Sequence alignment for CL0322

PF12349

SCAP_XENLA/306-459--------------------------------------------------------------------------------
A0MJA4_CANFA/661-815--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A2I5E0_LEUER/44-198--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5BXT3_VITVI/26-176--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A6SQG9_BOTFB/216-369--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
O16307_CAEEL/208-359--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q1MT74_DANRE/45-196--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q23E28_TETTS/595-746--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
Q4T749_TETNG/568-722--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/217-369--------------------------------------------------------------------------------
Q7YU59_DROME/651-805--------------------------------------------------------------------------------

PF03176

MMPL8_MYCTU/74-402---------------------------------------------AILP-SDAPVLVSTRQMTAAFRE..AGLQSV--AV
MMPL8_MYCTU/676-1049---------------------------------------------GLRG-ALATVIRAMGSLGMSSPGGVRS..KI--NL
MMPL4_MYCTU/59-388---------------------------------------------SLSP-KDAPSFEAMGRIGMVFKE..GDSDSF--AM
MMPL5_MYCTU/63-393---------------------------------------------SMSP-DAAPSMISMKHIGKVFEE..GDSDSA--AM
MMPL5_MYCTU/612-950---------------------------------------------VMTE-DINNLLPLMQRLDTLMPQLTAMMPEM--IQ
MMPLB_STRCO/48-383---------------------------------------------NLPP-AASDSMKARDLVRAQLPG..QDATPA--II
MMPL4_MYCLE/57-385---------------------------------------------SLSP-KDAPSYIAMQKMGQVFNE..GNSDSV--IM
MMPL7_MYCTU/74-391---------------------------------------------ALLP-QDAKTAAATSRIAQAFPG..TGSNAI--AY
MMPLA_MYCTU/29-358---------------------------------------------AVLP-ADAPSSVAVRQMAEAFHE..SGSENI--LV
MMPL1_MYCTU/52-381---------------------------------------------ALGP-HDAPSLIAMKRIGKDFQQ..FDSDTT--AM
MMPL1_MYCTU/600-941---------------------------------------------KLTE-DLANLTDDTERMDTTQRQLLAQLDPT--IA
MMPL9_MYCTU/58-387---------------------------------------------AVAP-DDAQSMRAMRRAGKVFNE..FDSNSI--AM
MMPL9_MYCTU/606-944---------------------------------------------TLTD-QLRALTDDMNKMEALTPQFLALLPPM--IT
YDFJ_BACSU/44-362---------------------------------------------DMSI-PDTPSEKAMDVIQKEFPH.GPDKGSI--RV
YDGH_BACSU/39-360---------------------------------------------AQLP-ADAVS....ERANAILKQ.AGEDNNS--IS
MMPL6_MYCTU/28-366---------------------------------------------QLGE-QLASVTVTLDKLAAIQPQLVALLPDE--IA
MMPL2_MYCTU/54-382---------------------------------------------SMSP-SDAASIQAIKRVGQVFGE..FDSDNA--VT
MMPL2_MYCTU/601-939---------------------------------------------QLSE-KLEYLVKDMDILITLLPQMRAQMPPM--IS
MMPLA_MYCLE/55-391---------------------------------------------VILP-VDAPSSVAAKKISQAFHE..VDSENV--LI
Q50086_MYCLE/31-369---------------------------------------------QIDE-RLNSIVGDIKNMDLLMPQMLEQFPPM--IE
MMPLC_MYCTU/55-384---------------------------------------------APLP-PGAPSMVLQKEMSAAFQE.KIETSAL--LL
MMPLC_MYCTU/658-1001---------------------------------------------TLDG-QLKQVVSTLKAV.....DGLPT..KL--AQ
MMPLA_STRCO/46-370---------------------------------------------AWLP-GNAESTEVLE.LSEKFQP..ADTSPT--VI
MMPLA_STRCO/397-682---------------------------------------------DGFK-TKPESVVGEEILTRHFPA..GSGEPM--VV
Q9RKC1_STRCO/44-379---------------------------------------------SFSI-PGTEAQKAFDLLEQRFPGASADGATA--RV
Q9RL63_STRCO/44-395---------------------------------------------SDSM-PGIESQHAFDLINERFPGAEAEGADA--RI
MMPLD_STRCO/50-373---------------------------------------------SFLP-RSAESTRVVD.AQQAFQQ..DETLPV--IV
Q9XB10_MYCBO/43-376---------------------------------------------PFSP-AGTATSRAVERSAAAFSQ..APGDNI--GY
Q9XB10_MYCBO/595-943---------------------------------------------ESCA-KLADAAGQLARGIADVASATSGVSGL--PN
Q9XCF5_MYCAV/55-384---------------------------------------------SLSP-IGAPSFKAMERLGEDFKE..TNTGAL--AM
Q9XCF5_MYCAV/604-943---------------------------------------------EIND-KLGDLVKNLDQLDALLPQLVMQIPPM--IE
Q9XCF6_MYCAV/51-382---------------------------------------------PLAP-QDAPAVQAMQRMGRDFKE..SDSDSL--RH
Q9XCF6_MYCAV/601-939---------------------------------------------TLSD-KMIDLVRDLDHMDRLMPLLLEQYPEM--IA
Q9Z577_STRCO/40-368---------------------------------------------DYGI-PGTGSDRASRLLESRFPDLGGDSDT.--..

PF00873

CZCA_RALME/5-1037IISFAIQQRWLVLLAVFGMAGLGIFSYNRLPIDAVPDITNVQVQVNTSA-PGYSPLETEQRATYPIEVVMAGLPGL--EQ
MEXB_PSEAE/1-1028MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYPAIAPPAIAVQVSY-PGASAETVQDTVVQVIEQQMNGIDNL--RY
HELA_LEGPN/5-1035IIRFSLKHRWFVLLFTLVIAILGVYNFQRLPIDAVPDITNVQVQINTQA-SGYSPFEVEQRITFPIELAMSGLPSL--DY
MDTB_ECOLI/12-1023PSRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLY-PGASPDVMTSAVTAPLERQFGQMSGL--KQ
ACRF_ECOLI/1-1029MANFFIRRPIFAWVLAIILMMAGALAILQLPVAQYPTIAPPAVSVSANY-PGADAQTVQDTVTQVIEQNMNGIDNL--MY
P74461_SYNY3/10-1047LSGLAIRRHIATLMLTLAIIVLGVFAVFSLPVDLLPSITYPRIGVRLDA-PGVSPEVAVDEITRPLEAALSATEGV--VQ
O25622_HELPY/6-1014IIEFSLRQRVIVIVGAILILFFGTYSFINTPVDAFPDISPTQVKIILKL-PGSSPEEMENNIVRPLELELLGLKGQ--KS
MDTF_ECOLI/1-1028MANYFIDRPVFAWVLAIIMMLAGGLAIMNLPVAQYPQIAPPTITVSATY-PGADAQTVEDSVTQVIEQNMNGLDGL--MY
SRPB_PSEPU/1-1028MSRFFIDRPIFAWVLAIVAMLAGALSLAKMPISQYPNIAAPAVSIQVSY-PGASAQTVQDTVVQVIEQQLSGLDGF--RY
P95422_PSEAI/3-1040FSQFFIQRPIFAAVLSLLILIGGAISLFQLPISEYPEVVPPTVVVRANF-PGANPKVIGETVASPLEQAITGVENM--LY
Q55935_SYNY3/9-1024ILKTSIAQRWFIVIAAIGITLWGIISVGQMPLDVFPEFAPPQVDIHTEA-PGLAPEEVETQITVPIESAVNGLPGV--TT
ACRB_ECOLI/1-1030MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTISASY-PGADAKTVQDTVTQVIEQNMNGIDNL--MY
MDTC_ECOLI/3-1009FFALFIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIIVSASL-PGASPETMASSVATPLERSLGRIAGV--SE
ACRD_ECOLI/1-1027MANFFIDRPIFAWVLAILLCLTGTLAIFSLPVEQYPDLAPPNVRVTANY-PGASAQTLENTVTQVIEQNMTGLDNL--MY
P73998_SYNY3/2-1028FVDFFIKRPVFSSVCAIIILLVGTISIFSLPIAQFPEVAPTTIQVSSNY-SGANAEVVERAVTDILERQINGVQGM--RY
O25328_HELPY/1-1011MYKTAINRPITTLMFALAIVFFGTMGFKKLSVALFPKIDLPTVVVTTTY-PGASAEIIESKVTDKIEEAVMGIDGI--KK

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
O57717_PYRHO/107-288--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
Q9Z7Y9_CHLPN/1204-1397--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

P91129_CAEEL/47-858----------------------------NPLSDAVYLFTPLGAQ.SKME-RMSIHEKWPLTDNNYIPGRAVTQSRE..IQ
O16307_CAEEL/1-766----------------------------MDNLLRRDYLDGVD...SLAE-YLQYNFTVPCS.G..VRGENKLECSF..SD
O44978_CAEEL/31-791----------------------------VLSSGLVHIRLEPDIRKAFSP-DDSDAGYETRVWLEYYGLDIYPERAF..CI
Q18129_CAEEL/47-926----------------------------QTTNDPQYVFSPANAP.WRYE-RAVLTEHWPLDEEKFWPGKSYDLHGY..VD
O61894_CAEEL/44-830----------------------------IFSFGILNMRTEDDLR.FLYS-PEHSLSREEYQVHKDFSGDSKNNSFV..SI
Q21883_CAEEL/44-838----------------------------FCSSKICFTKQEDDIKTGYTP-VGARSLDEIEVFSDFFASTGDPIAVF..LF
O16530_CAEEL/48-891----------------------------VLSLKIPFTRMQNDIS.DFTP-FGARSRVELEKYRKFFNNHGEPKAIY..AF
Q19945_CAEEL/49-901----------------------------LRVDDPSYVFTPSDAR.WRRE-ISVFNENWPLDENKFLPGKSFEAKRFVNIL
Q09938_CAEEL/52-945----------------------------LTLLDARKLYTPVSAP.SWKE-EQVFSELWPVKSYEFLPERTFQWNRY..LY

PF03323

SP5AF_BACSU/18-482-------------------------------------------NEEYFK.NRVGMGTSYDVGVRKL..............
GERAA_BACSU/13-470-------------------------------------------NLALVL.PKLK..ENDDLVKNKKML............
GERBA_BACSU/10-475-------------------------------------------NLDTLK.KTLG..QNDDMMFYTFAF............
Q2BAU7_9BACI/26-482-------------------------------------------SADHVR.KKME..GSDDFKERII..............
A9VUH9_BACWK/42-501-------------------------------------------NIADIQ.NIFR..QAPDLVIRRFQI............
Q3EV24_BACTI/19-484-------------------------------------------SIPEFI.QTMK..ESSDFVSYNV..............
A9VG15_BACWK/27-487-------------------------------------------LKNTLA.NIFD..ISADLIEHPLQL............
A5N0Y0_CLOK5/6-473-------------------------------------------KINSIL.ESCG..NSQQVIVRRFSI............
Q2RIQ3_MOOTA/17-482-------------------------------------------NNNWIM.KELGVGQSFDVIRRDI..............
Q63G10_BACCZ/23-479-------------------------------------------NINYIE.NKLC..HSDDIKKLDL..............
Q24YB3_DESHY/34-509-------------------------------------------NLQSLQ.QIFE..RCGDITFREFKI............
Q24V55_DESHY/18-483-------------------------------------------NLDYLN.RELGVPDNFDIVLREM..............
A5D162_PELTS/61-534-------------------------------------------NLRQIK.SVLS..KSSDVIYREFLF............
A6TLM7_ALKMQ/35-505-------------------------------------------NTTYLE.NRFK..DCSDITFRELRIN...........
A7FX43_CLOB1/8-474-------------------------------------------KIQPIL.DKLN..APDKFNVKKINL............
Q5KX57_GEOKA/17-481-------------------------------------------NASYLA.ERLGVGKSFDVIRLDV..............
B0KBH4_THEP3/30-504-------------------------------------------NLDYIK.NKLK..DCDDVIYRDIWV............
A4XN57_CALS8/19-490-------------------------------------------NLENVK.SEFG..NFSDLIIREFKI............
Q2RIG8_MOOTA/33-500-------------------------------------------NIAYIK.KAFG..RSEDLVIREIEL............
A4IND7_GEOTN/44-514-------------------------------------------NIDIIR.RATG..ESDDVVIRRFSL............
A7GH93_CLOBL/5-469-------------------------------------------FYNTIK.ERFK..NNFDTVFREV..............
A4J0K1_DESRM/54-524-------------------------------------------NLNHIN.NLLG..HNADYVQRKFVL............
Q5KZI4_GEOKA/26-506-------------------------------------------SEETLR.TLYE..KCHDVMIKEAGMPSP.........
A8FDZ9_BACP2/13-474-------------------------------------------DPNSVF.EALS..RSSDFTNELS..............
Q6HGW4_BACHK/14-474-------------------------------------------SLQELM.QLLK..KSKDFITLEI..............
A7VGE7_9CLOT/28-516-------------------------------------------NISRVK.SLFA..DWGDIVERRFTVRRTGMDVYAEDT
Q3EQU5_BACTI/209-667-------------------------------------------SLQDLI.EKLK..KSSDFINYHT..............
A3DD73_CLOTH/89-565-------------------------------------------NVEYLK.KRFSIPINGDVVLREFDIV...........
A7Z9E6_BACA2/10-475-------------------------------------------NLEVLK.KRFG..QSDDMMFYSFTY............
A4J5A4_DESRM/139-610-------------------------------------------NKKRIE.EIYGLPDNKDFIIREFTI............
A9KKP5_CLOPH/10-482-------------------------------------------NSATIK.EMFN..NSTDILVRPIHI............
A4XI75_CALS8/39-508-------------------------------------------NLKYIK.ELLV..DNDDIVYREFYC............
A4IQH7_GEOTN/19-483-------------------------------------------NAKFLQ.NRIGVGTSFDLGVRKI..............
Q4MKT0_BACCE/35-495-------------------------------------------NLKHLS.KLFS..GIPELITRTFPL............
A6LS87_CLOB8/10-467-------------------------------------------NIDLIH.SNLVVDKSFDIVERNF..............
A8FI46_BACP2/20-474-------------------------------------------KIRILK.KTFQ..QSGDFEYREL..............
Q5WGG7_BACSK/24-483-------------------------------------------TLEELL.DLCR..RSNDFHSFK...............
Q24NX7_DESHY/41-512-------------------------------------------NLEEIK.TILG..SSYDIAFREFDF............
A8ML63_ALKOO/33-512-------------------------------------------YQQNLE.EIFE..QCSDITYTPVKLN...........
Q9KCW3_BACHD/24-484-------------------------------------------TLADVI.QVYS..QSSDFTQFTM..............
Q0TRQ3_CLOP1/10-472-------------------------------------------NINTLS.KALRVGKSFDIIERSI..............
Q46191_CLOPA/46-510-------------------------------------------NEQYLK.SIFN..NCYDLTIRKISL............
A7GLD7_BACCN/11-477-------------------------------------------ITNSIR.ETLQ..SPNDLTVREFAL............
Q0AZ96_SYNWW/17-482-------------------------------------------NLDIMK.QELAEGENFDLIVREV..............
GERKA_BACSU/43-510-------------------------------------------NIAETK.KEVG..SSSDVIIREIKI............
A7FPG5_CLOB1/16-498-------------------------------------------NIKYIK.ELLE..GNSDMVFREFLI............
Q9KDW1_BACHD/38-516-------------------------------------------NLQQVK.NIFT..HCEDLVVLHWRY............
Q9KCZ6_BACHD/17-481-------------------------------------------NITYLK.KALGVEENFDIVHLEL..............
A3F901_BACME/37-507-------------------------------------------NLNIIK.QKTG..NSSDVVIRHLKM............
A5N3L1_CLOK5/16-477-------------------------------------------NISYLK.ELFK..DNSDIVFREFYI............
Q93N70_BACCE/14-480-------------------------------------------VMKEIR.DELG..SPNDLTIREVAL............
Q819C2_BACCR/18-482-------------------------------------------NENYLK.QTVGLGVTYDVGIRKF..............
Q24ZQ1_DESHY/10-463-------------------------------------------DIDKIS.TRLS.....GISARVV..............
Q0AXQ1_SYNWW/39-511-------------------------------------------NLKILR.EALG..SSNDVIIREIKI............
A8ML34_ALKOO/31-507-------------------------------------------NLDRIK.SILE..DCGDVIYREFVI............
Q97E19_CLOAB/26-494-------------------------------------------NKHTIE.TLFT..NCSDLTIREFKI............
Q892K0_CLOTE/36-502-------------------------------------------NIELFKNNIFP..GDNTIIYRQFKN............
A4IND1_GEOTN/26-499-------------------------------------------SEEALQ.MMYA..KCSDVIMTETVVPSL.........
A7Z684_BACA2/18-482-------------------------------------------NEQFFK.DRVGMGTSYDVGVRKV..............
Q9KBD9_BACHD/30-499-------------------------------------------NISTFR.QIIA..DSNDVGFRRFMV............
A7Z8M3_BACA2/13-470-------------------------------------------NLALVL.PHVE..QNDDLVQNKKML............
A6CHR9_9BACI/26-486-------------------------------------------LKEEIK.DSLK..QSADLAFHEI..............
A6TT32_ALKMQ/17-481-------------------------------------------NINYLL.KELRVDENFDIIHRQL..............
A5ZSN8_9FIRM/29-498-------------------------------------------NEIYIR.KQCE..NCADILVRPMRL............
Q4MUS4_BACCE/8-477-------------------------------------------NESILR.IWFEGCKDVKIMNRKWCA............
Q3ENA6_BACTI/39-514-------------------------------------------NLELIK.QQIG..HNSDVRFRKFNI............
B8I3H6_CLOCE/91-562-------------------------------------------NIQYIK.HKFNFPSNKDIIIRELTV............
Q65NF5_BACLD/51-522-------------------------------------------NLSLIK.EMTG..NSSDIVIRKLKT............
Q65F49_BACLD/13-468-------------------------------------------NLAMLL.PHLE..HNDDLIQNKKML............
A5N8W4_CLOK5/22-488-------------------------------------------NVKKVN.SFFSYPVNKDYLVKDICI............
Q8ESY2_OCEIH/19-476-------------------------------------------SIENIK.SQLN..HTSDLKDREI..............
A6TMS2_ALKMQ/40-511-------------------------------------------IRRHIE.KIGH..ETGGVIIKPFVI............
Q8EQ08_OCEIH/15-479-------------------------------------------NVTFLK.NYLGVEKSFDLIYLDL..............
Q5WH93_BACSK/15-478-------------------------------------------GLAFLK.KELAVEDNFDLICLEM..............
B8CZP3_HALOH/37-511-------------------------------------------NEKTIE.DIIG..FSDDVNFREFKL............
Q893N7_CLOTE/18-487-------------------------------------------TIDNLK.NILM..KSDDVLLREISI............
A6TT22_ALKMQ/49-524-------------------------------------------NIQIIE.SYLG..DSDDIKFRYLQI............
Q65HC9_BACLD/14-478-------------------------------------------NVEYLN.EKLGVDKSFDMIRLDV..............
Q2B5W1_9BACI/16-480-------------------------------------------NTAYLK.EALGVDKSFDVIQLNV..............
B0KC44_THEP3/27-499-------------------------------------------NIYIFQ.VLLK..GNNDIVFRQISI............
Q4V1V8_BACCZ/38-502-------------------------------------------NLKVLR.SMYK..DCFDVIFRTFWI............
A7AZA3_RUMGN/16-452-------------------------------------------NISYMD.RTLPVGKSFDLIKRTI..............
Q251Y5_DESHY/41-516-------------------------------------------SFARIK.EELS..KSSDIIFRDFIL............
A8FES2_BACP2/15-479-------------------------------------------NEDYFK.ENVGMGLSFDLGVRKI..............
A6TKM3_ALKMQ/37-510-------------------------------------------NRENLE.KAFE..NCDDLTYRTVKLQ...........
Q8XMP0_CLOPE/4-456-------------------------------------------QLDFLK.DKLK..DSFDVKYREV..............
Q2B6T1_9BACI/17-479-------------------------------------------EYKDWE.ESLV..KSEDYKKTFYYN............
Q5WL81_BACSK/9-469-------------------------------------------CAAAIK.SAFY..QSNSVQTLEI..............
A0Q243_CLONN/7-473-------------------------------------------IVNNVI.ERLG..IESQVVVKDIII............
Q2RJR1_MOOTA/46-519-------------------------------------------NLKILQ.EIFS..DCQDVVYRRMKI............
Q5L1C3_GEOKA/18-484-------------------------------------------NLSQLW.EKLR..QSSDFVEVSF..............
A8FI34_BACP2/12-479-------------------------------------------VIKRVK.SFAG..KSDDIVFHSFSF............
A3I5M3_9BACI/12-475-------------------------------------------AEDFLK.DQFGDGESFDVGIKHL..............
Q2B7X0_9BACI/28-484-------------------------------------------SIETLK.DLISNMDDGELIEHRI..............
B8I6L1_CLOCE/74-548-------------------------------------------NKSIMK.KIYNIPENSDIVYREFNIT...........
A1HTP0_9FIRM/14-479-------------------------------------------NINYLK.ELLGVGESFDVIFREY..............
A6BKH4_9FIRM/23-460-------------------------------------------NVAYMN.ETLPIQESFDLIQRDL..............
A3I5C1_9BACI/4-466-------------------------------------------NKDFFY.KEFD..HQSDITVSSK..FY..........
Q8EQ79_OCEIH/19-483-------------------------------------------NFNYLK.TKLGIKTSFDIGYREL..............
A6CSI7_9BACI/30-499-------------------------------------------NTAKLR.ETFNHPVNQDLAVRPFTI............
Q0B0R9_SYNWW/31-504-------------------------------------------NREKLK.TLLT..GCSDVVMRDFML............
A6CTR1_9BACI/19-481-------------------------------------------TQETFE.KLAR..KSTDYKEIFYYN............
A7Z1B0_BACA2/45-511-------------------------------------------NMKKLS.ERFG..NSADVVIRRLKI............
Q67LK9_SYMTH/66-540-------------------------------------------NVNHFK.ELFRHPRNKDLIVREITI............
Q2B1X4_9BACI/27-487-------------------------------------------LQNELS.RELN..ESPDLHVRML..............
B8G2F0_DESHD/16-479-------------------------------------------NRRRFI.NSFK..NSVDLLFRELRF............
A3I8R7_9BACI/8-460-------------------------------------------LVAKLK.KEIN..DVDDVKLNMI..............
Q9KCM6_BACHD/19-483-------------------------------------------NEECLK.ERLGMDVSFDVGIRKL..............
A9KJY3_CLOPH/12-470-------------------------------------------NMNYFN.QLFKVDKSFDILCRTF..............
A3IGD6_9BACI/11-474-------------------------------------------DLNTIK.KLFQ..KSADIQFQEY..............
Q8CUL1_OCEIH/19-480-------------------------------------------ELKKLLDKQYA..HSSDLSFTVY..............
A3DH40_CLOTH/24-495-------------------------------------------KITVLK.NYMS..NSKDIKDRRFKV............
Q8ESE5_OCEIH/39-505-------------------------------------------NLQNIK.QSIG..NPDDLNLRNIKV............
A1HTL4_9FIRM/126-599-------------------------------------------NEKILR.ALYSLPENKDLILRKFEI............
A8MKB7_ALKOO/16-482-------------------------------------------NIEMIK.EIFD..HDATLVSRLFQN............
A1BZL1_BACCE/26-497-------------------------------------------NEEKIR.STYQNSEDVKVVLHKIGS............
A5N512_CLOK5/37-508-------------------------------------------NLNILH.SLFS..NCTDIVCREFVI............
A6CMX7_9BACI/18-482-------------------------------------------LEKLMI.ETTGLNTSFDLGVRKL..............
A3I672_9BACI/39-510-------------------------------------------NIKTIK.NSIG..NSNDIIIREFLI............
A4J3J2_DESRM/20-485-------------------------------------------NIAYLN.TVMGHGKSFDIVLRRF..............
YFKQ_BACSU/29-493-------------------------------------------NLENLT.LLTE..GCSDIVFRQFDF............
A5D2Z0_PELTS/16-481-------------------------------------------NLRQLD.AAMGIKKNFDVLTREM..............
Q5WB92_BACSK/19-481-------------------------------------------TLAEVL.QAAK..QSSDFVEQVE..............
A8MJ63_ALKOO/11-465-------------------------------------------WLDYIK.KNLA..NNDTVIYREI..............
A1BYZ6_BACCE/12-473-------------------------------------------NYEKIK.YILN..ESPDLMCRTL..............
Q65HV1_BACLD/18-482-------------------------------------------NEAYFK.KRVGMGESFDLGVRKV..............
Q9KCH4_BACHD/17-476-------------------------------------------TVADVL.SQCK..QSNDYTEFLN..............
Q97TS7_CLOAB/39-510-------------------------------------------NLNTLK.GIIG..TSSDTIYREFSF............
Q5WC86_BACSK/7-466-------------------------------------------IKNKLT.AAVH..GTDDLVFREF..............
Q2B691_9BACI/19-483-------------------------------------------NEDFMK.ERIGLGVSFDLGVRKL..............
A7VTU7_9CLOT/37-502-------------------------------------------NLDFFR.DKFD..GSADLTIREM..............
Q3AF85_CARHZ/43-510-------------------------------------------DVGEIK.KILG..NPSDLLIREFSY............
A0Q328_CLONN/19-481-------------------------------------------NIEYIK.NLLE..NNSDIIYRQFKF............
A6TWV3_ALKMQ/29-505-------------------------------------------NLETIK.GFLK..DCDDVVYREFTI............
Q9KBJ3_BACHD/39-513-------------------------------------------NKKKIK.ELLG..NSSDLVIRELMI............
A3IF45_9BACI/60-532-------------------------------------------DVERIK.KEIG..HNWDAHFREFHI............
YNDD_BACSU/37-512-------------------------------------------DLEHVK.RKIG..HNGDVHFRELEI............
A4J7W6_DESRM/38-504-------------------------------------------DEQVIF.QGLS..GSSDIIRRRILI............
B8CVZ6_HALOH/19-483-------------------------------------------NLKTLK.NELGADESFDVLTREF..............
A6NQ51_9FIRM/26-495-------------------------------------------TVDTLR.RVFA..DCVDFAVREADL............
Q67NW6_SYMTH/72-542-------------------------------------------AEALMD.LYFG..HSQDLTVRHISL............
A8FH96_BACP2/13-470-------------------------------------------NLSVIL.PQLK..EMDDLVHEKKTL............
Q5WKA9_BACSK/40-504-------------------------------------------TIDFIL.TTTG..HSEDILVRPFSF............
Q2RGV1_MOOTA/61-532-------------------------------------------NLEQLQ.NIFA..KCSDVVRRDFYL............
A7VPD1_9CLOT/10-465-------------------------------------------TIAMLK.KRLRAEESFDLIYRTM..............
Q65IP8_BACLD/41-515-------------------------------------------DLKLAK.TAME..NNSDVHFREFNL............
Q2B3G2_9BACI/54-521-------------------------------------------LKEELS.CRFG..ASADLKIEELKA............
Q67MK2_SYMTH/57-527-------------------------------------------NREMVR.TLMG..YSSDLLERSLYL............
Q899A1_CLOTE/18-484-------------------------------------------NLKYLK.EIFK..DNSDMIFREFYM............
A1HRT4_9FIRM/73-539-------------------------------------------NEQLLR.VVFR..DCDDIKYRSF..............
A3IC08_9BACI/26-497-------------------------------------------NIKVIQ.NTLG..HSNDIIIREITI............
Q5WH20_BACSK/17-481-------------------------------------------NEAILK.QRLGLDQSFDVGVRKL..............

PF12349

SCAP_XENLA/306-459--------------------------------------------------------------------------------
A0MJA4_CANFA/661-815--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A2I5E0_LEUER/44-198--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5BXT3_VITVI/26-176--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A6SQG9_BOTFB/216-369--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
O16307_CAEEL/208-359--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q1MT74_DANRE/45-196--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q23E28_TETTS/595-746--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
Q4T749_TETNG/568-722--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/217-369--------------------------------------------------------------------------------
Q7YU59_DROME/651-805--------------------------------------------------------------------------------

PF03176

MMPL8_MYCTU/74-402VVL.SDAKGLGA.ADERSYKELVDALRRD--TRDVVMLQDF......................VT...............
MMPL8_MYCTU/676-1049VNKGVNDLADGSRQLAEGVQLLVDQVKKM--GFGLGEASAFLLAMKDTATTPAMAGFYIPPELLSYATGESVKAETMPSE
MMPL4_MYCTU/59-388VII.EGNQPLGD.AAHKYYDGLVAQLRAD--KKHVQSVQDL......................WG...............
MMPL5_MYCTU/63-393IVL.EGQRPLGD.AAHAFYDQMIGRLQAD--TTHVQSLQDF......................WG...............
MMPL5_MYCTU/612-950TMKSMKAQMLSMHSTQEGLQDQMAAMQED--SAAMGEAFD.........ASRNDDSFYLPPEVFD...............
MMPLB_STRCO/48-383VVRGKGTDAAKSATQSVAAITSALSGTSR--PDHVVSVVST......................VT...............
MMPL4_MYCLE/57-385IVL.EGDKPLGD.DAHRFYDGLIRKLRAD--.KHVQSVQDF......................WG...............
MMPL7_MYCTU/74-391LVV.EGGSTLEP.QDQPYYDAAVGALRAD--TRHVGSVLDW......................WS...............
MMPLA_MYCTU/29-358VLL.TDEKGLGA.ADENVYHTLVDRLRND--AKDVVMLQDF......................LT...............
MMPL1_MYCTU/52-381VLL.EGQEKLGD.EAHRFYDVLVTKLSQD--TTHVQHIENF......................WG...............
MMPL1_MYCTU/600-941TMQTVKDLAQTLTSAFSGLVTQMEDMTRN--ATVMGRTFD.........AANNDDSFYLPPEAFQ...............
MMPL9_MYCTU/58-387VVL.ESDQPLGE.KAHRYYDHLVDTLVLD--QSHIQHIQDF......................WR...............
MMPL9_MYCTU/606-944TMKTMRTMMLTMRSTISGVQDQMADMQDH--ATAMGQAFD.........TAKSGDSFYLPPEAFD...............
YDFJ_BACSU/44-362IFGAGDGEKLTGKPAKKAIEDTFKEISKD--DS.VDSIASP.......................................
YDGH_BACSU/39-360VVF.TLDNAIKK.ETENQLRIIIDKIKKI--DGVEEVTSPL......................SA...............
MMPL6_MYCTU/28-366SQQINRELALANYATMSGIYAQTAALIEN--AAAMGQAFD.........AAKNDDSFYLPPEAFD...............
MMPL2_MYCTU/54-382IVL.EGDQPLGG.DAHRFYSDLMRKLSAD--TRHVAHIQDF......................WG...............
MMPL2_MYCTU/601-939AMTTMRDMMLIWHGTLGAFYKQQERNNKD--PGAMGRVFD.........AAQIDDSFYLPQSAFE...............
MMPLA_MYCLE/55-391VLL.TDDKGLGP.ADETVYRTLVDRLRND--TKDVVVLQDF......................LS...............
Q50086_MYCLE/31-369SMESMRTIMLTMHSTMSGIFDQMNELSDN--ANTMGKAFD.........TAKNDDSFYLPPEVFK...............
MMPLC_MYCTU/55-384VLL.TNENGLGP.ADEAVYRKLIENLRAD--TQDKISVQDF......................LA...............
MMPLC_MYCTU/658-1001MQQGANALADGSAALAAGVQELVDQVKKM--GSGLNEAADFLLGIKRDADKPSMAGFNIPPQIFS...............
MMPLA_STRCO/46-370VYDRPSGITA...ADEAKARADATHFADG--TGVVGEPYGP.......................................
MMPLA_STRCO/397-682I............AKGASADQVHAALETV--PGVIEVAPPQ.......................................
Q9RKC1_STRCO/44-379VFKAPAGETMTDAGNKATVEKTVDEL.AD--GSEVASVADP.......................................
Q9RL63_STRCO/44-395VLVAPDGRQVTASEYRAAIDTLVAEV.AD--GPQVAAVSDP.......................................
MMPLD_STRCO/50-373VWTADGDGDAAVTAHQQAATRSVAGLEGD--PGIVGPASPA.......................................
Q9XB10_MYCBO/43-376LVL.ERNGVLND.QDRAYYDALVVALRRD--SRHVIEVVDW......................WG...............
Q9XB10_MYCBO/595-943ALDGIGGQLAQVRESAAGVQELLNNV..G--AAPLRELPDYLRELAAVSQSAPGVDLYAARRILT...............
Q9XCF5_MYCAV/55-384ILL.EGQQQLGD.DAHTYYDRLIRLLEND--HKHVQHVQNF......................WG...............
Q9XCF5_MYCAV/604-943TMSSMRTMMLTMHSTMSGVMGQMDSSAKD--PSAMGQAFD.........ASRNDDSFYLPPGIIN...............
Q9XCF6_MYCAV/51-382ACCSEGHHQLGRLTAHAYYDKLVRELRND--TKHVEHVQDL......................WG...............
Q9XCF6_MYCAV/601-939MSEDMRNMLLTNHSTMSGIIGQMDSNSKD--ATAMGEAFD.........ASKNDDSFYLPPDIFE...............
Q9Z577_STRCO/40-368IVWHTTSGTVRAADVEQAMTRTLDRI.AD--LPGVAAVSNP.......................................

PF00873

CZCA_RALME/5-1037TRSLS.RYGLSQVTVIFKDGTDVYFARQL--VNQRIQEAKDNLPEGV..VPAMGPISTGLGEIYLWTVEAEEGARKADGT
MEXB_PSEAE/1-1028ISSESNSDGSMTITVTFEQGTDPDIAQVQ--VQNKLQLATPLLPQEV.QRQGIRVTKAVKNFLMVVGVVST.......DG
HELA_LEGPN/5-1035TRSLS.RYGLSQVTVVFKDGTNIYFARQL--INERLQEVKDKLPPGV..ETTLGPISTGLGEIFMYTVTNKP..NVPISQ
MDTB_ECOLI/12-1023MSSQS.SGGASVITLQFQLTLPLDVAEQE--VQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTST.........
ACRF_ECOLI/1-1029MSSTSDSAGSVTITLTFQSGTDPDIAQVQ--VQNKLQLATPLLPQEV.QQQGISVEKSSSSYLMVAGFVSD.......NP
P74461_SYNY3/10-1047VYSQT.REGQISLDLFFEPGGNIDQALND--ATATFNRARNQLPDDL.ETPRLFKFDPSQLPVYEFAVTSP.........
O25622_HELPY/6-1014LRSVS.KYSISDITIDFDDSVDIYLARNI--VNERLSSVMKDLPVGV..EGGMAPIVTPLSDIFMFTIDGN.........
MDTF_ECOLI/1-1028MSSTSDAAGNASITLTFETGTSPDIAQVQ--VQNKLQLAMPSLPEAV.QQQGISVDKSSSNILMVAAFISD.......NG
SRPB_PSEPU/1-1028MSAESASDGSMTIIVTFEQGTDPDIAQVQ--VQNKLQLATPRLPEEV.QRQGLRVVKYQMNFFLVMSLVDR.......SG
P95422_PSEAI/3-1040MSSQSTSDGKLTLTITFALGTDLDNAQVQ--VQNRVTRTEPKLPEEV.TRLGITVDKASPDLTMVVHLTSP.......DN
Q55935_SYNY3/9-1024VRSSS.KVGLSMVSVVFDQDADVYKARQT--VTERLQQVTNQLPEGS.HPPEISPLVSPLGTIVQYAFTIK......DGG
ACRB_ECOLI/1-1030MSSNSDSTGTVQITLTFESGTDADIAQVQ--VQNKLQLAMPLLPQEV.QQQGVSVEKSSSSFLMVVGVINT.......DG
MDTC_ECOLI/3-1009MTSSS.SLGSTRIILQFDFDRDINGAARD--VQAAINAAQSLLPSGMPSRPTYRKANPSDAPIMILTLTSD.........
ACRD_ECOLI/1-1027MSSQSSGTGQASVTLSFKAGTDPDEAVQQ--VQNQLQSAMRKLPQAV.QNQGVTVRKTGDTNILTIAFVST.......DG
P73998_SYNY3/2-1028ISSTSSNDGTSSITVTFDRSQNKDIAAVD--VQNRVALAEPQLPEAV.RRTGIRVNKESNALLLGIGITSP.......DG
O25328_HELPY/1-1011VTSTS.SKNVSIVVIEFELEKPNEEALND--VVNKISSVRFD.DSNI.KKPSINKFDTDSQAIISLFVSSS.........

PF02355

SECF_METTH/102-285-----------VSEA.LRGTAT....INS--YKAVGPVLSK---------------------------------------
SECF_BORBU/108-297-----------TILDKLKETFDANIEVLD--SYFIDSSFSS---------------------------------------
SECDF_BACSU/540-729-----------KVKTYFKDKYG...SDPN--VSTVSPTVGK---------------------------------------
O57717_PYRHO/107-288-----------KVQNFLKEKFP..GVEPQ--VTFIGPTFGK---------------------------------------
SECF_STRCO/109-305-----------IKEDLSKNLDV.SAEKIN--ADLVGPSWGD---------------------------------------
SECF_HAEIN/120-308-----------HVKSMLQNVDK.DIQIRS--IEFVGPNVGE---------------------------------------
SECF_ECOLI/114-302-----------VLKVINESTNQ.NAAVKR--IEFVGPSVGA---------------------------------------
SECF_SYNY3/108-301-----------VQKALNEGIGKFDPETIQ--IDTVGPTVGK---------------------------------------
SECF_RICPR/110-299-----------IIKTSLRNNFPYNFEYRK--VDFVGPQVGR---------------------------------------
SECF_HELPY/106-293-----------IVANILKPSG..DFEIRK--FDTVGPRVGS---------------------------------------
SECF_RHOCB/123-311-----------KVETALTAVDP.ALKITS--FESVGPKVSG---------------------------------------
Q9Z7Y9_CHLPN/1204-1397-----------ETGLDFSTETL.NETQNF--WSKVSSKLSK---------------------------------------
SECF_METJA/88-276-----------QKIKEFFHVDSLDKLNYS--EKTIGATLSS---------------------------------------
SECF_TREPA/222-411-----------VYAALVRAYGADHVVRLA--MDFVGSRFSH---------------------------------------
Q9ZBS8_STRCO/569-757-----------TVTKAVAELGG.ETEKVR--DELIGPSLGE---------------------------------------
SECF_RHOS4/117-305-----------QVEEALKTVDP.SITFPS--VESVGPKVSG---------------------------------------
O84454_CHLTR/1200-1393-----------DSGSSTTSMVF.DASRGS--WFKVSGQLSN---------------------------------------
SECF_MYCLE/183-379-----------AFGPKGADAKP.SKQAIS--DAAVSETWGG---------------------------------------
SECF_AQUAE/92-279-----------KLEDVLKKFG..KYELIR--KETISGVVSE---------------------------------------

PF02460

P91129_CAEEL/47-858VTALARND.....SNILDPKFANAVYQLD--KYIQTRV.......................RVLHNG....HYYSYKNLC
O16307_CAEEL/1-766LCSGQCND.........NQKYLNKLRSNN--EKNLQ.........................VIPLFN......LIYRNAS
O44978_CAEEL/31-791FTAKRENS......SILQEGALADIYTVD--NRLSAAV.......................GYQDGD......G..RKNC
Q18129_CAEEL/47-926VIASGRIHPDYGRPNILNIRYLDEVARIN--DYIIHNL.......................TVPVDINGKHYDIAYTDLC
O61894_CAEEL/44-830TIQTSSED.....KNLLKKDLAQKLIQLN--KYVLEKM.......................EIQVDG...KIINFGKEVC
Q21883_CAEEL/44-838ITAKDNSS.......MADYNTMKEVVDIM--DYVGSN.........................LTHKG......ESFYTLC
O16530_CAEEL/48-891ITSKVGDN.......MLGISQLNDTVHVL--DTISRDF.......................YLKTSQ....GPKNFEEYC
Q19945_CAEEL/49-901IRAKDGGS.......IMRDNVLHEIEILN--QWIMNNI.......................SIPTDD..LKFNLTYQDLC
Q09938_CAEEL/52-945LVVHGRPYENGTYPNILEGSYLNDIAKIE--EELVTNVSFPREAALEDNPALMRKRHLNETEIEENRN...ITITFKDVC

PF03323

SP5AF_BACSU/18-482......TILDKE.IQLYYLNGLCDTAYII...HLMREL.................VAINNRKEDPDELVDIV..ENR...
GERAA_BACSU/13-470.......ANGLV.FYYLYFSEMTDENKVS...EAIKTLI......................KDEETLTLDQV..KKR...
GERBA_BACSU/10-475......GDSRQK.ACLLYIDGLTENKMLA..QYVISPL...................QKEALAHKECSIEDL..SAF...
Q2BAU7_9BACI/26-482......EAEGRT.LYLFFLSSMVDDARLE..ERIIKPLSL..........................SAGNLI..EKQ...
A9VUH9_BACWK/42-501......KADGLE.AGLVYLSGLTDKELIQ..NHVLSPLMN......................SDFDTNTELP........
Q3EV24_BACTI/19-484.......LEDET.LCLFYYKSVVEALIIK..QFILTPL........................KKESEQIQNI..SDLCNI
A9VG15_BACWK/27-487.......KTNTN.ILLYYFEGLTDGVALK..GNVVTPLL.......................QEVNEDSQIF..NSN...
A5N0Y0_CLOK5/6-473.....GKDTPLD.AALIYKDGLVNQDIIN..RDILNPLMH...............KVNEDLSKAQSINQEIC..NKY...
Q2RIQ3_MOOTA/17-482......TIAGRR.ATMFYINGMAREDVLV...YILTSL.................SKLKREDVTPDAYTKIL..NQY...
Q63G10_BACCZ/23-479......PFQNGK.GTILYIESLADPNLIH..QLALEPLLTRSD.........LSL...................DKA...
Q24YB3_DESHY/34-509.....NAGESID.AALIYFQEITDAKKIS..EYMLGPIMMHE..........TSGAADDGQPVAEKIVDFVR..NHL...
Q24V55_DESHY/18-483......TIGGKK.IAIYSVNGMVDTQVVS...IILEAL.................VELERADLVVNTLQTLV..KGR...
A5D162_PELTS/61-534.....AQNEQIR.LALIYVDGLTDKSQVS..EQIMRALVLEA...........PMAVPEQEITRARALSIIK..QRV...
A6TLM7_ALKMQ/35-505....AGSSKSGL.MLLVFTDGLIDSTLVN..ESIIKPI.................NFANGLKKSSDINVALL..QDI...
A7FX43_CLOB1/8-474.....GKGNNIK.VALVYDKDLIDRNIIS..DYILKPLML...............HVEESFTGKENITEILM..EKY...
Q5KX57_GEOKA/17-481......EYGGRA.MALFMIDGFVKDDILH...YLMRYL.................SRLEEHELDVHPLEKLL..KKY...
B0KBH4_THEP3/30-504.....GENQQYN.LAIVFIDGLVDKDLIN..DHVLHSLLLDS...........RQAAPSIEKIKGNLYEVIK..KGT...
A4XN57_CALS8/19-490.....GPKKDIR.AFLVMVDELVDKLVIN..EHILKPLMKD............TYLYQNQQYTPQDLYKFIK..DCI...
Q2RIG8_MOOTA/33-500........PGRK.LALVYVETLIDRDVVQ..RDILRSLLA...............LQTIPLPEDEAGFNRLL..RAR...
A4IND7_GEOTN/44-514.....GQEKQMK.AAVVFVDGLVDEKNVY..EFLLTPLLT...............ASFPLALEEKERLQWIE..QKL...
A7GH93_CLOBL/5-469......SCKQGT.LHLIFISNLCDSSFIS..EYIIYPLI....................KNKDYTYNIKNIK..ERM...
A4J0K1_DESRM/54-524.....GHDQTLE.AAIIFLDSMIDPALLG..GEIMKPLL................EPRLKDSSGSEMLKLLT.NGGL...
Q5KZI4_GEOKA/26-506...PPDESASVVRLLFLYCEELCDAQMLQ..KAVYPML.................RDMCKQCSCRSTAEINM..HKP...
A8FDZ9_BACP2/13-474......RSEGFL.YRISFFRSLINGHLLH..EQILPFMK......................ELQLTPTLEEL..KER...
Q6HGW4_BACHK/14-474......ASNNSS.IVISYFRTLIDVNIFH..EEVLTYI.......................KEKNFDSLQDI..QSV...
A7VGE7_9CLOT/28-516IGSADETSSSVGAIYVVYIDGLCDNGLIE..DTIIKPVTW..............EWRHEHGSSLWEAMDSFE........
Q3EQU5_BACTI/209-667.....SDDETMP.YWISYYRPSLDGEKLQ..KYLMPTLL.......................EKPCASLEQL..KEH...
A3DD73_CLOTH/89-565.....IKDRKIP.ACLIFYDGMVNGMLIN..LNILQPLMLL............SNLDVKGKNGEKDIAEYIH..KSL...
A7Z9E6_BACA2/10-475......GNGKCD.ACLIYIDGLTDNQLLA..EYIISPVQA...................AARHQEEPAEIPP..SSI...
A4J5A4_DESRM/139-610.....ALAPPVQ.AFALFLEGMSEKAIIN..QNILQPMML...............FSNFHEEVEGYLLDHVK..KRV...
A9KKP5_CLOPH/10-482.....KSDYNLT.LTVFCVDGLVNSQVFD..LTIIKPLAT...............EEGAKQCPTQAALFEYFYNNGG...
A4XI75_CALS8/39-508........MNVK.CATVFVDGLVSREIID..RDVIKHLMIE.............TSLMDEDISQINAYEKIL..NHI...
A4IQH7_GEOTN/19-483......HVLNRE.VHIYYCNGLCDTQYII...ELLKQI.................VRVNDDERQAAQARQII..ENR...
Q4MKT0_BACCE/35-495.......KNGQE.AALIYMEGLVDKTVIN..VNILRPLLF.......................KEWNEDDFW..EAC...
A6LS87_CLOB8/10-467......IVGGRS.SVLYFLNGFIKDAIME...EILKSFF................KITPETMNSYKTIDDFI..NNK...
A8FI46_BACP2/20-474......MVNETK.SVLFFIKTRVDEGKLN..DFIIGNLLGPP...........GK...................QDY...
Q5WGG7_BACSK/24-483......QADDNP.FEIYYFSSIVKSNVIH..EQILPVL.......................ANKQLKTLVGV..KEA...
Q24NX7_DESHY/41-512.....GPQGRIR.GTLVFLISMIDKTFLN..ESIIKPLMFD............DRLIEKEEEPELLNIDYIK..TTM...
A8ML63_ALKOO/33-512.....VGKEMIE.GLLIYSNVLVNLDVIN..KNIIHPINSYESERLSHGPQEPSLIYDKDHTPSKGNIRSLEIFAEI...
Q9KCW3_BACHD/24-484......DAIQLR.YHLFYLRTLVDPTTLQ..QDILTHL.......................IKSKALTLHEL..KRE...
Q0TRQ3_CLOP1/10-472......IIGDKK.ATMYYIDGFVKDDVME...LIMSDFF................SLSKTEMNLIKSPKDFM..RRQ...
Q46191_CLOPA/46-510.....YNENKGK.IAIAYLNEFTTEKLIN..DSIINKFPL.......................NLSAQNDIE..ESIKYT
A7GLD7_BACCN/11-477......SGSSTR.CAVVFLCGITDKDLIY..RFVIHPLQH..............E....EIPPKGPIMQTLV..DRF...
Q0AZ96_SYNWW/17-482......RVGGRK.AAFICLDGFVKDDIMT...ECMKSL.................LALKKEVFLSSTVKSIL..EKG...
GERKA_BACSU/43-510.....GEQDHVH.LAVIYISGLVDNNTIH..ESLIDPLVQ..............D....ESIQNTHAIQQIL..EKT...
A7FPG5_CLOB1/16-498........GDKK.AFIMYIDGMADKDLLN..DYVLESLMLESEKLGNISDIKNRISNKRYESNDKCNVNDIK..NKI...
Q9KDW1_BACHD/38-516.....GPEMAHT.AFSVYFDSLVQRKMVNYMKASLQDLVPH.............EVGPGEEVTPDDIISHFE..QNI...
Q9KCZ6_BACHD/17-481......FHAGKQ.MALFVVDGFAKDFAIT...QIQREL.................VTLELGDLDHDPVETLM..KSV...
A3F901_BACME/37-507.....GSNSNIR.VAIVYLEGIVDNQSIQ..EFLLESMMK..............D.NEKEKVNEHNALELIS..EDM...
A5N3L1_CLOK5/16-477........GDVK.CALVYIDGMADKILLS...DLLRGLM....................TRARYVQHAEGIK..DKL...
Q93N70_BACCE/14-480......AGSFTR.CAVVFLCGLTDKDNVY..KYVVRTLQY..............E....EVQNEAAVVQTLL..DRF...
Q819C2_BACCR/18-482......QILNKE.IGVLFVNGLCDTNYII...PILEEA.................VDTNEIRDVEEDTVKLL..ENR...
Q24ZQ1_DESHY/10-463......PCTGGDAITVLFIRQLTDRALLS..ECILKPLI..................ARAAAGKTPPAEELL..DRV...
Q0AXQ1_SYNWW/39-511.....SPHSNVD.AAVIYIDGLVDRNLLN..HDILQPLMFNL...........QMIKDNASHNHTSLIDYIK..SSV...
A8ML34_ALKOO/31-507.....GEGKGCK.AALVYIDGLVKTDVLN..DYVLENLMVES...........RMAPPNKKINREELSDTIK..EKT...
Q97E19_CLOAB/26-494.....ANNRNFS.AMIVYINNLIQSDVIE..SSVIKKLI................EEDYNNHPHLNIFEYTK...SI...
Q892K0_CLOTE/36-502......KNSQLK.FCVIFIDGMVNTEIIN..ENILPQLMNT.............T....VNSKSKNLINCIK..EEV...
A4IND1_GEOTN/26-499...LSDGSSKTVHLLFIYCEELCDVQMLQ..KTIYPMF.................RKICEQHSCFSHADIET..CKP...
A7Z684_BACA2/18-482......RVLDRE.VQIYFVNGLTDTLFII...HLMEQL.................VDVNNYDENADEAIDVV..ENR...
Q9KBD9_BACHD/30-499.......AQTVP.AALFYIKGLTKVETIE..REVLTPLLRC.............PKETLERTPSSEWVNLLS..QDV...
A7Z8M3_BACA2/13-470.......PNGLV.FYYMYLSEMNDEDKIK...EAIETLLQ..............E.......EDTLTLDTVT..KR....
A6CHR9_9BACI/26-486......NTDGHQ.ILIIYLENIINTDQLH..QHIIKPLE......................RTTDELNPKAI..ANT...
A6TT32_ALKMQ/17-481......EYANRK.FGLFFVDGFANENVMV...MIMREL.................EHLAPNDIYKDAVDKLV..KRF...
A5ZSN8_9FIRM/29-498.....GEDRKVD.CLMVYIEVTVSNMMLD..DSAIGKMINH.............F....WKIPPEKIQEFLK..NNS...
Q4MUS4_BACCE/8-477......DTTKTT.ILLVYCQHVIDHTKLK..QAIAPEMCT...................DLLQSSFKDSNLLASNSQ...
Q3ENA6_BACTI/39-514......GRTDIQ.AGIVFVDGLSDKEIID..KHIMKLLMDDFS.........DEYKNETSYVEGTVSKEYIK..NKV...
B8I3H6_CLOCE/91-562.......AKKYK.AFIAYIDGMVDRITIN..NFILRALMVN.............DDKFQEDSDDECKLDFIM..SNI...
Q65NF5_BACLD/51-522.....GAGEKIE.IAVVYVGGITDEKAIH..DFLLESIMN..............SEELAEKEYGREVLETIA..GDA...
Q65F49_BACLD/13-468.......KNGII.FYFLYFKDLNDDKKIQ...KAAKLLVS..............D.......DSSYSLEDVR..LR....
A5N8W4_CLOK5/22-488......QCLNRK.ATILCMNTIVDKEKIE..NHIILPLMY.................TKLEDSHGDIGTILM..EKV...
Q8ESY2_OCEIH/19-476......HSNNQI.YIILYINSLVDQEKLE..SKIIKPLTKM............EN...................NNILNE
A6TMS2_ALKMQ/40-511......HHNHTE.ALMVYIDGMADTASVE..FHVLRPLMSK............KIKESAGEKVDEDISSNLL..KEI...
Q8EQ08_OCEIH/15-479......NYAGKD.MAMFMVDGFAKDDISL...YIMQTL.................AELKEHELDEDTLTKLL..KRY...
Q5WH93_BACSK/15-478......RHANKR.MALFLVDGFAKDIALT...QIQREL.................SHTTEEELQ.DRYDALL..QSR...
B8CZP3_HALOH/37-511.....GKKLKIK.ATLIYIDSLVDKKTIN..ESILEPLFTEE...........FFSDNVENLTTDDIVKFVR..DNT...
Q893N7_CLOTE/18-487.......NKKLK.GTLFFIDGLVDSKSIS..EYIIEPLTQ..............MPRFTESKTEIEVINLIR..EGA...
A6TT22_ALKMQ/49-524.....PTLPSIR.AVVVFIETLVDDSILE..SSVLTPLTQGL...........GERTVEERTYLSSHIDDLI..EST...
Q65HC9_BACLD/14-478......VYADRD.MSLYLVDGFVKDDIMH...HLLKNL.................SRLTPENLEDDPLEKLI..KTH...
Q2B5W1_9BACI/16-480......EYAERE.MALYLVDGFVKDDILH...YLMKLL.................SSLDKEQLEGDTLAKLV..KTY...
B0KC44_THEP3/27-499......GDKKVK.AFLVYVDGMVDKLLIT..RNILEPIMIE............TRKLNKIIYTNDQLFNYIN..EYF...
Q4V1V8_BACCZ/38-502.......GGQAK.ATLIYVEGLSNVEEID..NYVLTPLMS...................ETEEIAHSLHEML..EKK...
A7AZA3_RUMGN/16-452......EIGERK.AVLYFIDGFVKDEAML...KLMDSF..................MGVTKEAMPKEAEMFS..QRH...
Q251Y5_DESHY/41-516.....RGKEDIP.CSLGMVDGLVDKDLLD..AYILRVIMVEA...........VDDPVFQEMTLKNVNDRLL..DLF...
A8FES2_BACP2/15-479......YIHDQE.IQLYYVNGLCDTQYVI...YLLKEL.................VEINDNEPESDDMARVI..ENR...
A6TKM3_ALKMQ/37-510.....DHEKTIE.VLLIYLNNLVDLKDIN..QNIIKPLNS...............YDASNNVQSRDEKININTIEEI...
Q8XMP0_CLOPE/4-456......DTALGP.ATIVFMDVLCSTQFIS..EYIVKPLT....................LVKDGIKDENDIM..TKV...
Q2B6T1_9BACI/17-479......QKTGLR.FGFSFMSTLVDESILQ..EGVLPYL.......................QGEEFTRIEDV..KKI...
Q5WL81_BACSK/9-469......PILETDQALVLFIQEIVDQNKLH..ALIVDPLTR...............FRLAKQSYPTESVTTWL..KDG...
A0Q243_CLONN/7-473.....GKTKKIP.AYVIYVDGEADKNLIN..KTVLNPLML...............EVNEELELEENLPDYLC..KRY...
Q2RJR1_MOOTA/46-519.....GGTGGLA.ALLVYVDGLVDNEIID..TQIVKSLLLE............AHQATPAFTPDGKFFYQVR..DSL...
Q5L1C3_GEOKA/18-484......VVGGKE.LSIYYFDSLVDPQVLQ..ERIFCHLQN...................DIPQHPNVRLEDL..QQI...
A8FI34_BACP2/12-479......GPSAIS.ACLMYVEGLTEFEMLS..KQIISPMQK...................ELDITEVDPNTLPALSKT...
A3I5M3_9BACI/12-475......FVKDLP.VLCAYISGLVDGEALT...QLLSSM.................LPDEDYEIDVEDEKEYF..ESY...
Q2B7X0_9BACI/28-484.......NRDRK.VTIIYISTLIDQERLN..ESIIQPIKN..........................CPEEMI..HTC...
B8I6L1_CLOCE/74-548.....VKDKSFQ.AFIVFIDGMTNSSIIS..DNILQPLMI..............LSNLDIKEEAKDVGEFIF..NRL...
A1HTP0_9FIRM/14-479......KFGRRR.GASFSINAMVNDVVMA...DVLEHM.................MAQGQEELSMNILQKLF..YSR...
A6BKH4_9FIRM/23-460......LIGGRV.SSFYFVNGFTSEETML...KIMDAL..................LKVKEEEMPEDVWEFA..NAC...
A3I5C1_9BACI/4-466....MLNNEKHE.VIFIYCHSLIDSVLFL..NSLLPNI.....................RFLAEQGNLYDVEIINRY...
Q8EQ79_OCEIH/19-483......IILKQR.IHIYYVTGLCDTSVIQ...EMLKKL.................VEINDVETNKRMLPEII..ENR...
A6CSI7_9BACI/30-499......SVFNRK.AVLFFMNGMSQRQVIE..KELIPNLI................SPFPNKNTEDKLNLDFF..SNC...
Q0B0R9_SYNWW/31-504.....ASHSPIP.GLLLYFDGLVDKEQVA..LHLLQPLLTE............QGGDSSENLSPDEMLKRVQ..YRI...
A6CTR1_9BACI/19-481......QHTNLR.FGLNFLSTLVDEDILQ..KDVLPSL.......................LGKHFEKLDDI..KKL...
A7Z1B0_BACA2/45-511.....GK.EELP.AAIVYIAGLVDEQLVS..QSLLEDLID..............I....PSVQPEQAVCLIY..DKT...
Q67LK9_SYMTH/66-540.....ATVPPIR.AALLFMEGISDKQIIN..GYILEPLMLL............GHELRLSPQPGPAAVDLVE..QRL...
Q2B1X4_9BACI/27-487......RKEEQK.IAVIFIKSLTDPLILD..ERILLPLQ......................KAKGPLDPEDI..SNL...
B8G2F0_DESHD/16-479.......GKTNK.GFLVYLDGLVDRQYMS..SSIIRPLMA..............C....QGSEPILSMDILQ..KDV...
A3I8R7_9BACI/8-460......ATEEGD.VTLIYFSSLIEKMTLQ..TMVSIPLT...................................NNINQI
Q9KCM6_BACHD/19-483......PVFDRE.IQLYYVNGLVDTQNII...ELLKEL.................MDLDARNRKITDVKKAV..KNH...
A9KJY3_CLOPH/12-470......QTGGRL.ACLYFINGFVDDTSLQ...RMLLKL...................ETEIEEFPKNAKEYA..EIN...
A3IGD6_9BACI/11-474......SFNEQK.VQFITCDAMIDQQMLN..GVIIQ.......................RTQYLYDHLDDVSFEENIARH
Q8CUL1_OCEIH/19-480......EHEEQQ.IAVFYIQFSVDDIKLQ..NFLLETLL......................ETKEKLTNRLA..LKR...
A3DH40_CLOTH/24-495......GGKNVN.TAILFIDNLVDEFMVQ..DHVIKPIMTN.............SFEWPQDTGPDAMLEIIK..DYM...
Q8ESE5_OCEIH/39-505......GKMNTN.CGIAYISGITDETLIN..NNIIQNLQQ..............N....LKDVEVDLIENIK..LEV...
A1HTL4_9FIRM/126-599.....PAHKPIK.AMLAFLDGMVDKKVIT..LSILQPLLL...............LPDTAALNACDAENIIRALNEH...
A8MKB7_ALKOO/16-482.....QNNTCLK.CGIVFIDGMVNDGHIN..EDIIKPILTN.............A....VVKNKADLFDQLQ..YEI...
A1BZL1_BACCE/26-497......EEKAVE.TFFIYCESLVDKKQIN..QIVIPQL.................EKIAQKHQYLFLKEEIHKYQQE...
A5N512_CLOK5/37-508......DAIKRS.SALVFINGLADVKLIN..ENILTSIMNI.............KEIPSEDLALNHIIEITK..KHF...
A6CMX7_9BACI/18-482......KILKKD.VHFYYVNGLCDTQFIM...RIVEDL.................VEVNDHERLSSKLYEIV..QNR...
A3I672_9BACI/39-510.....GKPIEVP.IAIIYTDGLADNTSIT..DFILESIIS..............DFEVTSDTPLQEIVDRLK..TYC...
A4J3J2_DESRM/20-485......NVAGKE.IAIYFVNGFVKDDVMS...LILRNL.................DELKRPEVSPGSLKKLF..NEH...
YFKQ_BACSU/29-493.......GNGLC.GFIVYIEGIVKSEHIQ..DHALRPFLM...............HLTDQIDEHEEAL......QNT...
A5D2Z0_PELTS/16-481......VIGGKK.TVLLFVDGLTNDQTVT...LVLQNL.................VALERAEMCPDSLKKLF..REH...
Q5WB92_BACSK/19-481.....ASKDREP.IHVYYYQSLIDMERIA..PNVLHPL.......................KQVDGISNKAL..QEA...
A8MJ63_ALKOO/11-465......EVNEGI.IHMVYDMSACDHKVIS..EFIILPVL....................TTNKSFSDIESVK..DKI...
A1BYZ6_BACCE/12-473......EVGGDC.LEVIFMKNLIKQEFLN..EYVIKYIQQ.....................LPIEYITYSYL..LKN...
Q65HV1_BACLD/18-482......FILGHE.VQLYYVNGLCDTQYII...HLLREL.................VHLNDKEKESGEVEDIV..ENR...
Q9KCH4_BACHD/17-476......HQKGFP.YILSYYETLIDADRLN..QDVTPYL........................KKEAKTLEEL..IED...
Q97TS7_CLOAB/39-510.....GSKMQIK.AALIFFKGLTEKKIIN..QTIMKPFMYD............DRIKSLEPDLSSGILKVVK..DGL...
Q5WC86_BACSK/7-466......TYQGLH.GFVLFLDSLVDEKWLE..NIIFKQL........................NQAAASKRSL..QEA...
Q2B691_9BACI/19-483......QILKKE.IQIYYVNGLCDTSFIT...QILEEL.................VEINDHEKLSSNVFNIV..KNR...
A7VTU7_9CLOT/37-502......EIEGTK.AAVITIEGMINKETLA..NAVINPIM................RTFYSQEDPAEKYEYIR..DNV...
Q3AF85_CARHZ/43-510........YGVA.AAAVMIDGLVDKMVVI..DGILKPLMV...............EAKIAREKPADPYKSLK..EEM...
A0Q328_CLONN/19-481........SHFK.TAIIYIDGMVDRDLLN..DYVLESFM....................EGNQKIEDFNDIK..DRI...
A6TWV3_ALKMQ/29-505.....GKENKHK.GAVIWIDGMVNKDLIN..NYIMESLMIDS...........RLVDPKPKAIKDNFIDLLK..NKT...
Q9KBJ3_BACHD/39-513.....IHEPEIS.GVAVFINGLADEQLVS..ECIVSATLHPS...........KEAHYFKEDTKDKRLSIIE..KQI...
A3IF45_9BACI/60-532......GNTDIR.AAIVFLEGLADKMQIE..EHILTSIMER............FSDTSASNLTEKGNLQNLM..KNN...
YNDD_BACSU/37-512......TQLHVK.AALIFVEGLSDQDLIN..KGLSVLVMNQPN.........QVSDEISQSGKGILTSKQIK..NQI...
A4J7W6_DESRM/38-504........GSTP.AVLIYIEGIIDNDVIH..KDVLNRLQ................RVKEIPSMTVGALDFIA..QKV...
B8CVZ6_HALOH/19-483......EIGDKE.AALIFIDGFIKDDLIL...PILYMM..................ETSREDISVDVIKKIL..KRR...
A6NQ51_9FIRM/26-495.....AGDPEKH.VTMCYIGGMVKLERAS..EYILRPLAQ...............DSTLRDAPPEEAWRKMA..GGA...
Q67NW6_SYMTH/72-542......EPGAVP.AMIVYLPTMVDEPRLD...QSLHSLLQP.............ASAAERPPAARDVVGWIR..HHQ...
A8FH96_BACP2/13-470.......PHGQV.VYYLYIKEMNKKMEIQ...TFLKLLLQ..............D.......HTSLTKEKLE..SN....
Q5WKA9_BACSK/40-504.....GRNQTLK.ATFIYVEGLCNEDAIE..KMISRAKFF..............D.......EKEPVFESAQ..QYL...
Q2RGV1_MOOTA/61-532.......GQAVK.VALFYIDGLADKKLIE..DTLVRTLQQA............PAELARSLAERTRDLTAVM..EMV...
A7VPD1_9CLOT/10-465......TIGGKG.ACLFFIDGLVKDEVME...KIMEFF...................YSAKPEDVTDAHSFV..KSS...
Q65IP8_BACLD/41-515......GRTGIR.AAIVFVEMLADQDLID..KHIMKSLMDDF..........SKEYKVELSSLSSNVTDLIK..KQI...
Q2B3G2_9BACI/54-521.....GA...AD.ALLFYLETMIDSNVLK..E.IIHSIAK..............EPGTDTKVKTIDDVKGYG..KEH...
Q67MK2_SYMTH/57-527......GANRVP.AALFCVDGLAERMQVM...TILESLAV...............QSHREAVPTDSVDGCLRTLQQM...
Q899A1_CLOTE/18-484........GEVK.SLIVYIDGMADKNLLN..DFVLENLM................DRDRSLKEEDFNKETLK..NKF...
A1HRT4_9FIRM/73-539......NAGQRQ.ALLVFLDGLTDLTLLE..KNVLETLMSP.............G....QGGQVHADPSALV..NQL...
A3IC08_9BACI/26-497.....GEAEPHR.LAIISIDGLSDKTMIS..DSVIDKLMA..............NIEEEQEIEITTINQYVR..SSY...
Q5WH20_BACSK/17-481......NIFNRE.VGIYYLTGLVDNLYII...EILREL.................MEVEGRLRRVEQPFVTI..KNH...

PF12349

SCAP_XENLA/306-459--------------------------------------------------------------------------------
A0MJA4_CANFA/661-815--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A2I5E0_LEUER/44-198--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5BXT3_VITVI/26-176--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A6SQG9_BOTFB/216-369--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
O16307_CAEEL/208-359--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q1MT74_DANRE/45-196--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q23E28_TETTS/595-746--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
Q4T749_TETNG/568-722--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/217-369--------------------------------------------------------------------------------
Q7YU59_DROME/651-805--------------------------------------------------------------------------------

PF03176

MMPL8_MYCTU/74-402........TP-P....LRELMTSK--------------------------------------------------------
MMPL8_MYCTU/676-1049YRDLLGGLNV-DQLKKVAAAFISP--------------------------------------------------------
MMPL4_MYCTU/59-388........DP-L....TAAGVQSN--------------------------------------------------------
MMPL5_MYCTU/63-393........DP-L....TATGAQSS--------------------------------------------------------
MMPL5_MYCTU/612-950........NP-D.FQRGLEQFLSP--------------------------------------------------------
MMPLB_STRCO/48-383........AP-D....AAAELVSQ--------------------------------------------------------
MMPL4_MYCLE/57-385........DP-L....TAPGAQSN--------------------------------------------------------
MMPL7_MYCTU/74-391........DP-V....TAPLGTSP--------------------------------------------------------
MMPLA_MYCTU/29-358........TP-P....LREVLGSK--------------------------------------------------------
MMPL1_MYCTU/52-381........DP-L....TAAGSQSA--------------------------------------------------------
MMPL1_MYCTU/600-941........NP-D.FQRGLKLFLSP--------------------------------------------------------
MMPL9_MYCTU/58-387........DP-L....TAAGAVSA--------------------------------------------------------
MMPL9_MYCTU/606-944........NA-E.FQQGMKLFLSP--------------------------------------------------------
YDFJ_BACSU/44-362..........-.....FVTGTIAK--------------------------------------------------------
YDGH_BACSU/39-360........EK-E....VKDQLMSK--------------------------------------------------------
MMPL6_MYCTU/28-366........NP-D.FQRGLKLFLSA--------------------------------------------------------
MMPL2_MYCTU/54-382........DP-L....TAAGSQSA--------------------------------------------------------
MMPL2_MYCTU/601-939........NP-D.FKRGLKMFLSP--------------------------------------------------------
MMPLA_MYCLE/55-391........TP-P....LHELLVSK--------------------------------------------------------
Q50086_MYCLE/31-369........NT-D.FKRAMKSFLSS--------------------------------------------------------
MMPLC_MYCTU/55-384........VP-E....MKELLASK--------------------------------------------------------
MMPLC_MYCTU/658-1001........RD-E.FKKGAQIFLSA--------------------------------------------------------
MMPLA_STRCO/46-370..........-.........VRSD--------------------------------------------------------
MMPLA_STRCO/397-682..........-...........VK--------------------------------------------------------
Q9RKC1_STRCO/44-379..........-.....YTGNAVSE--------------------------------------------------------
Q9RL63_STRCO/44-395..........-.....LDAATVSQ--------------------------------------------------------
MMPLD_STRCO/50-373..........-.........LPSD--------------------------------------------------------
Q9XB10_MYCBO/43-376........TP-A....IAEVARSD--------------------------------------------------------
Q9XB10_MYCBO/595-943........DP-N.MRAVLDYFVSP--------------------------------------------------------
Q9XCF5_MYCAV/55-384........DP-L....TRGAAQSQ--------------------------------------------------------
Q9XCF5_MYCAV/604-943........GS-DSFKRVEKVFMSP--------------------------------------------------------
Q9XCF6_MYCAV/51-382........DR-L....TQAGAQSP--------------------------------------------------------
Q9XCF6_MYCAV/601-939........NA-D.FKKAMSQFLSP--------------------------------------------------------
Q9Z577_STRCO/40-368..........-..YHDADSPLISE--------------------------------------------------------

PF00873

CZCA_RALME/5-1037AYTPTDLREI-QDWVVRPQLRNVPGVTEINTIGGFNKQYLVAPSLERLASYGLTLTDVVNALNKNNDNVGAGYI......
MEXB_PSEAE/1-1028SMTKEDLSNY-IVSNIQDPLSRTKGVGDFQVFG.SQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGQLGGLPAV
HELA_LEGPN/5-1035HYNPTELRTI-QDWIIKPQLRNVEGVAEVNTIGGYEKQFHITPDPSKLVRYRLSLNDVVEALERNNANVGAGYI......
MDTB_ECOLI/12-1023AMPMTQVEDM-VETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSL......
ACRF_ECOLI/1-1029GTTQDDISDY-VASNVKDTLSRLNGVGDVQLFG.AQYAMRIWLDADLLNKYKLTPVDVINQLKVQNDQIAAGQLGGTPAL
P74461_SYNY3/10-1047ELSGPSLRVF-AEEELARELGVVPGVASVNVSGAAQEEVRINVDLQRLQRSGVSLTQVLDALQSRNVDISGGRI......
O25622_HELPY/6-1014.ITEIEKRQL-LDFVIRPQLRMISGVADVNSIGGFSRAFVIVPDFNDMARLGVSISDLESAVRVNLRNSGAGRV......
MDTF_ECOLI/1-1028SLNQYDIADY-VASNIKDPLSRTAGVGSVQLFG.SEYAMRIWLDPQKLNKYNLVPSDVISQIKVQNNQISGGQLGGMPQA
SRPB_PSEPU/1-1028KLDNFDLGNL-IASQLQDPISRIPGVGDFQLFG.SPYAMRIWLDPGKLNSYQLTPTDVASAIREQNVQVSSGQLGGLPTR
P95422_PSEAI/3-1040RYDMLYLSNY-AVLNVKDELARLDGVGDVQLFGLGDYSLRVWLDPNKVASRNLTATDVVNAIREQNRQVAAGTLGAPPAP
Q55935_SYNY3/9-1024SSNLMDLRRL-LETTVGNQLLSVPGVSQVTLYGGDERQEQVLVDPAKLRALKVSLNEVTQASAEANSNAPGGFL......
ACRB_ECOLI/1-1030TMTQEDISDY-VAANMKDAISRTSGVGDVQLFG.SQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGTPPV
MDTC_ECOLI/3-1009TYSQGELYDF-ASTQLAPTISQIDGVGDVDVGGSSLPAVRVGLNPQALFNQGVSLDDVRTAVSNANVRKPQGAL......
ACRD_ECOLI/1-1027SMDKQDIADY-VASNIQDPLSRVNGVGDIDAYG.SQYSMRIWLDPAKLNSFQMTAKDVTDAIESQNAQIAVGQLGGTPSV
P73998_SYNY3/2-1028EYDNVFLSNY-ADRYLVDPIRRLEGVGDVRIFGERLYAMRLWVDPMKLAAQQLTMADLSRALQEQNLQVGAGQIGAEPAP
O25328_HELPY/1-1011SVPATTLNDY-AKNTIKPMLQKINGVGGVQLNGFRERQIRIYANPTLMNKYNLTYADLFSTLKAENVEIDGGRI......

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
O57717_PYRHO/107-288--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
Q9Z7Y9_CHLPN/1204-1397--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

P91129_CAEEL/47-858LQYKNGGCPS-NKHV.................HILSDLH-----------------------------------------
O16307_CAEEL/1-766SRL.....HP-N...........................-----------------------------------------
O44978_CAEEL/31-791DPLCDLNSPF-HLLAN.................LTRRNN-----------------------------------------
Q18129_CAEEL/47-926MRY.DWACYL-NDHITMLMPKTRWGNFSGPFAELASDII-----------------------------------------
O61894_CAEEL/44-830SRMKQCELSN-TIATIFLDT...........FWSEKLRK-----------------------------------------
Q21883_CAEEL/44-838TDFCQINEPV-RQYYNG.............LAMKQQNLS-----------------------------------------
O16530_CAEEL/48-891SGFCLLNEPV-KHFYSG...............MLISGQH-----------------------------------------
Q19945_CAEEL/49-901LSY.DWVCGA-NEHIQML...............LRRNDV-----------------------------------------
Q09938_CAEEL/52-945MNW.YGDCYR-EKNVI................ELLKRRH-----------------------------------------

PF03323

SP5AF_BACSU/18-482LLNAQVEKVK.TLDETTDQVLSGLVAVIV.EGAG..FAFIIDVRSYP..GRNPEEPDTEKVVRGARDGFVENIVVNTALL
GERAA_BACSU/13-470LDQLDARPVE.TAKKTIESILNGNCAVFI.NGLD..KAYILTTGKKK..TRSLTEPTTEKVVRGPKVAFVEDIDTNLALI
GERBA_BACSU/10-475FFGFHHSVVS.TMKEIEQLVFSGQAILLA.DGYR..GGLAFDTKSVA..TRSLDEPSSEVVERGPKIGFIEKLRTNTALL
Q2BAU7_9BACI/26-482AQTQEVQRTS.ILSDALKGILTGYCFAME.HDSS..EGVLLSAASSL..SREISDPANEHIIQGSHEGFIENIGKNLLLI
A9VUH9_BACWK/42-501IPLGQIKIIN.TWSQIENAIFGGDSVLLI.HTRT..TAHQLDTKGWP..QRNVEDAHNEIALKGAHQGFTEIRSQNIAMI
Q3EV24_BACTI/19-484VSIEDIITSP.SIDDIREKLLGGYILIRLKNNSNPDQYALIRAESTVLGTRLYNDTENEYSVIGPKIGFVENLDTNIHLL
A9VG15_BACWK/27-487IIATHTKIVY.TWNEIKEGLLEGQCVLFM.EGEK..RSLLINTKGWA..ERAIQEPISEVTIKGSHDGFIENATKNIGLI
A5N0Y0_CLOK5/6-473ISMSKIVIQT.DINMAIKDIRRGKTAVLV.HKED..TFIVADTQGTK..HRNISEPMDEIGIRGSKEGFIEDIEINLSLI
Q2RIQ3_MOOTA/17-482ISYLQVEALD.DLHKVVDKILSGGIVILI.DGFK..KVIQLDARNHP..VRNPQESDLERVVRGSRDNFVETLLFNVNLL
Q63G10_BACCZ/23-479FATLNMKKET.NLNYGVQLLLQGKSLYFH.EHVD..SFCIFETAISL..KRDIAEPDNEGIVRGPHTGFVEDLATNLTSI
Q24YB3_DESHY/34-509STAANVETAR.DIGELTKGILDSKVALLI.EGAP..AALLMDAHGER..ARSIAEPDSEPVVRGPKDGFVECLATNVMLL
Q24V55_DESHY/18-483IVGLQVSEVD.TMDKILYFILSGPMALFV.EGQE..KAIIIDARSFP..ARSPSEPDIERVTRGARDGFTETLAFNTALI
A5D162_PELTS/61-534LCIHQVMETD.KLQDVIHAILSGDTVLLV.DGHA..CALVSGARGWE..VRSITDPEAEPTVRGSRESFVETLRTNTSLI
A6TLM7_ALKMQ/35-505ILINSIRVTK.KLDEIIHSILSGDTVLFI.EGSD..EALLLDTRGGE..SRSIEESSVESVIRGSKEGFVENIRTNTAMI
A7FX43_CLOB1/8-474ICVDDTIIKT.DNEEITDFIKKGSTAIFV.PNSE..NTIIINTVKKN..YKSIIPPEIETSIRGPKEAFTEGIENNLSQI
Q5KX57_GEOKA/17-481LPYVEIGQTD.DLEEAVAMVLAGPTALVV.DGVE..RIILIDARTYP..VRGPQEPDTERVVRGARDGFVETIVFNTALI
B0KBH4_THEP3/30-504ITGGDIKQIT.DLDKCILSILSGDTALLF.EGSP..EIVIISSKGWQ..MRSISSPEAETVIRGPREGFTETIRVNTALV
A4XN57_CALS8/19-490LYSHCITEEF.DYAKTIHSILCGDVALFV.DGID..RALLVSVRGWE..SRGIEEPNTEVVVRGPREGFTENLRTNTALI
Q2RIG8_MOOTA/33-500LTIGDLQEEQ.LWSKIITGLLDGKAVLIG.EGFS..RCLLLSVEGWE..KRPVEEPVNEVSIRGPREGFAENLPTNISLI
A4IND7_GEOTN/44-514AAVGGVKHVA.DWKLLFCELFSGATVMMI.DGTS..FAICASTKGGQ..YRSIEEPQTQIAVRGPREGFTESLRTNTAMI
A7GH93_CLOBL/5-469LSASSVDEIT.DIDEAIMNILSGNVIIIS.DFFE..GIISVEAKGFS..KRSVSSPITESVIKGPREGFTESIMDNLSLI
A4J0K1_DESRM/54-524ISRAQMETFN.HFQGVVSNVLTGEVALFV.EGFA..HCFIISSKGYK..SRSIPEPHYENAVRGPREAFVENISINISLL
Q5KZI4_GEOKA/26-506VTLEYMGKEV.RIDDLNFRLFSGELLIYF.QEAD..ALYTMTLASPP..NRDPEEPNTEVSILGPKDGFVEDISKNVALI
A8FDZ9_BACP2/13-474IPIEQSVITT.DLKEVEKALHRGNMAIRLETDWG..KALLIPIEEKK..GRQVGPPEIEFGIISAQEAFVEVLDTNLNLV
Q6HGW4_BACHK/14-474LPFENSKITN.QMEDIQDSILNGYILIQF.DTDT.LNCLLVNVSKKE..KRDITKAEIEYNIVGPQIAFVEDLDVNLNLV
A7VGE7_9CLOT/28-516TQSADIKAEN.DFKNVMFSILKGDTAVFV.SDAD..QAFVVSSKKLP..VRGVEESSTEGGMRGPRDSFNESIRTSTALI
Q3EQU5_BACTI/209-667IPMSGITITN.DLQKIEDMVLKGHAIIQL.NQQD.QKCMLANIAIDN..YRAPTPPLNESTVIGPQEGFVEDIDTNINLV
A3DD73_CLOTH/89-565VTHNQVKVSH.EFDEIVGEINFGGCGVFI.DGID..VAYACDVKGWQ..HRGVDRPNNEIVIRGPQESFNEILRVNTALV
A7Z9E6_BACA2/10-475SFGYRHTRLS.SLKDAEADIFSGKSVLLA.EGWE..EALSFETETFK..MRDIEEPSSEVLERGPRIGFVEKLRTNTALL
A4J5A4_DESRM/139-610LTGNQVTAHE.RYEQIIGGVNFGSTAVFI.DGCD..QALVVETKGWE..HRGVGIALNESVVRGSQEGFGEILRTNTALI
A9KKP5_CLOPH/10-482TYHAFASEAS.DMDSLLTSVMSGMVALIF.DDLQ..KAILYDVRTFD..KRSVSEPAEEGVMKGAKDSFIEVLRTNTALI
A4XI75_CALS8/39-508LATADIKEVT.SFKSAILDLLCGETLLFV.DGSN..KIIRVSTRNFP..NRGIQQPITENAVRGPRDSFNEVVRFSTAVI
A4IQH7_GEOTN/19-483LVHQQVSPVT.SLDEAVDQLLSGLIIIFI.EGES..TGFAVDVRSYP..GRQPQEPDTEKVVRGARDGYVENIIVNTALT
Q4MKT0_BACCE/35-495VSIGNIKKIE.QWTDIEQSLLHGKSILFI.NGQL..SALELDTQAAP..KRSIEEPTTESSIKSSHEGFNEVASDSLALI
A6LS87_CLOB8/10-467VSHVSVKTET.DLDKILIALLSGQTIMYV.DGYD..SFILLDLRTYP..GSDSSKPEKEKTLRGGRDGFIEKLVFNAGFI
A8FI46_BACP2/20-474TKSLSTLETG.DLTLITDSIIAGSIAFLE.ENAS..QVKLFTVGQPP..LRSISEPSSESIIAGAHDGFVESLDTNLYLL
Q5WGG7_BACSK/24-483IRVEETKIEH.QLAKIEQALMRGEVLICL.QQAP.TEALLVPAEQAE..TRSINPPEVEFSVVGPKEAFVEPLSTNINLV
Q24NX7_DESHY/41-512LSMDEVHTAA.TINEVIENCLKGYAVLVI.SGLN..ESIVIRAYGGE..TRSLDEPKTETVVRGPRLGFTESLLTNTSLL
A8ML63_ALKOO/33-512ITTSNIKKID.HWSQVVQSILYGNTVLFT.NYCS..TALVLETKGKE..GRSIAESTVESAIRSPRDSFIEDIDTNIGLI
Q9KCW3_BACHD/24-484LPIDSIHIVQ.NDKELNTYLLTGHVCIHP.EYSD.FPCLCVPAQVEE..SREISIPEVEFSVVGPKEAFVESLDLNIYLV
Q0TRQ3_CLOP1/10-472IPYVEVAEEV.SIDKIVSQVLCGQTALIL.EGFS..SAIMIDLRTYP..VRGPQEPETEKVLRGSRDGFVETIVFNTALI
Q46191_CLOPA/46-510LAINDNNICE.NFAQCIDAILDGNVIIFS.DMLN..KAFIENIKSPP..ERSIEEPNIESTIRGPREGFTESMSKNIILL
A7GLD7_BACCN/11-477ISIGEINTVK.TFPDLVNSVLVGDTVVLI.DGIP..HALVINCRAWE..KRGLEPPITEDVIRGPKVGFVEDIATNKMLI
Q0AZ96_SYNWW/17-482VPYVELSTEN.KIDELLYSVLSGSVLFIL.DGSE..EAFIIDPRTYP..ARNPEEPDIERVVRGSRDGFTETIVFNTALL
GERKA_BACSU/43-510LPLGGVKAEK.SWDKLFSELMLGNALIFA.DGHD..EALICSTQGGE..QRSIQEPSTQVSFRGPRQGFTESLQTNISMI
A7FPG5_CLOB1/16-498LTVTDVSEKD.KLSKAIDLVLSGDTLLLI.EGMD..KAYVIATRLWP..VRGVGEPESETTIKGSRDGFTETIRFNTALV
Q9KDW1_BACHD/38-516ASAHSHRLVK.DFDDVIEKITNGHIVIFF.NQWD..KALAYKAISVE..TRQVDEPPTEPVIKGPREGTIENLDKNIGLI
Q9KCZ6_BACHD/17-481IPYVELSTAS.DLDQVVDEVLSGPAALVI.EGAE..KVILIDTREYP..VRGPEEPDTEKVIRGSRDGFVETIVMNVALI
A3F901_BACME/37-507MAVGNVTFIH.NWDDLFSALMVGDTLFLV.DGID..QALGAGTQGGE..KRSIAESTTQMVVRGPKGAFTESIGTNTAMV
A5N3L1_CLOK5/16-477ITISDVKELE.DFKKGIDLILSGDTLMVL.EGLK..SFYILSTRLWP..ARGVSEPSGETVLRGSRDGFTETIRFNTALI
Q93N70_BACCE/14-480ISIAEVGKKT.TFPDIINAILAGDTVILI.DNIQ..TAIIINSRAWE..KRSLEPPVTEDLIRGPRVGLNEDINVNKMLI
Q819C2_BACCR/18-482LIHQQVSKVK.TMDEVMLQVLSGLIVIFV.EGET..EAFAIDVRSYP..GRTPTEPDTEKVVRGARDGFVENIVVNTALI
Q24ZQ1_DESHY/10-463LYVDHCALDD.NPDAIDAYLLDGYTVLLG.PWGG..RYIVSDIKKIE..SKSIDSPELQYTLRGARDCFIENLDTNLSLI
Q0AXQ1_SYNWW/39-511LNVGQITVVQ.DIDRVIAQVLTGHIAILA.EGVS..RALLIDAKGWE..TRRIEEPKNELSVRGSKESFTETLRTNTALL
A8ML34_ALKOO/31-507LAVSEFKEVE.TIEEAVLNVLSGDTAFLL.DEYE..KMLIIATKGWS..SRGISQPETEAVVRGPRDGLVENLRVNTASI
Q97E19_CLOAB/26-494FAVNDKNVYK.SMDDVILSILKGSIALFL.DGES..KAIIISIGKPP..ERAITEPTVETVIRGPREGFTESLTTNVALL
Q892K0_CLOTE/36-502LIVNEVKESN.RLEDILSSLLMGKSILFI.DGFE..KVLILNTIQWE..KRSIEEPQGESVVKGPREGFNESLITNISLI
A4IND1_GEOTN/26-499PALEYMGHEV.RIDDLNLRLFSGDLLIYF.READ..ALYAMPLASPP..NRDPEEPNTEVSIRGPKDGFIEEINKNVALI
A7Z684_BACA2/18-482LVNQQVQKVK.TLDEATDQVLSGLVAVIV.EDAG..FAFIVDVRSYP..GRTPEEPDTEKVVRGARDGFIENIVINTALI
Q9KBD9_BACHD/30-499VTVTELSVHE.TYEQAIPSLLTGHSLIML.EGVD..KLITLSTKKIE..HRSIEEPESEVTIRGPRDGFIESLETNIALL
A7Z8M3_BACA2/13-470LDKIDARPVF.TSKEAVISILRGKCAVFI.NGLD..SVYILSTGKRE..KRSVNEPTSEKVVRGPKIAFIEDSDTNVAMI
A6CHR9_9BACI/26-486INIGKISFTN.HLIDVTEAILNGNAYIFA.EGQN..CGVLADIADKA..SRSLEKAETESLVFGPKVAFTEDLSTNMNVI
A6TT32_ALKMQ/17-481IPHIEVEKID.DLEESITQILSGQAVLII.EGCN..EGILIDIREYP..SRSPEEPDIERVVRGPRDGFVETLVFNVALI
A5ZSN8_9FIRM/29-498LGIADVQKLE.NMDEVFGAILSGNAVFFI.DGYN..KAMKISSKGYP..DMGVSEAESEKVLRGSREGFSDSVKTNSALV
Q4MUS4_BACCE/8-477FPVTTLELEN.SNENVSRMLFEGKLLIIF.QEYK..RGYIIDIAKLP..TRSIEQSNTEMTIRGSRDGFVEELSTNIGLI
Q3ENA6_BACTI/39-514LTISEVAEVH.YIKDLIPKVLIGSTALLI.DGLA..DVFILGTTKAN..KRNIEEPVSEALVRGPRVGFTEVLSDNTSLL
B8I3H6_CLOCE/91-562LQTNQAKKVD.SPDEFLYEILSGNTLLYV.NGCN..FYITNETKGYD..KRGVDKPLIEGVVLGSQEAFNENLRTNVTLI
Q65NF5_BACLD/51-522VALGGVEKEK.RLDKVLESLMAGNTIILA.EETA..EAVITTTKGGE..KRSIKEPENQQAFRGSREGFIEALDTNISLV
Q65F49_BACLD/13-468LNKLNAEPVT.AKKDAINAIFKGKCLLLI.NGLN..TVFALPTAEKK..KRSLGEVNTENVVRGPKVGFIEDVDTNVALV
A5N8W4_CLOK5/22-488LTVNIVSKVN.TYEDVIKGILDGDTVLFV.NGYN..EVLMIHTSKVQ..HRGVEKPTVENTLKGPQEAFTEWNEGNRSLI
Q8ESY2_OCEIH/19-476LYSQEISTAK.SNEIAINGLLDGYCLLIK.KSRN.SEGFLLKTNAST..DREVSEAIIEKTILGAKVGFVESLDKNIFLL
A6TMS2_ALKMQ/40-511ITAANSFTID.SMNVAMEYLFEGNALVFI.EDTS..QAIVIDAKGWA..IRPVEEPQTDTVIRGPREGFVEDLQTNIALL
Q8EQ08_OCEIH/15-479IPYIEIEPID.NIYQAADFVLAGATALFV.DGVD..KAIIIDSRTYP..ARSPEEPDLERVVRGPRDGFVETLVFNTALT
Q5WH93_BACSK/15-478IPYAEVETER.DLNQVVEQVLAGPAALLV.EGLD..YCLLIDTREYP..VRSPEEPDTEQVVRGSRDGLVETLVMNAALI
B8CZP3_HALOH/37-511MTINEVKVTE.KLEDTIEGILNGDSVLLV.DGYE..QVMVLNTKGWE..KRSVSEPVVESVIRGPRDGFTETLAVNTGLI
Q893N7_CLOTE/18-487LTYSSQTEKN.TLKDVINGILGGNAALLF.PGEN..IAFVFDVKGFD..KRNITEPTDENVIKGSRDVFVETLRVNTATV
A6TT22_ALKMQ/49-524LPNSNICFLQ.DVNEAVDELLSGNGIILI.QNYA..NVISITISQGA..AREYAEPQTEKVVKGPQQGFVEDIAANVSMI
Q65HC9_BACLD/14-478IPYIEIDTED.DLDKAADQVLSGPAVLLA.DGVD..HAIIIDARTYP..ARNPEEPDNERVVRGSRDGFVETIVFNTALT
Q2B5W1_9BACI/16-480IPYVEVETLD.DLDKVVDAVLSGPTALFA.DGVD..KAILIDARTYP..VRGPEEPDTERVVRGSRDGFVETLVFNTALT
B0KC44_THEP3/27-499ITTSEVNVKD.KIGDIIDDLLSGETILLI.DGVE..KALIISTKGWE..GRNITESTTESYVRGPKESFVETLRINTSML
Q4V1V8_BACCZ/38-502IHISKIKEVK.TFADCIENISIGNPVLLV.QQEM..SGLALGLPKWE..KRSIEEPEAESVVRGPREGFVETLGVNTALL
A7AZA3_RUMGN/16-452VPYIEVDVLK.DFDQVLRNVLSGVTCLFI.EGYA..ACIAIDTRTYP..ARSVEEPDKDKSLRGSRDGFVETIVFNTALM
Q251Y5_DESHY/41-516TPANEVKKIG.RLGEAIDGMLSGDAVLFI.KESQ..EALVISARGWS..DRGVGVPQNESSIRGPKEGFNETLRTNTSLL
A8FES2_BACP2/15-479LVNQQVSKVE.TLDEAVDQVLSGLVAVVV.EGEN..YAFIIDVRSYP..GRMPEEPDTEKVVRGARDGFVENIIVNTALI
A6TKM3_ALKMQ/37-510INTHDIQRIN.NMKYAMEGILSGDTLLLM.DHDV..DGLLLRTQGGE..IRSIEESDVESVIRGPRDSFIENVHVNIGLI
Q8XMP0_CLOPE/4-456IDINITNWSK.DKNDTLLHVLSGDVVIIF.DKFD..KVIYCETKGYT..RRGVGIPITEAVIKGPREGFNEAFVDNVTLL
Q2B6T1_9BACI/17-479IPIPDVSVSE.DPSDIEQKLFNGYVMVTI.ETEV.KHFAFVAAQKEV..VRSLTQPEVEFSVIGPKEAFVEAIDQNLNLI
Q5WL81_BACSK/9-469TPLPNA.....TVEQIKREMMNGQAVVLL.KNE...QPVLIDCAMWN..VRSVSVPLTSSVYEGPASALTESLDVNMNLL
A0Q243_CLONN/7-473IPSSDTKITT.DLDELSKSIRTGNTGIII.DYLK..SYIIVSSVGGQ..HRGISDSINEYSVKGTRESFVENIQTNISIM
Q2RJR1_MOOTA/46-519LTVANVREIA.NFREAAFCILSGFALLIL.EGSN..KGLALEVCGWE..HRGVEEPQNEAVIRGPRDGFSESFRTNTALL
Q5L1C3_GEOKA/18-484VPIQRIEVSE.DTALIEEKVLKGFVAVTF.REQP.NKAALMGAAAENLGLRENNDSENEFSVVGPKVGFVENVGVNLHLI
A8FI34_BACP2/12-479FFGIQNDVLE.DMNLAIEQLYSGRAILFV.DGAA..QALALQTNLFQ..FREVEEPQSEVLVRGPRIGFIENLEKNTALI
A3I5M3_9BACI/12-475FNFHGRSEET.ERKAYLLAILSGQVTFIT.K.SG..YCYVAELRNYP..GRSPEEPDNEKVIRGSRDGFTEGISQNTALV
Q2B7X0_9BACI/28-484LFTAKADSVT.GLDEAQKLLMQGH.VLLH.DTVG..NWLAVPLENPL..GSNVEQSESETILYGPKDSFTEQIDQNVTLL
B8I6L1_CLOCE/74-548IPFNQLKKAK.DFKEIVSNINFGGCTIFV.DGLE..YAYTADTKKWE..HRNVGQPNSETVIRGPQEAFNEQIRANTALL
A1HTP0_9FIRM/14-479LTHSQVKLVD.NMNDAITSVLSGEMLFFL.DGEG..QVMVVDARSYP..ARMPSESNIEKVTRGSRDSFVETLVFNTALI
A6BKH4_9FIRM/23-460IPYVEVEVLF.DFDQILKSLLSGETCVFI.DGYR..ACIVIDCRTYP..VRSVEEPDKDKSLRGSRDGFVETLVYNTAMM
A3I5C1_9BACI/4-466LEVQEIQEYRMKTDEINRKIFSGFLYFYH.VPSN..SLYSTNLAKLP..ERSIEESNMEVSLRGPRDGFVENIDTNFSLI
Q8EQ79_OCEIH/19-483LVHQQVESVK.TMDEAVDQVLSGLVAVFI.DGER..YAQIVDVRNYP..GRSPEEPDTEKVIRGSRDGYTENIIENTALT
A6CSI7_9BACI/30-499IPIQDIKEEC.NYENIISNILMGNSALFV.DGED..HAYLFGTAGFE..KRGVEKPEDEAVLKGPKEAFIESISVNISLI
Q0B0R9_SYNWW/31-504LSISEVKTLS.NIEELLHHISSGDTVLLI.DGCS..SGLVAGTRSWQ..SRGIQTPENEITIFGPKEGLSETLRFNTALL
A6CTR1_9BACI/19-481APVIDIQLSD.DESQIEQKLMNGYVLLKT.ENEK.ARFAFIAAQKEV..SRQVSQPEVEFSVVGPKEAFVESIDQNLNML
A7Z1B0_BACA2/45-511LAIGGVKEAE.KWKSLYAGLVAGSTLIFV.DGAD..KALIASTEGGE..HRSIQEPSTQVSFRGPRQGFTESLQTNISMI
Q67LK9_SYMTH/66-540LTGNQVSRHH.DVSSLAEAMLAGDTVILL.DGAA..VGLAVETKDPP..TRSVSDPKVEQVIWGPNDAFTEAWRVNVALV
Q2B1X4_9BACI/27-487LPIGELSSAN.LLKEISAALLNGNTYIYI.EGQP..FGSLAGTGKTA..ERSIEKAETESLVYGPKISFTESLESNVNII
B8G2F0_DESHD/16-479LCNSAIDIVQ.VFDQAVQGVLSGQTALFL.EGVE..EVLLLETFGGE..TRNVQQPETEATVRGPREGFVERIEVNASLL
A3I8R7_9BACI/8-460HQMAQYVDPK.DIQGVIKKLNSGQTLLFF.HETN..ALLSMDTYSAP..TRAITNTETESTVIGPQDAFTESLETNISLV
Q9KCM6_BACHD/19-483LTHYQVEETD.SMNEAVTQMLSGLIFILI.DGET..EAFVVDVRSYP..TRGPEEPDTERVVRGSRDGYTENIIINTALT
A9KJY3_CLOPH/12-470ISYIEIDILK.EEKAILKYLFSGISLIFI.DGFD..EVIAIDARTYP..ARGVEEPEKDKVLRGSRDGFVETIVYNTALI
A3IGD6_9BACI/11-474LHVPSLQKIQ.DKEQLISSVYSGFLLMYF.EQDH..LLYASNIAKKP..NRKPEETRMEVLIKGPRDNFIEDIRVNIALI
Q8CUL1_OCEIH/19-480IPLSDGREYD.DFEIILDYLIQGHVFIYF.ESEN..NILGYSIPNKI..IRNLETTETESLVLGPKVAFTESLTTNINII
A3DH40_CLOTH/24-495LYGDIVEEVC.TIEKMSLGVLDGETLLLV.EGSD..KGLLINTQNLP..KRSIQEPQTEPAVKGPNEGFVESFKDNLALI
Q8ESE5_OCEIH/39-505ISITSIEETE.NMDKIIDYILDGQTVFFI.DGEK..MALVIGSSGGK..ERSVEQPQSETLIHGPRDGFIENLEVNLSLI
A1HTL4_9FIRM/126-599LPNTEIKALT.EFAQIAEGINDGDTVLFL.DGAN..QALLLGSKGYA..SRSVSTPRIEQTVRGSQAAFTENLRTNTSLI
A8MKB7_ALKOO/16-482ISASNVSRTD.DVNKIIEEIVSGSTVLFL.ENAN..SALIIDTQQYE..TRSIEEPVSEKTLRGPREGFTENILTNISMV
A1BZL1_BACCE/26-497LEWTPLKVGE.GLESISLEIFNGNLVLYF.PKSL..TFFSVNASNKP..NRSTEQSNYEISVRGPRDNFIEDISTNVALI
A5N512_CLOK5/37-508FKIANTSEIS.TIGEVVYALLNGNTIFLL.DGDI..KALKMTTPGWK..EKNVSETNVEKVLRGSNEGFTENICTNISQL
A6CMX7_9BACI/18-482IPHQSVQPVT.TVEEMVDEVLSGLIAFVV.EGTQ..EALIVDVRSYP..GRQPQEPDTEKVVRGSRDGYVENIIVNTALT
A3I672_9BACI/39-510LTVGSIKNVS.DFPSLFNAILSGETVLLL.EGLA..IGISTSTKSSK..DRSITEPVTEAVIRGPRESFTETLRTNTALI
A4J3J2_DESRM/20-485INHIQVETVN.DLEKIIDQVLSGPLALLI.EGEE..QALIIDLRMYP..SRSPQEPDLEKVVRGPRDGFVETLLMNTLLI
YFKQ_BACSU/29-493LSISSVALET.SMSKVAASIIEGNAVLFA.DGHS..KGLILNIKGGQ..RRSIEEPITESTIRGSREGFTESLRVNTALV
A5D2Z0_PELTS/16-481IGYTEVNEVE.YLEDIVDKVLGGPMAILL.DGSE..KALILDARIYP..VRSPEEPDLERVIRGSRDGFVETLIFNTALI
Q5WB92_BACSK/19-481LYSAEVEQLE.DAMEIEKRLLKGSVLISF.KEKGAWQNWLVDLAYMK..GREMNVPEIEFSVFGSKESFIEAVETNLALL
A8MJ63_ALKOO/11-465LASSVILDVT.TKEDALDLILSGNVLILF.GFLN..KSVACYAANFP..TRPIDIPSTETVIKGPRAGFNESLADSVSSI
A1BYZ6_BACCE/12-473IPMNEVKKNL.KEQEIISSLLNGFAYIYL.SDES..KAFMVNCANPI..ERSIEKAETESLVYGPKISFTESLSSNIKII
Q65HV1_BACLD/18-482LLNQQVSKAE.TLDEAVDQVLSGLVAIIV.EDAG..FAFIIDVRSYP..GRTPEEPDTEKVVRGARDGLVENIIVNTALI
Q9KCH4_BACHD/17-476VPIQNKEISD.DPQQIKTKVMQGFVLLRK.KGEG.HEVALIEVTMDS..GREVQRPEVEFSVSGPQESFVEALQININLI
Q97TS7_CLOAB/39-510ISVGDVKESD.DINNLVSTCLSGNTIFLL.DGSN..KALIVDTQGWP..SRAIEEPKTDVVIRGPREGFSENLNSNMSLL
Q5WC86_BACSK/7-466LASASLEKKA.TVAECVPLLYKGQAAIVLYDQGP..SFFMVEAALSI..NRSIEEPTNERALQGTHEGFIESLLVNLHLI
Q2B691_9BACI/19-483IVNQSVQPIE.TMDELVDQVLSGLIVILV.EGET..TGLVVDVRSYP..GRTPEEPDTEKVVRGSRDGYVENIIVNTALT
A7VTU7_9CLOT/37-502LSSSEQVEVG.TFEQAFALVMSGFALLAI.DGCG..VVLAIGLQGFS..FRGVSEPTNEVMEKGSKEGFVEPLRINMTLI
Q3AF85_CARHZ/43-510LAIAEIKEVQ.TLDEFLLAVLSGEVGLLL.ENCS..VALLASAKGWA..SRSVTEPMNEVVVRGPQEGFTETIRVNTTLI
A0Q328_CLONN/19-481LTVSDLKEID.DLYEGISSILSGDTLLLV.DGFN..VACVISSRSWP..ARGIGEPSGETTIRGSRDGFSETIRFNTALV
A6TWV3_ALKMQ/29-505LAVSEIEEVD.TIEDVLVNIFSGETALLL.DDYE..KIIIIASRGWE..GRGISEPETEAVIRGPRDGFTETMRFNTALI
Q9KBJ3_BACHD/39-513LSVARVQAYD.LWNPIIHSLLSGNSIVLI.DGFD..KALSCSTPGSK..WRSIEEPSTETTVRGPKDAFNESLQTNLSLI
A3IF45_9BACI/60-532IPIGDVLEES.TMQGTISKVLTGYTALFV.DGMP..NALLLCTINGK..TRNIEEPISEAVVRGPRVGFTERLSDNTALL
YNDD_BACSU/37-512VSIGDVIDSE.KISDIVLNVFMGSTALLI.DGIP..QAFLLGTVKKQ..NRSIEEPLSEALVRGPRTGFTEELSTNTALL
A4J7W6_DESRM/38-504LSTSTVKKTT.LLANMLVEVLTGNAVLLI.EGNK..QVLIVEVKGGE..RRNITEPVTERTMRGSREGFIEDIAVNLALV
B8CVZ6_HALOH/19-483LPYYEVSTVK.TLDKIVQEVLAGPQVLLI.DGVD..EAIVIDGRTWL..SRSPDEPELEKATRGPADGFVETLLFNVNAV
A6NQ51_9FIRM/26-495LYNLMVEQRT.TADQAALDIINGNLILFF.PGAP..AVLSFYMATED..KRGVSAPDNEPSIKGARDAFVENLRSNTSLV
Q67NW6_SYMTH/72-542VSAPDTSEVV.QIRQAAFAVSEGMAVLFV.EGSG..CALAFDVTGGP..QRAISESKTQRVVRGPREGFIESIHVNLTLI
A8FH96_BACP2/13-470LSMMTTRSVK.TSEELVDAIFEGHCVVLI.NGFK..HAYILETNGTK..KRSLGDATSETVVRGPKIGFIEDLNTNLALV
Q5WKA9_BACSK/40-504EEVGHTETLN.CFRPLIDKLFIGYAICVI.DGFS..TPIAVAIPFYK..ERPVSEPMTEKVVRGSREGFVENVRTNISLL
Q2RGV1_MOOTA/61-532MPMTDVAVVD.NMGSLVKHVLNGDTVLIL.DGFN..KGLALSTRAWE..HRAVEEPITESVVRGPRESFIESLRTNTSLI
A7VPD1_9CLOT/10-465VPYIEVALSD.DEGLICTNILSGILVLVV.DGFD..KAISIDVRTYP..QRDSSEPDRDKVIVGSRDGFVETLVANTALI
Q65IP8_BACLD/41-515LSISGVSEVN.HVNEVVPEVLSGAAMLLI.DGSA..EVLLLGTVKRN..TRNIEEPVSESLVRGARVGFTETIGTNTALL
Q2B3G2_9BACI/54-521FGGSGYKLAE.TVSQMTDFMLSGSIILAF.KGVP..RAISIPVPTTE..SRSIAEPSTQTVVRGPKDGFVETLSVNVSLI
Q67MK2_SYMTH/57-527IPSVTLRSVT.SLGQALEALVTGDTILFV.DGMP..FALVLPTDGPP..GRQPDEPLTEPVVRGPKDGFTETLSDNLALI
Q899A1_CLOTE/18-484LTVSDLNEID.SLKKGIDSMLSGDTLMLV.NGLD..IAYVLSTRFWP..TRGVTEPSGETVLRGSRDGFTETIRFNTALV
A1HRT4_9FIRM/73-539LTSASLTVIS.QASEAIEAVMTGNALLLV.DGIA..EAFTIGTVKHV..KRSVEEAKSEGVVRGPQDAFNETLSDNIVLI
A3IC08_9BACI/26-497LTVGDVMNIE.NFTSLYYAILNGETVILL.DGFA..EGIVTSTKSAK..DRAVTEPSTESVIRGPRESFTETLRTNTALI
Q5WH20_BACSK/17-481LAHIQVEETE.SMDHAITQVLSGLIFVIV.DGEA..KALVADVRSYP..GRGPEEPDTERVVRGARDGYTENIIFNTGLT

PF12349

SCAP_XENLA/306-459--------------------------------------------------------------------------------
A0MJA4_CANFA/661-815--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A2I5E0_LEUER/44-198--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5BXT3_VITVI/26-176--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A6SQG9_BOTFB/216-369--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
O16307_CAEEL/208-359--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q1MT74_DANRE/45-196--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q23E28_TETTS/595-746--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
Q4T749_TETNG/568-722--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/217-369--------------------------------------------------------------------------------
Q7YU59_DROME/651-805--------------------------------------------------------------------------------

PF03176

MMPL8_MYCTU/74-402DNQAWILPVGLPGDLGSTQSKQAYARV-------------------------------------ADIVEHQV...AGSTL
MMPL8_MYCTU/676-1049DGHSIRYLIQTDLNPFSTAAMDQIDAI-------------------------------------TAAARGAQPNTALADA
MMPL4_MYCTU/59-388DGKAAYVQLSLAGNQGTPLANESVEAV-------------------------------------RSIVESTP...APPGI
MMPL5_MYCTU/63-393DGKAAYVQVKLAGNQGESLANESVEAV-------------------------------------KTIVERLA...PPPGV
MMPL5_MYCTU/612-950DGHAVRFIISHEGDPMSQAGIARIAKI-------------------------------------KTAAKEAIKGTPLEGS
MMPLB_STRCO/48-383DRGAQLVIVPMEGSPSDESFQNAVDEV-------------------------------------RALASDRA.....GPA
MMPL4_MYCLE/57-385DGKAAYVQLSLAGNQGELLAQESIDAV-------------------------------------RKIVVQTP...APPGI
MMPL7_MYCTU/74-391DGRSATAMVWLRGEAGTTQAAESLDAV-------------------------------------RSVLRQLP...PSEGL
MMPLA_MYCTU/29-358DGKAWILPIGLAGDLGTPKSYHAYTDV-------------------------------------ERIVKRTV...AGTTL
MMPL1_MYCTU/52-381DGKAAYVQLNLTGDQGGSQANESVAAV-------------------------------------QRIVDSVP...PPPGI
MMPL1_MYCTU/600-941DGTCARFVITHRGDPASAEGISHIDPI-------------------------------------MQAADEAVKGTPLQAA
MMPL9_MYCTU/58-387DGKAAYVQLYLAGNMGEALANESVEAV-------------------------------------RKIVANST...PPEGI
MMPL9_MYCTU/606-944NGKAVRFVISHESDPASTEGIDRIEAI-------------------------------------RAATKDAIKATPLQGA
YDFJ_BACSU/44-362DGTVAYADIQYK.SSADDIKDYSIKHL-------------------------------------KDSLKMAD....DEGL
YDGH_BACSU/39-360DKKTVLMPVTITG......SDKKAEKI-------------------------------------ADEIYQIV....PDDL
MMPL6_MYCTU/28-366DGKAARMIISHEGDPATPEGISHIDAI-------------------------------------KQAAHEAVKGTPMAGA
MMPL2_MYCTU/54-382DDRAAYVVVYLVGN.NETEAYDSVHAV-------------------------------------RHMVDTTP...PPHGV
MMPL2_MYCTU/601-939DGKAARFVIALEGDPATPEGISRVEPI-------------------------------------KREAREAIKGTPLQGA
MMPLA_MYCLE/55-391DGKAWILPIVLAGELGTSASYQAYAGV-------------------------------------AGIVKQTLESTAGSSL
Q50086_MYCLE/31-369DGHAARFIILHRGDPASVAGIASINAI-------------------------------------RTAAEEALKGTPLEDT
MMPLC_MYCTU/55-384DNKAWNLPITFAGDAASPETQAAFKRV-------------------------------------AAIVKQTV...AGTSL
MMPLC_MYCTU/658-1001DGHAARYFVQSALNPATTEAMDQVNDI-------------------------------------LRVADSARPNTELEDA
MMPLA_STRCO/46-370DGKALRTVVNVHLGKDGWEGLNAAAKD-------------------------------------MRAIARPS...APDGL
MMPLA_STRCO/397-682DGLA.YVEATLGAGADSPAAMRSVTAA-------------------------------------RETLARLD......GA
Q9RKC1_STRCO/44-379DGTIAYASVKYD.VSGMELEESTKDAL-------------------------------------EDAAQQAR....DAGL
Q9RL63_STRCO/44-395DGSTAYATVTYE.VTEDNVTDAGRADL-------------------------------------TAAVERAR....TSGL
MMPLD_STRCO/50-373DGRALQAVVQVEPDLGERLP.DVLADI-------------------------------------GDAAGQVP......GT
Q9XB10_MYCBO/43-376DHHAVTAALRFGGMVGTSQAGESITAA-------------------------------------RSIVTQLH...PPDGL
Q9XB10_MYCBO/595-943NGHATRLLVYGDGSEWGDDGAQRARAI-------------------------------------VTAVAEETDEGTLRPT
Q9XCF5_MYCAV/55-384DGKAAYVQVNLNGNAGAAAGDESVAAI-------------------------------------RKLVQEAS...PPPGL
Q9XCF5_MYCAV/604-943DGKDVRLLISQRGDPATPEGLSRVEQI-------------------------------------KTAAEEALKGTPLENS
Q9XCF6_MYCAV/51-382DGKAVYVQLNLAGNQGTTLGQESVAAV-------------------------------------RDAIARIP...PPAGL
Q9XCF6_MYCAV/601-939DGKAARFIISHRGDPATSEALNRIDKI-------------------------------------RSAAEEALKNTPLENA
Q9Z577_STRCO/40-368NADTAYATVTFE.DASQDLDPGQARAV-------------------------------------VDTAEAAE....TGGL

PF00873

CZCA_RALME/5-1037ERRGEQYLVRAPGQVASEDDIRNIIVG......TAQGQPIRIRDIGDVEIGKELRTGAATENG.KEVVLGTVFMLIGENS
MEXB_PSEAE/1-1028KGQQLNATIIGKTRLQTAEQFENILLKV.....NPDGSQVRLKDVADVGLGGQDYSINAQFNG.SPASGIAIKLATGANA
HELA_LEGPN/5-1035ETNGEQNLIRVPGQVQNMADIENIVIA......SFEGTPVRIRDVAEVALGKELRTGAATENS.KEVVLGTVFILMGENS
MDTB_ECOLI/12-1023DGPSRAVTLSANDQMQSAEEYRQLIIA......YQNGAPIRLGDVATVEQGAENSWLGAWANK.EQAIVMNVQRQPGANI
ACRF_ECOLI/1-1029PGQQLNASIIAQTRFKNPEEFGKVTLRV.....NSDGSVVRLKDVARVELGGENYNVIARING.KPAAGLGIKLATGANA
P74461_SYNY3/10-1047VGTESEPLTRTVGRFASAQEIEDLVVGTVSGLEDQSAQKVYLRDVATVIDGTEEERIFVTLNG.NPAVKVSVQKQPEANT
O25622_HELPY/6-1014DRDGETFLVKIQTASLSLEDIGKITV.......STNLGHLHIKDFAKVISQSRTRLGFVTKDGVGETTEGLVLSLKDANT
MDTF_ECOLI/1-1028ADQQLNASIIVQTRLQTPEEFGKILLKV.....QQDGSQVLLRDVARVELGAEDYSTVARYNG.KPAAGIAIKLAAGANA
SRPB_PSEPU/1-1028SGVQLNATVLGKTRMTTPSQFDEILVKV.....NPDGSQVRVKDVGRAELGADSFAISAQYKD.SPTASLALRLSTGGNL
P95422_PSEAI/3-1040NDTIFQLSINTQGRLVTEEEFENIIIRA.....GANGEITRLRDIARVELGSNQYALRSLLNN.KPAVAIPIFQRPGSNA
Q55935_SYNY3/9-1024IGGGQELLVRGLGQMQSIEDLRRSVVK......VVDGKPILLEDVAEVKTGSALKRGDGSFNG.QPAIVMMVNKQPDVDT
ACRB_ECOLI/1-1030KGQQLNASIIAQTRLTSTEEFGKILLKV.....NQDGSRVLLRDVAKIELGGENYDIIAEFNG.QPASGLGIKLATGANA
MDTC_ECOLI/3-1009EDGTHRWQIQTNDELKTAAEYQPLIIH......YNNGGAVRLGDVATVTDSVQDVRNAGMTNA.KPAILLMIRKLPEANI
ACRD_ECOLI/1-1027DKQALNATINAQSLLQTPEQFRDITLRV.....NQDGSEVRLGDVATVEMGAEKYDYLSRFNG.KPASGLGVKLASGANE
P73998_SYNY3/2-1028PGQEYQLDLLASSQLVEVKDFEDLIVKS.....GASGSVVRFKDIGRVELGAQNYNSFLRFRG.DEAVGLGIYQLLDSNA
O25328_HELPY/1-1011VNSQREFSILINANSYSVADVEKIQV..........GNHVRLGDIAKIEIGLEEDNTFASFKD.KPGVILEIQKIAGANE

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
O57717_PYRHO/107-288--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
Q9Z7Y9_CHLPN/1204-1397--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

P91129_CAEEL/47-858N...HGFNITYPYFRFGSEGGYIGSSLGGVTVMKGEN...................ETDILASAKAWFMIYHLKFHPEEM
O16307_CAEEL/1-766......FRLTYPTMHLYNDEYYVGEHFAGVKIDP......................NTNVISRVKVVVLYFRTDRQTTEV
O44978_CAEEL/31-791G...TTSVFTYPDMPYSGLDIFLGLHLSNADFEP.......................PTERISSKSLVLWYFSRSDTPEG
Q18129_CAEEL/47-926N...TQVNITYPIGWRGTEPIYFGALVGAPNLVD......................EEGHFDYASAIRLTYNTR..EGKV
O61894_CAEEL/44-830D...PRIKIEYPTMKFFDNKFFLPTHFYGVQPGG......................PLGIESIDMVHFVYQIPAYNEHTS
Q21883_CAEEL/44-838EVG.SRFQLTFPMMQVLGKELDLSPNFFGVKTDE.......................DGNVEYVKIIMLQIRANIPNDWK
O16530_CAEEL/48-891GTDFSHLDLGYPITTVLGTKLYMDPNFFGVKVTTSNNKVESIADGNTKLFGDHTKQEPNNIREVSLVVLQFRSELGDEVT
Q19945_CAEEL/49-901N...QILDLHFPRGGTKDTPVYLGGIFGDVQFFQ.......................NGTLSDAKLTQLFYFLKQDQKMV
Q09938_CAEEL/52-945ELNKRGISVTFPQVNQEGTPIYIAFVIGGVDTYP.......................NDTIKYARAMRLWYFLKFDDEEQ

PF03323

SP5AF_BACSU/18-482RRRIRDERLRVKMTKVGERSKTDLSIC---------------------------YIEDIADPDLVEIVEKEIASIDVDGL
GERAA_BACSU/13-470RQRTSHPKLITKKIMIGENKLKPAAIM---------------------------YIEGKAKKSVIKEVKARLKNIQLEDI
GERBA_BACSU/10-475RERTSDPNLVIKEMTLGKRTKKKIAVA---------------------------YIQDIAPDYVVKEVFKRLKSVNIDNL
Q2BAU7_9BACI/26-482RKRIENPNLKVKYITIGKATNTASALI---------------------------YIENLTSGKLITEITKRLASISMDSI
A9VUH9_BACWK/42-501RRYIPHRELTVKEIVIGVRSKTRISIL---------------------------YLKDVASEDVLKELETRIHNITVDAV
Q3EV24_BACTI/19-484RRNIVTEQLIFKEVTVGSISKTKVAVA---------------------------YIEGVTNEQFINTAIQRLEDIDFDVP
A9VG15_BACWK/27-487RRYIPSTELKIKKMTIGERATSLVYLI---------------------------YLGDVANEDVVQEIETRICKIKTDAV
A5N0Y0_CLOK5/6-473KKGLKDKNLIIEPFIIGRRSQKDVALI---------------------------YIKDIADKDLIEDTRNKLLSIDVDTF
Q2RIQ3_MOOTA/17-482RRRVRDPKLRTEILQVGSRSKTDVAVV---------------------------YVQDIANPRLVDTIKERIKAIKMDGL
Q63G10_BACCZ/23-479RKLIKSPNIVVKYFTLGEEMHTKVAIA---------------------------YMQNIANDDLVTEVKRRLETIKTDAL
Q24YB3_DESHY/34-509RRRIRTSRFKMEAFEIGELTRTKVGVC---------------------------YIQGIADNKIVEEVKIRLHRIKIDGV
Q24V55_DESHY/18-483RRRLRDPKLRLKLMQVGRRSKTDVCVA---------------------------YIEDITNDDLVKEISEEIQKIKIDGI
A5D162_PELTS/61-534RRRIKSPSLKIETFRIGEITNTDVAVI---------------------------YIEGIVNSKLVEEVKSRLEKIKVGAV
A6TLM7_ALKMQ/35-505RRKLKDPNLKIKDLKVGSRSHTSVAVV---------------------------YIDDIVNQEVLQYTLNKLEEIKIDGI
A7FX43_CLOB1/8-474NRRIKDKNLRIERFIIGVRSQTEVAMV---------------------------YIEDIADEKIVNEMRKRLNLIKVDHI
Q5KX57_GEOKA/17-481RRRVRDPSLRMEYVQVARRSKTDICIC---------------------------YIEEIADPELVRRVRESITAIDTDGL
B0KBH4_THEP3/30-504RRRIRDPNLKIKQIQIGERTHTDVAVL---------------------------YIEDIVDRNVLDKVMKRLKNIKIDGV
A4XN57_CALS8/19-490RRKIRDPKLKIESMKIGRISKTDIAIC---------------------------YIESIAKKELVDEVKRRLEKIDMDYI
Q2RIG8_MOOTA/33-500RRRLRAPELRFETMNLGRRTHTKVVIC---------------------------YLEGLALPGVLEELRRRLERIDIDGV
A4IND7_GEOTN/44-514RRRIKNPNLWLETMQIGTVTQTDVAIM---------------------------YVKGIANDEIIEEVKKRLRRIDIDGV
A7GH93_CLOBL/5-469RRRIKNENFEVEKFTLGKESNTLVAIC---------------------------YLKNKAPKDLINYIKDKISKAKFEFI
A4J0K1_DESRM/54-524RKRLVTPNLVFENITLGKISSTNISIV---------------------------YIKGLASEGLIEEVRERLRRIETDAI
Q5KZI4_GEOKA/26-506RKRIRSHCLVYEPFIVGTRSQTKVGLL---------------------------YIEDITNPTMIGEVRRRLLNLYVDSV
A8FDZ9_BACP2/13-474RRRLPTPNLKVSEKTVGTLSQTKVAVL---------------------------YIEEIANPANIETVLQRIEDIDFDQI
Q6HGW4_BACHK/14-474RRKLPTPYLQMKELKVGALSNTTVAIV---------------------------FIEGIVNDQNLQEIIKRVSQIKTDHV
A7VGE7_9CLOT/28-516RRRIKDTRLKLIQNTIGVRSRTEYGIM---------------------------YIEDIAEKKLVEQVKERMNEYEIDAI
Q3EQU5_BACTI/209-667RKRLPVLDLQTKEMIIGEFSKTKVVMM---------------------------YLDNLAEKDNVDFLEESLRALEYDQI
A3DD73_CLOTH/89-565RKILKDEDLVAESIEIGKRSKTPCSLL---------------------------YIKDIANESLVNEVRRRLQNIKTDYI
A7Z9E6_BACA2/10-475REQSGDPNLQIKEITLGERTKKRIAVA---------------------------YIRDIAPDDVVKEVMKRLDSITIDDI
A4J5A4_DESRM/139-610RKYIRSSKLTTEMLKVGNVAQNDVALM---------------------------YIRDIANESLVQEVKRRIKSLKIDGV
A9KKP5_CLOPH/10-482RRRIRSPYLVIEQMYVGKQSKTDVALV---------------------------YLSTICDLTLVDKIRKQLQSIDIDNI
A4XI75_CALS8/39-508RRRVRDTRLRLKNMKLGRRSQTDIYLV---------------------------YIDDIVDKNILNELKQRLSKIDIDAI
A4IQH7_GEOTN/19-483RRRIRDERLRFEILQVGERSKTDICIA---------------------------YIQDVADPGLVELVKNELKQINIDGL
Q4MKT0_BACCE/35-495RRYIPNRELKVKEFTVGERATSKVFLL---------------------------YLADIANEDVVQEMACRIESIKVDAI
A6LS87_CLOB8/10-467RRRIRDPRLVFDIHQVGNVSKTDVCIA---------------------------YIDGVADKKVLDLIIDSISKVDIKAL
A8FI46_BACP2/20-474RSHLNDRKLAIQYHKVGTKSETKLATI---------------------------YISDIANPEKIEEVNRRISSIKVDTL
Q5WGG7_BACSK/24-483RKRLPIPDLVITERIVGHLSKTKVAIL---------------------------HIDGITNNQVVQTVTQRIEDIGFDEI
Q24NX7_DESHY/41-512RRYVRTPNLTFETTIIGRETKTVVCIA---------------------------YIKGIANPSLIEEIKRRLDRINTDAI
A8ML63_ALKOO/33-512RKRIKSSHLKVMNMIIGSESHTTISVL---------------------------YMENKVNHHLLENIIDLITNIETEVV
Q9KCW3_BACHD/24-484RRRLPTSNLRIEEYEVGSLSHTRVAIL---------------------------YIETITNPELVTVVRNRINDIDFDHI
Q0TRQ3_CLOP1/10-472RRRIRDPRLTFEMMSIGNVSKTDVVIS---------------------------FLDEVVDKKTLNLIKKKFENLDIQAL
Q46191_CLOPA/46-510RKKIKNINLKTEKHTIGKNVKSNIVIC---------------------------YMEDAVDKKILEEVKARIRKINIDT.
A7GLD7_BACCN/11-477RRELRDPKLRFQSYIMGQRSQKEVTLI---------------------------YIEDIINPYIVKELNRRLQSIKTDMI
Q0AZ96_SYNWW/17-482RRRVRDPKLRIELLQAGKRSKTDICVC---------------------------YLKDVADPALVEDIKSKISGIAIDAL
GERKA_BACSU/43-510RRYIKNPNLWVEKMKKGSVTNTDIALM---------------------------YIQGICDEKVLKEVKQRLEKIDIDSI
A7FPG5_CLOB1/16-498RRRIKDTRLKIKSKTLGVRSKTDMAII---------------------------YIEDIVNQDVLNNIYDRLEKIDIDAI
Q9KDW1_BACHD/38-516RGRLKSANFKIEMFTCKGETRTRVAYG---------------------------YVDGLVDPKVLAEFKQRVKSIPEGDI
Q9KCZ6_BACHD/17-481RRRVRDRTLRVEYVSTGRRSKSDLAIT---------------------------YIADIADDKIVSKLKQGVEKMITDGI
A3F901_BACME/37-507RRIIKTPDLWTESFKIGRVTKTDVTLM---------------------------YIHDIANDKVINEIRQRLNKIDVDSI
A5N3L1_CLOK5/16-477RRRIRDTRLKIVSKPLGVRSKTDLVVM---------------------------YINDIVDTKVLEELIKRLDNINIDAI
Q93N70_BACCE/14-480RRSLRDPKLRFQSYIMGKRSQKEVTLV---------------------------YIEDIINPHIVKELDRRLQSIVTDVV
Q819C2_BACCR/18-482RRRIRDPRLRNEMVRVGDRSQTDICIT---------------------------YVQDVANPDLVKIIKQELNNIDVDGI
Q24ZQ1_DESHY/10-463RYRIKDPRLKIAMLETGKRTRTSVAVV---------------------------YIEDIANPGIVKDILQRIAKIRIDGI
Q0AXQ1_SYNWW/39-511RRKIRDPHLTFQSLQIGERSKTDLSIV---------------------------YIKGITPENLIEEINQRLQRIDTDTI
A8ML34_ALKOO/31-507RRRIRDPKLKLKGKQIGKRSKTDICVM---------------------------YIEDIVNQKCLEEVNKRLDTIDIDAI
Q97E19_CLOAB/26-494RKKIRSTDFKVEELTLGENSKTTVAIT---------------------------YLANVANPKIVEEIRRRIGKITIDSI
Q892K0_CLOTE/36-502RRRIKSQELKLQFKEIGVRTKTTICIA---------------------------YMDDIVNPKILKELENRLNKIDIEGV
A4IND1_GEOTN/26-499RKRLRSNCLAYESFIIGTRSQTKVALL---------------------------YVEDIANTAIIDEVRRRLLSLYIDSV
A7Z684_BACA2/18-482RRRIRDERLRVKITKVGERSKTDLAIV---------------------------YIEDIADPDLVSIVENEVNAIDIDGL
Q9KBD9_BACHD/30-499RTRIINPDLTVQVGNIGQHLKNRYAIV---------------------------YIKGLCKSELVDEVCYRIACINEDV.
A7Z8M3_BACA2/13-470RQRTNHPKLKTKKVPIGENKLKYATVM---------------------------YIDDKADPSVVSDVVKRLSEVKMDDI
A6CHR9_9BACI/26-486RTNVSDPNLCVEEFILGSRVKTKTYLI---------------------------YIKDIADEENVNTFRQRMKELEIDSI
A6TT32_ALKMQ/17-481RRRVRDRSLIMEPLQVGTRSKTDIVIA---------------------------YLDSVVDLDLVAQLKQKIEDISIDGL
A5ZSN8_9FIRM/29-498RKRIRDTRMKVEEYQSGVRSNTMIQIL---------------------------YIEDLVHEELLEEVKNRLEEYKIDGI
Q4MUS4_BACCE/8-477RKRLKTSSLSYDEFIIGERTQTKVGLL---------------------------YLKDVASQETISQVQFKLKEINIDGV
Q3ENA6_BACTI/39-514RRHCADESLSLVKLPVGERAKKELVVA---------------------------FIRDLASTELVDEVKNRIQKIDIDSV
B8I3H6_CLOCE/91-562RKLIKNNNLTTEFIKVGNVNKQLCAIM---------------------------SIKGITNPAIVEEVKRRIKNIKSDMV
Q65NF5_BACLD/51-522RRIIKNPNLWVEKTTMGSVTKTDVAIM---------------------------YINGICDPKAVKEVKKRMESIEIDSI
Q65F49_BACLD/13-468RQRVPDKELTVEKIPLGKSKFKDATIL---------------------------YIQGKADDSIIKDLKKRLKKVQLDDI
A5N8W4_CLOK5/22-488RKSLKDPGLITEAISFGKDNHDEVFIM---------------------------YIKNIVSVTLLKEVKTRISKIIDKNI
Q8ESY2_OCEIH/19-476RTVTKSPDFTVKNYTLGSSTTTNVSLI---------------------------YLDHVTDPEIIKKVEQRIKSITLDSI
A6TMS2_ALKMQ/40-511RRKFKSPKLRFESMFVGRYSRTEINIC---------------------------YISGKADEEMLKEMRRRIARIDIDAV
Q8EQ08_OCEIH/15-479RRRVRDRSLRMEYLQVGRRSKTDVVIS---------------------------NIEDIADNKHIDKIKSILERIDTDGL
Q5WH93_BACSK/15-478RRRVRDRTLRVVFKQVGRRSKTDIALM---------------------------YIGDIADKRYVEQMTAALDAIDTDGV
B8CZP3_HALOH/37-511RRRVKHPSLRIKNYNIGRFSKTSVSIC---------------------------YIEGIANKHLVEEVKERINNINIDNI
Q893N7_CLOTE/18-487RRKIKSPNLVFEEIILGKQTQTSISII---------------------------YMSNIANEQLLKELKKRLDKINVDAI
A6TT22_ALKMQ/49-524RKRIKSPNLVIKELTIGRESRSEIRVA---------------------------YIKHIVNPSIVKEVFKRLKRIDVDGI
Q65HC9_BACLD/14-478RRRIRDRSLRMEFLQVGRRSKTDVVIC---------------------------YLEDIADLESVKKLKQSLEAIDTDAL
Q2B5W1_9BACI/16-480RRRIRDRTLRMEYMQVGRRSKTDIVVS---------------------------YIEDIADPDTVKKIKEALSKIDTDGL
B0KC44_THEP3/27-499RRRIKHPDFVIENIKIGKYSKTDVSIA---------------------------YVKSIADDTVVQEVKKRLKKVQIDGV
Q4V1V8_BACCZ/38-502RKKIKSPDFKMKSIKIGRYTDTSIVIA---------------------------YIEGIADQTLIEEVQNRLQRIEIDGV
A7AZA3_RUMGN/16-452RRRIRDEHLIMEMTEAGQTSRTDIVIC---------------------------YMSDRVDKELLANVKSRIESLHIDDL
Q251Y5_DESHY/41-516RRKIKHPSLRLVSMKIGDLSKTDVVIA---------------------------YVETIADMDVVGEVLKRLSRIRTDAV
A8FES2_BACP2/15-479RRRVRDEKLRYKMLKVGERSKADVCVC---------------------------YIEDIADPDLVDIIEKEVSGIKVDGL
A6TKM3_ALKMQ/37-510RKKIKSPSLKVKQLIIGSESHTIVCVC---------------------------YMENIVNQQALSNIMNKLKEIKIDGI
Q8XMP0_CLOPE/4-456RRRIKNHNLKFEPLYVGEDTQTVVCIS---------------------------YIKNKAPKELIDEIREKIKNLDYKFI
Q2B6T1_9BACI/17-479RKRLSIKELIIEQYTIGKLSKTKVAVL---------------------------YIEGIADNENVNTVRQRLKDIEIDHI
Q5WL81_BACSK/9-469RNYFRSPELAIETLEVGENAAKKMAIV---------------------------SLHGKTNPDLVKEVRERLKQVHVAEF
A0Q243_CLONN/7-473TRRIKEKGLTIENFKVGKRSQTDLAIM---------------------------YIKDLVNEDALNTLKQRLNKIDIDSI
Q2RJR1_MOOTA/46-519RRRLRDPQLKLKTYFLGRRSQTAVGLL---------------------------YLKGVVDPELVAEVEGRLKNIDIDGI
Q5L1C3_GEOKA/18-484RRQVVTPNLVFREMSIGSMSKTKVVIA---------------------------YIDGVANPEVIQTVTQRLESIHFDLV
A8FI34_BACP2/12-479RERANDPNLVIQKVNVGTRNKKAAALV---------------------------YVRDIVDPKLVEDVLSRMSEIKMDDI
A3I5M3_9BACI/12-475RRRIRNSNLRFELHKISKIGQTDVAIA---------------------------YMKDVANEDMLEKLRQRLDQINHDGL
Q2B7X0_9BACI/28-484RRRLPLTELKTENFSAGYLTKVKVVMM---------------------------YIEGIANPDIIDIAREKISKVNFDII
B8I6L1_CLOCE/74-548RKILKDKDLTIKGLTIGKRSNTPCAVM---------------------------YIRDIANESLVREVLKRVKSIEVDYI
A1HTP0_9FIRM/14-479RRRLRDPNLRFEIVKVGTRSQTDVAVA---------------------------YIKDITNPELVETVKKRLNDINIDGV
A6BKH4_9FIRM/23-460RRRIRHPALIMEMMEVGDSSRTDVALC---------------------------YMGDRVDKELLKNVRDKIRSVDTDDL
A3I5C1_9BACI/4-466RMRLKSKNLSSDDFTIGDTSKTKVLLL---------------------------YIENYIDQNTLKNVQNKLNKIKVDNI
Q8EQ79_OCEIH/19-483RRRLRDENLRNEMVKVGERSKTDVCIT---------------------------YLQDVADDGLIKLIKNHISQIKLDGI
A6CSI7_9BACI/30-499RKQLRSSELMTEYVTIGDKGLSQVAIL---------------------------YLNDVANPNLLEKIKKRLKQINSDEV
Q0B0R9_SYNWW/31-504RRRIKSTNFKIENMVIGQLSKTDVALF---------------------------YIEHIAPRSMVDELKKRLQAIDIDAV
A6CTR1_9BACI/19-481RKRVPLKELIIEDFVIGRMTQTKTCLL---------------------------YIDGLADQENVQTMRQRLKAIDFDQI
A7Z1B0_BACA2/45-511RRYVKTPDVWVEKMEIGHETNTDVALM---------------------------YINGICDKKLIKEVRKRLKHIDIDSI
Q67LK9_SYMTH/66-540RRRLKDPRLVTEILTVGTVSQTYVGMM---------------------------YIDTIAPPLLVAEVKRRIEAIKVDVV
Q2B1X4_9BACI/27-487RRNLNGANLCIEDLNVGGRSKLKAKLF---------------------------YIKDIADEDNVRTFRQRISDLESDYV
B8G2F0_DESHD/16-479RRKIKDQKLRLETMNLGERTHTKIYMA---------------------------YIEGIANPKIVGEVKRRLQSIDIDGI
A3I8R7_9BACI/8-460RRRIQSAQLKNENRIVGSEANIKISIM---------------------------YMDNIVNHKNLDDLRNRIDQVEFPLF
Q9KCM6_BACHD/19-483RRRIRDERLRHEILKVGVRSKTDICIA---------------------------YIDGIVDPEMVKIVREELENIKIDGI
A9KJY3_CLOPH/12-470RRRIRSNDLVMKLMEVGESSKTDVVVT---------------------------YMDGRIDEKLLNRIISKLENLKIDSL
A3IGD6_9BACI/11-474RKRLPTNSFCVEKVELGKRSKTTVAIL---------------------------YFEDIVDMDILHGIKKQLAAVDTDIV
Q8CUL1_OCEIH/19-480RYGLKSKDLVMEKHVIGRRDPREVRLI---------------------------YIRSIANDTDINTFRQRIKALDVDFI
A3DH40_CLOTH/24-495RKRLKNPNLCVEITNIGKQTNNNAALI---------------------------YIKGIANDRIVNEVKNKLKSVKNYDV
Q8ESE5_OCEIH/39-505RRDLRDPKLRYKSFEIGSRSKQKVVLC---------------------------YIEDLINPDILEEVIRRIQSIDTEYV
A1HTL4_9FIRM/126-599RTIFPTSELVTEIMTVGDRAPLKCAIM---------------------------YLKPVANPNVVAELKRRLERIVTDYI
A8MKB7_ALKOO/16-482RRKLKTNHLKLEFRVFGKQSHTKTCIC---------------------------YIDGIVNKKILQELYRRLEDFHMDGV
A1BZL1_BACCE/26-497RKRLRHPTLSYQTLTLGKRTQTQIGIL---------------------------YLKDVVNLEILDNIRECLTLIDIDGV
A5N512_CLOK5/37-508RRRIKSYQLKIEEFIVGRQTQTKINIT---------------------------YLQGIVDDSIVKEVRKRIQKIDVDSI
A6CMX7_9BACI/18-482RRRIRDPRLRFEIFRIGERSKTDISIA---------------------------YIEDVANPSLIKVIKKELKSIKIDGL
A3I672_9BACI/39-510RRKIKSPNLWIKTRVIGEVTQTEIAIM---------------------------YINGIANEKIVKEVLKRLDRIDIDGI
A4J3J2_DESRM/20-485RRRLRDPRLRNEVMQVGTRSKTDVVIS---------------------------YIEDIANPDMVKRIKENLQKVKIDGI
YFKQ_BACSU/29-493RFRVKTFQLKMISFKIGTKTKTDVVLA---------------------------YIDGLADPKVIDKAKKRIKKIKIDAV
A5D2Z0_PELTS/16-481RRRIRDPKLRMEYFQVGTRSKSDIVVC---------------------------YIEDIANPELVQSIKEKIEYIKIDGI
Q5WB92_BACSK/19-481RKRIPSSDLHMVKFVVGSETKTDVYVI---------------------------YCASIANKENVQTVKQRIKGLQIDQV
A8MJ63_ALKOO/11-465RNKIKDPNLKFERFTLGDKSKTQVVLA---------------------------YIEGNAHSSLVNYIKGKMEHIQSDYV
A1BYZ6_BACCE/12-473RRNLNDSNLCTDELKIGERVKKQVRII---------------------------YLKDIADDDTLKTLKEKFENIKTDNI
Q65HV1_BACLD/18-482RRRIRDERLRYKMLHIGERSKTDICLC---------------------------YLEDVADPDLVEVLKKEIEDVKIDGL
Q9KCH4_BACHD/17-476RKRLPMPQLKVEQLTVGQLTKTKVALL---------------------------YIEGIANEENVNTIRQRIDKIEFDQV
Q97TS7_CLOAB/39-510RRKIKNPNLTFENMKIGKQTDTDICLV---------------------------YLKNVVNPKLIEEIRTRLDKIDTDSI
Q5WC86_BACSK/7-466RRQAATDKVIVRKKKIGKTIKKDVAVV---------------------------YMHDRASATVLAELMKKLEAINQDIT
Q2B691_9BACI/19-483RRRIRDERLRFEIMRIGERSKTDIAIA---------------------------YIKDVASTDLIEVVRQEIQSIDIDGL
A7VTU7_9CLOT/37-502RRRMKNPKLKFETLSVGSVSKTDVCLC---------------------------YLRDTVSPEIIKEIKKRLSSSTLETV
Q3AF85_CARHZ/43-510RRRVRSPYLRFEALKIGRISQTDVVIA---------------------------YLEDIANPQIVEEVRNRLSRIDVDAI
A0Q328_CLONN/19-481RRRVKDTRLRMESKVVGIRSKTDLAIT---------------------------YIDDIVNVGVLEELKRRLDKIDIDAI
A6TWV3_ALKMQ/29-505RRRIRDHRLKVKNYRVGVRSQTDVVVM---------------------------YMEDIANKGVLEEVDKRLNKIDVDAI
Q9KBJ3_BACHD/39-513RRRVKSNRLRVENTELGETTHTDVAIV---------------------------YVDDLVDKKLLQEIKQRLNRVITHKV
A3IF45_9BACI/60-532RQQGENQQLSIIQMAVGERVKKELVIA---------------------------YMDEIVDPELVEEVKKRIQTIDLDNL
YNDD_BACSU/37-512RQQGKNDQLTLQRFEVGTRLKKDLIIA---------------------------YMNDIADPKVVEEVRKRVRGIEIDHL
A4J7W6_DESRM/38-504RRKIVSTKLAIEVTRIGQRSRTKVALA---------------------------YMSDIADPKIVQEVRHRISQINTDVI
B8CVZ6_HALOH/19-483RRRIRDANFRAEVLQVGKRSKNDVALL---------------------------YIKDIINKDLVDRVREKLKNVDIDGL
A6NQ51_9FIRM/26-495RRHLRAPELKIREKIVGRQSLTPVDIL---------------------------WLDNIADPDLVRRVEERVAAIDIDAL
Q67NW6_SYMTH/72-542RRRVRDPRLRVDMLTVGELTRTRVAVC---------------------------YLATVCKQSLIDEAMRRIRRVKVDGM
A8FH96_BACP2/13-470RQRLKNPDVKTVDMKIGLQKYTQVTIM---------------------------YIDGIVQVPVLKEVKKRLKQVTIDDI
Q5WKA9_BACSK/40-504RRRIGDEQLWVETKTIGTRTKTKIMIA---------------------------YMNDIVDKSILRELHTRLDRIYTDSV
Q2RGV1_MOOTA/61-532RRRLKTPSLKMETVCLGRYTMTNIVIT---------------------------YIEDLADPAVVREVRRRLERIQIDGV
A7VPD1_9CLOT/10-465RRRIRNPSLTMKILSVGSLSKTDVVLC---------------------------YMDDHVDHALLNKLLKKIQDAPVESL
Q65IP8_BACLD/41-515RQHGKNQNLSMVQFQVGKRAVKNLVVA---------------------------YIKDIAEPGLVEEVKKRIEKIDIDDV
Q2B3G2_9BACI/54-521RRRIKNPRLQFEEFTIGNDTRTTVFIS---------------------------YMKDIADSGIVEEVRKRLKKIDTGAI
Q67MK2_SYMTH/57-527RRRIRDDRLRIERFTLGERSKTRVVII---------------------------YLMGIAPPEMVQEVRNRIGRIQADAV
Q899A1_CLOTE/18-484RRRIKDTGFKIVPKQLGTRSKTDIAVM---------------------------YIDDIANEDIVDEVFKRLDKIDIDAV
A1HRT4_9FIRM/73-539RRRTRDPNVKVRVLKLGERTRTAIALV---------------------------YAANLVKPGLVEEVERRLSLLKIDNV
A3IC08_9BACI/26-497RRKIKSPNLWIKSRVIGEVTQTDVAVM---------------------------YIHGIASDKIVAEVLARLDRINIDGI
Q5WH20_BACSK/17-481RRRIRDERLRQEIMQVGVRSKTDICLC---------------------------YIDGIVDPGFIKIIKKELKAINIDGL

PF12349

SCAP_XENLA/306-459-----------------------------------------------------------L--------------------
A0MJA4_CANFA/661-815-----------------------------------------------------------P--------------------
A1CTG5_ASPCL/632-787-----------------------------------------------------------F--------------------
A1Z6J2_DROME/390-543-----------------------------------------------------------V--------------------
PTC2_MOUSE/418-570-----------------------------------------------------------C--------------------
A2I5E0_LEUER/44-198-----------------------------------------------------------C--------------------
A4S8G2_OSTLU/258-409-----------------------------------------------------------C--------------------
A5BXT3_VITVI/26-176-----------------------------------------------------------H--------------------
A5E1Z8_LODEL/460-615-----------------------------------------------------------L--------------------
A6SQG9_BOTFB/216-369-----------------------------------------------------------A--------------------
A7RI14_NEMVE/240-393-----------------------------------------------------------M--------------------
A7RNK5_NEMVE/879-1035-----------------------------------------------------------R--------------------
A7S0G1_NEMVE/641-795-----------------------------------------------------------M--------------------
NPC1_HUMAN/649-803-----------------------------------------------------------L--------------------
O16307_CAEEL/208-359-----------------------------------------------------------V--------------------
SCAP_SCHPO/257-410-----------------------------------------------------------D--------------------
O61894_CAEEL/286-437-----------------------------------------------------------W--------------------
P91129_CAEEL/295-446-----------------------------------------------------------W--------------------
P91346_CAEEL/298-449-----------------------------------------------------------W--------------------
PTR9_CAEEL/288-439-----------------------------------------------------------I--------------------
Q16VL3_AEDAE/637-791-----------------------------------------------------------F--------------------
Q17FP9_AEDAE/355-509-----------------------------------------------------------L--------------------
Q17N28_AEDAE/360-513-----------------------------------------------------------V--------------------
Q18968_CAEEL/295-448-----------------------------------------------------------M--------------------
Q19945_CAEEL/297-448-----------------------------------------------------------W--------------------
Q1MT74_DANRE/45-196-----------------------------------------------------------C--------------------
Q21883_CAEEL/287-442-----------------------------------------------------------W--------------------
Q23E28_TETTS/595-746-----------------------------------------------------------K--------------------
Q29GK5_DROPS/626-780-----------------------------------------------------------L--------------------
Q2HB50_CHAGB/263-415-----------------------------------------------------------A--------------------
Q4PBD7_USTMA/410-564-----------------------------------------------------------K--------------------
Q4T749_TETNG/568-722-----------------------------------------------------------V--------------------
Q7S7Y9_NEUCR/217-369-----------------------------------------------------------A--------------------
Q7YU59_DROME/651-805-----------------------------------------------------------F--------------------

PF03176

MMPL8_MYCTU/74-402TANLTGPAATVADLNLT---------------------GQRDRSRIEFAITILLLVILLI--------------------
MMPL8_MYCTU/676-1049KVSVVGLPVVLKDTRDY---------------------SDHDLRLIIAMTVCIVLLILIV--------------------
MMPL4_MYCTU/59-388KAYVTGPSALAADMHHS---------------------GDRSMARITMVTVAVIFIMLLL--------------------
MMPL5_MYCTU/63-393KVYVTGSAALVADQQQA---------------------GDRSLQVIEAVTFTVIIVMLLL--------------------
MMPL5_MYCTU/612-950AIYLGGTAAMFKDLSDG---------------------NTYDLMIAGISALCLIFIIMLI--------------------
MMPLB_STRCO/48-383DVAVTGPAGIATDTVKV---------------------FSGGDKVLLLATVVLVLIILLA--------------------
MMPL4_MYCLE/57-385TAWVTGASALIADMHHS---------------------GDKSMIRITATSVIVILVTLLL--------------------
MMPL7_MYCTU/74-391RASIVVPAITNDMPMQI---------------------TAWQSATIVTVAAVIAVLLLLR--------------------
MMPLA_MYCTU/29-358TANVTGPAATVADLTDA---------------------GARDRASIELAIAVMLLVILMV--------------------
MMPL1_MYCTU/52-381KAYVTGPGPLGADRVVY---------------------GDRSLHTITGISIAVIAIMLFI--------------------
MMPL1_MYCTU/600-941SIYLAGTSSTYKDIHEG---------------------TLYDVMIAVVASLCLIFIIMLG--------------------
MMPL9_MYCTU/58-387RTYVTGPAALFADQIAA---------------------GDRSMKLITGLTFAVITVLLLL--------------------
MMPL9_MYCTU/606-944KIYIGGTAATYQDIRDG---------------------TKYDILIVGIAAVCLVFIVMLM--------------------
YDFJ_BACSU/44-362QTELSG......DVPGA---------------------EMEIGGVSEIVGIILAFVVLAI--------------------
YDGH_BACSU/39-360TAYITGASLINQDFAHS---------------------SEEGLKKTEVITVCLIIGLLLI--------------------
MMPL6_MYCTU/28-366GIYLAGTAATFKDIQDG---------------------ATYDLLIAGIAALSLILLIMMI--------------------
MMPL2_MYCTU/54-382KAYVTGPAALNADQAEA---------------------GDKSIAKVTAITSMVIAAMLLV--------------------
MMPL2_MYCTU/601-939AIYLGGTAATFKDIREG---------------------ARYDLLIAGVAAISLILIIMMI--------------------
MMPLA_MYCLE/55-391KANLTGPASTVADLTDA---------------------GARDRTSIELVIAVLLLTILMI--------------------
Q50086_MYCLE/31-369KIYLAGTAAVFKDIDEG---------------------ANWDLVIAGISSLCLIFIIMLI--------------------
MMPLC_MYCTU/55-384TVHLSGPIATVADLTEL---------------------GEKDVRIIEIGTAVSVLIILIL--------------------
MMPLC_MYCTU/658-1001TIGLAGVPTALRDIRDY---------------------YNSDMKFIVIATIVIVFLILVI--------------------
MMPLA_STRCO/46-370GVHVTGPTGYAADSAES---------------------FSSADFKLTLVTLLIVVTILVV--------------------
MMPLA_STRCO/397-682QARVGGSSAVVHDMREA---------------------SSRDRGLIIPVILAVVFCILAL--------------------
Q9RKC1_STRCO/44-379TVEIGGDALQAVP....---------------------...ETGATEVIGIAVAAVVLVI--------------------
Q9RL63_STRCO/44-395TVEAGGGAVAGEP....---------------------...PAGIGEFLGIGVAAVVLLI--------------------
MMPLD_STRCO/50-373RAQLAGPAASQADLSDA---------------------FAGIDGLLLAVALITVLVILLL--------------------
Q9XB10_MYCBO/43-376HVFVTGPGATIVDEFAA---------------------IDRQTQLITATTIVVLLILLLI--------------------
Q9XB10_MYCBO/595-943AVELTGVGPATRDLQDL---------------------VGSDLTLLAVITLAVIFAIAAL--------------------
Q9XCF5_MYCAV/55-384KVYVTGPAPIVADMNIA---------------------GQKTVMLVTLASLIVIFVTLLL--------------------
Q9XCF5_MYCAV/604-943RIYLTGTAAITKDLAQG---------------------SKFDLLIAGVSALCLIFIIMLI--------------------
Q9XCF6_MYCAV/51-382KAYVTGPAALFSDMQLA---------------------GDRSILKMTLIGALIIFIVLLF--------------------
Q9XCF6_MYCAV/601-939KIYLAGTASTFKDFRDG---------------------STYDLFIAGVGALCLIFIIMLI--------------------
Q9Z577_STRCO/40-368RIELGGGAIALTE....---------------------.SGGSHLAEAVGVAVAAVVLFL--------------------

PF00873

CZCA_RALME/5-1037RAVSKAVDEKVASINRT..MPEGVKIVTVYDRTRLVDKAIATVKKNLLEGAVLVIVILFL--------------------
MEXB_PSEAE/1-1028LDTAKAIRQTIANLEPF..MPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLVFLVMYL--------------------
HELA_LEGPN/5-1035RTVSERVAAKMKDINKT..LPEGVEAITVYNRTTLVNATINTVKNNLLEGALLVCVILFL--------------------
MDTB_ECOLI/12-1023ISTADSIRQMLPQLTES..LPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMIIYL--------------------
ACRF_ECOLI/1-1029LDTAKAIKAKLAELQPF..FPQGMKVLYPYDTTPFVQLSIHEVVKTLFEAIMLVFLVMYL--------------------
P74461_SYNY3/10-1047IEVVDGVKKRLEELRTEGIIPQAAELTPTLDDSVFIRNSVNNVVVSGLIGTVLAAIAVLL--------------------
O25622_HELPY/6-1014KEIITQVYQKLEELKPF..LPNGVSINVFYDRSEFTQKAIATVSKTLIEAVVLIIITLFL--------------------
MDTF_ECOLI/1-1028LDTSRAVKEELNRLSAY..FPASLKTVYPYDTTPFIEISIQEVFKTLVEAIILVFLVMYL--------------------
SRPB_PSEPU/1-1028LETVDAVKKLMEQQKAY..LPDGVEVIYPYDTTPVVEASIESVVHTIFEAVVLVFLVMYL--------------------
P95422_PSEAI/3-1040IEISNLVREKMAELKHS..FPQGMDYSIVYDPTIFVRGSIEAVVHTLFEALVLVVLVVIL--------------------
Q55935_SYNY3/9-1024PTVTKAVEAVVESLKPT..FPADVQIAQTFRQANFIDSAIRNVSTSLLEGIVIVSVIMLI--------------------
ACRB_ECOLI/1-1030LDTAAAIRAELAKMEPF..FPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILVFLVMYL--------------------
MDTC_ECOLI/3-1009IQTVDSIRAKLPELQET..IPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFL--------------------
ACRD_ECOLI/1-1027MATAELVLNRLDELAQY..FPHGLEYKVAYETTSFVKASIEDVVKTLLEAIALVFLVMYL--------------------
P73998_SYNY3/2-1028LEVARLVKDEMARLAQN..FPEGIEYSVAFDTTEFVQESLSEVVETLLIAVVLVILVILV--------------------
O25328_HELPY/1-1011IEIVDRVYEALKRIQA...ISPNYEIRPFLDTTGYIRTSIEDVKFDLVLGAILAVLVVFA--------------------

PF02355

SECF_METTH/102-285--------------------------------------QAMNQIYWAIGFAFLFMSVTVF--------------------
SECF_BORBU/108-297--------------------------------------TLRIRSIFLVLGTFILILIYIT--------------------
SECDF_BACSU/540-729--------------------------------------ELARNALYAVAIASIGIIIYVS--------------------
O57717_PYRHO/107-288--------------------------------------MVREQGIKAIVYAFIGMAVVVF--------------------
SECF_STRCO/109-305--------------------------------------QIANKAWQGLGIFMVLVVIYLA--------------------
SECF_HAEIN/120-308--------------------------------------ELAQGAVYATLATLAMVLIYVG--------------------
SECF_ECOLI/114-302--------------------------------------DLAQTGAMALMAALLSILVYVG--------------------
SECF_SYNY3/108-301--------------------------------------ALFRSGVLALVISLLGIIIYLT--------------------
SECF_RICPR/110-299--------------------------------------QLIEAGAMAMLFSFLAIMVYIG--------------------
SECF_HELPY/106-293--------------------------------------ELKEKGILSLILALIAIMVYVS--------------------
SECF_RHOCB/123-311--------------------------------------ELVWTAVWSLLAATVVIMFYIW--------------------
Q9Z7Y9_CHLPN/1204-1397--------------------------------------KMRYQATIGLLGALAIILLYVS--------------------
SECF_METJA/88-276--------------------------------------KFFEEGFKAVGFAFMFMAIVVY--------------------
SECF_TREPA/222-411--------------------------------------LLVRQALLLVLGALVLIFLYVA--------------------
Q9ZBS8_STRCO/569-757--------------------------------------ELRRDALIALGLALAAQLAYLA--------------------
SECF_RHOS4/117-305--------------------------------------ELIRSAILAVAAACAGIAVYIW--------------------
O84454_CHLTR/1200-1393--------------------------------------KMRTQAVIALFGALGIILFYVS--------------------
SECF_MYCLE/183-379--------------------------------------QITKKVVIALVVFLVLVGLYIT--------------------
SECF_AQUAE/92-279--------------------------------------ELQKKAVFAILTALGGILLYLG--------------------

PF02460

P91129_CAEEL/47-858SYISGEWELELGRMLTQYPEDP..YISITYFHSQTLADELKRNADTLIPRFIISITLLIVFSTLCSL..SFID...GSFS
O16307_CAEEL/1-766SQVLNNWETSLFDYVENFDHPF...LNMTVNSDAMIAREVRTNGMTCVPFFSFSVAAVVIFIFATNS..REHF.......
O44978_CAEEL/31-791KLAFKDAIDELFQLSKNSSAFE..HVQFTIFSDQVANREMIRGAIEATTLMTIGFFLLLTQVIIVIV..RLSS.......
Q18129_CAEEL/47-926DQYGIEWRRKLSMWLTDKENPVSELLEFGVNHNMTLPEGLQDVADTLAPKFVGTCAILFTFSFLVSV..VLRKHRTGQVM
O61894_CAEEL/44-830EEMSKIFEQSLTALLENQTTFD.....TSMFSLSILKDEMQKNSTYTMPFISLTILLLLCFTVASCM..TDNW.......
Q21883_CAEEL/44-838KEDAAEYERMISQYFHFKYDST..HVTPLAMSLTYTGDEVVRTGLTIFPFIGVGFIIMTTFSIITIY..YSSS.....RL
O16530_CAEEL/48-891PEDLRNYEHQILDYIHDEYQSE..HINVYILTDSYITEEIVRAGLTLLPFLVIGFTIMAVFSSIT......FV.......
Q19945_CAEEL/49-901EEYSSKFSYALETFLNQVYSSD..VITLSFAHYQSLEDGLDENAKAFVPNFVVSFFVLAMYALVSSF..TLKS..SSATK
Q09938_CAEEL/52-945EQLAKFWEDTAEKFVRETYADH.PTIQCHIKHSRIVDQGLTRNANRLKPYFNVTIAVLVLFTAFYSVKWYFRMDHSWPLH

PF03323

SP5AF_BACSU/18-482TMADKTVEEFIVNQS.YNPFPLVRYTERPDVAANHVLEGHVIIIVDTSPSVIITPTTLFHHVQHAEE-------------
GERAA_BACSU/13-470.QDSGTLEELIEDNK.YSPFPQIQNTERPDKVSSALFNGRVAILVDSSPFVLLVPVSLGILMQSPDD-------------
GERBA_BACSU/10-475.PESGTLEQLIEDEP.FSIFPTILSTERPDRVESSLLEGRVSILVDGTPFALIVPATVDEFIHSPDD-------------
Q2BAU7_9BACI/26-482.QSPGFIQDCIEDHP.FSPFPQILNTERPDRAAAHLMEGRAVLITDGSPSVMIMPVTFFAFFQSPED-------------
A9VUH9_BACWK/42-501.ASNGELIEFIEDNP.YSPFPQFILTERPDLAVSHILQGRFVTVMDHSPNVLIAPTNFISFFQGVDD-------------
Q3EV24_BACTI/19-484.FDSTMIEQFISDNS.NSPFPVLLPTERLDRAVFALINGEVLILTDGSPYALSGPTTLLDFFISPED-------------
A9VG15_BACWK/27-487.LSIGELSNFTKDQN.WTPFPQAYLSERPDAISNHILDGKVAVLIDRSPGAMIVPMNLIGFFQTPDD-------------
A5N0Y0_CLOK5/6-473.TSAGMLEQYIENHP.YSVFPQAHASQRPDVVQQNLSEGRIAILMDGTPFALTIPALFMEFFQAVED-------------
Q2RIQ3_MOOTA/17-482PMAEKSLEEFISPGSFWNPFPRVRYTERPDVAAAHLFEGHVLVMVDTSPSVMILPATIFHHLQHAEE-------------
Q63G10_BACCZ/23-479.MPPGYIQEFIEDTS.FSPFPQQLNTERPDRVAANLMEGRVAILSDGDPTALIVPVTLFAFYQSPDD-------------
Q24YB3_DESHY/34-509.LASGYIEEMIQDES.LSNFPLIFTTERPDRVAGCLLEGRVAIMVDNTPVSLVVPCTFMTLLQASED-------------
Q24V55_DESHY/18-483PMAEKSVEEFILGSKIWNPYPRVRYTERPDVAAVHLLEGHVVVLVDTSPSVMIAPATFWSHTQHAEE-------------
A5D162_PELTS/61-534.LESGNIEELIEDNP.FSPFPMVNHTEKPDRVAAMLLEGRVAILVDGTPFALTVPNLFVEYLQASED-------------
A6TLM7_ALKMQ/35-505.FDSGYIEQFLENNT.FSIFPQMQVTERPDKVCGNLLEGRMVVLVDGSPDALIFPVGLVQLLQSPDD-------------
A7FX43_CLOB1/8-474.KTVAYIEQYMQNNT.YTIFPQFFTTERPDVFEASIIEGRVGILMEGTEQGITAPAIFTEFFQTVED-------------
Q5KX57_GEOKA/17-481VMAEKTVEEFISGRH.WNPYPVVRYTERPDTAAAHLYEGHVLVIVDGSPSVIITPATFWHHLQHAEE-------------
B0KBH4_THEP3/30-504.FESGYIEQLIEEDW.HSPFPQVLSTERPDKVAASLLEGRVAILTDNTPFALIIPTTLATLFQSPED-------------
A4XN57_CALS8/19-490.LESGYIEAFIEDGK.YSIFSTVGNSEKPDVVVGKLMEGRVAILVDGTPFALTVPYLFVEAFQTSED-------------
Q2RIG8_MOOTA/33-500.LESGYIEELIEDAP.FSPVPQLNRTERPDKLVADLLEGRIGVLTDGTPFALVLPGSLVSQLHAPDD-------------
A4IND7_GEOTN/44-514.LESGYIEQLIEDQT.FTPFPTTYHTERPDIVAANLLEGRVAIFVEGTPFVLVAPALFIQFFQAVED-------------
A7GH93_CLOBL/5-469.IESNYIEELLSQKN..TLFDTISSSEKADVVCSKIFEGRVGILIDGTPFVLTAPHFFIENINMADD-------------
A4J0K1_DESRM/54-524.LESGYLESFIVDNP.RSPFPQLGNTERPDRVAGDLLEGRVAILTDTTPLVLIAPGELMSFLQTSED-------------
Q5KZI4_GEOKA/26-506.TSTNQIEHWISDRR.FAFFPLFGYTGRPDFAASSLLNGRFLLLVDGAPTALIGPGNLTFLLNTSED-------------
A8FDZ9_BACP2/13-474.LDANYLAQMLYDVS.NTIFPLFLNTERPDRVSSGLSEGKIAILVDGSPHVLLAPTILLEYFSTMED-------------
Q6HGW4_BACHK/14-474.LDSTYLIQLIADNP.NSIFPQFLNTERPDRVAAVLAEGKIALFVDGSPYAITLPTTLIDFFSTTED-------------
A7VGE7_9CLOT/28-516.FDSGMAEHLMEKKW.YRPFPVFQSTTRPDKAAAALADGRVVVVFDNSPEVLIAPATINTLFQTADD-------------
Q3EQU5_BACTI/209-667.NDSAYLQELMGEK...SIFPLYINTERTDRVTKALIDGKIAIFVDGSPNVLLTPVSYFDFFISPED-------------
A3DD73_CLOTH/89-565.FDTGELEQYIEDNT.LMSTPQIVATERPDRVASMLAEGKVAVIMSGSPFALVMPTTNNDFLQSAED-------------
A7Z9E6_BACA2/10-475.PESGAIEQLIEDNT.YSIFPTVLTTERPDRVMGALLEGRVSILVDGTPFTLLVPATVDEFIHSPDD-------------
A4J5A4_DESRM/139-610.IDSGILEQLIEERP.WSIAPQVMATERPDRVALMLLRGKVAIFLDGNPYVLLVPTTLFDQLHTQED-------------
A9KKP5_CLOPH/10-482.AAASFIEEYIVPPK.QTLMPQIMYTQRPDRCCSNLTDGRIAIVVDGIPFVYVLPCQLPMLLQSPED-------------
A4XI75_CALS8/39-508.IDGGMIEQLIEDDV.FCFFPTIQHTERVDTAVAAIYEGRIVILCDNTNTALIVPATIMTSIQHAED-------------
A4IQH7_GEOTN/19-483TMGDKTVEEFLVKQG.YNPYPLVRYTERPDVAATHLLEGHVLIMVDTSPSVIITPTTFFHHVQHAEE-------------
Q4MKT0_BACCE/35-495.LTTGELEGFVEDNS.YTLFPQLSITERPDTTAHHILDGRIAVVVDRSPGVLIGPMTFSAFFQTIDD-------------
A6LS87_CLOB8/10-467TLSDQSLVDVMCTKNWLNPFPKVRFTERPDVAAAHIVEGKIIIIVDNSPNVIILPTGIFDFLQDIND-------------
A8FI46_BACP2/20-474.LSPGAIVEAIEDDS.YSIFPQLIDTERPDKVRSAILEGRIVVLMDGSPMAIILPITFFSFFQSPDD-------------
Q5WGG7_BACSK/24-483.IDSSYIAQLISDDS.NSIFTQLIDTERPDRVAAMLAEGKVAVIVDGSPHALTGPTSFVEFFSAFED-------------
Q24NX7_DESHY/41-512.LESGYIEQFIEDAP.FSIFSTVGNSERPDAVAAKILEGRAALLINGTPFVLTVPVLFIESFSSTED-------------
A8ML63_ALKOO/33-512.LESAYIEQHLEQYP.YSPFPQTQITERPDKVCGDLMEGRIIILTDGSPIALVLPITFFQLFHSSED-------------
Q9KCW3_BACHD/24-484.SDSSFINQLIEDSS.QSPFPLLIDTERPDRVASVLAEGKVCVLTDGSPSAITGPTTLVEFFSSYED-------------
Q0TRQ3_CLOP1/10-472TMSEQSLVESLSNASWYNPFPKVRYTERPDVAAAHITEGKIVVIIDNSPSVIILPTTIFDFIQDVDD-------------
Q46191_CLOPA/46-510.FASNYVLEAISDDK.FSLVPTIFKTERPDVAASKLLEGKILILVDNTPIVLSIPALFVEFMQASDD-------------
A7GLD7_BACCN/11-477.LDSGKIEQLLEENT.LSPFPQFLNTERPDRAIAALAKGKAIILVDGSPFAILAPMVIVDIFQSPED-------------
Q0AZ96_SYNWW/17-482PMAEKSVEELIMPGNWWNPFPKVRYTERPDVAAVHLFEGHVLIMVDTSPSVIILPVTFFHHLQHAEE-------------
GERKA_BACSU/43-510.LESGYIEQLIEDET.FTTFPTMYHTERPDVVAGNLLEGRFAIIVDGTPFVLIAPALFVQFFQSVED-------------
A7FPG5_CLOB1/16-498.LGSGYIEHLIEDGK.WSLFPTTRSTERPDVVASALYEGKVAILVDNSPFAIIVPTTLPSLFQSPDD-------------
Q9KDW1_BACHD/38-516.LETSYIEELIEDST.YSPFPQYRYTERPDTAVAALLDGKIIVMVDGTGSILICPSLFVELMQSSED-------------
Q9KCZ6_BACHD/17-481PMGDKTIEEYVFGHH.LNPYPLVRYSERPDVAASHLFEGHVLLLVDGSPSVMIAPTTFWHHLQHAEE-------------
A3F901_BACME/37-507.LESGYIEQLIEDET.MTSFPTIYNTERPDVVAGNLLEGRIAIFVDGTPFVLIAPAVFMQFFQSAED-------------
A5N3L1_CLOK5/16-477.LDSGYIEQLIEDNK.WSFFPQIQSTERPDVVSSALYEGRIAVLVDNSPFAVIVPTTMANLFQSPDD-------------
Q93N70_BACCE/14-480.LETGTIEQLIQDNN.LSPFPQFLNTERPDNIIASLAKGKAAILVDGSPFALIAPLVFVDIFQSVED-------------
Q819C2_BACCR/18-482TMADKTVEEFVVKQS.YNPFPLIRYTERPDVAANHLLEGHVLVLVDTSPSAMITPTTYFHHLQHAEE-------------
Q24ZQ1_DESHY/10-463.VESGELQKQILNSK.WSLFPQTGIVERSDMACGALLEGKVIILVEGSGLGLIAPKVFHEFLISCDD-------------
Q0AXQ1_SYNWW/39-511.LDVSYIEQFIEDSP.NSLFPTVGSSERPDVVVARILEGRAAILLDGSPMALVVPFLFIEGFQNPDD-------------
A8ML34_ALKOO/31-507.MDSGYIEQLIEDNW.RSPFPQIQSTERPDVVAASLYEGKVIILVDNSPFALIAPASFNAMMQSAED-------------
Q97E19_CLOAB/26-494.IGMNYIKEYIQDEA.FSAFPTVFSTERPDVVAGKIFEGKIAILADGTPIVCTAPAIFFEFLETNED-------------
Q892K0_CLOTE/36-502.FSTGTMQELIRDNP.MSPFNTIGNTERPDVVASKLLQGRIAILCEGSPTVLTLPYLFIEQFQVNED-------------
A4IND1_GEOTN/26-499.TSTSQIEEWLSDTK.IALFPMFGYTGRPDFAVNSLLNGRFIILVDGSPTALIGPGNLTFLLNTSED-------------
A7Z684_BACA2/18-482TMADKTVEEFIVKQG.YNPFPMVRYTERPDVAANHILEGHVIIVVDTSPSVIITPTTIFHHVQHAEE-------------
Q9KBD9_BACHD/30-499.QETGAVEQLLQDEP.MTIFPQLSHTERPDKAVSEMLKGKVVILLNGSPFALMAPVKLSELLNSPED-------------
A7Z8M3_BACA2/13-470.QDSGTLEELIEDNK.YSPFPQIQNTERPDKVSSALFNGRVAILVDNSPFALVVPASLGILMQSPDD-------------
A6CHR9_9BACI/26-486.IDSSVLAQMIEDNS.YTVFPQLITTELPDRLSISLLHGKIGVLVDRSPQAIIGPTTFLNFFESTED-------------
A6TT32_ALKMQ/17-481PMEEKSLEEFIFGRH.YNPYPMVRYTERADTCGVHLREGHILMLVDGSPSVMICPATFWHHLQHAEE-------------
A5ZSN8_9FIRM/29-498.LDSGMLEQLTEKPW.YSPFPQYQVTERPDRTALELLNGKIALLCDNSPSALILPGAFSSFMESSED-------------
Q4MUS4_BACCE/8-477.VSSAQIEEFITGDQ.FSLFPLIEYTGRPDYAVNCLLHGRFILLVDGSPTATIAPVSFPFFVNTAED-------------
Q3ENA6_BACTI/39-514.LESGYIEQLIEDNY.LSPFPQIQNTERPDRVISALMEGRVAILLDGTPFVLIAPVTFSMLLQSPED-------------
B8I3H6_CLOCE/91-562.LGDGVLEQFIEDNP.YSIFPTILSTERPDRAAAHIMEGKVAILAEGAPFAKIVPVTLLTIMHSPED-------------
Q65NF5_BACLD/51-522.LESGYIEQFIEDTV.FTTFPTVYHTERPDMVAGNLLEGRIAIFVDGTPFVLLVPAVFIQFFQSVED-------------
Q65F49_BACLD/13-468.QDTGVLEELIEDNK.YSPFPQIQNTERPDKVSSALFNGRIAIFVDYSPFALIVPASFGMVMQSPDD-------------
A5N8W4_CLOK5/22-488.ENASILQQCIEDRP.YSILPSTFETERPDRVSSFLKEGHIALLIGSTPNVVIVPVTFWTLFHTSED-------------
Q8ESY2_OCEIH/19-476.RSAGDIQDCIEDHT.VTPFPQLLLTERPDRASANLKDGRVALIIDGSPTVIILPATFMTFFQTPDD-------------
A6TMS2_ALKMQ/40-511.LDSAYIEQYIEDSP.LSLFPLVGSTEKPDIVLGKILEGRIAILCDGSPFVLTAPQLFIEQIQSGAD-------------
Q8EQ08_OCEIH/15-479PMAEKTIEEFLSDRY.WNPYPSVRYTERPDTAAAHLYDGHILLIIDGSPSVMITATTFWNHLQHAEE-------------
Q5WH93_BACSK/15-478PMADKSIEEFIFKES.SNPYPLVRYSERPDVCATHLFEGHVLILVDGSPSVMITPTTFWHLLQHAEE-------------
B8CZP3_HALOH/37-511.GSSGFVEQLIEDSH.LSPFPQILSTERPDRVAANLMEGRVAVVVDNTPFVLILPMTISIFFQSPED-------------
Q893N7_CLOTE/18-487.LSLNSIEDYIIDKK.LSAFPQLINTERPDKFCSNIIEGRIGLIIDGLPISIIIPGTLVQFIQATED-------------
A6TT22_ALKMQ/49-524.VGSASIEEYIDDAP.TNLFQTTFYTERPDRVQAMLLEGRITILCDGTPFAITVPAIVTDFFINSDD-------------
Q65HC9_BACLD/14-478TMAEKTLEEYIGGRH.WNPYPTVRYTERPDTAAVHLYEGHILVFVDGSPSALITPVTFWHHLQHAEE-------------
Q2B5W1_9BACI/16-480PMAEKTIEEFISGRH.WNPFPMVRYTERPDTAATHLFEGHICIMIDGSPSVMITPTTFWHHLQHAEE-------------
B0KC44_THEP3/27-499.IDSGYLEEFIEDNP.FSPFPQIAHSEKPDKVTAEILEGKVAILVDGSPFVLIVPAVFVQFFQAAED-------------
Q4V1V8_BACCZ/38-502.LESGYIEELIEDNP.YSPFPQLLNTERPDVAAANLLEGRVIILVDGTPFVLIAPISFFSLLQSPED-------------
A7AZA3_RUMGN/16-452KMNQQTLAEAMFKRKWFNPFPKFKFTERPDTAVACLLEGKVIILVDNSPSAMILPTSILDMIEEAND-------------
Q251Y5_DESHY/41-516.ISGDMLEELIEDHP.YSPFPQVSNTERPDIVAADLLEGRVAIMVDGTPSALIVPVTLPTFMQVNDD-------------
A8FES2_BACP2/15-479TMSDKTIEEFIIKQG.YNPFPLVRYTERPDVAANHILEGHVIIITDTSPSVIITPTTIFHHVQHAEE-------------
A6TKM3_ALKMQ/37-510.FESGYIEQYLEGSP.YSPFPQMQITERPDKVCGNLLEGKIIILVDGSPVSLILPISFFQLFQSPED-------------
Q8XMP0_CLOPE/4-456.LDTNYIEAKLREDR..TLFDTVGYTEKADEVAAKLLEGRVAIIVDGTPFVLTVPFFFIENFQTPDD-------------
Q2B6T1_9BACI/17-479.MDSSYIVEIIADNQ.NTIFPQILDSERPDRVSGILAEGKIAIVVDGSPQVLICPTTLVEYFSSFED-------------
Q5WL81_BACSK/9-469.IISQIATDALEGKG..FLFPRTMANDRPDACALALAKGKIVLLVEGSPLAILAPSLFFHFFQNQDD-------------
A0Q243_CLONN/7-473.NSNGVLEQFIEGET.YSIFPQVFNTERPDIVEANLMEGRIAVILSGVSQVITVPALFVEFFHGVED-------------
Q2RJR1_MOOTA/46-519.LDSGFIEQLIEDCW.YSPFAQIQSTERPDEAAAALLEGRVIVLTDNTPFALLIPATFNSLMHSPED-------------
Q5L1C3_GEOKA/18-484.FDNAILDQLLADNS.RTPFPLFISTERIDRAIYALVSGQVAIFCDGSPYAVIGPAALFDFFTSPED-------------
A8FI34_BACP2/12-479.PETGYIEQLIEDSH.ISIFPQIQNTERPDRVIASVLEGKVSILLDGTPFALILPMTFTALMQSPED-------------
A3I5M3_9BACI/12-475TMADKSLEEWLFKQK.FHPVPFVRYTERPDIAAAHLLEGHIAIMVDTSPSVILVPITIFHLLQHAEE-------------
Q2B7X0_9BACI/28-484.LEQSELAAFMEDHI.HSVFPQFQQTDRPDQCAYSLGLGKIVILVANTPFALVAPITFFNLFQSPED-------------
B8I6L1_CLOCE/74-548.FDSGELEQLLEDST.FLTAPQIFATERPDTVARMLAQGNIAVILDGSPYVLVMPATITEYLSTPED-------------
A1HTP0_9FIRM/14-479PMAEKAIEEYIAVGSKWNILPKVRYSERPDVAAVHLLEGHVCVIVDTSPNVMILPTTFWHHVQHVEE-------------
A6BKH4_9FIRM/23-460RMNQQSLAECLFRRKWYNPFPKFKFTERPDTASACLLEGKVVILVDNSPSAMILPTSIFDMIEEAND-------------
A3I5C1_9BACI/4-466.ASSYHIEELLYDK..LTLFPLLDYSGRPDFVVSSLNKGRFVILVDGSPSCLIGPVNLLLILKAAED-------------
Q8EQ79_OCEIH/19-483SMAEKTLEEFLILRR.WNIYPMVRYTERPDVAASHLLEGHVLIFVDTSPSAIILPTTYFHHLQHAEE-------------
A6CSI7_9BACI/30-499.QNLGLLEQHIEERP.YSLVPTVLYTERPDRAVSFINEGHIVLLMDSSPSSLILPVTFWSFFHTSED-------------
Q0B0R9_SYNWW/31-504.LDPRYLVEFVADEK.RSIFTQEQYTEKPDRLCGYLLEGRIAIMVDGSPMALIVPVSFLEHLISPED-------------
A6CTR1_9BACI/19-481.NDSSFIEQMVADNA.NSPFPQLLDTERPDRAASVLVEGKVVVLSDGSPHALLGPTTLVEFFSAYED-------------
A7Z1B0_BACA2/45-511.LESGYIEQLIEDAP.FSVFPTVYHTERPDVVAGNLLEGRFAIIVDGTPFVLIAPALFIQFFQSVED-------------
Q67LK9_SYMTH/66-540.NGSGTLQPYIDDHP.RSLLPTTLMTERPDRAAAYLSEGHVVLFVDTSPHAIICPTTFWALLQTAED-------------
Q2B1X4_9BACI/27-487.PDTTVLAQYIEDNS.WSVFPQILTTELPDRFCISLIKGQVGVLLDRSPSALYGPTTFFSFFETTED-------------
B8G2F0_DESHD/16-479.LESGYIEQLIEDSP.QSIFPTVGTTEKPDKLAAKLLEGRIGILVDGTPFVITVPYLFVEAFQNPED-------------
A3I8R7_9BACI/8-460.TDISVLKQLIEDNP.LSPFPQYYMTVRPDSICRYLIDGRIVMFMDNSQLAIVCPTSFFEMFVSIED-------------
Q9KCM6_BACHD/19-483TMTDKIIEEYIVKQG.MNPFPLVRYTERPDVAATHLLEGHLVIMVDTSPSVIIAPTTFFHHVQHAEE-------------
A9KJY3_CLOPH/12-470SMNQESLAESLYRGSWFNPFPKYKYSERPDTTAACILEGSIVILVDNSPASMIIPSSLFDIIEGTDD-------------
A3IGD6_9BACI/11-474.FSGDLLMERVNKNS..KLFPKFDYTGRPDYAVQALARGRFVIFVDGVAYCIITPVNLFLLLKSAED-------------
Q8CUL1_OCEIH/19-480.DDTSVLTQYLEDNS.TTVFPQFLITELPDRLIYNLSRGKIGVLSENSPNAIIAPSTFFSFFESTED-------------
A3DH40_CLOTH/24-495.ISCEQLMQLVCERA.FSIFPLMQWTERPDKAVSSLLEGKVGVIFDNSRGMLIAPVTLTSLMQSPDD-------------
Q8ESE5_OCEIH/39-505.TDSAQIEQWIEDSS.LSPFPQMISSERPDKASFEMLHGKFVILVDGTPFCIIGPIVLNDIVKSMED-------------
A1HTL4_9FIRM/126-599.GDIGVLEQFIEDHP.NVLFPQMLSTERPDRVAVHLAEGRIALLLNGVPFVHILPVSFFTFFHSNED-------------
A8MKB7_ALKOO/16-482.LDVNYIQEFIKDSP.LSLFDTTGTTERPDVVAAKLLEGRIAIIIDGSPVVLTVPFLFIEYFQSCED-------------
A1BZL1_BACCE/26-497.ISSTQIQEMVSKQS.LSIFPLCGDTARPDFAVECLLQGRVVIIIDGSPIVIIAPVTITFLIKAAED-------------
A5N512_CLOK5/37-508.LESGYIEELIEDTS.YTLFPQIQHSERPDRVAAGILEGRVAILIDDTPCALILPATMIQFLQASED-------------
A6CMX7_9BACI/18-482TMADKTVEEFLVKQG.YNPYPLVRYTERADIGATHLLEGHVLIFVDTSPSVIITPTTFFHHMQHAEE-------------
A3I672_9BACI/39-510.LESGYIEQLIQDSK.FTIFPTVYNSERPDVIAGELLEGKIAILVDGTPFVLIVPALFTSFLQSAED-------------
A4J3J2_DESRM/20-485PMAEKAIEELIEPGKYGHLFPKVRFTERPDVAVTHLLEGRVLIMVDTSPSVIIAPCTLWDHLQSAEE-------------
YFKQ_BACSU/29-493.LESGYIEEFIEDDT.YSPFPQLQYTERPDTVAAQLLEGRFAIFTDNTPFVLTGPITFWQLMQASED-------------
A5D2Z0_PELTS/16-481PMGEKSVEELITPGSFWNPFPKVRYTERPDVAAMHLLEGHVLVLVDTSPSVIIAPATYFHHLQHAEE-------------
Q5WB92_BACSK/19-481.PDSSTILQVIQDNN.NSVFPQLVDTERPDRTAGALLEGKVAVLADGSPQALLAPVTALEFIVAFED-------------
A8MJ63_ALKOO/11-465.FYSSYIEEELKCRN..TPFDTIGYTEKPDAVATSLAEGKVAILVDGNPFVSLAPYFFIENFHSSDD-------------
A1BYZ6_BACCE/12-473.SDSSVLAQCLEDNH.YSFFPQFILTELPDRFLYSILNGRIGVLIDESPIAIIGPANFFSFFESTED-------------
Q65HV1_BACLD/18-482PMSDKSVEEFLVGQG.YNPFPLVRFTERADVAASHILEGHVIVIVDTSPSVIITPTTLFHHVQHAEE-------------
Q9KCH4_BACHD/17-476.IDSNSLAQMITDKS.LSIFPQLINTERPERVAAVLAEGKVAFLCDGSPEVIFGPSTLVEFFSSLED-------------
Q97TS7_CLOAB/39-510.LESGYIEQYIEDES.FSIFPTIGNSEKPDIVAAKILEGRAAILVDGTPFALTVPMLFIEGFQSSED-------------
Q5WC86_BACSK/7-466.ISPGVLNELLQQSK.RSIFPQVLYSERPDVVAGNMAEGRIAVLMEGNPTALILPVSFFSFLQSVDD-------------
Q2B691_9BACI/19-483TMADKTVEEFLLKQG.YNPYPLVRYTERADVGATHLLEGHVLIFVDTSPSVIITPTTFFHHLQHAEE-------------
A7VTU7_9CLOT/37-502.LSSSYLIPFLEEEKNMCPFSGIGLSERPDTVCGKIAEGRVAVLVDGTPGVLIVPYLFVEYFQTMDD-------------
Q3AF85_CARHZ/43-510.LESGYIEEFIEDDP.FNIFPQIKHTERPDKAVADLLEGKVVILTDGTPLALIVPATFPEFFQAAED-------------
A0Q328_CLONN/19-481.LDSGYIEQLIEDDC.LSPFPQVQSTERPDVVAAALYEGRVAVLVDNSPFAIIVPATMPNLLQSPDD-------------
A6TWV3_ALKMQ/29-505.IESGQLEEFIEDEW.QSLFPQIQNTERPDVAAAGIYQGRVILVVDNTPFALMVPTTFNMMMQSAED-------------
Q9KBJ3_BACHD/39-513.ISEANIEEAMQDEM.LTPFPTSYNTERPDMVAYALVEGKVALIIDGTPFALILPTDFAQFFKAAED-------------
A3IF45_9BACI/60-532.LESGYIEQLIEDNF.LSPFTQVQNTERPDRVYGALMEGRVAIILDGTPFALIVPVTINMLLQSPED-------------
YNDD_BACSU/37-512.PESGYVEQLIEDNY.LSPFPQVQSTERPDRVISGLMEGRVAILLDGTPFALIVPVTFSMMLQSPED-------------
A4J7W6_DESRM/38-504.LEAGYIERFIEDHP.WSLFPQVFGTERPDRVVANLLEGRVAILIDGTPYVLVVPTLFIQFLQGSED-------------
B8CVZ6_HALOH/19-483PLGDKSIEEIITGGT.INPLPLVRYTERPDNVAAHLLEGHLAIIVDNSPTALVLPAPFLSHIQTLEV-------------
A6NQ51_9FIRM/26-495.LSTGNLEEYIVDET.STAFPLVLYTERPDRFCAGLAQGRVGILVEGLPLGYLCPGTAGEFLRAPQD-------------
Q67NW6_SYMTH/72-542.LDSGQLMELIEDTP.WTVFPLVRATERPDAVVGGLLEGRFAIVVDGSPWVLVAPSTFMDLIHSPED-------------
A8FH96_BACP2/13-470.QDSGVLEELIEDNV.YSPFPQIQNTERPDKVASALNNGRVAIFVDHSPFVLVVPASLATIMQSPDD-------------
Q5WKA9_BACSK/40-504.LEDGNIEELIEDQV.YTPFPTVYSTERPDTTAAHLLEGKIAILSDGSPMALIVPALFVQFFHNAED-------------
Q2RGV1_MOOTA/61-532.LESAYIEELIEDNP.DSPFPQIDHTERPDKVAAALLEGRVGILIDGTPFALIVPTVFVQFLQASED-------------
A7VPD1_9CLOT/10-465TMNQQSLMEAMHRTRWYNPFPKFKYTERPDTAAASVLEGNIVILVDNSPSAVIVPTSIFDIIEEADD-------------
Q65IP8_BACLD/41-515.LESGFVEQLIEDNY.LSPFPQVQSTERLDRVMSALMEGRVAILLDGTPFVLIVPVTFSMLLQSPED-------------
Q2B3G2_9BACI/54-521.FETGNIEELIADKT.ATLFPLALNTERPDAVAANLLEGKVAILCDGTPFVLLVPAVLVDFFSVSED-------------
Q67MK2_SYMTH/57-527.LESGHIEELIEDDP.FTIFPLLKVTERPDVATAGMLEGKVAVLVDGSPNVLLMPSTLVAEMQSPED-------------
Q899A1_CLOTE/18-484.LDSGYVEQLIEDNE.WSIFPQTQSTERPDVVAASLYEGRVSILVDNSPFAIVVPATLPALFQSPDD-------------
A1HRT4_9FIRM/73-539.ILSATVEEALSDHP.WTPFPQVQVTERPETMVAAVYEGRVGIIVDNTPFSLIVPCTYANLMQSTDD-------------
A3IC08_9BACI/26-497.LESGYIEDFIQDSK.NTMFPTIYNSERPDVIAGELLDGKVAILVDGTPFVLVVPALFTSFLQSAED-------------
Q5WH20_BACSK/17-481TMADKVVEEYIVKQG.LNPFPLVRYTERPDVAATHILEGHVVIIVDTSPSVVITPATIFHHVQHAEE-------------

PF12349

SCAP_XENLA/306-459---VKSKWGLALA-AVVT-VLSSLLMSVGL-----CTLFG---..LTPTLNGGEI-FPYLVV-VIGLENVLVLTKSVVST
A0MJA4_CANFA/661-815---VDSKVTLGLG-GVAV-VLGAVTAAMGF-----FSYLG---..VPSSLVILQV-VPFLVL-AVGADNIFIFVLEYQRL
A1CTG5_ASPCL/632-787---VQSKFTLGIV-GILI-VLMSVSASVGL-----FSAAG---..VRATLIIAEV-IPFLVL-AVGVDNIFLVVHEFERI
A1Z6J2_DROME/390-543---FRSRFLLALC-SVIT-TAGSLAMSLGL-----CFFFG---..LTISLQSKDI-FPYLVI-LVGLENSLVITKSVVSM
PTC2_MOUSE/418-570---AQSQGAVGLA-GVLL-VALAVASGLGL-----CALLG---..ITFNAATTQV-LPFLAL-GIGVDDIFLLAHAFTKA
A2I5E0_LEUER/44-198---SKSQGAVGLA-GVLL-VALSVASGLGL-----CSLLG---..ISFNAATTQV-LPFLAL-GIGVDDMFLLAHAFTET
A4S8G2_OSTLU/258-409---VGSRVGVTLA-GIVS-IGMAIASAYGI-----GAYCG---..LFFSPLMN.V-LPFLLL-GIGVDDMFVIVNSYDNT
A5BXT3_VITVI/26-176---APCCCSHGLH-ATHV-VEPMCACSIAM-----PGCLL---GAVKARPSCGQG-SP...L-.VGVDNMCILVHAVKRQ
A5E1Z8_LODEL/460-615---VKTRFTLGLC-GIII-ILLSVTASVGL-----FSFIG---..LRSTLIIAEV-IPFLVL-AIGVDNIFLIVHELHKI
A6SQG9_BOTFB/216-369---LKSRLGLLIA-ATTQ-LAFTFTSTFTI-----CAIIK---..TDLSMIPREY-YPLIVV-FCGTENMLQLVRAFIVT
A7RI14_NEMVE/240-393---VKSKWGLAFS-AVIT-VIASLIMAAGL-----CTMFG---..LVPTLNSSEI-FPYLVI-MIGVENILVITKSVVST
A7RNK5_NEMVE/879-1035---LRLKAWLGVA-GVIC-VGLSIGVSFGM-----SSAFG---..VFYGPVHS.V-LPFLLL-GIGVDDMFVIVQAWNNL
A7S0G1_NEMVE/641-795---IDSKFTLGFC-GIII-VLCSVICSIGF-----WSYVG---..VPATLIIIEV-IPFLVL-AVGVDNFFIMVQAYQRI
NPC1_HUMAN/649-803---VDSKVSLGIA-GILI-VLSSVACSLGV-----FSYIG---..LPLTLIVIEV-IPFLVL-AVGVDNIFILVQAYQRD
O16307_CAEEL/208-359---FSHNVVMAIL-GIAG-PLMATGTAFGF-----LFLFG---..FPFNSITL.V-MPFLII-GVGCDDVFIIIHAMRKT
SCAP_SCHPO/257-410---IRAKFGLTAT-IFIQ-SGTAYFSTCSL-----LYFFE---..RTGPICPWPM-AYYIII-FMDIENSFRLLRAVIAS
O61894_CAEEL/286-437---VTSKPIEAMI-GILV-SSMAIVSAGGL-----LFALG---..VPFINQVT.V-MPFIAL-AIGVDDVYVMLGAWQDT
P91129_CAEEL/295-446---VLSKPILSIL-GVVS-AGIAILTGVGF-----LSLMG---..MPYNDIVG.V-MPFLVL-AVGVDNMFLMVAAVRRT
P91346_CAEEL/298-449---VVTKPILSVL-GVSN-AGMGIASAMGM-----LTYLE---..IQYNDIIA.V-MPFLVV-AVGTDNMFLMVASLKRT
PTR9_CAEEL/288-439---VKSQPFIGFF-AMFN-ATMATIASTSL-----LLYLQ---..YPFLPLVF.I-MPFLVV-SIGTDNMFLMLKSWRMT
Q16VL3_AEDAE/637-791---NESKIILAVG-GIVV-VLVSVACSLGF-----FGYLQ---..LATTMLTIEV-IPFLVL-AVGVDNIFMLVHAFQRI
Q17FP9_AEDAE/355-509---IDSKITLGLG-GVII-VLASVVASVGI-----FGYIG---..LPATLIIVEV-IPFLVL-AVGVDNIFILVQTHQRD
Q17N28_AEDAE/360-513---IRSRLVLAFS-AVLT-VLGSLTMSLGM-----CFFFG---..LTISLQSKGV-YPYLVI-LVGLENVLVITKSVLTT
Q18968_CAEEL/295-448---VASRWGLAFA-SSFT-VASTLLMTTGI-----CAHLD---..LSTTTWGSEV-YPYIAL-IMGLENTLCITRSVVYT
Q19945_CAEEL/297-448---ISSKPWLAAA-GMFS-TVLSIISAFGF-----LFILG---..VRYNVINT.I-IPFLII-AIGIDDMFLMNACWDQT
Q1MT74_DANRE/45-196---VRTKVWVALL-GVVS-AGMAVLASFGL-----LLFCG---..MPFAMTVG.S-APFLIL-GVGVDDMFIMISSWQKT
Q21883_CAEEL/287-442---SVHKVSEAIL-ACVC-PLLATSSALGT-----LFWFG---..FRFGTILC.V-TPFLIL-AIGVDDAYLQVHACMRL
Q23E28_TETTS/595-746---THSGFLIGLA-GIFI-VIFSIVCSMGF-----MAFIG---..VGMTMISGEV-IPFLIL-AIGVDNMFIISTAVKGC
Q29GK5_DROPS/626-780---LESRIMLAIG-GIVI-VLASVACSLGF-----WGYLD---..VTTTMLAIEV-IPFLVL-AVGVDNIFIMVHTFQRL
Q2HB50_CHAGB/263-415---VKSRVGLMVT-MLAQ-ITASIVSSFTV-----CAIFK---..VDLSHVPLQT-YPFVIL-AISMENSFRLINAVIMT
Q4PBD7_USTMA/410-564---VHSRFGLAFT-GTTQ-LIISMIMSVSI-----CALLG---..IRLTLVPWEL-LPFVIV-VVGSENMYSLTKAIVDT
Q4T749_TETNG/568-722---VDSKFLVGLG-GILV-VSCAVLSSLGF-----CSWVG---..IPSSLIIVQV-VPFLVL-AVGADNIFIFVLEYQRD
Q7S7Y9_NEUCR/217-369---VKSRFGLMAT-ILAQ-IAASIGSSFTI-----CAIFK---..IDLSRVPYYA-YPLVVL-AISMENSFRLINAVIMT
Q7YU59_DROME/651-805---IDSKITLGIG-GVII-VLASVVSSVGV-----FGYIG---..LPATLIIVEV-IPFLVL-AVGVDNIFILVQTHQRD

PF03176

MMPL8_MYCTU/74-402---IYGNPITMVL-PLIT-IGMSVVVAQRL.VA.IAGLAG-----LGIANQSIIF.MSGMMV-GAGTDYAVFLISRYHDY
MMPL8_MYCTU/676-1049---LLRAIVAPLY-LIGS-VIVSYLAALGIGVIVFQFLLG-----QEMHWSIPGL.TFVILV-AVGADYNMLLISRLREE
MMPL4_MYCTU/59-388---VYRSIITVVL-LLIT-VGVELTAARGV.VAVLGHSGA-----IGLTTFAVSL.LTSLAI-AAGTDYGIFIIGRYQEA
MMPL5_MYCTU/63-393---VYRSIITSAI-MLTM-VVLGLLATRGG.VAFLGFHRI-----IGLSTFATNL.LVVLAI-AAATDYAIFLIGRYQEA
MMPL5_MYCTU/612-950---TTRSVVAAAV-IVGT-VVLSLGASFGLSVLIWQHILG-----IELHWLVLAM.AVIILL-AVGADYNLLLVARLKEE
MMPLB_STRCO/48-383---IYRSPLMALV-PLLA-VGVAMRVAETL.GAILADAGV-----ITVSSQTASI.MTVLLF-GVGTDYALIITARYRET
MMPL4_MYCLE/57-385---VYRSFITVIL-LLFT-VGIESAVARGV.VALLGHTGL-----IGLSTFAVNL.LTSLAI-AAGTDYGIFITGRYQEA
MMPL7_MYCTU/74-391---ARLSVRAAAI-VLLT-ADLSLAVAWPL.AAVVRGHDW-----GTDSVFSWTL.AAVLTI-GTITAATML.......A
MMPLA_MYCTU/29-358---IYRNPVTMLL-PLVT-IGASLMTAQAL.VAGVSLVGG-----LAVSNQAIVL.LSAMIA-GAGTDYAVFLISRYHEY
MMPL1_MYCTU/52-381---AYRSLSAALI-MLLT-VGLELLAVRGI.ISTFAVNDL-----MGLSTFTVNV.LVALTI-AASTDYIIFLVGRYQEA
MMPL1_MYCTU/600-941---ITRSVVASAV-IVGT-VALSLGSAFGLSVLIWQHILH-----MPLHWLVLPM.AIIVML-AVGSDYNLLLIARFQEE
MMPL9_MYCTU/58-387---VYRSIATTLL-ILPM-VFIGLGATRGT.IAFLGYHGM-----VGLSTFVVNI.LTALAI-AAGTDYAIFLVGRYQEA
MMPL9_MYCTU/606-944---ITQSLIASLV-IVGT-VLLSLGTAFGLSVLIWQHFVG-----LQVHWTIVAM.SVIVLL-AVGSDYNLLLVSRFKEE
YDFJ_BACSU/44-362---TFGSLLIAGL-PILT-ALIGLGVSIGL...VLIGTQV-----FDIASVSLSL.AGMIGL-AVGIDYALFIFTKHRQF
YDGH_BACSU/39-360---VFRSVVTPFI-PIVV-VGFSYLISQSI.LGILVYNVD-----FPISTFTQTF.LVAILF-GIGTDYCILLLTRFREE
MMPL6_MYCTU/28-366---ITRSLVAALV-IVGT-VALSLGASFGLSVLVWQHLLG-----IQLYWIVLAL.AVILLL-AVGSDYNLLLISRFKEE
MMPL2_MYCTU/54-382---IYRSVITAVL-VLIM-VGIDLGAIRGF.IALLADHNI-----FSLSTFATNL.LVLMAI-AASTDYAIFMLGRYHES
MMPL2_MYCTU/601-939---ITRSVVAAVV-IVGT-VVLSMGASFGLSVLVWQDILG-----IELYWMVLAM.SVILLL-AVGSDYNLLLISRLKEE
MMPLA_MYCLE/55-391---IYRNPITMLL-PLIT-IGASLMTAQAV.VSGVSVLAG-----LAVSNQMIVL.LSAMIA-GAGTDYAVFLISRYHDY
Q50086_MYCLE/31-369---ITRAFVAAAV-IVGT-VALSLGASFGLSVLLWQHILG-----IELHYLVLAM.SVIVLL-AVGSDYNLLLVSRFKQE
MMPLC_MYCTU/55-384---VYRNLVTMLV-PLAT-IGASVVTAQGT.LSGLAEF.G-----LAVNMQAIVF.MSAVMI-GAGTDYAVFLISRYHDY
MMPLC_MYCTU/658-1001---LLRALVAPIY-LIGS-VLISYLSALGIGTLVFQLILG-----QEMHWSLPGL.SFILLV-AIGADYNMLLISRIRDE
MMPLA_STRCO/46-370---TYRSPLLWLL-PMIS-AGMSLVISQAI.VYLLAKNAG-----LTVNAQTAMI.LTVLVL-GAATDYALLLVARYREE
MMPLA_STRCO/397-682---LLRALVAPLL-LIAS-VVLSFFTALGLAALFFNHVFD-----FAGADSAFPLWVFVFLV-ALGVDYNIFLVTRIKEE
Q9RKC1_STRCO/44-379---TFGSLVSAGL-PLLT-ALIGVGIGVSS...ITALASA-----LELGSTTSIL.AMMIGL-AVGIDYALFIVSRYRAE
Q9RL63_STRCO/44-395---TFGSLAAAGL-PLIT-AVVGVALTLAS...IVALGSA-----LGMSTASGDL.AMMIGI-AVGVDYALLVVSRYREE
MMPLD_STRCO/50-373---VYRSVLLPLV-IILS-AVFALALSCAI.VYALADRDV-----VRVDGQVQGI.LSILVI-GAATDYALLLTARFREE
Q9XB10_MYCBO/43-376---VYRSAITATV-PLLS-VVVSLAVAKPI.VSVLVDRDF-----IGISLFSLGL.SVAVVV-GAGTGFAMFLIGRYHER
Q9XB10_MYCBO/595-943---LLRSPLAGLV-VVGT-IATSYICALGASVVIWKHILG-----DNLHWSVLPI.AFVLLI-SVGSAYNLLFALRIREE
Q9XCF5_MYCAV/55-384---VYRSVITVIL-LLLI-VGLELQIARGM.VALLGHLGV-----VGLTTFAVNL.LVAAVI-ATGTDYGIFFVGRYQEA
Q9XCF5_MYCAV/604-943---MTRSFIAAMV-IVGT-VLLSLGASFGLSVLVWQYLLH-----MQLNWTVLPT.SVIVLL-ALGPDYNLLLVSRMKEE
Q9XCF6_MYCAV/51-382---VYRSVTTVVL-LLLT-VGIEVFAARGV.IAFVANNNL-----MPLSTFAVNL.LVALAM-AAGTDYAIFFFGRYQEA
Q9XCF6_MYCAV/601-939---LTRSFIAALI-IVGT-VTLSLGASFGLSVLIWQYIFG-----IQLYWMVLPM.SVIVLL-AVGSDYNLLLVSRMKEE
Q9Z577_STRCO/40-368---AFGSVAAALL-PIAT-ALVSVGTAYAG...ITLLGHA-----MTVADFAPML.GTLIGL-GVGIDYALFIVTRHRRG

PF00873

CZCA_RALME/5-1037---FLGNIRAALI-TATI-IPLAMLFTFTG-----MVNYK-----ISANLMSLG--ALDF..-GIIIDGAVVIVENCVRR
MEXB_PSEAE/1-1028---FLQNFRATLI-PTIA-VPVVLLGTFGV-----LAAFG-----FSINTLTMF--GMVLAI-GLLVDDAIVVVENVERV
HELA_LEGPN/5-1035---FLGNIRAALI-TAMV-IPLSMLLTITG-----MVENQ-----ISANLMSLG--ALDF..-GLIVDGAVIIVENCIKH
MDTB_ECOLI/12-1023---FLRNIPATII-PGVA-VPLSLIGTFAV-----MVFLD-----FSINNLTLM--ALTIAT-GFVVDDAIVVIENISRY
ACRF_ECOLI/1-1029---FLQNMRATLI-PTIA-VPVVLLGTFAI-----LAAFG-----YSINTLTMF--GMVLAI-GLLVDDAIVVVENVERV
P74461_SYNY3/10-1047---FLGSLRQTLI-IVLA-IPLATMAAIIV-----MKAFG-----LSLNVFSLG--GLALGV-GIVVDNSIVMLETIAEG
O25622_HELPY/6-1014---FLGNLRASVA-VGVI-LPLSLSVAFIF-----IKFSD-----LTLNLMSLG--GLVIAI-GMLIDSAVVVVENAFEK
MDTF_ECOLI/1-1028---FLQNFRATII-PTIA-VPVVILGTFAI-----LSAVG-----FTINTLTMF--GMVLAI-GLLVDDAIVVVENVERV
SRPB_PSEPU/1-1028---FLQSFRATLI-PTLA-VPVVLLATFAL-----LPYFG-----LNINVLTMY--AMVLAI-GLLVDDAIVVVENVERL
P95422_PSEAI/3-1040---FLQTWRASII-PLAA-VPVSLIGTFAV-----MHMLG-----FSLNALSLF--GLVLAI-GIVVDDAIVVVENVERN
Q55935_SYNY3/9-1024---FLMNWRTAAI-TLTA-IPLSLLIGLMF-----MKAWG-----LGINTMTLG--GLVVAI-GSVVDDSIVDMENCYRG
ACRB_ECOLI/1-1030---FLQNFRATLI-PTIA-VPVVLLGTFAV-----LAAFG-----FSINTLTMF--GMVLAI-GLLVDDAIVVVENVERV
MDTC_ECOLI/3-1009---FLRSGRATII-PAVS-VPVSLIGTFAA-----MYLCG-----FSLNNLSLM--ALTIAT-GFVVDDAIVVLENIARH
ACRD_ECOLI/1-1027---FLQNFRATLI-PTIA-VPVVLMGTFSV-----LYAFG-----YSVNTLTMF--AMVLAI-GLLVDDAIVVVENVERI
P73998_SYNY3/2-1028---FLQDWRSALI-PALT-IPLALIGTFAF-----VKVFN-----FSINSLTLF--GLTLAT-GLVVDDAIIVVEQISRF
O25328_HELPY/1-1011---FLRNGTITLV-SAIS-IPISIMGTFAL-----IQWMG-----FSLNMLTMV--ALTLAI-GIIIDDAIVVIENIHKK

PF02355

SECF_METTH/102-285---IIFRDPVPSL-AVILAAASDIIIAVGG-----MSLFG.....IPLSLASVG--AILMLI-GYSVDTDILLTTRVLKR
SECF_BORBU/108-297---LRFKLSYAIA-SILS.IFHDIFFIVAF-----LGVFR.....IEINSYIIV--AILTII-GYSLNDTIIIFDRIRDN
SECDF_BACSU/540-729---IRFEYKMAIA-AIAS.LLYDAFFIVTF-----FSITR.....LEVDVTFIA--AILTII-GYSINDTIVTFDRVREH
O57717_PYRHO/107-288---LFFRVPVPSL-TVVFSAFSDMVIAVAL-----MDIFG.....IELSQATIA--ALLMLI-GYSVDSNILLTTRLLRR
SECF_STRCO/109-305---IAFEWRMALA-AFVA.LIHDITITVGI-----YALVG.....FEVTPGTVI--GLLTIL-GYSLYDTVVVFDSLKEQ
SECF_HAEIN/120-308---SRFEWRLGFG-SIAS.LAHDVIITLGV-----FSALQ.....IEIDLTFVA--AILSVV-GYSINDSIVVFDRVREN
SECF_ECOLI/114-302---FRFEWRLAAG-VVIA.LAHDVIITLGI-----LSLFH.....IEIDLTIVA--SLMSVI-GYSLNDSIVVSDRIREN
SECF_SYNY3/108-301---IRFQLDYAVF-AIIA.LLYDALITMGA-----FAIFGLV.GGVEVDSLFLV--ALLTII-GFSVNDTVVIYDRVRET
SECF_RICPR/110-299---VRFEWYFGFG-ILIA.LVHDVILALGF-----MSMTK.....LDFNLSTIA--AVLTII-GYSVNDSVVIYDRIREN
SECF_HELPY/106-293---FRYEWRFALA-SVIA.LVHDVILVASS-----VIVFK.....IDMNLEVIA--ALLTLI-GYSINDTIIIFDRIREE
SECF_RHOCB/123-311---VRFEWQFALG-AVVA.LVHDVLLTVGL-----FAVLQ.....LKFDLTTVA--ALLTIT-GYSINDTVVVFDRLREN
Q9Z7Y9_CHLPN/1204-1397---LRFEWQYAFS-AVCA.LIHDLLATCAV-----LFIAHFFLKKIQIDLQAIG--ALMTVL-GYSLNNTLIIFDRIRED
SECF_METJA/88-276---LYFRNPVPSG-AIILSALSDIIMALGA-----MSLLG.....IELSSATIA--ALLMVI-GYSVDSDILLTTRVLKR
SECF_TREPA/222-411---LRFRWFFALG-AIVA.LVHDACIMVSF-----MVWFG.....LEFNSASIA--AILTII-GYSINDTVVVFDRVRQT
Q9ZBS8_STRCO/569-757---VRFRLLFGTA-AVGA.LAHDVVILVGV-----FAWLG.....KPIDGVFLA--ALLTVI-GYSVNDSVVLFDRIREL
SECF_RHOS4/117-305---LRFEWQFALG-SVAA.LIHDVLVTIGV-----FALFQ.....IKFDLTTVA--ALLTVL-GYSINDTVVVFDRLREN
O84454_CHLTR/1200-1393---LRFEWRYAFS-AICA.LMHDLLATCAV-----LVALHFFLQRIQIDLQAIG--ALMTVL-GYSLNNTLIIFDRIRED
SECF_MYCLE/183-379---VRYERYMAIS-ALTT.MCFDLTVTAGV-----YSLVG.....FEVTPATVI--GLLTIL-GFSLYDTVIVFDKVEEN
SECF_AQUAE/92-279---VRFQPVWGFG-AILA.LAHDVITVLGA-----YSITQ.....REVNLEVVS--AILVVA-GYSVADTVVIFDRIREN

PF02460

P91129_CAEEL/47-858IDWVLSKPILSIL-GVVS-AGIAILTGVGF-----LSLMG-----MPYNDIVGV--MPFLVL.AVGVDNMFLMVAAVRRT
O16307_CAEEL/1-766V..FSHNVVMAIL-GIAG-PLMATGTAFGF-----LFLFG-----FPFNSITLV--MPFLIIG.VGCDDVFIIIHAMRKT
O44978_CAEEL/31-791...VKMAFYLVAT-SLLT-PMAATVASFGA-----ICWMG-----FPSFSIQCV--TPFLVLG.IGVDDAFILLHRWKHH
Q18129_CAEEL/47-926PDWVRSKPLVAAA-GLMT-PIMATVTSFGL-----ILWCG-----FLYNAIVNV--SPFLIL.CIGIDDLFIMCAEWHRT
O61894_CAEEL/44-830...VTSKPIEAMI-GILV-SSMAIVSAGGL-----LFALG-----VPFINQVTV--MPFIAL.AIGVDDVYVMLGAWQDT
Q21883_CAEEL/44-838DQWSVHKVSEAIL-ACVC-PLLATSSALGT-----LFWFG-----FRFGTILCV--TPFLIL.AIGVDDAYLQVHACMRL
O16530_CAEEL/48-891.......PILAVM-ACVC-PFMACGASLGA-----MFFIG-----FRFGSILCV--TPFLVL.AIGVDDSYLMANAWQRI
Q19945_CAEEL/49-901IDWISSKPWLAAA-GMFS-TVLSIISAFGF-----LFILG-----VRYNVINTI--IPFLII.AIGIDDMFLMNACWDQT
Q09938_CAEEL/52-945IDWLRSKPMLALG-GVLS-SVLAILSGIGL-----LLWFG-----MFFAEITLI--APFLVL.SIGVDDMFIAVAAWHNT

PF03323

SP5AF_BACSU/18-482---YRQAPSVGTF.LRWV-RFFGILASTLF-LPIWF.LFV-----LQPDLLPDNMKF..IGL-NKDTHIPIILQIFLADL
GERAA_BACSU/13-470---YYERWISASL.IRSL-RFASIFITLFL-SSIYITLVS-----FHQGLLPTALAVTISAN-RENVPFPPIFEALLMEV
GERBA_BACSU/10-475---YSQRWIPMSL.VRLL-RYSSILITIYL-PGLYISLVS-----FHTGLLPTRMAISIAGS-RLNVPFPPFVEAFIMIF
Q2BAU7_9BACI/26-482---YNNRWYLGSF.FRFL-RLISFILSLIL-PAFYVAVVS-----YHHEIVPIELVYTLQAS-LNFVPVPPVIEAMFMQL
A9VUH9_BACWK/42-501---YGTRWLVASS.IRML-RFISFIIALFL-PASYVAFIS-----FNFEVIPVELYLSIAES-RTRVPFSPVMEALLMEI
Q3EV24_BACTI/19-484---YYLPWMIGSF.FRII-RFFGAIFSLFS-SAIYTAALT-----YHYQMIPADLLGPIIFS-RANVPFPPILEALFLEI
A9VG15_BACWK/27-487---YNIHWLIASF.FRLL-RFAGFIIAIFL-PAIYIAIVS-----FHFEIIPLDLYTSIATS-RVKVPFSPLLEAFIMEI
A5N0Y0_CLOK5/6-473---YSQRTLLSNF.NRIL-RVFGTFIVILL-PSIYLDLIR-----FNSELIPIKFIIPIVQS-RRGIALPPLLEILSMYV
Q2RIQ3_MOOTA/17-482---FRQAPLIGTF.LRVV-RFIGVLLSLFL-PPVWL.LAA-----LQHDLLPPNLAW..IGP-KQLGYIPLVWQFLFAEL
Q63G10_BACCZ/23-479---YNNRWIVGSF.VRMI-RLVSFLIAFLL-PAIYIATVA-----FHPDVLPLELVYTIKAS-LEKVPLPPIFEALLMEL
Q24YB3_DESHY/34-509---YFTTAEFSTF.IRIL-RFIGLNFSLML-PALTVAVFS-----FHQELIPLPLLATVAGA-RQELPFPIFLEILAMEI
Q24V55_DESHY/18-483---YRQEPIVGAY.LRWV-RFMGIFAALFL-LPLWL.ACA-----LNPHLLPEWLQF..LGI-QEVGKIGLIPQVFLAEF
A5D162_PELTS/61-534---YYERFIFASA.VRLV-RFFSMIVSLTL-PSLYIAVVS-----FHHELLPTALLLSIAAQ-REAVPFPVFVEVLVMEL
A6TLM7_ALKMQ/35-505---YYERFIFANM.VRLI-RYLGFVIATTF-PAIYVAVTT-----FHQDLLPADFILDIAKT-RVDVPFPPVVEAMLMEG
A7FX43_CLOB1/8-474---YNQTFMLSTV.IRLF-RVIAVILVLSL-TPIYLTFIK-----FNVELLPDKLLQPIIQS-RVGIALNPIMEIISMEL
Q5KX57_GEOKA/17-481---YRNKPIVGAY.LRLV-RFLAVWASLFL-LPLWY.LLM-----IEPELLPDPLQF..LGK-AKLGDIPLFAQILMIEI
B0KBH4_THEP3/30-504---YYERWMISSL.LRIL-RFLAAIVALVS-PAVYIAFTA-----YHPGLIPTKLTLYVAAT-RQGIPFPAFFEALIMEA
A4XN57_CALS8/19-490---YYSRPYYYSI.VRLL-RYFSFFVSTTL-PAIYIAITT-----FHQELLPTSLLISIASA-QAGIPFPSSVETLTMLL
Q2RIG8_MOOTA/33-500---YYERWPLSMG.IRLF-RFFGLFIALLL-PSVYVAWTS-----YHQEMIPTPLAISIAAQ-RELVPYPAVVEALIMQV
A4IND7_GEOTN/44-514---YYARFDIATA.LRFL-RVLIFFISLVA-PAAYIAGTM-----FHQEMIPTLLVIAIAAQ-REAVPFPAFVEALIMEV
A7GH93_CLOBL/5-469---YYQRKSFANI.SRLL-RWSALGISLFL-PGLYLALST-----HHFSLIPYVFIFKLSKA-RAGVPFPTIIEVLLMMF
A4J0K1_DESRM/54-524---YYTKYQWSTF.VRWL-RFFSLFLALTL-PSLYIAITT-----FHQEMLPTTLFVSVAAA-RKGVPFPAVVEALIMEV
Q5KZI4_GEOKA/26-506---NHTFFLFVIF.QRLI-RLVSTSVSILL-PGGWVALTS-----FHQDQLPFTLLATLVLS-RQGVPLPISLEMFIMMI
A8FDZ9_BACP2/13-474---YNMPWIAASC.FRLL-RIFAVIFSIFA-TPLYVAVLT-----FHYELIPKDLLETIVSS-RYLVPFPPIIEALFLEI
Q6HGW4_BACHK/14-474---YTMPWIMASF.FRLL-RIFAFIFSVLT-TPLYVAILT-----YHYELIPKELLETLIIS-RSKVPFPPVIEALFLEI
A7VGE7_9CLOT/28-516---YYNRWPVATF.ARII-RYIAAFIAVGL-PGFYIAVTC-----YHREVIPDKLLYAIAVA-RNQLSFPIVLEVLIMEL
Q3EQU5_BACTI/209-667---YNVSWLYATF.SRVL-RLIAVLFSICA-APLYVAVLN-----YHYELIPSDLLETLILS-RAQVPFPPLIEALFLEL
A3DD73_CLOTH/89-565---AYVRFPYANL.LRIM-RVIAIFMSLLL-PGLYVAITN-----YHHEMIPTDLLFAIEAS-RERVPFPSVVEIIIMEF
A7Z9E6_BACA2/10-475---YNQRWVPVTF.LRLL-RYTCILITIYL-PGLYISLVT-----FHTGLLPTRMAVTIAGS-RLNVPFPPFVEAFIMIF
A4J5A4_DESRM/139-610---YYLRPLFGSF.LRLV-RGLAFYISFLT-PGVYLAIVL-----FHKEMIPTELLLAISGS-REKVPFPSFLEVLLMEI
A9KKP5_CLOPH/10-482---YSENFMASSA.FRLL-RYITVLLSLLL-PAFYIAITT-----FHNQLLPVQMILSIQEA-KAKVPFSSWIEVLGLLF
A4XI75_CALS8/39-508---YYERWHIATV.IRIL-RVIAAITAMTL-QGFYISISS-----FTPSMIPPDLGLFIAAT-REGVPIPVFIEALFLEF
A4IQH7_GEOTN/19-483---YRQSPGVGTF.VRWV-RFLGILSSLFL-LPLWM.LFV-----LEPSLLPDSWAF..IGP-NKQTNIPVVIQILIADF
Q4MKT0_BACCE/35-495---YSFRPMIPSF.IRLL-RFTGLFIAIFA-PALYIAMIS-----FHYEVIPLKLLLTIGES-RAKIPFPPILEALLMEL
A6LS87_CLOB8/10-467---YYFPLFTGNY.LRIV-RNFVMLATILL-TPVYL.MIV-----NGNIFIPSYFDF..LKP-QEEFALPLLGQFMLLEF
A8FI46_BACP2/20-474---YNSRWIPATF.IRVL-RYLACIIAVIL-PSFYIAVIG-----FHYEVVPDELAITMKNS-IIGIPFPPLIEAMLMEI
Q5WGG7_BACSK/24-483---YFLPWPLASA.FRLI-RLCAVLFSILS-TALYVAVMT-----YHYEMIPTQLLHKLVSS-RSGIPFPPIFEALILEV
Q24NX7_DESHY/41-512---YYSRPYFVGI.VRMI-RFLSYFISVFG-PAIFVALST-----FHQELIPTPLLFTMAAA-EEDVPFPAVIEALTMGA
A8ML63_ALKOO/33-512---YYTRIISSNL.TRFF-RFMGFFIATSL-PSIYVALIS-----FHHEMIPMNLLIDLSKN-RTNVPFPPVIEALLMEV
Q9KCW3_BACHD/24-484---YFLKWHIASI.FRLI-RLFSVLFSIFV-TPMYVAVLT-----YHPELIPQDLLATLTLS-RSAIPFPPILEALFLEV
Q0TRQ3_CLOP1/10-472---YYLPVITGNF.IRLI-RNFILISTIFI-TPLYL.LLI-----QNAYRIPDYLKF..LLP-VDGYKVPLIVQFLLLEV
Q46191_CLOPA/46-510---YYTNYIPATL.NRCF-RYIGLMITLTL-PGIYVALVT-----FHHELIPTPFITTIIKA-RAGIP