Sequence alignment for CL0322

PF12349

O16307_CAEEL/208-358--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
B4Q8Q7_DROSI/652-804--------------------------------------------------------------------------------
F7ANF6_MACMU/1-147--------------------------------------------------------------------------------
G1MH71_AILME/663-814--------------------------------------------------------------------------------
H3CDQ1_TETNG/587-739--------------------------------------------------------------------------------
Q23E28_TETTS/401-549--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/315-463--------------------------------------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402---------------A-ILPSDAPVLVSTRQMTAAFRE..AGLQSVA--VVVL.SDAKGLGA.ADERSYKELVDALRRDT
A0A038KNA6_MYCTX/676-1049---------------G-LRGALATVIRAMGSLGMSSPGGVRS..KIN--LVNKGVNDLADGSRQLAEGVQLLVDQVKKMG
A0A038KM54_MYCTX/59-388---------------S-LSPKDAPSFEAMGRIGMVFKE..GDSDSFA--MVII.EGNQPLGD.AAHKYYDGLVAQLRADK
A0A050EJJ2_MYCTX/63-393---------------S-MSPDAAPSMISMKHIGKVFEE..GDSDSAA--MIVL.EGQRPLGD.AAHAFYDQMIGRLQADT
A0A050EJJ2_MYCTX/612-950---------------V-MTEDINNLLPLMQRLDTLMPQLTAMMPEMI--QTMKSMKAQMLSMHSTQEGLQDQMAAMQEDS
MMPLB_STRCO/48-383---------------N-LPPAASDSMKARDLVRAQLPG..QDATPAI--IVVRGKGTDAAKSATQSVAAITSALSGTSRP
B8ZT45_MYCLB/57-385---------------S-LSPKDAPSYIAMQKMGQVFNE..GNSDSVI--MIVL.EGDKPLGD.DAHRFYDGLIRKLRAD.
A0A038F826_MYCTX/74-391---------------A-LLPQDAKTAAATSRIAQAFPG..TGSNAIA--YLVV.EGGSTLEP.QDQPYYDAAVGALRADT
A0A038KV10_MYCTX/29-358---------------A-VLPADAPSSVAVRQMAEAFHE..SGSENIL--VVLL.TDEKGLGA.ADENVYHTLVDRLRNDA
A0A038KR05_MYCTX/52-381---------------A-LGPHDAPSLIAMKRIGKDFQQ..FDSDTTA--MVLL.EGQEKLGD.EAHRFYDVLVTKLSQDT
A0A038KR05_MYCTX/600-941---------------K-LTEDLANLTDDTERMDTTQRQLLAQLDPTI--ATMQTVKDLAQTLTSAFSGLVTQMEDMTRNA
A0A038KUL5_MYCTX/58-387---------------A-VAPDDAQSMRAMRRAGKVFNE..FDSNSIA--MVVL.ESDQPLGE.KAHRYYDHLVDTLVLDQ
A0A038KUL5_MYCTX/606-944---------------T-LTDQLRALTDDMNKMEALTPQFLALLPPMI--TTMKTMRTMMLTMRSTISGVQDQMADMQDHA
J7JRH5_BACIU/44-362---------------D-MSIPDTPSEKAMDVIQKEFPH.GPDKGSIR--VIFGAGDGEKLTGKPAKKAIEDTFKEISKDD
J7JSG3_BACIU/39-360---------------A-QLPADAVS....ERANAILKQ.AGEDNNSI--SVVF.TLDNAIKK.ETENQLRIIIDKIKKID
A0A038LFT5_MYCTX/28-366---------------Q-LGEQLASVTVTLDKLAAIQPQLVALLPDEI--ASQQINRELALANYATMSGIYAQTAALIENA
A0A038WJQ1_MYCTX/54-382---------------S-MSPSDAASIQAIKRVGQVFGE..FDSDNAV--TIVL.EGDQPLGG.DAHRFYSDLMRKLSADT
A0A038WJQ1_MYCTX/601-939---------------Q-LSEKLEYLVKDMDILITLLPQMRAQMPPMI--SAMTTMRDMMLIWHGTLGAFYKQQERNNKDP
MMPLA_MYCLE/55-391---------------V-ILPVDAPSSVAAKKISQAFHE..VDSENVL--IVLL.TDDKGLGP.ADETVYRTLVDRLRNDT
Q50086_MYCLR/31-369---------------Q-IDERLNSIVGDIKNMDLLMPQMLEQFPPMI--ESMESMRTIMLTMHSTMSGIFDQMNELSDNA
A0A038KVP1_MYCTX/55-384---------------A-PLPPGAPSMVLQKEMSAAFQE.KIETSALL--LVLL.TNENGLGP.ADEAVYRKLIENLRADT
A0A038KVP1_MYCTX/658-1001---------------T-LDGQLKQVVSTLKAV.....DGLPT..KLA--QMQQGANALADGSAALAAGVQELVDQVKKMG
MMPLA_STRCO/46-370---------------A-WLPGNAESTEVLE.LSEKFQP..ADTSPTV--IVYDRPSGITA...ADEAKARADATHFADGT
MMPLA_STRCO/397-682---------------D-GFKTKPESVVGEEILTRHFPA..GSGEPMV--VI............AKGASADQVHAALETVP
Q9RKC1_STRCO/44-379---------------S-FSIPGTEAQKAFDLLEQRFPGASADGATAR--VVFKAPAGETMTDAGNKATVEKTVDEL.ADG
Q9RL63_STRCO/44-395---------------S-DSMPGIESQHAFDLINERFPGAEAEGADAR--IVLVAPDGRQVTASEYRAAIDTLVAEV.ADG
MMPLD_STRCO/50-373---------------S-FLPRSAESTRVVD.AQQAFQQ..DETLPVI--VVWTADGDGDAAVTAHQQAATRSVAGLEGDP
A0A038LLM0_MYCTX/43-376---------------P-FSPAGTATSRAVERSAAAFSQ..APGDNIG--YLVL.ERNGVLND.QDRAYYDALVVALRRDS
A0A038LLM0_MYCTX/595-943---------------E-SCAKLADAAGQLARGIADVASATSGVSGLP--NALDGIGGQLAQVRESAAGVQELLNNV..GA
Q9XCF5_MYCAV/55-384---------------S-LSPIGAPSFKAMERLGEDFKE..TNTGALA--MILL.EGQQQLGD.DAHTYYDRLIRLLENDH
Q9XCF5_MYCAV/604-943---------------E-INDKLGDLVKNLDQLDALLPQLVMQIPPMI--ETMSSMRTMMLTMHSTMSGVMGQMDSSAKDP
Q9XCF6_MYCAV/51-382---------------P-LAPQDAPAVQAMQRMGRDFKE..SDSDSLR--HACCSEGHHQLGRLTAHAYYDKLVRELRNDT
Q9XCF6_MYCAV/601-939---------------T-LSDKMIDLVRDLDHMDRLMPLLLEQYPEMI--AMSEDMRNMLLTNHSTMSGIIGQMDSNSKDA
Q9Z577_STRCO/40-368---------------D-YGIPGTGSDRASRLLESRFPDLGGDSDT..--.IVWHTTSGTVRAADVEQAMTRTLDRI.ADL

PF00873

CZCA_RALME/5-1037IISFAIQQRWLVLLAV-FGMAGLGIFSYNRLPIDAVPD--ITNVQVQ--VNTSAPGYSPLETEQRATYPIEVVMAGLPGL
MEXB_PSEAE/1-1028MSKFFIDRPIFAWVIA-LVIMLAGGLSILSLPVNQYPA--IAPPAIA--VQVSYPGASAETVQDTVVQVIEQQMNGIDNL
MDTB_ECOLI/12-1023PSRLFIMRPVATTLLM-VAILLAGIIGYRALPVSALPE--VDYPTIQ--VVTLYPGASPDVMTSAVTAPLERQFGQMSGL
ACRF_ECOLI/1-1029MANFFIRRPIFAWVLA-IILMMAGALAILQLPVAQYPT--IAPPAVS--VSANYPGADAQTVQDTVTQVIEQNMNGIDNL
P74461_SYNY3/10-1047LSGLAIRRHIATLMLT-LAIIVLGVFAVFSLPVDLLPS--ITYPRIG--VRLDAPGVSPEVAVDEITRPLEAALSATEGV
O25622_HELPY/6-1014IIEFSLRQRVIVIVGA-ILILFFGTYSFINTPVDAFPD--ISPTQVK--IILKLPGSSPEEMENNIVRPLELELLGLKGQ
MDTF_ECOLI/1-1028MANYFIDRPVFAWVLA-IIMMLAGGLAIMNLPVAQYPQ--IAPPTIT--VSATYPGADAQTVEDSVTQVIEQNMNGLDGL
Q55935_SYNY3/9-1024ILKTSIAQRWFIVIAA-IGITLWGIISVGQMPLDVFPE--FAPPQVD--IHTEAPGLAPEEVETQITVPIESAVNGLPGV
ACRB_ECOLI/1-1030MPNFFIDRPIFAWVIA-IIIMLAGGLAILKLPVAQYPT--IAPPAVT--ISASYPGADAKTVQDTVTQVIEQNMNGIDNL
MDTC_ECOLI/3-1009FFALFIYRPVATILLS-VAITLCGILGFRMLPVAPLPQ--VDFPVII--VSASLPGASPETMASSVATPLERSLGRIAGV
ACRD_ECOLI/1-1027MANFFIDRPIFAWVLA-ILLCLTGTLAIFSLPVEQYPD--LAPPNVR--VTANYPGASAQTLENTVTQVIEQNMTGLDNL
P73998_SYNY3/2-1028FVDFFIKRPVFSSVCA-IIILLVGTISIFSLPIAQFPE--VAPTTIQ--VSSNYSGANAEVVERAVTDILERQINGVQGM
O25328_HELPY/1-1011MYKTAINRPITTLMFA-LAIVFFGTMGFKKLSVALFPK--IDLPTVV--VTTTYPGASAEIIESKVTDKIEEAVMGIDGI
Q5ZWS7_LEGPH/6-1036IIRFSLKHRWFVLLFT-FIIAVLGVYNFQRLPIDAVPD--ITNVQVQ--INTQASGYSPFEVEQRITFPIELAMSGLPNL
Q9I0Y8_PSEAE/3-1040FSQFFIQRPIFAAVLS-LLILIGGAISLFQLPISEYPE--VVPPTVV--VRANFPGANPKVIGETVASPLEQAITGVENM

PF02355

SECF_METTH/102-285-------------------------------------------------------------VSEA.LRGTAT....INSY
SECF_BORBU/108-297-------------------------------------------------------------TILDKLKETFDANIEVLDS
SECDF_BACSU/540-729-------------------------------------------------------------KVKTYFKDKYG...SDPNV
SECF_STRCO/109-305-------------------------------------------------------------IKEDLSKNLDV.SAEKINA
SECF_HAEIN/120-308-------------------------------------------------------------HVKSMLQNVDK.DIQIRSI
SECF_ECOLI/114-302-------------------------------------------------------------VLKVINESTNQ.NAAVKRI
SECF_SYNY3/108-301-------------------------------------------------------------VQKALNEGIGKFDPETIQI
SECF_RICPR/110-299-------------------------------------------------------------IIKTSLRNNFPYNFEYRKV
SECF_HELPY/106-293-------------------------------------------------------------IVANILKPSG..DFEIRKF
SECF_RHOCB/123-311-------------------------------------------------------------KVETALTAVDP.ALKITSF
SECF_METJA/88-276-------------------------------------------------------------QKIKEFFHVDSLDKLNYSE
SECF_TREPA/222-411-------------------------------------------------------------VYAALVRAYGADHVVRLAM
Q9ZBS8_STRCO/569-757-------------------------------------------------------------TVTKAVAELGG.ETEKVRD
SECF_RHOS4/117-305-------------------------------------------------------------QVEEALKTVDP.SITFPSV
O84454_CHLTR/1200-1393-------------------------------------------------------------DSGSSTTSMVF.DASRGSW
SECF_MYCLE/183-379-------------------------------------------------------------AFGPKGADAKP.SKQAISD
SECF_AQUAE/92-279-------------------------------------------------------------KLEDVLKKFG..KYELIRK

PF02460

O16307_CAEEL/1-766MDNLLRRDYLDGVD...SLAEYLQYNFTVPCS...GVRGENKLECSF..SDLCSGQCND.........NQKYLNKLRSNN
P91129_CAEEL/47-858NPLSDAVYLFTPLGAQ.SKMERMSIHEKWPLTDNNYIPGRAVTQSRE..IQVTALARND.....SNILDPKFANAVYQLD
O44978_CAEEL/31-791VLSSGLVHIRLEPDIRKAFSPDDSDAGYETRVWLEYYGLDIYPERAF..CIFTAKRENS......SILQEGALADIYTVD
Q18129_CAEEL/47-926QTTNDPQYVFSPANAP.WRYERAVLTEHWPLDEEKFWPGKSYDLHGY..VDVIASGRIHPDYGRPNILNIRYLDEVARIN
O61894_CAEEL/44-830IFSFGILNMRTEDDLR.FLYSPEHSLSREEYQVHKDFSGDSKNNSFV..SITIQTSSED.....KNLLKKDLAQKLIQLN
Q21883_CAEEL/44-838FCSSKICFTKQEDDIKTGYTPVGARSLDEIEVFSDFFASTGDPIAVF..LFITAKDNSS.......MADYNTMKEVVDIM
O16530_CAEEL/48-891VLSLKIPFTRMQNDIS.DFTPFGARSRVELEKYRKFFNNHGEPKAIY..AFITSKVGDN.......MLGISQLNDTVHVL
Q19945_CAEEL/49-901LRVDDPSYVFTPSDAR.WRREISVFNENWPLDENKFLPGKSFEAKRFVNILIRAKDGGS.......IMRDNVLHEIEILN
Q09938_CAEEL/52-945LTLLDARKLYTPVSAP.SWKEEQVFSELWPVKSYEFLPERTFQWNRY..LYLVVHGRPYENGTYPNILEGSYLNDIAKIE

PF12349

O16307_CAEEL/208-358--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
B4Q8Q7_DROSI/652-804--------------------------------------------------------------------------------
F7ANF6_MACMU/1-147--------------------------------------------------------------------------------
G1MH71_AILME/663-814--------------------------------------------------------------------------------
H3CDQ1_TETNG/587-739--------------------------------------------------------------------------------
Q23E28_TETTS/401-549--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/315-463--------------------------------------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402RDVVMLQDF......................VT.......................TPP....LRELMTSK---------
A0A038KNA6_MYCTX/676-1049FGLGEASAFLLAMKDTATTPAMAGFYIPPELLSYATGESVKAETMPSEYRDLLGGLNVDQLKKVAAAFISP---------
A0A038KM54_MYCTX/59-388KHVQSVQDL......................WG.......................DPL....TAAGVQSN---------
A0A050EJJ2_MYCTX/63-393THVQSLQDF......................WG.......................DPL....TATGAQSS---------
A0A050EJJ2_MYCTX/612-950AAMGEAFD.........ASRNDDSFYLPPEVFD.......................NPD.FQRGLEQFLSP---------
MMPLB_STRCO/48-383DHVVSVVST......................VT.......................APD....AAAELVSQ---------
B8ZT45_MYCLB/57-385KHVQSVQDF......................WG.......................DPL....TAPGAQSN---------
A0A038F826_MYCTX/74-391RHVGSVLDW......................WS.......................DPV....TAPLGTSP---------
A0A038KV10_MYCTX/29-358KDVVMLQDF......................LT.......................TPP....LREVLGSK---------
A0A038KR05_MYCTX/52-381THVQHIENF......................WG.......................DPL....TAAGSQSA---------
A0A038KR05_MYCTX/600-941TVMGRTFD.........AANNDDSFYLPPEAFQ.......................NPD.FQRGLKLFLSP---------
A0A038KUL5_MYCTX/58-387SHIQHIQDF......................WR.......................DPL....TAAGAVSA---------
A0A038KUL5_MYCTX/606-944TAMGQAFD.........TAKSGDSFYLPPEAFD.......................NAE.FQQGMKLFLSP---------
J7JRH5_BACIU/44-362S.VDSIASP......................................................FVTGTIAK---------
J7JSG3_BACIU/39-360GVEEVTSPL......................SA.......................EKE....VKDQLMSK---------
A0A038LFT5_MYCTX/28-366AAMGQAFD.........AAKNDDSFYLPPEAFD.......................NPD.FQRGLKLFLSA---------
A0A038WJQ1_MYCTX/54-382RHVAHIQDF......................WG.......................DPL....TAAGSQSA---------
A0A038WJQ1_MYCTX/601-939GAMGRVFD.........AAQIDDSFYLPQSAFE.......................NPD.FKRGLKMFLSP---------
MMPLA_MYCLE/55-391KDVVVLQDF......................LS.......................TPP....LHELLVSK---------
Q50086_MYCLR/31-369NTMGKAFD.........TAKNDDSFYLPPEVFK.......................NTD.FKRAMKSFLSS---------
A0A038KVP1_MYCTX/55-384QDKISVQDF......................LA.......................VPE....MKELLASK---------
A0A038KVP1_MYCTX/658-1001SGLNEAADFLLGIKRDADKPSMAGFNIPPQIFS.......................RDE.FKKGAQIFLSA---------
MMPLA_STRCO/46-370GVVGEPYGP..........................................................VRSD---------
MMPLA_STRCO/397-682GVIEVAPPQ............................................................VK---------
Q9RKC1_STRCO/44-379SEVASVADP......................................................YTGNAVSE---------
Q9RL63_STRCO/44-395PQVAAVSDP......................................................LDAATVSQ---------
MMPLD_STRCO/50-373GIVGPASPA..........................................................LPSD---------
A0A038LLM0_MYCTX/43-376RHVIEVVDW......................WG.......................TPA....IAEVARSD---------
A0A038LLM0_MYCTX/595-943APLRELPDYLRELAAVSQSAPGVDLYAARRILT.......................DPN.MRAVLDYFVSP---------
Q9XCF5_MYCAV/55-384KHVQHVQNF......................WG.......................DPL....TRGAAQSQ---------
Q9XCF5_MYCAV/604-943SAMGQAFD.........ASRNDDSFYLPPGIIN.......................GSDSFKRVEKVFMSP---------
Q9XCF6_MYCAV/51-382KHVEHVQDL......................WG.......................DRL....TQAGAQSP---------
Q9XCF6_MYCAV/601-939TAMGEAFD.........ASKNDDSFYLPPDIFE.......................NAD.FKKAMSQFLSP---------
Q9Z577_STRCO/40-368PGVAAVSNP...................................................YHDADSPLISE---------

PF00873

CZCA_RALME/5-1037EQTRSLS.RYGLSQVTVIFKDGTDVYFARQLVNQRIQEAKDNLPEGV..VPAMGPISTGLGEIYLWTVEAEEGARKADGT
MEXB_PSEAE/1-1028RYISSESNSDGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEV.QRQGIRVTKAVKNFLMVVGVVST.......DG
MDTB_ECOLI/12-1023KQMSSQS.SGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTLAVTST.........
ACRF_ECOLI/1-1029MYMSSTSDSAGSVTITLTFQSGTDPDIAQVQVQNKLQLATPLLPQEV.QQQGISVEKSSSSYLMVAGFVSD.......NP
P74461_SYNY3/10-1047VQVYSQT.REGQISLDLFFEPGGNIDQALNDATATFNRARNQLPDDL.ETPRLFKFDPSQLPVYEFAVTSP.........
O25622_HELPY/6-1014KSLRSVS.KYSISDITIDFDDSVDIYLARNIVNERLSSVMKDLPVGV..EGGMAPIVTPLSDIFMFTIDGN.........
MDTF_ECOLI/1-1028MYMSSTSDAAGNASITLTFETGTSPDIAQVQVQNKLQLAMPSLPEAV.QQQGISVDKSSSNILMVAAFISD.......NG
Q55935_SYNY3/9-1024TTVRSSS.KVGLSMVSVVFDQDADVYKARQTVTERLQQVTNQLPEGS.HPPEISPLVSPLGTIVQYAFTIK......DGG
ACRB_ECOLI/1-1030MYMSSNSDSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEV.QQQGVSVEKSSSSFLMVVGVINT.......DG
MDTC_ECOLI/3-1009SEMTSSS.SLGSTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKANPSDAPIMILTLTSD.........
ACRD_ECOLI/1-1027MYMSSQSSGTGQASVTLSFKAGTDPDEAVQQVQNQLQSAMRKLPQAV.QNQGVTVRKTGDTNILTIAFVST.......DG
P73998_SYNY3/2-1028RYISSTSSNDGTSSITVTFDRSQNKDIAAVDVQNRVALAEPQLPEAV.RRTGIRVNKESNALLLGIGITSP.......DG
O25328_HELPY/1-1011KKVTSTS.SKNVSIVVIEFELEKPNEEALNDVVNKISSVRFD.DSNI.KKPSINKFDTDSQAIISLFVSSS.........
Q5ZWS7_LEGPH/6-1036DYTRSLS.RYGLSQVTVVFKDGTNIYFARQLINERLQEVKDKLPPEA..ETTLGPISTGLGEIFMYTVTNKSN..LPKSQ
Q9I0Y8_PSEAE/3-1040LYMSSQSTSDGKLTLTITFALGTDLDNAQVQVQNRVTRTEPKLPEEV.TRLGITVDKASPDLTMVVHLTSP.......DN

PF02355

SECF_METTH/102-285KAVGPVLSK-----------------------------------------------------------------------
SECF_BORBU/108-297YFIDSSFSS-----------------------------------------------------------------------
SECDF_BACSU/540-729STVSPTVGK-----------------------------------------------------------------------
SECF_STRCO/109-305DLVGPSWGD-----------------------------------------------------------------------
SECF_HAEIN/120-308EFVGPNVGE-----------------------------------------------------------------------
SECF_ECOLI/114-302EFVGPSVGA-----------------------------------------------------------------------
SECF_SYNY3/108-301DTVGPTVGK-----------------------------------------------------------------------
SECF_RICPR/110-299DFVGPQVGR-----------------------------------------------------------------------
SECF_HELPY/106-293DTVGPRVGS-----------------------------------------------------------------------
SECF_RHOCB/123-311ESVGPKVSG-----------------------------------------------------------------------
SECF_METJA/88-276KTIGATLSS-----------------------------------------------------------------------
SECF_TREPA/222-411DFVGSRFSH-----------------------------------------------------------------------
Q9ZBS8_STRCO/569-757ELIGPSLGE-----------------------------------------------------------------------
SECF_RHOS4/117-305ESVGPKVSG-----------------------------------------------------------------------
O84454_CHLTR/1200-1393FKVSGQLSN-----------------------------------------------------------------------
SECF_MYCLE/183-379AAVSETWGG-----------------------------------------------------------------------
SECF_AQUAE/92-279ETISGVVSE-----------------------------------------------------------------------

PF02460

O16307_CAEEL/1-766EKNLQ.........................VIPLFN......LIYRNASSRL.....HPN....................
P91129_CAEEL/47-858KYIQTRV.......................RVLHNG....HYYSYKNLCLQYKNGGCPSNKHV.................
O44978_CAEEL/31-791NRLSAAV.......................GYQDGD......G..RKNCDPLCDLNSPFHLLAN................
Q18129_CAEEL/47-926DYIIHNL.......................TVPVDINGKHYDIAYTDLCMRY.DWACYLNDHITMLMPKTRWGNFSGPFA
O61894_CAEEL/44-830KYVLEKM.......................EIQVDG...KIINFGKEVCSRMKQCELSNTIATIFLD...........TF
Q21883_CAEEL/44-838DYVGSN.........................LTHKG......ESFYTLCTDFCQINEPVRQYYNGL.............A
O16530_CAEEL/48-891DTISRDF.......................YLKTSQ....GPKNFEEYCSGFCLLNEPVKHFYSG...............
Q19945_CAEEL/49-901QWIMNNI.......................SIPTDDL..KFNLTYQDLCLSY.DWVCGANEHIQM..............L
Q09938_CAEEL/52-945EELVTNVSFPREAALEDNPALMRKRHLNETEIEENR...NITITFKDVCMNW.YGDCYREKNVI................

PF12349

O16307_CAEEL/208-358--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
B4Q8Q7_DROSI/652-804--------------------------------------------------------------------------------
F7ANF6_MACMU/1-147--------------------------------------------------------------------------------
G1MH71_AILME/663-814--------------------------------------------------------------------------------
H3CDQ1_TETNG/587-739--------------------------------------------------------------------------------
Q23E28_TETTS/401-549--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/315-463--------------------------------------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402-------------------------------------------------------------------------------D
A0A038KNA6_MYCTX/676-1049-------------------------------------------------------------------------------D
A0A038KM54_MYCTX/59-388-------------------------------------------------------------------------------D
A0A050EJJ2_MYCTX/63-393-------------------------------------------------------------------------------D
A0A050EJJ2_MYCTX/612-950-------------------------------------------------------------------------------D
MMPLB_STRCO/48-383-------------------------------------------------------------------------------D
B8ZT45_MYCLB/57-385-------------------------------------------------------------------------------D
A0A038F826_MYCTX/74-391-------------------------------------------------------------------------------D
A0A038KV10_MYCTX/29-358-------------------------------------------------------------------------------D
A0A038KR05_MYCTX/52-381-------------------------------------------------------------------------------D
A0A038KR05_MYCTX/600-941-------------------------------------------------------------------------------D
A0A038KUL5_MYCTX/58-387-------------------------------------------------------------------------------D
A0A038KUL5_MYCTX/606-944-------------------------------------------------------------------------------N
J7JRH5_BACIU/44-362-------------------------------------------------------------------------------D
J7JSG3_BACIU/39-360-------------------------------------------------------------------------------D
A0A038LFT5_MYCTX/28-366-------------------------------------------------------------------------------D
A0A038WJQ1_MYCTX/54-382-------------------------------------------------------------------------------D
A0A038WJQ1_MYCTX/601-939-------------------------------------------------------------------------------D
MMPLA_MYCLE/55-391-------------------------------------------------------------------------------D
Q50086_MYCLR/31-369-------------------------------------------------------------------------------D
A0A038KVP1_MYCTX/55-384-------------------------------------------------------------------------------D
A0A038KVP1_MYCTX/658-1001-------------------------------------------------------------------------------D
MMPLA_STRCO/46-370-------------------------------------------------------------------------------D
MMPLA_STRCO/397-682-------------------------------------------------------------------------------D
Q9RKC1_STRCO/44-379-------------------------------------------------------------------------------D
Q9RL63_STRCO/44-395-------------------------------------------------------------------------------D
MMPLD_STRCO/50-373-------------------------------------------------------------------------------D
A0A038LLM0_MYCTX/43-376-------------------------------------------------------------------------------D
A0A038LLM0_MYCTX/595-943-------------------------------------------------------------------------------N
Q9XCF5_MYCAV/55-384-------------------------------------------------------------------------------D
Q9XCF5_MYCAV/604-943-------------------------------------------------------------------------------D
Q9XCF6_MYCAV/51-382-------------------------------------------------------------------------------D
Q9XCF6_MYCAV/601-939-------------------------------------------------------------------------------D
Q9Z577_STRCO/40-368-------------------------------------------------------------------------------N

PF00873

CZCA_RALME/5-1037AYTPTDLREIQDWVVRPQLRNVPGVTEINTIGGFNKQYLVAPSLERLASYGLTLTDVVNALNKNNDNVGAGYI......E
MEXB_PSEAE/1-1028SMTKEDLSNYIVSNIQDPLSRTKGVGDFQVFG.SQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGQLGGLPAVK
MDTB_ECOLI/12-1023AMPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSL......D
ACRF_ECOLI/1-1029GTTQDDISDYVASNVKDTLSRLNGVGDVQLFG.AQYAMRIWLDADLLNKYKLTPVDVINQLKVQNDQIAAGQLGGTPALP
P74461_SYNY3/10-1047ELSGPSLRVFAEEELARELGVVPGVASVNVSGAAQEEVRINVDLQRLQRSGVSLTQVLDALQSRNVDISGGRI......V
O25622_HELPY/6-1014.ITEIEKRQLLDFVIRPQLRMISGVADVNSIGGFSRAFVIVPDFNDMARLGVSISDLESAVRVNLRNSGAGRV......D
MDTF_ECOLI/1-1028SLNQYDIADYVASNIKDPLSRTAGVGSVQLFG.SEYAMRIWLDPQKLNKYNLVPSDVISQIKVQNNQISGGQLGGMPQAA
Q55935_SYNY3/9-1024SSNLMDLRRLLETTVGNQLLSVPGVSQVTLYGGDERQEQVLVDPAKLRALKVSLNEVTQASAEANSNAPGGFL......I
ACRB_ECOLI/1-1030TMTQEDISDYVAANMKDAISRTSGVGDVQLFG.SQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGTPPVK
MDTC_ECOLI/3-1009TYSQGELYDFASTQLAPTISQIDGVGDVDVGGSSLPAVRVGLNPQALFNQGVSLDDVRTAVSNANVRKPQGAL......E
ACRD_ECOLI/1-1027SMDKQDIADYVASNIQDPLSRVNGVGDIDAYG.SQYSMRIWLDPAKLNSFQMTAKDVTDAIESQNAQIAVGQLGGTPSVD
P73998_SYNY3/2-1028EYDNVFLSNYADRYLVDPIRRLEGVGDVRIFGERLYAMRLWVDPMKLAAQQLTMADLSRALQEQNLQVGAGQIGAEPAPP
O25328_HELPY/1-1011SVPATTLNDYAKNTIKPMLQKINGVGGVQLNGFRERQIRIYANPTLMNKYNLTYADLFSTLKAENVEIDGGRI......V
Q5ZWS7_LEGPH/6-1036RYNPMELRTIQDWIIKPQLRNVEGVAEVNTIGGYEKQFHITPDPTKLVRYGLSLNNVVEALERNNANVGAGYI......E
Q9I0Y8_PSEAE/3-1040RYDMLYLSNYAVLNVKDELARLDGVGDVQLFGLGDYSLRVWLDPNKVASRNLTATDVVNAIREQNRQVAAGTLGAPPAPS

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

O16307_CAEEL/1-766.......------------------------------------------------------------------------.
P91129_CAEEL/47-858HILSDLH------------------------------------------------------------------------N
O44978_CAEEL/31-791.LTRRNN------------------------------------------------------------------------G
Q18129_CAEEL/47-926ELASDII------------------------------------------------------------------------N
O61894_CAEEL/44-830WSEKLRK------------------------------------------------------------------------D
Q21883_CAEEL/44-838MKQQNLS------------------------------------------------------------------------E
O16530_CAEEL/48-891MLISGQH------------------------------------------------------------------------G
Q19945_CAEEL/49-901.LRRNDV------------------------------------------------------------------------N
Q09938_CAEEL/52-945ELLKRRH------------------------------------------------------------------------E

PF12349

O16307_CAEEL/208-358--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
B4Q8Q7_DROSI/652-804--------------------------------------------------------------------------------
F7ANF6_MACMU/1-147--------------------------------------------------------------------------------
G1MH71_AILME/663-814--------------------------------------------------------------------------------
H3CDQ1_TETNG/587-739--------------------------------------------------------------------------------
Q23E28_TETTS/401-549--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/315-463--------------------------------------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402NQAWILPVGLPGDLGSTQSKQAYARV-------------------------------------ADIVEHQV...AGSTLT
A0A038KNA6_MYCTX/676-1049GHSIRYLIQTDLNPFSTAAMDQIDAI-------------------------------------TAAARGAQPNTALADAK
A0A038KM54_MYCTX/59-388GKAAYVQLSLAGNQGTPLANESVEAV-------------------------------------RSIVESTP...APPGIK
A0A050EJJ2_MYCTX/63-393GKAAYVQVKLAGNQGESLANESVEAV-------------------------------------KTIVERLA...PPPGVK
A0A050EJJ2_MYCTX/612-950GHAVRFIISHEGDPMSQAGIARIAKI-------------------------------------KTAAKEAIKGTPLEGSA
MMPLB_STRCO/48-383RGAQLVIVPMEGSPSDESFQNAVDEV-------------------------------------RALASDRA.....GPAD
B8ZT45_MYCLB/57-385GKAAYVQLSLAGNQGELLAQESIDAV-------------------------------------RKIVVQTP...APPGIT
A0A038F826_MYCTX/74-391GRSATAMVWLRGEAGTTQAAESLDAV-------------------------------------RSVLRQLP...PSEGLR
A0A038KV10_MYCTX/29-358GKAWILPIGLAGDLGTPKSYHAYTDV-------------------------------------ERIVKRTV...AGTTLT
A0A038KR05_MYCTX/52-381GKAAYVQLNLTGDQGGSQANESVAAV-------------------------------------QRIVDSVP...PPPGIK
A0A038KR05_MYCTX/600-941GTCARFVITHRGDPASAEGISHIDPI-------------------------------------MQAADEAVKGTPLQAAS
A0A038KUL5_MYCTX/58-387GKAAYVQLYLAGNMGEALANESVEAV-------------------------------------RKIVANST...PPEGIR
A0A038KUL5_MYCTX/606-944GKAVRFVISHESDPASTEGIDRIEAI-------------------------------------RAATKDAIKATPLQGAK
J7JRH5_BACIU/44-362GTVAYADIQYK.SSADDIKDYSIKHL-------------------------------------KDSLKMAD....DEGLQ
J7JSG3_BACIU/39-360KKTVLMPVTITG......SDKKAEKI-------------------------------------ADEIYQIV....PDDLT
A0A038LFT5_MYCTX/28-366GKAARMIISHEGDPATPEGISHIDAI-------------------------------------KQAAHEAVKGTPMAGAG
A0A038WJQ1_MYCTX/54-382DRAAYVVVYLVGN.NETEAYDSVHAV-------------------------------------RHMVDTTP...PPHGVK
A0A038WJQ1_MYCTX/601-939GKAARFVIALEGDPATPEGISRVEPI-------------------------------------KREAREAIKGTPLQGAA
MMPLA_MYCLE/55-391GKAWILPIVLAGELGTSASYQAYAGV-------------------------------------AGIVKQTLESTAGSSLK
Q50086_MYCLR/31-369GHAARFIILHRGDPASVAGIASINAI-------------------------------------RTAAEEALKGTPLEDTK
A0A038KVP1_MYCTX/55-384NKAWNLPITFAGDAASPETQAAFKRV-------------------------------------AAIVKQTV...AGTSLT
A0A038KVP1_MYCTX/658-1001GHAARYFVQSALNPATTEAMDQVNDI-------------------------------------LRVADSARPNTELEDAT
MMPLA_STRCO/46-370GKALRTVVNVHLGKDGWEGLNAAAKD-------------------------------------MRAIARPS...APDGLG
MMPLA_STRCO/397-682GLA.YVEATLGAGADSPAAMRSVTAA-------------------------------------RETLARLD......GAQ
Q9RKC1_STRCO/44-379GTIAYASVKYD.VSGMELEESTKDAL-------------------------------------EDAAQQAR....DAGLT
Q9RL63_STRCO/44-395GSTAYATVTYE.VTEDNVTDAGRADL-------------------------------------TAAVERAR....TSGLT
MMPLD_STRCO/50-373GRALQAVVQVEPDLGERLP.DVLADI-------------------------------------GDAAGQVP......GTR
A0A038LLM0_MYCTX/43-376HHAVTAALRFGGMVGTSQAGESITAA-------------------------------------RSIVTQLH...PPDGLH
A0A038LLM0_MYCTX/595-943GHATRLLVYGDGSEWGDDGAQRARAI-------------------------------------VTAVAEETDEGTLRPTA
Q9XCF5_MYCAV/55-384GKAAYVQVNLNGNAGAAAGDESVAAI-------------------------------------RKLVQEAS...PPPGLK
Q9XCF5_MYCAV/604-943GKDVRLLISQRGDPATPEGLSRVEQI-------------------------------------KTAAEEALKGTPLENSR
Q9XCF6_MYCAV/51-382GKAVYVQLNLAGNQGTTLGQESVAAV-------------------------------------RDAIARIP...PPAGLK
Q9XCF6_MYCAV/601-939GKAARFIISHRGDPATSEALNRIDKI-------------------------------------RSAAEEALKNTPLENAK
Q9Z577_STRCO/40-368ADTAYATVTFE.DASQDLDPGQARAV-------------------------------------VDTAEAAE....TGGLR

PF00873

CZCA_RALME/5-1037RRGEQYLVRAPGQVASEDDIRNIIVG......TAQGQPIRIRDIGDVEIGKELRTGAATENG.KEVVLGTVFMLIGENSR
MEXB_PSEAE/1-1028GQQLNATIIGKTRLQTAEQFENILLK.....VNPDGSQVRLKDVADVGLGGQDYSINAQFNG.SPASGIAIKLATGANAL
MDTB_ECOLI/12-1023GPSRAVTLSANDQMQSAEEYRQLIIA......YQNGAPIRLGDVATVEQGAENSWLGAWANK.EQAIVMNVQRQPGANII
ACRF_ECOLI/1-1029GQQLNASIIAQTRFKNPEEFGKVTLR.....VNSDGSVVRLKDVARVELGGENYNVIARING.KPAAGLGIKLATGANAL
P74461_SYNY3/10-1047GTESEPLTRTVGRFASAQEIEDLVVGTVSGLEDQSAQKVYLRDVATVIDGTEEERIFVTLNG.NPAVKVSVQKQPEANTI
O25622_HELPY/6-1014RDGETFLVKIQTASLSLEDIGKITV.......STNLGHLHIKDFAKVISQSRTRLGFVTKDGVGETTEGLVLSLKDANTK
MDTF_ECOLI/1-1028DQQLNASIIVQTRLQTPEEFGKILLK.....VQQDGSQVLLRDVARVELGAEDYSTVARYNG.KPAAGIAIKLAAGANAL
Q55935_SYNY3/9-1024GGGQELLVRGLGQMQSIEDLRRSVVK......VVDGKPILLEDVAEVKTGSALKRGDGSFNG.QPAIVMMVNKQPDVDTP
ACRB_ECOLI/1-1030GQQLNASIIAQTRLTSTEEFGKILLK.....VNQDGSRVLLRDVAKIELGGENYDIIAEFNG.QPASGLGIKLATGANAL
MDTC_ECOLI/3-1009DGTHRWQIQTNDELKTAAEYQPLIIH......YNNGGAVRLGDVATVTDSVQDVRNAGMTNA.KPAILLMIRKLPEANII
ACRD_ECOLI/1-1027KQALNATINAQSLLQTPEQFRDITLR.....VNQDGSEVRLGDVATVEMGAEKYDYLSRFNG.KPASGLGVKLASGANEM
P73998_SYNY3/2-1028GQEYQLDLLASSQLVEVKDFEDLIVK.....SGASGSVVRFKDIGRVELGAQNYNSFLRFRG.DEAVGLGIYQLLDSNAL
O25328_HELPY/1-1011NSQREFSILINANSYSVADVEKIQV..........GNHVRLGDIAKIEIGLEEDNTFASFKD.KPGVILEIQKIAGANEI
Q5ZWS7_LEGPH/6-1036RNGEQNLIRVPGQVKNIADIENIVVA......NFEGTPVRIRDVAEVALGKELRTGAATENG.DEVVLGTVFMLMGENSR
Q9I0Y8_PSEAE/3-1040DTSFQLSINTQGRLVTEEEFENIIIR.....AGANGEITRLRDIARVELGSNQYALRSLLNN.KPAVAIPIFQRPGSNAI

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

O16307_CAEEL/1-766.....FRLTYPTMHLYNDEYYVGEHFAGVKIDP......................NTNVISRVKVVVLYFRTDRQTTEVS
P91129_CAEEL/47-858...HGFNITYPYFRFGSEGGYIGSSLGGVTVMKG...................ENETDILASAKAWFMIYHLKFHPEEMS
O44978_CAEEL/31-791...TTSVFTYPDMPYSGLDIFLGLHLSNADFEP.......................PTERISSKSLVLWYFSRSDTPEGK
Q18129_CAEEL/47-926...TQVNITYPIGWRGTEPIYFGALVGAPNLVD......................EEGHFDYASAIRLTYNTR..EGKVD
O61894_CAEEL/44-830...PRIKIEYPTMKFFDNKFFLPTHFYGVQPGG......................PLGIESIDMVHFVYQIPAYNEHTSE
Q21883_CAEEL/44-838V.GSRFQLTFPMMQVLGKELDLSPNFFGVKTDE.......................DGNVEYVKIIMLQIRANIPNDWKK
O16530_CAEEL/48-891TDFSHLDLGYPITTVLGTKLYMDPNFFGVKVTTSNNKVESIADGNTKLFGDHTKQEPNNIREVSLVVLQFRSELGDEVTP
Q19945_CAEEL/49-901...QILDLHFPRGGTKDTPVYLGGIFGDVQFFQ.......................NGTLSDAKLTQLFYFLKQDQKMVE
Q09938_CAEEL/52-945LNKRGISVTFPQVNQEGTPIYIAFVIGGVDTYP.......................NDTIKYARAMRLWYFLKFDDEEQE

PF12349

O16307_CAEEL/208-358----------------------------------------------------------V---------------------
A1CTG5_ASPCL/632-787----------------------------------------------------------F---------------------
A1Z6J2_DROME/390-543----------------------------------------------------------V---------------------
PTC2_MOUSE/418-570----------------------------------------------------------C---------------------
A4S8G2_OSTLU/258-409----------------------------------------------------------C---------------------
A5E1Z8_LODEL/460-615----------------------------------------------------------L---------------------
A7RI14_NEMVE/240-393----------------------------------------------------------M---------------------
A7RNK5_NEMVE/879-1035----------------------------------------------------------R---------------------
A7S0G1_NEMVE/641-795----------------------------------------------------------M---------------------
NPC1_HUMAN/649-803----------------------------------------------------------L---------------------
SCAP_SCHPO/257-410----------------------------------------------------------D---------------------
O61894_CAEEL/286-437----------------------------------------------------------W---------------------
P91129_CAEEL/295-446----------------------------------------------------------W---------------------
P91346_CAEEL/298-449----------------------------------------------------------W---------------------
PTR9_CAEEL/288-439----------------------------------------------------------I---------------------
Q16VL3_AEDAE/637-791----------------------------------------------------------F---------------------
Q17FP9_AEDAE/355-509----------------------------------------------------------L---------------------
Q17N28_AEDAE/360-513----------------------------------------------------------V---------------------
Q18968_CAEEL/295-448----------------------------------------------------------M---------------------
Q19945_CAEEL/297-448----------------------------------------------------------W---------------------
Q21883_CAEEL/287-442----------------------------------------------------------W---------------------
Q29GK5_DROPS/626-780----------------------------------------------------------L---------------------
Q2HB50_CHAGB/263-415----------------------------------------------------------A---------------------
Q4PBD7_USTMA/410-564----------------------------------------------------------K---------------------
B4Q8Q7_DROSI/652-804----------------------------------------------------------.---------------------
F7ANF6_MACMU/1-147----------------------------------------------------------M---------------------
G1MH71_AILME/663-814----------------------------------------------------------.---------------------
H3CDQ1_TETNG/587-739----------------------------------------------------------.---------------------
Q23E28_TETTS/401-549----------------------------------------------------------.---------------------
Q7S7Y9_NEUCR/315-463----------------------------------------------------------.---------------------

PF03176

A0A038KNA6_MYCTX/74-402ANLTGPAATVADLNLT---------------------GQRDRSRIEFAITILLLVILLI---------------------
A0A038KNA6_MYCTX/676-1049VSVVGLPVVLKDTRDY---------------------SDHDLRLIIAMTVCIVLLILIV---------------------
A0A038KM54_MYCTX/59-388AYVTGPSALAADMHHS---------------------GDRSMARITMVTVAVIFIMLLL---------------------
A0A050EJJ2_MYCTX/63-393VYVTGSAALVADQQQA---------------------GDRSLQVIEAVTFTVIIVMLLL---------------------
A0A050EJJ2_MYCTX/612-950IYLGGTAAMFKDLSDG---------------------NTYDLMIAGISALCLIFIIMLI---------------------
MMPLB_STRCO/48-383VAVTGPAGIATDTVKV---------------------FSGGDKVLLLATVVLVLIILLA---------------------
B8ZT45_MYCLB/57-385AWVTGASALIADMHHS---------------------GDKSMIRITATSVIVILVTLLL---------------------
A0A038F826_MYCTX/74-391ASIVVPAITNDMPMQI---------------------TAWQSATIVTVAAVIAVLLLLR---------------------
A0A038KV10_MYCTX/29-358ANVTGPAATVADLTDA---------------------GARDRASIELAIAVMLLVILMV---------------------
A0A038KR05_MYCTX/52-381AYVTGPGPLGADRVVY---------------------GDRSLHTITGISIAVIAIMLFI---------------------
A0A038KR05_MYCTX/600-941IYLAGTSSTYKDIHEG---------------------TLYDVMIAVVASLCLIFIIMLG---------------------
A0A038KUL5_MYCTX/58-387TYVTGPAALFADQIAA---------------------GDRSMKLITGLTFAVITVLLLL---------------------
A0A038KUL5_MYCTX/606-944IYIGGTAATYQDIRDG---------------------TKYDILIVGIAAVCLVFIVMLM---------------------
J7JRH5_BACIU/44-362TELSG......DVPGA---------------------EMEIGGVSEIVGIILAFVVLAI---------------------
J7JSG3_BACIU/39-360AYITGASLINQDFAHS---------------------SEEGLKKTEVITVCLIIGLLLI---------------------
A0A038LFT5_MYCTX/28-366IYLAGTAATFKDIQDG---------------------ATYDLLIAGIAALSLILLIMMI---------------------
A0A038WJQ1_MYCTX/54-382AYVTGPAALNADQAEA---------------------GDKSIAKVTAITSMVIAAMLLV---------------------
A0A038WJQ1_MYCTX/601-939IYLGGTAATFKDIREG---------------------ARYDLLIAGVAAISLILIIMMI---------------------
MMPLA_MYCLE/55-391ANLTGPASTVADLTDA---------------------GARDRTSIELVIAVLLLTILMI---------------------
Q50086_MYCLR/31-369IYLAGTAAVFKDIDEG---------------------ANWDLVIAGISSLCLIFIIMLI---------------------
A0A038KVP1_MYCTX/55-384VHLSGPIATVADLTEL---------------------GEKDVRIIEIGTAVSVLIILIL---------------------
A0A038KVP1_MYCTX/658-1001IGLAGVPTALRDIRDY---------------------YNSDMKFIVIATIVIVFLILVI---------------------
MMPLA_STRCO/46-370VHVTGPTGYAADSAES---------------------FSSADFKLTLVTLLIVVTILVV---------------------
MMPLA_STRCO/397-682ARVGGSSAVVHDMREA---------------------SSRDRGLIIPVILAVVFCILAL---------------------
Q9RKC1_STRCO/44-379VEIGGDALQAVP....---------------------...ETGATEVIGIAVAAVVLVI---------------------
Q9RL63_STRCO/44-395VEAGGGAVAGEP....---------------------...PAGIGEFLGIGVAAVVLLI---------------------
MMPLD_STRCO/50-373AQLAGPAASQADLSDA---------------------FAGIDGLLLAVALITVLVILLL---------------------
A0A038LLM0_MYCTX/43-376VFVTGPGATIVDEFAA---------------------IDRQTQLITATTIVVLLILLLI---------------------
A0A038LLM0_MYCTX/595-943VELTGVGPATRDLQDL---------------------VGSDLTLLAVITLAVIFAIAAL---------------------
Q9XCF5_MYCAV/55-384VYVTGPAPIVADMNIA---------------------GQKTVMLVTLASLIVIFVTLLL---------------------
Q9XCF5_MYCAV/604-943IYLTGTAAITKDLAQG---------------------SKFDLLIAGVSALCLIFIIMLI---------------------
Q9XCF6_MYCAV/51-382AYVTGPAALFSDMQLA---------------------GDRSILKMTLIGALIIFIVLLF---------------------
Q9XCF6_MYCAV/601-939IYLAGTASTFKDFRDG---------------------STYDLFIAGVGALCLIFIIMLI---------------------
Q9Z577_STRCO/40-368IELGGGAIALTE....---------------------.SGGSHLAEAVGVAVAAVVLFL---------------------

PF00873

CZCA_RALME/5-1037AVSKAVDEKVASINRT..MPEGVKIVTVYDRTRLVDKAIATVKKNLLEGAVLVIVILFL---------------------
MEXB_PSEAE/1-1028DTAKAIRQTIANLEPF..MPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLVFLVMYL---------------------
MDTB_ECOLI/12-1023STADSIRQMLPQLTES..LPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALVVMIIYL---------------------
ACRF_ECOLI/1-1029DTAKAIKAKLAELQPF..FPQGMKVLYPYDTTPFVQLSIHEVVKTLFEAIMLVFLVMYL---------------------
P74461_SYNY3/10-1047EVVDGVKKRLEELRTEGIIPQAAELTPTLDDSVFIRNSVNNVVVSGLIGTVLAAIAVLL---------------------
O25622_HELPY/6-1014EIITQVYQKLEELKPF..LPNGVSINVFYDRSEFTQKAIATVSKTLIEAVVLIIITLFL---------------------
MDTF_ECOLI/1-1028DTSRAVKEELNRLSAY..FPASLKTVYPYDTTPFIEISIQEVFKTLVEAIILVFLVMYL---------------------
Q55935_SYNY3/9-1024TVTKAVEAVVESLKPT..FPADVQIAQTFRQANFIDSAIRNVSTSLLEGIVIVSVIMLI---------------------
ACRB_ECOLI/1-1030DTAAAIRAELAKMEPF..FPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILVFLVMYL---------------------
MDTC_ECOLI/3-1009QTVDSIRAKLPELQET..IPAAIDLQIAQDRSPTIRASLEEVEQTLIISVALVILVVFL---------------------
ACRD_ECOLI/1-1027ATAELVLNRLDELAQY..FPHGLEYKVAYETTSFVKASIEDVVKTLLEAIALVFLVMYL---------------------
P73998_SYNY3/2-1028EVARLVKDEMARLAQN..FPEGIEYSVAFDTTEFVQESLSEVVETLLIAVVLVILVILV---------------------
O25328_HELPY/1-1011EIVDRVYEALKRIQA...ISPNYEIRPFLDTTGYIRTSIEDVKFDLVLGAILAVLVVFA---------------------
Q5ZWS7_LEGPH/6-1036TVSQRVAAKMKEINKS..LPEGVEAVTVYNRTLLVNATINTVKKNLLEGALLVCVILFL---------------------
Q9I0Y8_PSEAE/3-1040EISNLVREKMAELKHS..FPQGMDYSIVYDPTIFVRGSIEAVVHTLFEALVLVVLVVIL---------------------

PF02355

SECF_METTH/102-285-------------------------------------QAMNQIYWAIGFAFLFMSVTVF---------------------
SECF_BORBU/108-297-------------------------------------TLRIRSIFLVLGTFILILIYIT---------------------
SECDF_BACSU/540-729-------------------------------------ELARNALYAVAIASIGIIIYVS---------------------
SECF_STRCO/109-305-------------------------------------QIANKAWQGLGIFMVLVVIYLA---------------------
SECF_HAEIN/120-308-------------------------------------ELAQGAVYATLATLAMVLIYVG---------------------
SECF_ECOLI/114-302-------------------------------------DLAQTGAMALMAALLSILVYVG---------------------
SECF_SYNY3/108-301-------------------------------------ALFRSGVLALVISLLGIIIYLT---------------------
SECF_RICPR/110-299-------------------------------------QLIEAGAMAMLFSFLAIMVYIG---------------------
SECF_HELPY/106-293-------------------------------------ELKEKGILSLILALIAIMVYVS---------------------
SECF_RHOCB/123-311-------------------------------------ELVWTAVWSLLAATVVIMFYIW---------------------
SECF_METJA/88-276-------------------------------------KFFEEGFKAVGFAFMFMAIVVY---------------------
SECF_TREPA/222-411-------------------------------------LLVRQALLLVLGALVLIFLYVA---------------------
Q9ZBS8_STRCO/569-757-------------------------------------ELRRDALIALGLALAAQLAYLA---------------------
SECF_RHOS4/117-305-------------------------------------ELIRSAILAVAAACAGIAVYIW---------------------
O84454_CHLTR/1200-1393-------------------------------------KMRTQAVIALFGALGIILFYVS---------------------
SECF_MYCLE/183-379-------------------------------------QITKKVVIALVVFLVLVGLYIT---------------------
SECF_AQUAE/92-279-------------------------------------ELQKKAVFAILTALGGILLYLG---------------------

PF02460

O16307_CAEEL/1-766QVLNNWETSLFDYVENFDHPF...LNMTVNSDAMIAREVRTNGMTCVPFFSFSVAAVVIFIFATNS..REHF........
P91129_CAEEL/47-858YISGEWELELGRMLTQYPEDP..YISITYFHSQTLADELKRNADTLIPRFIISITLLIVFSTLCSL..SFIDG...SFSI
O44978_CAEEL/31-791LAFKDAIDELFQLSKNSSAFE..HVQFTIFSDQVANREMIRGAIEATTLMTIGFFLLLTQVIIVIV..RLSS........
Q18129_CAEEL/47-926QYGIEWRRKLSMWLTDKENPVSELLEFGVNHNMTLPEGLQDVADTLAPKFVGTCAILFTFSFLVSV..VLRKHRTGQVMP
O61894_CAEEL/44-830EMSKIFEQSLTALLENQTTFD.....TSMFSLSILKDEMQKNSTYTMPFISLTILLLLCFTVASCM..TDNW........
Q21883_CAEEL/44-838EDAAEYERMISQYFHFKYDST..HVTPLAMSLTYTGDEVVRTGLTIFPFIGVGFIIMTTFSIITIY..YSSS.....RLD
O16530_CAEEL/48-891EDLRNYEHQILDYIHDEYQSE..HINVYILTDSYITEEIVRAGLTLLPFLVIGFTIMAVFSSIT......FV........
Q19945_CAEEL/49-901EYSSKFSYALETFLNQVYSSD..VITLSFAHYQSLEDGLDENAKAFVPNFVVSFFVLAMYALVSSF..TLKSS..SATKI
Q09938_CAEEL/52-945QLAKFWEDTAEKFVRETYADH.PTIQCHIKHSRIVDQGLTRNANRLKPYFNVTIAVLVLFTAFYSVKWYFRMDHSWPLHI

PF12349

O16307_CAEEL/208-358--FSHNVVMAILGIAG-PLMATGTAFGF-----LFLFG-----FPFNSITL.V-MPFLII-GVGCDDVFIIIHAMRKT--
A1CTG5_ASPCL/632-787--VQSKFTLGIVGILI-VLMSVSASVGL-----FSAAG-----VRATLIIAEV-IPFLVL-AVGVDNIFLVVHEFERI--
A1Z6J2_DROME/390-543--FRSRFLLALCSVIT-TAGSLAMSLGL-----CFFFG-----LTISLQSKDI-FPYLVI-LVGLENSLVITKSVVSM--
PTC2_MOUSE/418-570--AQSQGAVGLAGVLL-VALAVASGLGL-----CALLG-----ITFNAATTQV-LPFLAL-GIGVDDIFLLAHAFTKA--
A4S8G2_OSTLU/258-409--VGSRVGVTLAGIVS-IGMAIASAYGI-----GAYCG-----LFFSPLMN.V-LPFLLL-GIGVDDMFVIVNSYDNT--
A5E1Z8_LODEL/460-615--VKTRFTLGLCGIII-ILLSVTASVGL-----FSFIG-----LRSTLIIAEV-IPFLVL-AIGVDNIFLIVHELHKI--
A7RI14_NEMVE/240-393--VKSKWGLAFSAVIT-VIASLIMAAGL-----CTMFG-----LVPTLNSSEI-FPYLVI-MIGVENILVITKSVVST--
A7RNK5_NEMVE/879-1035--LRLKAWLGVAGVIC-VGLSIGVSFGM-----SSAFG-----VFYGPVHS.V-LPFLLL-GIGVDDMFVIVQAWNNL--
A7S0G1_NEMVE/641-795--IDSKFTLGFCGIII-VLCSVICSIGF-----WSYVG-----VPATLIIIEV-IPFLVL-AVGVDNFFIMVQAYQRI--
NPC1_HUMAN/649-803--VDSKVSLGIAGILI-VLSSVACSLGV-----FSYIG-----LPLTLIVIEV-IPFLVL-AVGVDNIFILVQAYQRD--
SCAP_SCHPO/257-410--IRAKFGLTATIFIQ-SGTAYFSTCSL-----LYFFE-----RTGPICPWPM-AYYIII-FMDIENSFRLLRAVIAS--
O61894_CAEEL/286-437--VTSKPIEAMIGILV-SSMAIVSAGGL-----LFALG-----VPFINQVT.V-MPFIAL-AIGVDDVYVMLGAWQDT--
P91129_CAEEL/295-446--VLSKPILSILGVVS-AGIAILTGVGF-----LSLMG-----MPYNDIVG.V-MPFLVL-AVGVDNMFLMVAAVRRT--
P91346_CAEEL/298-449--VVTKPILSVLGVSN-AGMGIASAMGM-----LTYLE-----IQYNDIIA.V-MPFLVV-AVGTDNMFLMVASLKRT--
PTR9_CAEEL/288-439--VKSQPFIGFFAMFN-ATMATIASTSL-----LLYLQ-----YPFLPLVF.I-MPFLVV-SIGTDNMFLMLKSWRMT--
Q16VL3_AEDAE/637-791--NESKIILAVGGIVV-VLVSVACSLGF-----FGYLQ-----LATTMLTIEV-IPFLVL-AVGVDNIFMLVHAFQRI--
Q17FP9_AEDAE/355-509--IDSKITLGLGGVII-VLASVVASVGI-----FGYIG-----LPATLIIVEV-IPFLVL-AVGVDNIFILVQTHQRD--
Q17N28_AEDAE/360-513--IRSRLVLAFSAVLT-VLGSLTMSLGM-----CFFFG-----LTISLQSKGV-YPYLVI-LVGLENVLVITKSVLTT--
Q18968_CAEEL/295-448--VASRWGLAFASSFT-VASTLLMTTGI-----CAHLD-----LSTTTWGSEV-YPYIAL-IMGLENTLCITRSVVYT--
Q19945_CAEEL/297-448--ISSKPWLAAAGMFS-TVLSIISAFGF-----LFILG-----VRYNVINT.I-IPFLII-AIGIDDMFLMNACWDQT--
Q21883_CAEEL/287-442--SVHKVSEAILACVC-PLLATSSALGT-----LFWFG-----FRFGTILC.V-TPFLIL-AIGVDDAYLQVHACMRL--
Q29GK5_DROPS/626-780--LESRIMLAIGGIVI-VLASVACSLGF-----WGYLD-----VTTTMLAIEV-IPFLVL-AVGVDNIFIMVHTFQRL--
Q2HB50_CHAGB/263-415--VKSRVGLMVTMLAQ-ITASIVSSFTV-----CAIFK-----VDLSHVPLQT-YPFVIL-AISMENSFRLINAVIMT--
Q4PBD7_USTMA/410-564--VHSRFGLAFTGTTQ-LIISMIMSVSI-----CALLG-----IRLTLVPWEL-LPFVIV-VVGSENMYSLTKAIVDT--
B4Q8Q7_DROSI/652-804--IDSKITLGIGGVII-VLASVVSSVGV-----FGYIG-----LPATLIIVEV-IPFLVL-AVGVDNIFILVQTHQRD--
F7ANF6_MACMU/1-147--VKSKWGLALAAVVT-VLSSLLMSVGL-----CTLFG-----LTPTLNGGEI-FPYLVV-VIGLENVLVLTKSVVST--
G1MH71_AILME/663-814--VDSKVTLGLGGVSV-VLGAVTAAMGL-----FSYLG-----VPSSLVILQV-VPFLVL-AVGADNIFIFVLEYQRL--
H3CDQ1_TETNG/587-739--VDSKFLVGLGGILV-VSCAVLSSLGF-----CSWVG-----IPSSLIIVQV-VPFLVL-AVGADNIFIFVLEYQRD--
Q23E28_TETTS/401-549--.HSGFLIGLAGIFI-VIFSIVCSMGF-----MAFIG-----VGMTMISGEV-IPFLIL-AIGVDNMFIISTAVKGC--
Q7S7Y9_NEUCR/315-463--VKSRFGLMATILAQ-IAASIGSSFTI-----CAIFK-----IDLSRVPYYA-YPLVVL-AISMENSFRLINAVIMT--

PF03176

A0A038KNA6_MYCTX/74-402--IYGNPITMVLPLIT-IGMSVVVAQRL.VA.IAGLAG-----LGIANQSIIF.MSGMMV-GAGTDYAVFLISRYHDY--
A0A038KNA6_MYCTX/676-1049--LLRAIVAPLYLIGS-VIVSYLAALGIGVIVFQFLLG-----QEMHWSIPGL.TFVILV-AVGADYNMLLISRLREE--
A0A038KM54_MYCTX/59-388--VYRSIITVVLLLIT-VGVELTAARGV.VAVLGHSGA-----IGLTTFAVSL.LTSLAI-AAGTDYGIFIIGRYQEA--
A0A050EJJ2_MYCTX/63-393--VYRSIITSAIMLTM-VVLGLLATRGG.VAFLGFHRI-----IGLSTFATNL.LVVLAI-AAATDYAIFLIGRYQEA--
A0A050EJJ2_MYCTX/612-950--TTRSVVAAAVIVGT-VVLSLGASFGLSVLIWQHILG-----IELHWLVLAM.AVIILL-AVGADYNLLLVARLKEE--
MMPLB_STRCO/48-383--IYRSPLMALVPLLA-VGVAMRVAETL.GAILADAGV-----ITVSSQTASI.MTVLLF-GVGTDYALIITARYRET--
B8ZT45_MYCLB/57-385--VYRSFITVILLLFT-VGIESAVARGV.VALLGHTGL-----IGLSTFAVNL.LTSLAI-AAGTDYGIFITGRYQEA--
A0A038F826_MYCTX/74-391--ARLSVRAAAIVLLT-ADLSLAVAWPL.AAVVRGHDW-----GTDSVFSWTL.AAVLTI-GTITAATML.......A--
A0A038KV10_MYCTX/29-358--IYRNPVTMLLPLVT-IGASLMTAQAL.VAGVSLVGG-----LAVSNQAIVL.LSAMIA-GAGTDYAVFLISRYHEY--
A0A038KR05_MYCTX/52-381--AYRSLSAALIMLLT-VGLELLAVRGI.ISTFAVNDL-----MGLSTFTVNV.LVALTI-AASTDYIIFLVGRYQEA--
A0A038KR05_MYCTX/600-941--ITRSVVASAVIVGT-VALSLGSAFGLSVLIWQHILH-----MPLHWLVLPM.AIIVML-AVGSDYNLLLIARFQEE--
A0A038KUL5_MYCTX/58-387--VYRSIATTLLILPM-VFIGLGATRGT.IAFLGYHGM-----VGLSTFVVNI.LTALAI-AAGTDYAIFLVGRYQEA--
A0A038KUL5_MYCTX/606-944--ITQSLIASLVIVGT-VLLSLGTAFGLSVLIWQHFVG-----LQVHWTIVAM.SVIVLL-AVGSDYNLLLVSRFKEE--
J7JRH5_BACIU/44-362--TFGSLLIAGLPILT-ALIGLGVSIGL...VLIGTQV-----FDIASVSLSL.AGMIGL-AVGIDYALFIFTKHRQF--
J7JSG3_BACIU/39-360--VFRSVVTPFIPIVV-VGFSYLISQSI.LGILVYNVD-----FPISTFTQTF.LVAILF-GIGTDYCILLLTRFREE--
A0A038LFT5_MYCTX/28-366--ITRSLVAALVIVGT-VALSLGASFGLSVLVWQHLLG-----IQLYWIVLAL.AVILLL-AVGSDYNLLLISRFKEE--
A0A038WJQ1_MYCTX/54-382--IYRSVITAVLVLIM-VGIDLGAIRGF.IALLADHNI-----FSLSTFATNL.LVLMAI-AASTDYAIFMLGRYHES--
A0A038WJQ1_MYCTX/601-939--ITRSVVAAVVIVGT-VVLSMGASFGLSVLVWQDILG-----IELYWMVLAM.SVILLL-AVGSDYNLLLISRLKEE--
MMPLA_MYCLE/55-391--IYRNPITMLLPLIT-IGASLMTAQAV.VSGVSVLAG-----LAVSNQMIVL.LSAMIA-GAGTDYAVFLISRYHDY--
Q50086_MYCLR/31-369--ITRAFVAAAVIVGT-VALSLGASFGLSVLLWQHILG-----IELHYLVLAM.SVIVLL-AVGSDYNLLLVSRFKQE--
A0A038KVP1_MYCTX/55-384--VYRNLVTMLVPLAT-IGASVVTAQGT.LSGLAEF.G-----LAVNMQAIVF.MSAVMI-GAGTDYAVFLISRYHDY--
A0A038KVP1_MYCTX/658-1001--LLRALVAPIYLIGS-VLISYLSALGIGTLVFQLILG-----QEMHWSLPGL.SFILLV-AIGADYNMLLISRIRDE--
MMPLA_STRCO/46-370--TYRSPLLWLLPMIS-AGMSLVISQAI.VYLLAKNAG-----LTVNAQTAMI.LTVLVL-GAATDYALLLVARYREE--
MMPLA_STRCO/397-682--LLRALVAPLLLIAS-VVLSFFTALGLAALFFNHVFD-----FAGADSAFPLWVFVFLV-ALGVDYNIFLVTRIKEE--
Q9RKC1_STRCO/44-379--TFGSLVSAGLPLLT-ALIGVGIGVSS...ITALASA-----LELGSTTSIL.AMMIGL-AVGIDYALFIVSRYRAE--
Q9RL63_STRCO/44-395--TFGSLAAAGLPLIT-AVVGVALTLAS...IVALGSA-----LGMSTASGDL.AMMIGI-AVGVDYALLVVSRYREE--
MMPLD_STRCO/50-373--VYRSVLLPLVIILS-AVFALALSCAI.VYALADRDV-----VRVDGQVQGI.LSILVI-GAATDYALLLTARFREE--
A0A038LLM0_MYCTX/43-376--VYRSAITATVPLLS-VVVSLAVAKPI.VSVLVDRDF-----IGISLFSLGL.SVAVVV-GAGTGFAMFLIGRYHER--
A0A038LLM0_MYCTX/595-943--LLRSPLAGLVVVGT-IATSYICALGASVVIWKHILG-----DNLHWSVLPI.AFVLLI-SVGSAYNLLFALRIREE--
Q9XCF5_MYCAV/55-384--VYRSVITVILLLLI-VGLELQIARGM.VALLGHLGV-----VGLTTFAVNL.LVAAVI-ATGTDYGIFFVGRYQEA--
Q9XCF5_MYCAV/604-943--MTRSFIAAMVIVGT-VLLSLGASFGLSVLVWQYLLH-----MQLNWTVLPT.SVIVLL-ALGPDYNLLLVSRMKEE--
Q9XCF6_MYCAV/51-382--VYRSVTTVVLLLLT-VGIEVFAARGV.IAFVANNNL-----MPLSTFAVNL.LVALAM-AAGTDYAIFFFGRYQEA--
Q9XCF6_MYCAV/601-939--LTRSFIAALIIVGT-VTLSLGASFGLSVLIWQYIFG-----IQLYWMVLPM.SVIVLL-AVGSDYNLLLVSRMKEE--
Q9Z577_STRCO/40-368--AFGSVAAALLPIAT-ALVSVGTAYAG...ITLLGHA-----MTVADFAPML.GTLIGL-GVGIDYALFIVTRHRRG--

PF00873

CZCA_RALME/5-1037--FLGNIRAALITATI-IPLAMLFTFTG-----MVNYK-----ISANLMSLG--ALDF..-GIIIDGAVVIVENCVRR--
MEXB_PSEAE/1-1028--FLQNFRATLIPTIA-VPVVLLGTFGV-----LAAFG-----FSINTLTMF--GMVLAI-GLLVDDAIVVVENVERV--
MDTB_ECOLI/12-1023--FLRNIPATIIPGVA-VPLSLIGTFAV-----MVFLD-----FSINNLTLM--ALTIAT-GFVVDDAIVVIENISRY--
ACRF_ECOLI/1-1029--FLQNMRATLIPTIA-VPVVLLGTFAI-----LAAFG-----YSINTLTMF--GMVLAI-GLLVDDAIVVVENVERV--
P74461_SYNY3/10-1047--FLGSLRQTLIIVLA-IPLATMAAIIV-----MKAFG-----LSLNVFSLG--GLALGV-GIVVDNSIVMLETIAEG--
O25622_HELPY/6-1014--FLGNLRASVAVGVI-LPLSLSVAFIF-----IKFSD-----LTLNLMSLG--GLVIAI-GMLIDSAVVVVENAFEK--
MDTF_ECOLI/1-1028--FLQNFRATIIPTIA-VPVVILGTFAI-----LSAVG-----FTINTLTMF--GMVLAI-GLLVDDAIVVVENVERV--
Q55935_SYNY3/9-1024--FLMNWRTAAITLTA-IPLSLLIGLMF-----MKAWG-----LGINTMTLG--GLVVAI-GSVVDDSIVDMENCYRG--
ACRB_ECOLI/1-1030--FLQNFRATLIPTIA-VPVVLLGTFAV-----LAAFG-----FSINTLTMF--GMVLAI-GLLVDDAIVVVENVERV--
MDTC_ECOLI/3-1009--FLRSGRATIIPAVS-VPVSLIGTFAA-----MYLCG-----FSLNNLSLM--ALTIAT-GFVVDDAIVVLENIARH--
ACRD_ECOLI/1-1027--FLQNFRATLIPTIA-VPVVLMGTFSV-----LYAFG-----YSVNTLTMF--AMVLAI-GLLVDDAIVVVENVERI--
P73998_SYNY3/2-1028--FLQDWRSALIPALT-IPLALIGTFAF-----VKVFN-----FSINSLTLF--GLTLAT-GLVVDDAIIVVEQISRF--
O25328_HELPY/1-1011--FLRNGTITLVSAIS-IPISIMGTFAL-----IQWMG-----FSLNMLTMV--ALTLAI-GIIIDDAIVVIENIHKK--
Q5ZWS7_LEGPH/6-1036--FLGNVRAALITAMV-IPLSMLLTITG-----MVTNQ-----ISANLMSLG--ALDF..-GLIVDGAVIIVENCIKH--
Q9I0Y8_PSEAE/3-1040--FLQTWRASIIPLAA-VPVSLIGTFAV-----MHMLG-----FSLNALSLF--GLVLAI-GIVVDDAIVVVENVERN--

PF02355

SECF_METTH/102-285--IIFRDPVPSLAVILAAASDIIIAVGG-----MSLFG.....IPLSLASVG--AILMLI-GYSVDTDILLTTRVLKR..
SECF_BORBU/108-297--LRFKLSYAIASILS.IFHDIFFIVAF-----LGVFR.....IEINSYIIV--AILTII-GYSLNDTIIIFDRIRDN..
SECDF_BACSU/540-729--IRFEYKMAIAAIAS.LLYDAFFIVTF-----FSITR.....LEVDVTFIA--AILTII-GYSINDTIVTFDRVREHMK
SECF_STRCO/109-305--IAFEWRMALAAFVA.LIHDITITVGI-----YALVG.....FEVTPGTVI--GLLTIL-GYSLYDTVVVFDSLKEQTR
SECF_HAEIN/120-308--SRFEWRLGFGSIAS.LAHDVIITLGV-----FSALQ.....IEIDLTFVA--AILSVV-GYSINDSIVVFDRVREN..
SECF_ECOLI/114-302--FRFEWRLAAGVVIA.LAHDVIITLGI-----LSLFH.....IEIDLTIVA--SLMSVI-GYSLNDSIVVSDRIREN..
SECF_SYNY3/108-301--IRFQLDYAVFAIIA.LLYDALITMGA-----FAIFGLV.GGVEVDSLFLV--ALLTII-GFSVNDTVVIYDRVRET..
SECF_RICPR/110-299--VRFEWYFGFGILIA.LVHDVILALGF-----MSMTK.....LDFNLSTIA--AVLTII-GYSVNDSVVIYDRIREN..
SECF_HELPY/106-293--FRYEWRFALASVIA.LVHDVILVASS-----VIVFK.....IDMNLEVIA--ALLTLI-GYSINDTIIIFDRIREE..
SECF_RHOCB/123-311--VRFEWQFALGAVVA.LVHDVLLTVGL-----FAVLQ.....LKFDLTTVA--ALLTIT-GYSINDTVVVFDRLREN..
SECF_METJA/88-276--LYFRNPVPSGAIILSALSDIIMALGA-----MSLLG.....IELSSATIA--ALLMVI-GYSVDSDILLTTRVLKR..
SECF_TREPA/222-411--LRFRWFFALGAIVA.LVHDACIMVSF-----MVWFG.....LEFNSASIA--AILTII-GYSINDTVVVFDRVRQT..
Q9ZBS8_STRCO/569-757--VRFRLLFGTAAVGA.LAHDVVILVGV-----FAWLG.....KPIDGVFLA--ALLTVI-GYSVNDSVVLFDRIREL..
SECF_RHOS4/117-305--LRFEWQFALGSVAA.LIHDVLVTIGV-----FALFQ.....IKFDLTTVA--ALLTVL-GYSINDTVVVFDRLREN..
O84454_CHLTR/1200-1393--LRFEWRYAFSAICA.LMHDLLATCAV-----LVALHFFLQRIQIDLQAIG--ALMTVL-GYSLNNTLIIFDRIRED..
SECF_MYCLE/183-379--VRYERYMAISALTT.MCFDLTVTAGV-----YSLVG.....FEVTPATVI--GLLTIL-GFSLYDTVIVFDKVEENTH
SECF_AQUAE/92-279--VRFQPVWGFGAILA.LAHDVITVLGA-----YSITQ.....REVNLEVVS--AILVVA-GYSVADTVVIFDRIREN..

PF02460

O16307_CAEEL/1-766.VFSHNVVMAILGIAG-PLMATGTAFGF-----LFLFG-----FPFNSITLV--MPFLII.GVGCDDVFIIIHAMRKT--
P91129_CAEEL/47-858DWVLSKPILSILGVVS-AGIAILTGVGF-----LSLMG-----MPYNDIVGV--MPFLVL.AVGVDNMFLMVAAVRRT--
O44978_CAEEL/31-791..VKMAFYLVATSLLT-PMAATVASFGA-----ICWMG-----FPSFSIQCV--TPFLVLG.IGVDDAFILLHRWKHH--
Q18129_CAEEL/47-926DWVRSKPLVAAAGLMT-PIMATVTSFGL-----ILWCG-----FLYNAIVNV--SPFLIL.CIGIDDLFIMCAEWHRT--
O61894_CAEEL/44-830..VTSKPIEAMIGILV-SSMAIVSAGGL-----LFALG-----VPFINQVTV--MPFIAL.AIGVDDVYVMLGAWQDT--
Q21883_CAEEL/44-838QWSVHKVSEAILACVC-PLLATSSALGT-----LFWFG-----FRFGTILCV--TPFLIL.AIGVDDAYLQVHACMRL--
O16530_CAEEL/48-891......PILAVMACVC-PFMACGASLGA-----MFFIG-----FRFGSILCV--TPFLVL.AIGVDDSYLMANAWQRI--
Q19945_CAEEL/49-901DWISSKPWLAAAGMFS-TVLSIISAFGF-----LFILG-----VRYNVINTI--IPFLII.AIGIDDMFLMNACWDQT--
Q09938_CAEEL/52-945DWLRSKPMLALGGVLS-SVLAILSGIGL-----LLWFG-----MFFAEITLI--APFLVL.SIGVDDMFIAVAAWHNT--

PF12349

O16307_CAEEL/208-358-DKSESL...--------.ED----RIAETMEEAGPSITVTSAT-----NCLSFA.I---GIATP--TP--AISL-FCLY
A1CTG5_ASPCL/632-787-NVSHPDE.E--------IDE----RVARAVGRIGPSIFLSAVT-----ETVAFA.L---GVFVG--MP--AVKN-FAVY
A1Z6J2_DROME/390-543-DETFDV...--------.KI----RVAQALSKEGWHISKTLLT-----EITILT.I---GLATF--VP--VIQE-FCIF
PTC2_MOUSE/418-570-PPDTPL...--------.PE----RMGECLRSTGTSVALTSVN-----NMVAFF.M---AALVP--IP--ALRA-FSLQ
A4S8G2_OSTLU/258-409-EARVDP...--------.VE----RMGRSLRVAGMSITVTSAT-----DVIAFL.I---GSSTS--LP--ALKN-FCFY
A5E1Z8_LODEL/460-615-SEHEPDL.D--------IPI----RIAFAMRNIGPSCFISAIL-----QISMFL.L---ATAVD--MP--AVKN-FAIY
A7RI14_NEMVE/240-393-PVDLDV...--------.KH----RVAQGLSKEGKYMLKNLLW-----EILVLG.L---GYLTY--VH--AIQE-FALF
A7RNK5_NEMVE/879-1035-TPEEHKTKE--------VHE----RIALTLQHAGCSITITSLT-----DFLAFL.I---GASTV--LP--GLQS-FCIY
A7S0G1_NEMVE/641-795-NRYSNEP..--------VSK----KISCALGEVAPSMLLSSLS-----ESVAFG.F---GAMSD--MP--AVKV-FSLY
NPC1_HUMAN/649-803-ERLQGET..--------LDQ----QLGRVLGEVAPSMFLSSFS-----ETVAFF.L---GALSV--MP--AVHT-FSLF
SCAP_SCHPO/257-410-PQTKRV...--------.PS----RIMEGFSSTIIASFSSLLK-----KLLTLFVL---S.FFV--YP--LVQE-FCLF
O61894_CAEEL/286-437-RRTLDA...--------.KK----RMGLALEEAGSAITVTSLT-----SVLSFG.I---GTYST--TP--AIAI-FCKF
P91129_CAEEL/295-446-SRTHTV...--------.HE----RMGECLADAAVSILITSST-----DVLSFG.V---GAITT--IP--AVQI-FCVY
P91346_CAEEL/298-449-DRNLKY...--------.DQ----RIAECMADAAVSILITALT-----DALSFG.V---GTITT--IP--AVQI-FCIY
PTR9_CAEEL/288-439-KKSSNE...--------.EQ----RYIHALTESAASLFLTSLT-----DGLSFA.I---GSISD--FH--AVRV-FCTY
Q16VL3_AEDAE/637-791-DRVQTPE..--------TDK----AIGKALGQIGPSILLTSAS-----ECCCFA.I---GGLSP--MP--AVNT-FAWY
Q17FP9_AEDAE/355-509-TKKPTET..--------HAE----HIGRILGRVGPSILLTAVS-----ESCCFF.L---GGLSD--MP--AVRA-FALY
Q17N28_AEDAE/360-513-DSNLDV...--------.KI----RLAQGLSREGWSITKNLLT-----EITILT.I---GLCTF--VP--VIQE-FCIF
Q18968_CAEEL/295-448-SPSLDV...--------.SS----RIAHGLSQEGYKLTKYYIL-----ELLALL.I---GFLTR--IS--DIQE-FCQF
Q19945_CAEEL/297-448-SKSLSV...--------.PE----RMSKTLSHAGVAVTITNVT-----DVMSFA.I---GCITD--LP--GIQF-FCIY
Q21883_CAEEL/287-442-TAEDSSM.T--------KRE----KIARMLVEVGPSIAITSMT-----NLFAFL.V---GIYTP--TP--EISL-FCAG
Q29GK5_DROPS/626-780-DHSRFET..--------THE----AIGEAIGQVGPSILQTAGS-----EFACFA.I---GALSD--MP--AVKT-FAMY
Q2HB50_CHAGB/263-415-SSAISI...--------.SD----RIGEAFGTTAHIAIASPIQ-----NSLILYGL---S.KTG--SL--GVSS-FCAF
Q4PBD7_USTMA/410-564-PLSLTV...--------.SS----RIAHGLGKVGVPITLTTLA-----DILLLLVI---ALFIE--VR--AVRE-FCIF
B4Q8Q7_DROSI/652-804-QRKPNET..--------LEQ----QVGRILGKVGPSMLLTSLS-----ESFCFF.L---GGLSD--MP--AVRA-FALY
F7ANF6_MACMU/1-147-PVDLEV...--------.KL----RIAQGLSSESWSIMKNMAT-----ELGIIL.I---GYFTL--VP--AIQE-FCLF
G1MH71_AILME/663-814-PRRPGER..--------REA----HIGRALGRVAPSMLLCSLS-----EAICFF.L---GALTP--MP--AVRT-FALT
H3CDQ1_TETNG/587-739-VRRPGEK..--------REE----QIGRILGNVAPSMLLCSLS-----ESICFF.F---GALST--MP--AVKS-FALY
Q23E28_TETTS/401-549-HGENL....--------.LE----KIKGGMTEVGPSITAAAVS-----EILAFM.V---GTFTN--IP--ALTT-FCIQ
Q7S7Y9_NEUCR/315-463-SSSISI...--------.SD----RIGEAFGQTAYVAILNRLQ-----NLAILLGL---S.RIT--FP--GVAA-FCTF

PF03176

A0A038KNA6_MYCTX/74-402-LRQGADS-----------DQ....AVKKALTSIGKVIAASAAT-----VAITFL-G...MVFTQ--LG--ILKT.VGPM
A0A038KNA6_MYCTX/676-1049-AVLGVRS-----------......GVIRTVASTGGVITAAGLI-----MAASMY-G...LVFAS--LG--SVVQ.GAFV
A0A038KM54_MYCTX/59-388-RQAGEDK-----------EA....AYYTMYRGTAHVILGSGLT-----IAGATF-C...LSFAR--MP--YFQT.LGIP
A0A050EJJ2_MYCTX/63-393-RGLGQDR-----------ES....AYYTMFGGTAHVVLGSGLT-----IAGATF-C...LSFTR--LP--YFQT.LGVP
A0A050EJJ2_MYCTX/612-950-IHAGINT-----------......GIIRAMGGSGSVVTAAGLV-----FAFTMM-S...FAVSE--LT--VMAQ.VGTT
MMPLB_STRCO/48-383-LLDEPDR-----------AR....AMQAAVRRTAESVLASAST-----IVLAMF-A...LLVAV--SP--ALHG.FGPY
B8ZT45_MYCLB/57-385-RQANENK-----------EA....AFYTMYRGTFHVILGSGLT-----ISGATF-C...LSFAR--MP--YFQT.LGVP
A0A038F826_MYCTX/74-391-ARLGSDA-----------GH....SAAPTYRDSLPAFALPGAC-----VAIFTG-P...LLLAR--TP--ALHG.VGTA
A0A038KV10_MYCTX/29-358-VRLGEHP-----------ER....AVQRAMMSVGKVIAASAAT-----VGITFL-G...MRFAK--LG--VFST.VGPA
A0A038KR05_MYCTX/52-381-RATGQNR-----------EA....AYYTMFGGTAHVVLASGLT-----VAGAMY-C...LGFTR--LP--YFNT.LASP
A0A038KR05_MYCTX/600-941-IGAGLKT-----------......GMIRAMAGTGRVVTIAGLV-----FAFTMG-S...MVASD--LR--VVGQ.IGTT
A0A038KUL5_MYCTX/58-387-RHIGQNR-----------EA....SFYTMYRGTANVILGSGLT-----IAGATY-C...LSFAR--LT--LFHT.MGPP
A0A038KUL5_MYCTX/606-944-VGAGLKT-----------......GIIRAMAGTGAVVTSAGLV-----FAFTMA-S...MAVSE--LR--VIGQ.VGTT
J7JRH5_BACIU/44-362-LGEGIQK-----------NE....SIARAVGTAGSAVVFAGLT-----VIVALC-G...LTVVN--IP--FMSA.MGLT
J7JSG3_BACIU/39-360-LANGHDK-----------KE....AALIAYRTGGKTLFISGFA-----VLIGFS-A...LGFAK--FA--IFQSAVGVA
A0A038LFT5_MYCTX/28-366-IGAGLNT-----------......GIIRAMAGTGGVVTAAGLV-----FAATMS-S...FVFSD--LR--VLGQ.IGTT
A0A038WJQ1_MYCTX/54-382-RYAGEDR-----------ET....AFYTMFHGTAHVILGSGLT-----IAGAMY-C...LSFAR--LP--YFET.LGAP
A0A038WJQ1_MYCTX/601-939-IGAGLNT-----------......GIIRAMAGTGGVVTAAGMV-----FAVTMS-L...FVFSD--LR--IIGQ.IGTT
MMPLA_MYCLE/55-391-IRMGSGS-----------AQDAGCAVRQALISLGKVIAASAAT-----VGITFL-G...MSFTK--IR--VFST.VGPA
Q50086_MYCLR/31-369-IQAGLKT-----------......GIIRSMGGTGKVVTNAGLV-----FAFTMA-S...MVVSD--LR--VIGQ.VGTT
A0A038KVP1_MYCTX/55-384-VRHGEKS-----------DM....AVKKALMSIGKVITASAAT-----VAVTFL-A...MVFTK--LE--VFSA.VGPA
A0A038KVP1_MYCTX/658-1001-SPHGIRI-----------......GVIRTVGSTGGVITSAGLI-----FAASMF-G...LVGAS--IN--TMAQ.AGFT
MMPLA_STRCO/46-370-LRRHEDR-----------HE....AMAVALRRAGPAIVASAAT-----VAVSML-V...LLLAA--LN--STKG.LGPV
MMPLA_STRCO/397-682-SDRLGTR-----------Q.....GALKGLTSTGGVITAAGLV-----LAGTFA-A...LATLP--LV--FIAE.LGFT
Q9RKC1_STRCO/44-379-LAEGRER-----------EE....AAGRAVGTAGSAVVFAGLT-----VVIALV-G...LAVVN--IP--MLTK.MGIA
Q9RL63_STRCO/44-395-RAEGHDA-----------RE....AAGLAVGTAGSAVVFAGLT-----VVIALA-G...LSVIG--VP--SLTK.MGLA
MMPLD_STRCO/50-373-LARHPDR-----------FG....AVRAALRDSWGAVVASAAT-----VALGLL-A...LLLSD--LT--NNRA.LGPV
A0A038LLM0_MYCTX/43-376-RRQHIAP-----------AA....ALADAYRGVAPAIAGATFI-----VVTSLG-AVGWLSLAR--IG--MFAT.TGIL
A0A038LLM0_MYCTX/595-943-SPAGPRT-----------......SVIRAFAATGMVVTAAGIV-----FGTTMF-A...LAAST--SL--SVAQ.IGVT
Q9XCF5_MYCAV/55-384-RQAGESR-----------EE....AFYTTFNGVAKVVLASGLT-----IAGAVL-C...LSFTR--LP--YFQP.LGIP
Q9XCF5_MYCAV/604-943-LAAGIHT-----------......GIIRAMGGTGKVVTNAGLV-----FAFTMG-A...MVVSD--LR--SIGQ.VGTT
Q9XCF6_MYCAV/51-382-RQAGEDR-----------AT....AYFTTYRSVAPVVLGSGLT-----IAGAML-C...LSFTR--MP--IFQT.MGLP
Q9XCF6_MYCAV/601-939-IAAGINT-----------......GIIRAMGGTGKVVTNAGLV-----FAFTMA-S...MVVSD--LR--IIGQ.VGTT
Q9Z577_STRCO/40-368-LKRGLSV-----------AD....AAADAVATTGRAVVFAGAT-----VCIALL-G...MLILR--LS--FLNG.VAVA

PF00873

CZCA_RALME/5-1037-LAH.AQEHHGRPLTRSERFH----EVFAAAKEARRPLIFGQLI-----IMIVYLPI---FALTG--VEGKMFHP-MAFT
MEXB_PSEAE/1-1028-MAE.EGLSP.........RE----AARKSMGQIQGALVGIAMV-----LSAVFLPM---AFFGG--STGVIYRQ-FSIT
MDTB_ECOLI/12-1023-IEK..GEKP.........LA----AALKGAGEIGFTIISLTFS-----LIAVLIPL---LFMGD--IVGRLFRE-FAIT
ACRF_ECOLI/1-1029-MME.DKLPP.........KE----ATEKSMSQIQGALVGIAMV-----LSAVFIPM---AFFGG--STGAIYRQ-FSIT
P74461_SYNY3/10-1047-AGMTPGKVNPLPLTKGEMRN----QAIASSQTVESALVASTST-----NLVAVLPF---LMIGG--FIALIFNE-LILT
O25622_HELPY/6-1014-LSANTKTTK.........LH----AIYRSCKEIAVSVVSGVVI-----IIVFFVPI---LTLQG--LEGKMFRP-LAQS
MDTF_ECOLI/1-1028-IAE.DKLPP.........KE----ATHKSMGQIQRALVGIAVV-----LSAVFMPM---AFMSG--ATGEIYRQ-FSIT
Q55935_SYNY3/9-1024-LRTNQAEGNPK.....HPLR----VVYETSVEVRLAVIFSTVI-----IVVVFAPI---FSLTG--VEGRIFAP-MGLA
ACRB_ECOLI/1-1030-MAE.EGLPP.........KE----ATRKSMGQIQGALVGIAMV-----LSAVFVPM---AFFGG--STGAIYRQ-FSIT
MDTC_ECOLI/3-1009-LEA..GMKP.........LQ----AALQGTREVGFTVLSMSLS-----LVAVFLPL---LLMGG--LPGRLLRE-FAVT
ACRD_ECOLI/1-1027-MSE.EGLTP.........RE----ATRKSMGQIQGALVGIAMV-----LSAVFVPM---AFFGG--TTGAIYRQ-FSIT
P73998_SYNY3/2-1028-IKV.KHEDP.........QE----AAQEAMGELTGAVIATSLV-----LMAVFIPV---AFFPG--TTGALYQQ-FALT
O25328_HELPY/1-1011-LEM..GMSK.........RK----ASYEGVREIGFALVAISAM-----LLSVFVPI---GNMKG--IIGRFFQS-FGIT
Q5ZWS7_LEGPH/6-1036-LGEQQHALQRILN.LEERLK----TIAYATTEVIRPSIFGVFI-----ITVVYLPI---LTLTG--VEGKMFLP-MAET
Q9I0Y8_PSEAE/3-1040-IGL..GLKP.........VE----ATKRAMREVTGPIIATALV-----LCAVFIPT---AFISG--LTGQFYRQ-FALT

PF02355

SECF_METTH/102-285..RK...GTI---------NE----RALGAMKTGVTMSIAAIAS....MAALYLVTV---FVMPE....ARVLSD-IAAV
SECF_BORBU/108-297.VKRLTDNTF---------LN----VLNISISQTLSRTVLTSVT.....TFVAVFSI---YVFTE....G.SIKD-FSLV
SECDF_BACSU/540-729KRKPKTFADL---------NH----IVNLSLQQTFTRSINTVLT.....VVIVVVTL---LIFGA.....SSITN-FSIA
SECF_STRCO/109-305DITKQTRWTY---------AE----IANRSINSTLVRSINTTVV.....ALLPVAGL---LFIGGGVLGAGMLND-ISLS
SECF_HAEIN/120-308.FRKIRRLDT---------ID----IIDISLTQTLSRTIITSVT.....TLVVVMAL---FFFGG.....PSIHN-FSLA
SECF_ECOLI/114-302.FRKIRRGTP---------YE----IFNVSLTQTLHRTLITSGT.....TLMVILML---YLFGG.....PVLEG-FSLT
SECF_SYNY3/108-301.LERHSDWDI---------NH----VVDDAVNQTLTRSINTSLT.....TSLPLVAI---FLFGG.....DSLKF-FALA
SECF_RICPR/110-299.LRKYHKKNI---------TE----IINLSINETLSRTILTVIT.....TLLANLAL---ILFGG.....KAIHS-FSVL
SECF_HELPY/106-293.MLSQKTKNA---------TQ----AIDEAISSTLTRTLLTSLT.....VFFVVLIL---CVFGS.....KIIIG-FSLP
SECF_RHOCB/123-311.LIKYKTMPL---------RD----VMNLSVNETLSRTVMTGMT.....TLLALVPM---LIWGG.....DVIRG-FVFA
SECF_METJA/88-276.LTKSFDETV---------KE----AMKTGLTMTLT.TITAMLI......LLIVVKL---FIPVA.....DILAN-IATV
SECF_TREPA/222-411.ILLDPIASV---------TT----VLDRSQTDMLTRTVVTTVT.....TLLAALML---YVFTE.....GGSRD-FSLA
Q9ZBS8_STRCO/569-757.LGKERKAPF---------DR----LTNDAILQTLPRTVNTGMG.....AVLILASL---AILAD.....DSLTD-FALA
SECF_RHOS4/117-305.LVKYKTMPL---------RD----VMNLSVNETLSRTIMTLMT.....TLIALVSL---LVFGG.....DVIRG-FVFA
O84454_CHLTR/1200-1393.RREKLFTPM---------PI----LINDALQKTLGRTVMTTAT.....TLSVLVIL---LFVGG.....GSIFN-FAFI
SECF_MYCLE/183-379GFQHTTRRTF---------AE----QANLAINQTFMRSINTSLISVLPVLALMVVAV---WLLGV.....GTLKD-LALV
SECF_AQUAE/92-279.LRKKKGFTL---------EE----IMDLSINQTLSRTIMTSLT.....TLVTALTL---FILGG.....YALSN-IMFA

PF02460

O16307_CAEEL/1-766--DKSES...........LED----RIAETMEEAGPSITVTSAT-----NCLSFA-I---GIATP--TP--AISL-FCLY
P91129_CAEEL/47-858--SRTHT...........VHE----RMGECLADAAVSILITSST-----DVLSFG-V---GAITT--IP--AVQI-FCVY
O44978_CAEEL/31-791--IAITD...........TPR----RLEQVIVDVGPSITITSLT-----NIIAFG-I---GFLTP--TP--QMSL-FCLT
Q18129_CAEEL/47-926--NPQHS...........PEK----RIGKTLSEAAVAISITSLT-----DIATFA-M---GCYTT--LP--GVQM-FCMY
O61894_CAEEL/44-830--RRTLD...........AKK----RMGLALEEAGSAITVTSLT-----SVLSFG-I---GTYST--TP--AIAI-FCKF
Q21883_CAEEL/44-838--TAEDSS........MTKRE----KIARMLVEVGPSIAITSMT-----NLFAFL-V---GIYTP--TP--EISL-FCAG
O16530_CAEEL/48-891--TCHRRKHARFESVNVELKN----RITEMFIETGPSITITTIT-----NALAFG-I---GATTP--AA--EIQL-FSIG
Q19945_CAEEL/49-901--SKSLS...........VPE----RMSKTLSHAGVAVTITNVT-----DVMSFA-I---GCITD--LP--GIQF-FCIY
Q09938_CAEEL/52-945--EMKYPGRS.....PKVMKK----RMIEAMSESAVAIFITSFT-----DVLSFG-A---GTITD--II--AVQG-FCAM

PF12349

O16307_CAEEL/208-358TCVAVAVDFVYQLTFF-VAVLVY-----------EEKRL-----------------------------------------
A1CTG5_ASPCL/632-787AAGAVFINAILQMTMF-VSVLAL-----------NQRRV-----------------------------------------
A1Z6J2_DROME/390-543AIVGLLSDFMLQMLLF-STILAM-----------NIKRT-----------------------------------------
PTC2_MOUSE/418-570AAIVVGCNFAAVMLVF-PAILSL-----------DLRRR-----------------------------------------
A4S8G2_OSTLU/258-409AALGIFFDYLYQITFF-TAFLSI-----------DERRK-----------------------------------------
A5E1Z8_LODEL/460-615SAGAVAINFILQMTCF-VSLLAL-----------DQQRM-----------------------------------------
A7RI14_NEMVE/240-393ALVGLLTDFFLQVFMF-ATILSI-----------DIRRM-----------------------------------------
A7RNK5_NEMVE/879-1035AGLGILIDFILQITLF-SAFLTL-----------DGRRE-----------------------------------------
A7S0G1_NEMVE/641-795ASFAVAVDFILQITWF-VALMSL-----------DAKRQ-----------------------------------------
NPC1_HUMAN/649-803AGLAVFIDFLLQITCF-VSLLGL-----------DIKRQ-----------------------------------------
SCAP_SCHPO/257-410LACSFVVSFLLHGSFF-LAVLSV-----------DIRRL-----------------------------------------
O61894_CAEEL/286-437IALAIMFDWFYQLTFF-AAVMAM-----------GAKRE-----------------------------------------
P91129_CAEEL/295-446TGVAIFFAFIYQITFF-AACLAL-----------AMKHE-----------------------------------------
P91346_CAEEL/298-449TMCALLLTFAYQLTFF-CAILVY-----------YTRIE-----------------------------------------
PTR9_CAEEL/288-439CAMAILFMFLFQVTFF-NAVMSL-----------CCRRE-----------------------------------------
Q16VL3_AEDAE/637-791ATVALFVDFVLQITAF-VALMAL-----------DERRV-----------------------------------------
Q17FP9_AEDAE/355-509AGMALLIDFFLQITCF-VSLLAL-----------DTARQ-----------------------------------------
Q17N28_AEDAE/360-513AIVGLVSDFFLQMMIF-STVLAL-----------NIKQV-----------------------------------------
Q18968_CAEEL/295-448SVICVTVDFYMQLFFY-APCLTF-----------DLQRL-----------------------------------------
Q19945_CAEEL/297-448ACVSVAFSYFYQLTFF-SGAMAI-----------MGEVE-----------------------------------------
Q21883_CAEEL/287-442NAVAILFDFIYQITMY-TAILSI-----------CENLE-----------------------------------------
Q29GK5_DROPS/626-780AAAAILFDFLLQITAF-VALMAI-----------DQRRV-----------------------------------------
Q2HB50_CHAGB/263-415ATIATFFDFFYLATFF-LAVLSV-----------DVRQR-----------------------------------------
Q4PBD7_USTMA/410-564AIFSLIMDWFLQMTFF-VTVLSI-----------DMQRL-----------------------------------------
B4Q8Q7_DROSI/652-804AGVALIIDFLLQITCF-VSLFTL-----------DTKRR-----------------------------------------
F7ANF6_MACMU/1-147AVVGLVSDFFLQMLFF-TTVLSI-----------DIRRM-----------------------------------------
G1MH71_AILME/663-814SGFAVVLDFLLQVSAF-VALLSL-----------DSRRQ-----------------------------------------
H3CDQ1_TETNG/587-739AAVAILLDFALQMTAF-VALLSL-----------DCRRQ-----------------------------------------
Q23E28_TETTS/401-549AAIAVFFDYIFQITAF-VAILAW-----------DEERK-----------------------------------------
Q7S7Y9_NEUCR/315-463AAVAIVFDFLYLATFF-LAVLSV-----------DVRQR-----------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402LGISVAVVFFAAVTLL.PALMVL...........TGRRG.WI.-------------------------------------
A0A038KNA6_MYCTX/676-1049LGTGLLLDTFLVRTVTVPAIAVL...........VGQA.....-------------------------------------
A0A038KM54_MYCTX/59-388CAVGMLVAVAVALTLG.PAVLHV...........GSRFG.LF.-------------------------------------
A0A050EJJ2_MYCTX/63-393LAIGMVIVVAAALTLG.PAIIAV...........TSRFGKLL.-------------------------------------
A0A050EJJ2_MYCTX/612-950IGMGLLFDTLIVRSFMTPSIAAL...........LGKW.....-------------------------------------
MMPLB_STRCO/48-383LALGVAVMALVAFTFI.PALVLL...........LGRSVFWPG-------------------------------------
B8ZT45_MYCLB/57-385CAVGMLIAVAVALTLG.PAVLTV...........GSRFG.LF.-------------------------------------
A0A038F826_MYCTX/74-391.GLGVFVALAASLTVL.PALIAL...........AGASRQLP.-------------------------------------
A0A038KV10_MYCTX/29-358LAIGIAVSFLAAVTLL.PAILVL...........ASPRG.WV.-------------------------------------
A0A038KR05_MYCTX/52-381CAIGLVTVMLASLTLA.PAIIAV...........ASRFG.LF.-------------------------------------
A0A038KR05_MYCTX/600-941IMIGLLFDTLVVRSYMTPALATL...........LGRW.....-------------------------------------
A0A038KUL5_MYCTX/58-387LAIGMLVSVAAALTLA.PAIIAI...........AGRFG.LL.-------------------------------------
A0A038KUL5_MYCTX/606-944IGLGLLFDTLVVRSFMTPSIAAL...........LGRW.....-------------------------------------
J7JRH5_BACIU/44-362AGLSVLMAVLASITLV.PAVLSI...........AGKRMIPK.-------------------------------------
J7JSG3_BACIU/39-360VGVGILMIIL..YTLL.PLFMVT...........LGEK..LF.-------------------------------------
A0A038LFT5_MYCTX/28-366IGLGLLFDTLVVRAFMTPSIAVL...........LGRW.....-------------------------------------
A0A038WJQ1_MYCTX/54-382IAIGMLVAVLAALTLG.PAVLTV...........GSFFK.LF.-------------------------------------
A0A038WJQ1_MYCTX/601-939IGLGLLFDTLVVRSFMTPSIAAL...........LGRW.....-------------------------------------
MMPLA_MYCLE/55-391LAIGIAVAFLAAVTLM.PALLVL...........AGTRG.WV.-------------------------------------
Q50086_MYCLR/31-369IGLGLLFDTLIVRSFMMPSIAAL...........LGRW.....-------------------------------------
A0A038KVP1_MYCTX/55-384IAVAITVSLLGAVTLL.PAILTL...........TGRRG.WI.-------------------------------------
A0A038KVP1_MYCTX/658-1001IGIGIVLDTFLVRTVTVPALTTM...........IGRA.....-------------------------------------
MMPLA_STRCO/46-370CAVGVLVGLLSMMTLL.PALLVI...........FGRWVFWPA-------------------------------------
MMPLA_STRCO/397-682VAVGVLLDTMIVRSVLVTALTLD...........VGRW.....-------------------------------------
Q9RKC1_STRCO/44-379AAGTVAIAVLIALTMI.PALLGY...........AGRRVKPAG-------------------------------------
Q9RL63_STRCO/44-395AAGAVVIAVLITLTLV.PALCGFWPDALLARRVRKGRSAPPAR-------------------------------------
MMPLD_STRCO/50-373GAIGIVCSVLSTLTFL.PAVLVL...........LGRAAYWPA-------------------------------------
A0A038LLM0_MYCTX/43-376CSIGVLAVGLAALTLT.PALVAL...........ASRANLLK.-------------------------------------
A0A038LLM0_MYCTX/595-943VGMGLLLDALVIRGFVLPALMVL...........LGRW.....-------------------------------------
Q9XCF5_MYCAV/55-384VAVGISIAVLVALTLG.PALLAA...........GARFG.LF.-------------------------------------
Q9XCF5_MYCAV/604-943IGLGLLFDTLIVRAFMTPSVAAL...........LGRW.....-------------------------------------
Q9XCF6_MYCAV/51-382CSVGMLISVFIALTLV.PAVLTV...........GGGFG.LF.-------------------------------------
Q9XCF6_MYCAV/601-939IGLGLMFDTLIVRSFMTPTIAAL...........FGRW.....-------------------------------------
Q9Z577_STRCO/40-368ASLTVLLTVAASVTLL.PALLSY...........IGPRALSR.-------------------------------------

PF00873

CZCA_RALME/5-1037VVLALLGAMILSVTFV-PAAVAL-----------FIGERVAEKE..................NRLMLWAKRRYEPLLEKS
MEXB_PSEAE/1-1028IVSAMALSVIVALILT-PALCAT-----------MLKPIEKGDHGEH.......KGGFFGWFNRMFLSTTHGYERGVASI
MDTB_ECOLI/12-1023LAVAILISAVVSLTLT-PMMCAR-----------MLSQESLRKQN...........RFSRASEKMFDRIIAAYGRGLAKV
ACRF_ECOLI/1-1029IVSAMALSVLVALILT-PALCAT-----------LLKPVSAEHHEN........KGGFFGWFNTTFDHSVNHYTNSVGKI
P74461_SYNY3/10-1047ISFAVAASILVAVTLV-PMAASR-----------LLAIRRRSGLGN.........WLFFREFNRRFAGATAAYARFLSIL
O25622_HELPY/6-1014IVYALLGTLVLSITII-PVVSSL-----------VLKATPHSE...................TFLTRFLNRIYAPLLEFF
MDTF_ECOLI/1-1028LISSMLLSVFVAMSLT-PALCAT-----------ILKAAPEGGHKP.........NALFARFNTLFEKSTQHYTDSTRSL
Q55935_SYNY3/9-1024YLLCIGASTLVAMTVS-PALCGI-----------LLANQRLPQEG.................TFVSRWAERLYRPLLNFS
ACRB_ECOLI/1-1030IVSAMALSVLVALILT-PALCAT-----------MLKPIAKGDHGEG.......KKGFFGWFNRMFEKSTHHYTDSVGGI
MDTC_ECOLI/3-1009LSVAIGISLLVSLTLT-PMMCGW-----------MLKASKPREQ............KRLRGFGRMLVALQQGYGKSLKWV
ACRD_ECOLI/1-1027IVAAMVLSVLVAMILT-PALCAT-----------LLKPLKKGEHHG........QKGFFAWFNQMFNRNAERYEKGVAKI
P73998_SYNY3/2-1028IAFSILLSTFLALTLT-PSLCAL-----------LLREGQEPPAFI.........AGFFNWFNRVLDIIKNGYGNVLGKL
O25328_HELPY/1-1011VALAIALSYVVVVTII-PMVSSV-----------VVNPRHS...............RFYVWSEPFFKALESRYTKLLQWV
Q5ZWS7_LEGPH/6-1036VIIALLASMLFALTFV-PAAVAI-----------FLRGHIQEKE..................NRLVHFLSIGYAKVLRRC
Q9I0Y8_PSEAE/3-1040IAISTVISAFNSLTLS-PALAAV-----------LLKGHHEPKDRFSVFLDKLLGSWLFRPFNRFFDRASHGYVGTVNRV

PF02355

SECF_METTH/102-285LIIGLLADILTTWLMN-LGILRW-----------YLEV------------------------------------------
SECF_BORBU/108-297FMVGVIVGTYSSVFIA-SPILLN-----------LYKK------------------------------------------
SECDF_BACSU/540-729LLVGLLTGVYSSLYIA-AQIWLA-----------WKGR------------------------------------------
SECF_STRCO/109-305LFVGLAAGAYSSIFIA-TPLVAD-----------LKEA------------------------------------------
SECF_HAEIN/120-308LLVGIGFGTYSSIFVA-IAIAYD-----------VGLR------------------------------------------
SECF_ECOLI/114-302MLIGVSIGTASSIYVA-SALALK-----------LGMK------------------------------------------
SECF_SYNY3/108-301LIIGFASGVYSSIFMA-TTLWAW-----------WRKW------------------------------------------
SECF_RICPR/110-299VFFGIIAGTYSSIFIS-APILTM-----------FANR------------------------------------------
SECF_HELPY/106-293MLIGTIVGTYSSIFIA-PKVALL-----------LGFD------------------------------------------
SECF_RHOCB/123-311MVWGVFTGTYSSVYVA-KNIVLF-----------IGLD------------------------------------------
SECF_METJA/88-276LILALIADIINTWLLN-AGILKY-----------YITE------------------------------------------
SECF_TREPA/222-411LMVGMVSGVYSTIYIA-GGCIAL-----------ISRG------------------------------------------
Q9ZBS8_STRCO/569-757LLIGVGVGTYSSVFTA-SPLAIE-----------LHNR------------------------------------------
SECF_RHOS4/117-305ITFGVVIGTYSSVYMA-KNIVLY-----------LGVD------------------------------------------
O84454_CHLTR/1200-1393MTVGILLGTLSSLYIA-PPLLLF-----------MVRK------------------------------------------
SECF_MYCLE/183-379QLVGIIVGTYSSIFFA-TPLLVT-----------LRER------------------------------------------
SECF_AQUAE/92-279FVVGVVVGTYSSVFVA-SAFVLD-----------MQKL------------------------------------------

PF02460

O16307_CAEEL/1-766TCVAVAVDFVYQLTFF-VAVLVY-----------EEKRL---------------------------------MKLQKVGE
P91129_CAEEL/47-858TGVAIFFAFIYQITFF-AACLAL-----------AMKHE---------------------------------ASGRNSLF
O44978_CAEEL/31-791ASLALLLDYIFTYTIL-APIVFL-----------CNDPD---------------------------------YKS.....
Q18129_CAEEL/47-926TCVQCFFCYVYQIIFL-GPVLAY-----------AAEME---------------------------------QNGQHVLL
O61894_CAEEL/44-830IALAIMFDWFYQLTFF-AAVMAM-----------GAKRE---------------------------------AAGYHCVF
Q21883_CAEEL/44-838NAVAILFDFIYQITMY-TAILSI-----------CENLE---------------------------------MRKN....
O16530_CAEEL/48-891NALAVITDFVFTITFY-GALMAV-----------VGRYE---------------------------------IEQELKTQ
Q19945_CAEEL/49-901ACVSVAFSYFYQLTFF-SGAMAI-----------MGEVE---------------------------------REKRHCLF
Q09938_CAEEL/52-945TAACMFFTFLYQITFF-AALMVI-----------SAKAQ---------------------------------MSGRNSCM

PF12349

O16307_CAEEL/208-358--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
B4Q8Q7_DROSI/652-804--------------------------------------------------------------------------------
F7ANF6_MACMU/1-147--------------------------------------------------------------------------------
G1MH71_AILME/663-814--------------------------------------------------------------------------------
H3CDQ1_TETNG/587-739--------------------------------------------------------------------------------
Q23E28_TETTS/401-549--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/315-463--------------------------------------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402--------------------------------------------------------------------------------
A0A038KNA6_MYCTX/676-1049--------------------------------------------------------------------------------
A0A038KM54_MYCTX/59-388--------------------------------------------------------------------------------
A0A050EJJ2_MYCTX/63-393--------------------------------------------------------------------------------
A0A050EJJ2_MYCTX/612-950--------------------------------------------------------------------------------
MMPLB_STRCO/48-383--------------------------------------------------------------------------------
B8ZT45_MYCLB/57-385--------------------------------------------------------------------------------
A0A038F826_MYCTX/74-391--------------------------------------------------------------------------------
A0A038KV10_MYCTX/29-358--------------------------------------------------------------------------------
A0A038KR05_MYCTX/52-381--------------------------------------------------------------------------------
A0A038KR05_MYCTX/600-941--------------------------------------------------------------------------------
A0A038KUL5_MYCTX/58-387--------------------------------------------------------------------------------
A0A038KUL5_MYCTX/606-944--------------------------------------------------------------------------------
J7JRH5_BACIU/44-362--------------------------------------------------------------------------------
J7JSG3_BACIU/39-360--------------------------------------------------------------------------------
A0A038LFT5_MYCTX/28-366--------------------------------------------------------------------------------
A0A038WJQ1_MYCTX/54-382--------------------------------------------------------------------------------
A0A038WJQ1_MYCTX/601-939--------------------------------------------------------------------------------
MMPLA_MYCLE/55-391--------------------------------------------------------------------------------
Q50086_MYCLR/31-369--------------------------------------------------------------------------------
A0A038KVP1_MYCTX/55-384--------------------------------------------------------------------------------
A0A038KVP1_MYCTX/658-1001--------------------------------------------------------------------------------
MMPLA_STRCO/46-370--------------------------------------------------------------------------------
MMPLA_STRCO/397-682--------------------------------------------------------------------------------
Q9RKC1_STRCO/44-379--------------------------------------------------------------------------------
Q9RL63_STRCO/44-395--------------------------------------------------------------------------------
MMPLD_STRCO/50-373--------------------------------------------------------------------------------
A0A038LLM0_MYCTX/43-376--------------------------------------------------------------------------------
A0A038LLM0_MYCTX/595-943--------------------------------------------------------------------------------
Q9XCF5_MYCAV/55-384--------------------------------------------------------------------------------
Q9XCF5_MYCAV/604-943--------------------------------------------------------------------------------
Q9XCF6_MYCAV/51-382--------------------------------------------------------------------------------
Q9XCF6_MYCAV/601-939--------------------------------------------------------------------------------
Q9Z577_STRCO/40-368--------------------------------------------------------------------------------

PF00873

CZCA_RALME/5-1037LANTAVVLTFAAVSIVL.CVAIAARLGSEFIPNLNEGDIAIQALRIPGTSLSQSVEMQKTIET.TLKAKFPEIERVF.AR
MEXB_PSEAE/1-1028LKHRAPYLLIYVVIVAG.MIWMFTRIPTAFLPDEDQGVLFAQVQTPPGSSAERTQVVVDSMREYLLEKESSSVSSVF.TV
MDTB_ECOLI/12-1023LNHPWLTLSVALSTLLL.SVLLWVFIPKGFFPVQDNGIIQGTLQAPQSSSFANMAQRQRQVAD.VIL.QDPAVQSLT.SF
ACRF_ECOLI/1-1029LGSTGRYLLIYALIVAG.MVVLFLRLPSSFLPEEDQGVFLTMIQLPAGATQERTQKVLDQVTDYYLKNEKANVESVF.TV
P74461_SYNY3/10-1047IRHRLVAVASIFIVFGGSSLWMIGQIPQEILPRINTGQASMFAQFPPGTPLEENQRLMAIVDD.ILI.NQPETEYAFTTV
O25622_HELPY/6-1014VHNPKKVILGAFVFLIA.SLSLFPFVGKNFMPVLDEGDVVLSVETTPSISLDQSRDLMLNIES.AIKKHVKEVKSIV.AR
MDTF_ECOLI/1-1028LRCTGRYMVVYLLICAG.MAVLFLRTPTSFLPEEDQGVFMTTAQLPSGATMVNTTKVLQQVTDYYLTKEKDNVQSVF.TV
Q55935_SYNY3/9-1024LRAPQVILSIALIAVIA.SVSLVPSLGRVFLPEFREKSMVNSMVLFPGVSLDMTNRAGMALFN.NLK.DNPLYEWVQ.IR
ACRB_ECOLI/1-1030LRSTGRYLVLYLIIVVG.MAYLFVRLPSSFLPDEDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKEKNNVESVF.AV
MDTC_ECOLI/3-1009LNHTRLVGVVLLGTIAL.NIWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLQDFMK.IIR.DDPAVDNVT.GF
ACRD_ECOLI/1-1027LHRSLRWIVIYVLLLGG.MVFLFLRLPTSFLPLEDRGMFTTSVQLPSGSTQQQTLKVVEQIEKYYFTHEKDNIMSVF.AT
P73998_SYNY3/2-1028VNLRAWVIGVFVLLLGA.TAWLYVTVPTAFLPEEDQGYFITIIQAPQGVSLQYTSRVMAQVEK.ELL.AVPEVTATF.AV
O25328_HELPY/1-1011LNHKIIISIAVVLVFVG.SLFVASKIGMEFMLKEDRGRFLVWLKAKPGVSIDYMTQKSKIFQK.AIE.KHAEVEFTT.LQ
Q5ZWS7_LEGPH/6-1036FHARRQVIGAAVVLVII.SFMLAFRLGGEFIPSLDEGDIAMHAMRIPGTSLTQAIAMQDLVEK.RVR.QFPEVKRVF.AK
Q9I0Y8_PSEAE/3-1040LRGSSIALLVYGGLMVL.TYFGFSSTPTGFVPQQDKQYLVAFAQLPDAASLDRTEAVIKQMSE.IAL.AQPGVADSV.AF

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

O16307_CAEEL/1-766EKK....IEAAM..ERRP.............KQVLSIQNSIR......................................
P91129_CAEEL/47-858LIEA...VSAEK..KTSLS...........TFQRLFNLGSVP......................................
O44978_CAEEL/31-791..................................IANET.EP......................................
Q18129_CAEEL/47-926IRKA...VDPDK..TESPVKLWLLSGSVNRQDQEARRRNSRKVAPVEKEGEKKSKF.................GEVVEKL
O61894_CAEEL/44-830VW..............................KRCDREEIAK......................................
Q21883_CAEEL/44-838.........AT....K.................RKDSGLSFK......................................
O16530_CAEEL/48-891KP.......LPE..SESP..............SETSSTGSMR......................................
Q19945_CAEEL/49-901FYRTFQLVDISKMNEEADS...........KLQQIKSRSASPAPFNYLSSSNSSFSSDSDSFS....SKKTIPAEFAWKE
Q09938_CAEEL/52-945PC.......IT.......AG..........DIYTIEDGSLQPNLKKKKSKSRKDAKAEKEKKDEAKNDKNMEIEENAENA

PF12349

O16307_CAEEL/208-358--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
B4Q8Q7_DROSI/652-804--------------------------------------------------------------------------------
F7ANF6_MACMU/1-147--------------------------------------------------------------------------------
G1MH71_AILME/663-814--------------------------------------------------------------------------------
H3CDQ1_TETNG/587-739--------------------------------------------------------------------------------
Q23E28_TETTS/401-549--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/315-463--------------------------------------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402----------------------------------------------------------.........APRRDLTR.....
A0A038KNA6_MYCTX/676-1049----------------------------------------------------------......................
A0A038KM54_MYCTX/59-388----------------------------------------------------------.........DPKRLLKV.....
A0A050EJJ2_MYCTX/63-393----------------------------------------------------------.........EPKRMARV.....
A0A050EJJ2_MYCTX/612-950----------------------------------------------------------......................
MMPLB_STRCO/48-383----------------------------------------------------------.........GVDKAAERSRGA.
B8ZT45_MYCLB/57-385----------------------------------------------------------.........EPKRLIKV.....
A0A038F826_MYCTX/74-391----------------------------------------------------------.........AP...TTG.....
A0A038KV10_MYCTX/29-358----------------------------------------------------------.........APRGERMA.....
A0A038KR05_MYCTX/52-381----------------------------------------------------------.........DPKRATTK.....
A0A038KR05_MYCTX/600-941----------------------------------------------------------......................
A0A038KUL5_MYCTX/58-387----------------------------------------------------------.........DPKRRLKT.....
A0A038KUL5_MYCTX/606-944----------------------------------------------------------......................
J7JRH5_BACIU/44-362----------------------------------------------------------.........SNKKIEKQSTET.
J7JSG3_BACIU/39-360----------------------------------------------------------.........WPSKKVLSHSD..
A0A038LFT5_MYCTX/28-366----------------------------------------------------------......................
A0A038WJQ1_MYCTX/54-382----------------------------------------------------------.........DPKRRMNT.....
A0A038WJQ1_MYCTX/601-939----------------------------------------------------------......................
MMPLA_MYCLE/55-391----------------------------------------------------------.........APRRDRAG.....
Q50086_MYCLR/31-369----------------------------------------------------------......................
A0A038KVP1_MYCTX/55-384----------------------------------------------------------.........KPRRDLTS.....
A0A038KVP1_MYCTX/658-1001----------------------------------------------------------......................
MMPLA_STRCO/46-370----------------------------------------------------------.........RPKHGTEPDVTR.
MMPLA_STRCO/397-682----------------------------------------------------------......................
Q9RKC1_STRCO/44-379----------------------------------------------------------..AKGKRLGRSRKGEPKPDRPA
Q9RL63_STRCO/44-395----------------------------------------------------------RFRKGRSTPPARRLRGGPGRGA
MMPLD_STRCO/50-373----------------------------------------------------------.........KPVRTGDPEAGH.
A0A038LLM0_MYCTX/43-376----------------------------------------------------------.........PPQHKRIQ.....
A0A038LLM0_MYCTX/595-943----------------------------------------------------------......................
Q9XCF5_MYCAV/55-384----------------------------------------------------------.........EPRRAVSA.....
Q9XCF5_MYCAV/604-943----------------------------------------------------------......................
Q9XCF6_MYCAV/51-382----------------------------------------------------------.........DPKRAIGF.....
Q9XCF6_MYCAV/601-939----------------------------------------------------------......................
Q9Z577_STRCO/40-368----------------------------------------------------------.........RERRRLAEHGPEP

PF00873

CZCA_RALME/5-1037TGTAEIASDLMPPNISDGYIMLKPEKDWPEPKK.THAELLSAIQEEAGKIPGNNYEF.SQPIQLRF..NELISGVRSDVA
MEXB_PSEAE/1-1028TGFNF.AG..RGQSSGMAFIMLKPWEERPGGEN.SVFELAKRAQMHFFSFKDAMVFA.FAPPSVLE..LGNATGFDLFLQ
MDTB_ECOLI/12-1023VGV...DGTNPSLNSARLQINLKPLDER...DD.RVQKVIARLQTAVDKVPGVDLFL.QPTQDLTI....DTQVSRTQYQ
ACRF_ECOLI/1-1029NGFSF.SG..QAQNAGMAFVSLKPWEERNGDEN.SAEAVIHRAKMELGKIRDGFVIP.FNMPAIVE..LGTATGFDFELI
P74461_SYNY3/10-1047GGFLFGSNVNANALRSSSTITLKPNT........DVEAFTERVTAELEALNLVDIRLRMAPGQLRGLILSNSPLRNVDVD
O25622_HELPY/6-1014TGSDELGLDLGGLNQTDTFISFIPKKEW..SVK.TKDELLEKIMDSLKDFKGINFSF.TQPIEMRI..SEMLTGVRGDLA
MDTF_ECOLI/1-1028GGFGF.SG..QGQNNGLAFISLKPWSERVGEEN.SVTAIIQRAMIALSSINKAVVFP.FNLPAVAE..LGTASGFDMELL
Q55935_SYNY3/9-1024AGRAPGDADGAGVSMAHVDVELSDEALK......DREASVKELRKAFNQLPGVASNM.GGFISHRM..DEVLSGVRSAIA
ACRB_ECOLI/1-1030NGFGF.AG..RGQNTGIAFVSLKDWADRPGEEN.KVEAITMRATRAFSQIKDAMVFA.FNLPAIVE..LGTATGFDFELI
MDTC_ECOLI/3-1009TGG.......SRVNSGMMFITLKPRDER...SE.TAQQIIDRLRVKLAKEPGANLFL.MAVQDIRV....GGRQSNASYQ
ACRD_ECOLI/1-1027VGSGP.GG..NGQNVARMFIRLKDWSERDSKTG.TSFAIIERATKAFNQIKEARVIA.SSPPAISG..LGSSAGFDMELQ
P73998_SYNY3/2-1028GGFSF.SG..NSPNQGIIFTRLKPWGERTAPNQ.SVQAIIGQMFGKFSQIPEANIIP.INPPPIRG..LGQFGGFDFQLQ
O25328_HELPY/1-1011VG....YGTTQNPFKAKIFVQLKPLKERKKEHQLGQFELMSVLRKELRSLPEAK..G.LDTINLSEVTLIGGGGDSSPFQ
Q5ZWS7_LEGPH/6-1036LGTAEVATDPMPPNVADTFIMLKPRNEWPNPKK.SKQQLVQEIEQAVKQIPGNNYEF.TQPIQMRF..NELISGVRSDVA
Q9I0Y8_PSEAE/3-1040PGLSI.NGFTNSPNSGIVFTPLKPFDERKDPSQ.SAGAIAAALNAKYADIQDAYIAI.FPPPPVQG..LGTIGGFRLQIE

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

O16307_CAEEL/1-766........STAGAHPPP..ANP.....NGIVSRYCRFLKDWKTRLCLLLVLCGYWTASYYGCKTMEIKMDTTNLIMNDSP
P91129_CAEEL/47-858.......DHSASHDVKQ.PLTS.....RFFGEWYAPVLMHPVVRGIAMVWFVIYLLGASYGCSRIKEGLEPVNLLVEDSY
O44978_CAEEL/31-791.............KISR....A.....DTWLSKYSSFVCSVKGRVACIMVLLGMYALTTYGVVTMKTTFEPAKAFPSNSK
Q18129_CAEEL/47-926EHTLEKHDDDPGHNSEE.TLVS.....KVFREIIGPFILQKSTQVCALLLYLVYISLAIGGCLNIKEGLDPKLLVRESFY
O61894_CAEEL/44-830.........AKNENAIS..PTR.....YFFENIFAPFICRPSVRFCMLNLYVVYIAIAFYGCSQLTPNLTPSQLVVDDSP
Q21883_CAEEL/44-838..............NEQ....F.....TVMLDSYCDWVANAYTHLLVLFCFIVYIFVSIRGALNINIILSPDKLVIGDSP
O16530_CAEEL/48-891...........SSELDD..CKF.....RRMIANVCKFLTNTWVCSVVLGLLAVYWYICIVGTVNIKSELSPNKLFLAESN
Q19945_CAEEL/49-901QQSPNSSLSKKSKDREEKDRIV.....HFIGKIYGPFILSNSVRIFSGLIFVVYLAIAMYGCYNFREGLNPGNLVTNDHY
Q09938_CAEEL/52-945EKSSYDSSPDPSQIHIP..VKSRGAMGHFFRDYYVPWLLNWKTKLFMFVTFIIYLGISVYGICVMEQGLDYDKLLLHSDP

PF12349

O16307_CAEEL/208-358---------------.MKL.QKVGEEKKI---------------------------------------------------
A1CTG5_ASPCL/632-787---------------.ESLRADCMPCVTV---------------------------------------------------
A1Z6J2_DROME/390-543---------------EYTAEAKHLPKMLL---------------------------------------------------
PTC2_MOUSE/418-570---------------.HRQRLDVLCCFSS---------------------------------------------------
A4S8G2_OSTLU/258-409---------------.SENKADCFFCLDC---------------------------------------------------
A5E1Z8_LODEL/460-615---------------.ESNRVDCAPWITI---------------------------------------------------
A7RI14_NEMVE/240-393---------------EGILLRQRGRLHSS---------------------------------------------------
A7RNK5_NEMVE/879-1035---------------DRKRDGCCCCCIVL---------------------------------------------------
A7S0G1_NEMVE/641-795---------------.ETNRWDIMCCVKQ---------------------------------------------------
NPC1_HUMAN/649-803---------------.EKNRLDIFCCVRG---------------------------------------------------
SCAP_SCHPO/257-410---------------ELQDFLDSNSSNRN---------------------------------------------------
O61894_CAEEL/286-437---------------.AAGYHCVFVWKRC---------------------------------------------------
P91129_CAEEL/295-446---------------.ASGRNSLFLIEAV---------------------------------------------------
P91346_CAEEL/298-449---------------.EQGLHSIWLRPAV---------------------------------------------------
PTR9_CAEEL/288-439---------------.VSGKHPVFCCYEI---------------------------------------------------
Q16VL3_AEDAE/637-791---------------.ASGRLDLFCCVKS---------------------------------------------------
Q17FP9_AEDAE/355-509---------------.ADNRYDVLFFLRG---------------------------------------------------
Q17N28_AEDAE/360-513---------------EYSAEVRQLPKMLY---------------------------------------------------
Q18968_CAEEL/295-448---------------GLEEKRKFAEILLY---------------------------------------------------
Q19945_CAEEL/297-448---------------.REKRHCLFFYRTF---------------------------------------------------
Q21883_CAEEL/287-442---------------MRKNATKRKDSGLS---------------------------------------------------
Q29GK5_DROPS/626-780---------------.LDGRLDMLCCVQT---------------------------------------------------
Q2HB50_CHAGB/263-415---------------ELCE.LEKASLKRA---------------------------------------------------
Q4PBD7_USTMA/410-564---------------ELADLLTQGTRLSR---------------------------------------------------
B4Q8Q7_DROSI/652-804---------------.EENRMDICCFIK.---------------------------------------------------
F7ANF6_MACMU/1-147---------------ELADLNK.......---------------------------------------------------
G1MH71_AILME/663-814---------------.EASRLDVCCCV..---------------------------------------------------
H3CDQ1_TETNG/587-739---------------.DSNRCELLCCIK.---------------------------------------------------
Q23E28_TETTS/401-549---------------.LKGICDVFVCIR.---------------------------------------------------
Q7S7Y9_NEUCR/315-463---------------.ELYELEKASL...---------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402...........RFW.RSSGVHIVRRPKTH---------------------------------------------------
A0A038KNA6_MYCTX/676-1049...........NWWLPSSWRPATWWPLGR---------------------------------------------------
A0A038KM54_MYCTX/59-388...........RGW.RRVGTVVVRWPLPV---------------------------------------------------
A0A050EJJ2_MYCTX/63-393...........RGW.RKVGAAIVRWPGPI---------------------------------------------------
A0A050EJJ2_MYCTX/612-950...........FWW.PQV...VRQRPIPQ---------------------------------------------------
MMPLB_STRCO/48-383...........GIW.HRIAALVARAPVKV---------------------------------------------------
B8ZT45_MYCLB/57-385...........RGW.RRIGTVVVRWPLPI---------------------------------------------------
A0A038F826_MYCTX/74-391...........AGW...TGRLSLPVSSAS---------------------------------------------------
A0A038KV10_MYCTX/29-358...........TFW.RRAGTRIVRRPKAY---------------------------------------------------
A0A038KR05_MYCTX/52-381...........RRW.RRIGTVVVRWPGPV---------------------------------------------------
A0A038KR05_MYCTX/600-941...........FWW.PRRVDRLARQPQVL---------------------------------------------------
A0A038KUL5_MYCTX/58-387...........RGW.RRVGTAVVRWPGPI---------------------------------------------------
A0A038KUL5_MYCTX/606-944...........FWW.PNM...IHSRPTVP---------------------------------------------------
J7JRH5_BACIU/44-362...........NVW....GRFVTKNPIML---------------------------------------------------
J7JSG3_BACIU/39-360..........NKLW.AFLGRHSVARPFLF---------------------------------------------------
A0A038LFT5_MYCTX/28-366...........FWW.PQR...VRPRPASR---------------------------------------------------
A0A038WJQ1_MYCTX/54-382...........RRW.RRVGTAIVRWPGPV---------------------------------------------------
A0A038WJQ1_MYCTX/601-939...........FWW.PLR...VRPRPASQ---------------------------------------------------
MMPLA_MYCLE/55-391...........AFW.RRTGVRIVRRPVAY---------------------------------------------------
Q50086_MYCLR/31-369...........FWW.PQQ...GRTRPLLT---------------------------------------------------
A0A038KVP1_MYCTX/55-384...........RMW.RRSGVRIVRRSTIH---------------------------------------------------
A0A038KVP1_MYCTX/658-1001...........NWW.PSELGRDPSTPPTK---------------------------------------------------
MMPLA_STRCO/46-370...........GLW.SRIARLVSGRPRAV---------------------------------------------------
MMPLA_STRCO/397-682...........MWW...........PHPL---------------------------------------------------
Q9RKC1_STRCO/44-379GQPKANLG...TRW....ASFVVRRPLAV---------------------------------------------------
Q9RL63_STRCO/44-395ARRTREAGAWSVRW....ARFVQRRPVPV---------------------------------------------------
MMPLD_STRCO/50-373...........RLW.HRVAALVDRAPRRI---------------------------------------------------
A0A038LLM0_MYCTX/43-376...........RQF.RRLGTHVARWPAPI---------------------------------------------------
A0A038LLM0_MYCTX/595-943...........LWW.PRRSVSNRQVPEPS---------------------------------------------------
Q9XCF5_MYCAV/55-384...........RRW.RRIGTAIVRWPAPI---------------------------------------------------
Q9XCF5_MYCAV/604-943...........FWW.PQL...VRPRPAST---------------------------------------------------
Q9XCF6_MYCAV/51-382...........GRW.RRIGTAIVRWPTPI---------------------------------------------------
Q9XCF6_MYCAV/601-939...........FWW.PQL...VRRRPASQ---------------------------------------------------
Q9Z577_STRCO/40-368EVPTGFA....ARW....SAFVERRPKLL---------------------------------------------------

PF00873

CZCA_RALME/5-1037VKIFGDDNNVLSETAKKVSAVLQGIPG.A..-..QEVKVEQTTGLPMLTVKIDREKAARYGLNMSDVQDAVATGVGG.RD
MEXB_PSEAE/1-1028D.QAGVGHEVLLQARNKFLMLAAQNPA.L..-..QRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAWGS.SY
MDTB_ECOLI/12-1023FTLQATSLDALSTWVPQLMEKLQQLPQ.L..-..SDVSSDWQDKGLVAYVNVDRDSASRLGISMADVDNALYNAFGQ.RL
ACRF_ECOLI/1-1029D.QAGLGHDALTQARNQLLGMAAQHPASL..-..VSVRPNGLEDTAQFKLEVDQEKAQALGVSLSDINQTISTALGG.TY
P74461_SYNY3/10-1047VVLQGNDADVLDEAGRAVLAELGEKVT.L..-..ARFRPDADPRQPEVQIRPDWQRATELGLTTQAIGQTVQTALDG.AV
O25622_HELPY/6-1014VKIFGDGISELNELSFQIAQALKGIKG.S..-..SEVLTTLNEGVNYLYVTPNKESMADVGITSDEFSKFLKSALEG.LV
MDTF_ECOLI/1-1028D.NGNLGHEKLTQARNELLSLAAQSPNQV..-..TGVRPNGLEDTPMFKVNVNAAKAEAMGVALSDINQTISTAFGS.SY
Q55935_SYNY3/9-1024VKIFGPDLKELRAIGEQVQEAMKTVPG.I..-..VDLQLEPQLPIRQVQIHYDRAAAAQYGLRMADISAVVETALNG.RI
ACRB_ECOLI/1-1030D.QAGLGHEKLTQARNQLLAEAAKHPDML..-..TSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGG.SY
MDTC_ECOLI/3-1009YTLLSDDLAALREWEPKIRKKLATLPE.L..-..ADVNSDQQDNGAEMNLVYDRDTMARLGIDVQAANSLLNNAFGQ.RQ
ACRD_ECOLI/1-1027D.HAGAGHDALMAARNQLLALAAENPE.L..-..TRVRHNGLDDSPQLQIDIDQRKAQALGVAIDDINDTLQTAWGS.SY
P73998_SYNY3/2-1028DLRVNSELDTMVGTMGEILGAANQNPA.L..-..TRVFSTFQANNPQLIVNVNRNKAKSLGVPVDQIFQTMETALGS.SY
O25328_HELPY/1-1011TFVFSHSQEAVDKSVENLKKFLLESPE.LKG-KVESYHTSTSESQPQLQLKILRQNANKYGVSAQTIGSVVSSAFSGTSQ
Q5ZWS7_LEGPH/6-1036VKVFGDDMPTLLKTADAISAELKKVPG.A..-..SDVKVEQVSGLPLLTIEINRDALARYGLQIGNVQDAIVIAAGG.KK
Q9I0Y8_PSEAE/3-1040D.RGNQGYEELFKQTQNIITKARALPE.LE.-.PSSVFSSYQVNVPQIDADIDREKAKTHGVAISDIFDTLQVYLGS.LY

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

O16307_CAEEL/1-766LNHIAWIYERFLWSEGQLVMVFVNNPPDLTK.SENLHEVLELVNRFETLPYSMGKNSTSIWLRSFL..Y........QSS
P91129_CAEEL/47-858AIPHYRLLEKYFWKYGQQVQIVINNAPDLRN.HTSRDRVHAMVLDFATSKHAIGMESVQFWLFEMER.YYQ......KEL
O44978_CAEEL/31-791LVDSLSNI.KPVFNRYFPITVIVNNPPNIEI.KAEYDSFNNMMDRLEHVPGIRGDNRSLIFLPQYVNFDKT.....MNIL
Q18129_CAEEL/47-926LSKFYEIIDETFWREGLQMQVVVNNPPDLFT.PETRKGFDEMMAEFENTQYTMHPNATMIWLRAYEHHLET......EVH
O61894_CAEEL/44-830LVPYLNLAEKKIWAEGLIGRIYVNNAPDFSKNPEMVDRMLQMVNELESTPYSMGPNSTNFWLNEFN..NYR......QFF
Q21883_CAEEL/44-838LLQVNYLRDQFVLPNYTTVNIFVQNPGNLTI.QSNLDYMNSLFDSFESYPECLGKKFSHYFVRDYESFRESS...LEEME
O16530_CAEEL/48-891IVEIFKQRKSHIIPYYSACWVLVENPGDINN.PNQRAKLEELIESFEALPSANGRYSTKFWLRDYEDFLKQSEEIDLPME
Q19945_CAEEL/49-901IAKYFSDI.KHFWRIGAQLHVAVLNPPNLTI.SENRNELLKVVSAFENTQYTLGREGTVFFLLEYLNYL..S...ELNAE
Q09938_CAEEL/52-945LVEALK.REIELFHGGDQIEIAIQNCPNITI.AESRDRIELVAQEFENISYSLGGKGTSFWMREYKK.Y..S...NLTGS

PF12349

O16307_CAEEL/208-358--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
B4Q8Q7_DROSI/652-804--------------------------------------------------------------------------------
F7ANF6_MACMU/1-147--------------------------------------------------------------------------------
G1MH71_AILME/663-814--------------------------------------------------------------------------------
H3CDQ1_TETNG/587-739--------------------------------------------------------------------------------
Q23E28_TETTS/401-549--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/315-463--------------------------------------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402--------------------------------------------------------------------------------
A0A038KNA6_MYCTX/676-1049--------------------------------------------------------------------------------
A0A038KM54_MYCTX/59-388--------------------------------------------------------------------------------
A0A050EJJ2_MYCTX/63-393--------------------------------------------------------------------------------
A0A050EJJ2_MYCTX/612-950--------------------------------------------------------------------------------
MMPLB_STRCO/48-383--------------------------------------------------------------------------------
B8ZT45_MYCLB/57-385--------------------------------------------------------------------------------
A0A038F826_MYCTX/74-391--------------------------------------------------------------------------------
A0A038KV10_MYCTX/29-358--------------------------------------------------------------------------------
A0A038KR05_MYCTX/52-381--------------------------------------------------------------------------------
A0A038KR05_MYCTX/600-941--------------------------------------------------------------------------------
A0A038KUL5_MYCTX/58-387--------------------------------------------------------------------------------
A0A038KUL5_MYCTX/606-944--------------------------------------------------------------------------------
J7JRH5_BACIU/44-362--------------------------------------------------------------------------------
J7JSG3_BACIU/39-360--------------------------------------------------------------------------------
A0A038LFT5_MYCTX/28-366--------------------------------------------------------------------------------
A0A038WJQ1_MYCTX/54-382--------------------------------------------------------------------------------
A0A038WJQ1_MYCTX/601-939--------------------------------------------------------------------------------
MMPLA_MYCLE/55-391--------------------------------------------------------------------------------
Q50086_MYCLR/31-369--------------------------------------------------------------------------------
A0A038KVP1_MYCTX/55-384--------------------------------------------------------------------------------
A0A038KVP1_MYCTX/658-1001--------------------------------------------------------------------------------
MMPLA_STRCO/46-370--------------------------------------------------------------------------------
MMPLA_STRCO/397-682--------------------------------------------------------------------------------
Q9RKC1_STRCO/44-379--------------------------------------------------------------------------------
Q9RL63_STRCO/44-395--------------------------------------------------------------------------------
MMPLD_STRCO/50-373--------------------------------------------------------------------------------
A0A038LLM0_MYCTX/43-376--------------------------------------------------------------------------------
A0A038LLM0_MYCTX/595-943--------------------------------------------------------------------------------
Q9XCF5_MYCAV/55-384--------------------------------------------------------------------------------
Q9XCF5_MYCAV/604-943--------------------------------------------------------------------------------
Q9XCF6_MYCAV/51-382--------------------------------------------------------------------------------
Q9XCF6_MYCAV/601-939--------------------------------------------------------------------------------
Q9Z577_STRCO/40-368--------------------------------------------------------------------------------

PF00873

CZCA_RALME/5-1037SGTFFQGDRRFDIVVRLPEAVRGEVEALRRLPIPLPKGVDARTTFIPLSEVATLEMAPGPNQISRENGKRRIVISANV..
MEXB_PSEAE/1-1028VNDFIDRGRVKRVYLQGRPDARMNPDDLSKWYVRNDKGE.....MVPFNAFATGKWEYGSPKLERYNGVPAMEILGEP..
MDTB_ECOLI/12-1023ISTIYTQANQYRVVLEHNTENTPGLAALDTIRLTSSDGG.....VVPLSSIAKIEQRFAPLSINHLDQFPVTTISFNV..
ACRF_ECOLI/1-1029VNDFIDRGRVKKLYVQADAKFRMLPEDVDKLYVRSANGE.....MVPFSAFTTSHWVYGSPRLERYNGLPSMEIQGEA..
P74461_SYNY3/10-1047PTQLQRENRLVDVRVKLDNDLLSGPGDLAQIPLFIDGDR.....PIRLGDVATIDQGRAPGEIQRINQRPVFLIAGTL..
O25622_HELPY/6-1014VDVIPTGISRTPVMIRQESDFASSITKIKSLALTSKYGV.....LVPITSIAKIEEVDGPVSVVRENSMRMSVVRSNV..
MDTF_ECOLI/1-1028VNDFLNQGRVKKVYVQAGTPFRMLPDNINQWYVRNASGT.....MAPLSAYSSTEWTYGSPRLERYNGIPSMEILGEA..
Q55935_SYNY3/9-1024VSQVPEDQQLVNVVVMLPETERNSLDAMGAIPISTPTGQ.....MITLGDVAKIDYGMGANVVNREDVSRLIVVSANV..
ACRB_ECOLI/1-1030VNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQ.....MVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQA..
MDTC_ECOLI/3-1009ISTIYQPMNQYKVVMEVDPRYTQDISALEKMFVINNEGK.....AIPLSYFAKWQPANAPLSVNHQGLSAASTISFNL..
ACRD_ECOLI/1-1027VNDFMDRGRVKKVYVQAAAPYRMLPDDINLWYVRNKDGG.....MVPFSAFATSRWETGSPRLERYNGYSAVEIVGEA..
P73998_SYNY3/2-1028VNDFVLQGRTYRVYLQADEQFRSSPEDINSLYVRSESGT.....MIPMANLVTVTQGVGAPIITHYNLFRSIAITGSA..
O25328_HELPY/1-1011ASVFKEDGKEYDMIIRVPDDKRVSVEDIKRLQVRNKYDK.....LMFLDALVEITETKSPSSISRYNRQRSVTVLAEPNR
Q5ZWS7_LEGPH/6-1036GGELFEGDKRFDLIVRLPEALRTSPTVLRQVFIPLPLAKDGERHFIPLSEVAKMVRSESPNQISREVGKRRVVVTANV..
Q9I0Y8_PSEAE/3-1040ANDFNRFGRTYQVNVQAEQQFRLEPEQIGQLKVRNNLGE.....MVPLASFIKVSDTSGPDRVMHYNGFITAELNGAP..

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

O16307_CAEEL/1-766LYHNNK.................GF.NGLLQEWLEDSEGGGA.RWNDMLRLK.KDENGTILGIDKFMFATACAMGDDANW
P91129_CAEEL/47-858EVQIID.................SS.FYGLLHHFLASKTNNP.LAEDIYWGP.MPDDDNGTMVKSFRFILG..MKDLVTT
O44978_CAEEL/31-791STLVGEK................YRPSYDNLPTWMDAIGNPP.LVKYHMGD......DNKTIVTAFRLTLL..GKGMSEW
Q18129_CAEEL/47-926ELNIEKPNS............TVEW.YTRCRDWLIVAGGRRL.WQMDMVWA..NTTFEETPRITAFRFQLG..LRNYRTP
O61894_CAEEL/44-830FQEDAK....................FYETLKSFLKVSFNSH.WETDLVWDTPDKSSKGGTKVEKFVFTTA...FKISNW
Q21883_CAEEL/44-838MMEDEEGDTN.........KTALEPFSKAAMSEFLAWPEFQH.WNGFVKFD.......KNGMLSKYWATVSYHGEGLGDF
O16530_CAEEL/48-891EEEDEELAIQFTVNGSQVVTPSQPFGQGNELRQFLEWPEFSF.WKGFIQVN......ESTYQMSKFLVTTAYHGSDLVDW
Q19945_CAEEL/49-901VEDTER.................LW..KTKLNSWLKYTGGSTQWASNLKIN......KTDGSFQAFRFQIA..LKNFVEP
Q09938_CAEEL/52-945YLNDNRE................SW.IVGVYEWSQLFAFYKL.WSQDFVWA..NESDYDTLELKSYRFRIG..VHRLSTP

PF12349

O16307_CAEEL/208-358--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
B4Q8Q7_DROSI/652-804--------------------------------------------------------------------------------
F7ANF6_MACMU/1-147--------------------------------------------------------------------------------
G1MH71_AILME/663-814--------------------------------------------------------------------------------
H3CDQ1_TETNG/587-739--------------------------------------------------------------------------------
Q23E28_TETTS/401-549--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/315-463--------------------------------------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402--------------------------------------------------------------------------------
A0A038KNA6_MYCTX/676-1049--------------------------------------------------------------------------------
A0A038KM54_MYCTX/59-388--------------------------------------------------------------------------------
A0A050EJJ2_MYCTX/63-393--------------------------------------------------------------------------------
A0A050EJJ2_MYCTX/612-950--------------------------------------------------------------------------------
MMPLB_STRCO/48-383--------------------------------------------------------------------------------
B8ZT45_MYCLB/57-385--------------------------------------------------------------------------------
A0A038F826_MYCTX/74-391--------------------------------------------------------------------------------
A0A038KV10_MYCTX/29-358--------------------------------------------------------------------------------
A0A038KR05_MYCTX/52-381--------------------------------------------------------------------------------
A0A038KR05_MYCTX/600-941--------------------------------------------------------------------------------
A0A038KUL5_MYCTX/58-387--------------------------------------------------------------------------------
A0A038KUL5_MYCTX/606-944--------------------------------------------------------------------------------
J7JRH5_BACIU/44-362--------------------------------------------------------------------------------
J7JSG3_BACIU/39-360--------------------------------------------------------------------------------
A0A038LFT5_MYCTX/28-366--------------------------------------------------------------------------------
A0A038WJQ1_MYCTX/54-382--------------------------------------------------------------------------------
A0A038WJQ1_MYCTX/601-939--------------------------------------------------------------------------------
MMPLA_MYCLE/55-391--------------------------------------------------------------------------------
Q50086_MYCLR/31-369--------------------------------------------------------------------------------
A0A038KVP1_MYCTX/55-384--------------------------------------------------------------------------------
A0A038KVP1_MYCTX/658-1001--------------------------------------------------------------------------------
MMPLA_STRCO/46-370--------------------------------------------------------------------------------
MMPLA_STRCO/397-682--------------------------------------------------------------------------------
Q9RKC1_STRCO/44-379--------------------------------------------------------------------------------
Q9RL63_STRCO/44-395--------------------------------------------------------------------------------
MMPLD_STRCO/50-373--------------------------------------------------------------------------------
A0A038LLM0_MYCTX/43-376--------------------------------------------------------------------------------
A0A038LLM0_MYCTX/595-943--------------------------------------------------------------------------------
Q9XCF5_MYCAV/55-384--------------------------------------------------------------------------------
Q9XCF5_MYCAV/604-943--------------------------------------------------------------------------------
Q9XCF6_MYCAV/51-382--------------------------------------------------------------------------------
Q9XCF6_MYCAV/601-939--------------------------------------------------------------------------------
Q9Z577_STRCO/40-368--------------------------------------------------------------------------------

PF00873

CZCA_RALME/5-1037RGRDIGSFVPEAEAAIQSQVKIPAGYWMTWGGTFEQLQSATTRLQVVVPVALLLVFVLLFAMFNNIKDGLLVFTGIPFAL
MEXB_PSEAE/1-1028APGLSSGDAMAAVEEIVKQ..LPKGVGYSWTGLSYEERLSGSQAPALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGV
MDTB_ECOLI/12-1023PDNYSLGDAVQAIMDTEKTLNLPVDITTQFQGSTLAFQSALGSTVWLIVAAVVAMYIVLGILYESFIHPITILSTLPTAG
ACRF_ECOLI/1-1029APGTSSGDAMALMENLASK..LPAGIGYDWTGMSYQERLSGNQAPALVAISFVVVFLCLAALYESWSIPVSVMLVVPLGI
P74461_SYNY3/10-1047VEGASLSEALTEVDQVLSAMEFPPGVSRLPSTAAASNEQLQSSLVILGGLAAFLVFVVMAVQYNSLLDPLVIMFTLPLAL
O25622_HELPY/6-1014VGRDLKSFVEEAKKVIAQNIKLPPSYYITYGGQFENQQRANKRLSTVIPLSILAIFFILFFTFKSIPLALLILLNIPFAV
MDTF_ECOLI/1-1028AAGKSTGDAMKFMADLVAK..LPAGVGYSWTGLSYQEALSSNQAPALYAISLVVVFLALAALYESWSIPFSVMLVVPLGV
Q55935_SYNY3/9-1024AERDLGSVVEDVQAQIKEKVQLPQGYFIEYGGQFESEQRATNSLLLFSFVAALVIGILMFFSVKSLPATIAIMINLPLAL
ACRB_ECOLI/1-1030APGKSTGEAMELMEQLASK..LPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGV
MDTC_ECOLI/3-1009PTGKSLSDASAAIDRAMTQLGVPSTVRGSFAGTAQVFQETMNSQVILIIAAIATVYIVLGILYESYVHPLTILSTLPSAG
ACRD_ECOLI/1-1027APGVSTGTAMDIMESLVKQ..LPNGFGLEWTAMSYQERLSGAQAPALYAISLLVVFLCLAALYESWSVPFSVMLVVPLGV
P73998_SYNY3/2-1028NFGVSTGQAMNAMAAIARQ.VMPPGFDFQWSGISLEEMGSQGQAPLIFGLGLLFVFLVLAAQYENYIDPVIILLSVPLAI
O25328_HELPY/1-1011NAGVSLGEILTQVSKNTKE.WLVEGANYRFTGEADNAKESNGEFLVALATAFVLIYMILAALYESILEPFIIMVTMPLSF
Q5ZWS7_LEGPH/6-1036RNRDLSSFVNEAKQRIEQKVKVPSGYWITWGGQFEQLQSASQRLQIVVPITLLGIFLLLFMSFGNARNALLVFSGIPLAL
Q9I0Y8_PSEAE/3-1040AAGYSSGQAQAAIEKLLKE.ELPNGMTYEWTELTYQQILAGNTALFVFPLCVLLAFLVLAAQYESWSLPLAVILIVPMTL

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

O16307_CAEEL/1-766STREKLQKQWRGVAHEYEH..FNVTVFQSYSFYIDQLDSIGATTMSTVIWAAITMDLACLLMIPGINSILTSTIAMISIN
P91129_CAEEL/47-858MDQTDATMSFREVAARWPE..FNVTTFMPIWMFTDQYIIIIPNTVQNIIIALLVMIVIAVLFIPQPMCSLWVALACASID
O44978_CAEEL/31-791AERARAMQHIRTILHEESQ..FNATLFDCDSAILSIILTVGTDLIGSIAVTVVCMAIVCFVFIANFNAVAVITSVIASIC
Q18129_CAEEL/47-926TDHTHSCKLMRSIADKYSM..FNVTTFHEYYPFADQYLELTPSLFQNMISDLCTIFAVSWVMIPELICAVAIVLSIASIN
O61894_CAEEL/44-830NIRTSLLLTWRNITSSYPE..FDALVFDENNFYSDQMLELQSTILSSLGTAIILLSAICIMFIAESYIVFWVVCTLISMD
Q21883_CAEEL/44-838QVRRRMLNRWRATADQFAP..LNVSIFDDYAPFVDTLETILPATISTSVCTLICMMIVCFLFMYNVFTVFVATLAITSIC
O16530_CAEEL/48-891SNRAKLLNEWRSVADQDKFKSLNVTVYEEDAKFLDLIETMSPVAIQSALWTFASMFLVAALFISHPPTLFVATFSILSTS
Q19945_CAEEL/49-901NDHKHAAQLLRDIAD.HQP..FNVVVYHEAFPFADQYLIILPATIQNVVISLLCMAVVSFLLVPSLPSGFVIFVSIVSIN
Q09938_CAEEL/52-945TDLVLITEELRGVADRHPD..LNIVTYQQSRAIADQLNVILSSTITNDTLAMFCMFCVALIFIPNPICALFITFAMVTID

PF12349

O16307_CAEEL/208-358--------------------------------------------------------------------------------
A1CTG5_ASPCL/632-787--------------------------------------------------------------------------------
A1Z6J2_DROME/390-543--------------------------------------------------------------------------------
PTC2_MOUSE/418-570--------------------------------------------------------------------------------
A4S8G2_OSTLU/258-409--------------------------------------------------------------------------------
A5E1Z8_LODEL/460-615--------------------------------------------------------------------------------
A7RI14_NEMVE/240-393--------------------------------------------------------------------------------
A7RNK5_NEMVE/879-1035--------------------------------------------------------------------------------
A7S0G1_NEMVE/641-795--------------------------------------------------------------------------------
NPC1_HUMAN/649-803--------------------------------------------------------------------------------
SCAP_SCHPO/257-410--------------------------------------------------------------------------------
O61894_CAEEL/286-437--------------------------------------------------------------------------------
P91129_CAEEL/295-446--------------------------------------------------------------------------------
P91346_CAEEL/298-449--------------------------------------------------------------------------------
PTR9_CAEEL/288-439--------------------------------------------------------------------------------
Q16VL3_AEDAE/637-791--------------------------------------------------------------------------------
Q17FP9_AEDAE/355-509--------------------------------------------------------------------------------
Q17N28_AEDAE/360-513--------------------------------------------------------------------------------
Q18968_CAEEL/295-448--------------------------------------------------------------------------------
Q19945_CAEEL/297-448--------------------------------------------------------------------------------
Q21883_CAEEL/287-442--------------------------------------------------------------------------------
Q29GK5_DROPS/626-780--------------------------------------------------------------------------------
Q2HB50_CHAGB/263-415--------------------------------------------------------------------------------
Q4PBD7_USTMA/410-564--------------------------------------------------------------------------------
B4Q8Q7_DROSI/652-804--------------------------------------------------------------------------------
F7ANF6_MACMU/1-147--------------------------------------------------------------------------------
G1MH71_AILME/663-814--------------------------------------------------------------------------------
H3CDQ1_TETNG/587-739--------------------------------------------------------------------------------
Q23E28_TETTS/401-549--------------------------------------------------------------------------------
Q7S7Y9_NEUCR/315-463--------------------------------------------------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402--------------------------------------------------------------------------------
A0A038KNA6_MYCTX/676-1049--------------------------------------------------------------------------------
A0A038KM54_MYCTX/59-388--------------------------------------------------------------------------------
A0A050EJJ2_MYCTX/63-393--------------------------------------------------------------------------------
A0A050EJJ2_MYCTX/612-950--------------------------------------------------------------------------------
MMPLB_STRCO/48-383--------------------------------------------------------------------------------
B8ZT45_MYCLB/57-385--------------------------------------------------------------------------------
A0A038F826_MYCTX/74-391--------------------------------------------------------------------------------
A0A038KV10_MYCTX/29-358--------------------------------------------------------------------------------
A0A038KR05_MYCTX/52-381--------------------------------------------------------------------------------
A0A038KR05_MYCTX/600-941--------------------------------------------------------------------------------
A0A038KUL5_MYCTX/58-387--------------------------------------------------------------------------------
A0A038KUL5_MYCTX/606-944--------------------------------------------------------------------------------
J7JRH5_BACIU/44-362--------------------------------------------------------------------------------
J7JSG3_BACIU/39-360--------------------------------------------------------------------------------
A0A038LFT5_MYCTX/28-366--------------------------------------------------------------------------------
A0A038WJQ1_MYCTX/54-382--------------------------------------------------------------------------------
A0A038WJQ1_MYCTX/601-939--------------------------------------------------------------------------------
MMPLA_MYCLE/55-391--------------------------------------------------------------------------------
Q50086_MYCLR/31-369--------------------------------------------------------------------------------
A0A038KVP1_MYCTX/55-384--------------------------------------------------------------------------------
A0A038KVP1_MYCTX/658-1001--------------------------------------------------------------------------------
MMPLA_STRCO/46-370--------------------------------------------------------------------------------
MMPLA_STRCO/397-682--------------------------------------------------------------------------------
Q9RKC1_STRCO/44-379--------------------------------------------------------------------------------
Q9RL63_STRCO/44-395--------------------------------------------------------------------------------
MMPLD_STRCO/50-373--------------------------------------------------------------------------------
A0A038LLM0_MYCTX/43-376--------------------------------------------------------------------------------
A0A038LLM0_MYCTX/595-943--------------------------------------------------------------------------------
Q9XCF5_MYCAV/55-384--------------------------------------------------------------------------------
Q9XCF5_MYCAV/604-943--------------------------------------------------------------------------------
Q9XCF6_MYCAV/51-382--------------------------------------------------------------------------------
Q9XCF6_MYCAV/601-939--------------------------------------------------------------------------------
Q9Z577_STRCO/40-368--------------------------------------------------------------------------------

PF00873

CZCA_RALME/5-1037TGGILALWIRGIPMSITAAVGFIALCGVAVLNGLVMLSFIRSLRE.EGHSLDSAVRVGALTRLRPVLMTALVASLGFVPM
MEXB_PSEAE/1-1028IGALLATSMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHE.QGKGIVEAAIEACRMRLRPIVMTSLAFILGVVPL
MDTB_ECOLI/12-1023VGALLALLIAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMSPREAIYQACLLRFRPILMTTLAALLGALPL
ACRF_ECOLI/1-1029VGVLLAATLFNQKNDVYFMVGLLTTIGLSAKNAILIVEFAKDLMEKEGKGVVEATLMAVRMRLRPILMTSLAFILGVLPL
P74461_SYNY3/10-1047AGGILGLYVTQTAIGATVIVGTVLLVGIVVNNAIIMVELANQIWAEEGISREAAILRAAPQRLRPILMTTITTVLGMFPL
O25622_HELPY/6-1014TGGLIALFAVGEYISVPASVGFIALFGIAVLNGVVMIGYFKELLLQGKS.VEECVLLGAKRRLRPVLMTACIAGLGLLPL
MDTF_ECOLI/1-1028VGALLATDLRGLSNDVYFQVGLLTTIGLSAKNAILIVEFAVEMMQKEGKTPIEAIIEAARMRLRPILMTSLAFILGVLPL
Q55935_SYNY3/9-1024IGGLLSVVFTGGVISIASLVGFITLFGVAVRNGLLLVDNYNQKFAQGMK.LKETIFKGSMERVNAILMTALTSALGMLPL
ACRB_ECOLI/1-1030IGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPL
MDTC_ECOLI/3-1009VGALLALELFNAPFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRHGNLTPQEAIFQACLLRFRPIMMTTLAALFGALPL
ACRD_ECOLI/1-1027IGALLATWMRGLENDVYFQVGLLTVIGLSAKNAILIVEFANEMNQ.KGHDLFEATLHACRQRLRPILMTSLAFIFGVLPM
P73998_SYNY3/2-1028LGALTAQSLRGFPNDVYCQIGLVMLIGLSSKNAILIVEFANQLRA.EGYPIAKAALEASKDRLRPILMTALSTLFGIFPL
O25328_HELPY/1-1011SGAFFALGLVHQPLSMFSMIGLILLIGMVGKNATLLIDVANEERK.KGLNIQEAILFAGKTRLRPILMTTIAMVCGMLPL
Q5ZWS7_LEGPH/6-1036TGGVFALWLRGIPLSISAGVGFIALSGVAVLNGLVMITFINKLREQKKYYLKDAVLQGSLARLRPVLMTALVASLGFVPM
Q9I0Y8_PSEAE/3-1040LSAITGVILAGSDNNIFTQIGLIVLVGLACKNAILIVEFAKDKQE.EGMDRVAAVLEACRLRLRPILMTSIAFIMGVVPL

PF02355

SECF_METTH/102-285--------------------------------------------------------------------------------
SECF_BORBU/108-297--------------------------------------------------------------------------------
SECDF_BACSU/540-729--------------------------------------------------------------------------------
SECF_STRCO/109-305--------------------------------------------------------------------------------
SECF_HAEIN/120-308--------------------------------------------------------------------------------
SECF_ECOLI/114-302--------------------------------------------------------------------------------
SECF_SYNY3/108-301--------------------------------------------------------------------------------
SECF_RICPR/110-299--------------------------------------------------------------------------------
SECF_HELPY/106-293--------------------------------------------------------------------------------
SECF_RHOCB/123-311--------------------------------------------------------------------------------
SECF_METJA/88-276--------------------------------------------------------------------------------
SECF_TREPA/222-411--------------------------------------------------------------------------------
Q9ZBS8_STRCO/569-757--------------------------------------------------------------------------------
SECF_RHOS4/117-305--------------------------------------------------------------------------------
O84454_CHLTR/1200-1393--------------------------------------------------------------------------------
SECF_MYCLE/183-379--------------------------------------------------------------------------------
SECF_AQUAE/92-279--------------------------------------------------------------------------------

PF02460

O16307_CAEEL/1-766IGVFGLLSMWRVNLDPITMCTTLMSIGFSVDFTAHISYHYYRNPTS...WTTDERLADALKSIGWPMIQAASSTVLCIFP
P91129_CAEEL/47-858FGVIGYMTLWGVNLDAISMITIIMSIGFSVDYSAHIAYGYVVSRED....TAAGRVKEALSALGWPLSQGAMSTIIAVSV
O44978_CAEEL/31-791YVLVGGLSLWGADLDPVIQVDVLLATGFSVDYTAHVAYNFFRARG.....TPQERVYSSLAEMAMPMCEAGLSTFLCMLP
Q18129_CAEEL/47-926VGVLGFMSFWGVNLDSVSIITVIMCIGFSVDLSAHIAYAFSQSYG.....NSHARAVAALETLGWPVFLGASSTVLGILL
O61894_CAEEL/44-830IGTAGLLSLWGADLDPMTVVNILMSIGQCIDFATHVGIRIYRSEYS....DPDERIRDAMGAIGWPVVQAGTSTLLAIVV
Q21883_CAEEL/44-838IGVFGFLSMWGIDLDPISMACLIMSIGFSVDFPAHITFHYFREGLHDPQSTPAKRVARSLAAIGFPLLQCGLSTILFVLC
O16530_CAEEL/48-891LGVFGIMSWWGADLDPIMMSATVMSIGFSVDIPSHVSYHFYQTAKDT..SDIRRRLQMTIEAVGFPIFEASLSTSLCVMS
Q19945_CAEEL/49-901IGVFGYMTLWGVNLDAVSMISIIMSIGFAVDLSAHIIYAFVTSHG.....DTKQRVIGALETLGWPIFQGASSTIAGISI
Q09938_CAEEL/52-945IGVIGFLSLWSVKLDPISMITIIMSIGFSIEFSAHITHGFVSNDSN...LSAFDRCVDAMEKLAWPVVHGSLSTILGVFV

PF12349

O16307_CAEEL/208-358-----------------------------------------
A1CTG5_ASPCL/632-787-----------------------------------------
A1Z6J2_DROME/390-543-----------------------------------------
PTC2_MOUSE/418-570-----------------------------------------
A4S8G2_OSTLU/258-409-----------------------------------------
A5E1Z8_LODEL/460-615-----------------------------------------
A7RI14_NEMVE/240-393-----------------------------------------
A7RNK5_NEMVE/879-1035-----------------------------------------
A7S0G1_NEMVE/641-795-----------------------------------------
NPC1_HUMAN/649-803-----------------------------------------
SCAP_SCHPO/257-410-----------------------------------------
O61894_CAEEL/286-437-----------------------------------------
P91129_CAEEL/295-446-----------------------------------------
P91346_CAEEL/298-449-----------------------------------------
PTR9_CAEEL/288-439-----------------------------------------
Q16VL3_AEDAE/637-791-----------------------------------------
Q17FP9_AEDAE/355-509-----------------------------------------
Q17N28_AEDAE/360-513-----------------------------------------
Q18968_CAEEL/295-448-----------------------------------------
Q19945_CAEEL/297-448-----------------------------------------
Q21883_CAEEL/287-442-----------------------------------------
Q29GK5_DROPS/626-780-----------------------------------------
Q2HB50_CHAGB/263-415-----------------------------------------
Q4PBD7_USTMA/410-564-----------------------------------------
B4Q8Q7_DROSI/652-804-----------------------------------------
F7ANF6_MACMU/1-147-----------------------------------------
G1MH71_AILME/663-814-----------------------------------------
H3CDQ1_TETNG/587-739-----------------------------------------
Q23E28_TETTS/401-549-----------------------------------------
Q7S7Y9_NEUCR/315-463-----------------------------------------

PF03176

A0A038KNA6_MYCTX/74-402-----------------------------------------
A0A038KNA6_MYCTX/676-1049-----------------------------------------
A0A038KM54_MYCTX/59-388-----------------------------------------
A0A050EJJ2_MYCTX/63-393-----------------------------------------
A0A050EJJ2_MYCTX/612-950-----------------------------------------
MMPLB_STRCO/48-383-----------------------------------------
B8ZT45_MYCLB/57-385-----------------------------------------
A0A038F826_MYCTX/74-391-----------------------------------------
A0A038KV10_MYCTX/29-358-----------------------------------------
A0A038KR05_MYCTX/52-381-----------------------------------------
A0A038KR05_MYCTX/600-941-----------------------------------------
A0A038KUL5_MYCTX/58-387-----------------------------------------
A0A038KUL5_MYCTX/606-944-----------------------------------------
J7JRH5_BACIU/44-362-----------------------------------------
J7JSG3_BACIU/39-360-----------------------------------------
A0A038LFT5_MYCTX/28-366-----------------------------------------
A0A038WJQ1_MYCTX/54-382-----------------------------------------
A0A038WJQ1_MYCTX/601-939-----------------------------------------
MMPLA_MYCLE/55-391-----------------------------------------
Q50086_MYCLR/31-369-----------------------------------------
A0A038KVP1_MYCTX/55-384-----------------------------------------
A0A038KVP1_MYCTX/658-1001-----------------------------------------
MMPLA_STRCO/46-370-----------------------------------------
MMPLA_STRCO/397-682-----------------------------------------
Q9RKC1_STRCO/44-379-----------------------------------------
Q9RL63_STRCO/44-395-----------------------------------------
MMPLD_STRCO/50-373-----------------------------------------
A0A038LLM0_MYCTX/43-376-----------------------------------------
A0A038LLM0_MYCTX/595-943-----------------------------------------
Q9XCF5_MYCAV/55-384-----------------------------------------
Q9XCF5_MYCAV/604-943-----------------------------------------
Q9XCF6_MYCAV/51-382-----------------------------------------
Q9XCF6_MYCAV/601-939-----------------------------------------
Q9Z577_STRCO/40-368-----------------------------------------

PF00873

CZCA_RALME/5-1037AIATGTGAEVQRPLATVVIGGILSSTALTLLVLPVLYRLAH
MEXB_PSEAE/1-1028AISTGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYVAVS
MDTB_ECOLI/12-1023MLSTGVGAELRRPLGIGMVGGLIVSQVLTLFTTPVIYLLFD
ACRF_ECOLI/1-1029AISNGAGSGAQNAVGIGVMGGMVSATLLAIFFVPVFFVVIR
P74461_SYNY3/10-1047ALGIGQGSELLQPLGIVVFSGLSLATLLTLFLIPCLYVLLH
O25622_HELPY/6-1014LFSHSVGSEVQKPLAIVVLGGLVTSSALTLLLLPPMFMLIA
MDTF_ECOLI/1-1028VISHGAGSGAQNAVGTGVMGGMFAATVLAIYFVPVFFVVVE
Q55935_SYNY3/9-1024ATASSAGNEILQPLAIVVLGGLCTSTALTLLVLPALYAKFG
ACRB_ECOLI/1-1030VISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVR
MDTC_ECOLI/3-1009VLSGGDGSELRQPLGITIVGGLVMSQLLTLYTTPVVYLFFD
ACRD_ECOLI/1-1027ATSTGAGSGGQHAVGTGVMGGMISATILAIYFVPLFFVLVR
P73998_SYNY3/2-1028AIATGAGAGSRQALGTAVFGGMLVATFLSLFVVPVLYIVVK
O25328_HELPY/1-1011ALASGDGAAMKSPIGIAMSGGLMISMVLSLLIVPVFYRLLA
Q5ZWS7_LEGPH/6-1036ALATGTGSEVQRPLATVVIGGIISSTFLTLLVLPGLYYIFH
Q9I0Y8_PSEAE/3-1040VISTGAGAEMRHAMGVAVFSGMIGVTFFGLLLTPVFYVLIR

PF02355

SECF_METTH/102-285-----------------------------------------
SECF_BORBU/108-297-----------------------------------------
SECDF_BACSU/540-729-----------------------------------------
SECF_STRCO/109-305-----------------------------------------
SECF_HAEIN/120-308-----------------------------------------
SECF_ECOLI/114-302-----------------------------------------
SECF_SYNY3/108-301-----------------------------------------
SECF_RICPR/110-299-----------------------------------------
SECF_HELPY/106-293-----------------------------------------
SECF_RHOCB/123-311-----------------------------------------
SECF_METJA/88-276-----------------------------------------
SECF_TREPA/222-411-----------------------------------------
Q9ZBS8_STRCO/569-757-----------------------------------------
SECF_RHOS4/117-305-----------------------------------------
O84454_CHLTR/1200-1393-----------------------------------------
SECF_MYCLE/183-379-----------------------------------------
SECF_AQUAE/92-279-----------------------------------------

PF02460

O16307_CAEEL/1-766LMFNTSYMVWVFVKTILLVTVLGLLHGIIFLPALLLTSGD-
P91129_CAEEL/47-858LADIPAYMIVTFFKTVVLSISLGLLHGLVFLPVLLSIFVR-
O44978_CAEEL/31-791LIFVPTYAIVCFAKTVFLVVAIGLLHGLFILPVILALFSK-
Q18129_CAEEL/47-926LTLVDSYIVQIFFKTVFLVINFSILHGLIFLPIFLMKVVR-
O61894_CAEEL/44-830MLMVPSSAVRMFARTSVLVVGTGFFHGLIILPIIVRSFAT-
Q21883_CAEEL/44-838LLFVPTYMGEVFVKTMILVVTLGLIHGLFIVPAFLCAFTA-
O16530_CAEEL/48-891LFFVDLNMAQIFAKCMLLVVVIGMVHGMLVMPVIFALLDT-
Q19945_CAEEL/49-901LYTVDAYIILVFFKTIWLTMLIGAIHGLFFIPIFLSLFPV-
Q09938_CAEEL/52-945LAFIDSYMVLVFFKTISLVLIIGAWHALMLLPILLSMCIP-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window