Sequence alignment for CL0323

PF01735

PLB2_SCHPO/134-617LGLAFSGGGLRAM----VHGGGVLNAFDSRN------------------------.GNGS...SLAGILQSAMY----IA
PLB5_SCHPO/125-607LGIAISGGGFPAM----LTGAGAINAFDARN------------------------.GNTT...SLGGILQSSMY----LT
PLB1_YEAST/99-586IAVACSGGGYRAM----LSGAGMLAAMDNRT------------------------.DGANE.HGLGGLLQGATY----LA
PA24A_CHICK/190-675IAVLGSGGGFRAM----VGFAGVMKALY...------------------------.........ESGVLDCATY----IA
PLB_NEUCR/121-606VAIAISGGGYRAL----MNGAGFVAAADNRI------------------------.QNTTGAGGIGGLLQSSTY----LA
PLB_KLULA/102-589VAIACSGGGYRAM----LSGAGMISAMDNRT------------------------.DGAND.HGLGGLLQSSTY----LA
PLB6_SCHPO/114-600LGIAVSGGGWRSM----LFGGGALAALDSRS------------------------.NETT....LGGLLQSAHY----IT
PA24A_DANRE/185-664IAILGSGGGFRAM----VGFSGVMKALY...------------------------.........ESGVFDCATY----VA
PLB1_CANAL/88-565IGLAFSGGGYRAM----LTGAGEISSLDSRT------------------------KTNTP...VLAGILQASSY----IA
PLB3_YEAST/105-592IAVAVSGGGYRSM----LTGAGVLAAMDNRT------------------------.EGAYE.HGLGGLLQSTTY----LS
PLB1_SCHPO/114-593IGIALSGGGLRAM----ILGSGALSAMDARH------------------------.DNHT...VLTGLLQASDY----LV
PLB2_YEAST/101-588IGIACSGGGYRAM----LGGAGMIAAMDNRT------------------------.DGANE.HGLGGLLQSSTY----LS
B6HB59_PENCW/114-597IGIAVSGGGWRAL----MNGAGAVKAFDSRT------------------------.DNATATGHLGGLLQSATY----IS
G8ZY27_TORDC/97-584IAVACSGGGYRAM----LSGAGMLAAMDNRT------------------------.DGANE.HGLGGLLQSTTY----LA
Q59W34_CANAL/88-564IGLAFGGGGYRAM----LVGAGELLALDSRA------------------------.TNPS...VLSGILQSSSY----IV

PF01734

Q9N5Z7_CAEEL/97-269--LSFGGCGFL.G....SYQFGAAKM....IF..............................DHGKKLMKRVER----YS
G7QJN7_LEPII/12-165--LTFNSAFFG.F....YAHAGFAKG....L..................................SEIGFRPSK----IT
B8GC44_CHLAD/8-228--LVLAGGGVAGA....AYEIGALCAIDQVL.................................DHLSVNEFDI----YV
C1DSE3_AZOVD/14-206--LALQGGGAH.G....AFTWGVLDA...LL..................................EDGRLDFTG----IS
A9BEP0_PETMO/3-174--LVMGGFFEG.F....YWESGVLES....I...................................AKKENALN----LY
A9B328_HERA2/4-179--IVFSGGANR.G....SLQAGAALA....L..................................LEAGIIPDL----VV
B2U808_RALPJ/9-214--MVFAGGGNR.C....WWQAGWWDV....V.................................QPELGLAPRV----IA
Q3AAC7_CARHZ/6-206--LALGGGFLR.G....AAHIGVLKV....L..................................EKEGLKPSI----VS
A6CHF0_9BACI/8-175--LVLEGGGMR.G....VYTAGVLEF....F..................................LEKEIEFPY----VI
Q2GUC2_CHAGB/19-224--LCIDGGGIK.G....YTALLILRRIFRTLSADM.........................GGNLSPRPCDIFDL----IA
Q9XAG3_STRCO/16-207--LVLGGGGLTAY....GWQIGVLAG....LA...............................DAGVDLADADV----LA
A0A022N4I9_9ACTO/11-221--LVLGAGGVLGS....AWMIGAMRAVETAT..................................GRDLSGADL----VV
Q8R6F6_FUSNN/65-256--LVLSGGGVK.G....YAHLGVLRV....L..................................ERENIKIDY----IT
D5AXK0_RICPP/15-214--ALLEGGGVK.G....EIHLEKLKVIEEIT.................................GKPTCKVFDF----TG
Q038G8_LACC3/6-159--VVFGGGAAH.G....AYQAGVWAVLGPRL.......................................RPTF----VI
A5IE43_LEGPC/25-249--VVCSGGGAK.G....VVYPGSYKA....M................................EDTGVFKGVEE----LS
Q4UJC7_RICFE/42-240--LSLSGGGVK.G....IAELVVLAEIEERT.................................GKSISELFPI----IS
Q54HM9_DICDI/140-357--VTLDGGGIR.G....IVTLTILRELQKMM.................................GLDIIDKAHM----VC
Q2K9E1_RHIEC/30-248--LCLSGGYRA.M....LFHAGSLAR....L................................NEAGLLAKLDM----IS
A4IAC8_LEIIN/190-378--LLLQGGVLA.S....SAHFGVAKA....L..................................YDAGLLPPV----VY
Q21S96_ALBFT/26-231--VVFAGGGNR.C....FWQAGFWSVAAVAL.....................................KLAPSG----VV
A5GF97_GEOUR/15-187--LMLLGGGIR.F....PAFTGALKA....I..................................EEKGLNIRK----IV
Q1CW69_MYXXD/353-514--LALSGGGVW.G....FYHVHILRW....L..................................VSQGVPIDI----VS
A6NV66_9FIRM/7-176--LVLEGGAFR.T....IFSSGACDG....L..................................LAADIMPDY----CV
A0A038KND4_MYCTX/181-420--TVLGGGGGA.G....FVYIGGMQR....L..................................LAAGQVPDY----MI
A0YM74_LYNSP/12-230--LVLTGGGAK.G....AYQAGALRY....L..................................AELNFQPKI----IA
Q5X5T5_LEGPA/27-309--LVFRGGGSK.G....VAYVGALQS....L................................SEQGVLENIEN----VA
Q2GS92_CHAGB/73-327--LTIDGGGIR.G....YSSLIVLRALMQEIERIEQSLEPRASASTQTDRIPREQIPDDVFREGQYLPCHYFDY----IA
Q1ZT25_PHOAS/33-203--LVVQGGGQR.G....IFSAGVLDS...FL..................................EHEFDPFAL----YI
Q5CY77_CRYPI/46-241--LIMSSGSNK.G....PWQAGVVRGIAQKY................................HDSGKKLRWDL----VG
A0A039K3R0_MYCBI/806-965--LVLSGGAAR.A....CAHLGVLEE....L..................................EAAGVTVDR----FA
PATA2_SOLTU/32-227--LSIDGGGIK.G....IIPGTILEFLEGQLQKM..........................DNNADARLADYFDV----IG
A6G7S9_9DELT/458-735--LVLSGGGAK.G....AFEAGAVAE....L..................................WKTGYRPDI----IC
C6TYS0_BURPE/13-264--LVMNGGVSL.A....IWMGGVTNEIFRLVKEQHPV.....................YAALLAMTRTVPRVDV----IS
A4F8K0_SACEN/17-281--LAMRGGASL.A....VWIGGAVAEINHLRSALAEPGPA..............RHPWGALARLAGYDSVAVDV----LA
Q2R2X0_ORYSJ/139-303--FSFSAAGLL.F....PYHIGVAQC....L................................IDRGYLTERTP----LA
Q0A7T0_ALKEH/6-219--LVLPGGGAR.G....AYQVGVLKAVAALT.................................PRDRGNPFPV----II
A0A031KR74_ENTFC/138-323--LVLGGGGAH.G....AYQIGVWQA....L..................................KEHDINFEI----IT
M6BTQ1_LEPBO/13-188--LLVEGGGMK.G....AFAGGALHA....L................................HTLVSPKHYDL----VV
E3VZB4_MIMIV/38-270--FFIEGGGTK.G....VYAMGVLNYLYDEN.................................VYIKLQDVDI----FG
Q0FZD9_9RHIZ/20-226--LVFSGGGTR.C....FWHGGFCEHVRKPL.....................................RLMPKR----IT
Q5A7P0_CANAL/211-417--LVLSGGSTF.G....IFHIGVLTT....L..................................FEANLLPRI----IS
Q11UC9_CYTH3/381-624--ICSSGGGQRAA....VWTLRTLQYADSMT.................................NGAMFKQTRL----MT
A6ASA3_VIBCY/5-186--LCLTGGGYR.G....IYTAAVIRNLEKEF.................................ETKIKQQCDC----IA
Q1D826_MYXXD/142-382--LVTGGGGGT.A....YVYLGVMSL....L..................................GEYGLEPRL----LA
A0AZM8_BURCH/61-294--LTISGGGSRAA....YLGARVISE....LKD.............................VDGTDLTNYINV----VS
Q5CE49_CRYHO/149-342--LTVSGGGAK.G....SFSAGLLNGLAFIY................................RYHGIKLRWDV----TS
A4HB10_LEIBR/40-220--VSFSCGGWF.Q....MYFFGVAYA....LIDS..........................GVLRRWYSEGKRVR----FT
I0WT11_9NOCA/7-221--LVVAGGGAR.G....AYEAGAITSLLPRL.....................................GRSPTI----LV
A3QTZ2_9VIRU/28-255--LALEGGGTQ.A....ISYIGALLA....LKD............................TGYYKDDGYTFDQ----IG
Q1D5W1_MYXXD/154-432--LVVSGGISL.G....AYQAGFLSTLVRFWSVAQ........................REGAQADLGNPAPRV----WT
Q09D74_STIAD/17-214--ISFDGGPSA......LITLRVLRQLEARF..................................PGFVERAQM----FS
A4BNM2_9GAMM/38-218--VSLGGGSTA.GLCGNIALIHLLEE....L...................................ELKQHISE----LW
Q4LA62_STAHJ/11-202--IVLGGGGSLAI....GWELGYLLTLSNQG...................................IDVRHADL----MI
Q5ZPA4_9DELT/22-208--LSLDGGGLR.T....LLSIGLLKRIDQLR..................................PGFLDQVDL----VA
D3MBX2_PROAA/25-319--LVLAGGGSR.A....SFQMGALRHLYDVV.....................................GITPTS----MV
NTE1_PICST/1239-1403--LVLGGGGSR.G....ISHVGIVTA....L..................................ERHGIPVDL----IG
A4SJS7_AERS4/8-174--LVVEGRAMR.G....IFAAGVLDA...FL..................................AQGRTAFDH----CI
Q1I961_PSEE4/42-302--LVMEGGGML.G....IALVGYTYV....L..................................EQAGIRFLG----VG
A7RB12_PBCVA/19-192--IVVAGGGAK.S....MSGLGAIHV....L................................KRNGQLKNLKV----VA
Q0VPN6_ALCBS/36-193--LAMSSGFFG.F....FAHFGTVRA....L..................................LDHGLQPAR----FC
A6G1N7_9DELT/36-362--LCFSGGGSRAM....SASLGYLRG....L................................TKQGLVDRVRY----IS
A6QA07_SULNB/41-281--LVISGGVSL.G....AYEAGYNWALIKMISKI...........................KSMNVDIRPDLLS----VA
Q5WWS2_LEGPL/304-496--LVFCGGGAK.I....FAHVGVWKA....L..................................NEAGMKPTK----FA
A0Z6H0_9GAMM/8-199--LSIDGGGIR.G....IIPAMVLDHLETRT.................................GHRAADLFDL----MV
A6LMU7_THEM4/5-176--LSLAAGGVK.G....FSHIATLNF....L..................................EENNIKVDI----IT
A7I0A5_CAMHC/6-211--VVLSGGGLK.G....AYEIGFLKA....L..................................GEFEILPAT----IS
C7LH54_BRUMC/13-187--VAFGGGGAR.G....IAHIHVVDV....L..................................NELGIQPVA----IA
A6G3Y0_9DELT/12-216--LVLSGGGCK.T....FWGMGAYEVLEDLL......................................PPIER----WS
A1DP95_NEOFI/20-225--LSLDGGGIR.G....LSSLHMLKYMMQAIDP.............................RQPPRPCEVFDV----IG
A5K2I7_PLAVS/1168-1482--LCLDGGGIR.G....LLSIEILKCINSHL.................................KKNIFEYFDI----IC
TEG_BACME/7-180--ITFDGGGTL.G....ALSLQLLNRLAYQN..................................PKLISETNV----FS
Q2W5X1_MAGSA/6-225--LVLGGGAPN.F....TLMTGALLA....F..................................DEAGVKFDV----IS
A4U0C8_9PROT/5-257--ICLAGGGPAVG.....LSLGALKR....L.................................HEEEDIRFDV----WS
A5N2W9_CLOK5/4-191--LALEGGGAK.G....AFHMGATKA....F..................................IEEGYKFHG----IV
A4JJZ7_BURVG/8-242--LVLSGGGAK.G....AYQVGVMRA....L..................................AEVGAQIDM----VA
A6R0J1_AJECN/673-891--LAIDGGGVR.G....VIPLEFLLLVQEKLG...............................ANCPVVDLCEL----VM
A0A024F582_BDEBC/72-224--VILGGGGAK.T....YAHIGFLHE....L..................................QRAKVPVYA----IG
A5P920_9SPHN/106-312--LMLSGGGQW.G....AYGAGLFRALHDAS................................GNGLAMKNVKV----IT
Q2C291_9GAMM/11-214--YVFQGGGAL.G....SYQLGAFQA....L..................................NEKGFTPDS----II
A1VHY7_DESVV/116-308--IVFKGGGIK.G....LAYAGALRA....M................................GRHGMLRDVRR----TA
A7BB55_9ACTO/26-199--LVFEGGGMR.N....AYTAALVSR....L..................................IAEGINFPH----IS
A5I1W5_CLOBH/6-200--GVFQGGGVK.A....TAFTGAICR....L..................................EKEGMMWQR----LA
A8GLS3_RICAH/7-147--LAFAGGGVK.V....IAYAWALKV....L................................KDKDCLKNIQK----VV
A4T0K7_POLSQ/80-285--MVLGGGGEYYI....AWYCGFFHGLYEAG..................................LDMAQIPEM----VV
A6DDL8_9PROT/5-162--IALSGGAAR.G....VFHLGFLDV....L..................................LKEGVEIKE----IS
A4CKZ2_ROBBH/4-195--LVISGGGSK.G....AFAGGVAQF....L.................................MEQRGYDYDL----LL
A0A031WAB0_PEPDI/5-179--LCLEGGGAK.G....AYQAGVVKA....L.................................YDGGINKFYS----IS
A0A014PKG8_YERPE/86-275--LALSGGGPN.G....AFGAGFLNG.....W...............................TETGKRPVFKV----VS
M6C3B5_LEPBO/36-250--FAIAGGGCK.A....FYGLGFGHE....M..................................KSWGLKFRE----VS
Q12EZ0_POLSJ/6-228--LALSGGGMRAM....VFHCGVLKS....L................................AEHGALEHVSK----VS
Q1GX66_SPHAL/43-328--GAIGGTGAV.Y....RDLLGAIAA.....H...............................GNVRLRVFTDI----VA
Q4RS54_TETNG/14-183--ISFAGCGFL.G....IYHVGVASCLLEQA..................................PFLVHNARH----IY
Q5C8M6_LEGPN/32-295--LVLSGGGAK.G....ISYLGMIQA....L................................QERGKIKNLTH----VS
Q6JBI3_DICVI/201-395--LSIDGGGTR.G....LMGLEVLEQLEKIS.................................GKKICELFDH----VV
Q0FKF7_PELBH/6-360--LIMKGGITS.G....VVYPYAITA....L...................................ARSYRLRS----IG
N0BV45_SALTI/8-168--LALGSGAAR.G....WSHIGVIKA....L..................................KQTGIDIDI----VA
Q6ASS6_ORYSJ/60-258--LAIDGCGSS.GAGDALLAAAALARLEAGLRKR..........................TGDSDARVADFFDV----AA
A6QX75_AJECN/242-440--LILQGGAVY.G....TCHLGVVKA....L..................................FLRGLLPRI----IT
Q74A07_GEOSL/58-306--LAFSGGGTRAA....AFSFGLMEE....LNRVEY......................AGRDGARHRLLDDVEI----IS
Q54XY1_DICDI/13-231--LSLDGGGTK.G....LYTIEVIEHFVKLS.................................GSDFTKHVDL----FG
Q55G69_DICDI/65-250--VSFDGGGMR.G....IVSILLLKEIQNIL.................................GFDIGVNCDI----VC
Q5Z158_NOCFA/22-193--LVIEGGGSR.G....VYSSGMVQG....L................................EELGLSAVFDA----VY
Q54QX6_DICDI/893-1088--LSLDGGGVR.G....ILHCDALEQIQKQL................................FDIPIISLFDL----IV
A1UXE2_BURMS/413-612--LILQGGGAL.G....AFECGAVKA....L..................................EQHGVRPDV----IS
A2QZY6_ASPNC/473-679--ITIDGGGVR.A....IMPLRFLGYMQKILG...............................PGCLVQDMVDV----AF
A4XTW9_PSEMY/15-385--LVMKGGITS.G....IVYPLAISEIAKAF.......................................RLRS----IG
Q0E508_SFAVA/27-224--LVISGGGFK.A....LYFVGAVDA....M....................................ELCRVDC----YA
A6GI17_9DELT/71-215--MCLSGGGIRSA....TFGLGVIQA....L................................ARKGLFEHVDY----LS
A7IE20_XANP2/6-198--LSLDGGNGGKA....GVFLSTLERRAEVL.................................GFSVLRQIDL----FA
Q1DCU7_MYXXD/197-406--IVLSGGGAN.G....AFSAGAIWRLLGVLEQCR........................GKPAPEGCGDARIDL----AA
Q6MAN6_PARUW/474-738--LVIKGGGPK.G....IAYIAVLKK....L................................EEHEALKNLER----IA
Q4Z1R8_PLABA/352-558--LSLDSGGVL.A....TSTLIVLTRIEHELRKE..........................LGNDTINLIDCFDM----VC
A4RTL4_OSTLU/164-398--LVVEGGGMR.G....VISAGAAGA....L................................LEAGYYDCFDA----AY
A0JUC4_ARTS2/74-249--LVLAGGGMR.V....AWQAGVVRA....L..................................AEEGLHFDH----VD

PF00698

FAS_HUMAN/493-810--WFICSGMGT------Q-WRGMGLSLMRL.----------------------------------DRFRDSILRSDEAVK
STCK_EMENI/1547-1902--TYVFTGQGT------Q-ERGMGMALYDTN----------------------------------AAARAVWDRAERHFR
FAS_CHICK/492-809--WYICSGMGT------Q-WKGMGLSLMKL.----------------------------------DLFRQSILRSDEALK
FAS1_YEAST/1663-2037--TFVFTGQGS------Q-EQGMGMDLYKTS----------------------------------KAAQDVWNRADNHFK
A4F7N8_SACEN/109-425--VFVFPGQGA------Q-WAGMAGELLGES----------------------------------RVFAAAMDACARAFE
A4F7P0_SACEN/560-880--VFLFPGQGS------Q-WAGMGAELLSSS----------------------------------PVFAGKIRACDESMA
I6Y231_MYCTU/534-851--VWVFSGQGS------Q-WAAMGTQLLASE----------------------------------PVFAATIAKLEPVIA
PPSA_MYCTU/632-950--VFVYSGRGS------Q-WAGMGRQLLADE----------------------------------PAFAAAVAELEPVFV

PF16073

B8MGX9_TALSN/8-250---IFFGDLSL------S.IHPAFSQLL..R----------------------------------SQKEHSLLS.N--FL
B6HLN4_PENCW/17-255---LLFGDQTD------S.WIEGIDQLY..N----------------------------------QAASTPWLK.S--FV
E9D6Y9_COCPS/8-245---FLFGDQTY------D.LVPDLRQLL...----------------------------------RCNTKPILS.A--FL
K1X7W5_MARBU/800-1037---LLFGDQSL------G.VHGFLADFY...----------------------------------QYGNPSVLTIS--FL
L8G6V9_PSED2/30-264---LLFGDLAI------R.FEDELRQLV...----------------------------------HVGGNESLR.S--FF
B6QFH1_PENMQ/10-246---YVFGDQTS------E.FDSGLRRLL...----------------------------------QDKGNSFVT.S--FL
B6QER4_PENMQ/12-248---LYFGDQTE------K.NIP.FEELF..E----------------------------------YSRESDRTK.Q--FL
A7F3E3_SCLS1/4-241---LVFGDQSL------D.THTFLTDFC...----------------------------------QHRRPSVLSRS--FL
N1RV88_FUSC4/8-242---YVFGDQST------P.VLDKLQTLL...----------------------------------RVKDNALLT.S--FL
E9F646_METAR/19-261---FIFGDQSS------C.NLSNLQLLL...----------------------------------FKKSNVYLA.S--FI
S3EB79_GLAL2/16-254---LLFGDQTD------S.WVDGIDQLY..K----------------------------------QAASTPWLK.L--FL
G4UHA1_NEUT9/13-252---YLFGDQSL------D.THAFLASAF...----------------------------------LKPKKGTLAKA--YL
B6HKK0_PENCW/8-244---YLFGDQTA------E.FDSGLRRLL...----------------------------------HAKNDSLLA.A--FF
E9F7M7_METAR/10-244---YVFGDRTF------N.YEHSLAQLLCCH----------------------------------....NTFLT.L--FF
WA_EMENI/8-244---YLFGDQTG------D.FEVGLRRLL...----------------------------------QAKNHSLLS.S--FL
V5GBX6_BYSSN/4-246---LLFGDQTD------PEIISYLHGLL...----------------------------------SAPVDTPLVSS--FL
G2QWR8_THITE/16-254---LLLGDQSL------D.THGFLVRFF...----------------------------------GQEQHGELAKA--FL
M3CY75_SPHMS/5-242---LLFGDQTA------E.QYPLLHKVT...----------------------------------LHRDNVLVS.N--FV
M2RQ22_COCSN/4-241---LIFGDQTA------D.QYPLLRKAC...----------------------------------TWKNNATLT.T--FL
B8LZ55_TALSN/27-260---YIFGDQTV------S.FEDTLRSLL...----------------------------------NIKDNAALS.D--FF
S3D9A7_GLAL2/4-237---LLLGDQTT------D.YLPTLRKLL...----------------------------------RRNRSPYFS.I--FL
G7XN60_ASPKW/8-244---YLFGDQTS------D.IEAGLRRLL...----------------------------------QAKNSTIVQ.S--FF
M2T1K1_COCSN/8-240---YLFGDQTF------D.VEPHFSGLL...----------------------------------EARNNLFLH.T--LL
E9DR08_METAQ/20-259---LLFGDLSA------SGFEEDLRRLL...----------------------------------HIKTDPLLS.S--FL
S3CWG8_GLAL2/8-245---FLFGDQTY------D.FASDFKKLL...----------------------------------REENNPILT.A--FL
F2PW05_TRIEC/6-242---LLFGDQTY------D.FRPGLRQLL...----------------------------------QREPIPVLA.G--FF
H1VJ39_COLHI/10-255---YVFGDQTH------D.IADTLSGLA...----------------------------------QSHHDPLVI.N--FL
U1GE50_ENDPU/4-243---YIFGDQTA------D.CRSFLAKAV...----------------------------------GRKENVLLN.V--FL
A1C888_ASPCL/9-246---YLFGDQTI------S.CDEGLRNLL...----------------------------------QAKNHTIVA.S--FF
R0KB98_SETT2/8-242---YLFGDQTY------E.VQSRLKELL...----------------------------------QYRTNPVLD.D--FL
E4V2N2_ARTGP/10-256---FFGNEFPS------DDLKDLFRRLYQHS----------------------------------KDRRFRLLS.A--FL
L8G4G9_PSED2/24-270---YFSNDFPK------DELGDIFRRLHNHS----------------------------------KDKHFPILA.Q--FI
M2ZZX0_MYCFI/5-242---LLFGDQTA------E.QYPLLRKVA...----------------------------------LHKDNVLVH.N--FV
Q2GV63_CHAGB/785-1022---LLFGDYSV------E.KLPAIKALA..Q----------------------------------HARTTPAAE.R--FL
B8N7H8_ASPFN/9-246---LLFGDVTD------R.WVSSIDYVY..S----------------------------------QAATKPWLQ.S--FL
Q2UA48_ASPOR/8-244---YLFGDQTS------D.FDAGLRRLL...----------------------------------QVKNNTIVA.S--FF
N4VBL7_COLOR/10-255---YVFGDQAH------D.VADDLSSLL...----------------------------------QSRTDPLVV.S--FL
B2B495_PODAN/8-245---LLFGDQSL------D.THGFLAEFF...----------------------------------RQEKQGILAKA--FL
M4G4F1_MAGP6/8-245---LLFGDQSL------D.THGFLADFY...----------------------------------RREDQGILAKA--FL
R7YU14_CONA1/7-242---YLFGDQTH------S.FDAGLRRLY...----------------------------------QQKENGPLT.A--FF
R0KD65_SETT2/13-258---LLFGDQTD------G.FFAPIKQLY..D----------------------------------QAANDAFLC.K--FL
V5G4B2_BYSSN/8-244---YLFGDQTG------E.FEPGLRQLL...----------------------------------QAKNNGFLT.S--FF
H1VY29_COLHI/8-245---LLFGDQSL------D.THGFLAEFY...----------------------------------RSGNPSTLAKT--FL
L8GBJ0_PSED2/42-283---LLFGDLSL------LRFKDRLRRLL...----------------------------------HVETNPLLT.S--FF
B6QC69_PENMQ/7-243---LLFGDQTV------D.LVPSLHRLL..S----------------------------------ISQSSQTVR.R--FL
G3JFQ9_CORMM/16-246---LVFGDLTA------S.FEEELRQLL...----------------------------------HVRGNEAMT.S--FF
F9XMW3_MYCGM/5-242---LLFGDQTA------E.QYPLLHRIV...----------------------------------LRKDNVLLL.S--FV
G9MXY7_HYPVG/19-259---FVFGDQSS------C.SLSNLQLLL...----------------------------------LKKDNPYLI.S--FI
G0RW83_HYPJQ/19-262---IVFGDQSS------C.SLSKLQQLL...----------------------------------LKKDSPYLT.S--FI
C5G0R3_ARTOC/8-243---YLFGDVTY------D.ISTKLQPLL...----------------------------------HSESSPLLR.S--FF
K1WM58_MARBU/4-242---ILFGDQTA------D.PQQFLTKVL...----------------------------------RRKGSPLLS.S--FL
G9NQM0_HYPAI/19-259---FVFGDQSS------F.SLSNLQLLL...----------------------------------LKKNNPYLT.L--FT
A2QH36_ASPNC/29-262---FLFGDQTV------V.FESTLHSLL...----------------------------------HVKDNAVLT.D--FF
STCA_EMENI/11-251---FLFGDQTY------D.FVADLRDLL...----------------------------------NIRNNPILV.A--FL
Q8EYQ4_LEPIN/19-271---LQFGGQGS------....PFLKEISKLY----------------------------------ES..EPSLK.E--FF
C7ZNQ1_NECH7/8-238---YLFGDQTF------D.IKPHLQKLF...----------------------------------QQRDHLFLQ.D--FL
M2N8F6_BAUCO/8-232---FLFGDQTY------D.FVPDLRKLL...----------------------------------AIKTKPVLN.A--FF
G7Y059_ASPKW/7-243---LCFGDQTT------D.SCSRIKDLY..A----------------------------------KATQYNRLR.D--FL
E4V6P4_ARTGP/8-243---YLFGDLTY------D.VSPKLQPLL...----------------------------------HSELYPLLR.S--FF
U1GYJ0_ENDPU/26-259---FLFGDLTT------S.FEQDLRRLL...----------------------------------HVKDNATLH.S--FF
H6BVA1_EXODN/5-241---YVFGDQTA------D.CRAFFTKVF...----------------------------------TRKDNVLLQ.S--FL
E9F7X1_METAR/8-256---IVFGDLSV------P.YHAELQRLL...----------------------------------SDKDSCTLV.S--LF
E3R122_COLGM/12-243---YLFGDQTF------D.IAEQFKDLL...----------------------------------RYRNNPLVE.N--FL
G2WRK7_VERDV/8-245---LLFGDQSL------N.THAFLAEFY...----------------------------------RLGAPSILAKT--FL
G0SDA9_CHATD/19-258---FYLGDQSL------D.IHGFITDYL...----------------------------------GHGSRGILGRA--FL
B6QHV7_PENMQ/4-241---LIYGDQTV------D.VCPFLDHLF...----------------------------------KKKRTPLLQ.N--FL
Q2UG06_ASPOR/8-245---FLFGDQTA------D.FVPKLRSLL...----------------------------------SVQDSPILA.A--FL
C5FQT2_ARTOC/8-245---CLFGDQTN------D.FVPGLRQLL...----------------------------------RIKDGPLLL.S--FF
E9D5J9_COCPS/7-242---LLFGDQTE------T.NFN.VRALF..E----------------------------------YSKQSDRLR.S--YI
N1PC72_MYCP1/5-242---LLFGDQTA------E.QYPLLHRLC...----------------------------------LRKDNALVS.N--FI
E3R0Q2_COLGM/12-250---LLFGDQTD------S.WNDGLDQVY..K----------------------------------LAGSMPWLQ.E--FL
R8BTJ4_TOGMI/8-245---LLFGDQST------D.THGFLAEFF...----------------------------------RHGNQGLLAKA--FL
G4MU27_MAGO7/14-251---LLFGDQSL------D.THGFLAEFY...----------------------------------RHEDRGILAKA--FL
R7YTG2_CONA1/4-241---LLFGDQTA------D.QYPLLRKIS...----------------------------------QRKDNALLS.T--FL
U7PRD0_SPOS1/5-267---LLFGDQTA------E.VLPSIESLN..A----------------------------------HALHSAALR.Q--FF
E5A495_LEPMJ/4-241---LIFGDQTS------D.QYALLRKAC...----------------------------------TLRSNSSLT.T--FL
E9F8F0_METAR/70-305---LLFGDQTV------E.KLPAIRHLV..S----------------------------------HGASSPLVQ.R--FL
B8NVD5_ASPFN/5-241---YIFGDQTV------R.VDDAVHKLL...----------------------------------HVKNNPILK.S--FL
B8MV60_TALSN/15-255---TFFGDQTV------D.TLLCIKDLA..N----------------------------------RSHQLPILR.R--YL
E9FC93_METAR/16-256---IAFGDLAA------SECLDSLQGLL...----------------------------------HSKNNANLS.D--FF
G9NBV5_HYPVG/10-247---LLFGDQTV------E.KLSSIQALV..R----------------------------------NAKSSPAAK.R--FL
R1G9D8_BOTPV/4-241---LIFGDQTA------E.QYPLLRKAV...----------------------------------LRKDNALLS.T--FL
S3CAW2_OPHP1/8-244---LLFGDQSL------D.TYGFLSGFY...----------------------------------RQTDQGILARV--FL
B2B664_PODAN/7-242---LLFGDQTG------E.VLPSIQSLS..R----------------------------------NASSNQTLA.T--FL
M1WG96_CLAP2/23-272---FFGNELPN------DDLQTHFRRLHTRS----------------------------------KDKNHPLLA.R--FI
E9F5C9_METAR/8-246---LLFGDQTE------T.NLS.IQALY..N----------------------------------HANTSERLL.G--YI
I1RF58_GIBZE/4-241---FVFGDQST------R.FAPPLKDLL...----------------------------------LKGNSPYLT.H--FV
G2YLD0_BOTF4/4-242---ILFGDQTA------D.CQSFLKKAL...----------------------------------RRKNCPILS.T--FL
B2W1Q0_PYRTR/9-246---LLFGDVTD------S.WVEGIDHVY..M----------------------------------QAATKPWLQ.S--FL
C7Z6X3_NECH7/7-240---LLFGDLSV------P.FEGQLQALL...----------------------------------HVHDNPLLT.S--FL
E3QS53_COLGM/10-256---YVFGDQTY------D.STEALRSLS...----------------------------------QTHNDPLLM.D--FI
G9NGU8_HYPAI/9-247---IFFGDQTV------D.TLQNIKVLA..N----------------------------------QARTSPIIA.R--FL
B8MYS6_ASPFN/10-247---IVFGDLTC------D.SVAGLRTLV...----------------------------------TVKDNPLLI.S--FF
G2RCG6_THITE/8-247---VLFGDLTC------D.YVSGLRSLV...----------------------------------PVRDNPLLT.S--FF
S0DTP6_GIBF5/8-239---YLFGDQTF------D.VQPHLQHLL...----------------------------------QKRDNLFLH.E--FL
G2QMK9_THIHA/8-254---IVFGDQAV------P.YAAELRRFI...----------------------------------AKREDFTLA.K--LL
F0XGQ5_GROCL/8-244---LLFGDQSL------D.TYAFLSGLC...----------------------------------RQDNTGILAQA--FL
T0KJR9_COLGC/11-253---LLFGGYTE------P.WLESIDRIH..E----------------------------------QAGKCAWLR.L--FL
M2RHZ9_COCSN/9-246---FLFGDQAD------APL.PMIRRVA..E----------------------------------KARHSKNLQ.S--FL
R0JX83_SETT2/4-242---VLFPDHVT------D.TRSILRQVH...----------------------------------EARNTSTLVKS--FL
L8G0G7_PSED2/41-278---LLFGEQSL------D.TQGFLADFC...----------------------------------RNGNPSVLSHA--FL
Q2HGW2_CHAGB/17-254---LLFGDQSL------D.SHGFFAQFY...----------------------------------RQSKHGELARV--FL
B8MF01_TALSN/8-245---YVFGDLNN------D.FDSSLRALC...----------------------------------KSQGNPLLV.S--FL
N4VM62_COLOR/16-257---LLFGDQTD------G.FHASIRQLY..H----------------------------------DASKDPILG.A--FL
S3DAZ0_GLAL2/11-247---FLFGDQSL------D.TYGFLANFL...----------------------------------HRSSPSLLSKT--FI
E3SAD1_PYRTT/8-240---FLFGDQTF------D.IRPHFSGLL...----------------------------------EARDNLFLH.A--FL
U7PK37_SPOS1/8-244---LLFGDQSL------D.TYDFLSGFY...----------------------------------REGHQGILATA--FL
B2B6C8_PODAN/41-279---FLFGDQTF------D.FVPKLRELL...----------------------------------TVQDCPLLA.A--FL
V5G236_BYSSN/6-248---VLFGDTSI------S.VQPALSLLLSSS----------------------------------SQKELPLLR.Q--FL
M2NM35_BAUCO/5-243---LLFGDQTA------E.QYTLLHKII...----------------------------------LRKEDALVR.S--FV
B6QAB8_PENMQ/31-263---YVFGDQTA------A.FEDTLKSLL...----------------------------------SVKDNATLS.D--FF
M2XHZ5_MYCP1/10-247---LVFGDQTY------D.FVPKLRELF...----------------------------------HVKDNPILT.A--FL
R7YHB3_CONA1/8-244---LLFGDQSK------D.VSSDLRELV...----------------------------------SVKDNPLLL.S--FF

PF01735

PLB2_SCHPO/134-617---GLSGGSWLV---------------------------------------------------GSVA-------------
PLB5_SCHPO/125-607---GLSGGSWLV---------------------------------------------------GSVA-------------
PLB1_YEAST/99-586---GLSGGNWLT---------------------------------------------------STLA-------------
PA24A_CHICK/190-675---GLSGSTWYM---------------------------------------------------STL.-------------
PLB_NEUCR/121-606---GLSGGGWLV---------------------------------------------------GSLF-------------
PLB_KLULA/102-589---GLSGGNWLV---------------------------------------------------GTLA-------------
PLB6_SCHPO/114-600---GADGGSWLL---------------------------------------------------SSLA-------------
PA24A_DANRE/185-664---GLSGSTWYM---------------------------------------------------SML.-------------
PLB1_CANAL/88-565---GLSGGSWLV---------------------------------------------------GSLA-------------
PLB3_YEAST/105-592---GASGGNWLV---------------------------------------------------GTLA-------------
PLB1_SCHPO/114-593---GTDGSAWTV---------------------------------------------------GGIA-------------
PLB2_YEAST/101-588---GLSGGNWLT---------------------------------------------------GTLA-------------
B6HB59_PENCW/114-597---GLSGGSWLL---------------------------------------------------GSIY-------------
G8ZY27_TORDC/97-584---GLSGGNWLV---------------------------------------------------GTLA-------------
Q59W34_CANAL/88-564---GLSGGSWLV---------------------------------------------------GSLA-------------

PF01734

Q9N5Z7_CAEEL/97-269---GCSSGSLVA...................................................AMFI-------------
G7QJN7_LEPII/12-165---GCSSGALIG...................................................SLVA-------------
B8GC44_CHLAD/8-228---GTSAGALIN...................................................ACLA-------------
C1DSE3_AZOVD/14-206---GTSAGAMNA...................................................TMLA-------------
A9BEP0_PETMO/3-174---TSSLGSLRG...................................................LFYA-------------
A9B328_HERA2/4-179---GSSVGSING...................................................AVLA-------------
B2U808_RALPJ/9-214---GISAGASTA...................................................CMLH-------------
Q3AAC7_CARHZ/6-206---GTSVGGIIA...................................................LLYG-------------
A6CHF0_9BACI/8-175---GVSAGACIA...................................................ASYL-------------
Q2GUC2_CHAGB/19-224---GTSTGGIIA......................................................V-------------
Q9XAG3_STRCO/16-207---GTSAGSLLA...................................................LDLA-------------
A0A022N4I9_9ACTO/11-221---GTSAGSVVA...................................................ALLG-------------
Q8R6F6_FUSNN/65-256---GTSIGAFIG...................................................TLYS-------------
D5AXK0_RICPP/15-214---GTSVGGLIL...................................................ILLN-------------
Q038G8_LACC3/6-159---GSSIGAINA...................................................AGTA-------------
A5IE43_LEGPC/25-249---GASAGAITS...................................................TMLA-------------
Q4UJC7_RICFE/42-240---GTSVGGLIA...................................................GLLT-------------
Q54HM9_DICDI/140-357---GTSTGSIIA.......................................................-------------
Q2K9E1_RHIEC/30-248---SVSGGSIAS...................................................GLLA-------------
A4IAC8_LEIIN/190-378---GSGSGALVA...................................................TLVC-------------
Q21S96_ALBFT/26-231---AVSAGSAIA...................................................CALF-------------
A5GF97_GEOUR/15-187---GSSTGSIIG...................................................SLYA-------------
Q1CW69_MYXXD/353-514---GASMGSLVG...................................................AYFC-------------
A6NV66_9FIRM/7-176---GVSAGIAYG...................................................VSYI-------------
A0A038KND4_MYCTX/181-420---GSSFGSIIG...................................................SLVA-------------
A0YM74_LYNSP/12-230---GTSVGALNG...................................................AVLA-------------
Q5X5T5_LEGPA/27-309---GSSAGAMTA...................................................AIVA-------------
Q2GS92_CHAGB/73-327---GTSVGGLIA......................................................I-------------
Q1ZT25_PHOAS/33-203---GTSAGALNL...................................................SSFI-------------
Q5CY77_CRYPI/46-241---GTSVGAINA...................................................LASQ-------------
A0A039K3R0_MYCBI/806-965---GTSMGAIIA...................................................ALAA-------------
PATA2_SOLTU/32-227---GTSTGGLLT...................................................AMIT-------------
A6G7S9_9DELT/458-735---GVSVGAVNA...................................................IKLA-------------
C6TYS0_BURPE/13-264---GTSAGGING...................................................AALA-------------
A4F8K0_SACEN/17-281---GASAGGLNA...................................................TLLS-------------
Q2R2X0_ORYSJ/139-303---GSSAGAIIC...................................................AVIA-------------
Q0A7T0_ALKEH/6-219---GTSAGAINA...................................................AVLA-------------
A0A031KR74_ENTFC/138-323---GTSVGALNG...................................................ALIL-------------
M6BTQ1_LEPBO/13-188---AVSSGACSA...................................................AYYV-------------
E3VZB4_MIMIV/38-270---GTSVGSILA...................................................VGLS-------------
Q0FZD9_9RHIZ/20-226---GASGGAMSA....................................................ACF-------------
Q5A7P0_CANAL/211-417---GSSAGSIVA...................................................SILC-------------
Q11UC9_CYTH3/381-624---GASGGIIGASYF............................................RELCLLKA-------------
A6ASA3_VIBCY/5-186---GTSIGGIIA...................................................IGLA-------------
Q1D826_MYXXD/142-382---GTSMGAILA...................................................IMRS-------------
A0AZM8_BURCH/61-294---SVSGGSLAA...................................................ALYG-------------
Q5CE49_CRYHO/149-342---GVSIGTLNTI.................................................WSQFY-------------
A4HB10_LEIBR/40-220---GVSAGALAA...................................................TCLA-------------
I0WT11_9NOCA/7-221---GTSAGALNV...................................................VGLA-------------
A3QTZ2_9VIRU/28-255---GSSTGCLVG...................................................LLVS-------------
Q1D5W1_MYXXD/154-432---GASAGAVNA...................................................LLGG-------------
Q09D74_STIAD/17-214---GTSTGAFVS...................................................LYLA-------------
A4BNM2_9GAMM/38-218---GTSAGAIVG...................................................GSWT-------------
Q4LA62_STAHJ/11-202---GTSGGAQAA...................................................TGLT-------------
Q5ZPA4_9DELT/22-208---GTSAGAISA...................................................LIIA-------------
D3MBX2_PROAA/25-319---ATSAGSIVA...................................................CTLA-------------
NTE1_PICST/1239-1403---GTSIGSLVG...................................................GLYA-------------
A4SJS7_AERS4/8-174---GVSAGAVNL...................................................AAFL-------------
Q1I961_PSEE4/42-302---GTSAGSINA..................................................LLLAS-------------
A7RB12_PBCVA/19-192---GTSAGSIVA...................................................AGVA-------------
Q0VPN6_ALCBS/36-193---GSSAGALVG...................................................GCMA-------------
A6G1N7_9DELT/36-362---AVSGGSWAT...................................................SLFT-------------
A6QA07_SULNB/41-281---GASAGSINT...................................................LLSA-------------
Q5WWS2_LEGPL/304-496---GSSAGAIMS...................................................LMCY-------------
A0Z6H0_9GAMM/8-199---GTSTGGILA...................................................LGLA-------------
A6LMU7_THEM4/5-176---GSSAGAIVA...................................................ALYG-------------
A7I0A5_CAMHC/6-211---GTSIGAING...................................................AFLS-------------
C7LH54_BRUMC/13-187---GSSIGSIIG...................................................SSMA-------------
A6G3Y0_9DELT/12-216---AVSAGVAMA...................................................LARC-------------
A1DP95_NEOFI/20-225---GVGSGGLIA......................................................I-------------
A5K2I7_PLAVS/1168-1482---GTSTGAIIS...................................................ILIG-------------
TEG_BACME/7-180---GNSIGSFTA...................................................LALA-------------
Q2W5X1_MAGSA/6-225---ATGGGGGVAL.................................................SYLAP-------------
A4U0C8_9PROT/5-257---LACIGAWLGIVWNQAEPGHEAETSE..................AFFRQIFRPDDVYDRFPIAAA-------------
A5N2W9_CLOK5/4-191---GTSIGAING...................................................AVIA-------------
A4JJZ7_BURVG/8-242---GASIGALNG...................................................AIVA-------------
A6R0J1_AJECN/673-891---GTSSGGIIA...................................................HALV-------------
A0A024F582_BDEBC/72-224---GVEFAAPMA...................................................ALYA-------------
A5P920_9SPHN/106-312---GISTGSLQT...................................................LLLM-------------
Q2C291_9GAMM/11-214---GISIGAINA....................................................AII-------------
A1VHY7_DESVV/116-308---GTSSGAMAA...................................................VFLA-------------
A7BB55_9ACTO/26-199---GVSAGSSHL....................................................CNF-------------
A5I1W5_CLOBH/6-200---GTSAGAIIA...................................................AFLA-------------
A8GLS3_RICAH/7-147---GASGGAIAA...................................................FSIV-------------
A4T0K7_POLSQ/80-285---GTSAGSYVG...................................................SSLL-------------
A6DDL8_9PROT/5-162---GSSAGAIVA...................................................GAIA-------------
A4CKZ2_ROBBH/4-195---GTSTGSLLI...................................................SHLA-------------
A0A031WAB0_PEPDI/5-179---GTSIGAING...................................................YYLY-------------
A0A014PKG8_YERPE/86-275---GVSTGALIA...................................................PFAF-------------
M6C3B5_LEPBO/36-250---GVSAGAAMV...................................................LCLI-------------
Q12EZ0_POLSJ/6-228---TVSGGSLLV..................................................GLLLQ-------------
Q1GX66_SPHAL/43-328---GASAGGING...................................................IFLA-------------
Q4RS54_TETNG/14-183---GASAGALTA...................................................TALV-------------
Q5C8M6_LEGPN/32-295---GASAGAMTA...................................................SILA-------------
Q6JBI3_DICVI/201-395---GVSTGSIIA......................................................S-------------
Q0FKF7_PELBH/6-360---GSSAGAIAAALAAAAEYRRQSSPQKDDMGGFDEIEKIAGELAEDLGKLLQPAPPFAGLFKLLLA-------------
N0BV45_SALTI/8-168---GCSIGSLVG....................................................AAY-------------
Q6ASS6_ORYSJ/60-258---GAGAGGVLA...................................................AMLF-------------
A6QX75_AJECN/242-440---GTATGALVA...................................................ALVA-------------
Q74A07_GEOSL/58-306---SVSGGSFTS...................................................AYYA-------------
Q54XY1_DICDI/13-231---GTSTGGILS...................................................IAKS-------------
Q55G69_DICDI/65-250---GTSTGGIVT...................................................YAKL-------------
Q5Z158_NOCFA/22-193---GTSAGAING...................................................AWLL-------------
Q54QX6_DICDI/893-1088---GTSAGGLVA...................................................LALA-------------
A1UXE2_BURMS/413-612---AVSIGAFNG...................................................AIVA-------------
A2QZY6_ASPNC/473-679---GTSGGGIAV......................................................L-------------
A4XTW9_PSEMY/15-385---GTSAGAIAAAAAAAAELGRQRYLAGELSEDP......QGFAEIERLPCQLCLPATECRGTRLLA-------------
Q0E508_SFAVA/27-224---GTSCGAALC...................................................ALMC-------------
A6GI17_9DELT/71-215---TVSGGGFTGS.................................................MLSAV-------------
A7IE20_XANP2/6-198---GTSNGAVNA...................................................LLLA-------------
Q1DCU7_MYXXD/197-406---GSSTGALIS...................................................TLVD-------------
Q6MAN6_PARUW/474-738---GTSSGAIFA...................................................SLIS-------------
Q4Z1R8_PLABA/352-558---GTSAGGLIS...................................................LALL-------------
A4RTL4_OSTLU/164-398---GSSAGAMNL....................................................TYY-------------
A0JUC4_ARTS2/74-249---GTSGGILTA...................................................GMML-------------

PF00698

FAS_HUMAN/493-810---P.FGLKVSQ---------------------------------------------------LLLSTDE..........
STCK_EMENI/1547-1902---SQYGISLLH---------------------------------------------------IVRENPTSLTVNFGSRR
FAS_CHICK/492-809---S.TGLKVSD---------------------------------------------------LLLNADE..........
FAS1_YEAST/1663-2037---DTYGFSILD---------------------------------------------------IVINNPVNLTIHFGGEK
A4F7N8_SACEN/109-425---PVTDWTLAQ---------------------------------------------------VLDSPE...........
A4F7P0_SACEN/560-880---PMQDWKVSD---------------------------------------------------VLRQAPGA.........
I6Y231_MYCTU/534-851---AESGFSVTE---------------------------------------------------AITAQQ...........
PPSA_MYCTU/632-950---EQAGFSLHD---------------------------------------------------VLANGE...........

PF16073

B8MGX9_TALSN/8-250...NQAKSALQA---------------------------------------------------EATN..-----------
B6HLN4_PENCW/17-255...DNLACVVNA---------------------------------------------------ETKTIL-----------
E9D6Y9_COCPS/8-245...EQSHYVIRA---------------------------------------------------QSAT..-----------
K1X7W5_MARBU/800-1037...DQVGAALRE---------------------------------------------------EVDR..-----------
L8G6V9_PSED2/30-264...DQVSYALRQ---------------------------------------------------EFGN..-----------
B6QFH1_PENMQ/10-246...ERCSFALRH---------------------------------------------------EVTQ..-----------
B6QER4_PENMQ/12-248...QNAFHSIQL---------------------------------------------------VIETLT-----------
A7F3E3_SCLS1/4-241...EQAGSALRE---------------------------------------------------EIDR..-----------
N1RV88_FUSC4/8-242...GEAFLAVRH---------------------------------------------------EIVS..-----------
E9F646_METAR/19-261...DQVNLTLRH---------------------------------------------------EIAR..-----------
S3EB79_GLAL2/16-254...DKLYDAIKA---------------------------------------------------ELKITT-----------
G4UHA1_NEUT9/13-252...DQVGYAIRR---------------------------------------------------EIDQ..-----------
B6HKK0_PENCW/8-244...QKSYYALRK---------------------------------------------------EITS..-----------
E9F7M7_METAR/10-244...RKCYSAIRT---------------------------------------------------EPGR..-----------
WA_EMENI/8-244...QRSYHAVRQ---------------------------------------------------EISH..-----------
V5GBX6_BYSSN/4-246...KATSCALRR---------------------------------------------------NIAD..-----------
G2QWR8_THITE/16-254...RQAAYALKW---------------------------------------------------EIQR..-----------
M3CY75_SPHMS/5-242...QRSALALRE---------------------------------------------------ETRA..-----------
M2RQ22_COCSN/4-241...DRISVVIRE---------------------------------------------------EVQK..-----------
B8LZ55_TALSN/27-260...NKVGLRLRS---------------------------------------------------YIGG..-----------
S3D9A7_GLAL2/4-237...EEATALIQN---------------------------------------------------EVLI..-----------
G7XN60_ASPKW/8-244...QQCFHAIRQ---------------------------------------------------EIAK..-----------
M2T1K1_COCSN/8-240...HGAYNAIRT---------------------------------------------------EIYT..-----------
E9DR08_METAQ/20-259...EQAGLSLRR---------------------------------------------------LIGN..-----------
S3CWG8_GLAL2/8-245...NQSCFAIRA---------------------------------------------------ELNH..-----------
F2PW05_TRIEC/6-242...ARVHRALRQ---------------------------------------------------EISK..-----------
H1VJ39_COLHI/10-255...ERSCGVLKH---------------------------------------------------EVAR..-----------
U1GE50_ENDPU/4-243...EKAAFAIRD---------------------------------------------------EISR..-----------
A1C888_ASPCL/9-246...ERCFHALRR---------------------------------------------------EISK..-----------
R0KB98_SETT2/8-242...LKSYDAIRT---------------------------------------------------NISN..-----------
E4V2N2_ARTGP/10-256...EESTTVLKD---------------------------------------------------EIAK..-----------
L8G4G9_PSED2/24-270...REATWAIKD---------------------------------------------------EVRQ..-----------
M2ZZX0_MYCFI/5-242...QRCALALRE---------------------------------------------------EARA..-----------
Q2GV63_CHAGB/785-1022...REITAVIQL---------------------------------------------------EFSR..-----------
B8N7H8_ASPFN/9-246...DSLFSAIRS---------------------------------------------------GTRA..-----------
Q2UA48_ASPOR/8-244...QRCFHALRQ---------------------------------------------------EIAR..-----------
N4VBL7_COLOR/10-255...ESSCVVLKT---------------------------------------------------ETAH..-----------
B2B495_PODAN/8-245...EQAGHELRK---------------------------------------------------EVEK..-----------
M4G4F1_MAGP6/8-245...DQAGEALRA---------------------------------------------------EVDR..-----------
R7YU14_CONA1/7-242...EKVHFALRR---------------------------------------------------EIGQ..-----------
R0KD65_SETT2/13-258...QDAATVLRR---------------------------------------------------ELSS..-----------
V5G4B2_BYSSN/8-244...EKCFYALRQ---------------------------------------------------EISK..-----------
H1VY29_COLHI/8-245...DQAGQALRE---------------------------------------------------EIDG..-----------
L8GBJ0_PSED2/42-283...DRVSYALRR---------------------------------------------------LLGT..-----------
B6QC69_PENMQ/7-243...QSTLDVVQA---------------------------------------------------NISA..-----------
G3JFQ9_CORMM/16-246...ERVAFSLRQ---------------------------------------------------ELGR..-----------
F9XMW3_MYCGM/5-242...ERCALALRE---------------------------------------------------ETRT..-----------
G9MXY7_HYPVG/19-259...DQANYILRH---------------------------------------------------EIAQ..-----------
G0RW83_HYPJQ/19-262...DRVNHTLRH---------------------------------------------------EVAR..-----------
C5G0R3_ARTOC/8-243...DCACDKLRA---------------------------------------------------EIGR..-----------
K1WM58_MARBU/4-242...EQAQVVLQE---------------------------------------------------EVSS..-----------
G9NQM0_HYPAI/19-259...DRVNVALRQ---------------------------------------------------EIAQ..-----------
A2QH36_ASPNC/29-262...DRVGFQLRR---------------------------------------------------HVGN..-----------
STCA_EMENI/11-251...EQSHHVIRA---------------------------------------------------QMIR..-----------
Q8EYQ4_LEPIN/19-271...DTSFKAIAE---------------------------------------------------EVPK..-----------
C7ZNQ1_NECH7/8-238...TKAYNAIRV---------------------------------------------------EMYR..-----------
M2N8F6_BAUCO/8-232...EQAHYVIRA---------------------------------------------------QAQQ..-----------
G7Y059_ASPKW/7-243TVVDRLVRSQRL---------------------------------------------------GISTTD-----------
E4V6P4_ARTGP/8-243...DRACDKLRA---------------------------------------------------EIGR..-----------
U1GYJ0_ENDPU/26-259...EKVSAAFRT---------------------------------------------------EFGK..-----------
H6BVA1_EXODN/5-241...ERAGEAVRF---------------------------------------------------ENQN..-----------
E9F7X1_METAR/8-256...SDAHRALRS---------------------------------------------------EISR..-----------
E3R122_COLGM/12-243...EKSYQLMRK---------------------------------------------------ELYL..-----------
G2WRK7_VERDV/8-245...EQAGQALRE---------------------------------------------------EIDG..-----------
G0SDA9_CHATD/19-258...DQAAHALIK---------------------------------------------------EVSQ..-----------
B6QHV7_PENMQ/4-241...ERSKIVLQD---------------------------------------------------EICR..-----------
Q2UG06_ASPOR/8-245...DQSHYVVRA---------------------------------------------------QMLQ..-----------
C5FQT2_ARTOC/8-245...EKTHITLRQ---------------------------------------------------EITR..-----------
E9D5J9_COCPS/7-242...QRSQESARR---------------------------------------------------AFENAA-----------
N1PC72_MYCP1/5-242...ERVALALRE---------------------------------------------------EVRS..-----------
E3R0Q2_COLGM/12-250...GGLTRTVNE---------------------------------------------------ETRAIV-----------
R8BTJ4_TOGMI/8-245...EQAGRRLKK---------------------------------------------------EIDQ..-----------
G4MU27_MAGO7/14-251...DQAAQALRK---------------------------------------------------EIER..-----------
R7YTG2_CONA1/4-241...ERVSVALRD---------------------------------------------------EVTR..-----------
U7PRD0_SPOS1/5-267...DKCTDGLRT---------------------------------------------------VIAR..-----------
E5A495_LEPMJ/4-241...DRISVVIRE---------------------------------------------------EVQK..-----------
E9F8F0_METAR/70-305...RQLCDAVQL---------------------------------------------------QVSKLP-----------
B8NVD5_ASPFN/5-241...DESFAAIRK---------------------------------------------------QIFR..-----------
B8MV60_TALSN/15-255...REAADKLQL---------------------------------------------------LLSQ..-----------
E9FC93_METAR/16-256...VRVSFGLRQ---------------------------------------------------FLGC..-----------
G9NBV5_HYPVG/10-247...QEITDVIQL---------------------------------------------------EFST..-----------
R1G9D8_BOTPV/4-241...ERVGVTLRN---------------------------------------------------EVKR..-----------
S3CAW2_OPHP1/8-244...SQTGEALRK---------------------------------------------------EIET..-----------
B2B664_PODAN/7-242...RKATDRLRS---------------------------------------------------AVLQ..-----------
M1WG96_CLAP2/23-272...DEATLVLKE---------------------------------------------------EISA..-----------
E9F5C9_METAR/8-246...DAAYEAANQ---------------------------------------------------ALDQQD-----------
I1RF58_GIBZE/4-241...KQVHALLRR---------------------------------------------------EISS..-----------
G2YLD0_BOTF4/4-242...EQAHAALQD---------------------------------------------------ELSS..-----------
B2W1Q0_PYRTR/9-246...DNLFSAIKT---------------------------------------------------ETKA..-----------
C7Z6X3_NECH7/7-240...EQAGAKIRD---------------------------------------------------EIGL..-----------
E3QS53_COLGM/10-256...ERSCAVLKR---------------------------------------------------EIAQ..-----------
G9NGU8_HYPAI/9-247...RECADVVQV---------------------------------------------------NLSE..-----------
B8MYS6_ASPFN/10-247...ERVTTGLRE---------------------------------------------------EIGL..-----------
G2RCG6_THITE/8-247...ERVAFGLRQ---------------------------------------------------EIGL..-----------
S0DTP6_GIBF5/8-239...NQSYNALRA---------------------------------------------------ELFK..-----------
G2QMK9_THIHA/8-254...SEAYHALRA---------------------------------------------------EIAR..-----------
F0XGQ5_GROCL/8-244...NQATEALRK---------------------------------------------------EVEG..-----------
T0KJR9_COLGC/11-253...DDVAAVVRA---------------------------------------------------ETRH..-----------
M2RHZ9_COCSN/9-246...QSAIDNVQL---------------------------------------------------EVSR..-----------
R0JX83_SETT2/4-242...EKAYHALRH---------------------------------------------------ETWN..-----------
L8G0G7_PSED2/41-278...NRVASTLQN---------------------------------------------------EIER..-----------
Q2HGW2_CHAGB/17-254...QQANHALLG---------------------------------------------------VVEK..-----------
B8MF01_TALSN/8-245...DRAAFALRA---------------------------------------------------EIGA..-----------
N4VM62_COLOR/16-257...QDASVVLRR---------------------------------------------------ELAS..-----------
S3DAZ0_GLAL2/11-247...EQASDALCR---------------------------------------------------EVNA..-----------
E3SAD1_PYRTT/8-240...RAAYNALRK---------------------------------------------------EIFT..-----------
U7PK37_SPOS1/8-244...NQAGEALWR---------------------------------------------------EIEG..-----------
B2B6C8_PODAN/41-279...GQAHYVVRA---------------------------------------------------QMIR..-----------
V5G236_BYSSN/6-248...ERSCEVLRD---------------------------------------------------EVVR..-----------
M2NM35_BAUCO/5-243...ERISVVLRE---------------------------------------------------ETRA..-----------
B6QAB8_PENMQ/31-263...RRVGFQLRS---------------------------------------------------HVGR..-----------
M2XHZ5_MYCP1/10-247...EQSHYVVRA---------------------------------------------------QMIQ..-----------
R7YHB3_CONA1/8-244...EKAYITLRD---------------------------------------------------EVAR..-----------

PF01735

PLB2_SCHPO/134-617--------------------------------------------VNNFANITYLRD......NVWNLEHSVFA.P..HGD
PLB5_SCHPO/125-607--------------------------------------------VNNFANITFLHDD......VWNLDHSLFA.P...YD
PLB1_YEAST/99-586--------------------------------------------WNNWTSVQAIVDNTTESNSIWDISHSILT.P..DGI
PA24A_CHICK/190-675--------------------------------------------....YSHPDFPEKGPKEINQELMNSVSHN.P..LLL
PLB_NEUCR/121-606--------------------------------------------SNNFSSIETLLS....ENKVWDFENSIFKGPKEAGL
PLB_KLULA/102-589--------------------------------------------YNNWTSVQAIINNMTDDNSIWDISNSIVN.P..GGI
PLB6_SCHPO/114-600--------------------------------------------VNEFRTIQNISK......SIWYTRLGIFF.I..EET
PA24A_DANRE/185-664--------------------------------------------....YSHPEFPAKGPGDINKELMNRVSNN.P..LKL
PLB1_CANAL/88-565--------------------------------------------SNNLNSVDDMLS..QG...LWELTHSFLS.Y..YGI
PLB3_YEAST/105-592--------------------------------------------LNNWTSVQDILNNMQNDDSIWDLSDSIVT.P..GGI
PLB1_SCHPO/114-593--------------------------------------------LNNFSTINDFSK.......LWAFNHPLMY.P...KS
PLB2_YEAST/101-588--------------------------------------------WNNWTSVQEIVDHMSESDSIWNITKSIVN.P..GGS
B6HB59_PENCW/114-597--------------------------------------------INNFTTVDKLQT..HEAGSVWQFGNSIIEGPDAGGI
G8ZY27_TORDC/97-584--------------------------------------------WNNWTSVQDIVNNMTADDSIWDISNSIIN.P..GGF
Q59W34_CANAL/88-564--------------------------------------------SNDLIPVDQLLR....EDKLWDIQNSLVA.Y..YGV

PF01734

Q9N5Z7_CAEEL/97-269--------------------------------------------FN...-------------------------------
G7QJN7_LEPII/12-165--------------------------------------------AG...-------------------------------
B8GC44_CHLAD/8-228--------------------------------------------NN...-------------------------------
C1DSE3_AZOVD/14-206--------------------------------------------HGLLQ-------------------------------
A9BEP0_PETMO/3-174--------------------------------------------LY..G-------------------------------
A9B328_HERA2/4-179--------------------------------------------CH...-------------------------------
B2U808_RALPJ/9-214--------------------------------------------AW...-------------------------------
Q3AAC7_CARHZ/6-206--------------------------------------------AG...-------------------------------
A6CHF0_9BACI/8-175--------------------------------------------SK...-------------------------------
Q2GUC2_CHAGB/19-224--------------------------------------------ML...-------------------------------
Q9XAG3_STRCO/16-207--------------------------------------------RG...-------------------------------
A0A022N4I9_9ACTO/11-221--------------------------------------------LGIGI-------------------------------
Q8R6F6_FUSNN/65-256--------------------------------------------IG...-------------------------------
D5AXK0_RICPP/15-214--------------------------------------------LP...-------------------------------
Q038G8_LACC3/6-159--------------------------------------------RM...-------------------------------
A5IE43_LEGPC/25-249--------------------------------------------LG...-------------------------------
Q4UJC7_RICFE/42-240--------------------------------------------IP...-------------------------------
Q54HM9_DICDI/140-357--------------------------------------------MG...-------------------------------
Q2K9E1_RHIEC/30-248--------------------------------------------HV...-------------------------------
A4IAC8_LEIIN/190-378--------------------------------------------CS...-------------------------------
Q21S96_ALBFT/26-231--------------------------------------------AG...-------------------------------
A5GF97_GEOUR/15-187--------------------------------------------SG...-------------------------------
Q1CW69_MYXXD/353-514--------------------------------------------GS...-------------------------------
A6NV66_9FIRM/7-176--------------------------------------------SK...-------------------------------
A0A038KND4_MYCTX/181-420--------------------------------------------RE...-------------------------------
A0YM74_LYNSP/12-230--------------------------------------------SD...-------------------------------
Q5X5T5_LEGPA/27-309--------------------------------------------CG...-------------------------------
Q2GS92_CHAGB/73-327--------------------------------------------ML...-------------------------------
Q1ZT25_PHOAS/33-203--------------------------------------------SR...-------------------------------
Q5CY77_CRYPI/46-241--------------------------------------------FY...-------------------------------
A0A039K3R0_MYCBI/806-965--------------------------------------------SG...-------------------------------
PATA2_SOLTU/32-227--------------------------------------------TP...-------------------------------
A6G7S9_9DELT/458-735--------------------------------------------EG...-------------------------------
C6TYS0_BURPE/13-264--------------------------------------------IS...-------------------------------
A4F8K0_SACEN/17-281--------------------------------------------TS...-------------------------------
Q2R2X0_ORYSJ/139-303--------------------------------------------SG...-------------------------------
Q0A7T0_ALKEH/6-219--------------------------------------------CY...-------------------------------
A0A031KR74_ENTFC/138-323--------------------------------------------QG...-------------------------------
M6BTQ1_LEPBO/13-188--------------------------------------------TM...-------------------------------
E3VZB4_MIMIV/38-270--------------------------------------------LG...-------------------------------
Q0FZD9_9RHIZ/20-226--------------------------------------------IA...-------------------------------
Q5A7P0_CANAL/211-417--------------------------------------------CH...-------------------------------
Q11UC9_CYTH3/381-624--------------------------------------------QG...-------------------------------
A6ASA3_VIBCY/5-186--------------------------------------------LG...-------------------------------
Q1D826_MYXXD/142-382--------------------------------------------RL...-------------------------------
A0AZM8_BURCH/61-294--------------------------------------------IS...-------------------------------
Q5CE49_CRYHO/149-342--------------------------------------------HV...-------------------------------
A4HB10_LEIBR/40-220--------------------------------------------SG...-------------------------------
I0WT11_9NOCA/7-221--------------------------------------------AGA.H-------------------------------
A3QTZ2_9VIRU/28-255--------------------------------------------LD...-------------------------------
Q1D5W1_MYXXD/154-432--------------------------------------------LA...-------------------------------
Q09D74_STIAD/17-214--------------------------------------------HA...-------------------------------
A4BNM2_9GAMM/38-218--------------------------------------------TG...-------------------------------
Q4LA62_STAHJ/11-202--------------------------------------------SD...-------------------------------
Q5ZPA4_9DELT/22-208--------------------------------------------AA...-------------------------------
D3MBX2_PROAA/25-319--------------------------------------------QW...-------------------------------
NTE1_PICST/1239-1403--------------------------------------------KD...-------------------------------
A4SJS7_AERS4/8-174--------------------------------------------AG...-------------------------------
Q1I961_PSEE4/42-302--------------------------------------------LD...-------------------------------
A7RB12_PBCVA/19-192--------------------------------------------LN...-------------------------------
Q0VPN6_ALCBS/36-193--------------------------------------------SG...-------------------------------
A6G1N7_9DELT/36-362--------------------------------------------YY...-------------------------------
A6QA07_SULNB/41-281--------------------------------------------MY...-------------------------------
Q5WWS2_LEGPL/304-496--------------------------------------------LG...-------------------------------
A0Z6H0_9GAMM/8-199--------------------------------------------QP...-------------------------------
A6LMU7_THEM4/5-176--------------------------------------------LY...-------------------------------
A7I0A5_CAMHC/6-211--------------------------------------------AY...-------------------------------
C7LH54_BRUMC/13-187--------------------------------------------NG...-------------------------------
A6G3Y0_9DELT/12-216--------------------------------------------TG...-------------------------------
A1DP95_NEOFI/20-225--------------------------------------------ML...-------------------------------
A5K2I7_PLAVS/1168-1482--------------------------------------------LE...-------------------------------
TEG_BACME/7-180--------------------------------------------SG...-------------------------------
Q2W5X1_MAGSA/6-225--------------------------------------------KG...-------------------------------
A4U0C8_9PROT/5-257--------------------------------------------FA...-------------------------------
A5N2W9_CLOK5/4-191--------------------------------------------QG...-------------------------------
A4JJZ7_BURVG/8-242--------------------------------------------SA...-------------------------------
A6R0J1_AJECN/673-891--------------------------------------------NL...-------------------------------
A0A024F582_BDEBC/72-224--------------------------------------------NK...-------------------------------
A5P920_9SPHN/106-312--------------------------------------------VA...-------------------------------
Q2C291_9GAMM/11-214--------------------------------------------AG...-------------------------------
A1VHY7_DESVV/116-308--------------------------------------------LG...-------------------------------
A7BB55_9ACTO/26-199--------------------------------------------TS...-------------------------------
A5I1W5_CLOBH/6-200--------------------------------------------VG...-------------------------------
A8GLS3_RICAH/7-147--------------------------------------------LG...-------------------------------
A4T0K7_POLSQ/80-285--------------------------------------------SG...-------------------------------
A6DDL8_9PROT/5-162--------------------------------------------CK...-------------------------------
A4CKZ2_ROBBH/4-195--------------------------------------------L....-------------------------------
A0A031WAB0_PEPDI/5-179--------------------------------------------TG...-------------------------------
A0A014PKG8_YERPE/86-275--------------------------------------------LG...-------------------------------
M6C3B5_LEPBO/36-250--------------------------------------------CG...-------------------------------
Q12EZ0_POLSJ/6-228--------------------------------------------LN...-------------------------------
Q1GX66_SPHAL/43-328--------------------------------------------RA...-------------------------------
Q4RS54_TETNG/14-183--------------------------------------------TG...-------------------------------
Q5C8M6_LEGPN/32-295--------------------------------------------VG...-------------------------------
Q6JBI3_DICVI/201-395--------------------------------------------LL...-------------------------------
Q0FKF7_PELBH/6-360--------------------------------------------AV...-------------------------------
N0BV45_SALTI/8-168--------------------------------------------AC...-------------------------------
Q6ASS6_ORYSJ/60-258--------------------------------------------LR...-------------------------------
A6QX75_AJECN/242-440--------------------------------------------VH...-------------------------------
Q74A07_GEOSL/58-306--------------------------------------------LY...-------------------------------
Q54XY1_DICDI/13-231--------------------------------------------KE...-------------------------------
Q55G69_DICDI/65-250--------------------------------------------FS...-------------------------------
Q5Z158_NOCFA/22-193--------------------------------------------CG...-------------------------------
Q54QX6_DICDI/893-1088--------------------------------------------ST..P-------------------------------
A1UXE2_BURMS/413-612--------------------------------------------SH...-------------------------------
A2QZY6_ASPNC/473-679--------------------------------------------KA...-------------------------------
A4XTW9_PSEMY/15-385--------------------------------------------LF...-------------------------------
Q0E508_SFAVA/27-224--------------------------------------------AG...-------------------------------
A6GI17_9DELT/71-215--------------------------------------------LN...-------------------------------
A7IE20_XANP2/6-198--------------------------------------------WF...-------------------------------
Q1DCU7_MYXXD/197-406--------------------------------------------LF...-------------------------------
Q6MAN6_PARUW/474-738--------------------------------------------VG...-------------------------------
Q4Z1R8_PLABA/352-558--------------------------------------------EG...-------------------------------
A4RTL4_OSTLU/164-398--------------------------------------------LS...-------------------------------
A0JUC4_ARTS2/74-249--------------------------------------------SG...-------------------------------

PF00698

FAS_HUMAN/493-810...........................................STF----------------------------------
STCK_EMENI/1547-1902GRQIRDIYLSMSD........SDPSMLPGLTRDSRSYTFNYPSGLL----------------------------------
FAS_CHICK/492-809...........................................NTF----------------------------------
FAS1_YEAST/1663-2037GKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLL----------------------------------
A4F7N8_SACEN/109-425............................................QS----------------------------------
A4F7P0_SACEN/560-880...........................................PGL----------------------------------
I6Y231_MYCTU/534-851............................................TV----------------------------------
PPSA_MYCTU/632-950............................................EL----------------------------------

PF16073

B8MGX9_TALSN/8-250--------------------------------------------LS----------------------------------
B6HLN4_PENCW/17-255--------------------------------------------LD----------------------------------
E9D6Y9_COCPS/8-245--------------------------------------------WL----------------------------------
K1X7W5_MARBU/800-1037--------------------------------------------LS----------------------------------
L8G6V9_PSED2/30-264--------------------------------------------LP----------------------------------
B6QFH1_PENMQ/10-246--------------------------------------------LP----------------------------------
B6QER4_PENMQ/12-248--------------------------------------------E.----------------------------------
A7F3E3_SCLS1/4-241--------------------------------------------LP----------------------------------
N1RV88_FUSC4/8-242--------------------------------------------LS----------------------------------
E9F646_METAR/19-261--------------------------------------------LT----------------------------------
S3EB79_GLAL2/16-254--------------------------------------------LD----------------------------------
G4UHA1_NEUT9/13-252--------------------------------------------LP----------------------------------
B6HKK0_PENCW/8-244--------------------------------------------LP----------------------------------
E9F7M7_METAR/10-244--------------------------------------------LP----------------------------------
WA_EMENI/8-244--------------------------------------------LP----------------------------------
V5GBX6_BYSSN/4-246--------------------------------------------LP----------------------------------
G2QWR8_THITE/16-254--------------------------------------------LP----------------------------------
M3CY75_SPHMS/5-242--------------------------------------------LP----------------------------------
M2RQ22_COCSN/4-241--------------------------------------------LP----------------------------------
B8LZ55_TALSN/27-260--------------------------------------------LP----------------------------------
S3D9A7_GLAL2/4-237--------------------------------------------LP----------------------------------
G7XN60_ASPKW/8-244--------------------------------------------LP----------------------------------
M2T1K1_COCSN/8-240--------------------------------------------LP----------------------------------
E9DR08_METAQ/20-259--------------------------------------------LP----------------------------------
S3CWG8_GLAL2/8-245--------------------------------------------SL----------------------------------
F2PW05_TRIEC/6-242--------------------------------------------LP----------------------------------
H1VJ39_COLHI/10-255--------------------------------------------LS----------------------------------
U1GE50_ENDPU/4-243--------------------------------------------RA----------------------------------
A1C888_ASPCL/9-246--------------------------------------------LP----------------------------------
R0KB98_SETT2/8-242--------------------------------------------LP----------------------------------
E4V2N2_ARTGP/10-256--------------------------------------------LP----------------------------------
L8G4G9_PSED2/24-270--------------------------------------------LP----------------------------------
M2ZZX0_MYCFI/5-242--------------------------------------------LP----------------------------------
Q2GV63_CHAGB/785-1022--------------------------------------------AD----------------------------------
B8N7H8_ASPFN/9-246--------------------------------------------MD----------------------------------
Q2UA48_ASPOR/8-244--------------------------------------------LS----------------------------------
N4VBL7_COLOR/10-255--------------------------------------------LS----------------------------------
B2B495_PODAN/8-245--------------------------------------------LP----------------------------------
M4G4F1_MAGP6/8-245--------------------------------------------LP----------------------------------
R7YU14_CONA1/7-242--------------------------------------------LP----------------------------------
R0KD65_SETT2/13-258--------------------------------------------LE----------------------------------
V5G4B2_BYSSN/8-244--------------------------------------------LP----------------------------------
H1VY29_COLHI/8-245--------------------------------------------LG----------------------------------
L8GBJ0_PSED2/42-283--------------------------------------------LP----------------------------------
B6QC69_PENMQ/7-243--------------------------------------------LG----------------------------------
G3JFQ9_CORMM/16-246--------------------------------------------LP----------------------------------
F9XMW3_MYCGM/5-242--------------------------------------------LS----------------------------------
G9MXY7_HYPVG/19-259--------------------------------------------LT----------------------------------
G0RW83_HYPJQ/19-262--------------------------------------------LT----------------------------------
C5G0R3_ARTOC/8-243--------------------------------------------LP----------------------------------
K1WM58_MARBU/4-242--------------------------------------------QS----------------------------------
G9NQM0_HYPAI/19-259--------------------------------------------LT----------------------------------
A2QH36_ASPNC/29-262--------------------------------------------LP----------------------------------
STCA_EMENI/11-251--------------------------------------------EL----------------------------------
Q8EYQ4_LEPIN/19-271--------------------------------------------L.----------------------------------
C7ZNQ1_NECH7/8-238--------------------------------------------LP----------------------------------
M2N8F6_BAUCO/8-232--------------------------------------------WL----------------------------------
G7Y059_ASPKW/7-243--------------------------------------------N.----------------------------------
E4V6P4_ARTGP/8-243--------------------------------------------LP----------------------------------
U1GYJ0_ENDPU/26-259--------------------------------------------LP----------------------------------
H6BVA1_EXODN/5-241--------------------------------------------RS----------------------------------
E9F7X1_METAR/8-256--------------------------------------------LP----------------------------------
E3R122_COLGM/12-243--------------------------------------------LP----------------------------------
G2WRK7_VERDV/8-245--------------------------------------------LG----------------------------------
G0SDA9_CHATD/19-258--------------------------------------------LP----------------------------------
B6QHV7_PENMQ/4-241--------------------------------------------LS----------------------------------
Q2UG06_ASPOR/8-245--------------------------------------------SM----------------------------------
C5FQT2_ARTOC/8-245--------------------------------------------QS----------------------------------
E9D5J9_COCPS/7-242--------------------------------------------V.----------------------------------
N1PC72_MYCP1/5-242--------------------------------------------LA----------------------------------
E3R0Q2_COLGM/12-250--------------------------------------------ID----------------------------------
R8BTJ4_TOGMI/8-245--------------------------------------------LP----------------------------------
G4MU27_MAGO7/14-251--------------------------------------------LP----------------------------------
R7YTG2_CONA1/4-241--------------------------------------------LP----------------------------------
U7PRD0_SPOS1/5-267--------------------------------------------LP----------------------------------
E5A495_LEPMJ/4-241--------------------------------------------LP----------------------------------
E9F8F0_METAR/70-305--------------------------------------------LH----------------------------------
B8NVD5_ASPFN/5-241--------------------------------------------LP----------------------------------
B8MV60_TALSN/15-255--------------------------------------------IE----------------------------------
E9FC93_METAR/16-256--------------------------------------------LP----------------------------------
G9NBV5_HYPVG/10-247--------------------------------------------LS----------------------------------
R1G9D8_BOTPV/4-241--------------------------------------------LS----------------------------------
S3CAW2_OPHP1/8-244--------------------------------------------LG----------------------------------
B2B664_PODAN/7-242--------------------------------------------AP----------------------------------
M1WG96_CLAP2/23-272--------------------------------------------LS----------------------------------
E9F5C9_METAR/8-246--------------------------------------------VN----------------------------------
I1RF58_GIBZE/4-241--------------------------------------------LP----------------------------------
G2YLD0_BOTF4/4-242--------------------------------------------LP----------------------------------
B2W1Q0_PYRTR/9-246--------------------------------------------MD----------------------------------
C7Z6X3_NECH7/7-240--------------------------------------------LT----------------------------------
E3QS53_COLGM/10-256--------------------------------------------LP----------------------------------
G9NGU8_HYPAI/9-247--------------------------------------------LD----------------------------------
B8MYS6_ASPFN/10-247--------------------------------------------LP----------------------------------
G2RCG6_THITE/8-247--------------------------------------------LT----------------------------------
S0DTP6_GIBF5/8-239--------------------------------------------IP----------------------------------
G2QMK9_THIHA/8-254--------------------------------------------LP----------------------------------
F0XGQ5_GROCL/8-244--------------------------------------------LH----------------------------------
T0KJR9_COLGC/11-253--------------------------------------------MH----------------------------------
M2RHZ9_COCSN/9-246--------------------------------------------LT----------------------------------
R0JX83_SETT2/4-242--------------------------------------------LN----------------------------------
L8G0G7_PSED2/41-278--------------------------------------------LP----------------------------------
Q2HGW2_CHAGB/17-254--------------------------------------------LP----------------------------------
B8MF01_TALSN/8-245--------------------------------------------LP----------------------------------
N4VM62_COLOR/16-257--------------------------------------------LE----------------------------------
S3DAZ0_GLAL2/11-247--------------------------------------------LS----------------------------------
E3SAD1_PYRTT/8-240--------------------------------------------LS----------------------------------
U7PK37_SPOS1/8-244--------------------------------------------LG----------------------------------
B2B6C8_PODAN/41-279--------------------------------------------SL----------------------------------
V5G236_BYSSN/6-248--------------------------------------------LR----------------------------------
M2NM35_BAUCO/5-243--------------------------------------------LP----------------------------------
B6QAB8_PENMQ/31-263--------------------------------------------LP----------------------------------
M2XHZ5_MYCP1/10-247--------------------------------------------TL----------------------------------
R7YHB3_CONA1/8-244--------------------------------------------DP----------------------------------

PF01735

PLB2_SCHPO/134-617NVV.ENLAYYDD-----L-DDEIDQK---------KDAGFDTSLTDLWGRALSRKLVD.ATQGGPNITFSSIRNQTWFQN
PLB5_SCHPO/125-607DAF.ENFYIYQE-----W-FEQVLQK---------KNAGFNVSITDLWGRALALKLVN.PLTGGANTTFSSVTNETWFQD
PLB1_YEAST/99-586NIF.KTGSRWDD-----I-SDDVQDK---------KDAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKN
PA24A_CHICK/190-675LTP.QKVKRY..-----.-IEALWNK---------KSSGQPVTFTDIFGMLIGETLIH....NRMDTTLSDMK..EKVSE
PLB_NEUCR/121-606STV.NRIQYWSE-----V-AKEVAKK---------KDAGFETSITDYWGRALSYQLIG.ADMGGPAYTFSSIAQTDNFQK
PLB_KLULA/102-589NIF.SSISRWDD-----I-SDAVEEK---------KKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKN
PLB6_SCHPO/114-600HFG.DLKNYYTN-----V-VDEVNQK---------AAAGFNVSLTDYWGRAIARHFVG.QLRGGPNLTYSSVQNASWFQT
PA24A_DANRE/185-664LLP.QNINRY..-----.-VKALWKK---------KSAGQPVTFTDIFGMLIGETLIP....GRMNIKLSSLK..GKINE
PLB1_CANAL/88-565EHPIKQVEEWVN-----V-GNQVASK---------RNANFNVSLTDIYGRLLSYPLLTNTEDEGDAYLWSDVTSASNFQS
PLB3_YEAST/105-592NIF.KTAKRWDH-----I-SNAVESK---------QNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQN
PLB1_SCHPO/114-593AIV.FNAHFYSS-----I-MNEVAEK---------ANAGFNISLSDYWGRVISRTLGD.TTYGFPNVSLSSITSQEWYRN
PLB2_YEAST/101-588NLT.YTIERWES-----I-VQEVQAK---------SDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKN
B6HB59_PENCW/114-597QLL.DSAGYYKD-----L-ADAVDGK---------KKAGFDTTLTDIWGRALSYQMFN.ASNGGLSYTWSSIADTPEFQD
G8ZY27_TORDC/97-584MIV.TTIKRWDH-----I-SDAVEGK---------QDAGFNVSLTDIWGRALSYNFFPSLYSGDVAYTWSTLRDVEVFQN
Q59W34_CANAL/88-564NIV.RNTAMWGN-----I-NLQVQTK---------QLAGFTVSITDVYGRALSHQLLTNFDNQRASFLWSDVTETTSFQN

PF01734

Q9N5Z7_CAEEL/97-269----..PEKISE-----A-VEEIYKM---------ADEVND.......................................
G7QJN7_LEPII/12-165----IPIDTMTD-----L-ILNLKKK---------DFWEGN.......................................
B8GC44_CHLAD/8-228----MSPRTLIS-----V-LERSLLG---------IDQLEP.......................................
C1DSE3_AZOVD/14-206----GGRDGARE-----A-LASFWQA---------VASSAP.......................................
A9BEP0_PETMO/3-174----VNFFGRLK-----D-FIYEKNN---------PLREVITN.....................................
A9B328_HERA2/4-179----PNLAGIQR-----I-AQRWKSV---------KREDIF.......................................
B2U808_RALPJ/9-214----.NSAELMD-----Y-YGEALRQ---------NTRNAH.......................................
Q3AAC7_CARHZ/6-206----LSPKDMEE-----L-ALQIKPK---------DLYNCLFTAG...................................
A6CHF0_9BACI/8-175----QKGRNKKV-----N-IGFAGNP---------KYLSWR.......................................
Q2GUC2_CHAGB/19-224----GRLHMTID-----E-CIEVYER---------LGKDVF.......................................
Q9XAG3_STRCO/16-207----AAPAGLYK-----E-QLDRERP---------MLDVDF.......................................
A0A022N4I9_9ACTO/11-221----DVMANSER-----G-IYEAGDP---------VLDYRDLGASLPPR...............................
Q8R6F6_FUSNN/65-256----YTVDEIEK-----F-LDDVNVS---------NFLETITDNTN..................................
D5AXK0_RICPP/15-214----DSDNPGKP-----L-FSAEQAQ---------TLFERMV......................................
Q038G8_LACC3/6-159----.....LPE-----Q-VPQWWQH---------FSEAKV.......................................
A5IE43_LEGPC/25-249----MPSAVFRD-----K-LLTTNLK---------NLMGSRIGSLFGTNP..............................
Q4UJC7_RICFE/42-240----KEQGSNIA-----K-YSAKDAL---------KIFTDA.......................................
Q54HM9_DICDI/140-357----RSKPLPYD-----E-IVEIYKN---------FGKVIF.......................................
Q2K9E1_RHIEC/30-248----WPRLAFEN-----E-VAVNFRA---------QYVDRI.......................................
A4IAC8_LEIIN/190-378----TDLASLFH-----S-SSGSNSI---------AEANALL......................................
Q21S96_ALBFT/26-231----.TFEACFT-----G-YKRAVAE---------NVHNLY.......................................
A5GF97_GEOUR/15-187----ISPSEIQQ-----E-TLTVDTN---------RFKDFN.......................................
Q1CW69_MYXXD/353-514----ALDGHDGL-----E-GLRRLEE---------RAMSRQ.......................................
A6NV66_9FIRM/7-176----QSGRNLEI-----L-THYANDK---------RYMGVN.......................................
A0A038KND4_MYCTX/181-420----LPVPI..D-----E-YAEWAKT---------VSYRAILGPERRRS...............................
A0YM74_LYNSP/12-230----RPFSNAVQ-----Q-LNELWTN---------LGEVEILKPNTEQI...............................
Q5X5T5_LEGPA/27-309----GSAELMDY-----F-CSANSLA---------DFVDNRLTKKLLPKSEKS...........................
Q2GS92_CHAGB/73-327----GMFGKTVD-----D-CINEFHR---------QNKSIPLADDAS.................................
Q1ZT25_PHOAS/33-203----QPRFGYKF-----I-QNYTTTD---------KFFSLY.......................................
Q5CY77_CRYPI/46-241----PPGEELAW-----T-TELVILW---------KMARQKDITT...................................
A0A039K3R0_MYCBI/806-965----LDAAGVDA-----Q-IYEHFVR---------KSHGDY.......................................
PATA2_SOLTU/32-227----NENNRPFA-----A-ANEIVPF---------YFEHGP.......................................
A6G7S9_9DELT/458-735----APDSA..E-----Q-LVAMWRA---------FSADRNAIFWRNYHLWLLEAAVQRALDS...........AEDAAL
C6TYS0_BURPE/13-264----LLYDGEFS-----E-LREVWMK---------TATFND.......................................
A4F8K0_SACEN/17-281----MVYGMPFD-----R-MRRMWVR---------LADLEAM......................................
Q2R2X0_ORYSJ/139-303----NTMRDALQ-----V-TKDLADN---------CRSNGT.......................................
Q0A7T0_ALKEH/6-219----ATHFQRGV-----A-NMEAVWA---------NFRCQHIYRTG..................................
A0A031KR74_ENTFC/138-323----.DMKKAVN-----L-WKKLSTR---------QVLALPE......................................
M6BTQ1_LEPBO/13-188----PKPEP..E-----K-SLKTLAI---------WYIELA.......................................
E3VZB4_MIMIV/38-270----YQKKDFEK-----F-VETFDLS---------KFVDSK.......................................
Q0FZD9_9RHIZ/20-226----QREVKLLE-----T-MGAAFLD---------RDENIS.......................................
Q5A7P0_CANAL/211-417----.NNEETFE-----L-LSTITTK---------KFNIFDVVD....................................
Q11UC9_CYTH3/381-624----KIKSPHEF-----Q-YLSDISE---------DVLNPIVFSMV..................................
A6ASA3_VIBCY/5-186----KSSDDIIT-----A-FQTYKAD---------IFKSKG.......................................
Q1D826_MYXXD/142-382----TRFDA..T-----D-MINIVRG---------LSFRKLFR.....................................
A0AZM8_BURCH/61-294----TDRTT..G-----D-SWRPVWN---------DSLIRTR......................................
Q5CE49_CRYHO/149-342----GQSTHFST-----E-GASIWSN---------FTHKNV.......................................
A4HB10_LEIBR/40-220----QYDILSVK-----K-FSLAAAE---------DYRSSI.......................................
I0WT11_9NOCA/7-221----HGIDQAAE-----R-VVSLWDS---------VSLGDVFSV....................................
A3QTZ2_9VIRU/28-255----IPPVKLEK-----L-IYKLNIF---------KHTVNFDT.....................................
Q1D5W1_MYXXD/154-432----SCDTAFAQ-----P-TWSPEQS---------LFWTVWI......................................
Q09D74_STIAD/17-214----LSLRQRQG-----V-QAPGCLD---------IIDGCIAF.....................................
A4BNM2_9GAMM/38-218----TTAAEMLA-----T-IRNLDSK---------DTVDLC.......................................
Q4LA62_STAHJ/11-202----KSFDVIYD-----E-QIAPKSN---------ETPPVK.......................................
Q5ZPA4_9DELT/22-208----REPAVGLE-----Q-ARQIWFT---------PGLFDS.......................................
D3MBX2_PROAA/25-319----TDPAKQSA-----A-LRQLEAM---------WLEMTDQSDMFTPRAWFSRLLEIGPEWMSLLNREAAKTKSQRPWL
NTE1_PICST/1239-1403----YNIVSIYG-----R-AKKFSKR---------VASLWR.......................................
A4SJS7_AERS4/8-174----QRGRNHSV-----I-TDYSCRP---------EFISLA.......................................
Q1I961_PSEE4/42-302----EPGKPKGE-----K-LLAELAN---------TNLRDFVDGDADV................................
A7RB12_PBCVA/19-192----KDPVSMCK-----A-FIDEVYK---------PSFDIS.......................................
Q0VPN6_ALCBS/36-193----ASVNAIED-----T-LLGLDRA---------QFWDPS.......................................
A6G1N7_9DELT/36-362----RAGARDDA-----Q-FLDLGLD---------APTDPGTLSLDAL................................
A6QA07_SULNB/41-281----WCQKESVP-----Y-QNRVDDN---------LFYETW.......................................
Q5WWS2_LEGPL/304-496----YTADEISE-----L-FQHFKQE---------HLVQFD.......................................
A0Z6H0_9GAMM/8-199----DTEKPENS-----R-FSARDLA---------DLYANR.......................................
A6LMU7_THEM4/5-176----GNSKIVYK-----K-FSNAVEK---------FFPNLK.......................................
A7I0A5_CAMHC/6-211----KDPIKTAE-----I-LQNLWLN---------TNVLDVFKLKKPQNLKLE...........................
C7LH54_BRUMC/13-187----MSGKDIYD-----Y-MASIFTN---------RSEVVR.......................................
A6G3Y0_9DELT/12-216----LFPETMQV-----F-LDEVDRN---------ESNIYP.......................................
A1DP95_NEOFI/20-225----GRLKMDVE-----Q-CINAYQN---------LLECSFQ......................................
A5K2I7_PLAVS/1168-1482----RAHLNEVE-----F-LYNLLIN---------KIFQKD.......................................
TEG_BACME/7-180----RSPEETFD-----F-FKDQILP---------AFSVSRP......................................
Q2W5X1_MAGSA/6-225----MSRQDSLR-----N-SVNFGVS---------DEIYKYIPMN...................................
A4U0C8_9PROT/5-257----PDYQASAT-----N-MVEFILD---------PASYRNLVVPA..................................
A5N2W9_CLOK5/4-191----.DFEKGYN-----W-WTKIDIS---------TIFNLEKIHM...................................
A4JJZ7_BURVG/8-242----VTPQKAHA-----H-LALLWDR---------LAQTSPVEFQAFGYLTLLS..........................
A6R0J1_AJECN/673-891----RWDVATCS-----D-VFERLAR---------RVFHRARR.....................................
A0A024F582_BDEBC/72-224----ELANDVEW-----Q-MFKLKDE---------EVLKKS.......................................
A5P920_9SPHN/106-312----LDGNAKRQ-----T-RDYAMRQ---------LEWGYSP......................................
Q2C291_9GAMM/11-214----NKPENRLK-----N-LEIFWER---------VTSSISFSNLFFNFNNE............................
A1VHY7_DESVV/116-308----ATPDQMVD-----I-LLRTPFH---------KFMDGS.......................................
A7BB55_9ACTO/26-199----RDAARSHD-----T-FVDLVED---------PEFGGL.......................................
A5I1W5_CLOBH/6-200----YRGKEIKK-----I-MYDLDYE---------KVGNIT.......................................
A8GLS3_RICAH/7-147----YQSEKIED-----I-LKKIKFL---------DRTSKW.......................................
A4T0K7_POLSQ/80-285----EFYRLRKE-----F-DFFGKFP---------EIFSQIAPLA...................................
A6DDL8_9PROT/5-162----IPLKDIFE-----I-VKSKEFK---------SIFKFS.......................................
A4CKZ2_ROBBH/4-195----QKIEKIRK-----V-YTSVNQQ---------SIFSNLPFTI...................................
A0A031WAB0_PEPDI/5-179----.NVDNLEK-----M-WTNIKDI---------QNGNVK.......................................
A0A014PKG8_YERPE/86-275----SDHDKALH-----D-FYTTTTT---------RDIFHI.......................................
M6C3B5_LEPBO/36-250----.DEEECVS-----F-FENIVRK---------NPANFYLSRLFKGGR..............................
Q12EZ0_POLSJ/6-228----GMRWPTSD-----E-YLEALLP---------KLKDVLT......................................
Q1GX66_SPHAL/43-328----LATGESLD-----P-LTDLWLD---------SADVDNLLDPDARP...............................
Q4RS54_TETNG/14-183----VCLGETGA-----S-IIDVAKE---------ARKRFL.......................................
Q5C8M6_LEGPN/32-295----MDIKDIKK-----L-IEGLDIT---------KLLDNSGVGFRARGDRFRNILDV....................IY
Q6JBI3_DICVI/201-395----IGKGYTVE-----D-CRTIYVD---------VSKRLF.......................................
Q0FKF7_PELBH/6-360----SDPAGGRS-----K-IRGLLSA---------ATGLWKRPILLGAGTALAGLIAAAV.................LCD
N0BV45_SALTI/8-168----NKLSALEQ-----W-VCSFRYW---------DVLRLM.......................................
Q6ASS6_ORYSJ/60-258----GPDGRPRY-----T-AEEALEF---------VAASVG.......................................
A6QX75_AJECN/242-440----KDDDLIPV-----L-NGEGIDE---------AVSDRLSKQKHFK................................
Q74A07_GEOSL/58-306----PDRFF..D-----D-FPGTFLY---------RDIQGG.......................................
Q54XY1_DICDI/13-231----ISNSELLN-----M-YEGKESK---------KIFGSL.......................................
Q55G69_DICDI/65-250----VDNDELLR-----L-YCEFGKK---------IFPSSS.......................................
Q5Z158_NOCFA/22-193----RAVPGMRS-----W-SNPDIMR---------AVIDPA.......................................
Q54QX6_DICDI/893-1088----KTPVQLST-----A-MESLSKS---------AFVKHP.......................................
A1UXE2_BURMS/413-612----..PKGATK-----A-LEAFWRE---------LSIALPLPYESQWREA.............................
A2QZY6_ASPNC/473-679----FRQRRPIS-----E-CQQTLAD---------LIVRFFQG.....................................
A4XTW9_PSEMY/15-385----RPAPALRS-----L-FDSFTAA---------LDARRNPLGLPRALLAHYWRAAGVGALLGG.......GPLWPVAL
Q0E508_SFAVA/27-224----ATPLSILK-----R-IVNQRKN---------LGVCSDALESK..................................
A6GI17_9DELT/71-215----DPRQT..K-----E-PFPVRKE---------TGESEP.......................................
A7IE20_XANP2/6-198----DDPVLAFE-----A-VLRFDDE---------VRESQT.......................................
Q1DCU7_MYXXD/197-406----HTPGHEEA-----A-RQLLVSN---------YTCSVE.......................................
Q6MAN6_PARUW/474-738----YTSSEIRD-----I-LDEIDLN---------KILDYPDDLRLDIEKLKKVLLDA....................KE
Q4Z1R8_PLABA/352-558----YSLQEISA-----L-LPFIMEK---------TFEGNR.......................................
A4RTL4_OSTLU/164-398----KQPEGIFA-----Y-EEDLCDG---------SFLDLKRHVSRRMTVI.............................
A0JUC4_ARTS2/74-249----VSPADMCR-----N-WSAVNVK---------DFGSAL.......................................

PF00698

FAS_HUMAN/493-810----DDIVHSFV-SLTAIQIGLIDLL.SCMG..LRPDGIVGHSLGEVACGYADGCLSQEEAVLAAYWRGQCIKE------
STCK_EMENI/1547-1902----MSTQFAQP-ALAVMEIAEYAHL.QAQGVVQTQAIFAGHSLGEYSSLGACTTIMPFESLLSLILYRGLKMQ------
FAS_CHICK/492-809----DDTVHAFV-GLAAIQIAQIDVL.KAAG..LQPDGILGHSVGELACGYADNSLSHEEAVLAAYWRGRCVKE------
FAS1_YEAST/1663-2037----SATQFTQP-ALTLMEKAAFEDL.KSKGLIPADATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQ------
A4F7N8_SACEN/109-425----RRVEVVQP-ALFAVQTSLAALW.RSFG..VTPDAVVGHSIGELAAAHVCGAAGAADAARAAALWSREMIP------
A4F7P0_SACEN/560-880----DRVDVVQP-VLFAVMVSLAELW.RSYG..VEPAAVVGHSQGEIAAAHVAGALTLEDAAKLVVGRSRLMRS------
I6Y231_MYCTU/534-851----TGIDKVQP-AVFAVQVALAATMEQTYG..VRPGAVVGHSMGESAAAVVAGALSLEDAARVICRRSKLMTR------
PPSA_MYCTU/632-950----VGIEQIQL-GLIGMQLALTELW.CSYG..VRPDLVIGHSMGEVAAAVVAGALTPAEGLRVTATRSRLMAP------

PF16073

B8MGX9_TALSN/8-250----VIERKELP.S...L.TDLYSLS-........ESENGN.........AS..DHPILSPALLVILQLGQFIS......
B6HLN4_PENCW/17-255----RALQNSLG.H...F.TSLQELG-........DRYRH..........SNDE.FGVARALLLHTLRVGTLLQ......
E9D6Y9_COCPS/8-245----SPEEQQRS.R...S.SNLAHLL-........QKYSDG.........DL...NPAFQVALHSLTQLACFIN......
K1X7W5_MARBU/800-1037----TIERQRVP.T...F.SSIKDLN-........ENYQAK.........KI..KNSAVDSALLCITQLAHYID......
L8G6V9_PSED2/30-264----RSQQDLFP.R...F.TTLVDLV-........SKLAE..........TE..GNPVLRFTLLPVCEIGQFIR......
B6QFH1_PENMQ/10-246----PSDRRKFP.R...F.TSIVSLL-........SRYREL.........G...PNPALESALTTLYQLASFIS......
B6QER4_PENMQ/12-248----PERSK.YK.....F.DSFEEAS-........KRLA...........VDSSPDVVLRTIVLCAAQLGYLIA......
A7F3E3_SCLS1/4-241----SLQRNRIP.E...F.TTILELN-........KLYHAR.........NI..RNPAVDSALLCITQLSQYID......
N1RV88_FUSC4/8-242----SIERKSIP.E...A.ESLSLLL-........EGVRRS.........E...PHAALDSAFVCIYEIGYYID......
E9F646_METAR/19-261----AAERQSFP.A...F.SSVQNLV-........ARALKK.........DT...SVALESTLATIYHLCCFIN......
S3EB79_GLAL2/16-254----RALQTSLG.H...F.SSLQELG-........ERYRN..........STDD.LGVVRSLLLHTVRAGNLLQ......
G4UHA1_NEUT9/13-252----RTERSKLP.E...F.LNLQQLN-........ERYHGQ.........PI..KHPGIDGALLCISQLAHYID......
B6HKK0_PENCW/8-244----PSERQGFP.R...F.TSIVDLL-........ARFKES.........G...PNPALESALTTIYQLGCFIH......
E9F7M7_METAR/10-244----LHTRDTTA.K...F.SSVADLL-........MRKRDGC............LSPALEQVLCLVHTLAAFIW......
WA_EMENI/8-244----PSERSTFP.R...F.TSIGDLL-........ARHCES.........P...GNPAIESVLTCIYQLGCFIN......
V5GBX6_BYSSN/4-246----AYLRQQLP.P...F.ASLEEFI-........RCYNN..........SDPCKNAVVESTLLCVAQLADYIS......
G2QWR8_THITE/16-254----AAEARRLP.D...F.LTLKQLN-........ERYNKS.........DY..KHAAVDAALLTISQLAHFLD......
M3CY75_SPHMS/5-242----RSQRDAMP.D...F.LTLTSLV-........EAYYQK.........GE..KVPMLESALVTIAQLGHYIG......
M2RQ22_COCSN/4-241----RTQRDQIP.N...F.LTTWDLV-........EAYYAK.........GL..KIPEIESCMVTIAQLAHYIG......
B8LZ55_TALSN/27-260----LHERDFFP.Q...F.TTLVDLF-........ARHDQ..........FA..GAPALKFTLLCVTQIGQWIR......
S3D9A7_GLAL2/4-237----KHKNINFP.P...F.STMEELV-........DRYEFS.........DK..RNAVLDSTLACLAQIAHFVM......
G7XN60_ASPKW/8-244----PSQRKLFP.R...F.TSIVDLL-........SRSRES.........G...PSPVLESALTCIYQLGCFIH......
M2T1K1_COCSN/8-240----PEVRNELP.R...F.TCLEDLA-.........SWKHS.........GTGKRCIALDMAMTTLWQLGMFVL......
E9DR08_METAQ/20-259----SRQQDLFP.R...F.TTLIDLV-........SWLES..........TP..GAPVLKFFALCVYEIAQFIV......
S3CWG8_GLAL2/8-245----PLKERKAS.F...A.PTIADLL-........HKYRQG.........SL...SPAFQTALSCCYQLASFIS......
F2PW05_TRIEC/6-242----MREAQSLQ.A...F.TGILDLL-........HQCEQS.........Q...PHPALAGALTCIYQIASYIQ......
H1VJ39_COLHI/10-255----PEQQERCP.R...F.VTLADLL-........SPY............RSETLNPCFVQGLTCITQLGLFIR......
U1GE50_ENDPU/4-243----YIQSD.IP.N...F.STVQELA-........ERYYKS.........ES..PDTAIESSLVCLAQLIHFIG......
A1C888_ASPCL/9-246----PSQRSLFP.R...F.TSIADLL-........ARHRES.........G...TNPALGSALTCIHQLGCFID......
R0KB98_SETT2/8-242----IQIRDNLP.R...F.TAIDDLL-...................LMEPTSGKRCIPLEMALTCMYQLGVFIS......
E4V2N2_ARTGP/10-256----WPLKELVP.P...F.NSVLDLA-D....V...DFRQGP............LGAAMESSMLTILELGMFIG......
L8G4G9_PSED2/24-270----TELKQLIP.P...F.NTILAWA-E....N..SQLREGL............ICGAVDGVLLIVVQLATYIG......
M2ZZX0_MYCFI/5-242----RTQRVLIP.D...F.LTLNNLI-........EAYYQK.........GD..KLPALESALVTIAQLGHYIG......
Q2GV63_CHAGB/785-1022----RAIHGWDR.G...C.GSLLEMA-........EAVDS..........PGGN.NLAVSTVLLCAGRLGQLIV......
B8N7H8_ASPFN/9-246----RAMQDSLR.N...C.SSFQELP-........AKYRY..........TGDE.FGMAHAMLIYVIRAVDLLK......
Q2UA48_ASPOR/8-244----PSERKIFP.R...F.TSIVDLL-........ARHRES.........D...PNPALESALTCIYQLGCFIN......
N4VBL7_COLOR/10-255----PEQRARCP.R...F.GSMADLL-........SPY............RNRTLNPCLVQALTCVTQLGLFIR......
B2B495_PODAN/8-245----RVERSRLP.I...F.RTLQQLN-........ERYYAQ.........KL..KHPGIDGALLCISQLAHYID......
M4G4F1_MAGP6/8-245----RLERSKLP.I...F.RNLRQLN-........ERYHSH.........AT..KHSGIDSALLALSQLVDYID......
R7YU14_CONA1/7-242----VAERQWFP.A...F.TSVVDLL-........ARHREL.........G...NNPALEGALTCIHHLACFIS......
R0KD65_SETT2/13-258----PRMRDSMG.GS..F.SDLLQLA-........ERFRS..........QDDV.VGLAHAVLVGIVRAAKLVQ......
V5G4B2_BYSSN/8-244----PSQRQIFP.R...F.TSVIDLL-........ARHRES.........G...PNPALESALTCIYHFACFIN......
H1VY29_COLHI/8-245----KLERSKLP.T...F.LSLRQLN-........ERYHAQ.........GI..KHPGVDSALLCITQLAHYID......
L8GBJ0_PSED2/42-283----EEEQNLFP.R...F.TTLIDLV-........AKFGE..........TD..CASVLGFFLLSVHEVAQSIV......
B6QC69_PENMQ/7-243----SDERVRIG.H...F.GSFEDLL-........QRYSG..........TEDT.IGVIHTVVICACRLAELIL......
G3JFQ9_CORMM/16-246----SAVQNMFT.R...F.TTLIDLV-........AGFGDK.........IE..GAPVMQFCLMTVCQLAKFI.......
F9XMW3_MYCGM/5-242----RSQREVMP.D...F.LTLSNLI-........EAYYQK.........GE..KVLMLESAFLTIAQLGHYIG......
G9MXY7_HYPVG/19-259----TTERQLFP.A...F.SSIQNLV-........TRGIKK.........DK...NAALESTLATVYQICCFLN......
G0RW83_HYPJQ/19-262----TAERQSFP.A...F.CSIQNLV-........SRVLKT.........DKHTENAAVESTLATVYQLCCFFS......
C5G0R3_ARTOC/8-243----AQEKEIFP.R...F.SSIAELL-........TWRGRH.........NR..SNPPVENALTCVYQLGQFIN......
K1WM58_MARBU/4-242----PSHRRELP.A...F.SNIAELV-........ERYYKA.........DR..PNIAIESTVTCLAQLVHFIG......
G9NQM0_HYPAI/19-259----IAERQWFP.A...F.SSIKNLV-........ARGLKK.........DK...NAALDSTLTTIYQICAFIN......
A2QH36_ASPNC/29-262----LHQQEWFP.Y...F.TTLIDLL-........AQHEN..........CY..AAPALKLPLLCATELGQFIR......
STCA_EMENI/11-251----PPKEHKQA.R...T.ASLAELL-........QKYVDR.........KL...PSAFQTALSCVTQIGLFMR......
Q8EYQ4_LEPIN/19-271----..DKKIIY.GGYDF.E......-........SWVKNPDSAPD....ENYLCSAPVSIVGIFLTQIGNYIA......
C7ZNQ1_NECH7/8-238----FKVRNDLP.R...F.TCQEDLL-.........RWDE...........SGKRCIALDMAMTTLYHLGTFIS......
M2N8F6_BAUCO/8-232----GPVKAEKA.R...S.ASLADLL-........QKYTEG.........HL...SPAFQVALHSLTQLGAVIR......
G7Y059_ASPKW/7-243----PLFDD........Y.DSMDTVA-........EAYA...........QRTDYGVVMPTVLLCVAQLGGLIL......
E4V6P4_ARTGP/8-243----AQDKEFFP.R...F.SSIAELL-........TWRNSH.........SR..SNPAIENALTCIYQLGQFIH......
U1GYJ0_ENDPU/26-259----ARQQALLP.R...F.TTITDLL-........ANLGE..........TE..GKPALSFALHCLCEIGQFIR......
H6BVA1_EXODN/5-241----HPSKA.VP.N...F.STIQELV-........DRYYRG.........DA..KDAATESALVCISQFCHFIG......
E9F7X1_METAR/8-256----PSQRSCFP.H...V.SNLAELL-........IAR.Q..........SSQVPNCALDSALVCLCHIASFIALAGLEN
E3R122_COLGM/12-243----SAVREGLP.R...F.TCIEDFV-...................LLGPQNIGKCNALELALTCIYQIGTFIR......
G2WRK7_VERDV/8-245----KLDRAQLP.I...F.RTLQQLN-........ERYHAQ.........SR..KHSGVDSALLCVAQLAHYID......
G0SDA9_CHATD/19-258----KAEQSKIP.V...F.RSIQQLS-........TRYRAQ.........QQ..KHTGIDGALLCAAQIVHYLD......
B6QHV7_PENMQ/4-241----RTERVGIP.Q...F.SSLRGLV-........DEYQRR.........CP..RVASLESALTCLAQLAHFIG......
Q2UG06_ASPOR/8-245----NTVDHKLA.R...T.ADLRQMV-........QKYVDG.........KL...TPAFRTALVCLCQLGCFIR......
C5FQT2_ARTOC/8-245----REIQELLP.R...F.SGIADLL-........ASYSTD.........LD..STPVLASTLTAIYQLGSFIS......
E9D5J9_COCPS/7-242----PDVKK.YA.....F.DSYLGLE-........ERIL...........AEKVPDVVLRTLLLCFTQLGHLIM......
N1PC72_MYCP1/5-242----RSQRNTIP.D...F.LTVSNLV-........EAYYQK.........GD..KVPMLESAFVTIAQIGHYIG......
E3R0Q2_COLGM/12-250----PFLQDSLG.T...F.SSLHELG-........ERYRN..........TTDE.LGMAHCLLLHTVRASNLLL......
R8BTJ4_TOGMI/8-245----KVERVKLP.A...F.LTLQQLN-........ERYYAQ.........GN..KHPGVDGALLCIAQLAHYID......
G4MU27_MAGO7/14-251----RLERSRLP.V...F.RTLQQLN-........ERYHAQ.........IT..KHSGLDGALLCVAQLAHYID......
R7YTG2_CONA1/4-241----RSHRDSIP.D...F.LTVQHLV-........EAYYEK.........GL..KMPQLESCLVTIAQLAHFIG......
U7PRD0_SPOS1/5-267----AADRRQCPAS...F.TSPLELA-RWAASPASDSVSGGIPGGT....LLRKISPALSAALLCMAQLGHVIV......
E5A495_LEPMJ/4-241----RTQRDQIP.D...F.LTTWDLV-........EAYFAQ.........GV..KVPQLESCMVTIAQLAHFIG......
E9F8F0_METAR/70-305----SEQRSNIG.N...F.DSILRLA-........ENNAR..........LEEP.NEIIATVLMNIARLGELIL......
B8NVD5_ASPFN/5-241----ANERTSLP.D...A.HTLPLLL-........EAVRRG.........R...RHVALESALVCLCEIGQYIA......
B8MV60_TALSN/15-255----LGDYECYR.N...F.ETIVELA-........EIYSK..........QDGT.YEPIGCALWTISQFADYLS......
E9FC93_METAR/16-256----STQQQLFP.R...F.STLVDLL-........DNWECA.........P...GRPALQLFLLSVLQSAQFIH......
G9NBV5_HYPVG/10-247----KSEHGWTG.N...F.DTLLGLA-........EENEE..........QHGA.NALISTVLMCIGRLGELIV......
R1G9D8_BOTPV/4-241----RSQRDSIP.E...F.NTVSSLM-........EAYYEK.........GV..KVPQIESSFVTIAQLSHYIG......
S3CAW2_OPHP1/8-244----QLERAKLP.V...F.KTLQQLN-........ERYHSQ.........DL..KHPGLDGALLCVTQLAHYID......
B2B664_PODAN/7-242----AHYRRSFP.N...F.TSLSELA-........AAVS...........KQDHPSPALYAALLCIAQIGDVII......
M1WG96_CLAP2/23-272----TDLGRLIP.T...F.ETVLQWS-E....DANASLREGL............LCGAIDGVLLVVLQLASYIC......
E9F5C9_METAR/8-246----PDVRAVYH.....F.ASWIELE-........KTIA...........SQEVPDVVLRTTALCFAQLGHFIR......
I1RF58_GIBZE/4-241----AVQQKLFP.N...F.ADIQELV-........S...KS.........DWGSGNPALTSALACFYHLCSFIH......
G2YLD0_BOTF4/4-242----STARQHVA.V...F.SSVSEFT-........ERYFEA.........DH..PDLAVESAITCLAQLTHFIG......
B2W1Q0_PYRTR/9-246----RVLQESCK.G...C.SSLQELA-........ERYRH..........TGDE.FGMAHAMLIYAVRAVVLLE......
C7Z6X3_NECH7/7-240----TQQQSLFP.R...F.TTLIDLV-........SKLGE..........TE..GTPVLRFCLLPVCQIGQFIN......
E3QS53_COLGM/10-256----SAQQSRCP.R...F.AKIVDLL-........SQS............RAGALNPCISQALTCISQLGLFIR......
G9NGU8_HYPAI/9-247----TKEKQPYL.R...F.ESILELA-........EIFAE..........QNTP.FEAVSTILFFIAQFGDLLF......
B8MYS6_ASPFN/10-247----FSQRQRFI.R...F.TTFEELL-........ARVQRS.........TC..PHPALEKALACTYQLACFIR......
G2RCG6_THITE/8-247----TSEQAKFV.G...F.TTFQELL-........AGVQQV.........SS..RHPALEKALACTYQLACFIK......
S0DTP6_GIBF5/8-239----YSIRKDLP.R...F.TCQEDLL-.........LWDQ...........SGPRCVALDMAMTTLYQLGTFIS......
G2QMK9_THIHA/8-254----YSQRTQFP.S...S.STLTELL-........NAHCS..........SSTTPSCALDSALACLHQIAAFVS......
F0XGQ5_GROCL/8-244----RIERAKLP.V...F.KTIQQLN-........EKYHSQ.........DI..KHPGLDGALLCITQLAHYID......
T0KJR9_COLGC/11-253----PKIRDSLG.PSGIF.SSVQEVA-........DLYRD..........HDDD.VGFVQCIMSYIVRAVILLR......
M2RHZ9_COCSN/9-246----PAERDTIG.P...F.HSLQGLT-........NALK...........EKSDRHGIAQMVSVFIARIGELIL......
R0JX83_SETT2/4-242----PDVRHHIP.P...F.NSVFDLS-........ERYA...........ACEVQRLEVSSALLCIAQLAQYIG......
L8G0G7_PSED2/41-278----SLERRHIP.P...F.TTIEELS-........QRYHTR.........DV..THSAIDSALLVTTQLAHYID......
Q2HGW2_CHAGB/17-254----ALERATLP.N...F.RTLRQLN-........EQYHST.........EQ..KHSGIDAALLTISQIAHYLD......
B8MF01_TALSN/8-245----LAQRSVFP.S...F.TTLPELL-........AKLQSD.........SV..PHPALETALVCVLQFASFIK......
N4VM62_COLOR/16-257----AKLREALG.GP..F.TDLLQLA-........DRFRT..........KEDS.FGLAHALFVGIVRAAKLLQ......
S3DAZ0_GLAL2/11-247----NLERNKIP.R...F.SSLEDLN-........ERYHIS.........GI..KHSGIESALLCATQIAHYLD......
E3SAD1_PYRTT/8-240----PEVRKDLP.R...F.TCLEDLA-.........SWKDG.........GSGKQCLALDMAMTTLWQLGRYIL......
U7PK37_SPOS1/8-244----RLERAKLP.L...F.RTLQQLN-........ERYHAQ.........DL..KHPAVDGALLCITQLVHYID......
B2B6C8_PODAN/41-279----PPQEHKLS.R...T.ANLAEML-........QKYADG.........KL...NPAFQTALSCISQLGSFMQ......
V5G236_BYSSN/6-248----RQDREGLP.S...FASDLYEL.-.........CRNDK.........KP..ENPILSPVMLVIVQLGQFIA......
M2NM35_BAUCO/5-243----RSQRDVIP.D...F.LTLNDLV-........EAYYQK.........GS..KVPMLESTFVTIAQIGHYIG......
B6QAB8_PENMQ/31-263----LHEQDLFP.Q...F.TTLVDLF-........ARHEQ..........FA..GSPALKFTLLCVTQIAQFIK......
M2XHZ5_MYCP1/10-247----PPAEHKAA.R...T.FDLADML-........KKYVAG.........KL...NPAFQTALSCITQLGVFMR......
R7YHB3_CONA1/8-244----RTARD.LP.G...F.TSVENLL-........WRYSES.........GV..RHPAIESALACIYQIASLLR......

PF01735

PLB2_SCHPO/134-617ADYPYPIIISDSRL....EEEKAIPANTSIFEFTPYEFGTWDNGIKAFLPMEYVGTHLKNGVPP.DHK---------CIR
PLB5_SCHPO/125-607GEFPFPIIIADNVI....EGETVIPLNDTVFEFTPIEFGTWDTGVESFIPMEYTGTHLINGIPL.NES---------CVR
PLB1_YEAST/99-586GEMPFPITVADGRY....PGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQ---------CIA
PA24A_CHICK/190-675AQCALPLFTCLHVK....PDVSELMF.ADWVEFSPYEIG..MAKYGTFMSPDLFGSKFFMGTVVKKYS---------ENP
PLB_NEUCR/121-606AETPFPILVADGRA....PGDTIISLNATNYEFNPFETGSWDPTVYGFAPTKYLGANFSNGVIPSGGK---------CVE
PLB_KLULA/102-589GEMPFPISVAVGRY....PGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGTNVTNGTPNVTGK---------CVA
PLB6_SCHPO/114-600AEYPYPLIVTQGLTGGLPDGSNGTATNSSIYEISPYYLTSFDNNVRSYTPTQYLGTNYSNGTAV.DGK---------CVT
PA24A_DANRE/185-664GQSPLPLFTCLHVK....PDVSELMF.ADWVEFSPYEIG..MAKYGTFMSPGLFGSKFFMGSVVKQYE---------ENP
PLB1_CANAL/88-565HQMPFPILISDGRA....PDTTIINLNSTVIELTPYEFGSWDPSLNEFVDTRYLGTKLDNGRPT..GK---------CYN
PLB3_YEAST/105-592AEMPFPISVADGRY....PGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGK---------CTA
PLB1_SCHPO/114-593ANFPYPIITFATQN....YGEDISNVNTTFFEASPNVFGTFDHGINSFIPTEYLGTTLNNGASS.NGS---------CVI
PLB2_YEAST/101-588GEMPLPITVADGRY....PGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQ---------CVS
B6HB59_PENCW/114-597GDYPMPFVVADGRN....PGELVIGSNSTVYEFNPWEFGTFDPTIFGFVPLEYLGSKFEGGSLPSNES---------CIR
G8ZY27_TORDC/97-584GEMPFPISVADGRY....PGTQIIDLNATVFEFNPFEMGSWDPTLNAFTDVKYLGTKVSNGEPVNKGQ---------CVA
Q59W34_CANAL/88-564NEMPYPILAALGRE....PNTVLMNFNSTVFELTPYEVGSWDPSLRSFVDTKYIGTRLDDGAPV.SKR---------CVN

PF01734

Q9N5Z7_CAEEL/97-269..............----..................................KTLGAMSPGFVISDRL---------R..
G7QJN7_LEPII/12-165..............----.....................LVTNFVKPIRKGLKNYSGILSGKNVKELL---------K..
B8GC44_CHLAD/8-228..............----........................HHLYQLNLADLVRRGLQLPGAVVQAL---------R..
C1DSE3_AZOVD/14-206..............----.......................LLNAGANIRSGHPATGLKLMLYWAQML---------S..
A9BEP0_PETMO/3-174.............T----E.................LYNSRYAQTTALIRLGRGKMSLYNPDNLKKFL---------E..
A9B328_HERA2/4-179..............----......................PGGSLRSAWRVVRGRGSLHHNHGLRRFI---------L..
B2U808_RALPJ/9-214..............----.............................WGNLLRGERVFPHYGMYRTAL---------L..
Q3AAC7_CARHZ/6-206............VG----I.F..............IISYNLLKLFGYQNNKLKLPLGIFRPIGLQRKI---------V..
A6CHF0_9BACI/8-175..............----................................NYIRNRELFGMDFVFDEI---------P..
Q2GUC2_CHAGB/19-224..............----....................GRPVGGQVGRVLRGMTSSPFYDIADLQQSI---------R..
Q9XAG3_STRCO/16-207..............----.........................TFGMTVRYLWAALGSRDPETVVRRL---------G..
A0A022N4I9_9ACTO/11-221.......PRMRMGS----P.RLL...........TASARHPRRSSPMVTLAAMLPQGRGKISAVGDLV---------T..
Q8R6F6_FUSNN/65-256..........LSLE----K.KE.............SLKKYSVHLSFDNELNFSFPKGLRGTGEAYLLL---------K..
D5AXK0_RICPP/15-214..............----H.................NIFPEGLTFRKLWSCNGLFSYKFSPDPLVKLL---------K..
Q038G8_LACC3/6-159..............----....................................NGPIFLRRHFVPVL---------D..
A5IE43_LEGPC/25-249.......PGVSAIT----R.DGK...........PLEDFIRENIISSVKTNIASIEKIETIAASDQTL---------Q..
Q4UJC7_RICFE/42-240..............----....................APKIFEHHWYDGIKQIFTHKHSQGPLKEIL---------E..
Q54HM9_DICDI/140-357..............----...........................KGTVKNFLVGATLANSDKKEQEL---------I..
Q2K9E1_RHIEC/30-248..............----......................LAFSQIFADGPSFLKGAFNPFSSAAEEV---------A..
A4IAC8_LEIIN/190-378..............----...................GTPTADSRWKRFHRLLHTGEVCDPVALADFL---------Q..
Q21S96_ALBFT/26-231..............----.............................LRNLLREQPIFPHGDIYRDAI---------L..
A5GF97_GEOUR/15-187..............----..............................IKSVFTGKGIYEGKALESWV---------D..
Q1CW69_MYXXD/353-514..............----...............................LTLAATAAIVTTYSLERFV---------E..
A6NV66_9FIRM/7-176..............----.............................NLLRPGNHRCYFGLQFTYDTI---------P..
A0A038KND4_MYCTX/181-420.......RHGLAGM----F.TL............RFDQFAHTLLSRADGERMRMSDLAIPFDVVVAGV---------R..
A0YM74_LYNSP/12-230.......YHLISYA----A.QTF...........IPTFREWMLDFLVESGILKDRTAIYDPTPIESLV---------R..
Q5X5T5_LEGPA/27-309...PQAGSSVDYSS----I.SHEQ.........KGSQLDTESSLAEAKLVTKPSKLTFAIASKGAKLV---------EAM
Q2GS92_CHAGB/73-327..........VVSS----I.DF.............PLIYRRSTWPTKRTSSFFDTFAKFTVTATGRTL---------P..
Q1ZT25_PHOAS/33-203..............----..........................KYLSKQQPMNLDWALQVVSPSGEL---------A..
Q5CY77_CRYPI/46-241............CK----T.P...............LKKNYARWAVSFLKGWISSRNPFRYLCDNSPA---------R..
A0A039K3R0_MYCBI/806-965..............----.................................TLPSKGLIRGKRTQSTL---------R..
PATA2_SOLTU/32-227..............----..........................HIFNSSTGQFFGPKYDGKYLMQVL---------Q..
A6G7S9_9DELT/458-735WGGVAKLFMGLLNP----V.SMFSDDV...TAVATTLLTAEANGLDDHLRRVLNLATMTHGMHCMEPL---------R..
C6TYS0_BURPE/13-264..............----..........................LLRPPLGKNPGSLLKGDEYFLPGI---------R..
A4F8K0_SACEN/17-281..............----...................ARQVPKLWDARPPSLLEGDGYFRTELARTIS---------E..
Q2R2X0_ORYSJ/139-303..............----......................................AFRLGAVLKDVL---------D..
Q0A7T0_ALKEH/6-219...........WRH----N.L..............TTGLHWMAAMALGGLGGHNPRSLLDNEPLAELL---------R..
A0A031KR74_ENTFC/138-323..............----M.................AAVEDLRERFYRERRQMTKTALIEGGVSSAPL---------E..
M6BTQ1_LEPBO/13-188..............----........................GRKLISPFHPFQGKTFLDQEYLVDDL---------F..
E3VZB4_MIMIV/38-270..............----........................YYAPFTLYRFLTKGHLYDDTNRQTLV---------K..
Q0FZD9_9RHIZ/20-226..............----............................TTLNEIQEDGLTPHQRIYREVV---------T..
Q5A7P0_CANAL/211-417............CD----T.S...............QIQGSFKKVLYYLGHWIQYGTIFDIEGLQDTM---------I..
Q11UC9_CYTH3/381-624..........VNDL----F.FR.............FQKFTDGNHEYYKDRGYAFEQKLHENTNYVLYK---------R..
A6ASA3_VIBCY/5-186..............----..............................WYHNYLYSSRYTNDGLKEAI---------N..
Q1D826_MYXXD/142-382.............F----I.S...............TESRYGLPAALRLFLRAGLGRFFSAGPENSGM---------R..
A0AZM8_BURCH/61-294..............----L.................AENLKFDMAEQLANPEFLGGYIFGHTNRTDAF---------F..
Q5CE49_CRYHO/149-342..............----.....................HDCKKTLSKNAPLFIFRAITEGKKLPNYL---------CST
A4HB10_LEIBR/40-220..............----..........................FHWFRLGKYLMAAIDDFGASLRAI---------DTD
I0WT11_9NOCA/7-221.............T----G.S...............LTRGGLRYLGQLAGLPMRLPSLFDTTRMRETI---------G..
A3QTZ2_9VIRU/28-255..............----G.................LFDEMPEKASTYMWITSILKTFNLISKTQTLL---------D..
Q1D5W1_MYXXD/154-432..............----..................DQLDLGRLLPEERNEPPQGTHLFSEPHMQDTL---------Q..
Q09D74_STIAD/17-214.............N----E.R...............MTRQFKVKAINILRLISGLVPMYDGKAIREIL---------E..
A4BNM2_9GAMM/38-218..............----...................HVAILRSLLLRPFGRFLPDGLIQGRRLALLI---------D..
Q4LA62_STAHJ/11-202..............----.......................DMSGIFERYAQIQEHSKSPKEWIENYS---------V..
Q5ZPA4_9DELT/22-208..............----.........................PLSNQLGALVGQSALMPSENMARAL---------T..
D3MBX2_PROAA/25-319SLPFHRGPEQTKVP----DPAEPVAGRDDDRLTGQARTLEIATRDDPITGGSWTPGVILQLLSALSRL---------SRD
NTE1_PICST/1239-1403..............----............................SVFDLTYPVTSYITGYEFNRGI---------W..
A4SJS7_AERS4/8-174..............----..........................RFVRGGHWLDLDWLWEITIRECRL---------D..
Q1I961_PSEE4/42-302........QDFIES----W.LG............GAGKFKLAFKAAQVIDNLQNDLGLNPGTAFSVWL---------E..
A7RB12_PBCVA/19-192..............----................................NFVNTFGLDTGVHLSRWI---------D..
Q0VPN6_ALCBS/36-193..............----...................................PGLGLLSGQSFRTML---------A..
A6G1N7_9DELT/36-362........GAELPA----G.SM............ASVITSSLRDALFEAIREGGEQNIWNRAVAKIYL---------EPF
A6QA07_SULNB/41-281..............----...................VHLGLEDLIIEGADPDNHSTLFTRKPLVKKA---------Q..
Q5WWS2_LEGPL/304-496..............----..................................IDRNGLSDTHSLKTAL---------D..
A0Z6H0_9GAMM/8-199..............----.....................GSQIFGKNLWRQFRSALGIFDESYSASPL---------E..
A6LMU7_THEM4/5-176..............----.....................IYTEKLEKSNLWSIFQRALVPIDEYYKFF---------K..
A7I0A5_CAMHC/6-211....NFGHFSKIPN----F.KKDF.........DFCAPQKFFYQLANAALPNFINEGFFKRENLANFL---------R..
C7LH54_BRUMC/13-187..............----.....................RMWQTRPAHWAELFKGGLRVSQFNIEKVL---------D..
A6G3Y0_9DELT/12-216..............----.............................RRVFSRRDRAFPHDGIYRGTI---------A..
A1DP95_NEOFI/20-225..............----Q.................RSLHLRHGKSEPQRSLHLGHAKFDPQRCASEL---------R..
A5K2I7_PLAVS/1168-1482..............----.........................MYAVRNTRYLFKHSYYDANILSNIL---------NSF
TEG_BACME/7-180..............----...................GGPVFNQQVPYSGLIKAIRTFFPRDLRLRDL---------K..
Q2W5X1_MAGSA/6-225............YK----V.F..............MKGSKVAEAYRWLISKLPGYNRIMNQFSMTKRQ---------KFW
A4U0C8_9PROT/5-257...........AIQ----E.A..............WMDILRFAGDPSQWTQANFNSLILNQVLAVNPL---------S..
A5N2W9_CLOK5/4-191...........QKF----M.N..............RNIDKETLIYILSAMKNIIENRGIDTKKMREIL---------N..
A4JJZ7_BURVG/8-242...SAGAVLAPTRA----L.GRVL.........KAARVAAAMLDVTLPKSLDMLANGLASDKPLKALM---------D..
A6R0J1_AJECN/673-891.............A----L.................LVRKSFAGRLYGWLTWWLYDGLYDSAVLESLL---------K..
A0A024F582_BDEBC/72-224..............----................................LLGGVNKNNEVTVLKDFV---------G..
A5P920_9SPHN/106-312..............----...................EDEGEVVDNKGMFQMLLRGAQAGTAPLRKRI---------R..
Q2C291_9GAMM/11-214.....MKNWADAQQ----A.IWQ..........GQPGFFKPKLWPSEFETYKTSELSYYDTSPLKETL---------N..
A1VHY7_DESVV/116-308..............----........................RWLGGDLQRLVRDFGWFKGEVLERWA---------R..
A7BB55_9ACTO/26-199..............----...............................KHFRKGHGYFNAEYIYERI---------CY.
A5I1W5_CLOBH/6-200..............----....................AIKKFPLAKKSLGLILEKGIFSTVYIEKYL---------E..
A8GLS3_RICAH/7-147..............----............................DQVYNLVFYGWLNSEKYLEEFL---------G..
A4T0K7_POLSQ/80-285............TP----N.I...............SQMRADQINMSATDGSIETRKIIGAAALAADN---------K..
A6DDL8_9PROT/5-162..............----...................................LKTGLFKIDLNSTIL---------D..
A4CKZ2_ROBBH/4-195............SH----K.Y..............GVDSIGINHWNVLRNFMRGSKTFGESHNLLKLI---------R..
A0A031WAB0_PEPDI/5-179..............----..................................IVNNTVDNSPAIDNLR---------E..
A0A014PKG8_YERPE/86-275..............----...........................NNLLFRLFFRESLADTSPLSQLI---------D..
M6C3B5_LEPBO/36-250......VFPHEEMY----R.KTI...........RFGMDFQKIVKSEIKVFIHTLKAIPKEDSLRNKF---------R..
Q12EZ0_POLSJ/6-228..............----..................QTDLQKAAMLAMLRPANWRFALSRANVLASAI---------GST
Q1GX66_SPHAL/43-328........LSRMTK----F.WA............VPIAGWAMKRRGNSIDRTVGEAAQDEVRAKLSRF---------VRA
Q4RS54_TETNG/14-183..............----.....................................GPMHPSFNLVKIV---------R..
Q5C8M6_LEGPN/32-295MMQMKKHLESVQQP----I.PPEQQ......MNYGILKQKIALYEDKLSRAGIVINNVDDIINLTKSV---------KDL
Q6JBI3_DICVI/201-395..............----.......................SQNRLSGVSGVVLNHSYYDTKKWVKML---------K..
Q0FKF7_PELBH/6-360LGWLFFGALFGLVL----T.VGLIAL.....DLRRLVVRDLPANRFGLLPGTTQPGG..EGPGLTDWL---------ADK
N0BV45_SALTI/8-168..............----...............................DVSWGRGGLLRGKRVFNHY---------R..
Q6ASS6_ORYSJ/60-258..............----.........................RDWAGRRGRWARLFRGGARGAERSF---------R..
A6QX75_AJECN/242-440........GWNILS----L.LA............RDNGYGRLPSLIRRTEEYIRESYFPDLKLLEEYV---------K..
Q74A07_GEOSL/58-306..............----..........................LVRRLFNPYNWWRLASPDFSRIDM---------AEE
Q54XY1_DICDI/13-231..............----...........................WDEVKGVFTRGEMFNSDELINIA---------NSW
Q55G69_DICDI/65-250..............----...........................MGIMYNVYEESTLCSTKELISTL---------E..
Q5Z158_NOCFA/22-193..............----................................RLLRGGAAFDVRYLVHRV---------Y..
Q54QX6_DICDI/893-1088..............----............................FNFITYPLIKPKYRRDKLRESF---------K..
A1UXE2_BURMS/413-612......WLSSYVLS----F.GVP...........NFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLI---------A..
A2QZY6_ASPNC/473-679..............----H.................PPLRTTWNKLIRTILCWWKDGWYDAGLWDGLL---------Q..
A4XTW9_PSEMY/15-385HGGNPLLWLWLLGC----A.GIGALTAI.GWRMLRQISREMPANGFALCSGMPGPDDQAPDEVLTPWL---------T..
Q0E508_SFAVA/27-224..........LKLS----I.T..............PMVRSNRVTIGASVMTLFNMLALFGVAKFIEEF---------E..
A6GI17_9DELT/71-215..............----............................PALHHLRDASRYLSSGSLLESL---------R..
A7IE20_XANP2/6-198..............----..........................PWSIAGTVLGNNAAMTTGRIKTFC---------D..
Q1DCU7_MYXXD/197-406..............----...................SDLYCVNNTWIWKIASNLRGLVQFDGIYGKL---------R..
Q6MAN6_PARUW/474-738EVGLIQKKGVSNSK----F.KIAFNL.....IFNWVDWWGIPCDQKKILKERYASGGLCKGEYLRELI---------E..
Q4Z1R8_PLABA/352-558..............----.....................NIISGIFFEGYDINNVKELFMEHIGNKFL---------ASC
A4RTL4_OSTLU/164-398......KEAHIDLV----R.PFV...........RFGRRSRNALAARNGASTIETATMADVGTLAETL---------SDD
A0JUC4_ARTS2/74-249..............----............................PLGDYVKGPWSLPAIGDAGGLL---------G..

PF00698

FAS_HUMAN/493-810-------AHLPPGA------MAAVGL....SWEECKQR.CPPGVVPACHNSKDTVTISGPQAPVFEFVEQLRKEGVFAKE
STCK_EMENI/1547-1902-------NT.LPRN------ANGRTD..................YGMVAADPSRIRSDFTEDRLIELVRLVSQAT..GVL
FAS_CHICK/492-809-------AKLPPGG------MAAVGL....TWEECKQR.CPPNVVPACHNSEDTVTVSGPLDSVSEFVTKLKKDGVFAKE
FAS1_YEAST/1663-2037-------VA.VPRD------ELGRSN..................YGMIAINPGRVAASFSQEALQYVVERVGKRT..GWL
A4F7N8_SACEN/109-425-------LV.GNGD------MAAVALS..ADEIEPRIARWDDDVVLAGVNGPRSVLLTGSPEPVARRVQELSAEG.VRAQ
A4F7P0_SACEN/560-880-------LS.GEGG------MAAVALG..EAAVRERLRPWQDRLSVAAVNGPRSVVVSGEPGALRAFSEDCAAEG.IRVR
I6Y231_MYCTU/534-851-------IA.GAGA------MGSVELPAKQVNSELMAR.GIDDVVVSVVASPQSTVIGGTSDTVRDLIARWEQRD.VMAR
PPSA_MYCTU/632-950-------LS.GQGG------MALLEL...DAPTTEALIADFPQVTLGIYNSPRQTVIAGPTEQIDELIARVRAQN.RFAS

PF16073

B8MGX9_TALSN/8-250.......W...YEE......HPERRY..PES.........DSTLIAGICVGQISATAISLAKSLTELL---------PLA
B6HLN4_PENCW/17-255.......W............A.....KQEPSLLGPN.AR..SEWL.GISGGLISLSALAVAEDFDTLV---------DAC
E9D6Y9_COCPS/8-245.......H...Y.E......EPGRPY..PSP.........GRKYVVGLCTGALAAAAISSSSSLSELL---------PAA
K1X7W5_MARBU/800-1037.......R...T.E......KVPEDITNPT...........ETVLVGLCTGLFAAAAISSSQSLSTLI---------PIA
L8G6V9_PSED2/30-264.......Y...F.G......EGSRLY..PSA.........TDSYCLGLCAGGFAAAAVSTSHTLAELI---------PAG
B6QFH1_PENMQ/10-246.......Y...Y.G......DGGQVY..PVG.........SQSHVIGLCTGLLASAAIASSRTIGELV---------PLA
B6QER4_PENMQ/12-248.........................ILEKDPELREVWA.AQKTLIVASCAGQLPAAIAACSHTIDELV---------DLA
A7F3E3_SCLS1/4-241.......R...Y.E......KEHGDSTSPS...........ETCLVGLCTGLFAAAAIASSPSISQLI---------PIA
N1RV88_FUSC4/8-242.......Y............LARSDKQHPSA.........SPSFLLGICTGSIAAAAVSCAKDVFEIS---------KLG
E9F646_METAR/19-261.......Y...F.G......DGQEAY..PTG.........PTTHVSGLCIGALAAAAVSSSKSLAELV---------QAG
S3EB79_GLAL2/16-254.......W............V.....KREPHLIDPT.SH..TEWL.GISGGLLTLSALAIAGDFDALY---------EAC
G4UHA1_NEUT9/13-252.......H...I.E......SNHDDLARPE...........NTCLVGLCSGLFAATAIACTKSLSELV---------PLA
B6HKK0_PENCW/8-244.......Y...Y.G......DLGHAY..PSG.........DESCIIGLCTGQLASAAVSSSRTIGELI---------PAG
E9F7M7_METAR/10-244.......Q............HSERKLSFPTP.........QDSVLLGFCTGSLAAAAVSSSQDLVSFI---------PAA
WA_EMENI/8-244.......Y...Y.G......DLGHTF..PSH.........SQSQLVGLCTGLLSCAAVSCASNIGELL---------KPA
V5GBX6_BYSSN/4-246...........L.T......ENVRDF..PDR..........ERIILGLSPGLIAGATASVLPPGSAGI---------PFA
G2QWR8_THITE/16-254.......H...V.E......KHSEDIPHPE...........HTVAVGLCSGLWAGAAISVTPSLPDLV---------PVG
M3CY75_SPHMS/5-242.......Y...F.S......EHPDEL..PAT.........SNTRVLGLCTGLLAAAAVVSARTIDELV---------LLG
M2RQ22_COCSN/4-241.......Y...F.A......ENPTEL..PNP.........SNTRVVGLCTGLLAGSVVASARSLSELL---------PLA
B8LZ55_TALSN/27-260.......Y...Y.G......KGPKVY..PSP.........TSTYLAGACTGSFAVAAISTSRSIGELL---------SPA
S3D9A7_GLAL2/4-237.......F...L.ERRQVKKEHQPEF.................RVVGVCTGLLAAAAAASCESLETFI---------PLA
G7XN60_ASPKW/8-244.......F...Y.G......DLGHDY..PTP.........SNSHLVGLCTGVLSCTAVSCARNVGELI---------PVA
M2T1K1_COCSN/8-240....................QAEACYIAPKC...........SVVVGLCTGTFAAAAVSCSKNTTELI---------PLA
E9DR08_METAQ/20-259.......K...Y.G......SNSKSY..PSS.........TGTCIIGPCTGGFAAAAISCSQTLSDLI---------PVA
S3CWG8_GLAL2/8-245.......H...F.G......EIGRSY..PQP.........HDTYIIGLCTGALAAAAIGSCSTLSELL---------PAA
F2PW05_TRIEC/6-242.......F...VYD......DGGKYPSIPAA...........GQVIGLCTGLLAAAAVAVSHSLDDLI---------EPA
H1VJ39_COLHI/10-255.......Q...H.S......SGCQVY..PTP.........ENSLLAGACTGALAAAAVSCAHSAPGLL---------QPA
U1GE50_ENDPU/4-243.......C...F.E......EQPRTYI.PSS......FSRPDAKIVGLCTGLIAASAVASADSLTALV---------PLA
A1C888_ASPCL/9-246.......Y...H.G......DRGHPY..PSA.........EDSLLLGSCTGLLSCAAVSSCRNVGELL---------PLA
R0KB98_SETT2/8-242....................QEESDY..PSS.........DNSRFLGLCTGTLAAAAVSCSRSTLDLI---------PLG
E4V2N2_ARTGP/10-256......................HYQ.AEDVEWDL....IPERTLLAGLSIGILAAAAVALSSSLADVS---------KNG
L8G4G9_PSED2/24-270......................YVE.SRSGDL.F....DFSTTSLAGLGTGLLASSAVSLSKTLADLP---------LAG
M2ZZX0_MYCFI/5-242.......Y...F.S......EHPSEL..PAA.........SNTRVLGLCTGLLAAAAVVSSKTIDELV---------GLG
Q2GV63_CHAGB/785-1022.......H............A.....DADPTILGSPTN...PVDIIGFCGGLLPAAVALAAHDTSQLF---------ALG
B8N7H8_ASPFN/9-246.......A............I.....DREPQLLDPNRPR..PEVI.GIPGGLSSAAVVPTSTNLKSLY---------DAC
Q2UA48_ASPOR/8-244.......Y...Y.G......DLGNVY..PSA.........SDCHIVGLCAGLLSSAAVSCSNNVGELL---------PAA
N4VBL7_COLOR/10-255.......Q...H.S......SGNHVY..PVQ.........DSSCLAGVCTGALAAAAVSCSHSAPSLL---------SAG
B2B495_PODAN/8-245.......H...A.E......KNFEDVTRHD...........STHLVGLCSGLFAASAIASTPSLSALV---------PVA
M4G4F1_MAGP6/8-245.......H...A.E......KHYEDVTQHE...........NTHLVGLCSGLFAASAIACTTSVSSLV---------PLA
R7YU14_CONA1/7-242.......H...F.G......EGSRIY..PAP.........VDSIAAGACIGLLAAAAISSAQTVIDLL---------PPA
R0KD65_SETT2/13-258.......F............VLTHLINAYPRLLT.ANSL..PTYLVGACGGLLAASAMMVANNLPSLY---------QSS
V5G4B2_BYSSN/8-244.......H...Y.G......DGGHTY..PSA.........SESHILGLCTGLLASAAIGSSRTVGELI---------PAA
H1VY29_COLHI/8-245.......R...A.E......KEPQDAAPHD...........HTFFMGLCTGLFAAAAIASTPSVSTLI---------PIA
L8GBJ0_PSED2/42-283.......Y...F.T......EGSKPY..PPP.........PGTYVIGPCTGGFAAAAISCSQSLSDLV---------SNG
B6QC69_PENMQ/7-243.......L............V.....ENDPSLLGSSSKV....TALGLCTGLLPAAALAGSQNITELI---------AIG
G3JFQ9_CORMM/16-246.......H...F.A......TG.RPF..PSP.........ENSYLLGICTGSFAASAICVSQSIPEVV---------VAG
F9XMW3_MYCGM/5-242.......Y...F.S......ENPSEL..PAV.........SDTRVLGLCTGLLAASAVVSAKTVEELA---------IVG
G9MXY7_HYPVG/19-259.......Y...F.G......DGQQAY..PTG.........PNNYVSGLCIGALAAAAVSSSNSLSELV---------QAG
G0RW83_HYPJQ/19-262.......H...F.G......NGQETY..PTG.........PDTHVSGLCIGALAAAAVSSSRSLGELV---------EAG
C5G0R3_ARTOC/8-243.......Q...H.E......GIGQTYFSP...........LETCVSGFCTGALSAAAVSCCRTPSELI---------PMA
K1WM58_MARBU/4-242.......Y...Y.E......QYPLEY..PRS.........ASSQILGICTGLLSASVAASSNSLSSFV---------PLA
G9NQM0_HYPAI/19-259.......Y...F.G......DCDEIY..PSN.........LNNYVSGLCIGTLAAAAVGSSKSLGELV---------QAG
A2QH36_ASPNC/29-262.......H...Y.G......QAGRTY..PAP.........ESTFLIGACTGAFAAAAVATSLTLAELV---------PAA
STCA_EMENI/11-251.......Q...F.D......DPRVLY..PHA.........NDSYVLGVCTGSLAAAAISCSTSLSELL---------PIA
Q8EYQ4_LEPIN/19-271...........................FTNKGFPVSELISNSIGATGHSQGVISSALIALGKEGSDFY---------SAF
C7ZNQ1_NECH7/8-238....................QAGISSYDAQS...........SRVVGLCTGAFAAAAISCSSFTADLI---------PMA
M2N8F6_BAUCO/8-232.......HVLFY.D......EPGRLY..PTQ.........GSTYLVGLCTGALAAAAIASSGSLSELL---------PAA
G7Y059_ASPKW/7-243.........................HLEENPTL..LWGETSKLHIVGLCTGLFPAALAATVPSPAELL---------PLS
E4V6P4_ARTGP/8-243.......Q...Y.E......GIGQAYLTP...........QETCVSGICTGALSAAAVSCCRTTSEIV---------PIA
U1GYJ0_ENDPU/26-259.......Y...F.G......EGSRPY..PSD.........ANTYLVALCTGSFAAAAISTSRTLSELI---------PAG
H6BVA1_EXODN/5-241.......A...F.E......ERRPSYIQPNS..........DARLVGLCTGLIAATAVAASDSLTALI---------PLA
E9F7X1_METAR/8-256STNTRARY...T.N......ESGRCY..PRP.........SSSCLLGSCIGLLAAVAVSCAENVLDLV---------EAA
E3R122_COLGM/12-243...............................RNDLGSYNDGECRVIGLCTGALSAAAVSCSTSPLDLI---------CTG
G2WRK7_VERDV/8-245.......R...A.E......KEPQDVVAHE...........DTYILGLCTGLFAAAAVASTGSVSTLI---------PLA
G0SDA9_CHATD/19-258.......H...V.E......RNFEDVPKPDG..........QSLLAAICSGLFAAWAISVAPSLPAVV---------PIG
B6QHV7_PENMQ/4-241.......L...A.E......ENPQYYIK............KGSHIVGVCIGLLSASAIACSHSLVHLI---------PLA
Q2UG06_ASPOR/8-245.......E...Y.E......ESGNMY..PQP.........SDSYVLGFCMGSLAAVAVSCSRSLSELL---------PIA
C5FQT2_ARTOC/8-245.......Y...Y.G......DGSRPY..PTG.........QSHTLIGLCTGQLAACAVASASTAGELV---------SLA
E9D5J9_COCPS/7-242.........................RLEKDDRVRALWS.KQKLLIVASCAGQIPAALAAATQSLDELA---------DAA
N1PC72_MYCP1/5-242.......Y...F.S......EHQSEL..PPA.........TNTRVLGLCTGLLAATAIVSAKTVEELV---------TLG
E3R0Q2_COLGM/12-250.......W............A.....RRDASILSNN.GN..TEWL.GISGGLISMSAWAVSEDFDTLR---------AAL
R8BTJ4_TOGMI/8-245.......H...A.E......RHYEDVTKHD...........HTFLVGLCSGLFAAAAITSTPSLSALV---------PVA
G4MU27_MAGO7/14-251.......H...A.E......KNHEDVTQHD...........KTYLVGLCSGLFAASAIASTPSLSSLV---------PVA
R7YTG2_CONA1/4-241.......Y...F.E......EHPFEL..PNP.........SNTRILGLCTGLLAASAVASARSLADLL---------PLA
U7PRD0_SPOS1/5-267...............................DLENNPSRLADTVILGTCTGLLAAVAVACSDNLADVL---------AIA
E5A495_LEPMJ/4-241.......Y...Y.G......ENPTEL..PSP.........ANTRVVGLCTGLLAASVVASARSLSELL---------PLS
E9F8F0_METAR/70-305.......Y............A.....EQDPTVLASKGN...RNCILGFCTGEVAAAVAAVAQDTNELV---------ELG
B8NVD5_ASPFN/5-241.......L............LQTTDLCHPPT.........G.SILVGFCTGSLAAAAVSCARTSIDLL---------TLG
B8MV60_TALSN/15-255.......R............S.....ETDPSILTLSDSAAQPTYVVGVCGGLLLGAAAATARDINELL---------DIG
E9FC93_METAR/16-256.......H...YGG......NAATEY..PSA.........ADACIISSCAGNFTAAAASCSSSVTSFV---------PLA
G9NBV5_HYPVG/10-247.......Y............A.....ERDPTILGTSER...PVEILGFCTGLLPATAVVAAKDTSELH---------TLA
R1G9D8_BOTPV/4-241.......Y...F.S......ENPTEL..PSQ.........ANTRALGLCTGLLAASAVASAKTLSDLL---------PLG
S3CAW2_OPHP1/8-244.......H...A.E......RNWEDITKHD...........HTFLVGLCSGMFAASAIASTPSLSALV---------PVA
B2B664_PODAN/7-242...........................YLENNPGLLDASKDRLAIVGLCTGLLPAAVVSCSRNLTEVI---------ALA
M1WG96_CLAP2/23-272......................YHEILTYDKE......ECVHIALTGLGIGLLSSTAVSLAPTPSHLP---------LAG
E9F5C9_METAR/8-246.........................LLETDTHLRQAWV.SQKLILAASCAGQVPAALAASTQSLDQFV---------LAA
I1RF58_GIBZE/4-241.......F...Y.D......GQGRTF..PSE..........NSRIIGLCVGSLAAAAVSCSTSLSELV---------SAG
G2YLD0_BOTF4/4-242.......F...F.E......ENPLAY..LEP.........SNTEVLAVCTGLLAASAVASSKSLTSLI---------PLA
B2W1Q0_PYRTR/9-246.......A............V.....NREPHILDSSRPR..PEII.GISGGLFSAAVMSISTNFETLY---------AAC
C7Z6X3_NECH7/7-240.......Y...Y.G......RNGRQY..PSP.........DEAYCLGICAGAFSAAAVSSSSSLSELV---------NIA
E3QS53_COLGM/10-256.......Q...H.S......SGCQIY..PTP.........EQSCLAGVCTGALAAAAVSCAHSVSSLV---------EPA
G9NGU8_HYPAI/9-247.......R............A.....ENDPSFFKASRNS..PSYSIGLCTGLLPAAAAATAGDVGELL---------TIG
B8MYS6_ASPFN/10-247.......Q...Y.T......SPGHKY..PST.........QQTCLVGLCTGLLSAAAVGCCQSITDLL---------PLA
G2RCG6_THITE/8-247.......Y...H.T......APGRTY..PAP.........QDTWLVGLCTGLLSAAPVSCCQSITDLI---------PLA
S0DTP6_GIBF5/8-239....................QAGISSYDAQN...........SRVVGLCTGAFAAAAVSCSSFTADLI---------PMA
G2QMK9_THIHA/8-254.......Y...F.N......DTGKKY..PKS.........PSSCLVGTCIGLLSAFAISCSESILDLV---------DLA
F0XGQ5_GROCL/8-244.......H...G.E......KHYEDIIRHD...........QTFLAGLCSGLFAAVAIASTPSLSSLV---------PVG
T0KJR9_COLGC/11-253.......W............V.....DDSPDALKTN.PR..PEGL.GISGGLINAAVLAISDDFESLR---------EAS
M2RHZ9_COCSN/9-246............................HAENDPALLDSSTPLLSLGICGGLLPAAAVAVATNIHELI---------EVA
R0JX83_SETT2/4-242............................HNERNDQLRLDANSDLLVGTGIGQLCAAAVACTATVVKLP---------DLA
L8G0G7_PSED2/41-278.......R...A.E......KVPEDATSPQ...........ETWAVGLCTGLFAAVAVSIAPSLSALV---------NIG
Q2HGW2_CHAGB/17-254.......H...A.E......KNCGDITRPH...........KTFLVGLCSGLWAAAAISVAPSLPDLV---------HIG
B8MF01_TALSN/8-245.......Y...I.S......QAGQLY..PTN.........ANERLTGLCTGLLTAVTVSCCRSLSELI---------PLA
N4VM62_COLOR/16-257.......F............A.....QVYPAILNGSDDA..PVYLAGACGGLLVASALVIADDVQSLY---------QGS
S3DAZ0_GLAL2/11-247.......R...A.E......KVPEDSASPN...........NTTLVGLSTGLFAAAAISCSASLSALI---------QVG
E3SAD1_PYRTT/8-240....................QGESNYKTPGS...........SVFVGLCTGTFAAAAASCSANTTELV---------PLA
U7PK37_SPOS1/8-244.......H...A.E......KHWEDVTQHE...........HTYLVGLCSGLFAAAAIASTPSLSALV---------PVA
B2B6C8_PODAN/41-279.......T...YEE......DSTKPY..PRA.........NDSYVLGVCTGSLAAAAISCSSSLSELL---------PIA
V5G236_BYSSN/6-248.......W...YEK......RAGEKY..PDT.........SSTIIIGLCIGQLSATAVSLTKSLVELI---------PFA
M2NM35_BAUCO/5-243.......Y...F.N......VNRKEL..PAT.........NNIRVLGLCTGMLAAAAVVSAKTIEELV---------ILG
B6QAB8_PENMQ/31-263.......Y...Y........GGRGTY..PPL.........TSTYLTGACTGSFAVAAISSSRSIGELL---------APA
M2XHZ5_MYCP1/10-247.......E...F.H......DFTKPY..PRH.........DSSYVLGICTGSLAAAAVSSSNSLSELL---------PIA
R7YHB3_CONA1/8-244.......Y...L.G......DGSEEY..PSA.........ENTRLVGSCTGLLTAAAVSCSRTYLDLV---------NMS

PF01735

PLB2_SCHPO/134-617NYDNAG-----------------------FVMGTSATLFNTFLLE.WSQEV....TSNSTLYDIIHKVFE.KLSEDQN.D
PLB5_SCHPO/125-607NFDNAG-----------------------FLMGTSSNVFSGILPA.TNASL...TASNNTFNNAVLSFLE.MLAEDQL.D
PLB1_YEAST/99-586GFDNTG-----------------------FITATSSTLFNQFLLR.LNSTD.....LPSFIANLATDFLE.DLSDNSD.D
PA24A_CHICK/190-675LHFLMG-----------------------VWGSAFSILFNRVLGV.SNSQNKGPTMEEELENIRLKHLVS.NDSSDSE.D
PLB_NEUCR/121-606GLDQAG-----------------------FVMGTSSTLFNQFLLANISSYD....GVPDVLIEAVTSVLK.EIGAKRD.D
PLB_KLULA/102-589GFDNTG-----------------------FVMGTSSSLFNQFLLQ.LNTTD.....LPSFLYNLLHGFLT.DASDDYD.D
PLB6_SCHPO/114-600QFDNVG-----------------------FLVGTSSTRYNEALID.VSLRQS..RMS.RRLGFTLRHMRI.NGSS.....
PA24A_DANRE/185-664LHFLMG-----------------------VWGSAFSILFNRVLGV.KETTSS.STMEEELEQIKPEHIVG.DDSADNE.E
PLB1_CANAL/88-565GFDNAG-----------------------FFMGTSSALFNEAVLS.ITEAN.....IPSFLKDIIDDILV.DPILKSNID
PLB3_YEAST/105-592GFDNAG-----------------------FIMGTSSTLFNQFLLR.INSTH.....LPSFITRLARHFLK.DLSQDFN.D
PLB1_SCHPO/114-593NYDNFG-----------------------FMMGASSTYFNKIMRN.FNDSS.......TKNGRIIQQYLKGNFSENGQ.Q
PLB2_YEAST/101-588GYDNAG-----------------------FVIATSASLFNEFSLE.ASTST.....YYKMINSFANKYVN.NLSQDDD.D
B6HB59_PENCW/114-597GFDSAG-----------------------FVIGTSSSLFNQFLLQ.INTTS.....LPSFIKDVFNGILF.DLDKSQN.D
G8ZY27_TORDC/97-584GYDNTG-----------------------FIMGTSSSLFNQFLLQ.INSTS.....LPSFIKNLVTGFLD.DLSEDED.D
Q59W34_CANAL/88-564GFDNAG-----------------------FFMGTSSSLFNIVLQQ.LNNMP.....IPPFLKELISKFTL.DPVEKLNID

PF01734

Q9N5Z7_CAEEL/97-269....KV.......................VEKFLPDDVAKANDLL-..................................
G7QJN7_LEPII/12-165....PH.......................LGHKKIEELSIPMGIS-..................................
B8GC44_CHLAD/8-228....RW.......................LREGQEASLLDLLETL-AVGLPTGIYDSQ......................
C1DSE3_AZOVD/14-206...PRQ.......................LNPLNVNPLRDILASL-V.................................
A9BEP0_PETMO/3-174....GY.......................FGNQTLSSLRKNVSFE-..................................
A9B328_HERA2/4-179....SL.......................LPPNIRRFSDLAIPFF-..................................
B2U808_RALPJ/9-214....TV.......................FSEGRFGRLAQAPEIR-IGVAHIPRWLG.......................
Q3AAC7_CARHZ/6-206....RE.......................LGTLNINQLKEQVAVI-..................................
A6CHF0_9BACI/8-175....NK.......................IVPYDYEAFHNNQSEF-..................................
Q2GUC2_CHAGB/19-224....SV.......................LRARGIESDEPFIERE-GP................................
Q9XAG3_STRCO/16-207....RL.......................ALSVRDVPQSAVFAAI-GA................................
A0A022N4I9_9ACTO/11-221....AA.......................MDRKGLDPTEWPTRPA-..................................
Q8R6F6_FUSNN/65-256....GL.......................LGKYEHMDNFDNFPIP-..................................
D5AXK0_RICPP/15-214....KY.......................CKDYTLKDLIGEVIVT-..................................
Q038G8_LACC3/6-159....RM.......................LQAPKLDSRAVLAVTT-..................................
A5IE43_LEGPC/25-249....DL.......................LAKLKTKFPVITFGDL-ALL...............................
Q4UJC7_RICFE/42-240....QH.......................LAGLRLDDTTSRLIIP-..................................
Q54HM9_DICDI/140-357....KV.......................FGNNTMGNFAQNKKLF-VVVSKLKHNNSLLQ....................
Q2K9E1_RHIEC/30-248....KL.......................YERHLFDGRSPSLSDL-PVSP..............................
A4IAC8_LEIIN/190-378....RS.......................IGDVTFAEAFARTGRV-..................................
Q21S96_ALBFT/26-231....GS.......................IDEQALSRLHQGPKIS-VLISYPPPWAC.......................
A5GF97_GEOUR/15-187....EK.......................LKGQKFSDDFRIPPHV-..................................
Q1CW69_MYXXD/353-514....QD.......................LGRLCLEELAIRFLPV-..................................
A6NV66_9FIRM/7-176....NE.......................LIPFDYETFAAFPGEV-..................................
A0A038KND4_MYCTX/181-420....RQ.......................PYAALPSRFRHRERST-LTLRSLP...........................
A0YM74_LYNSP/12-230....ET.......................INPVELRRGIELWVTV-FPS...............................
Q5X5T5_LEGPA/27-309EHVMRMAIFTHFPESLDNELKNVHEKLNAIEDKGSAEYINLAKRQ-QILEDTQKIING......................
Q2GS92_CHAGB/73-327....GA.......................LASPTVSRASSQASAA-SSEFR.............................
Q1ZT25_PHOAS/33-203.............................LDFHTAKRTLKHRQAF-..................................
Q5CY77_CRYPI/46-241....KL.......................LRELFLHRKHKQRLFF-..................................
A0A039K3R0_MYCBI/806-965....TI.......................FGDHLVEELPKHFRCV-..................................
PATA2_SOLTU/32-227....EK.......................LGETRVHQALTEVAIS-..................................
A6G7S9_9DELT/458-735....RL.......................ITEHTRPALIRAAGTV-LRLGISDAKS........................
C6TYS0_BURPE/13-264....NA.......................LQHMARNRDAARTDLP-IDLRLTTTLLSGVQ....................
A4F8K0_SACEN/17-281....GV.......................AEGDGARDVSRRADLL-LTATLLDPVI........................
Q2R2X0_ORYSJ/139-303....RF.......................LPDDVHIRCNGRIRVA-..................................
Q0A7T0_ALKEH/6-219....RN.......................LPLDGIRMAIHRGALR-AVG...............................
A0A031KR74_ENTFC/138-323....KM.......................VKDNLDLSLLKHNPKI-..................................
M6BTQ1_LEPBO/13-188....GH.......................KYPLPAENFEKFGLPE-LRIA..............................
E3VZB4_MIMIV/38-270....K........................ILNINIETIRSHLDLP-IDSDFEGTD.........................
Q0FZD9_9RHIZ/20-226....EV.......................LDDDAIQAVIDGPQFQ-VLIAHPPTEIL.......................
Q5A7P0_CANAL/211-417....GF.......................LGDLTFREAYNRTGKI-..................................
Q11UC9_CYTH3/381-624.............................ISDYKKPEEEAQIPML-ILSPTIINDGR.......................
A6ASA3_VIBCY/5-186....AIF....................GDFAQKTMQDLKAHSGID-..................................
Q1D826_MYXXD/142-382.............................LKDLPVPTLIAVGGIR-RGMLPRPLEYYER.....................
A0AZM8_BURCH/61-294....AA.......................LNSSVLFGLSPAKRQL-TLGDFNPNR.........................
Q5CE49_CRYHO/149-342YPMLIF.......................MRHLLQNRKRFKGPKW-..................................
A4HB10_LEIBR/40-220PRMRQV.......................LASGSLEIGVTVLPKL-..................................
I0WT11_9NOCA/7-221....AL.......................VSFEKVQENIDRGLVE-AV................................
A3QTZ2_9VIRU/28-255....LW.......................LDSDSPGLSTEDTLLR-LLNEIILPLSP.......................
Q1D5W1_MYXXD/154-432....LI.......................LKKAQTTRFKEDCTFA-YGITVTNLRGREVPFGEGGPDA......QFKLKR
Q09D74_STIAD/17-214....ET.......................FGEAKLCELEKMVVIE-..................................
A4BNM2_9GAMM/38-218....AG.......................LKVKDFQSCTIPFRCI-..................................
Q4LA62_STAHJ/11-202....YA.......................LEDHKFNESVHITRLE-H.................................
Q5ZPA4_9DELT/22-208....HI.......................LGDKTLRDLKRKVVIP-A.................................
D3MBX2_PROAA/25-319GGDIST.......................IVRGAETSASTYRAGP-ILAKLLDR..........................
NTE1_PICST/1239-1403....KI.......................FGFTEIEDFWIRYFCN-..................................
A4SJS7_AERS4/8-174.............................LARFAVNQVPLTVVTT-..................................
Q1I961_PSEE4/42-302....QL.......................MAREGVHDFASLAKRM-QTMPDGLRL.........................
A7RB12_PBCVA/19-192....IV.......................LGNKSYTFQSILEETG-..................................
Q0VPN6_ALCBS/36-193....AL.......................LPIQRMEHTLAPLAVS-..................................
A6G1N7_9DELT/36-362GLVDPQKVLAPCLDAATRDAIRARPGNAGVPGLEPDNFIFPRPGR-PFLVVNACIVEPDDTRAFAAQNPISLQCTPLYVG
A6QA07_SULNB/41-281....KI.......................MQHMKKPVFREGCEIP-MAFAVTKVTPIVE.....................
Q5WWS2_LEGPL/304-496....YA.......................IANKVRQIVNKYKIPY-PKGKITFS..........................
A0Z6H0_9GAMM/8-199....AA.......................LADYFDNNVLGDCRCP-..................................
A6LMU7_THEM4/5-176....YL.......................FERKKFSDLKYKIGIV-..................................
A7I0A5_CAMHC/6-211....TN.......................ISTSKILNGIPLFIAL-..................................
C7LH54_BRUMC/13-187....VF.......................LPDSFPSNVEDLKIPM-..................................
A6G3Y0_9DELT/12-216....AI.......................LERGGFERVRESVPVH-MLISHIEPGY........................
A1DP95_NEOFI/20-225....SI.......................LVQSGYEENALFGESE-PS................................
A5K2I7_PLAVS/1168-1482FKNMKMFHYNADFFTPYVFTVSTQMNVTPLQPVILKNYTANLGKI-KGGKEADGGDAYTSSNYDHVGDGEEQEGGDAEGW
TEG_BACME/7-180....KR.......................IVVPAFHLFAPELNRW-..................................
Q2W5X1_MAGSA/6-225SDLIQM.......................FWALTTPSTVNVFSKG-LCANA.............................
A4U0C8_9PROT/5-257....RF.......................VTSLMYKSKTRGLSRI-YYPDSAF...........................
A5N2W9_CLOK5/4-191....NI.......................IDEDKLRKSKIDFGMV-..................................
A4JJZ7_BURVG/8-242....EY.......................LDPAALNAGLPLYVSL-FRS...............................
A6R0J1_AJECN/673-891....EI.......................FGEFRRTFHAAGPDGS-GALISGT...........................
A0A024F582_BDEBC/72-224....VA.......................FNRTKVEDFKIPFACP-..................................
A5P920_9SPHN/106-312....HA.......................IYENGSAEFLDAIRNS-SI................................
Q2C291_9GAMM/11-214....EL.......................IDFDYLNQKEVRLSLC-..................................
A1VHY7_DESVV/116-308....SN.......................IGVLTGKPHMTFGELR-QR................................
A7BB55_9ACTO/26-199...PDG.......................ILPFNMDAFLANPART-..................................
A5I1W5_CLOBH/6-200....EM.......................FKNKGKTKFKHISLNG-..................................
A8GLS3_RICAH/7-147....QL.......................LKDNGFDPDITFKQLH-..................................
A4T0K7_POLSQ/80-285.............................LNSNHIEKLAGLLTGD-SK................................
A6DDL8_9PROT/5-162....KF.......................FLYDDLSKSDIPLFIC-..................................
A4CKZ2_ROBBH/4-195....KT.......................ITKEEFQTLKTGPKDL-..................................
A0A031WAB0_PEPDI/5-179.............................LDDSNIEEMNFYVNYV-..................................
A0A014PKG8_YERPE/86-275....GH.......................ITPQLLSEIAKAHKGG-R.................................
M6C3B5_LEPBO/36-250.............................LARLIAETAKAFLEDE-RD................................
Q12EZ0_POLSJ/6-228WGVDAL.......................LDELPASPVWSINATT-..................................
Q1GX66_SPHAL/43-328RWFEPP.......................FGGETFSHLLFDAFAA-MDAAPRGPVLVPDG....................
Q4RS54_TETNG/14-183....HM.......................MGRTLPDGCHHQASGR-..................................
Q5C8M6_LEGPN/32-295EKLDKA.......................LNSIPTELKGAKGEQL-ENPRLTLG..........................
Q6JBI3_DICVI/201-395....ET.......................IGEELTLIDTSKESVP-RLS...............................
Q0FKF7_PELBH/6-360IDIVAGNLGADGKPGPPLTVGALDERNIELAAMTTDLTSKRPFQL-PLRSGHHFF.........................
N0BV45_SALTI/8-168....DI.......................MPVTDFDHCSRRFGAV-..................................
Q6ASS6_ORYSJ/60-258....RV.......................FGDATLKDTVAPLLVP-..................................
A6QX75_AJECN/242-440....ST.......................VGEMTFEEAFAKTKRC-..................................
Q74A07_GEOSL/58-306YYNDTV.......................FGGKTFADLVAAPGKR-A.................................
Q54XY1_DICDI/13-231FPSSPD.......................GADTQITELNEKKFFV-VSLKKTGE..........................
Q55G69_DICDI/65-250....TN.......................FQGKIMSDRKGFVVTV-..................................
Q5Z158_NOCFA/22-193....DG.......................VEPMDFDAILNHATTF-..................................
Q54QX6_DICDI/893-1088....TI......................FPSDEKLKNSFSKIRVA-VTS...............................
A1UXE2_BURMS/413-612....RY.......................VDFDSLGMSPTRLLIG-..................................
A2QZY6_ASPNC/473-679....KE.......................FGVDQGMFDVQPVSGT-..................................
A4XTW9_PSEMY/15-385....EYLDRLCGQRQACASNADSIERERPLTFGELRRHGIDLQMM-TTCASMARPFRLPFR...................
Q0E508_SFAVA/27-224....DF.......................IFDLGHDRKITFEELH-..................................
A6GI17_9DELT/71-215....LP.......................M...............-..................................
A7IE20_XANP2/6-198....EV.......................FGAGAILADVKRPVLV-..................................
Q1DCU7_MYXXD/197-406....AA.......................VVPEQLTNGTELVAVS-..................................
Q6MAN6_PARUW/474-738....KK.......................LTEKVEKHQGTKINHL-TFGELR............................
Q4Z1R8_PLABA/352-558KNLYCF.......................VTATDVKHNPYKLFLL-..................................
A4RTL4_OSTLU/164-398DGDSKF.......................AVDPAMNVNYLLETVM-GGETG.............................
A0JUC4_ARTS2/74-249....KV.......................FPALGINEGEIRRRAA-..................................

PF00698

FAS_HUMAN/493-810VRTGGM-----------------------AFHSYFMEAIAPPLLQ-----------------------------------
STCK_EMENI/1547-1902LEVVNY-----------------------NVHSRQYVCAGHVRSL-----------------------------------
FAS_CHICK/492-809VRRAGV-----------------------AFHSYYMASIAPALLS-----------------------------------
FAS1_YEAST/1663-2037VEIVNY-----------------------NVENQQYVAAGDLRAL-----------------------------------
A4F7N8_SACEN/109-425VINVSM-----------------------AAHSAQVDDIAEGMRS-----------------------------------
A4F7P0_SACEN/560-880DIDVDY-----------------------ASHSPQIERVREELLE-----------------------------------
I6Y231_MYCTU/534-851EVAVDV-----------------------ASHSPQVDPILDDLAA-----------------------------------
PPSA_MYCTU/632-950RVNIEV-----------------------APHNPAMDALQPAMRS-----------------------------------

PF16073

B8MGX9_TALSN/8-250VDAVRI-----------------------AFRLGTLTTTARNDLE-----------------------------------
B6HLN4_PENCW/17-255LEVTRV-----------------------LMRLCKLTSVRSRSME-----------------------------------
E9D6Y9_COCPS/8-245VHTVQV-----------------------ALRLGLLANDMKDRIE-----------------------------------
K1X7W5_MARBU/800-1037VQVSLM-----------------------AFRAGAYVTAMAERLH-----------------------------------
L8G6V9_PSED2/30-264VEAVIT-----------------------AFRTALCTVGICNDIE-----------------------------------
B6QFH1_PENMQ/10-246VEAVVV-----------------------ALRLGLCAYKVRDYVG-----------------------------------
B6QER4_PENMQ/12-248PETVAI-----------------------AFRIGMDVDRRTASL.-----------------------------------
A7F3E3_SCLS1/4-241IQVVLM-----------------------AFRTGAHVAALADRLN-----------------------------------
N1RV88_FUSC4/8-242VEAATV-----------------------AFRLGMHVRRRAENLG-----------------------------------
E9F646_METAR/19-261IDAVRV-----------------------SLKVGLLVARTAALFS-----------------------------------
S3EB79_GLAL2/16-254LEVGRL-----------------------VFRVSKLASVRSRAVE-----------------------------------
G4UHA1_NEUT9/13-252VQVTLM-----------------------SFRVGRHVYKVAEQIY-----------------------------------
B6HKK0_PENCW/8-244VETVIV-----------------------ALRLGMCVLKVQELIE-----------------------------------
E9F7M7_METAR/10-244VHAVVV-----------------------ALYTGLRAAQEAQSIH-----------------------------------
WA_EMENI/8-244VEVVVV-----------------------ALRLGLCVYRVRKLFG-----------------------------------
V5GBX6_BYSSN/4-246VEAVQI-----------------------AFRLALYIGRCADRLH-----------------------------------
G2QWR8_THITE/16-254VQTVIL-----------------------AFKLGSYVQTIAQQFS-----------------------------------
M3CY75_SPHMS/5-242VDFVRV-----------------------AFRSGAAVDGIRSVLA-----------------------------------
M2RQ22_COCSN/4-241TEAVRV-----------------------AFRAGTCVGAAKEALE-----------------------------------
B8LZ55_TALSN/27-260VEAVLI-----------------------AFKTASYSLSLRKDLG-----------------------------------
S3D9A7_GLAL2/4-237LETIRV-----------------------AFRVGFLVATRAEELI-----------------------------------
G7XN60_ASPKW/8-244VEAIVI-----------------------ALRLGICVFRVRELVA-----------------------------------
M2T1K1_COCSN/8-240IEAVIA-----------------------SFKTGVLVQDVAQRLA-----------------------------------
E9DR08_METAQ/20-259VQACLA-----------------------AFRTALRSWLAGQDLS-----------------------------------
S3CWG8_GLAL2/8-245VQTVQV-----------------------AFRLGLCVVDVCSRIE-----------------------------------
F2PW05_TRIEC/6-242IEVTLV-----------------------ALRIGLSSLRIAHQIG-----------------------------------
H1VJ39_COLHI/10-255LHAVAV-----------------------AIRLGALAWDVADRVA-----------------------------------
U1GE50_ENDPU/4-243VEAVRV-----------------------AFRTGAHVGRVAQQVE-----------------------------------
A1C888_ASPCL/9-246VEVVAM-----------------------AIHLGLCVMTVRDLVD-----------------------------------
R0KB98_SETT2/8-242VAAVVT-----------------------AFKTGMHVTDVAQRVE-----------------------------------
E4V2N2_ARTGP/10-256AEAVRV-----------------------SFRLGIYVADISSKLE-----------------------------------
L8G4G9_PSED2/24-270ADAVRL-----------------------AFRLGIHVLDISENLE-----------------------------------
M2ZZX0_MYCFI/5-242VDFVRI-----------------------AFRSGAAVDRVRSVLG-----------------------------------
Q2GV63_CHAGB/785-1022REIVSI-----------------------SFRLACEVAQRKGLID-----------------------------------
B8N7H8_ASPFN/9-246LEAGRV-----------------------WARLCNLILVRLRAME-----------------------------------
Q2UA48_ASPOR/8-244VEAVVV-----------------------ALRLGLCVLKVRELVS-----------------------------------
N4VBL7_COLOR/10-255LHAVAV-----------------------AVRVGALAWDVAERVS-----------------------------------
B2B495_PODAN/8-245VQAVLL-----------------------AFRTGSYVHTLGDRLC-----------------------------------
M4G4F1_MAGP6/8-245VQTVLM-----------------------AFRTGSQVAALAERLE-----------------------------------
R7YU14_CONA1/7-242VEAVLV-----------------------AFYTGLRTMETRDYIE-----------------------------------
R0KD65_SETT2/13-258LEMIRV-----------------------TCRLSNLMISRSMAVE-----------------------------------
V5G4B2_BYSSN/8-244VETVVV-----------------------ALRLGLCVLRARDLVD-----------------------------------
H1VY29_COLHI/8-245VQVVLM-----------------------AFRTGSHVGSLAERLS-----------------------------------
L8GBJ0_PSED2/42-283VHAVLA-----------------------AFSAALRSFLVGQSLL-----------------------------------
B6QC69_PENMQ/7-243TETIAV-----------------------CFRLALELYRRTRRIE-----------------------------------
G3JFQ9_CORMM/16-246VEATIA-----------------------AFRTALRSFL......-----------------------------------
F9XMW3_MYCGM/5-242VDFVRI-----------------------AFRSGAVVDNVRSMLG-----------------------------------
G9MXY7_HYPVG/19-259IDAVRV-----------------------SLRVGLLVARTAALFG-----------------------------------
G0RW83_HYPJQ/19-262IDAVRV-----------------------SLRVGLLVARTAALFG-----------------------------------
C5G0R3_ARTOC/8-243VQTVLV-----------------------AFRMGLRTLHTATAVD-----------------------------------
K1WM58_MARBU/4-242VQAVRI-----------------------AFRTGSRVSTIAEQLE-----------------------------------
G9NQM0_HYPAI/19-259VDAVRV-----------------------SLKIGLLAARTAALFG-----------------------------------
A2QH36_ASPNC/29-262VEAVTV-----------------------AFRTALRSLILRSDLV-----------------------------------
STCA_EMENI/11-251VQTVLV-----------------------AFRLGLWAEKVRDNLE-----------------------------------
Q8EYQ4_LEPIN/19-271SKFLKF-----------------------VLYIGYRAQELV....-----------------------------------
C7ZNQ1_NECH7/8-238VYSVIA-----------------------AFRTGMLVTDVAKRVD-----------------------------------
M2N8F6_BAUCO/8-232VHTVQL-----------------------ALRLGLHAIDVRDRIY-----------------------------------
G7Y059_ASPKW/7-243LLMVML-----------------------SLRLAIQVDRRS.RY.-----------------------------------
E4V6P4_ARTGP/8-243VQTILV-----------------------AFRLGMCTLRASGAID-----------------------------------
U1GYJ0_ENDPU/26-259IEAVLA-----------------------AFRTGLCSLELRNDIE-----------------------------------
H6BVA1_EXODN/5-241VEAVRI-----------------------AFRAGAHVGKVAQQTE-----------------------------------
E9F7X1_METAR/8-256PHFVAL-----------------------AFRLGHMVQNRTTSVV-----------------------------------
E3R122_COLGM/12-243IIAVKT-----------------------AFRIGLKVTEVAGRLA-----------------------------------
G2WRK7_VERDV/8-245VQTVLM-----------------------AFRIGSHVASLAERLC-----------------------------------
G0SDA9_CHATD/19-258VQAVLL-----------------------AFRTGLYVHKLATRMF-----------------------------------
B6QHV7_PENMQ/4-241VETVRT-----------------------AFRLGSCVGRMARLQE-----------------------------------
Q2UG06_ASPOR/8-245VQTVLI-----------------------AFRLGLCALEMRDRVD-----------------------------------
C5FQT2_ARTOC/8-245IEAVVI-----------------------AYRTGLHVTKTRRLLE-----------------------------------
E9D5J9_COCPS/7-242SDIVAT-----------------------SVRAGLDVDRRTSEY.-----------------------------------
N1PC72_MYCP1/5-242VEFVRV-----------------------AFRSGAAVETLRSVLG-----------------------------------
E3R0Q2_COLGM/12-250LEIARL-----------------------LVRLCKFTSIKSRSVE-----------------------------------
R8BTJ4_TOGMI/8-245VQMVLM-----------------------AFRTGRHVASLAERLC-----------------------------------
G4MU27_MAGO7/14-251VQTVLM-----------------------AFRTGAHVAALAERLE-----------------------------------
R7YTG2_CONA1/4-241VEAVRI-----------------------AFRAGTCVGTAKEALE-----------------------------------
U7PRD0_SPOS1/5-267DHVVVL-----------------------AFRVGYEGVRRTARLD-----------------------------------
E5A495_LEPMJ/4-241TEAVRI-----------------------AFRVGCMTGAARDALE-----------------------------------
E9F8F0_METAR/70-305VEVTHI-----------------------IFRMARELNRRSLMVD-----------------------------------
B8NVD5_ASPFN/5-241IEAVVV-----------------------AFRVGMHVARRANALG-----------------------------------
B8MV60_TALSN/15-255RKLVDV-----------------------SFNLGVAQWKRAMDIE-----------------------------------
E9FC93_METAR/16-256VESALA-----------------------AFRTGLKSFLVGETIA-----------------------------------
G9NBV5_HYPVG/10-247REIVSI-----------------------TFRMTREIVRQTKMVE-----------------------------------
R1G9D8_BOTPV/4-241VEAVRI-----------------------AFRTGAVVGNVKEALE-----------------------------------
S3CAW2_OPHP1/8-244TQAVLM-----------------------AFRTGLHVSKLADQLG-----------------------------------
B2B664_PODAN/7-242DETVHL-----------------------AFQVGLAASKRSHEVD-----------------------------------
M1WG96_CLAP2/23-272ADVVRL-----------------------AFRLGIHVLGVSELLE-----------------------------------
E9F5C9_METAR/8-246PELVSI-----------------------AARIGLEINRRANSF.-----------------------------------
I1RF58_GIBZE/4-241VDAVRV-----------------------ALHVGLRVWRTTSLFD-----------------------------------
G2YLD0_BOTF4/4-242VQAVRI-----------------------AFRLGSRVAAVGNQLE-----------------------------------
B2W1Q0_PYRTR/9-246IEAGRI-----------------------WSRLCNLTLVRSRAME-----------------------------------
C7Z6X3_NECH7/7-240SETVII-----------------------AFRTALHSFSIKTDTV-----------------------------------
E3QS53_COLGM/10-256VHAVAI-----------------------AVRLGALAWDVSSRID-----------------------------------
G9NGU8_HYPAI/9-247RVLIPV-----------------------AYRLGVQQWRSAHEIE-----------------------------------
B8MYS6_ASPFN/10-247THTVLI-----------------------AFRAGLFVADVRDRLE-----------------------------------
G2RCG6_THITE/8-247AHTVLV-----------------------AFRAGLCVGEVRNRIE-----------------------------------
S0DTP6_GIBF5/8-239VSSVVA-----------------------AFRTGLLVTDTARRVD-----------------------------------
G2QMK9_THIHA/8-254PDLILL-----------------------AFRLGLVVQNRTASVV-----------------------------------
F0XGQ5_GROCL/8-244VQAVLM-----------------------AFRTGSHVAKLADRLS-----------------------------------
T0KJR9_COLGC/11-253VVTAGF-----------------------VCRLCEVAGHVSRAVE-----------------------------------
M2RHZ9_COCSN/9-246SYLARV-----------------------NCRVAVAISRRSLGIE-----------------------------------
R0JX83_SETT2/4-242AEAVRL-----------------------AFRIGSVVETYSV...-----------------------------------
L8G0G7_PSED2/41-278AEFVLL-----------------------AFRTGRHVSALAENIH-----------------------------------
Q2HGW2_CHAGB/17-254VQAVLL-----------------------AFKTGSYVHAIGERLS-----------------------------------
B8MF01_TALSN/8-245VHTVII-----------------------ALHTGFLVNAVRLRIE-----------------------------------
N4VM62_COLOR/16-257LEMVRV-----------------------TCRLSSLMIARSRAVE-----------------------------------
S3DAZ0_GLAL2/11-247VQATVL-----------------------AFRTGSYVAALADQLG-----------------------------------
E3SAD1_PYRTT/8-240VEAVVA-----------------------SFKTGILVENVARRLT-----------------------------------
U7PK37_SPOS1/8-244VQAVLM-----------------------SFRTGLYVATLADRLC-----------------------------------
B2B6C8_PODAN/41-279VQTALI-----------------------AFRLGLCALEMRDSLE-----------------------------------
V5G236_BYSSN/6-248VEAVRI-----------------------AFRVGVVVTNVKKELE-----------------------------------
M2NM35_BAUCO/5-243VQFVRI-----------------------AFRSGAAVDAARGVLS-----------------------------------
B6QAB8_PENMQ/31-263VEAVIA-----------------------AFKTAIYSLNLRNDTD-----------------------------------
M2XHZ5_MYCP1/10-247VQTALI-----------------------AFRLGLCVTDMRDRLE-----------------------------------
R7YHB3_CONA1/8-244VEILKI-----------------------AFRVGAQVAEAGDELE-----------------------------------

PF01735

PLB2_SCHPO/134-617IAPYP..NPYQNFTTT.NTTVKN.........PFERFDTIDLVDGGEDD..E--NIPIWPLLHP----------------
PLB5_SCHPO/125-607VGLYP..NPYQGYGNASNTTTTN.........PLEPYPIIELIDGGSDS..E--GIPFWPLLHP----------------
PLB1_YEAST/99-586IAIYA.PNPFKEANFL.QKNATS.........SIIESEYLFLVDGGEDN..Q--NIPLVPLLQK----------------
PA24A_CHICK/190-675ESQHPKGTENSEANEE.YQNSSQESWVQRMLMALVGDSALFNTREGRAGKVH--NFMLGLNLNS----------------
PLB_NEUCR/121-606VSQII.PNPFLDWN.....NRTN.........PNADTLELDLVDGGEDL..Q--NIPLNPLTQP----------------
PLB_KLULA/102-589ISIWA.PNPFYEITNI.PSNYSQ.........SISEDDTLYLVDGGEDG..Q--NIPLTPLLQT----------------
PLB6_SCHPO/114-600VSFYP..NPYTDATDI.AGNATAV......SEDIVDTPYLDLFDGGYDG..Q--NIPIWPLLQP----------------
PA24A_DANRE/185-664ETQRG.GTESADAEDE.RQRHAQASWVQRMLTSIMGDTTLFTTREGRAGKVH--NFMLGLNLNS----------------
PLB1_CANAL/88-565VSAYN.PNPFFKSS.....GSNT.........AISQSKNLYLVDGGEDG..Q--NIPISPLLH.----------------
PLB3_YEAST/105-592IAVYS.PNPFKDTKFL.DSDYTT.........SIVDSDSLFLVDGGEDD..E--NVPVLPLIQK----------------
PLB1_SCHPO/114-593IISIP..NPFQGVESA.NSDAAN.........NLGSSSSLNLVDTFLTG..E--KIPLWPLLQK----------------
PLB2_YEAST/101-588IAIYA.ANPFKDTEFV.DRNYTS.........SIVDADDLFLVDGGEDG..Q--NLPLVPLIKK----------------
B6HB59_PENCW/114-597IASYD.PNPFYKYN.....EHSS.........PYAAQKLLDVVDGGEDG..Q--NVPLHPLIQP----------------
G8ZY27_TORDC/97-584IAIYA.PNPFKDTSYI.HDNFSK.........SISESDYLYLVDGGEDN..Q--NIPLVPLVQD----------------
Q59W34_CANAL/88-564IAQYN.PNPFHKSN.....NSDT.........KIAQSRTLYLADGGEDG..Q--NVPLLPLIH.----------------

PF01734

Q9N5Z7_CAEEL/97-269..........................................FVSVTKLKTW--KNELISNFES..----------....
G7QJN7_LEPII/12-165.................................................VSN--ITKQIRELKT..----------....
B8GC44_CHLAD/8-228....ALERYVRV.AL..........EQPGRSNRFHDLDRELLIIATDLDSGE--RAVFGLPPLD..----------....
C1DSE3_AZOVD/14-206................................DFERLRTDCPLKLFIAATNA--NTGRLRLFRS..----------....
A9BEP0_PETMO/3-174................................................VFEL--KNKEVIILKN..----------....
A9B328_HERA2/4-179............................................VTATNYRT--GDMHLFGDDP..----------....
B2U808_RALPJ/9-214......ARSAVA.AG...........LIAYNIEKHVRKTLHPTLGKRLGFTA--EIVRAQDCAT..----------....
Q3AAC7_CARHZ/6-206................................SVDLYSGKRVVFGNFPGEFL--RGINDYIAVR..----------....
A6CHF0_9BACI/8-175..........................................VIGTTDCHTG--EPVYHYKKDY..----------....
Q2GUC2_CHAGB/19-224..............................GCKVILCATRVETGKADVLRNY--KSGHPTAENY..----------....
Q9XAG3_STRCO/16-207...............................QLPVRDWPDRTVRMFAVDALT--GEPTAFDADS..----------....
A0A022N4I9_9ACTO/11-221........................................LRVVAMNFDTGE--RVLFGVADAP..----------....
Q8R6F6_FUSNN/65-256.............................................LRIIATN--LNTGETKAFS..----------....
D5AXK0_RICPP/15-214.....................................GYDLNNQQNPLITFS--TIEARKSQDN..----------....
Q038G8_LACC3/6-159..............................................SVPDFQ--AHVTRLDVLT..----------....
A5IE43_LEGPC/25-249..............................NHHFPDKFKQLNMPAVEFPNGA--IQVFNSTLTP..----------....
Q4UJC7_RICFE/42-240........................................VTDLASKDKEVK--IFDSHDSYSP..----------....
Q54HM9_DICDI/140-357...QQQTPQQTF.INQ.........STPSSLQQPQQQQILINQQQESEFKTK--IISNYNKKYE..----------....
Q2K9E1_RHIEC/30-248.............................WFVFCASNLSTGSLFRMSNRYIA--DYRIGLSFHP..----------....
A4IAC8_LEIIN/190-378................................LNIPFVSASPVMPRRNADVD--VQLLNYLTSP..----------....
Q21S96_ALBFT/26-231......AHMAML.LG...........MLAYGLKACNKDAVHSLTGQRVGFRP--LFISVQECVT..----------....
A5GF97_GEOUR/15-187...........................................IATDILNYK--PVIFSAKTFP..----------....
Q1CW69_MYXXD/353-514.................................................TTD--LTSGDCVALE..----------....
A6NV66_9FIRM/7-176........................................EAVVTNMDTGKA--EYLPVPKQDE..----------....
A0A038KND4_MYCTX/181-420..........FL.P.............IGIGPWVAARMWQVAAFIDLRVVKP--IVISADGATR..----------....
A0YM74_LYNSP/12-230.............................LKIPGLGYDWLIDFIRAKTGTGA--EWLCIQDCPD..----------....
Q5X5T5_LEGPA/27-309....LHDPNFDL.TF..........GHLHTLHQYDPQRFKELYVTGTDENGE--LRIFSHEKDA..----------....
Q2GS92_CHAGB/73-327...........................TDTYQCQTLAWCTEVETRRSRRPYA--FCTYAEDEND..----------....
Q1ZT25_PHOAS/33-203...................................................A--CATRKDTLKDIY----------MPMF
Q5CY77_CRYPI/46-241...........................................TNTMRYTDR--TAHVFTEQLE..----------....
A0A039K3R0_MYCBI/806-965.................................................SVD--LLARRPVVHR..----------....
PATA2_SOLTU/32-227.......................................SFDIKTNKPVIFT--KSNLAKSPEL..----------....
A6G7S9_9DELT/458-735......GTFFSV.GE...........PIADGDLANYGYIDPEPDMALSADWL--RQPAFGCKRF..----------....
C6TYS0_BURPE/13-264...GNTVDDLGT.PVH.........DVDYRAYFHFTNMASHGTPSPQSAFDS--TNDFDDRTDV..----------....
A4F8K0_SACEN/17-281......ERHFDG.RS...........RPLTQERRTASFRFRHRGEAGDPLSD--FGTGTAFDET..----------....
Q2R2X0_ORYSJ/139-303............................................ITQLSWRP--RGLLVDQFDS..----------....
Q0A7T0_ALKEH/6-219.............................VTGAGYTSGRAVTFFQAAPDVEG--WLKGKRVGRP..----------....
A0A031KR74_ENTFC/138-323.......................................RLYTVSTKLPELA--EVVTDIQQTK..----------....
M6BTQ1_LEPBO/13-188.............................VSNL..................Q--TRTIEYVRAT..----------....
E3VZB4_MIMIV/38-270.......ITFWH.LK...........KLIKKYPQIYKHLLINSVDISREQQI--FMTTLDDNWD..----------....
Q0FZD9_9RHIZ/20-226......PKWSTF.PM...........MAAYLLDLTVRSTPHVEWPAKLGADS--SLVDAREAAK..----------....
Q5A7P0_CANAL/211-417.......................................LNITVSPASVHEQ--TRLLNYLTAP..----------....
Q11UC9_CYTH3/381-624......KLYISP.LN...........ISYMTTASTTSTSSTNFRQKLKGIEF--KKFFEEQDAN..----------....
A6ASA3_VIBCY/5-186......................................LLITTVEMNTGKTL--LINTIDEDYR..----------....
Q1D826_MYXXD/142-382....LLGTSPLG.LLN.........PVGVARRIQAAMGAMAELFTRPEITAR--LYLGADDTTG..----------....
A0AZM8_BURCH/61-294.......PQIII.N............STVATAEGTTAFQPRPFGSLFTFSPS--DLDSIGVNYS..----------....
Q5CE49_CRYHO/149-342..........................................NALAYHFKSA--LSYYFNEEVP..----------....
A4HB10_LEIBR/40-220....................................................--RSHLINSFSS..----------....
I0WT11_9NOCA/7-221...............................AVAATSVATGGTVVFVHKHPA--IALPPFDANRNI----------TYVE
A3QTZ2_9VIRU/28-255......HRDLIE.NL..........KSITFLDLKHITNHELRCFSTQLNDMV--IYEFSVSRTP..----------....
Q1D5W1_MYXXD/154-432VTEKLVVQVMTQ.GEGKLT...ARLPFMEGAASASFPHIGVKPKELAYYPAL--GAQPTGDGGH..----------....
Q09D74_STIAD/17-214.........................................AFDSTVWRKAT--YHQFPPDADF..----------....
A4BNM2_9GAMM/38-218................................................ACSD--DGRNRRKVFR..----------....
Q4LA62_STAHJ/11-202................................RIKGIEWPSNLMITAINARK--AERVALTSDS..----------....
Q5ZPA4_9DELT/22-208...............................FQLDDGDPDEDRRGWRPRIFH--NFPGDTFVNL..----------....
D3MBX2_PROAA/25-319........GFFK.S............ELLATSGMSVRIATVALESGELRYMT--ESGVLVDRDNNP----------IGSS
NTE1_PICST/1239-1403.................................................TTN--ITNSTMDIHE..----------....
A4SJS7_AERS4/8-174.................................................RVS--DGQAAYLKGN..----------....
Q1I961_PSEE4/42-302.......RSGVP.ID...........KPVEALFRLAIIATDVTTQTKVEFPR--MASLYWDDVD..----------....
A7RB12_PBCVA/19-192......................................MFLVICATNLTEHC--PEYFSPTETP..----------....
Q0VPN6_ALCBS/36-193.................................................AWH--GRSRRTHVLR..----------....
A6G1N7_9DELT/36-362SLQPLKIRYAGEPFGDVVLPMGGGAVESFAFGGEGPAQVQSGELSCVPTNPV--NIQARQTLEF..----------....
A6QA07_SULNB/41-281....EYQGIKIK.NQA.........FSVPLTFKVTQGRVSIINRKMPPSTAF--YISIPGIEKD..----------....
Q5WWS2_LEGPL/304-496.........TLA.S.............LREQFPDCGIGKELIVTATNKRSGK--TIYLSANRYP..----------....
A0Z6H0_9GAMM/8-199......................................TIVTAYDLEARSTT--FFKSFKPEHA..----------....
A6LMU7_THEM4/5-176.................................................TFD--TLDGNSLLIT..----------....
A7I0A5_CAMHC/6-211.............................................TESSDFS--PFFVNVQSLD..----------....
C7LH54_BRUMC/13-187..............................................TITAVD--FHGAREIHIS..----------....
A6G3Y0_9DELT/12-216......PLVRTS.AV...........AVRNHMIARRRRDLHGPGHLAPGLGY--RALSSHDAQS..----------....
A1DP95_NEOFI/20-225..............................CRVVIYLTDWKTQKSFPLTSYE--SKRCPSELSM..----------....
A5K2I7_PLAVS/1168-1482DGQQNGEVGVEDAEGANGANAANTANPANTANTANPANTANTANTANTANTA--NPANTANPAN..----------....
TEG_BACME/7-180................................................NPVL--FHNFLGSPYL..----------....
Q2W5X1_MAGSA/6-225............................PFIQEMVDFDALKTVEEDVYLNAY--NLTDHKMAIF..----------....
A4U0C8_9PROT/5-257.........LQQ.I.............DFKRLSEPGRPVLYHNAYNLTDDRL--ELFSNKDGKY..----------....
A5N2W9_CLOK5/4-191............................................TVSISDFK--PLNLYKEDIP..----------....
A4JJZ7_BURVG/8-242..............................QTPFDDLLRIAAAEVGIEDTPA--STYVHVQGLP..----------....
A6R0J1_AJECN/673-891..........KV.G.............VVATSISRETSTFVFGNFNGAECGK--QRVRPEDDGD..----------....
A0A024F582_BDEBC/72-224.................................................SYN--LKKNQVYLMN..----------....
A5P920_9SPHN/106-312..............................EGYVGFVEANCGHFHYADVREL--VRKAPNNESA..----------....
Q2C291_9GAMM/11-214..............................................AVDLES--GDFKTFDSFN..----------....
A1VHY7_DESVV/116-308..............................AEVEPGRFLDLTVVGANLSRET--PELFNAERTP..----------....
A7BB55_9ACTO/26-199........................................RVAAFNASRGEV--RWFSKEDMST..----------....
A5I1W5_CLOBH/6-200.....................................QSPLKIIASDVTNKR--LLILPDDIRKYG----------MDPM
A8GLS3_RICAH/7-147....................................................--.....DSQKT..----------....
A4T0K7_POLSQ/80-285...............................TNWPASRMFTTGIDCYSGERL--VVGQQTAQKN..----------....
A6DDL8_9PROT/5-162.................................................VTD--FQEEKALYLN..----------....
A4CKZ2_ROBBH/4-195.........................................VVTVSNLSLNQ--VEYKSINDFD..----------....
A0A031WAB0_PEPDI/5-179...........................................EVDNKVVSE--KIVDVSKMPR..----------....
A0A014PKG8_YERPE/86-275................................RLYMGTVDLDSQRFIVWNMG--LIASKGTPEA..----------....
M6C3B5_LEPBO/36-250...............................KKRGLNTERMQRILRKWNMKE--VLFMEKDFDD..----------....
Q12EZ0_POLSJ/6-228.....................................AKTGKRACIEGGQLR--DWTLGSTPMK..----------....
Q1GX66_SPHAL/43-328...QPVDLFVSV.TDF........AGHSVPLALNSPPRVTENEHRLILHFRE--DGRTGKRLDD..----------....
Q4RS54_TETNG/14-183.........................................LGISLTRVTDG--ENVLVTHFDD..----------....
Q5C8M6_LEGPN/32-295........DLGR.L............RELLPEENKHLIKNLSVVVTNQTKHE--LERYSEDTTP..----------....
Q6JBI3_DICVI/201-395.............................IVAAIVNFPVIQPYAFRNYEPPA--GRDSHYRGST..----------....
Q0FKF7_PELBH/6-360.......SAQEF.E............ALFPPRIMAYLIGEATPFDASAAGGP--TDLYPMRIEE..----------....
N0BV45_SALTI/8-168.................................................ATN--LSTGRELWFT..----------....
Q6ASS6_ORYSJ/60-258.......................................CYDLATAAPFMFS--RADAVESDSY..----------....
A6QX75_AJECN/242-440.......................................LNITIPTAGRAGT--PNLLNYLTAP..----------....
Q74A07_GEOSL/58-306...............................PFLVLNATDISIAHRFEFTQD--QFDLLCSDLA..----------....
Q54XY1_DICDI/13-231........KNDI.L............TPVIISNYKFDETTTIAGNNNNNNNH--FIKGEEIERLYT----------IGEE
Q55G69_DICDI/65-250..................................AQDKISAEKSVKIFANYQ--NPSTNLHDDD..----------....
Q5Z158_NOCFA/22-193.........................................HPIATDARTGN--AVDLRPHIYD..----------....
Q54QX6_DICDI/893-1088.............................VTQESGNLEECLFLNYQKKTNPT--RCSEQRKFIT..----------....
A1UXE2_BURMS/413-612..............................................AVDVET--GEPRIFDSYV..----------....
A2QZY6_ASPNC/473-679.................................KVAVTAVADQPVLLINYRR--VVDPPGQRCV..----------....
A4XTW9_PSEMY/15-385.NDEKVRENNQF.HFSE.......SEFGALFPQRVVNWMRARQRPAQQGERS--DGLYRLPLPD..----------....
Q0E508_SFAVA/27-224.................................RKTGKNLAIVATDIVSKFE--PYVMSTSTTP..----------....
A6GI17_9DELT/71-215....................................................--............----------....
A7IE20_XANP2/6-198................................NTVQLDNALSDGQRSWLPRT--FSNFPGDLGR..----------....
Q1DCU7_MYXXD/197-406..................................VDFDTGDVFGISDQDPAN--FDPNATEQQR..----------....
Q6MAN6_PARUW/474-738...........E...............LIKTEKNSPFKHLYIVAAKLGPQHG--VRIFSSEDPNC.----------...D
Q4Z1R8_PLABA/352-558...........................................RNYTHKYNA--INGESYGGLN..----------....
A4RTL4_OSTLU/164-398...........................RPLRWKDVITSSVPLKVVATSLDTL--TTVILDDFKD..----------....
A0JUC4_ARTS2/74-249.......................................LPGAVEGTFNVVE--FTEKRCHAID..----------....

PF00698

FAS_HUMAN/493-810ELKKVIREPKPRSARWLSTSIPEAQWHSSLARTSSAEYNVNNLVSPVLFQEA--LWHV.....PEH--AVVLEIAPHALL
STCK_EMENI/1547-1902WVLS.HA......CDDLSRSTSPN.....SPQTMSECIAHHIPSSCSVTNET--ELSR..GRATIP--LAGVDIPFHSQM
FAS_CHICK/492-809ALKKVIPHPKPRSARWISTSIPESQWQSDLARNSSAEYHVNNLVNPVLFHEG--LKHI.....PEN--AVVVEIAPHALL
FAS1_YEAST/1663-2037DTVT.NVLNFIKLQKIDIIELQKSLSLEEVEGHLFEIIDEASKKSAVKPRPL--KLER..GFACIP--LVGISVPFHSTY
A4F7N8_SACEN/109-425ALAW.FAPGGSEVPFYASLTGGAV.....DTRELVADYWRRSFRLPVRFDEA--IRSA...LEVGP--GTFVEASPHPVL
A4F7P0_SACEN/560-880TTGD.IAPRPARVTFHSTVESRSM.....DGTELDARYWYRNLRETVRFADA--VTRL...AESGY--DAFIEVSPHPVV
I6Y231_MYCTU/534-851ALAD.IAPMTPKVPYYSATLFDPR.....EQPVCDGAYWVDNLRNTVQFAAA--VQAA...MEDGY--RVFAELSPHPLL
PPSA_MYCTU/632-950ELAD.LTPRTPTIGIISTTYADLH.....TQPVFDAEHWATNMRNPVRFQQA--IASAGSGADGAY--HTFIEISAHPLL

PF16073

B8MGX9_TALSN/8-250.............A---------------SLHEA....WAVVI..PRDITIP..TEDVLDGIV.KE..SE......ILGR
B6HLN4_PENCW/17-255D.............---------------.HPGI....WGWAV..LGISADD..LRTALDQFQ.QS..VG...IP.PI..
E9D6Y9_COCPS/8-245TP..........TQ---------------ESPRE....WSAAF..FDMTEAA..AVSALVEFD.SV..TP...VP.CK..
K1X7W5_MARBU/800-1037.Q..........NI---------------DSSDP....WTYVL..PTIGEKE..TKSIIDSFH.ND..AG...IP.SA..
L8G6V9_PSED2/30-264GP.........NHD---------------RHHQS....WSAVV...NIQDDE..ASKLIKQFI.LE..KG...LP.HI..
B6QFH1_PENMQ/10-246.Q..........YS---------------GQSQS....WSAVI..SGISEEK..ALSIIAEFS.TK..KD...IS.PS..
B6QER4_PENMQ/12-248............GD---------------DRSQS....WAKAV..FGVSAPD..AQKMVDKFL.IR..EG...ID.AK..
A7F3E3_SCLS1/4-241.N..........QS---------------ESPES....WTYVV..PAAQESE..VNSILNDFH.KE..NA...TP.LV..
N1RV88_FUSC4/8-242YS..........TT---------------SS.......WSMIL..SSNQEEL..VSEALQEFS.KD..KN...LT.SS..
E9F646_METAR/19-261HQ..........ES---------------NGTSS..SPWSYALPDSQLPLAL..AEEAIESYQ.AK..TN...IP.PL..
S3EB79_GLAL2/16-254D.............---------------.KPGV....WGWAV..LGISADD..LRKAMEQFQ.EN..AG...IP.PT..
G4UHA1_NEUT9/13-252.P..........TA---------------EKSES....WTYIF..TNISEGA..ASQVVHDFN.KK..SG...WN.RV..
B6HKK0_PENCW/8-244.P..........SK---------------SATPS....WSVLI..SGMREAE..AQDLIQQYA.EK..NA...LP.RV..
E9F7M7_METAR/10-244..............---------------...GNASSPWSLLV..LGISGDQ..MTTILEGFN.SR..NV...L......
WA_EMENI/8-244.Q..........DQ---------------AAPLS....WSALV..SGLSESE..GTSLIDKFT.RR..NV...IP.PS..
V5GBX6_BYSSN/4-246............LA---------------TDAANP.EPWTITV..AGLTEEG..ARSLLEHFD.EA..VA...LP.GP..
G2QWR8_THITE/16-254HS..........AQ---------------DESES....WTYLF..PLLSHEE..TAVKLAEFQ.ES..TG...IP.PA..
M3CY75_SPHMS/5-242.Q..........PG---------------QEKTP....WSAIV..TGTTQED..AKLALSAFH.EE..KG...IP.LS..
M2RQ22_COCSN/4-241.Q..........SS---------------TSKDS....WSTIV..TNISEDA..AKDAIAAFH.EE..QK...IP.TL..
B8LZ55_TALSN/27-260FT..........VS---------------GGPNS....WSVVV...GVQESE..AARLVENFN.SA..KG...LP.VV..
S3D9A7_GLAL2/4-237.Q..........D.---------------SSDQL....WSTVI..ARHINDD..PDIEITSLN.EK..LN...LK.HG..
G7XN60_ASPKW/8-244.S..........AD---------------SESTC....WSALV..SGISEAE..AGRLIDEYS.SK..KA...TP.PS..
M2T1K1_COCSN/8-240..............---------------.PSQDLDQSWAILI..EGAA.....SASLLSNFN.DE..IS...MP.SI..
E9DR08_METAQ/20-259PH..........QP---------------SDTSS....WSAAV...RPKELNESVESLLKELD.TS..VT...HR.EQ..
S3CWG8_GLAL2/8-245SP..........TG---------------DAAQS....WSAVF..PGLGTSE..AASLIKDFS.ES..KN...IP.KT..
F2PW05_TRIEC/6-242..............---------------TSIDPY.KQWSVAA..AGLLKEA..AEALISRHF.EE..TG...IS.PS..
H1VJ39_COLHI/10-255IKHEGP.....GSS---------------NSFD....SWSRVA..TGSSRKI..LADALLQYA.AD..TG...LP.VI..
U1GE50_ENDPU/4-243.C..........E.---------------PGRKS....WSTIV..AA.DVKA..VEAALSEFH.EE..NG...IC.TS..
A1C888_ASPCL/9-246.S..........SS---------------SSTGS....WSVLV..SDLNEED..AINRIAQFH.EK..RG...IN.PS..
R0KB98_SETT2/8-242.............P---------------SQGAQTDRSWSMLV..GGTDS....ATEAVNKFL.QE..TD...LP.LT..
E4V2N2_ARTGP/10-256TP..........QS---------------D..GTL.KSWAHVV..TEMTQAS..VQDELNQFN.TD..TH...SP.EL..
L8G4G9_PSED2/24-270AR..........DL---------------S..ESP.DSWAYVV..HNVDPAA..AYQELDDMH.SR..MK...TP.NT..
M2ZZX0_MYCFI/5-242.Q..........TG---------------EDKEP....WSTIV..TGIDGAS..AKKALDAFH.KE..KG...IP.QS..
Q2GV63_CHAGB/785-1022A.............---------------.TPTS....WGKTY..VGLATDH..VQDILDKFH.ES..QN...IP.KF..
B8N7H8_ASPFN/9-246E.............---------------.CPGT....WGWAV..LGIPAKE..LGKTLEQFQ.NV..MG...VP.SP..
Q2UA48_ASPOR/8-244.S..........DQ---------------ASSTS....WSVLI..SGISEKD..ASQLIGEFT.AE..RA...IP.PS..
N4VBL7_COLOR/10-255NLD.........GD---------------SAEAASFESWSRAV..TGCCLTA..LADTLLWHA.SD..NG...LP.AI..
B2B495_PODAN/8-245.P..........AN---------------EQSES....WTYIF..PGLKEDD..ATAALESFH.RE..NG...IP.QA..
M4G4F1_MAGP6/8-245.P..........TT---------------DRSES....WTYIV..PGLTEEA..AEAEISEFH.RS..QG...IS.PA..
R7YU14_CONA1/7-242.R..........AP---------------S.TAN....WCMVV..AAPDEHM..VSAAIEDYA.CA..KC...LS.RS..
R0KD65_SETT2/13-258D.............---------------.TVDS....WGWSI..LGVSTSN..LQGYLDAFH.NT..QK...TS.PH..
V5G4B2_BYSSN/8-244.H..........GK---------------EKSQS....WSIVV..SGISEQK..SDALIHEFC.QK..KF...LA.PS..
H1VY29_COLHI/8-245.P..........PV---------------GQSEP....WTHIL..PGLKESD..AKEALTNFH.ES..NY...IP.IA..
L8GBJ0_PSED2/42-283PRAKS......TQT---------------QPNKS....WS.AV...LIAQGDISVEKMVQEYT.NI..KT...PL.HN..
B6QC69_PENMQ/7-243E.............---------------.TPGH....WAHTV..LGVPARE..MDVILKEFH.AS..MN...VP.TH..
G3JFQ9_CORMM/16-246.QRGI......ITT---------------AGNRP....WSAVV......SRDKLVDKLIEKFT.ED..NK...PY.HSKL
F9XMW3_MYCGM/5-242.Q..........SS---------------QDKST....WSTII..SGPSEVD..VKDALTSFH.EA..SG...IP.RS..
G9MXY7_HYPVG/19-259HP..........ES---------------DGTAS....WSYVVPESQFPLEL..AEKTIASYT.DK..AN...IP.RL..
G0RW83_HYPJQ/19-262QP..........QS---------------TGTSS....WSYVVPESQIPLAF..AEKAISSYN.DE..SN...IP.PL..
C5G0R3_ARTOC/8-243............PS---------------EGS......WSMVV..SCDSIDN..IESILCQFS.RD..NN...LP.VT..
K1WM58_MARBU/4-242.R..........TT---------------DQSKT....WSTVV..VGITRDD..AEIALAEFN.RA..HG...LS.KS..
G9NQM0_HYPAI/19-259HH..........RS---------------NGPSS....WSYVVAESQYPLAL..AEKAIAAYK.DS..SM...IP.PL..
A2QH36_ASPNC/29-262PT.........V.E---------------ETPEP....WSAIV...GVSETE..ATSAIQGFN.AE..KG...LP.PV..
STCA_EMENI/11-251IS..........ET---------------NQTQP....WSAVC..H.VPPEE..VAIAIDRFS.HK..KVRSPVY.RA..
Q8EYQ4_LEPIN/19-271.GTYNPSEALLKAN---------------EEVGDKQPAPMVAV..IGYSQKE..LEDRVKQTN.DSLGLS......GS..
C7ZNQ1_NECH7/8-238..............---------------.QSQDLDQSWALLV..PGSK.....SAAAVEKFC.EE..SN...LP.LT..
M2N8F6_BAUCO/8-232SS..........VS---------------SEQEP....WSVLY..FGVDEPA..AAAALEKFS.RE..............
G7Y059_ASPKW/7-243............IE---------------ASTQS....WAVSV..KRASAGE..LERVIASFN.EE..QE...LP.EH..
E4V6P4_ARTGP/8-243............PS---------------EGA......WSMVV..SCDSTDK..IQERLSKFS.RE..NN...LP.VT..
U1GYJ0_ENDPU/26-259RP.........S.S---------------RIPRS....WSAIV...SASEAQ..AAELLQSFN.SK..NT...LS.GS..
H6BVA1_EXODN/5-241.C..........D.---------------SKTQS....WSTIV..AA.DEKS..AQEALDAFH.KE..KG...TS.PI..
E9F7X1_METAR/8-256.......SVTDVHS---------------SCSSV........V..SGVDEET..MAPRIEAYC.VS..RG...LA.AL..
E3R122_COLGM/12-243..............---------------.ASDHQHQNWSLIV..SGIG.....ISEIINEFC.HE..TS...LS.AA..
G2WRK7_VERDV/8-245.P..........AT---------------DRSDP....WTHVL..VDVTEAD..VNKALQSFH.SS..HS...VP.PP..
G0SDA9_CHATD/19-258.P..........AS---------------ESLDKF...WTYVF..PGQEEKA..LAERLTAAQ.DQ..HN...IP.GA..
B6QHV7_PENMQ/4-241.P..........VV---------------HESKS....WTSLV..TGVDLQA..VASAIHAFN.RT..QR...LQ.NA..
Q2UG06_ASPOR/8-245GC..........SD---------------DRGDP....WSTIV..WGLDPQQ..ARDQIEVFC.QT..TN...VP.QT..
C5FQT2_ARTOC/8-245.N..........DT---------------DRNKN....WSYIV..PKLQVDL..AASRIEQFS.QS..AN...LP.IG..
E9D5J9_COCPS/7-242............SD---------------DRSES....WATAV...GVSLEE..AQGVVATFN.QS..KD...LS.AA..
N1PC72_MYCP1/5-242.Q..........AG---------------QEKVP....WSTIV..TGTTESA..ARESLAAFH.TE..RG...IA.QS..
E3R0Q2_COLGM/12-250D.............---------------.RRGV....WGWAV..VGVALED..LSKSLEEFQ.QS..VG...IP.PL..
R8BTJ4_TOGMI/8-245.P..........SV---------------QRSQS....WTYIL..PGVKQDQ..ARLILDEFH.HA..NG...TP.LA..
G4MU27_MAGO7/14-251.P..........VS---------------ERSES....WTYIV..PGFTEEA..AQKEIAGFH.ES..HG...IP.QA..
R7YTG2_CONA1/4-241............QA---------------NSRES....WSTIV..TGISEQS..ANAALADFH.SE..KG...IP.IS..
U7PRD0_SPOS1/5-267D...........TA---------------STSSTTTAAWATLVTNITADRAA..IDAALADFN.QT........RVLAAD
E5A495_LEPMJ/4-241.R..........AP---------------NSKQS....WST.V..TGVSEDV..AKDALASFH.EQ..RR...IP.PA..
E9F8F0_METAR/70-305R.............---------------.TNGP....WARTI..LGISVDR..VREILQDFH.EN..QS...IP.RA..
B8NVD5_ASPFN/5-241GD..........GG---------------SQWKP....WSLAV..TDGSESE..TEKILEEFT.RD..EG...LP.AI..
B8MV60_TALSN/15-255G.............---------------.KPGR....WAVAI..VNVPPKQ..IRNIITAFN.ED..MA...IP.KH..
E9FC93_METAR/16-256VE..........RS---------------DASMT....WSASV..LPTTSAT..VEELLASFT.KS..AT...VLEDY..
G9NBV5_HYPVG/10-247D.............---------------.SSGD....WARTY..VGITREK..MKSILDEFH.SS..NN...IP.PI..
R1G9D8_BOTPV/4-241............HA---------------EEAQS....WSTIV..AGISEES..AKTALADFH.QE..KG...IA.LS..
S3CAW2_OPHP1/8-244.P..........SE---------------KASGS....WTYIF..PNQTEEK..VSNVLSDFN.KS..NG...IP.AA..
B2B664_PODAN/7-242..............---------------....PSTGSWATLV..SQVDISA..AREAIGIFN.RN..........SIPR
M1WG96_CLAP2/23-272AR..........DV---------------S..GKP.ASWAYLV..QIADSDA..AQAELDLLYGNA..ES...SA.NS..
E9F5C9_METAR/8-246............ND---------------DRTKS....WATAV...GTDLKS..AQSVVDGFN.RS..KD...LS.QS..
I1RF58_GIBZE/4-241.V..........PD---------------RPSAT....WSIIVPEAVLPRES..AQDRLDSFI.IE..MG...LA.RS..
G2YLD0_BOTF4/4-242.T..........AS---------------DRQKT....WSTIV..MGISSEA..AEHALAEFN.ES..RG...LV.QS..
B2W1Q0_PYRTR/9-246E.............---------------.RPGT....WGWAI..LGISAAE..LGETLEQFQ.SS..MG...IP.SS..
C7Z6X3_NECH7/7-240GN.........N.E---------------EHERS....WSVII...PGEEKE..IQEKLDRWG.AS..GN...LH.DL..
E3QS53_COLGM/10-256NDDE........NS---------------GGSASEFAAWSYAV..ASSSPKA..LADALKQYA.AE..TR...LP.IV..
G9NGU8_HYPAI/9-247S.............---------------.APGS....WAVAI..VSVDPQE..IENIINAFN.DD..MA...IP.QH..
B8MYS6_ASPFN/10-247.............P---------------QTGAPL.A.WSVLI..PGLDGDT..ASLTLQKYN.EE..KG...LP.AT..
G2RCG6_THITE/8-247.P..........QP---------------QTGPPA.S.WSVLI..PNSGGED..PGPVIGRYN.EE..KG...LP.AT..
S0DTP6_GIBF5/8-239..............---------------.PSQDLNRSWALLV..PGQK.....AAKAFQEFW.DA..ND...GGVLT..
G2QMK9_THIHA/8-254ASGLAAGSSSTTAS---------------DSTSV.....SYAV..SGIDGAT..AASLVDQFC.RS..RS...LA.PA..
F0XGQ5_GROCL/8-244.P..........AT---------------GRSES....WTYIF..PSQKEEE..TRKVLSEFC.HG..KS...LP.QA..
T0KJR9_COLGC/11-253DG..........DS---------------GSSSS....WGCAV..VGITPEK..LDGILHQIQ.ES..SK...VP.SL..
M2RHZ9_COCSN/9-246..............---------------....SGTGSWAFSVLGKDIVAQ...LPDILNQFH.RE..QS......IPRH
R0JX83_SETT2/4-242............QN---------------QRSAHSNESWSISV...PVPFEK..LQEELQTVQ.DD..AN...LS.VA..
L8G0G7_PSED2/41-278.E..........SG---------------DAAKS....WTYVV..PGLNESA..ARSLLADFN.ES..KG...YT.TT..
Q2HGW2_CHAGB/17-254.P..........AF---------------ERSES....WSYIF..SVSSVED..VTQTLDAFH.DT..SN...LP.PA..
B8MF01_TALSN/8-245L...........SG---------------NASDS....WSMVI..PGLKEDP..AIAVLEKFS.SE..MG...IP.VA..
N4VM62_COLOR/16-257D.............---------------.SSDS....WGWSI..IGMTRVD..LQSHLDSFH.QQ..HH...IQ.AH..
S3DAZ0_GLAL2/11-247.G..........AN---------------DNANP....WAYSI...SADEAQ..AASKLDEFH.AE..KA...IS.HA..
E3SAD1_PYRTT/8-240..............---------------.SSQNLDQSWAMLI..ESAA.....SAQLIHEFN.EK..SS...MP.SI..
U7PK37_SPOS1/8-244.P..........PS---------------EKSES....WTYVY..PNQQEED..IRRVLSEFC.RS..NS...IP.PA..
B2B6C8_PODAN/41-279TS..........AP---------------DRARP....WSVVV..SGLMPQV..AEAFVKEFC.DG..NA...LP.KT..
V5G236_BYSSN/6-248.............P---------------G.HEG....QTWAM..SRDKNAV..DDEVLKRIQ.ED..LV......STVD
M2NM35_BAUCO/5-243.Q..........IG---------------EEKAP....WSTIV..TGTTEQA..AKEALAAFH.QE..KG...IP.QS..
B6QAB8_PENMQ/31-263YR..........GS---------------TGSNS....WSVVV...GIHESE..AAQLVTTFN.AG..KR...LP.PV..
M2XHZ5_MYCP1/10-247SS..........EE---------------DRTQP....WSVVL..FDTDEQT..VTKAIKDFC.TS..NV...LP.KT..
R7YHB3_CONA1/8-244.Q..........TS---------------TNSAS....WSAIF..PGIDKEA..AFMAHEDFC.TT..HG...IP.PA..

PF01735

PLB2_SCHPO/134-617QRFVDV------------------------------IFAVDATY.DDSNGWPD.GSSIVTTYERIITYNANKSV.DVRGF
PLB5_SCHPO/125-607QRDVDV------------------------------IFAIDGGYQSATSGWPD.GSSLVSTYERVLA...TNSS.GVRGF
PLB1_YEAST/99-586ERELDV------------------------------IFALDNSA.DTDDYWPD.GASLVNTYQRQFG....SQG.LNLSF
PA24A_CHICK/190-675CYPLSP------------------------------LADLLTQE.SVEEDELDAAVADPDEFERIYE...PLDV.KSKKI
PLB_NEUCR/121-606VRAVDV------------------------------IFAVDSSA.DVTN.WPN.GTALRATYERTFG....SIS.NGTLF
PLB_KLULA/102-589EREIDV------------------------------IFALDNSA.DTDQSWPD.GFSLTQTYARQFG....LQG.KGIAF
PLB6_SCHPO/114-600ERKLDV------------------------------VFAFDSSG.DTSNFWPN.GSSLVATYERVTQR.ASDAVYDVEDF
PA24A_DANRE/185-664TLPFSP------------------------------FSGITHQT.SLEE.EVD.AVTDPDEFERIYE...PLDV.KSKKI
PLB1_CANAL/88-565.RNVSA------------------------------IFAFDNSN.DVLN.WPD.GTSLVKTYERQFS....SQG.NGIAF
PLB3_YEAST/105-592ERDVDI------------------------------IFAVDNSA.DMRLAWPD.GSSLVHTYERQFV....KQG.QGMSF
PLB1_SCHPO/114-593GRDVDV------------------------------IVAVDNGD.DSEWLWPN.GNSLVQTYERVVAAQAAGNT.NVKGF
PLB2_YEAST/101-588ERDLDV------------------------------VFALDISD.NTDESWPS.GVCMTNTYERQYS....KQG.KGMAF
B6HB59_PENCW/114-597ERHVDV------------------------------IFAVDSSA.DTDYFWPN.GTSLVATYERSLN..SSGIA.NGTAF
G8ZY27_TORDC/97-584ERNIDV------------------------------IFALDNSA.DTDYYWPD.GASLVSTYERQFS....SQG.MNMSF
Q59W34_CANAL/88-564.RKVSA------------------------------IFAFDQSA.DKNN.WPD.GSALIKTFERQFS....SQG.DGIAF

PF01734

Q9N5Z7_CAEEL/97-269KIDLID..............................CLM...AS-------------------------------C..YH
G7QJN7_LEPII/12-165KGDLID..............................QIL...AS-------------------------------.....
B8GC44_CHLAD/8-228QVPISL..............................AVC...AS-------------------------------A..AI
C1DSE3_AZOVD/14-206HELSVD..............................CVL...AS-------------------------------A..CL
A9BEP0_PETMO/3-174ETKIVD..............................MLM...ME-------------------------------L..AF
A9B328_HERA2/4-179RERLVD..............................ALM...AS-------------------------------A..AV
B2U808_RALPJ/9-214PEDLAD..............................LLL...QS-------------------------------A..ST
Q3AAC7_CARHZ/6-206DALLVT..............................ALE...AT-------------------------------S..AV
A6CHF0_9BACI/8-175GKDVLT..............................PIR...AS-------------------------------S..SL
Q2GUC2_CHAGB/19-224SCRIWE..............................AAS...AT-------------------------------A..AA
Q9XAG3_STRCO/16-207GVDLLH..............................AMS...AT-------------------------------C..AL
A0A022N4I9_9ACTO/11-221RATLSE..............................AVM...AS-------------------------------C..AI
Q8R6F6_FUSNN/65-256KGDVAK..............................ILI...AS-------------------------------M..SI
D5AXK0_RICPP/15-214NYYLSD..............................IIQ...GI-------------------------------T..AA
Q038G8_LACC3/6-159APEARE..............................WLL...AS-------------------------------S..AM
A5IE43_LEGPC/25-249DVEIAL..............................ACR...AS-------------------------------A..SI
Q4UJC7_RICFE/42-240HIRVQD..............................VLL...AT-------------------------------T..AA
Q54HM9_DICDI/140-357NVKVSE..............................ALN...AS-------------------------------S..AA
Q2K9E1_RHIEC/30-248ALSLAT..............................AVA...AS-------------------------------A..AF
A4IAC8_LEIIN/190-378DVLVRS..............................AVL..CAI-------------------------------C..PT
Q21S96_ALBFT/26-231PGDLAD..............................LII...AS-------------------------------S..CV
A5GF97_GEOUR/15-187DLKVAT..............................AAR...FS-------------------------------T..GV
Q1CW69_MYXXD/353-514QGPVAL..............................AVR...AS-------------------------------G..SA
A6NV66_9FIRM/7-176HFELLQ....................................AT-------------------------------C..AL
A0A038KND4_MYCTX/181-420DVNVVD..............................AAS...FS-------------------------------S..AI
A0YM74_LYNSP/12-230NETIYN..............................LLL...AS-------------------------------V..AI
Q5X5T5_LEGPA/27-309DMPVSI..............................AVR...IS-------------------------------A..SL
Q2GS92_CHAGB/73-327PEQLIS..............................IPE...VA-------------------------------KAITT
Q1ZT25_PHOAS/33-203QDDWYE..............................VLR...AS-------------------------------C..AI
Q5CY77_CRYPI/46-241LEEIIE..............................AVI...GS-------------------------------G..TI
A0A039K3R0_MYCBI/806-965QGPLAD..............................VVG...CS-------------------------------M..RL
PATA2_SOLTU/32-227DAKMYD..............................ICY...SA-------------------------------A..AA
A6G7S9_9DELT/458-735AMRLRD..............................AVY...AS-------------------------------S..IM
C6TYS0_BURPE/13-264LDRLAR..............................AAR...ST-------------------------------A..SF
A4F8K0_SACEN/17-281VRRLAH..............................AAR...TT-------------------------------S..SF
Q2R2X0_ORYSJ/139-303KDDVIS..............................AVI...TS-------------------------------S..FI
Q0A7T0_ALKEH/6-219VRLGVQ..............................HLL...AS-------------------------------S..AL
A0A031KR74_ENTFC/138-323TEEIPD..............................WIL...AS-------------------------------A..SF
M6BTQ1_LEPBO/13-188SSNIFD..............................LLK...AA-------------------------------T..SL
E3VZB4_MIMIV/38-270NIKLYD..............................SIL...AS-------------------------------S..AF
Q0FZD9_9RHIZ/20-226QGKLID..............................LIC...AA-------------------------------A..VI
Q5A7P0_CANAL/211-417NCLIWS..............................AVC...AS-------------------------------C..SV
Q11UC9_CYTH3/381-624DLHFMS..............................ALR...MS-------------------------------A..TF
A6ASA3_VIBCY/5-186YWTLEQ..............................VAL...AT-------------------------------S..AA
Q1D826_MYXXD/142-382DFDALD..............................AAG...FS-------------------------------S..AL
A0AZM8_BURCH/61-294TLPLSR..............................AVA...AS-------------------------------A..AF
Q5CE49_CRYHO/149-342RSIIPS..............................IIR...SS-------------------------------S..AF
A4HB10_LEIBR/40-220YAAIRE..............................TLI...AS-------------------------------C.CLV
I0WT11_9NOCA/7-221TTLQPE..............................HVL...AS-------------------------------A..AV
A3QTZ2_9VIRU/28-255DEYVTK..............................AVY...AS-------------------------------M..TL
Q1D5W1_MYXXD/154-432EVSLSN..............................LLLTPQAS-------------------------------G..AF
Q09D74_STIAD/17-214VTTLVD..............................AAL...AS-------------------------------S..AF
A4BNM2_9GAMM/38-218KGLLLP..............................AIL...SS-------------------------------M..SL
Q4LA62_STAHJ/11-202QVNLHR..............................AMA...SS-------------------------------G..SL
Q5ZPA4_9DELT/22-208DDYLVD..............................LAL...RS-------------------------------S..SL
D3MBX2_PROAA/25-319TFDVSR..............................GVL...AS-------------------------------C..SI
NTE1_PICST/1239-1403SGYSWR..............................FIR...AS-------------------------------M..SL
A4SJS7_AERS4/8-174AAELEQ..............................QIK...AS-------------------------------C..SV
Q1I961_PSEE4/42-302SVHPAM..............................FAR...AS-------------------------------M..SI
A7RB12_PBCVA/19-192DMDVRT..............................AIR...MS-------------------------------C..SI
Q0VPN6_ALCBS/36-193SGNLVE..............................SVY...AS-------------------------------C..AV
A6G1N7_9DELT/36-362AVGCSS..............................AAY...GA-------------------------------VADEL
A6QA07_SULNB/41-281TAKITD..............................VLF...AS-------------------------------S..AF
Q5WWS2_LEGPL/304-496LLEVSE..............................AVK...IS-------------------------------A..SF
A0Z6H0_9GAMM/8-199QVLCKS..............................AAR...AT-------------------------------S..AA
A6LMU7_THEM4/5-176EGFLVD..............................AVM...AS-------------------------------S..SV
A7I0A5_CAMHC/6-211KNEIID..............................YLL...SS-------------------------------A..SF
C7LH54_BRUMC/13-187DGDLRS..............................AIA...AS-------------------------------C..AI
A6G3Y0_9DELT/12-216PAELID..............................WIV...AS-------------------------------S..TI
A1DP95_NEOFI/20-225TATIVQ..............................AGQ...AC-------------------------------L..AS
A5K2I7_PLAVS/1168-1482AANVLEKTPHTSDIYVNQNINSVSIYKSFYNIFVKYVLR...CT-------------------------------T..AA
TEG_BACME/7-180NEKASD..............................VIL...RS-------------------------------S..AA
Q2W5X1_MAGSA/6-225GKDVLD..............................YPH...FG-------------------------------ATLAY
A4U0C8_9PROT/5-257QGISAQ..............................TLC...AC-------------------------------S..AL
A5N2W9_CLOK5/4-191NGKMIN..............................YLM...AS-------------------------------A..NF
A4JJZ7_BURVG/8-242EAEQKA..............................ALL...AS-------------------------------A..AI
A6R0J1_AJECN/673-891DPFVWQ..............................SAR...AT-------------------------------S..AA
A0A024F582_BDEBC/72-224RGGIDQ..............................LMY...LC-------------------------------M..AY
A5P920_9SPHN/106-312VEALTA..............................AAM...AS-------------------------------S..AM
Q2C291_9GAMM/11-214ETITAE..............................HIM...AS-------------------------------G..AM
A1VHY7_DESVV/116-308DTPIHE..............................ALR...IS-------------------------------M..SI
A7BB55_9ACTO/26-199LDTLGP..............................IIR...AS-------------------------------S..TL
A5I1W5_CLOBH/6-200ELEISK..............................AVT...MS-------------------------------I..SI
A8GLS3_RICAH/7-147NIDLYV..............................VIL...IS-------------------------------V.LNF
A4T0K7_POLSQ/80-285NIALAH..............................GAA...AS-------------------------------S..SL
A6DDL8_9PROT/5-162AGDPKK..............................IIP...AS-------------------------------C..AI
A4CKZ2_ROBBH/4-195YDEFCE..............................WIW...IS-------------------------------C..NY
A0A031WAB0_PEPDI/5-179NEAIIS..............................ISY...SG-------------------------------LLPSN
A0A014PKG8_YERPE/86-275LMLFRK..............................VML...AS-------------------------------S..SV
M6C3B5_LEPBO/36-250EKTVEQ..............................IIL...NS-------------------------------S..SV
Q12EZ0_POLSJ/6-228RFPLRD..............................AMA...VS-------------------------------A..AF
Q1GX66_SPHAL/43-328VPGLAA..............................AAR...AT-------------------------------A..SF
Q4RS54_TETNG/14-183KEELVQ..............................ACV...CS-------------------------------A..FI
Q5C8M6_LEGPN/32-295QQSIAQ..............................VVQ...WS-------------------------------G..AH
Q6JBI3_DICVI/201-395GHYLWK..............................AIQ...AS-------------------------------A..AA
Q0FKF7_PELBH/6-360DFPLLL..............................VAR...LS-------------------------------L..SF
N0BV45_SALTI/8-168EGDLHL..............................AVR...AS-------------------------------C..SM
Q6ASS6_ORYSJ/60-258DFALRD..............................VCA...AT-------------------------------C..AA
A6QX75_AJECN/242-440NVLIWS..............................AAA...AS-------------------------------N..VS
Q74A07_GEOSL/58-306GVSVAR..............................AVA...AS-------------------------------S..NF
Q54XY1_DICDI/13-231ALSLAD..............................AIR...AT-------------------------------S..SI
Q55G69_DICDI/65-250STSVVD..............................IIR...ST-------------------------------A..GI
Q5Z158_NOCFA/22-193KRSLMR..............................ALR...AS-------------------------------A..NL
Q54QX6_DICDI/893-1088NSNVID..............................AAE...AT-------------------------------S..AA
A1UXE2_BURMS/413-612DRLSPA..............................HVL...AS-------------------------------G..SL
A2QZY6_ASPNC/473-679DHEMQT..............................TGV...AS-------------------------------L..AH
A4XTW9_PSEMY/15-385DLPVVV..............................AVR...MS-------------------------------L..SF
Q0E508_SFAVA/27-224NMSISE..............................GFS...AS-------------------------------CSLAV
A6GI17_9DELT/71-215..VIIR..............................GII...LS-------------------------------LLIVL
A7IE20_XANP2/6-198VELIAD..............................VVL...RT-------------------------------M..AM
Q1DCU7_MYXXD/197-406VEGIIN..............................GVV...AS-------------------------------I..VE
Q6MAN6_PARUW/474-738DIIISD..............................AVR...AS-------------------------------M..SI
Q4Z1R8_PLABA/352-558KIPLWL..............................AAW...AT-------------------------------A..SA
A4RTL4_OSTLU/164-398EADLKK..............................SLL...AS-------------------------------A..RV
A0JUC4_ARTS2/74-249ARDVDA..............................ELL...AA-------------------------------G.MSL

PF00698

FAS_HUMAN/493-810QAVLKR------------------------------GLK.....-------------------------------.....
STCK_EMENI/1547-1902LRGHID------------------------------GYRQYLRH-------------------------------HLRVS
FAS_CHICK/492-809QAILRR------------------------------TLK.....-------------------------------.....
FAS1_YEAST/1663-2037LMNGVK------------------------------PFKSFLKK-------------------------------NIIKE
A4F7N8_SACEN/109-425AAALQQ------------------------------TLD.....-------------------------------....A
A4F7P0_SACEN/560-880VQAVEE------------------------------AVEE....-------------------------------...AD
I6Y231_MYCTU/534-851THAVEQ------------------------------TGRS....-------------------------------....L
PPSA_MYCTU/632-950TQAIID------------------------------TLHS....-------------------------------...AQ

PF16073

B8MGX9_TALSN/8-250KKPYIT------------------------------AYFP.KT.-------------------------------..VTI
B6HLN4_PENCW/17-255KRAKVG------------------------------VSG....V-------------------------------GWNTV
E9D6Y9_COCPS/8-245LRPWIG------------------------------ATSS.KA.-------------------------------..ITI
K1X7W5_MARBU/800-1037NHVYIS------------------------------AITN.SS.-------------------------------..IAV
L8G6V9_PSED2/30-264SKPYLS------------------------------AITP.SN.-------------------------------..VTI
B6QFH1_PENMQ/10-246SRPYVS------------------------------AVSY.NG.-------------------------------..LTI
B6QER4_PENMQ/12-248KGVYVA------------------------------ATSA.WA.-------------------------------..STV
A7F3E3_SCLS1/4-241NQAYIS------------------------------AITS.KS.-------------------------------..IAI
N1RV88_FUSC4/8-242TRPYIS------------------------------AVGP.GF.-------------------------------..TTI
E9F646_METAR/19-261SLPYIS------------------------------AKGQ.NS.-------------------------------..WTV
S3EB79_GLAL2/16-254KRAKVG------------------------------VTG....A-------------------------------GWSTI
G4UHA1_NEUT9/13-252NRLYLS------------------------------ASSS.QS.-------------------------------..VAI
B6HKK0_PENCW/8-244SQPYIS------------------------------AVSP.NG.-------------------------------..LTI
E9F7M7_METAR/10-244IRTILP------------------------------CIHQRLWN-------------------------------GWCDI
WA_EMENI/8-244SRPYIS------------------------------AVCA.NT.-------------------------------..LTI
V5GBX6_BYSSN/4-246NRPYIS------------------------------AISH.SA.-------------------------------..VSL
G2QWR8_THITE/16-254NRAYVS------------------------------AVSS.SG.-------------------------------..IAV
M3CY75_SPHMS/5-242NQAYIS------------------------------AVSV.MA.-------------------------------..ITI
M2RQ22_COCSN/4-241AQAYIS------------------------------AVST.MA.-------------------------------..LTI
B8LZ55_TALSN/27-260SSIYLS------------------------------CMNR.NN.-------------------------------..TSV
S3D9A7_GLAL2/4-237RKLYIS------------------------------SIGP.ST.-------------------------------..ITI
G7XN60_ASPKW/8-244SKPYIS------------------------------AVSA.NG.-------------------------------..VTV
M2T1K1_COCSN/8-240NKPYIS------------------------------AYAP.SG.-------------------------------..VTV
E9DR08_METAQ/20-259ARLYIS------------------------------VTTPDHP.-------------------------------..TTI
S3CWG8_GLAL2/8-245SQPWIG------------------------------ATAG.KS.-------------------------------..TTI
F2PW05_TRIEC/6-242ARLYVS------------------------------AVAS.GS.-------------------------------..VSL
H1VJ39_COLHI/10-255TTPYIS------------------------------AIIGTTQ.-------------------------------..ATI
U1GE50_ENDPU/4-243NRLWIS------------------------------AASA.TA.-------------------------------..VTV
A1C888_ASPCL/9-246SRPYIS------------------------------AVGS.KG.-------------------------------..LTI
R0KB98_SETT2/8-242DRPYIS------------------------------AVAP.SG.-------------------------------..ITV
E4V2N2_ARTGP/10-256TKVFIS------------------------------AADK.TS.-------------------------------..VSV
L8G4G9_PSED2/24-270GKIFIS------------------------------AVSR.TS.-------------------------------..VTV
M2ZZX0_MYCFI/5-242NQAYVS------------------------------AVSV.MA.-------------------------------..ITV
Q2GV63_CHAGB/785-1022RRITIG------------------------------VVA....Q-------------------------------GWLTL
B8N7H8_ASPFN/9-246KRAKVG------------------------------VNE....D-------------------------------RWSTV
Q2UA48_ASPOR/8-244SKPYIS------------------------------AVGY.NS.-------------------------------..ITI
N4VBL7_COLOR/10-255KAPYIS------------------------------AVVGPTQ.-------------------------------..ATV
B2B495_PODAN/8-245SRAYVS------------------------------AASA.SS.-------------------------------..LAI
M4G4F1_MAGP6/8-245SRAWVS------------------------------ATST.AN.-------------------------------..CAI
R7YU14_CONA1/7-242SRPYIS------------------------------AVST.SS.-------------------------------..LAI
R0KD65_SETT2/13-258RRVKIG------------------------------ASG..VDD-------------------------------GWHTI
V5G4B2_BYSSN/8-244SRPYVS------------------------------AVNT.HS.-------------------------------..LTI
H1VY29_COLHI/8-245SQAYVS------------------------------AVSA.SS.-------------------------------..LAI
L8GBJ0_PSED2/42-283AALWIS------------------------------AITP.KT.-------------------------------..TTL
B6QC69_PENMQ/7-243RQVFIG------------------------------VED....E-------------------------------SWLTL
G3JFQ9_CORMM/16-246SNLYIS------------------------------ATTP.FT.-------------------------------..ATV
F9XMW3_MYCGM/5-242NQAYVS------------------------------AVST.MA.-------------------------------..LTV
G9MXY7_HYPVG/19-259SSPYVS------------------------------AKGQ.NS.-------------------------------..WTI
G0RW83_HYPJQ/19-262SSPYIS------------------------------AKGQ.NS.-------------------------------..WTL
C5G0R3_ARTOC/8-243SRPWIS------------------------------AYGEESW.-------------------------------..VSI
K1WM58_MARBU/4-242KCLYTS------------------------------AVGS.MS.-------------------------------..VTI
G9NQM0_HYPAI/19-259SSPYVS------------------------------AKGQ.NS.-------------------------------..WTV
A2QH36_ASPNC/29-262YRLYLS------------------------------SVSR.TN.-------------------------------..VSI
STCA_EMENI/11-251QRPWIT------------------------------ATSA.KT.-------------------------------..TTV
Q8EYQ4_LEPIN/19-271KAIYVS------------------------------LYNTPDS.-------------------------------..NIV
C7ZNQ1_NECH7/8-238SRPYIS------------------------------AYAP.NG.-------------------------------..ITV
M2N8F6_BAUCO/8-232......------------------------------.....KA.-------------------------------..LTI
G7Y059_ASPKW/7-243KRAYIS------------------------------AELD.TS.-------------------------------..VTI
E4V6P4_ARTGP/8-243SRPWIS------------------------------AYGEENW.-------------------------------..VSI
U1GYJ0_ENDPU/26-259SRLFLS------------------------------AVSP.NS.-------------------------------..ITI
H6BVA1_EXODN/5-241NQLWIS------------------------------ASSA.TS.-------------------------------..VTI
E9F7X1_METAR/8-256SRVYIS------------------------------AVGS.GS.-------------------------------..VTI
E3R122_COLGM/12-243SRPYIS------------------------------AYME.KS.-------------------------------..MTL
G2WRK7_VERDV/8-245SQAYIS------------------------------AVST.HR.-------------------------------..LAV
G0SDA9_CHATD/19-258NRAYIS------------------------------AVSA.NS.-------------------------------..IAV
B6QHV7_PENMQ/4-241NKLYVS------------------------------AVAS.NS.-------------------------------..TAV
Q2UG06_ASPOR/8-245RRPWIS------------------------------CISK.NA.-------------------------------..ITL
C5FQT2_ARTOC/8-245FRPFIG------------------------------IVAP.CS.-------------------------------..VTI
E9D5J9_COCPS/7-242KGLYCG------------------------------ATSA.WA.-------------------------------..TTI
N1PC72_MYCP1/5-242NQAYIS------------------------------AVST.MA.-------------------------------..LTI
E3R0Q2_COLGM/12-250KRAKPG------------------------------VTG....A-------------------------------GWSTI
R8BTJ4_TOGMI/8-245ARAYVS------------------------------AVSA.SN.-------------------------------..VAV
G4MU27_MAGO7/14-251SQVYVS------------------------------ASSS.AN.-------------------------------..VAI
R7YTG2_CONA1/4-241QQAYVS------------------------------AVST.MA.-------------------------------..LTI
U7PRD0_SPOS1/5-267RRVYIS------------------------------SASS.TLS-------------------------------SVITL
E5A495_LEPMJ/4-241AQAYIS------------------------------AVST.MA.-------------------------------..ITI
E9F8F0_METAR/70-305RQVCIG------------------------------FVS....D-------------------------------GWLTL
B8NVD5_ASPFN/5-241MKPYVS------------------------------AAGS.NT.-------------------------------..LTI
B8MV60_TALSN/15-255RQFYIS------------------------------FLA....K-------------------------------GWAAI
E9FC93_METAR/16-256EAIWVT------------------------------ARTPTEV.-------------------------------..TTL
G9NBV5_HYPVG/10-247RQISIG------------------------------VVS....E-------------------------------KWTTI
R1G9D8_BOTPV/4-241NQAWVS------------------------------AVSV.MA.-------------------------------..ITI
S3CAW2_OPHP1/8-244SSAYIS------------------------------AVSS.SN.-------------------------------..VAV
B2B664_PODAN/7-242HQVYIS------------------------------AESP.NS.-------------------------------..VTI
M1WG96_CLAP2/23-272NKIIIS------------------------------AVSQ.TS.-------------------------------..IVA
E9F5C9_METAR/8-246EGLYVG------------------------------VTSA.WA.-------------------------------..TTI
I1RF58_GIBZE/4-241SVPYIS------------------------------SVAH.HN.-------------------------------..MTI
G2YLD0_BOTF4/4-242TRLYIS------------------------------AIGT.SS.-------------------------------..VTI
B2W1Q0_PYRTR/9-246KRAKVG------------------------------VLG....D-------------------------------RWSTI
C7Z6X3_NECH7/7-240WRPYIS------------------------------ATAP.NN.-------------------------------..ITL
E3QS53_COLGM/10-256SVPYIS------------------------------AIVGPTQ.-------------------------------..TTI
G9NGU8_HYPAI/9-247RHIYIS------------------------------TLA....H-------------------------------RWAVI
B8MYS6_ASPFN/10-247SAPYIS------------------------------TYAN.TG.-------------------------------..VTL
G2RCG6_THITE/8-247SAAYIS------------------------------SYAN.TS.-------------------------------..FTL
S0DTP6_GIBF5/8-239SMPYIS------------------------------AYAP.NG.-------------------------------..ITV
G2QMK9_THIHA/8-254ARVYVS------------------------------AVGN.GN.-------------------------------..VTV
F0XGQ5_GROCL/8-244SQIYIS------------------------------AVSA.SS.-------------------------------..VAV
T0KJR9_COLGC/11-253KRARVG------------------------------IRG....D-------------------------------HWGTV
M2RHZ9_COCSN/9-246RRAWIA------------------------------VST....P-------------------------------TWATV
R0JX83_SETT2/4-242GRAFIT------------------------------TVGI.ST.-------------------------------..CII
L8G0G7_PSED2/41-278SQAYIS------------------------------AITS.TS.-------------------------------..IAF
Q2HGW2_CHAGB/17-254SRAYIS------------------------------AVSD.NG.-------------------------------..IVV
B8MF01_TALSN/8-245SRPYIS------------------------------ASSH.SG.-------------------------------..VTL
N4VM62_COLOR/16-257RRAKIG------------------------------VSD..VDD-------------------------------GWHTV
S3DAZ0_GLAL2/11-247SRAYIS------------------------------ATTP.DS.-------------------------------..VAI
E3SAD1_PYRTT/8-240SKPYIS------------------------------AYAP.GA.-------------------------------..VTV
U7PK37_SPOS1/8-244ATGYIS------------------------------AVSS.GN.-------------------------------..VAV
B2B6C8_PODAN/41-279RYPWIT------------------------------ATAA.KS.-------------------------------..TTI
V5G236_BYSSN/6-248TKVYIS------------------------------GEFP.KT.-------------------------------..ITL
M2NM35_BAUCO/5-243NQAYVS------------------------------AVSV.MA.-------------------------------..ITI
B6QAB8_PENMQ/31-263SAIYLS------------------------------CITH.SN.-------------------------------..TSI
M2XHZ5_MYCP1/10-247KQPWIT------------------------------SASS.KT.-------------------------------..ITI
R7YHB3_CONA1/8-244SGLFVS------------------------------ATSS.NA.-------------------------------..VTI

PF01735

PLB2_SCHPO/134-617PYIPDEDTIIS.LGLNTHPTFFGCDGRNTTAGNHTVDNNTPPLLVYFPNYPWVYYSNISTFTMSMNDTLSSGILEN.AAL
PLB5_SCHPO/125-607PYIPDTNTFLA.LGLNTHPTFFGCDGRNTTAGNHTVNDDTPPLVVYFPNYPWTMYANVTTYTVQLEDTLSSGMIEN.AAV
PLB1_YEAST/99-586PYVPDVNTFVN.LGLNKKPTFFGCDARNLTDL.....EYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKN.GFE
PA24A_CHICK/190-675HIVDSGLTFNLPYPLILRP.QRGVDLIISFDFSARPSDSSPPFKEILLAEKWAKMNKLPFPKIDPNVFDREGLKECYVFK
PLB_NEUCR/121-606PSIPDDWTFIN.LGLNNRPSFFGCDVKNFTLN...ANQKVPPLIVYVPNAPYTALSNVSTFDPSYTMSQRNDIIGN.GWN
PLB_KLULA/102-589PYVPDVNTFTN.LGLNTRPTFFGCDARNLTDL.....ESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQN.GFE
PLB6_SCHPO/114-600VHVPTPETFVN.LGLNANPTFFGCDGRNTTRGDVPVDHNTPPLVVYMPNTPWTMKSNLVDHRYRIANSEIQALIQN.GFV
PA24A_DANRE/185-664HVVDSGLTFNLPYPLILRC.QRGVDLIISFDFSARPSDSSPPFKELLLAEKWARMNKLPFPKIDSKVFDREGLKECYVFK
PLB1_CANAL/88-565PYVPDQYTFRN.LNLTSKPTFFGCDAKNLTSL..TKDIYDVPLVIYLANRPFTYWSNTSTFKLTYDDNERQGMISN.GFE
PLB3_YEAST/105-592PYVPDTNTFVN.LGLNKKPTFFGCDANNLTDL.....QYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQN.GFE
PLB1_SCHPO/114-593PYVPSQQSFVS.LHFNDRPVFFGCDGRNTTAGNHTVTRDTPPLVIYLPNVPYNYFTNISTDRTYYTEDMIQQLLTN.GLI
PLB2_YEAST/101-588PYVPDVNTFLN.LGLTNKPTFFGCDAKNLTDL.....EYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRN.GFE
B6HB59_PENCW/114-597PAVPDQNTFIN.LGLSTRPSFFGCDSSNQTGP........SPLVVYIPNAPYSYHSNISTFQLSTDDAERDNIILN.GYE
G8ZY27_TORDC/97-584PYVPDKRTFVN.LGLADKPSFFGCDAQNLTDL.....NYIPPLVVYIPNARHSYNSNTSTFKLSYTDDERLKMIKN.GFE
Q59W34_CANAL/88-564PYVPDQNTFRN.LNLTSKPTFFGCDAQNLTSL..TENIYDVPVVIYLANRPFTYFSNTSTFKLKYSDTERQGMISN.GYD

PF01734

Q9N5Z7_CAEEL/97-269PMYSSG...............................LNGKAPIL........RGE.......AY..........IDGG.
G7QJN7_LEPII/12-165PMFL............................................................................
B8GC44_CHLAD/8-228PIFY....................................RPVRI........GDR.......DY..........IDGG.
C1DSE3_AZOVD/14-206PTFH....................................HTVEI........DGE.......PY..........WDGA.
A9BEP0_PETMO/3-174PPYY....................................SYYEY........Q.......................GG.
A9B328_HERA2/4-179PPYL....................................PAYHY........RGE.......TY..........LDGG.
B2U808_RALPJ/9-214PPFT....................................PVLRR........AGR.......PV..........LDGG.
Q3AAC7_CARHZ/6-206PGIF....................................TPVKF........YDY.......LL..........TDGG.
A6CHF0_9BACI/8-175PFVA....................................PIVEF........QSR.......HL..........LDGG.
Q2GUC2_CHAGB/19-224PMYF....................................KSVKFA......SGGE.......RW..........CDGA.
Q9XAG3_STRCO/16-207PPLF....................................PPISI........GAG.......RW..........MDGG.
A0A022N4I9_9ACTO/11-221PGWY....................................APVTV........DGQ.......RF..........VDGG.
Q8R6F6_FUSNN/65-256PSIF....................................EPMKI........DGE.......IY..........VDGL.
D5AXK0_RICPP/15-214PGYF.....................................PSHH........FSNITNTKVHTI..........IDGG.
Q038G8_LACC3/6-159PGVF....................................SPVER........AGV.......SY..........VDGG.
A5IE43_LEGPC/25-249PVIL....................................KPVTI........TINGV...EKQF..........VDGG.
Q4UJC7_RICFE/42-240PTYF....................................KPVTNQEHIKGYENQEDA...LYAY..........ADGG.
Q54HM9_DICDI/140-357PIYF....................................KPVEI........NGH.......KY..........VDGG.
Q2K9E1_RHIEC/30-248PPVLSPLRLDL.....................SKFPWKREKLDDT........VGDPVAPERAIL..........SDGG.
A4IAC8_LEIIN/190-378AAVH....................................PASSS........SYG...................PAGG.
Q21S96_ALBFT/26-231PPLT....................................PQARR........NGI.......AL..........LDGS.
A5GF97_GEOUR/15-187PWVY....................................AYRQF........THKGK...KHIF..........IDGT.
Q1CW69_MYXXD/353-514PGIW....................................GPTVV........PPA.......RY..........VDGA.
A6NV66_9FIRM/7-176PFLF....................................PVYHI........NGK.......PY..........MDGG.
A0A038KND4_MYCTX/181-420PGVLHHETSDP.....................RMLPILDELCADQ........DVA.......AM..........VDGG.
A0YM74_LYNSP/12-230PLAF....................................PCRSV........NGK.......NY..........VDGG.
Q5X5T5_LEGPA/27-309PGVF....................................DPVIY........EGR.......KY..........IDGG.
Q2GS92_CHAGB/73-327PSRYS..................................FKPFKL........GSG.......QF..........VDGSK
Q1ZT25_PHOAS/33-203PVLY...................................NLPVNM........NEL.......EW..........VDGG.
Q5CY77_CRYPI/46-241PGIF....................................PIKYL........RNL.......GY.........HVDGG.
A0A039K3R0_MYCBI/806-965PFLY....................................APLPY........GGT.......LH..........VDGG.
PATA2_SOLTU/32-227PTYF....................................PPHYF........ATNTINGDKYEFN........LVDGA.
A6G7S9_9DELT/458-735PLFM....................................EPMEM........QLGS.....PRL..........VDTEH
C6TYS0_BURPE/13-264PFAFEPSL...........................VGTDGKPSSL........KGR........FGDDLKVPRYVVDGG.
A4F8K0_SACEN/17-281PFAF....................................EPSRVYSSTGEVPPGEPNMSGLFSELNTTGSPYRVIDGG.
Q2R2X0_ORYSJ/139-303PGYLA.................................PRPATFF........RNR.......LC..........IDGG.
Q0A7T0_ALKEH/6-219PFIF....................................PARRV........GHE.......YF..........GDGG.
A0A031KR74_ENTFC/138-323YPAM....................................AYRKI........GKN.......KY..........ADGG.
M6BTQ1_LEPBO/13-188PIAT...................................RGKHKV........DGK.......LY..........SDAA.
E3VZB4_MIMIV/38-270PFVFPSSKFYY......................NSTTQKYQYESL........TDTNDKITENSF..........IDGG.
Q0FZD9_9RHIZ/20-226PPVF....................................NVEGW........EGK.......KV..........IDGG.
Q5A7P0_CANAL/211-417PGIFPSCS............................VYEKNPKTNEIHEWNNDESM.......KY..........VDGS.
Q11UC9_CYTH3/381-624PYIT....................................PNVDL........PSEP....AMEI..........MDAG.
A6ASA3_VIBCY/5-186PTFF....................................PAFTR........SKI.......RY..........IDGG.
Q1D826_MYXXD/142-382PGVIHYDVL..........................REDPGMHTLV........EGLMGQHGVARL..........IDGG.
A0AZM8_BURCH/61-294PGLLSPVV............................LNRFRLGST........ERELGKPRFIHL..........IDGG.
Q5CE49_CRYHO/149-342PLVL....................................EPAEI........SGI......GIF..........GDGA.
A4HB10_LEIBR/40-220PLVG....................................LPFKM........ESTGE...WC............ADGG.
I0WT11_9NOCA/7-221PALF....................................RPIHI........DTPAA..WAGWY..........VDGG.
A3QTZ2_9VIRU/28-255PGIF...................................KPLSDG........QGN.......TL..........IDGG.
Q1D5W1_MYXXD/154-432PLAF....................................PPVPV........EVSF....FNQTQWGPLESLKLIDGG.
Q09D74_STIAD/17-214PVLM....................................PIYRS........GNTVGRHKNDLM..........MDGA.
A4BNM2_9GAMM/38-218PGIL...................................APRPAL........EGEE.....CGY..........YDGG.
Q4LA62_STAHJ/11-202PGVW....................................PATTI........ESD.......KH..........FDGG.
Q5ZPA4_9DELT/22-208PIV.....................................SPVHQ..................GY..........VDGG.
D3MBX2_PROAA/25-319PGVF....................................RPVDL........DGE.......HY..........VDGG.
NTE1_PICST/1239-1403AGLL....................................PPIAF........QGC.......ML..........LDGG.
A4SJS7_AERS4/8-174PLVY...................................RDFVRI........GGE.......AM..........TDGG.
Q1I961_PSEE4/42-302PYFFHPLKVGNIPS...............DQAAEARWQAWAGYHT........VDEGRLPDEVLF..........IDGG.
A7RB12_PBCVA/19-192PVYF....................................SAIKH........NDC.......IF..........VDGA.
Q0VPN6_ALCBS/36-193PLLF....................................QPARI........GKN.......YY..........WDGG.
A6G1N7_9DELT/36-362PILD....................................DMRQY........TPTLPYWPVREGAVPETRVFDVADGG.
A6QA07_SULNB/41-281PGAF....................................QQVKLRYEYKGKIASE.......YF..........IDGG.
Q5WWS2_LEGPL/304-496PVLY....................................RDTLL........DGE.......EH..........NDGG.
A0Z6H0_9GAMM/8-199PTFF....................................EPAQL........EVAGR...STSL..........IDGA.
A6LMU7_THEM4/5-176PGVF....................................SPLWI........AGT.......QN..........TDGG.
A7I0A5_CAMHC/6-211AFGF.................................................ENT......NGF..........IDGA.
C7LH54_BRUMC/13-187PPVF....................................APVRR........NGR.......IL..........VDGG.
A6G3Y0_9DELT/12-216PPFT....................................RIQRE........GGR.......TF..........LDGG.
A1DP95_NEOFI/20-225LAGY....................................KPVTIG......PDGK.......KY..........CDSS.
A5K2I7_PLAVS/1168-1482PGFF....................................NFFSF........DSN.......IY..........ADGA.
TEG_BACME/7-180PATQ....................................RAYQN...................Y..........VDGY.
Q2W5X1_MAGSA/6-225PFIY....................................PPAEV........DGK.......LY..........LEGA.
A4U0C8_9PROT/5-257PYIE....................................EPVIM........DGK.......TY..........CEGA.
A5N2W9_CLOK5/4-191PIFR.....................................IEPL........DDR.......YY..........IDGG.
A4JJZ7_BURVG/8-242PAIY....................................AAKTV........NGE.......RY..........SDGGI
A6R0J1_AJECN/673-891PSIF....................................PPAYI........RAI......GTF..........QDGG.
A0A024F582_BDEBC/72-224PPFF....................................KPHQN........S.....................VAGV.
A5P920_9SPHN/106-312PVFH....................................QQLRV........TGLAS..GDRSL..........YDGG.
Q2C291_9GAMM/11-214PPGF....................................PPVEI........DGK.......YY..........IDGG.
A1VHY7_DESVV/116-308PLFF...................................TAVRNS........RGE.......VL..........VDGS.
A7BB55_9ACTO/26-199PILM....................................PPVDI........DGD.......TY..........VDGA.
A5I1W5_CLOBH/6-200PFFF....................................TPVKL........KYMGK...EAYI..........VDGG.
A8GLS3_RICAH/7-147QKLY............................................................................
A4T0K7_POLSQ/80-285PGVA....................................GPTLL........GQR.......YV..........MDGG.
A6DDL8_9PROT/5-162YPFF....................................EPIVY........KDK.......IL..........VDGG.
A4CKZ2_ROBBH/4-195IPFM....................................SLVRK........NGC.......EY..........ADGG.
A0A031WAB0_PEPDI/5-179PNATL.................................GFKEQFV........KDVQEGIYDGFK..........LDGG.
A0A014PKG8_YERPE/86-275PVAF....................................SPVFFDVVANGKHYDE.......MH..........VDGG.
M6C3B5_LEPBO/36-250PPVV....................................SVQSH........EKE.......YY..........FDGG.
Q12EZ0_POLSJ/6-228PGLIGPYVLQ.......................ADSFDWDLPMYA........SGDEARPAEDRFAR.....IHLYDGG.
Q1GX66_SPHAL/43-328PGAFPPFTLREIDRVLE..........KRGLDWPGRDAFVRAQLP........RGEAGDAADRVL..........IDGS.
Q4RS54_TETNG/14-183PVYCG..................................IIPPTL........RGV.......RY..........VDGG.
Q5C8M6_LEGPN/32-295PVLF...................................VPGRNA........KGE.......YI..........ADGG.
Q6JBI3_DICVI/201-395PLYF....................................EEVKL........DHL.......LL..........QDGG.
Q0FKF7_PELBH/6-360PGLIQ..................................AVPLWRKDYELKTPAGENGLWCRCLF..........SDGG.
N0BV45_SALTI/8-168PGLM....................................SPVEH........NGY.......WL..........VDGA.
Q6ASS6_ORYSJ/60-258GSTA...................................AAVRSV........DGRTA..IAA............ASGG.
A6QX75_AJECN/242-440SATS....................................SRVTL........YCK...................DETG.
Q74A07_GEOSL/58-306PVAFAPLTLTIHKEPCGPLPEWIGLGLDRESNPKRRVADAEAGRS........YREPDR.LYAHL..........LDGG.
Q54XY1_DICDI/13-231PAAF....................................QKHKQ........GDE.......EY..........LDGG.
Q55G69_DICDI/65-250PGLF....................................HLYEN........DKY.......IY..........YDGG.
Q5Z158_NOCFA/22-193PILA...................................GGPILL........DGV.......PY..........FDGG.
Q54QX6_DICDI/893-1088PTFF....................................SKFEF........NNR.......QF..........QDGG.
A1UXE2_BURMS/413-612PPGM....................................PWTVV........DGR.......PY..........WDGG.
A2QZY6_ASPNC/473-679SGGYYRV..............................YTAPDPEH........EPQ.......LWK.......CCADGG.
A4XTW9_PSEMY/15-385PLLLSA...............................MPLHAVDY........RSDDRRLERCWF..........TDGG.
Q0E508_SFAVA/27-224PVRV.................................................GHK.......LL..........MDGY.
A6GI17_9DELT/71-215PTIM....................................IAVFL........TEL.......AY...........EGGL
A7IE20_XANP2/6-198PLQYP.................................IYQSGAQ........TGP.......AY..........VDGA.
Q1DCU7_MYXXD/197-406PVLA....................................DPVPW........LPSHTGRMKGSF..........FDGG.
Q6MAN6_PARUW/474-738PIVFSPHT...........................LCKKVNGMRI........QDES....LGTY..........VDGG.
Q4Z1R8_PLABA/352-558PTYL...................................KGPNED........DFK.......KYGFNIKPEIHLVDGA.
A4RTL4_OSTLU/164-398PALAG..................................SSPVTH........RGH.......RL..........VDAA.
A0JUC4_ARTS2/74-249PIFL....................................TPLRR........EGK.......VW..........TDAV.

PF00698

FAS_HUMAN/493-810..--------------------------------------PSCTI--------IP----LMKKDH----------RD..-
STCK_EMENI/1547-1902DI--------------------------------------KPEEL--------VG----RWIPNV----------TGKP-
FAS_CHICK/492-809..--------------------------------------PTCTI--------LP----LMKKDH----------KN..-
FAS1_YEAST/1663-2037NV--------------------------------------KVARL--------AG----KYIPNL----------TAKP-
A4F7N8_SACEN/109-425EG--------------------------------------SSAAV--------VP----TLQRGQ----------GG..-
A4F7P0_SACEN/560-880GA--------------------------------------EDAVV--------VG----SLHRDG----------GD..-
I6Y231_MYCTU/534-851DM--------------------------------------SVAAL--------AG----.MRREQ----------PL..-
PPSA_MYCTU/632-950PG--------------------------------------ARYTS--------LG----TLQRDT----------DD..-

PF16073

B8MGX9_TALSN/8-250QG--------------------------------------PPSTL--------RLVSDWLQKTR.----------GSSP-
B6HLN4_PENCW/17-255IG--------------------------------------PPSVI--------QL....CIRKCP----------AVKT-
E9D6Y9_COCPS/8-245SG--------------------------------------PPSVL--------RR....LIKGR.----------ALGQ-
K1X7W5_MARBU/800-1037SG--------------------------------------PPASL--------KL....LFGFH.----------NFEA-
L8G6V9_PSED2/30-264SG--------------------------------------PPSIL--------KE....FFA...----------...A-
B6QFH1_PENMQ/10-246SA--------------------------------------PPPVL--------EE....FIDSE.----------.LAK-
B6QER4_PENMQ/12-248VG--------------------------------------PPPVL--------NL....FFSRD.----------PFNG-
A7F3E3_SCLS1/4-241SG--------------------------------------PPSTL--------RA....LFASE.----------TFQA-
N1RV88_FUSC4/8-242SG--------------------------------------PPSIL--------ES....LKALD.----------IFSG-
E9F646_METAR/19-261SG--------------------------------------PPAIV--------QH....FLETS.----------QFEK-
S3EB79_GLAL2/16-254IG--------------------------------------PPSVL--------SL....IVEQCS----------AIRS-
G4UHA1_NEUT9/13-252SG--------------------------------------PPSSL--------KA....FASGH.----------NFGG-
B6HKK0_PENCW/8-244SG--------------------------------------PPTFL--------GR....FIEAS.----------.LSK-
E9F7M7_METAR/10-244SG--------------------------------------PPEVL--------TR....LSQQD.----------CLQE-
WA_EMENI/8-244SG--------------------------------------PPVVL--------NQ....FLDTF.----------.ISG-
V5GBX6_BYSSN/4-246SG--------------------------------------PPSTL--------ER....LLHHHS----------NAFQ-
G2QWR8_THITE/16-254SG--------------------------------------PPVTL--------ST....LVNRG.----------ILST-
M3CY75_SPHMS/5-242SG--------------------------------------PPTTL--------ER....FFKES.----------.ALS-
M2RQ22_COCSN/4-241SG--------------------------------------PPATT--------KR....LLEKE.----------.AFK-
B8LZ55_TALSN/27-260CG--------------------------------------PPELL--------LE....FLS...----------...S-
S3D9A7_GLAL2/4-237SG--------------------------------------PPSSL--------DL....RSKQL.----------....-
G7XN60_ASPKW/8-244SA--------------------------------------PPTVL--------DE....FVETC.----------.ISK-
M2T1K1_COCSN/8-240SG--------------------------------------PPDSI--------SR....LVSFG.----------AFKE-
E9DR08_METAQ/20-259SG--------------------------------------PPSSL--------RE....FLSKA.----------...S-
S3CWG8_GLAL2/8-245SA--------------------------------------PPSIL--------HL....LLSSP.----------SFST-
F2PW05_TRIEC/6-242SG--------------------------------------PLPTL--------SS....FLTG..----------.ISD-
H1VJ39_COLHI/10-255SG--------------------------------------PPMVL--------SD....FFAST.----------IGKS-
U1GE50_ENDPU/4-243SG--------------------------------------PPSIK--------QR....LLESS.----------DFFQ-
A1C888_ASPCL/9-246SA--------------------------------------PPEIL--------DE....FIEEA.----------.LPK-
R0KB98_SETT2/8-242SG--------------------------------------PPNAL--------AQ....LADSK.----------HFKG-
E4V2N2_ARTGP/10-256SG--------------------------------------PPSRV--------KA....AFQHS.----------PILR-
L8G4G9_PSED2/24-270SG--------------------------------------PPSRL--------KA....LFNKS.----------EFFR-
M2ZZX0_MYCFI/5-242SG--------------------------------------PPTTL--------EH....FFQQG.----------.PLS-
Q2GV63_CHAGB/785-1022IG--------------------------------------PPSSM--------AE....LTSWSP----------VIQA-
B8N7H8_ASPFN/9-246IG--------------------------------------PPSSL--------EL....VLNECP----------TQKN-
Q2UA48_ASPOR/8-244SA--------------------------------------PPKVL--------DD....LIDSR.----------.LSK-
N4VBL7_COLOR/10-255SG--------------------------------------PPDVL--------SD....FFTSG.----------AGKL-
B2B495_PODAN/8-245SG--------------------------------------PPTTL--------RL....LVAKG.----------RLSA-
M4G4F1_MAGP6/8-245SG--------------------------------------PPSTL--------KA....FRAAS.----------TYAS-
R7YU14_CONA1/7-242SG--------------------------------------PPRVL--------ET....MLQSS.----------.PFN-
R0KD65_SETT2/13-258IG--------------------------------------PPSML--------KL....FFSSCA----------PVRA-
V5G4B2_BYSSN/8-244SA--------------------------------------PPLIL--------QE....FASSC.----------.LSK-
H1VY29_COLHI/8-245SG--------------------------------------PPATL--------RA....LEDQN.----------VFGV-
L8GBJ0_PSED2/42-283SG--------------------------------------RPSVL--------QD....FLTTN.----------...V-
B6QC69_PENMQ/7-243FG--------------------------------------PPPEL--------AQ....LFSYST----------KIES-
G3JFQ9_CORMM/16-246SG--------------------------------------PPDVL--------ND....FLARN.----------NLPL-
F9XMW3_MYCGM/5-242SG--------------------------------------PPITV--------ER....FFQES.----------.SLI-
G9MXY7_HYPVG/19-259SG--------------------------------------PPTTV--------QH....FLKTS.----------PSAG-
G0RW83_HYPJQ/19-262SG--------------------------------------PPAVV--------QH....FLQSS.----------QFSG-
C5G0R3_ARTOC/8-243SA--------------------------------------PASVL--------ST....LCSTD.----------ILSG-
K1WM58_MARBU/4-242SG--------------------------------------PPSVR--------DR....LFDTS.----------LPFQ-
G9NQM0_HYPAI/19-259SG--------------------------------------PPETV--------QK....FLESS.----------QFLE-
A2QH36_ASPNC/29-262SG--------------------------------------PPHLL--------GQ....FLS...----------...S-
STCA_EMENI/11-251SA--------------------------------------SPDIL--------SQ....LASQA.----------PFTN-
Q8EYQ4_LEPIN/19-271SG--------------------------------------NPESL--------LE....FRKKF.----------.KSE-
C7ZNQ1_NECH7/8-238SG--------------------------------------PPKTL--------AQ....LISSP.----------SFKG-
M2N8F6_BAUCO/8-232SG--------------------------------------PPSTL--------K.....LLRKD.----------VFFG-
G7Y059_ASPKW/7-243SG--------------------------------------PPSTL--------.S....LLTRH.----------PSIS-
E4V6P4_ARTGP/8-243SA--------------------------------------PASTL--------LA....LRSSE.----------ILSG-
U1GYJ0_ENDPU/26-259SG--------------------------------------PPSIL--------HN....FLA...----------...S-
H6BVA1_EXODN/5-241SG--------------------------------------PPSTK--------AR....LFEES.----------EFFR-
E9F7X1_METAR/8-256SG--------------------------------------PPAHL--------KE....FLLHN.----------PAFK-
E3R122_COLGM/12-243SG--------------------------------------PPPVL--------KQ....FIKYA.----------...S-
G2WRK7_VERDV/8-245SG--------------------------------------PPTTL--------KA....LVESN.----------LLGA-
G0SDA9_CHATD/19-258SG--------------------------------------PPLTL--------RT....LFDKG.----------VLTT-
B6QHV7_PENMQ/4-241SG--------------------------------------PPSVH--------GN....FWEQF.----------KKTQ-
Q2UG06_ASPOR/8-245SG--------------------------------------SPSTL--------RA....FCAMP.----------QMAQ-
C5FQT2_ARTOC/8-245CG--------------------------------------PPRVL--------KD....LFNSP.----------IMGD-
E9D5J9_COCPS/7-242IG--------------------------------------PPRLL--------RE....LFDST.----------PFGK-
N1PC72_MYCP1/5-242SG--------------------------------------PPTTV--------ER....FFQES.----------.ALS-
E3R0Q2_COLGM/12-250IG--------------------------------------PPSVL--------ER....FIHECP----------AMKR-
R8BTJ4_TOGMI/8-245SG--------------------------------------PPATL--------QA....LFEYS.----------SFST-
G4MU27_MAGO7/14-251SG--------------------------------------PPTTL--------KA....FRAAT.----------SSLT-
R7YTG2_CONA1/4-241SG--------------------------------------PPSTT--------KR....IFQDS.----------EAFK-
U7PRD0_SPOS1/5-267SG--------------------------------------PPSTT--------AA....FFATEP----------AVLQ-
E5A495_LEPMJ/4-241SG--------------------------------------PPSTT--------QR....LFDEV.----------EAFK-
E9F8F0_METAR/70-305FG--------------------------------------PPTTL--------QR....LLEWSA----------ELED-
B8NVD5_ASPFN/5-241SG--------------------------------------TPRVL--------EA....LKASP.----------HLRG-
B8MV60_TALSN/15-255SG--------------------------------------PPSIF--------PE....LWEYSS----------TLSS-
E9FC93_METAR/16-256GG--------------------------------------RPLVL--------SD....FVA...----------.VNK-
G9NBV5_HYPVG/10-247IG--------------------------------------APSSL--------NR....LSGWST----------EIEL-
R1G9D8_BOTPV/4-241SG--------------------------------------PPATT--------SR....FFAES.----------EAVK-
S3CAW2_OPHP1/8-244SG--------------------------------------PPSTL--------KA....LTAAG.----------ALGR-
B2B664_PODAN/7-242SG--------------------------------------PPSAT--------EA....FFSST.----------SIFG-
M1WG96_CLAP2/23-272SG--------------------------------------PPSRL--------KL....LFNKS.----------PLFR-
E9F5C9_METAR/8-246IG--------------------------------------SPRLH--------RD....LFDSK.----------PFAE-
I1RF58_GIBZE/4-241SG--------------------------------------PPSVL--------EK....FIHS..----------.IST-
</