/49-108----------------------------------------.IGLKNK.................----------------
YKOJ_BACSU/108-167----------------------------------------.SKLDED.................----------------
O26402_METTH/29-126----------------------------------------.YTAMTPAYSDWKAKVRVNKTG..----------------
A3UNN0_VIBSP/116-195----------------------------------------.NVQHQLFIYQGS...........----------------
A4QG45_CORGB/37-98----------------------------------------.GVRLG..................----------------
Q1R143_CHRSD/68-125----------------------------------------.YVPPA..................----------------
A7VSV8_9CLOT/179-240----------------------------------------RIHLDRD.................----------------
Q9KFU6_BACHD/130-191----------------------------------------.IELERE.................----------------
A8FEH2_BACP2/99-159----------------------------------------.DVQLARE................----------------
Q181V6_CLOD6/337-394----------------------------------------.CYYD...................----------------
A7K2T9_VIBSE/115-189----------------------------------------.NQRQGLRIYV.............----------------
Q5WKR9_BACSK/175-233----------------------------------------.SELDEE.................----------------
A9AUX6_HERA2/135-191----------------------------------------.ATPELVN................----------------
A1B2L4_PARDP/40-99----------------------------------------.VELEEE.................----------------

PF11396

C6W664_DYAFD/240-302----------------------------------------.GYKFSDPAG.-----------------------------
A6L510_BACV8/38-96----------------------------------------.AA....EDGS-----------------------------
B9XID0_9BACT/98-160----------------------------------------.VEKTSEEDGT-----------------------------
Q7MWB4_PORGI/302-359----------------------------------------.IER....KSN-----------------------------
A7LSF7_BACOV/156-219----------------------------------------.VDVEDDRNDW-----------------------------
Q4HPP5_CAMUP/21-74----------------------------------------.AKKDL.....-----------------------------
Q7MWB4_PORGI/160-216----------------------------------------.YEIED.....-----------------------------
A6LDA4_PARD8/215-276----------------------------------------.IHVIQKAEG.-----------------------------
A6L1R4_BACV8/91-153----------------------------------------.VDKLTREGME-----------------------------
A6LDA4_PARD8/22-79----------------------------------------.WENEA.....-----------------------------
Q8A9N6_BACTN/42-103----------------------------------------.AYVAEKETG.-----------------------------
A7VAB9_BACUN/24-82----------------------------------------.IKIESEILQT-----------------------------
Q609W9_METCA/25-85----------------------------------------.YEKKVKHGE.-----------------------------
A6EC49_9SPHI/80-140----------------------------------------.VEKIELAQR.-----------------------------
A7V913_BACUN/87-150----------------------------------------.VDKLERKEMA-----------------------------
Q11R11_CYTH3/84-141----------------------------------------.YFKMKDAKGT-----------------------------
A6EBA3_9SPHI/40-102----------------------------------------.AFLVVKADKS-----------------------------
Q64Q98_BACFR/42-103----------------------------------------.ASVTTKEEG.-----------------------------
A3U576_CROAH/46-104----------------------------------------.AFANDK....-----------------------------
Q8A9P3_BACTN/16-71----------------------------------------.WSQDD.....-----------------------------
Q5L9Y2_BACFN/77-142----------------------------------------.VTYVEFPKWQ-----------------------------
Q5LBR7_BACFN/156-212----------------------------------------.IEVEH.....-----------------------------
A1ZPX0_9BACT/161-219----------------------------------------.AYKLTKKEGA-----------------------------
A7V913_BACUN/224-284----------------------------------------.ADFIETPDG.-----------------------------
A0LZK7_GRAFK/81-141----------------------------------------.FDLLVSGDM.-----------------------------
C0QYD0_BRAHW/7-56----------------------------------------.VYKTS.....-----------------------------
Q89YQ5_BACTN/90-143----------------------------------------.VERDR.....-----------------------------
A5ZCE1_9BACE/25-80----------------------------------------.WENKY.....-----------------------------
B0MTD2_9BACT/41-98----------------------------------------.IKTLDELA..-----------------------------
B9KG60_CAMLR/21-74----------------------------------------.VKQDI.....-----------------------------
A3U577_CROAH/47-105----------------------------------------.AYINSK....-----------------------------
Q7MWB4_PORGI/235-292----------------------------------------.IER....NSN-----------------------------
A0M1R1_GRAFK/98-159----------------------------------------.VEHVISAKKG-----------------------------
D5UB28_BRAM5/1-54----------------------------------------.TTFT......-----------------------------
B9KG75_CAMLR/19-71----------------------------------------.VEQDG.....-----------------------------
A6LDM3_PARD8/41-102----------------------------------------.VEVSNNSTF.-----------------------------
A6L4L1_BACV8/88-141----------------------------------------.IERDK.....-----------------------------
A6L4Q2_BACV8/76-141----------------------------------------.VNLIEFPKRT-----------------------------
B9KE59_CAMLR/80-133----------------------------------------.VDKRI.....-----------------------------
A7M5Y9_BACOV/86-149----------------------------------------.VYVLTFPQNP-----------------------------
Q89YQ4_BACTN/86-149----------------------------------------.VFVLTYPQHP-----------------------------
B3JHE8_9BACE/293-346----------------------------------------.YDCNN.....-----------------------------
Q1VZW6_9FLAO/27-87----------------------------------------.WYYQTDGGK.-----------------------------
Q5HUF8_CAMJR/79-132----------------------------------------.IERKI.....-----------------------------
A6LDE6_PARD8/86-148----------------------------------------.TYAINRLNMG-----------------------------
A5FMA0_FLAJ1/39-96----------------------------------------.AYVNDK....-----------------------------
A6L4L1_BACV8/24-81----------------------------------------.AKMETDWFD.-----------------------------
A7AB56_9PORP/24-80----------------------------------------.WETRN.....-----------------------------
Q26DS8_FLABB/19-76----------------------------------------.FELDDH....-----------------------------
A6EC48_9SPHI/26-83----------------------------------------.VEKDREGAL.-----------------------------
B9KG75_CAMLR/77-130----------------------------------------.IERKI.....-----------------------------
A6L337_BACV8/89-142----------------------------------------.IERNR.....-----------------------------
D5U9R1_BRAM5/24-79----------------------------------------.VSLYQSG...-----------------------------
A0M1R1_GRAFK/37-94----------------------------------------.WEQDEH....-----------------------------
B3JHE8_9BACE/30-87----------------------------------------.ISRINEEE..-----------------------------
Q7MWB4_PORGI/82-144----------------------------------------.IDKVERNGTE-----------------------------
A6LDA3_PARD8/25-83----------------------------------------.IQIEKNLIRI-----------------------------
Q8A995_BACTN/24-79----------------------------------------.WETKA.....-----------------------------
A7LSF8_BACOV/24-81----------------------------------------.AKMESDFFY.-----------------------------
A6LDE6_PARD8/216-277----------------------------------------.IYTLLNANG.-----------------------------
Q025C3_SOLUE/32-92----------------------------------------.ISKETEKGV.-----------------------------
Q64WW2_BACFR/25-83----------------------------------------.WEQKG.....-----------------------------
A7LSF7_BACOV/83-145----------------------------------------.IDKLERTGVE-----------------------------
A7LSF7_BACOV/24-79----------------------------------------.WETKS.....-----------------------------
A0M0Q0_GRAFK/82-142----------------------------------------.VEISETSKG.-----------------------------
A7V913_BACUN/163-220----------------------------------------.IEKEKN....-----------------------------
Q1PYA3_9BACT/240-300----------------------------------------.IVKKEFDGK.-----------------------------
A6L1R4_BACV8/226-288----------------------------------------.ADYVVTPDN.-----------------------------
Q4HEV5_CAMCO/79-132----------------------------------------.IERKI.....-----------------------------
Q7MWB3_PORGI/88-141----------------------------------------.IDRDS.....-----------------------------
A7AAP4_9PORP/39-100----------------------------------------.AYVAGADGA.-----------------------------
Q8A995_BACTN/83-145----------------------------------------.VDKLERQGIE-----------------------------
D5UB30_BRAM5/29-82----------------------------------------.ASVS......-----------------------------
A5FIF1_FLAJ1/22-79----------------------------------------.AQKDPEHGE.-----------------------------
A6LDA3_PARD8/90-143----------------------------------------.IEKEI.....-----------------------------
A6LDA0_PARD8/28-84----------------------------------------.YDKDA.....-----------------------------
A7VAB9_BACUN/89-142----------------------------------------.IERGR.....-----------------------------
A7V913_BACUN/27-83----------------------------------------.WETKG.....-----------------------------
A7UZY2_BACUN/47-109----------------------------------------.AAVEVAEDGV-----------------------------
A7V2B6_BACUN/24-81----------------------------------------.AKLESGMFY.-----------------------------
A6ERM3_9BACT/45-103----------------------------------------.VWKNSK....-----------------------------
Q2Y6A1_NITMU/95-160----------------------------------------.IKKKTEAVGG-----------------------------
A6L337_BACV8/24-82----------------------------------------.IKIEKDLFQT-----------------------------
Q1PYA3_9BACT/45-105----------------------------------------.IVKKEYDGK.-----------------------------
B9KE59_CAMLR/20-73----------------------------------------.VKQDV.....-----------------------------
A6LDE6_PARD8/26-82----------------------------------------.FEIEG.....-----------------------------
A7M5Y9_BACOV/25-82----------------------------------------.WEMKG.....-----------------------------
Q4HEV5_CAMCO/20-72----------------------------------------.VQRDK.....-----------------------------
A7ABZ7_9PORP/218-279----------------------------------------.IYMFTDANG.-----------------------------
Q606T7_METCA/26-86----------------------------------------.YSERTTDGK.-----------------------------
A6LDA4_PARD8/83-145----------------------------------------.VDMLERPDAG-----------------------------
A1ZPX0_9BACT/82-140----------------------------------------.AAQMTTPDGT-----------------------------
A5FNS8_FLAJ1/26-83----------------------------------------.ILEDKEILS.-----------------------------
D8ICV0_BRAP9/18-73----------------------------------------.VSLYQNG...-----------------------------
Q4HTG4_CAMUP/18-70----------------------------------------.AQRDD.....-----------------------------
A5ZCE1_9BACE/84-144----------------------------------------.TEYVEEATGA-----------------------------
A0M5V4_GRAFK/44-104----------------------------------------.AWVKSEGDL.-----------------------------
A3J6C3_9FLAO/78-139----------------------------------------.VAKIENNKGE-----------------------------
Q8A994_BACTN/88-141----------------------------------------.IERDK.....-----------------------------
Q11R11_CYTH3/24-80----------------------------------------.WKKMD.....-----------------------------
B9KDT7_CAMLR/39-93----------------------------------------.VDWEE.....-----------------------------
Q8YLV6_NOSS1/89-149----------------------------------------.YEIEITPNG.-----------------------------
A4ANN1_MARSH/103-168----------------------------------------RVTYNQKKGAN-----------------------------
A5FM86_FLAJ1/39-96----------------------------------------.AYKNEK....-----------------------------
A3XQ60_LEEBM/44-103----------------------------------------.AWVDAEN...-----------------------------
Q4HTG4_CAMUP/77-130----------------------------------------.IERKI.....-----------------------------
C0QVH4_BRAHW/20-75----------------------------------------.VSLYQNG...-----------------------------
Q64UH5_BACFR/42-103----------------------------------------.VYSADKETG.-----------------------------
A6LDA4_PARD8/155-211----------------------------------------.IDTET.....-----------------------------
E4MSA5_CAPOC/22-79----------------------------------------.VWKDTDYND.-----------------------------
Q64SP0_BACFR/83-145----------------------------------------.VDMLERPDME-----------------------------
Q4HE98_CAMCO/48-102----------------------------------------.VDWEE.....-----------------------------
B9KG60_CAMLR/81-134----------------------------------------.VEKEI.....-----------------------------
Q5LEW1_BACFN/42-107----------------------------------------.AFVSERETS.-----------------------------
Q8YLV6_NOSS1/29-85----------------------------------------.TWQRHD....-----------------------------
C0R146_BRAHW/31-84----------------------------------------.SAVS......-----------------------------
C0R148_BRAHW/1-54----------------------------------------.VTFN......-----------------------------
A0LZK7_GRAFK/21-77----------------------------------------.WEMNG.....-----------------------------
A2TPA4_9FLAO/87-148----------------------------------------.IERVQSAEKG-----------------------------
A7AB56_9PORP/84-146----------------------------------------.VDMIERRDVE-----------------------------
A3YT26_CAMJU/21-74----------------------------------------.VKKDI.....-----------------------------
Q64TS2_BACFR/42-107----------------------------------------.AFVAEKENG.-----------------------------
A6E8W6_9SPHI/40-102----------------------------------------.AFLVTNADKT-----------------------------
B3JHE8_9BACE/156-216----------------------------------------GSEQLNPSM..-----------------------------
Q8A995_BACTN/230-292----------------------------------------.AEYFEMATET-----------------------------
A0M0Q0_GRAFK/20-78----------------------------------------.WEKENE....-----------------------------
A5ZGS8_9BACE/87-150----------------------------------------.VYVLVYPQNP-----------------------------
A6EC48_9SPHI/89-142----------------------------------------.WELET.....-----------------------------
Q1PY86_9BACT/10-70----------------------------------------.IVKKEADGK.-----------------------------
A5FMA1_FLAJ1/39-96----------------------------------------.AYKNDK....-----------------------------
A7V329_BACUN/79-144----------------------------------------.IRIITFPKHP-----------------------------
Q5LBR7_BACFN/23-79----------------------------------------.WETKG.....-----------------------------
Q4HPP5_CAMUP/81-134----------------------------------------.VEKQI.....-----------------------------
A5FNS8_FLAJ1/90-143----------------------------------------.IEIES.....-----------------------------
Q606T7_METCA/90-152----------------------------------------.AEKVFNPKGT-----------------------------
A7ABZ7_9PORP/87-149----------------------------------------.ADTIGRAGMG-----------------------------
Q89YQ5_BACTN/24-82----------------------------------------.IKIDKDLLES-----------------------------
Q64SP0_BACFR/216-278----------------------------------------.ADFVETPGG.-----------------------------
A7AB55_9PORP/91-144----------------------------------------.IEKED.....-----------------------------
A5FM85_FLAJ1/39-96----------------------------------------.AYKNSA....-----------------------------
A4CIV2_ROBBH/43-101----------------------------------------.AFVNES....-----------------------------
A4JEG0_BURVG/34-94----------------------------------------.IEKLTRNGK.-----------------------------
Q64WW2_BACFR/87-150----------------------------------------.VVILEYPNEP-----------------------------
A6L1R4_BACV8/162-222----------------------------------------.IER....EK.-----------------------------
Q0P9P8_CAMJE/20-72----------------------------------------.VQKDK.....-----------------------------
A7AB55_9PORP/27-84----------------------------------------.AKMEKDFFD.-----------------------------
A2TZP8_9FLAO/26-85----------------------------------------.YVEESNEG..-----------------------------
A6KXD7_BACV8/38-100----------------------------------------.AAVEANEDGT-----------------------------
A5FBY0_FLAJ1/85-146----------------------------------------.VSVVVDDKNQ-----------------------------
A5FM84_FLAJ1/39-94----------------------------------------.AFVNSN....-----------------------------
A7V329_BACUN/19-75----------------------------------------.WEQMA.....-----------------------------
Q11P99_CYTH3/20-76----------------------------------------.WELKR.....-----------------------------
D8IF52_BRAP9/11-64----------------------------------------.INKIN.....-----------------------------
A7VAB8_BACUN/86-148----------------------------------------.IVLLEYPVVP-----------------------------
Q8ABX7_BACTN/27-89----------------------------------------.AAVEESEEGT-----------------------------
Q64ZG0_BACFR/31-91----------------------------------------.IERTNTDQEN-----------------------------
A6E8W7_9SPHI/39-101----------------------------------------.AWLVTNADKT-----------------------------
Q11P99_CYTH3/80-140----------------------------------------.AKKIEVGNT.-----------------------------
Q2Y9L0_NITMU/27-92----------------------------------------.IEKETERISG-----------------------------
Q5LD45_BACFN/111-176----------------------------------------.VRIITFPKQP-----------------------------
A6LDA0_PARD8/88-149----------------------------------------.VTQIDKPSG.-----------------------------
A7AKE6_9PORP/56-112----------------------------------------.SEKET.....-----------------------------
A7AKE6_9PORP/116-177----------------------------------------.ITAIERPDG.-----------------------------
Q64WW3_BACFR/89-143----------------------------------------.IERDR.....-----------------------------
Q4HFB7_CAMCO/81-132----------------------------------------.VSREI.....-----------------------------
A7VAB8_BACUN/26-82----------------------------------------.WEQKG.....-----------------------------
Q7MWB3_PORGI/24-81----------------------------------------.VKMDDDLFS.-----------------------------
Q2Y7C4_NITMU/25-90----------------------------------------.IEKETEKIGG-----------------------------
A6LAS6_PARD8/41-101----------------------------------------.VYVAEKTKG.-----------------------------
A3ZG36_CAMJU/81-133----------------------------------------.VDKEI.....-----------------------------
A7LSF7_BACOV/223-284----------------------------------------.AEYIEKADGS-----------------------------
Q5LG07_BACFN/24-82----------------------------------------.IKIENEILQT-----------------------------
A7AB56_9PORP/219-280----------------------------------------.ADFIETLTG.-----------------------------
A7LXE2_BACOV/77-142----------------------------------------.VTMVEFPKWQ-----------------------------
A5FIF1_FLAJ1/86-139----------------------------------------.IDYGH.....-----------------------------
A7V158_BACUN/77-142----------------------------------------.VTWVQFPKWQ-----------------------------
Q26DS8_FLABB/80-141----------------------------------------.VEHVISATQG-----------------------------
A6EC49_9SPHI/20-76----------------------------------------.WEMEN.....-----------------------------
A7UZJ9_BACUN/42-107----------------------------------------.AFISEKETG.-----------------------------
Q64SP1_BACFR/24-81----------------------------------------.AKVESDFLQ.-----------------------------
A7V2B6_BACUN/88-141----------------------------------------.IEYDD.....-----------------------------

PF14620

Q3ACX8_CARHZ/13-371----------------------------------------ELKKINNKLEKAVDIL..KNQPIM.ITK............
A3DI39_CLOTH/26-388----------------------------------------FAVTLGQSLNDLQNQL..SAGRIK.WGE............
Q736X0_BACC1/13-372----------------------------------------NAGNIQDELRKVQHLV..LKNNLR.WMD............
C6CU97_PAESJ/16-375----------------------------------------KSEDISKDLYKMQEKV..LSDHLR.WMD............
Q8R774_THETN/13-368----------------------------------------YAVFLGKNLHDLSKKV...QGGYE.LGN............
D5DRI0_BACMQ/13-373----------------------------------------QSGEIQNEMRQVQHLV..IDNNLR.WMD............
D5W1I7_CLOB2/17-379----------------------------------------ESLQLENQLNNVVTDI..NEGRVK.WGD............
C6PVF7_9CLOT/17-378----------------------------------------ESFSLEKQLKTASDEI..NNGKVK.WGD............
E0RD66_PAEP6/16-382----------------------------------------NSREISKNMHEVRQKV..LSKNLR.WTD............
D3G027_BACPE/13-376----------------------------------------HSHEIREEMREAQAYV..LKNGQR.WLD............
B8D1J1_HALOH/6-366----------------------------------------QAARVSASLHDLESQV..FSGDIN.WVE............
B8I3U7_CLOCE/26-387----------------------------------------YAVSLQKNLHGIEDQI..TNGKMT.WDK............
B1C6Q7_9FIRM/13-365----------------------------------------ASDKIFKRLDEMNNEIRYSKDGYN.WVE............
E8SXZ7_GEOS2/13-373----------------------------------------SAGAIRQELRNVQHLV..LENNLR.WMD............
A4J9E3_DESRM/15-376----------------------------------------QAAQLNKDLQGMEAKV..ADGRLT.VSE............
D9TFB8_CALOO/29-390----------------------------------------YADKLSNNLNELAIEI..SQGRLR.WGE............
A6NSM3_9FIRM/22-381----------------------------------------ASSQLSQMLQDLQADI..HSGTIT.LDD............
D5N4Y3_BACPN/13-374----------------------------------------QSEDIQNELRHVQHLV..MSKNLR.WMD............
D9QUD9_ACEAZ/13-381----------------------------------------QVQTVAKEMKDIHNKI..EKEGFR.WSE............
B0MLG6_9FIRM/17-370----------------------------------------YADRLADNMWKVEQRI..TNGELS.FEK............
C5VNR0_CLOBO/15-376----------------------------------------QADYLLIQLNEVQREI..NKGKIK.WGD............
A5CYA9_PELTS/14-376----------------------------------------QSAELNRELQGMQYRV..AQNNFY.FGE............
Q67K56_SYMTH/19-394----------------------------------------AAAALKEQLGTMLTQY..QRGGFR.WHQ............
E5YVT8_9BACL/16-375----------------------------------------NSGEITKDLQHVQNKV..ITNSLR.WMD............
B1I6Q9_DESAP/14-380----------------------------------------QAGILNTQLQVVQRRV..EAGGAR.YWE............
Q67QG8_SYMTH/1-374----------------------------------------AATDLTATLRDTGQAS..VSEGFR.FAKAGVGLSDLFTAW
YPEB_BACHD/13-371----------------------------------------YSKTIKNDLRKTQAMT..LKKDMR.WLD............
D5XDM3_THEPJ/19-379----------------------------------------EAGYLAVELQRIRAKA..VEGLLT.WGE............
E9SE89_RUMAL/27-377----------------------------------------FSQTLSDRLWELEGEV..AGGELT.FQQ............
F0K5G1_CLOAE/18-380----------------------------------------QADSLENQLKDVQNNI..NLGRVG.WGE............
Q898Z6_CLOTE/17-379----------------------------------------RSVKLEANLNQVSNDI..NEGKVR.WGE............
Q65I06_BACLD/13-374----------------------------------------NSKDIQNELRNVQHLI..IDKNLR.WMD............
A7VNV5_9CLOT/20-375----------------------------------------YAKELNGSLKDLETTL..MEGDIP.IGE............
Q67JA4_SYMTH/1-357----------------------------------------QAVYFEQELSNLLGLV..GNNLIR.WQP............
D5WQ69_BACT2/16-374----------------------------------------QAAQVETDLRQVQSNV..LSHNLR.WMD............
E6U685_ETHHY/20-373----------------------------------------YADKLSTQLSDLNSDL..QTGRIT.LFK............
C6J414_9BACL/16-377----------------------------------------SSAQIAQDLQGVQNKV..IANRLR.WMD............
F0DLG0_9FIRM/14-375----------------------------------------QAAQLNKDLHDMEAKI..SDGRLN.IGE............
Q2RM03_MOOTA/13-383----------------------------------------EMGRLAADLHQTEGQV..AGKTLR.WSS.....FYGFKMP
B4AKG7_BACPU/13-373----------------------------------------QASDIQNELRQVQHLV..LNKNLK.WMD............
B9DX91_CLOK1/17-380----------------------------------------ESVTLENQLKSVSDNI..NQGKVG.WGE............
B7GHM6_ANOFW/13-372----------------------------------------KSADIQQELRNVQHLV..LENNLR.WMD............
E6TZD5_BACCJ/13-373----------------------------------------QSGEIQNEMRKVQSMV..LRDNLR.WMD............
C8VVD3_DESAS/16-378----------------------------------------QSQELNKDLQTAQSNL..MNGHVS.IQE............
E6UCG1_RUMA7/18-368----------------------------------------FSKALSDRLWELEGEV..AAGGLS.FEQ............
D9TPL0_THETC/12-368----------------------------------------YAVYLGKNLQDLRSKI...QGGYD.LGN............
Q2B634_9BACI/13-372----------------------------------------ESADIQQELRKVQHMV..LKNNLR.WMD............
A8MIH5_ALKOO/13-373----------------------------------------YAISLSEQLVELQQKV..ASGGVN.FGD............
B0TAV0_HELMI/41-428----------------------------------------QTTFLRDELGKMGEQL..NERRVT.WVA............
E5WI28_9BACI/13-372----------------------------------------QSADVQQDLRKVQHMV..LEKNLR.WMD............
C0GK90_9FIRM/17-388----------------------------------------MLLQMEDIFIEENPRFSNAQTNREFYLG............
C0EB21_9CLOT/19-374----------------------------------------YCQSMKEQLYLLQDEL..LTGGVS.FQK............
D8GKX4_CLOLD/17-380----------------------------------------QSNVLENQLELVSNNI..NQGKVK.WGE............
YPEB_OCEIH/13-370----------------------------------------QSGQIKDELRQVQHVA..LEEGLN.WMD............
B0PG38_9FIRM/20-373----------------------------------------YAFKLRDYVDDMQRDI..REGRIT.VDA............
C0ZCA7_BREBN/17-378----------------------------------------QAKEIQDELRKVQTVA..MDKQLR.WMD............
A6TN00_ALKMQ/13-373----------------------------------------YANYLSQQLIELQQTV..AAGGIK.FGD............
D9S297_THEOJ/14-374----------------------------------------NTQNLSRRLRELQDSV..ATGRIR.WES............
A0Q324_CLONN/15-376----------------------------------------QADYLLIQLNQVQRDI..NEGKLK.WGE............
A6CR99_9BACI/13-371----------------------------------------QSADIQKELRKVQHLV..IENNLR.WMD............
E0ICB3_9BACL/16-375----------------------------------------NSEEISKNLQAMQQKV..LQNNLR.WMD............
Q5WGU9_BACSK/13-375----------------------------------------QASSIRESMRKTQATV..MQGGMQ.WLA............

PF11399

Q085F9_SHEFN/19-127----------------------------------------TADFSEAYT-------------------------------
A4C487_9GAMM/27-130----------------------------------------SPDLTFAKN-------------------------------
A6WL17_SHEB8/20-121----------------------------------------KADFSEAKA-------------------------------
A8FY56_SHESH/14-118----------------------------------------QADFNEAYI-------------------------------
Q15QY7_PSEA6/20-121----------------------------------------GPDISEAKK-------------------------------
B1KNV8_SHEWM/19-120----------------------------------------DADFYEAYM-------------------------------
Q8EGJ0_SHEON/23-132----------------------------------------ASDLSESYL-------------------------------
B1KQX2_SHEWM/20-121----------------------------------------KADFSEAKV-------------------------------
A1S8B9_SHEAM/20-121----------------------------------------APDFSEAKS-------------------------------
Q07ZE7_SHEFN/20-121----------------------------------------SADFVEAKT-------------------------------
Q15QZ2_PSEA6/17-120----------------------------------------VADFSEFVK-------------------------------
Q12L38_SHEDO/25-126----------------------------------------EADFVEAKT-------------------------------
Q3ICC6_PSEHT/20-123----------------------------------------SPDLTFAKR-------------------------------
A4C4D7_9GAMM/17-125----------------------------------------TPNFSEFVT-------------------------------
A1S4M5_SHEAM/17-118----------------------------------------KADFHEAWQ-------------------------------
Q47YB6_COLP3/19-124----------------------------------------VSDFSETYA-------------------------------
F2GBX2_ALTMD/20-121----------------------------------------SPDITEAKR-------------------------------
A6WL90_SHEB8/24-135----------------------------------------TADFSEAYI-------------------------------
A3QGB8_SHELP/19-123----------------------------------------TADFNEAYT-------------------------------
Q8EGQ0_SHEON/20-121----------------------------------------KADFSEAKS-------------------------------
A8H6M9_SHEPA/19-123----------------------------------------TADFNEAYV-------------------------------
A4Y4Y3_SHEPC/20-121----------------------------------------KADFSEAKT-------------------------------
Q12P24_SHEDO/19-127----------------------------------------TADFSEAFV-------------------------------
A0Y2J8_9GAMM/16-124----------------------------------------TPNFTELLK-------------------------------
Q47YA7_COLP3/20-124----------------------------------------SPDITEART-------------------------------
Q5QW11_IDILO/20-121----------------------------------------SPDITEAKA-------------------------------
A4A742_9GAMM/18-118----------------------------------------TPADSEAFT-------------------------------
A3WM12_9GAMM/19-120----------------------------------------SPDINEAKE-------------------------------
A3WM05_9GAMM/20-124----------------------------------------TPDFTERWT-------------------------------
A3QGM5_SHELP/20-121----------------------------------------KADFSEAKS-------------------------------
F2GBX8_ALTMD/17-120----------------------------------------VADFNELFE-------------------------------
A8H6V7_SHEPA/20-121----------------------------------------KADFTEAKI-------------------------------

PF04355

Q5NL78_ZYMMO/17-93----------------------------------------RPTLA.GEF-------------------------------
Q5LQJ9_SILPO/35-111----------------------------------------TPSSS.GLL-------------------------------
Q1LSR9_BAUCH/37-105----------------------------------------TPIFQ.DQN-------------------------------
Q5PHB7_SALPA/28-97----------------------------------------KPSSEVSMI-------------------------------
A4N7P6_HAEIF/34-104----------------------------------------TPVLV.DPY-------------------------------
Q1MIT0_RHIL3/42-118----------------------------------------TPSTT.ATF-------------------------------
Q1LBA9_RALME/75-149----------------------------------------RPHFNEGFL-------------------------------
A3YB50_9GAMM/31-104----------------------------------------SPMIR.DLY-------------------------------
A3XVL9_9VIBR/35-105----------------------------------------SPMLI.ENG-------------------------------
Q2SZ95_BURTA/41-112----------------------------------------TPLLT.DMF-------------------------------
A5WGN5_PSYWF/35-114----------------------------------------SPAMR.DSL-------------------------------
Q9CJV5_PASMU/34-104----------------------------------------TPVLV.EPF-------------------------------
BAME_PSYIN/35-104----------------------------------------SPMLI.DQF-------------------------------
B0KU54_PSEPG/23-91----------------------------------------KPDAETDRT-------------------------------
A0YHQ3_9GAMM/36-106----------------------------------------TPLIK.DSF-------------------------------
Q1ZJZ5_PHOAS/34-104----------------------------------------TPMLV.DPS-------------------------------
Q0HGH3_SHESM/49-120----------------------------------------RPVLR.DSF-------------------------------
Q220P9_RHOFD/38-108----------------------------------------TPLLS.SIF-------------------------------
Q3BVC3_XANC5/28-99----------------------------------------TPSIP.DPF-------------------------------
BAME_NEIMB/36-106----------------------------------------SPILR.DAF-------------------------------
Q5NEF6_FRATT/34-106----------------------------------------SPDII.DTF-------------------------------
A4TNU9_YERPP/35-105----------------------------------------TPMLQ.DPF-------------------------------
Q7WYE0_ACIHA/30-99----------------------------------------SPTIS.DPL-------------------------------
Q1N393_9GAMM/29-99----------------------------------------TPVLK.DPF-------------------------------
BAME_VIBF1/35-105----------------------------------------SPMLV.ESG-------------------------------
Q8G1E5_BRUSU/49-125----------------------------------------TPSTT.ATF-------------------------------
A5ZZI3_VIBCL/52-122----------------------------------------SPMLV.ENG-------------------------------
A6VMF3_ACTSZ/34-104----------------------------------------TPALK.DPF-------------------------------
Q7VRQ4_BLOFL/39-110----------------------------------------SPPTLKNIF-------------------------------
BAME_NITEU/35-105----------------------------------------TPLVM.DIF-------------------------------
Q0C315_HYPNA/29-105----------------------------------------SPSTE.GLF-------------------------------
Q47XI1_COLP3/29-101----------------------------------------SPVVV.DAF-------------------------------
Q7P9U9_RICSI/27-103----------------------------------------TPTIV.PEY-------------------------------
A4TZI9_9PROT/28-104----------------------------------------TPSSV.MPY-------------------------------
Q47HJ0_DECAR/36-107----------------------------------------TPLVA.DIF-------------------------------
Q4ZMZ6_PSEU2/30-98----------------------------------------EPSSTIERR-------------------------------
B0KIS9_PSEPG/35-105----------------------------------------NPLIQ.DTF-------------------------------
Q5FUN3_GLUOX/45-121----------------------------------------SPTAH.ATF-------------------------------
Q2SMN2_HAHCH/93-162----------------------------------------SPVLE.STL-------------------------------
Q2BRB3_9GAMM/31-102----------------------------------------SPLIT.DTF-------------------------------
Q0A7D7_ALHEH/37-107----------------------------------------PPAVV.DPF-------------------------------
A1AX05_RUTMC/37-107----------------------------------------SPSII.DSF-------------------------------
Q3SSS7_NITWN/53-129----------------------------------------TPSTV.ATL-------------------------------
A5W9P3_PSEP1/29-96----------------------------------------SPSNVIDLP-------------------------------
Q2RTT3_RHORT/36-112----------------------------------------TPSAT.SMF-------------------------------
Q5X816_LEGPA/32-102----------------------------------------TSLMS.PTF-------------------------------
A6D2W0_9VIBR/35-105----------------------------------------SPMLI.ENG-------------------------------
Q46NU4_CUPPJ/65-139----------------------------------------RPHFNEGMA-------------------------------
Q2NRT5_SODGM/28-97----------------------------------------VPATSSTMI-------------------------------
O85277_PASHA/57-127----------------------------------------RPHFEEGLY-------------------------------
A4VII8_PSEU5/29-97----------------------------------------EPSRATART-------------------------------
A5PER7_9SPHN/21-97----------------------------------------RPTFT.SQF-------------------------------
A7I1H3_CAMHC/52-124----------------------------------------TPHFAAGLA-------------------------------
A6FB83_9GAMM/42-112----------------------------------------SPMLV.DSF-------------------------------
A3J973_9ALTE/29-99----------------------------------------SPLML.NPV-------------------------------
Q6G003_BARQU/42-118----------------------------------------TPSLK.TKY-------------------------------
Q8KTI1_AZOVI/35-105----------------------------------------SPLIT.DTF-------------------------------
Q5PFG5_SALPA/21-91----------------------------------------TPMMT.DPF-------------------------------
A4WTT5_RHOS5/40-116----------------------------------------RPSAS.TLL-------------------------------
Q604C4_METCA/51-121----------------------------------------SPLTV.SPF-------------------------------
B0UR41_METS4/34-110----------------------------------------TPTTV.STV-------------------------------
Q15V54_PSEA6/31-104----------------------------------------KPVVE.DSF-------------------------------
Q492C5_BLOPB/40-110----------------------------------------DPTLE.GFL-------------------------------
Q3R3Z3_XYLFA/29-77----------------------------------------TPSIS.DIF-------------------------------
Q1N9S5_9SPHN/44-120----------------------------------------RPSFV.SQF-------------------------------
Q31FS2_THICR/36-107----------------------------------------PPLGQ.DPF-------------------------------
A4BRW9_9GAMM/48-119----------------------------------------TPTIQ.DPF-------------------------------
Q3R9M0_XYLFA/29-100----------------------------------------TPSIS.DIF-------------------------------
A6U7Q1_SINMW/42-118----------------------------------------TPSTT.ATF-------------------------------
A1IQ08_NEIMA/52-134----------------------------------------RPHYDEGMY-------------------------------
A3RS11_RALSL/104-175----------------------------------------SPLLT.DMF-------------------------------
A1WGT8_VEREI/51-121----------------------------------------SPLLT.SLF-------------------------------
A4SVD7_POLSQ/67-138----------------------------------------TPLLA.SYF-------------------------------
Q2NRZ9_SODGM/35-105----------------------------------------TSMMK.DPF-------------------------------
A1WCQ4_ACISJ/49-119----------------------------------------TPLMV.SVF-------------------------------
B1ZKI2_METPB/33-109----------------------------------------TPSTV.STV-------------------------------
A1TVV3_ACIAC/48-118----------------------------------------TPLVT.SLF-------------------------------
Q1LMT9_RALME/71-142----------------------------------------TPLLT.DVF-------------------------------
Q6FDQ3_ACIAD/30-107----------------------------------------SPTIT.DPL-------------------------------
Q7CZT7_AGRT5/48-124----------------------------------------TPSTT.ATF-------------------------------
Q0K704_CUPNH/51-122----------------------------------------TPLLN.DVF-------------------------------
Q2T565_BURTA/70-143----------------------------------------EPHFSEGII-------------------------------
Q21H32_SACD2/36-106----------------------------------------SPLLE.DTF-------------------------------
A3UCC7_9RHOB/30-106----------------------------------------NPSTR.GAF-------------------------------
Q7W511_BORPA/42-112----------------------------------------SPTLT.SVL-------------------------------
Q83C32_COXBU/30-100----------------------------------------TPVLT.NMY-------------------------------
A8GGW6_SERP5/28-97----------------------------------------PPSTTATLV-------------------------------
A7JT78_PASHA/34-104----------------------------------------TPMLK.NIF-------------------------------
A5FV68_ACICJ/239-315----------------------------------------SPTLR.ETF-------------------------------
Q3SJS3_THIDA/32-102----------------------------------------TPLVV.DPF-------------------------------
A0KI84_AERHH/30-100----------------------------------------SAMLR.DGF-------------------------------
Q1ZGE3_9GAMM/45-115----------------------------------------SPMLV.DPF-------------------------------
Q3IE33_PSEHT/35-105----------------------------------------KPIAE.NAF-------------------------------
Q1YIM3_MOBAS/35-111----------------------------------------SPSTT.ATF-------------------------------
A6W2D6_MARMS/31-103----------------------------------------NPMLR.DTF-------------------------------
A4A5R9_9GAMM/32-102----------------------------------------SPLVE.DTF-------------------------------
A3TX83_9RHOB/22-98----------------------------------------APSTS.GVT-------------------------------
Q2G501_NOVAD/31-107----------------------------------------RPTFT.SQF-------------------------------
A7HX93_PARL1/37-112----------------------------------------SPSTV.STV-------------------------------
A3WGB0_9SPHN/35-111----------------------------------------RPTFE.SQY-------------------------------
A3WPM9_9GAMM/35-105----------------------------------------RPVAE.NSF-------------------------------
Q983A2_RHILO/103-179----------------------------------------TPSTT.ATF-------------------------------
Q7NX33_CHRVO/32-104----------------------------------------TPLLT.DPF-------------------------------
A4EML3_9RHOB/35-111----------------------------------------PPRSE.RGL-------------------------------
A3XBH2_9RHOB/39-115----------------------------------------TPSAS.GVL-------------------------------
Q2YBT7_NITMU/31-101----------------------------------------SPMIS.DAF-------------------------------
A2SC95_METPP/48-118----------------------------------------SPLLA.DIF-------------------------------
Q1QE29_PSYCK/52-131----------------------------------------SPAIR.DTL-------------------------------
Q3ZU02_ECOLX/52-122----------------------------------------RPHFAEGMF-------------------------------
A1K8N9_AZOSB/69-139----------------------------------------TPLVV.DIF-------------------------------
A7INK8_XANP2/42-117----------------------------------------TPSTV.ATV-------------------------------
Q1QSW6_CHRSD/33-103----------------------------------------SPLLK.GPF-------------------------------
A6AQ89_VIBHA/35-105----------------------------------------SPMLV.ENG-------------------------------
A0NMF1_9RHOB/29-104----------------------------------------TPSTT.SSL-------------------------------
Q1H393_METFK/54-124----------------------------------------SPLIQ.DSF-------------------------------
A4CD42_9GAMM/31-101----------------------------------------KPVAE.DAF-------------------------------
Q1Z300_PHOPR/34-104----------------------------------------SPMLV.EPS-------------------------------
Q0G6I2_9RHIZ/46-123----------------------------------------SPSTT.ATF-------------------------------
Q0I1R6_HAES1/25-95----------------------------------------TPMLI.DPF-------------------------------
A3MZE6_ACTP2/34-104----------------------------------------TPMLK.DTF-------------------------------
B0T0T5_CAUSK/29-105----------------------------------------SPSAT.STF-------------------------------
A0Z1I1_9GAMM/51-121----------------------------------------TPLIE.DTF-------------------------------
Q1YQK7_9GAMM/34-104----------------------------------------TPLVA.DTF-------------------------------
A6GNF7_9BURK/49-119----------------------------------------TPLLN.DAF-------------------------------
A1WX37_HALHL/38-106----------------------------------------TPVLE.HAF-------------------------------
Q0FTJ6_9RHOB/18-94----------------------------------------VPSAS.GVA-------------------------------
Q0I3M4_HAES1/52-122----------------------------------------RPHFSEGLY-------------------------------
A7C6T6_9GAMM/33-103----------------------------------------TPLLV.DVF-------------------------------
Q11J87_MESSB/48-124----------------------------------------TPSTT.ATF-------------------------------
A4XUA2_PSEMY/28-96----------------------------------------PPSSQFEHS-------------------------------
Q28RF7_JANSC/34-109----------------------------------------SPGTG.GVM-------------------------------
Q5QXM4_IDILO/32-102----------------------------------------TPVAQ.NSF-------------------------------
BAME_BUCAI/32-101----------------------------------------IPIIS.DSF-------------------------------
Q0B235_BURCM/41-111----------------------------------------PPHFNEWFV-------------------------------
A9AMY8_BURM1/53-123----------------------------------------PPQFHEGFV-------------------------------
Q0BTE4_GRABC/35-111----------------------------------------SPTTK.ATF-------------------------------
Q2NDV7_ERYLH/16-92----------------------------------------RPTFE.SQF-------------------------------
Q122Q0_POLSJ/29-99----------------------------------------TPLMA.SLF-------------------------------
Q3JBU9_NITOC/42-112----------------------------------------SPLLI.DSF-------------------------------
Q7VM11_HAEDU/34-104----------------------------------------TPMLK.DIF-------------------------------
Q6D4H9_ERWCT/28-96----------------------------------------SGMEK.RLV-------------------------------
A6VCY4_PSEA7/30-98----------------------------------------TPSGTQKRL-------------------------------
A5V7M5_SPHWW/32-109----------------------------------------RPSFA.GQF-------------------------------
Q1GPC4_SPHAL/37-113----------------------------------------RPTFV.GQF-------------------------------
A6EYM2_9ALTE/29-99----------------------------------------TPLMT.NPA-------------------------------
Q0VSU2_ALCBS/35-105----------------------------------------APTLV.DPF-------------------------------

PF07467

Q9KJ90_STREX/2-185ILCFTE.SGDYAPYGGFSFTDE...GELWSKRNEYLYKAKTPSVKLSHY-------------------------------
P97062_STRCL/2-181IICYNN.PDHYGPQGHFFFNAA...DKLIHKRQMELFPAPKPTMRLATY-------------------------------
BLIP_STRCL/10-200IHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF-------------------------------

PF12978

Q8DTX1_STRMU/47-205TLDSYTWVKDGAVINAQ.LYKNSTVARSISNFSFS.R---EAKIGKEDY-------------------------------
Q3CZX6_STRAG/47-206TLKGYRWNVDDISITIQ.LLNDSSIVRSISNFKFI.R---DANITTKDY-------------------------------
E7FPD9_9LACO/70-224KVKDETWTKDGVTVTVQ.FNDDKTVSKDIIGFKFT.R---SPKLDLKAF-------------------------------
B9DSB0_STRU0/47-205TLDHYTWTFDRVSIQVN.LFENSTIVKSITNFAFN.R---DLNISLKDY-------------------------------
C2LUW8_STRSL/44-203KLDVYNWQYDNVVVTAK.LFNNSTVVKSISNFSYV.R---DPKITLKMY-------------------------------
Q044U3_LACGA/47-206KTKSYIWNKGAVTVTVQ.FEPDKAVTKDITGFKWGKR---DEKLDLAAF-------------------------------
A9D9J1_9VIRU/47-206KLKQLTWTKGAVTVAIQTLDSNKVVSKEITGFKWGKR---DEKLTLGEF-------------------------------
C0ME71_STRS7/45-203TLDSYTWQFDHVTVNIN.LYENSSIVKTIANFAFI.R---DLALSLKDY-------------------------------
A2RE59_STRPG/46-204TIDAYTWQFDQVTLTVN.LYQNSSIVKTISNFTFA.R---ELGLSQKEY-------------------------------

PF13670

Q0BXA6_HYPNA/7-95--------------------------------------------------------------------------------
Q0BXA5_HYPNA/6-84--------------------------------------------------------------------------------
A3WRM0_9BRAD/6-83--------------------------------------------------------------------------------
Q0BY17_HYPNA/6-92--------------------------------------------------------------------------------
A4VHV2_PSEU5/30-109--------------------------------------------------------------------------------
A4XVH9_PSEMY/6-85--------------------------------------------------------------------------------
Q3KD49_PSEPF/7-87--------------------------------------------------------------------------------
B1ZL54_METPB/14-93--------------------------------------------------------------------------------
C7CAP4_METED/4-84--------------------------------------------------------------------------------
A3WVM1_9BRAD/4-83--------------------------------------------------------------------------------
Q1QMT6_NITHX/5-85--------------------------------------------------------------------------------
Q07QG0_RHOP5/5-84--------------------------------------------------------------------------------
B8EKV5_METSB/3-81--------------------------------------------------------------------------------
Q3BZQ4_XANC5/7-87--------------------------------------------------------------------------------
D8JU49_HYPDA/7-90--------------------------------------------------------------------------------
Q0FJR3_9RHOB/4-79--------------------------------------------------------------------------------
B6B6G1_9RHOB/5-81--------------------------------------------------------------------------------
A3X8K5_9RHOB/6-81--------------------------------------------------------------------------------
A4F198_9RHOB/68-143--------------------------------------------------------------------------------
B9QWG8_9RHOB/19-97--------------------------------------------------------------------------------
Q5LX53_SILPO/50-129--------------------------------------------------------------------------------
A3JXM1_9RHOB/4-83--------------------------------------------------------------------------------
B1G434_9BURK/9-91--------------------------------------------------------------------------------
B8IVF4_METNO/5-90--------------------------------------------------------------------------------
A5EBJ8_BRASB/4-90--------------------------------------------------------------------------------
Q1I4X8_PSEE4/3-87--------------------------------------------------------------------------------
B3PI60_CELJU/2-85--------------------------------------------------------------------------------
C1DNM7_AZOVD/2-85--------------------------------------------------------------------------------
A3WIS1_9GAMM/4-89--------------------------------------------------------------------------------
Q1LBN9_RALME/3-85--------------------------------------------------------------------------------
Q46SM0_CUPPJ/3-85--------------------------------------------------------------------------------
Q8XWW7_RALSO/3-85--------------------------------------------------------------------------------
B9YYZ8_9NEIS/4-86--------------------------------------------------------------------------------
A1K227_AZOSB/5-88--------------------------------------------------------------------------------
Q5P431_AROAE/5-88--------------------------------------------------------------------------------
Q5P432_AROAE/18-101--------------------------------------------------------------------------------
D0KWU4_HALNC/5-88--------------------------------------------------------------------------------
B0SVT0_CAUSK/5-90--------------------------------------------------------------------------------
B3PS83_RHIE6/3-88--------------------------------------------------------------------------------
A7IQ54_XANP2/6-90--------------------------------------------------------------------------------
Q8D5M1_VIBVU/5-90--------------------------------------------------------------------------------
D2YV68_VIBMI/5-91--------------------------------------------------------------------------------
B1Y4P0_LEPCP/3-85--------------------------------------------------------------------------------
B8IVE9_METNO/4-91--------------------------------------------------------------------------------
Q07GW2_RHOP5/24-110--------------------------------------------------------------------------------
Q1QM54_NITHX/4-90--------------------------------------------------------------------------------
A9DGE5_9RHIZ/5-87--------------------------------------------------------------------------------
C9X3G7_NEIM8/6-91--------------------------------------------------------------------------------
C5TKZ2_NEIFL/6-91--------------------------------------------------------------------------------
B6BXY0_9GAMM/6-84--------------------------------------------------------------------------------
B4X0R3_9GAMM/21-99--------------------------------------------------------------------------------
Q2C6V1_9GAMM/7-89--------------------------------------------------------------------------------
A1B769_PARDP/5-86--------------------------------------------------------------------------------
A3W5R2_9RHOB/5-86--------------------------------------------------------------------------------
A6FVG6_9RHOB/5-86--------------------------------------------------------------------------------
A6FVG8_9RHOB/5-87--------------------------------------------------------------------------------
A1B772_PARDP/5-86--------------------------------------------------------------------------------
A1UW16_BURMS/12-98--------------------------------------------------------------------------------
Q46QS0_CUPPJ/12-98--------------------------------------------------------------------------------
Q1MGZ9_RHIL3/5-86--------------------------------------------------------------------------------
B6JDT2_OLICO/6-87--------------------------------------------------------------------------------
A5VTX2_BRUO2/5-87--------------------------------------------------------------------------------
A1U059_MARAV/5-86--------------------------------------------------------------------------------
A1SRM1_PSYIN/5-86--------------------------------------------------------------------------------
C8RZP8_9RHOB/6-87--------------------------------------------------------------------------------
A6UM17_SINMW/4-85--------------------------------------------------------------------------------
B9K2Y3_AGRVS/4-85--------------------------------------------------------------------------------
A7IKT6_XANP2/6-87--------------------------------------------------------------------------------
A1B771_PARDP/5-86--------------------------------------------------------------------------------
B2S782_BRUA1/5-86--------------------------------------------------------------------------------
Q0AG96_NITEC/6-89--------------------------------------------------------------------------------
A6T0P1_JANMA/11-102--------------------------------------------------------------------------------
Q0S079_RHOSR/10-95--------------------------------------------------------------------------------
D0DC31_9RHOB/4-83--------------------------------------------------------------------------------
A8LNS6_DINSH/4-81--------------------------------------------------------------------------------
A3PJ37_RHOS1/4-81--------------------------------------------------------------------------------
Q0G655_9RHIZ/24-110--------------------------------------------------------------------------------
D8JXS4_HYPDA/4-89--------------------------------------------------------------------------------
D8JRG1_HYPDA/7-86--------------------------------------------------------------------------------
A5VRY8_BRUO2/10-90--------------------------------------------------------------------------------
B1ZIF7_METPB/6-84--------------------------------------------------------------------------------
B1M6N2_METRJ/3-84--------------------------------------------------------------------------------
A7HVA0_PARL1/7-87--------------------------------------------------------------------------------

PF03413

Q4K807_PSEF5/38-102------------..........----------------------------------------------------------
Q8D7W4_VIBVU/128-189------------..........----------------------------------------------------------
Q9KC80_BACHD/94-154------------..........----------------------------------------------------------
Q9K7V1_BACHD/28-100------------..........----------------------------------------------------------
Q6W134_RHISN/286-345------------..........----------------------------------------------------------
A8FCD9_BACP2/110-169------------..........----------------------------------------------------------
A5UQY0_ROSS1/111-167------------..........----------------------------------------------------------
A5MW77_STRPN/106-160------------..........----------------------------------------------------------
Q8E8L7_SHEON/45-99------------..........----------------------------------------------------------
Q03RI8_LACBA/34-106------------..........----------------------------------------------------------
Q6GFW2_STAAR/32-101------------..........----------------------------------------------------------
Q38Z32_LACSS/130-188------------..........----------------------------------------------------------
Q0VNU0_ALCBS/63-123------------..........----------------------------------------------------------
A0REW6_BACAH/375-436------------..........----------------------------------------------------------
Q186H8_CLOD6/144-202------------..........----------------------------------------------------------
Q3ETC3_BACTI/150-220------------..........----------------------------------------------------------
Q5WGU9_BACSK/378-439------------..........----------------------------------------------------------
Q3DSW2_STRAG/153-213------------..........----------------------------------------------------------
Q6EA99_LISMN/121-195------------..........----------------------------------------------------------
A0REU8_BACAH/162-234------------..........----------------------------------------------------------
Q8KFX7_CHLTE/45-103------------..........----------------------------------------------------------
Q8TLV5_METAC/114-171------------..........----------------------------------------------------------
Q6ANJ0_DESPS/50-117------------..........----------------------------------------------------------
Q5KVG3_GEOKA/282-341------------..........----------------------------------------------------------
Q9A4R3_CAUCR/50-105------------..........----------------------------------------------------------
NPRM_BACME/152-222------------..........----------------------------------------------------------
Q8RBF9_THETN/464-522------------..........----------------------------------------------------------
Q7P204_CHRVO/118-188------------..........----------------------------------------------------------
A3HZ45_9BACT/55-116------------..........----------------------------------------------------------
Q72M70_LEPIC/153-248------------KGELLVYQHS----------------------------------------------------------
Q5WLC0_BACSK/141-199------------..........----------------------------------------------------------
Q8ERG4_OCEIH/132-194------------..........----------------------------------------------------------
Q8E690_STRA3/31-94------------..........----------------------------------------------------------
Q8R5X9_FUSNN/83-142------------..........----------------------------------------------------------
A3UR63_VIBSP/116-190------------..........----------------------------------------------------------
Q8PEF5_XANCP/86-141------------..........----------------------------------------------------------
Q93J57_STRCO/330-390------------..........----------------------------------------------------------
A7GDD3_CLOBL/148-213------------..........----------------------------------------------------------
C3NWD2_VIBCJ/115-190------------..........----------------------------------------------------------
Q1Q7U9_PSYCK/44-104------------..........----------------------------------------------------------
Q15RY9_PSEA6/32-87------------..........----------------------------------------------------------
A0KRR6_SHESA/27-86------------..........----------------------------------------------------------
Q6HZB7_BACAN/163-222------------..........----------------------------------------------------------
Q8TTA4_METAC/138-199------------..........----------------------------------------------------------
Q5X972_LEGPA/122-197------------..........----------------------------------------------------------
Q9L1F9_STRCO/146-216------------..........----------------------------------------------------------
A1S2N2_SHEAM/113-188------------..........----------------------------------------------------------
Q9L126_STRCO/81-167------------.......ASP----------------------------------------------------------
A3D9D2_SHEB5/116-190------------..........----------------------------------------------------------
A8MEK6_ALKOO/172-230------------..........----------------------------------------------------------
C1DJ09_AZOVD/39-99------------..........----------------------------------------------------------
Q1QQG0_NITHX/28-83------------..........----------------------------------------------------------
A5G759_GEOUR/48-108------------..........----------------------------------------------------------
A7Z7T0_BACA2/28-100------------..........----------------------------------------------------------
Q0AQU2_MARMM/109-177------------..........----------------------------------------------------------
A1S4V2_SHEAM/92-162------------..........----------------------------------------------------------
A6P1K3_9FIRM/263-321------------..........----------------------------------------------------------
A3YDS2_9GAMM/122-191------------..........----------------------------------------------------------
Q2MG71_MICEC/79-138------------..........----------------------------------------------------------
Q825U8_STRAW/286-346------------..........----------------------------------------------------------
A5EBU9_BRASB/13-71------------..........----------------------------------------------------------
Q181V6_CLOD6/408-465------------..........----------------------------------------------------------
A3IDB5_9BACI/37-95------------..........----------------------------------------------------------
A5W1K1_PSEP1/32-87------------..........----------------------------------------------------------
Q8ESN0_OCEIH/32-90------------..........----------------------------------------------------------
A4XTT8_PSEMY/39-99------------..........----------------------------------------------------------
A7N0D3_VIBHB/111-186------------..........----------------------------------------------------------
A4JUZ6_BURVG/39-97------------..........----------------------------------------------------------
Q9R9S7_AERPU/113-179------------..........----------------------------------------------------------
Q9A8Q0_CAUCR/73-133------------..........----------------------------------------------------------
Q81R43_BACAN/43-101------------..........----------------------------------------------------------
Q1MKW1_RHIL3/284-343------------..........----------------------------------------------------------
Q5FIK0_LACAC/141-199------------..........----------------------------------------------------------
Q3KIR7_PSEPF/283-342------------..........----------------------------------------------------------
Q6GJS7_STAAR/52-111------------..........----------------------------------------------------------
Q5WLC0_BACSK/58-117------------..........----------------------------------------------------------
Q884E8_PSESM/260-320------------..........----------------------------------------------------------
Q5FIK1_LACAC/43-101------------..........----------------------------------------------------------
A7VSV8_9CLOT/98-161------------..........----------------------------------------------------------
Q9L7Z4_STACR/122-196------------..........----------------------------------------------------------
Q8RTZ9_9GAMM/126-201------------..........----------------------------------------------------------
A6AL37_VIBHA/130-204------------..........----------------------------------------------------------
Q3D1Y5_STRAG/117-182------------..........----------------------------------------------------------
Q4ZPX1_PSEU2/38-99------------..........----------------------------------------------------------
Q8RBF9_THETN/109-184------------..........----------------------------------------------------------
Q4MVM1_BACCE/29-101------------..........----------------------------------------------------------
A9VL27_BACWK/39-104------------..........----------------------------------------------------------
C2SHN7_BACCE/94-163------------..........----------------------------------------------------------
B1KR36_SHEWM/116-189------------..........----------------------------------------------------------
Q6HDI2_BACHK/430-497------------..........----------------------------------------------------------
Q8KI45_ENTFL/35-92------------..........----------------------------------------------------------
Q9KE75_BACHD/74-132------------..........----------------------------------------------------------
Q1JAF1_STRPB/81-144------------..........----------------------------------------------------------
Q4EQU7_LISMN/131-191------------..........----------------------------------------------------------
Q4JLE6_LACRE/76-135------------..........----------------------------------------------------------
Q9L126_STRCO/188-249------------..........----------------------------------------------------------
Q8P606_XANCP/82-140------------..........----------------------------------------------------------
A5W5R7_PSEP1/39-99------------..........----------------------------------------------------------
Q181V6_CLOD6/490-547------------..........----------------------------------------------------------
Q2FUX4_STAA8/118-192------------..........----------------------------------------------------------
Q3DA42_STRAG/78-137------------..........----------------------------------------------------------
A7G9N1_CLOBL/383-444------------..........----------------------------------------------------------
B0KBH9_THEP3/371-432------------..........----------------------------------------------------------
Q1IC64_PSEE4/41-101------------..........----------------------------------------------------------
Q0HTI7_SHESR/103-173------------..........----------------------------------------------------------
Q82ND7_STRAW/171-257------------.......TSH----------------------------------------------------------
B9LEH7_CHLSY/84-135------------..........----------------------------------------------------------
Q97G52_CLOAB/161-230------------..........----------------------------------------------------------
Q5M069_STRT1/87-141------------..........----------------------------------------------------------
A6V146_PSEA7/122-192------------..........----------------------------------------------------------
A7FTW6_CLOB1/148-213------------..........----------------------------------------------------------
Q8U1R9_PYRFU/327-383------------..........----------------------------------------------------------
Q1H2G7_METFK/106-166------------..........----------------------------------------------------------
B8G477_CHLAD/218-274------------..........----------------------------------------------------------
Q5UKQ5_9BACI/139-216------------..........----------------------------------------------------------
Q5GXB5_XANOR/79-137------------..........----------------------------------------------------------
NPRE_PAEPO/214-283------------..........----------------------------------------------------------
Q1ARP9_RUBXD/67-126------------..........----------------------------------------------------------
Q2B384_9BACI/29-101------------..........----------------------------------------------------------
A6NW01_9FIRM/193-253------------..........----------------------------------------------------------
Q97GS5_CLOAB/161-230------------..........----------------------------------------------------------
A5WGS1_PSYWF/34-90------------..........----------------------------------------------------------
Q6HZB7_BACAN/33-91------------..........----------------------------------------------------------
Q46237_CLOPF/161-230------------..........----------------------------------------------------------
A3QGG2_SHELP/47-105------------..........----------------------------------------------------------
A3UN73_VIBSP/32-105------------..........----------------------------------------------------------
A0M3G0_GRAFK/62-119------------..........----------------------------------------------------------
Q2SJ90_HAHCH/129-208------------..........----------------------------------------------------------
YPEB_BACSU/377-438------------..........----------------------------------------------------------
A6P1K3_9FIRM/443-502------------..........----------------------------------------------------------
Q047A4_LACGA/60-119------------..........----------------------------------------------------------
Q3K852_PSEPF/38-98------------..........----------------------------------------------------------
Q7A1T8_STAAW/129-187------------..........----------------------------------------------------------
Q884E8_PSESM/67-126------------..........----------------------------------------------------------
B3XMM9_LACRE/153-213------------..........----------------------------------------------------------
A9VSE9_BACWK/148-221------------..........----------------------------------------------------------
Q211C9_RHOPB/96-155------------..........----------------------------------------------------------
A8MEK5_ALKOO/294-355------------..........----------------------------------------------------------
A6FBW4_9GAMM/126-204------------..........----------------------------------------------------------
Q5X0P7_LEGPA/120-190------------..........----------------------------------------------------------
YKOI_BACSU/164-223------------..........----------------------------------------------------------
Q8EP78_OCEIH/29-101------------..........----------------------------------------------------------
Q541Q2_VIBAN/116-194------------..........----------------------------------------------------------
Q81R44_BACAN/99-158------------..........----------------------------------------------------------
Q9I178_PSEAE/60-119------------..........----------------------------------------------------------
Q5KXX8_GEOKA/94-154------------..........----------------------------------------------------------
Q7NNP8_GLOVI/232-295------------..........----------------------------------------------------------
Q7CY41_AGRT5/75-132------------..........----------------------------------------------------------
Q47KW9_THEFY/83-144------------..........----------------------------------------------------------
Q9KFU6_BACHD/49-108------------..........----------------------------------------------------------
Q825U8_STRAW/84-147------------..........----------------------------------------------------------
Q4EUP2_LISMN/142-200------------..........----------------------------------------------------------
Q2NX96_XANOM/33-88------------..........----------------------------------------------------------
A7ZG54_CAMC1/58-115------------..........----------------------------------------------------------
YPEB_BACHD/374-435------------..........----------------------------------------------------------
Q82ZK1_ENTFA/63-122------------..........----------------------------------------------------------
Q47MU5_THEFY/138-194------------..........----------------------------------------------------------
Q3K994_PSEPF/60-119------------..........----------------------------------------------------------
THER_BACCL/139-214------------..........----------------------------------------------------------
Q82BN5_STRAW/115-187------------..........----------------------------------------------------------
Q71Z55_LISMF/29-101------------..........----------------------------------------------------------
A8MEK6_ALKOO/94-155------------..........----------------------------------------------------------
Q4MSV8_BACCE/94-162------------..........----------------------------------------------------------
Q82US0_NITEU/41-96------------..........----------------------------------------------------------
Q3JE96_NITOC/270-334------------..........----------------------------------------------------------
F2MNH6_ENTFO/119-186------------..........----------------------------------------------------------
Q0BZN8_HYPNA/53-112------------..........----------------------------------------------------------
A6T0P0_JANMA/40-97------------..........----------------------------------------------------------
Q0AR59_MARMM/55-114------------..........----------------------------------------------------------
Q1J2R6_DEIGD/90-144------------..........----------------------------------------------------------
A4BGK8_9GAMM/17-91------------..........----------------------------------------------------------
Q8R5Y9_FUSNN/99-158------------..........----------------------------------------------------------
Q72M68_LEPIC/155-250------------KGELLVYEHS----------------------------------------------------------
A0RG40_BACAH/171-259------------..........----------------------------------------------------------
A6AYE9_VIBPA/130-204------------..........----------------------------------------------------------
A6C2A1_9PLAN/247-311------------..........----------------------------------------------------------
Q9L2B8_STRCO/83-152------------..........----------------------------------------------------------
Q8ERG4_OCEIH/56-114------------..........----------------------------------------------------------
Q725B7_LISMF/59-118------------..........----------------------------------------------------------
A3DI39_CLOTH/391-452------------..........----------------------------------------------------------
Q9L2B8_STRCO/168-232------------..........----------------------------------------------------------
B8G480_CHLAD/109-162------------..........----------------------------------------------------------
Q815U2_BACCR/146-219------------..........----------------------------------------------------------
A6NW01_9FIRM/109-172------------..........----------------------------------------------------------
A6CLW5_9BACI/159-247------------..........----------------------------------------------------------
Q186H8_CLOD6/62-121------------..........----------------------------------------------------------
Q5ZZ46_LEGPH/35-90------------..........----------------------------------------------------------
E0THY6_PARBH/109-174------------..........----------------------------------------------------------
Q8PQ63_XANAC/120-190------------..........----------------------------------------------------------
A5WGS1_PSYWF/109-165------------..........----------------------------------------------------------
A8LN27_DINSH/31-89------------..........----------------------------------------------------------
Q48DF8_PSE14/60-118------------..........----------------------------------------------------------
Q5HNG3_STAEQ/33-102------------..........----------------------------------------------------------
A4B9Z5_9GAMM/151-215------------..........----------------------------------------------------------
Q988S6_RHILO/46-105------------..........----------------------------------------------------------
Q8VLQ5_PSEO7/125-198------------..........----------------------------------------------------------
A4CC52_9GAMM/131-201------------..........----------------------------------------------------------
Q3J9Y2_NITOC/30-84------------..........----------------------------------------------------------
Q391Q3_BURS3/71-131------------..........----------------------------------------------------------
Q8ESM9_OCEIH/39-97------------..........----------------------------------------------------------
A6CTU8_9BACI/147-221------------..........----------------------------------------------------------
A6AP50_VIBHA/116-190------------..........----------------------------------------------------------
Q74LX8_LACJO/141-200------------..........----------------------------------------------------------
Q7X5N6_9BACL/163-236------------..........----------------------------------------------------------
B2TDF6_BURPP/75-135------------..........----------------------------------------------------------
Q020P0_SOLUE/231-293------------..........----------------------------------------------------------
Q97G51_CLOAB/153-222------------..........----------------------------------------------------------
A7ZEI5_CAMC1/22-81------------..........----------------------------------------------------------
Q6NKB0_CORDI/71-132------------..........----------------------------------------------------------
A3WUT4_9BRAD/64-123------------..........----------------------------------------------------------
A8AXQ2_STRGC/352-411------------..........----------------------------------------------------------
E0TIH6_PARBH/43-102------------..........----------------------------------------------------------
A5W9M7_PSEP1/60-118------------..........----------------------------------------------------------
Q82WV7_NITEU/279-343------------..........----------------------------------------------------------
Q12WY7_METBU/120-186------------..........----------------------------------------------------------
B7WSK7_COMTE/118-177------------..........----------------------------------------------------------
A3TLC9_9MICO/123-187------------..........----------------------------------------------------------
A5VEY7_SPHWW/24-82------------..........----------------------------------------------------------
Q0VNT9_ALCBS/52-112------------..........----------------------------------------------------------
Q474Y4_CUPPJ/260-324------------..........----------------------------------------------------------
A6DY87_9RHOB/293-357------------..........----------------------------------------------------------
Q8ELD0_OCEIH/32-90------------..........----------------------------------------------------------
Q3JBE9_NITOC/51-111------------..........----------------------------------------------------------
A4XTT9_PSEMY/41-101------------..........----------------------------------------------------------
A5TS99_FUSNP/24-83------------..........----------------------------------------------------------
A6GN46_9BURK/40-99------------..........----------------------------------------------------------
A0Q324_CLONN/379-440------------..........----------------------------------------------------------
A7B3W1_RUMGN/132-193------------..........----------------------------------------------------------
O27358_METTH/81-143------------..........----------------------------------------------------------
Q48H34_PSE14/39-99------------..........----------------------------------------------------------
Q1D8Q2_MYXXD/168-239------------..........----------------------------------------------------------
Q07JR2_RHOP5/48-107------------..........----------------------------------------------------------
Q8R5X9_FUSNN/10-69------------..........----------------------------------------------------------
A6GN43_9BURK/49-110------------..........----------------------------------------------------------
A5W119_PSEP1/60-119------------..........----------------------------------------------------------
YKOI_BACSU/98-153------------..........----------------------------------------------------------
Q03GC8_PEDPA/34-106------------..........----------------------------------------------------------
Q9KE75_BACHD/288-347------------..........----------------------------------------------------------
Q2RPG4_RHORT/72-131------------..........----------------------------------------------------------
YCDB_BACSU/416-471------------..........----------------------------------------------------------
A9KIB6_CLOPH/218-275------------..........----------------------------------------------------------
Q1D188_MYXXD/208-277------------..........----------------------------------------------------------
A9KIB6_CLOPH/317-399------------..........----------------------------------------------------------
Q6SFP6_9BACT/100-160------------..........----------------------------------------------------------
A9C057_DELAS/120-179------------..........----------------------------------------------------------
A4VTY9_STRSY/109-163------------..........----------------------------------------------------------
Q8RBF9_THETN/290-362------------..........----------------------------------------------------------
A2SEW0_METPP/117-177------------..........----------------------------------------------------------
Q2JP28_SYNJB/29-85------------..........----------------------------------------------------------
Q5WKR8_BACSK/122-181------------..........----------------------------------------------------------
Q6R6B9_LISSE/121-195------------..........----------------------------------------------------------
A4TZD4_9PROT/37-96------------..........----------------------------------------------------------
Q63MT4_BURPS/165-233------------..........----------------------------------------------------------
Q6N7G2_RHOPA/56-115------------..........----------------------------------------------------------
A5W1V5_PSEP1/63-122------------..........----------------------------------------------------------
A6CHW0_9BACI/149-219------------..........----------------------------------------------------------
Q3EVA2_BACTI/125-196------------..........----------------------------------------------------------
A6GPB0_9BURK/65-125------------..........----------------------------------------------------------
A8FCD8_BACP2/167-226------------..........----------------------------------------------------------
Q49X11_STAS1/141-216------------..........----------------------------------------------------------
A4YY21_BRASO/40-99------------..........----------------------------------------------------------
A7Z5Y9_BACA2/99-159------------..........----------------------------------------------------------
Q8D5E6_VIBVU/113-191------------..........----------------------------------------------------------
A7HRL7_PARL1/62-117------------..........----------------------------------------------------------
A1T724_MYCVP/79-141------------..........----------------------------------------------------------
Q8A623_BACTN/26-84------------..........----------------------------------------------------------
Q1H2G7_METFK/31-90------------..........----------------------------------------------------------
A3IDB5_9BACI/115-169------------..........----------------------------------------------------------
Q5F637_NEIG1/47-105------------..........----------------------------------------------------------
A5N159_CLOK5/17-76------------..........----------------------------------------------------------
Q82ZK1_ENTFA/146-205------------..........----------------------------------------------------------
Q2RM03_MOOTA/386-447------------..........----------------------------------------------------------
A4YNR6_BRASO/46-105------------..........----------------------------------------------------------
Q9KFU7_BACHD/111-170------------..........----------------------------------------------------------
Q74JH3_LACJO/126-184------------..........----------------------------------------------------------
B8G477_CHLAD/152-208------------..........----------------------------------------------------------
Q4QZ38_BACIU/144-218------------..........----------------------------------------------------------
Q9RC54_BACHO/24-83------------..........----------------------------------------------------------
Q1LJM8_RALME/260-324------------..........----------------------------------------------------------
A7ZEI5_CAMC1/100-159------------..........----------------------------------------------------------
B8G9I4_CHLAD/116-172------------..........----------------------------------------------------------
Q8ESM9_OCEIH/119-177------------..........----------------------------------------------------------
Q0S7B7_RHOSR/138-198------------..........----------------------------------------------------------
NPRS_GEOSE/147-222------------..........----------------------------------------------------------
A8MIH5_ALKOO/376-437------------..........----------------------------------------------------------
B0UCU3_METS4/66-129------------..........----------------------------------------------------------
YPEB_OCEIH/373-434------------..........----------------------------------------------------------
Q82ZL5_ENTFA/37-109------------..........----------------------------------------------------------
B1YFR1_EXIS2/113-183------------..........----------------------------------------------------------
Q5HKU0_STAEQ/128-202------------..........----------------------------------------------------------
Q8RD03_THETN/115-173------------..........----------------------------------------------------------
Q1ARP9_RUBXD/144-202------------..........----------------------------------------------------------
Q6W134_RHISN/75-133------------..........----------------------------------------------------------
B4SM17_STRM5/23-78------------..........----------------------------------------------------------
A0Q1L3_CLONN/59-118------------..........----------------------------------------------------------
A3IDB6_9BACI/160-218------------..........----------------------------------------------------------
Q2RPK6_RHORT/75-133------------..........----------------------------------------------------------
Q8PWA1_METMA/60-123------------..........----------------------------------------------------------
Q8DVN1_STRMU/57-120------------..........----------------------------------------------------------
Q7NVU2_CHRVO/229-292------------..........----------------------------------------------------------
B1YKF6_EXIS2/28-100------------..........----------------------------------------------------------
A9B7B4_HERA2/311-370------------..........----------------------------------------------------------
Q70B12_ACTTI/120-189------------..........----------------------------------------------------------
Q82P05_STRAW/125-192------------..........----------------------------------------------------------
Q72UE2_LEPIC/159-252------------..KGELIVYN----------------------------------------------------------
Q1Q7U9_PSYCK/123-181------------..........----------------------------------------------------------
A3X073_9BRAD/44-103------------..........----------------------------------------------------------
Q5FIK0_LACAC/62-121------------..........----------------------------------------------------------
Q9A7E1_CAUCR/252-316------------..........----------------------------------------------------------
A0R6J4_MYCS2/78-140------------..........----------------------------------------------------------
B8I195_CLOCE/108-180------------..........----------------------------------------------------------
MSPA_LEGLO/128-199------------..........----------------------------------------------------------
Q81MX8_BACAN/145-217------------..........----------------------------------------------------------
Q1WU38_LACS1/104-164------------..........----------------------------------------------------------
Q3SKV5_THIDA/55-112------------..........----------------------------------------------------------
Q03XK6_LEUMM/140-199------------..........----------------------------------------------------------
Q06DP6_9GAMM/118-194------------..........----------------------------------------------------------
Q5FIK1_LACAC/119-178------------..........----------------------------------------------------------
A8FEM8_BACP2/376-437------------..........----------------------------------------------------------
Q8ESH1_OCEIH/143-217------------..........----------------------------------------------------------
Q8ELE8_OCEIH/178-237------------..........----------------------------------------------------------
Q89L62_BRAJA/85-144------------..........----------------------------------------------------------
Q11VT5_CYTH3/217-280------------..........----------------------------------------------------------
Q5WLI5_BACSK/75-133------------..........----------------------------------------------------------
Q9KBS1_BACHD/60-118------------..........----------------------------------------------------------
A5FLJ5_FLAJ1/130-219------------....LPDMEQ----------------------------------------------------------
A4FCJ5_SACEN/417-477------------..........----------------------------------------------------------
Q8FUC0_COREF/86-161------------..........----------------------------------------------------------
A0AXS1_BURCH/321-380------------..........----------------------------------------------------------
Q1NCJ5_9SPHN/62-120------------..........----------------------------------------------------------
Q8CK35_STRCO/128-197------------..........----------------------------------------------------------
Q09A13_STIAD/60-114------------..........----------------------------------------------------------
A9C057_DELAS/43-102------------..........----------------------------------------------------------
NPRE_BREBE/144-218------------..........----------------------------------------------------------
Q74JH3_LACJO/49-108------------..........----------------------------------------------------------
YKOJ_BACSU/108-167------------..........----------------------------------------------------------
O26402_METTH/29-126------------...EVKWIPF----------------------------------------------------------
A3UNN0_VIBSP/116-195------------..........----------------------------------------------------------
A4QG45_CORGB/37-98------------..........----------------------------------------------------------
Q1R143_CHRSD/68-125------------..........----------------------------------------------------------
A7VSV8_9CLOT/179-240------------..........----------------------------------------------------------
Q9KFU6_BACHD/130-191------------..........----------------------------------------------------------
A8FEH2_BACP2/99-159------------..........----------------------------------------------------------
Q181V6_CLOD6/337-394------------..........----------------------------------------------------------
A7K2T9_VIBSE/115-189------------..........----------------------------------------------------------
Q5WKR9_BACSK/175-233------------..........----------------------------------------------------------
A9AUX6_HERA2/135-191------------..........----------------------------------------------------------
A1B2L4_PARDP/40-99------------..........----------------------------------------------------------

PF11396

C6W664_DYAFD/240-302--------------------------------------------------------------------------------
A6L510_BACV8/38-96--------------------------------------------------------------------------------
B9XID0_9BACT/98-160--------------------------------------------------------------------------------
Q7MWB4_PORGI/302-359--------------------------------------------------------------------------------
A7LSF7_BACOV/156-219--------------------------------------------------------------------------------
Q4HPP5_CAMUP/21-74--------------------------------------------------------------------------------
Q7MWB4_PORGI/160-216--------------------------------------------------------------------------------
A6LDA4_PARD8/215-276--------------------------------------------------------------------------------
A6L1R4_BACV8/91-153--------------------------------------------------------------------------------
A6LDA4_PARD8/22-79--------------------------------------------------------------------------------
Q8A9N6_BACTN/42-103--------------------------------------------------------------------------------
A7VAB9_BACUN/24-82--------------------------------------------------------------------------------
Q609W9_METCA/25-85--------------------------------------------------------------------------------
A6EC49_9SPHI/80-140--------------------------------------------------------------------------------
A7V913_BACUN/87-150--------------------------------------------------------------------------------
Q11R11_CYTH3/84-141--------------------------------------------------------------------------------
A6EBA3_9SPHI/40-102--------------------------------------------------------------------------------
Q64Q98_BACFR/42-103--------------------------------------------------------------------------------
A3U576_CROAH/46-104--------------------------------------------------------------------------------
Q8A9P3_BACTN/16-71--------------------------------------------------------------------------------
Q5L9Y2_BACFN/77-142--------------------------------------------------------------------------------
Q5LBR7_BACFN/156-212--------------------------------------------------------------------------------
A1ZPX0_9BACT/161-219--------------------------------------------------------------------------------
A7V913_BACUN/224-284--------------------------------------------------------------------------------
A0LZK7_GRAFK/81-141--------------------------------------------------------------------------------
C0QYD0_BRAHW/7-56--------------------------------------------------------------------------------
Q89YQ5_BACTN/90-143--------------------------------------------------------------------------------
A5ZCE1_9BACE/25-80--------------------------------------------------------------------------------
B0MTD2_9BACT/41-98--------------------------------------------------------------------------------
B9KG60_CAMLR/21-74--------------------------------------------------------------------------------
A3U577_CROAH/47-105--------------------------------------------------------------------------------
Q7MWB4_PORGI/235-292--------------------------------------------------------------------------------
A0M1R1_GRAFK/98-159--------------------------------------------------------------------------------
D5UB28_BRAM5/1-54--------------------------------------------------------------------------------
B9KG75_CAMLR/19-71--------------------------------------------------------------------------------
A6LDM3_PARD8/41-102--------------------------------------------------------------------------------
A6L4L1_BACV8/88-141--------------------------------------------------------------------------------
A6L4Q2_BACV8/76-141--------------------------------------------------------------------------------
B9KE59_CAMLR/80-133--------------------------------------------------------------------------------
A7M5Y9_BACOV/86-149--------------------------------------------------------------------------------
Q89YQ4_BACTN/86-149--------------------------------------------------------------------------------
B3JHE8_9BACE/293-346--------------------------------------------------------------------------------
Q1VZW6_9FLAO/27-87--------------------------------------------------------------------------------
Q5HUF8_CAMJR/79-132--------------------------------------------------------------------------------
A6LDE6_PARD8/86-148--------------------------------------------------------------------------------
A5FMA0_FLAJ1/39-96--------------------------------------------------------------------------------
A6L4L1_BACV8/24-81--------------------------------------------------------------------------------
A7AB56_9PORP/24-80--------------------------------------------------------------------------------
Q26DS8_FLABB/19-76--------------------------------------------------------------------------------
A6EC48_9SPHI/26-83--------------------------------------------------------------------------------
B9KG75_CAMLR/77-130--------------------------------------------------------------------------------
A6L337_BACV8/89-142--------------------------------------------------------------------------------
D5U9R1_BRAM5/24-79--------------------------------------------------------------------------------
A0M1R1_GRAFK/37-94--------------------------------------------------------------------------------
B3JHE8_9BACE/30-87--------------------------------------------------------------------------------
Q7MWB4_PORGI/82-144--------------------------------------------------------------------------------
A6LDA3_PARD8/25-83--------------------------------------------------------------------------------
Q8A995_BACTN/24-79--------------------------------------------------------------------------------
A7LSF8_BACOV/24-81--------------------------------------------------------------------------------
A6LDE6_PARD8/216-277--------------------------------------------------------------------------------
Q025C3_SOLUE/32-92--------------------------------------------------------------------------------
Q64WW2_BACFR/25-83--------------------------------------------------------------------------------
A7LSF7_BACOV/83-145--------------------------------------------------------------------------------
A7LSF7_BACOV/24-79--------------------------------------------------------------------------------
A0M0Q0_GRAFK/82-142--------------------------------------------------------------------------------
A7V913_BACUN/163-220--------------------------------------------------------------------------------
Q1PYA3_9BACT/240-300--------------------------------------------------------------------------------
A6L1R4_BACV8/226-288--------------------------------------------------------------------------------
Q4HEV5_CAMCO/79-132--------------------------------------------------------------------------------
Q7MWB3_PORGI/88-141--------------------------------------------------------------------------------
A7AAP4_9PORP/39-100--------------------------------------------------------------------------------
Q8A995_BACTN/83-145--------------------------------------------------------------------------------
D5UB30_BRAM5/29-82--------------------------------------------------------------------------------
A5FIF1_FLAJ1/22-79--------------------------------------------------------------------------------
A6LDA3_PARD8/90-143--------------------------------------------------------------------------------
A6LDA0_PARD8/28-84--------------------------------------------------------------------------------
A7VAB9_BACUN/89-142--------------------------------------------------------------------------------
A7V913_BACUN/27-83--------------------------------------------------------------------------------
A7UZY2_BACUN/47-109--------------------------------------------------------------------------------
A7V2B6_BACUN/24-81--------------------------------------------------------------------------------
A6ERM3_9BACT/45-103--------------------------------------------------------------------------------
Q2Y6A1_NITMU/95-160--------------------------------------------------------------------------------
A6L337_BACV8/24-82--------------------------------------------------------------------------------
Q1PYA3_9BACT/45-105--------------------------------------------------------------------------------
B9KE59_CAMLR/20-73--------------------------------------------------------------------------------
A6LDE6_PARD8/26-82--------------------------------------------------------------------------------
A7M5Y9_BACOV/25-82--------------------------------------------------------------------------------
Q4HEV5_CAMCO/20-72--------------------------------------------------------------------------------
A7ABZ7_9PORP/218-279--------------------------------------------------------------------------------
Q606T7_METCA/26-86--------------------------------------------------------------------------------
A6LDA4_PARD8/83-145--------------------------------------------------------------------------------
A1ZPX0_9BACT/82-140--------------------------------------------------------------------------------
A5FNS8_FLAJ1/26-83--------------------------------------------------------------------------------
D8ICV0_BRAP9/18-73--------------------------------------------------------------------------------
Q4HTG4_CAMUP/18-70--------------------------------------------------------------------------------
A5ZCE1_9BACE/84-144--------------------------------------------------------------------------------
A0M5V4_GRAFK/44-104--------------------------------------------------------------------------------
A3J6C3_9FLAO/78-139--------------------------------------------------------------------------------
Q8A994_BACTN/88-141--------------------------------------------------------------------------------
Q11R11_CYTH3/24-80--------------------------------------------------------------------------------
B9KDT7_CAMLR/39-93--------------------------------------------------------------------------------
Q8YLV6_NOSS1/89-149--------------------------------------------------------------------------------
A4ANN1_MARSH/103-168--------------------------------------------------------------------------------
A5FM86_FLAJ1/39-96--------------------------------------------------------------------------------
A3XQ60_LEEBM/44-103--------------------------------------------------------------------------------
Q4HTG4_CAMUP/77-130--------------------------------------------------------------------------------
C0QVH4_BRAHW/20-75--------------------------------------------------------------------------------
Q64UH5_BACFR/42-103--------------------------------------------------------------------------------
A6LDA4_PARD8/155-211--------------------------------------------------------------------------------
E4MSA5_CAPOC/22-79--------------------------------------------------------------------------------
Q64SP0_BACFR/83-145--------------------------------------------------------------------------------
Q4HE98_CAMCO/48-102--------------------------------------------------------------------------------
B9KG60_CAMLR/81-134--------------------------------------------------------------------------------
Q5LEW1_BACFN/42-107--------------------------------------------------------------------------------
Q8YLV6_NOSS1/29-85--------------------------------------------------------------------------------
C0R146_BRAHW/31-84--------------------------------------------------------------------------------
C0R148_BRAHW/1-54--------------------------------------------------------------------------------
A0LZK7_GRAFK/21-77--------------------------------------------------------------------------------
A2TPA4_9FLAO/87-148--------------------------------------------------------------------------------
A7AB56_9PORP/84-146--------------------------------------------------------------------------------
A3YT26_CAMJU/21-74--------------------------------------------------------------------------------
Q64TS2_BACFR/42-107--------------------------------------------------------------------------------
A6E8W6_9SPHI/40-102--------------------------------------------------------------------------------
B3JHE8_9BACE/156-216--------------------------------------------------------------------------------
Q8A995_BACTN/230-292--------------------------------------------------------------------------------
A0M0Q0_GRAFK/20-78--------------------------------------------------------------------------------
A5ZGS8_9BACE/87-150--------------------------------------------------------------------------------
A6EC48_9SPHI/89-142--------------------------------------------------------------------------------
Q1PY86_9BACT/10-70--------------------------------------------------------------------------------
A5FMA1_FLAJ1/39-96--------------------------------------------------------------------------------
A7V329_BACUN/79-144--------------------------------------------------------------------------------
Q5LBR7_BACFN/23-79--------------------------------------------------------------------------------
Q4HPP5_CAMUP/81-134--------------------------------------------------------------------------------
A5FNS8_FLAJ1/90-143--------------------------------------------------------------------------------
Q606T7_METCA/90-152--------------------------------------------------------------------------------
A7ABZ7_9PORP/87-149--------------------------------------------------------------------------------
Q89YQ5_BACTN/24-82--------------------------------------------------------------------------------
Q64SP0_BACFR/216-278--------------------------------------------------------------------------------
A7AB55_9PORP/91-144--------------------------------------------------------------------------------
A5FM85_FLAJ1/39-96--------------------------------------------------------------------------------
A4CIV2_ROBBH/43-101--------------------------------------------------------------------------------
A4JEG0_BURVG/34-94--------------------------------------------------------------------------------
Q64WW2_BACFR/87-150--------------------------------------------------------------------------------
A6L1R4_BACV8/162-222--------------------------------------------------------------------------------
Q0P9P8_CAMJE/20-72--------------------------------------------------------------------------------
A7AB55_9PORP/27-84--------------------------------------------------------------------------------
A2TZP8_9FLAO/26-85--------------------------------------------------------------------------------
A6KXD7_BACV8/38-100--------------------------------------------------------------------------------
A5FBY0_FLAJ1/85-146--------------------------------------------------------------------------------
A5FM84_FLAJ1/39-94--------------------------------------------------------------------------------
A7V329_BACUN/19-75--------------------------------------------------------------------------------
Q11P99_CYTH3/20-76--------------------------------------------------------------------------------
D8IF52_BRAP9/11-64--------------------------------------------------------------------------------
A7VAB8_BACUN/86-148--------------------------------------------------------------------------------
Q8ABX7_BACTN/27-89--------------------------------------------------------------------------------
Q64ZG0_BACFR/31-91--------------------------------------------------------------------------------
A6E8W7_9SPHI/39-101--------------------------------------------------------------------------------
Q11P99_CYTH3/80-140--------------------------------------------------------------------------------
Q2Y9L0_NITMU/27-92--------------------------------------------------------------------------------
Q5LD45_BACFN/111-176--------------------------------------------------------------------------------
A6LDA0_PARD8/88-149--------------------------------------------------------------------------------
A7AKE6_9PORP/56-112--------------------------------------------------------------------------------
A7AKE6_9PORP/116-177--------------------------------------------------------------------------------
Q64WW3_BACFR/89-143--------------------------------------------------------------------------------
Q4HFB7_CAMCO/81-132--------------------------------------------------------------------------------
A7VAB8_BACUN/26-82--------------------------------------------------------------------------------
Q7MWB3_PORGI/24-81--------------------------------------------------------------------------------
Q2Y7C4_NITMU/25-90--------------------------------------------------------------------------------
A6LAS6_PARD8/41-101--------------------------------------------------------------------------------
A3ZG36_CAMJU/81-133--------------------------------------------------------------------------------
A7LSF7_BACOV/223-284--------------------------------------------------------------------------------
Q5LG07_BACFN/24-82--------------------------------------------------------------------------------
A7AB56_9PORP/219-280--------------------------------------------------------------------------------
A7LXE2_BACOV/77-142--------------------------------------------------------------------------------
A5FIF1_FLAJ1/86-139--------------------------------------------------------------------------------
A7V158_BACUN/77-142--------------------------------------------------------------------------------
Q26DS8_FLABB/80-141--------------------------------------------------------------------------------
A6EC49_9SPHI/20-76--------------------------------------------------------------------------------
A7UZJ9_BACUN/42-107--------------------------------------------------------------------------------
Q64SP1_BACFR/24-81--------------------------------------------------------------------------------
A7V2B6_BACUN/88-141--------------------------------------------------------------------------------

PF14620

Q3ACX8_CARHZ/13-371..ETKL......YS..LREDLM........................PEAIVNALRDVENNVLDLRNKKVAYEGDF.....
A3DI39_CLOTH/26-388.LANKG......TP..LFQKTS........................QNMQLQQFENIDKTF.QDYP.TLIYDGPF...SD
Q736X0_BACC1/13-372.VEMAL......AS..NRDPAD........................NTIIDG.LKTVEKNV.TSYS.STNF.GPT.FTSA
C6CU97_PAESJ/16-375.VEVAL......AK..QNSPND........................NTIIDG.FKTVDKKV.SEYP.EINW.GPS..VAS
Q8R774_THETN/13-368.LRKQG......TK..KMAQID........................SKILNVRMNSVNQTM.TNFP.TLIYDGPF...SE
D5DRI0_BACMQ/13-373.VELAL......AT..KEKQGD........................NTIIDG.LKTVEKSM.DSFA.ETDL.GVM.NATN
D5W1I7_CLOB2/17-379.IRKKV......GG..VLAKEN........................PNSVKGQFNNMQKQV.MQYP.ALIYDGPF...SD
C6PVF7_9CLOT/17-378.IRKKT......SS..VLASNK........................EPLISEQFQGIQKQV.TQYP.ALIYDGPF...SD
E0RD66_PAEP6/16-382.VEADP......GS..QTGPKD........................NTIVDG.FKTVDKKV.EGYK.ELDW.GPS..VAS
D3G027_BACPE/13-376.IDKEL......QAATTEEPSD........................NLVVNN.FEVMNKNI.EGYS.EVEW.GAGLTSIE
B8D1J1_HALOH/6-366.LVKGT......RG..KMQENK........................PNPMLDGFDEIRSEL.SKYP.TLIYDGPF...SD
B8I3U7_CLOCE/26-387.YTNKG......KF..MVASTS........................KDPKTGQFENIDKTF.QEYP.TLIYDGPY...SD
B1C6Q7_9FIRM/13-365............NSNVFMADTS.........................TKIDNSFKATNEEI.NEYP.TLIFDGPF...SD
E8SXZ7_GEOS2/13-373.VELAL......AT..NDEKGD........................NIIIDG.LKAVEKNV.DTFSSSSEF.GPS.FIGL
A4J9E3_DESRM/15-376.IVQSA......RQ..DLAKGT........................PTGAAKNFQGIDQQM.QGFP.TLIYDGPF...SD
D9TFB8_CALOO/29-390.VRVVG......TS..RFKRIA........................QNVTSSRMLAVEAGF.KDYP.TLIYDGPF...SD
A6NSM3_9FIRM/22-381.LEHAQ......ARLAQAQEST........................GDTAGSSFQNVESDF.PEVP.TLIYDGPF...SE
D5N4Y3_BACPN/13-374.VEMAL......AS..DEKQSD........................NTIINS.FKTVEKNV.GAFSTGTDL.GPS.FTST
D9QUD9_ACEAZ/13-381.QRHII......LEKEDLEENS...........................ILSSLQGLEGEV.SKINLNPDNESIKDGLPE
B0MLG6_9FIRM/17-370............AATEVQEAKN.....................SDEPSYITEGFTDFEEGY.DNYP.TLIYDGPF...SD
C5VNR0_CLOBO/15-376.IRRKA......NS..RLGRSS........................EKLASDQFKEIQSQV.VQYP.TLIYDGPF...SE
A5CYA9_PELTS/14-376.LLRQV......RK..NLQKPE........................ENPAQADLQALDRQM.QRYP.ALIYDGPF...SE
Q67K56_SYMTH/19-394PAQLSLRTLMRPPGRVLSDPAA..................SGGPAAAALLDGGWAQLATSM.EQMP.TFIYNGPF...SD
E5YVT8_9BACL/16-375.VETAL......AT...NKVGD........................NSIIDG.FKTVDKKV.ESYP.ELDW.GPS..VSS
B1I6Q9_DESAP/14-380.LASELR.....ARRGALRPAP........................PDPASTALEAVNREM.EQFP.TLVYDGAF...SE
Q67QG8_SYMTH/1-374RERRAAG.....GADLTQDQAQ........................KSLIPPGLNQVGPQM.DQMP.VLVYDGPF...SD
YPEB_BACHD/13-371.LNKEF......QA..QDEPLD........................NAIVDG.FRTMDEHV.KGAS.EVEW.GPGMVIRN
D5XDM3_THEPJ/19-379.VENQA.........PKLKKAG........................LTGISAGFEKIDGQM.QKFP.TLIYDGPF...SD
E9SE89_RUMAL/27-377.............SESMMTDKE........................PPHVTEGFTDFEGGF.DDYP.KLIYDGPF...SD
F0K5G1_CLOAE/18-380.IRRKM......SG..VLASAN........................GANISDSFKNIQKQS.AQYP.ALIYDGPF...SD
Q898Z6_CLOTE/17-379.IRKKV......GG..VLARNK........................ED.ISEQFKGIQKQV.TQYP.ALIYDGPF...SD
Q65I06_BACLD/13-374.VELAL......AS..GQKQSD........................NKIING.FKTVEKSA.SAFS.DTDL.GATEMTNT
A7VNV5_9CLOT/20-375.AQQAYQ.....NLSRETQDQA........................VPAINSGFREMNEGF.TDYP.TLIYDGPF...SD
Q67JA4_SYMTH/1-357.TVQAT......SP..AQSGQA........................STPITKSVMLLEENL.PVPP......GEENALAP
D5WQ69_BACT2/16-374.AEMAM......SD..TQKKGD........................NQIIDG.FQKLEKQV.TEFP.EVSF.GPTNRTLE
E6U685_ETHHY/20-373.AENV.......TKRNNPNQAT........................PTSLQGGFLNIENTF.ANLP.SLIYDGPF...SD
C6J414_9BACL/16-377.VETAL......AS..EKEPRD........................NTIIDG.FKTVDKKV.SEYP.ELDW.GPS..ISS
F0DLG0_9FIRM/14-375.LATAV......RQ..EMKQGA........................PANVPANFQSIDRNM.QGYP.TLVYDGPF...SD
Q2RM03_MOOTA/13-383SLPRTI......AGRALPVEAR........................PGPLDG.FVNTDRRL.QTLP.SLNYDGPF...SD
B4AKG7_BACPU/13-373.VEMAL......AD..GDRKND........................NTIIDG.LKTVERNA.DAFA.DVDL.GPT.NVST
B9DX91_CLOK1/17-380.IRKKI......TG..VLAKSN........................TTSISQQFEGIQKQI.VQYP.ALIYDGPF...SD
B7GHM6_ANOFW/13-372.VELAL......AT..NNRPND........................NTIIDG.FKTVEKNV.QSYN.ETDF.GPS.FTSV
E6TZD5_BACCJ/13-373.VEMAL......AS..EEEPLD........................NAIVNG.FHIINEKV.DGFS.EVNF.GADASSLS
C8VVD3_DESAS/16-378.LAGES......GS..KMQGQA........................KRLASSNFQQINQKV.QDYP.ALIYDGPF...SD
E6UCG1_RUMA7/18-368.............AEGVMADEE........................PPHVTEGFTDFESSF.DDYP.KLIYDGPF...SD
D9TPL0_THETC/12-368.LRKKG......TQ..KMSQID........................SKILNVNMSAVNQQM.SNYP.TLIYDGPF...SE
Q2B634_9BACI/13-372.VEMAL......AS..NKQPMD........................NTIIDG.FKTVEKTV.ESYG.ETDF.GPA.MVNM
A8MIH5_ALKOO/13-373.LRREG......NR..NLKELE........................NQMKDFNLITFEERL.LEYP.ELIYDGPF...SD
B0TAV0_HELMI/41-428.LEKQ.......ARQQEQQGSKQQTALGQFWQRVVAAVAGQGPETQAPPILANFQFVENEL.QKYS.PVEYDGRH...SE
E5WI28_9BACI/13-372.VEMAL......AS..NGEAAD........................NTIIDG.FKTVEKTV.EGYG.ETDF.GPA.FVNM
C0GK90_9FIRM/17-388............KVWPEVLEKM........................ESLLGDDLQQIYTVY..VYP...HYDPQL.....
C0EB21_9CLOT/19-374.LQSIG......NLVDDQQVQQ........................AGNFGDGFQEFEDSL.EGTP.SLIYDGPF...SD
D8GKX4_CLOLD/17-380.IRKKI......TG..VFAQSN........................DVSISEQFKGIQKQV.LQYP.TLIYDGPF...SD
YPEB_OCEIH/13-370.VELAL......SD..ENAQQD........................NTIVNG.FQTVEKSV.EGFG.QADPENST..IST
B0PG38_9FIRM/20-373.LPSG.......GGDDTEGTRA........................AHGLSSGFEDIEQTM.TGYP.TLIYDGPF...SD
C0ZCA7_BREBN/17-378.VETAL......AS..NKNKED........................NSIIDG.FQTIEKKV.QEYP.DLDW.GVGIQSLD
A6TN00_ALKMQ/13-373.LRREG......NR..DLGSVS........................DQMKDFNLIDIEERI.NEYP.ELIYDGPF...SE
D9S297_THEOJ/14-374.GSFA.......PGLSKRIEPG...........................LADRFAAIDQRLKEEAP.SITYDGPF...SD
A0Q324_CLONN/15-376.IRKKA......TS..KLAKSS........................ENLASDKFKAIQNQV.LQYP.TLINDGPF...SE
A6CR99_9BACI/13-371.VEMAL......AT..GKEQAD........................NTIIDG.FKTVEKTV.DGYD.EANFGGPT.YVNT
E0ICB3_9BACL/16-375.VEVAL......AS..EKSTRD........................NTIIDG.FKTVDKKV.SEYP.EINW.GPS..VAS
Q5WGU9_BACSK/13-375.QNDEQ......R...EDEPTQ........................SSSVAGHFERLNKSV.QGFS.EVEW.GATDSAIR

PF11399

Q085F9_SHEFN/19-127--------------------------------------------------------------------------------
A4C487_9GAMM/27-130--------------------------------------------------------------------------------
A6WL17_SHEB8/20-121--------------------------------------------------------------------------------
A8FY56_SHESH/14-118--------------------------------------------------------------------------------
Q15QY7_PSEA6/20-121--------------------------------------------------------------------------------
B1KNV8_SHEWM/19-120--------------------------------------------------------------------------------
Q8EGJ0_SHEON/23-132--------------------------------------------------------------------------------
B1KQX2_SHEWM/20-121--------------------------------------------------------------------------------
A1S8B9_SHEAM/20-121--------------------------------------------------------------------------------
Q07ZE7_SHEFN/20-121--------------------------------------------------------------------------------
Q15QZ2_PSEA6/17-120--------------------------------------------------------------------------------
Q12L38_SHEDO/25-126--------------------------------------------------------------------------------
Q3ICC6_PSEHT/20-123--------------------------------------------------------------------------------
A4C4D7_9GAMM/17-125--------------------------------------------------------------------------------
A1S4M5_SHEAM/17-118--------------------------------------------------------------------------------
<