Sequence alignment for CL0323

PF01735

PLB2_SCHPO/134-617LGLAFSGGGLR-------------AM----VHGGGVL---NAFDSRN------------------------.GNGS...S
PLB5_SCHPO/125-607LGIAISGGGFP-------------AM----LTGAGAI---NAFDARN------------------------.GNTT...S
PLB1_YEAST/99-586IAVACSGGGYR-------------AM----LSGAGML---AAMDNRT------------------------.DGANE.HG
PA24A_CHICK/190-675IAVLGSGGGFR-------------AM----VGFAGVM---KALY...------------------------.........
PLB_NEUCR/121-606VAIAISGGGYR-------------AL----MNGAGFV---AAADNRI------------------------.QNTTGAGG
PLB_KLULA/102-589VAIACSGGGYR-------------AM----LSGAGMI---SAMDNRT------------------------.DGAND.HG
PLB6_SCHPO/114-600LGIAVSGGGWR-------------SM----LFGGGAL---AALDSRS------------------------.NETT....
PA24A_DANRE/185-664IAILGSGGGFR-------------AM----VGFSGVM---KALY...------------------------.........
PLB1_CANAL/88-565IGLAFSGGGYR-------------AM----LTGAGEI---SSLDSRT------------------------KTNTP...V
PLB3_YEAST/105-592IAVAVSGGGYR-------------SM----LTGAGVL---AAMDNRT------------------------.EGAYE.HG
PLB1_SCHPO/114-593IGIALSGGGLR-------------AM----ILGSGAL---SAMDARH------------------------.DNHT...V
PLB2_YEAST/101-588IGIACSGGGYR-------------AM----LGGAGMI---AAMDNRT------------------------.DGANE.HG
B6HB59_PENCW/114-597IGIAVSGGGWR-------------AL----MNGAGAV---KAFDSRT------------------------.DNATATGH
G8ZY27_TORDC/97-584IAVACSGGGYR-------------AM----LSGAGML---AAMDNRT------------------------.DGANE.HG
Q59W34_CANAL/88-564IGLAFGGGGYR-------------AM----LVGAGEL---LALDSRA------------------------.TNPS...V

PF01734

Q9N5Z7_CAEEL/97-269--LSFGGCGFL-------------.G....SYQFGAA---KM....IF..............................DH
Q8F079_LEPIN/12-165--LTFNSAFFG-------------.F....YAHAGFA---KG....L.................................
B8GC44_CHLAD/8-228--LVLAGGGVA-------------GA....AYEIGAL---CAIDQVL.................................
C1DSE3_AZOVD/14-206--LALQGGGAH-------------.G....AFTWGVL---DA...LL.................................
A9BEP0_PETMO/3-174--LVMGGFFEG-------------.F....YWESGVL---ES....I.................................
A9B328_HERA2/4-179--IVFSGGANR-------------.G....SLQAGAA---LA....L.................................
B2U808_RALPJ/9-214--MVFAGGGNR-------------.C....WWQAGWW---DV....V.................................
Q3AAC7_CARHZ/6-206--LALGGGFLR-------------.G....AAHIGVL---KV....L.................................
A6CHF0_9BACI/8-175--LVLEGGGMR-------------.G....VYTAGVL---EF....F.................................
Q2GUC2_CHAGB/19-224--LCIDGGGIK-------------.G....YTALLIL---RRIFRTLSADM.........................GGNL
Q9XAG3_STRCO/16-207--LVLGGGGLT-------------AY....GWQIGVL---AG....LA...............................D
Q2JEY3_FRASC/11-221--LVLGAGGVL-------------GS....AWMIGAM---RAVETAT.................................
Q8R6F6_FUSNN/65-256--LVLSGGGVK-------------.G....YAHLGVL---RV....L.................................
Q9ZCV7_RICPR/15-214--ALLEGGGVK-------------.G....EIHLEKL---KVIEEIT.................................
Q038G8_LACC3/6-159--VVFGGGAAH-------------.G....AYQAGVW---AVLGPRL.................................
D5T6X7_LEGP2/25-249--VVCSGGGAK-------------.G....VVYPGSY---KA....M................................E
Q4UJC7_RICFE/42-240--LSLSGGGVK-------------.G....IAELVVL---AEIEERT.................................
Q54HM9_DICDI/140-357--VTLDGGGIR-------------.G....IVTLTIL---RELQKMM.................................
Q2K9E1_RHIEC/30-248--LCLSGGYRA-------------.M....LFHAGSL---AR....L................................N
A4IAC8_LEIIN/190-378--LLLQGGVLA-------------.S....SAHFGVA---KA....L.................................
Q21S96_RHOFT/26-231--VVFAGGGNR-------------.C....FWQAGFW---SVAAVAL.................................
A5GF97_GEOUR/15-187--LMLLGGGIR-------------.F....PAFTGAL---KA....I.................................
Q1CW69_MYXXD/353-514--LALSGGGVW-------------.G....FYHVHIL---RW....L.................................
A6NV66_9FIRM/7-176--LVLEGGAFR-------------.T....IFSSGAC---DG....L.................................
I6YB49_MYCTU/181-420--TVLGGGGGA-------------.G....FVYIGGM---QR....L.................................
A0YM74_LYNSP/12-230--LVLTGGGAK-------------.G....AYQAGAL---RY....L.................................
A0A0C9NUJ5_LEGPN/27-309--LVFRGGGSK-------------.G....VAYVGAL---QS....L................................S
Q2GS92_CHAGB/73-327--LTIDGGGIR-------------.G....YSSLIVL---RALMQEIERIEQSLEPRASASTQTDRIPREQIPDDVFREG
Q1ZT25_PHOAS/33-203--LVVQGGGQR-------------.G....IFSAGVL---DS...FL.................................
Q5CY77_CRYPI/46-241--LIMSSGSNK-------------.G....PWQAGVV---RGIAQKY................................H
PATA2_SOLTU/32-227--LSIDGGGIK-------------.G....IIPGTIL---EFLEGQLQKM..........................DNNA
A6G7S9_9DELT/458-735--LVLSGGGAK-------------.G....AFEAGAV---AE....L.................................
A0A0E1WDL8_BURPE/13-264--LVMNGGVSL-------------.A....IWMGGVT---NEIFRLVKEQHPV.....................YAALLA
A4F8K0_SACEN/17-281--LAMRGGASL-------------.A....VWIGGAV---AEINHLRSALAEPGPA..............RHPWGALARL
Q2R2X0_ORYSJ/139-303--FSFSAAGLL-------------.F....PYHIGVA---QC....L................................I
Q0A7T0_ALKEH/6-219--LVLPGGGAR-------------.G....AYQVGVL---KAVAALT.................................
Q3Y1A6_ENTFC/138-323--LVLGGGGAH-------------.G....AYQIGVW---QA....L.................................
M6BTQ1_LEPBO/13-188--LLVEGGGMK-------------.G....AFAGGAL---HA....L................................H
YL620_MIMIV/38-270--FFIEGGGTK-------------.G....VYAMGVL---NYLYDEN.................................
Q0FZD9_9RHIZ/20-226--LVFSGGGTR-------------.C....FWHGGFC---EHVRKPL.................................
Q5A7P0_CANAL/211-417--LVLSGGSTF-------------.G....IFHIGVL---TT....L.................................
Q11UC9_CYTH3/381-624--ICSSGGGQR-------------AA....VWTLRTL---QYADSMT.................................
A6ASA3_VIBCY/5-186--LCLTGGGYR-------------.G....IYTAAVI---RNLEKEF.................................
Q1D826_MYXXD/142-382--LVTGGGGGT-------------.A....YVYLGVM---SL....L.................................
A4HB10_LEIBR/40-220--VSFSCGGWF-------------.Q....MYFFGVA---YA....LIDS..........................GVLR
Q0RZB6_RHOJR/7-221--LVVAGGGAR-------------.G....AYEAGAI---TSLLPRL.................................
A3QTZ2_9VIRU/28-255--LALEGGGTQ-------------.A....ISYIGAL---LA....LKD............................TGY
Q1D5W1_MYXXD/154-432--LVVSGGISL-------------.G....AYQAGFL---STLVRFWSVAQ........................REGAQ
Q09D74_STIAD/17-214--ISFDGGPSA-------------......LITLRVL---RQLEARF.................................
A4BNM2_9GAMM/38-218--VSLGGGSTA-------------.GLCGNIALIHLL---EE....L.................................
Q4LA62_STAHJ/11-202--IVLGGGGSL-------------AI....GWELGYL---LTLSNQG.................................
Q5ZPA4_9DELT/22-208--LSLDGGGLR-------------.T....LLSIGLL---KRIDQLR.................................
Q6A6E2_PROAC/25-319--LVLAGGGSR-------------.A....SFQMGAL---RHLYDVV.................................
NTE1_PICST/1239-1403--LVLGGGGSR-------------.G....ISHVGIV---TA....L.................................
A4SJS7_AERS4/8-174--LVVEGRAMR-------------.G....IFAAGVL---DA...FL.................................
Q1I961_PSEE4/42-302--LVMEGGGML-------------.G....IALVGYT---YV....L.................................
A7RB12_PBCVA/19-192--IVVAGGGAK-------------.S....MSGLGAI---HV....L................................K
Q0VPN6_ALCBS/36-193--LAMSSGFFG-------------.F....FAHFGTV---RA....L.................................
A6G1N7_9DELT/36-362--LCFSGGGSR-------------AM....SASLGYL---RG....L................................T
A6QA07_SULNB/41-281--LVISGGVSL-------------.G....AYEAGYN---WALIKMISKI...........................KSM
Q5WWS2_LEGPL/304-496--LVFCGGGAK-------------.I....FAHVGVW---KA....L.................................
A0Z6H0_9GAMM/8-199--LSIDGGGIR-------------.G....IIPAMVL---DHLETRT.................................
A6LMU7_THEM4/5-176--LSLAAGGVK-------------.G....FSHIATL---NF....L.................................
A7I0A5_CAMHC/6-211--VVLSGGGLK-------------.G....AYEIGFL---KA....L.................................
Q2YJ28_BRUA2/13-187--VAFGGGGAR-------------.G....IAHIHVV---DV....L.................................
A6G3Y0_9DELT/12-216--LVLSGGGCK-------------.T....FWGMGAY---EVLEDLL.................................
A1DP95_NEOFI/20-225--LSLDGGGIR-------------.G....LSSLHML---KYMMQAIDP.............................RQ
A5K2I7_PLAVS/1168-1482--LCLDGGGIR-------------.G....LLSIEIL---KCINSHL.................................
TEG_BACME/7-180--ITFDGGGTL-------------.G....ALSLQLL---NRLAYQN.................................
Q2W5X1_MAGSA/6-225--LVLGGGAPN-------------.F....TLMTGAL---LA....F.................................
A4U0C8_9PROT/5-257--ICLAGGGPA-------------VG.....LSLGAL---KR....L.................................
A5N2W9_CLOK5/4-191--LALEGGGAK-------------.G....AFHMGAT---KA....F.................................
A4JJZ7_BURVG/8-242--LVLSGGGAK-------------.G....AYQVGVM---RA....L.................................
A6R0J1_AJECN/673-891--LAIDGGGVR-------------.G....VIPLEFL---LLVQEKLG...............................A
Q6MR93_BDEBA/72-224--VILGGGGAK-------------.T....YAHIGFL---HE....L.................................
A5P920_9SPHN/106-312--LMLSGGGQW-------------.G....AYGAGLF---RALHDAS................................G
Q2C291_9GAMM/11-214--YVFQGGGAL-------------.G....SYQLGAF---QA....L.................................
A7BB55_9ACTO/26-199--LVFEGGGMR-------------.N....AYTAALV---SR....L.................................
A5I1W5_CLOBH/6-200--GVFQGGGVK-------------.A....TAFTGAI---CR....L.................................
A8GLS3_RICAH/7-147--LAFAGGGVK-------------.V....IAYAWAL---KV....L................................K
A4T0K7_POLSQ/80-285--MVLGGGGEY-------------YI....AWYCGFF---HGLYEAG.................................
A6DDL8_9PROT/5-162--IALSGGAAR-------------.G....VFHLGFL---DV....L.................................
A4CKZ2_ROBBH/4-195--LVISGGGSK-------------.G....AFAGGVA---QF....L.................................
Q18D71_PEPD6/5-179--LCLEGGGAK-------------.G....AYQAGVV---KA....L.................................
Q7CIX4_YERPE/86-275--LALSGGGPN-------------.G....AFGAGFL---NG.....W...............................T
M6C3B5_LEPBO/36-250--FAIAGGGCK-------------.A....FYGLGFG---HE....M.................................
Q12EZ0_POLSJ/6-228--LALSGGGMR-------------AM....VFHCGVL---KS....L................................A
Q1GX66_SPHAL/43-328--GAIGGTGAV-------------.Y....RDLLGAI---AA.....H...............................G
Q4RS54_TETNG/14-183--ISFAGCGFL-------------.G....IYHVGVA---SCLLEQA.................................
Q5C8M6_LEGPN/32-295--LVLSGGGAK-------------.G....ISYLGMI---QA....L................................Q
Q6JBI3_DICVI/201-395--LSIDGGGTR-------------.G....LMGLEVL---EQLEKIS.................................
Q0FKF7_PELBH/6-360--LIMKGGITS-------------.G....VVYPYAI---TA....L.................................
Q8Z7F2_SALTI/8-168--LALGSGAAR-------------.G....WSHIGVI---KA....L.................................
Q6ASS6_ORYSJ/60-258--LAIDGCGSS-------------.GAGDALLAAAAL---ARLEAGLRKR..........................TGDS
A6QX75_AJECN/242-440--LILQGGAVY-------------.G....TCHLGVV---KA....L.................................
Q74A07_GEOSL/58-306--LAFSGGGTR-------------AA....AFSFGLM---EE....LNRVEY......................AGRDGA
Q54XY1_DICDI/13-231--LSLDGGGTK-------------.G....LYTIEVI---EHFVKLS.................................
Q55G69_DICDI/65-250--VSFDGGGMR-------------.G....IVSILLL---KEIQNIL.................................
Q5Z158_NOCFA/22-193--LVIEGGGSR-------------.G....VYSSGMV---QG....L................................E
Q54QX6_DICDI/893-1088--LSLDGGGVR-------------.G....ILHCDAL---EQIQKQL................................F
A0A0D5GHL8_BURML/413-612--LILQGGGAL-------------.G....AFECGAV---KA....L.................................
A2QZY6_ASPNC/473-679--ITIDGGGVR-------------.A....IMPLRFL---GYMQKILG...............................P
A4XTW9_PSEMY/15-385--LVMKGGITS-------------.G....IVYPLAI---SEIAKAF.................................
Q0E508_SFAVA/27-224--LVISGGGFK-------------.A....LYFVGAV---DA....M.................................
A6GI17_9DELT/71-215--MCLSGGGIR-------------SA....TFGLGVI---QA....L................................A
A7IE20_XANP2/6-198--LSLDGGNGG-------------KA....GVFLSTL---ERRAEVL.................................
Q1DCU7_MYXXD/197-406--IVLSGGGAN-------------.G....AFSAGAI---WRLLGVLEQCR........................GKPAP
Q6MAN6_PARUW/474-738--LVIKGGGPK-------------.G....IAYIAVL---KK....L................................E
Q4Z1R8_PLABA/352-558--LSLDSGGVL-------------.A....TSTLIVL---TRIEHELRKE..........................LGND
A4RTL4_OSTLU/164-398--LVVEGGGMR-------------.G....VISAGAA---GA....L................................L
A0JUC4_ARTS2/74-249--LVLAGGGMR-------------.V....AWQAGVV---RA....L.................................

PF00698

FAS_HUMAN/493-810-WFICSGMGTQ-WRGMGLSLM-----RL.DRFR-DSI---LRSDEAV---------------------------------
STCK_EMENI/1547-1902-TYVFTGQGTQ-ERGMGMALY-----DTNAAAR-AVW---DRAERHF---------------------------------
FAS_CHICK/492-809-WYICSGMGTQ-WKGMGLSLM-----KL.DLFR-QSI---LRSDEAL---------------------------------
FAS1_YEAST/1663-2037-TFVFTGQGSQ-EQGMGMDLY-----KTSKAAQ-DVW---NRADNHF---------------------------------
A4F7N8_SACEN/109-425-VFVFPGQGAQ-WAGMAGELL-----GESRVFA-AAM---DACARAF---------------------------------
A4F7P0_SACEN/560-880-VFLFPGQGSQ-WAGMGAELL-----SSSPVFA-GKI---RACDESM---------------------------------
I6Y231_MYCTU/534-851-VWVFSGQGSQ-WAAMGTQLL-----ASEPVFA-ATI---AKLEPVI---------------------------------
PPSA_MYCTU/632-950-VFVYSGRGSQ-WAGMGRQLL-----ADEPAFA-AAV---AELEPVF---------------------------------

PF16073

E9F646_METRA/19-261--FIFGDQSSC.NLSNLQLLL...FKKSNVYLA.SFI...DQVNLTL---------------------------------
E9F8F0_METRA/9-244--LLFGDQTVE.KLPAIRHLV..SHGASSPLVQ.RFL...RQLCDAV---------------------------------
B8MGX9_TALSN/8-250--IFFGDLSLS.IHPAFSQLL..RSQKEHSLLS.NFL...NQAKSAL---------------------------------
B6HLN4_PENCW/17-255--LLFGDQTDS.WIEGIDQLY..NQAASTPWLK.SFV...DNLACVV---------------------------------
E9D6Y9_COCPS/8-245--FLFGDQTYD.LVPDLRQLL...RCNTKPILS.AFL...EQSHYVI---------------------------------
K1X7W5_MARBU/800-1037--LLFGDQSLG.VHGFLADFY...QYGNPSVLTISFL...DQVGAAL---------------------------------
L8G6V9_PSED2/30-264--LLFGDLAIR.FEDELRQLV...HVGGNESLR.SFF...DQVSYAL---------------------------------
B6QFH1_PENMQ/10-246--YVFGDQTSE.FDSGLRRLL...QDKGNSFVT.SFL...ERCSFAL---------------------------------
B6QER4_PENMQ/12-248--LYFGDQTEK.NIP.FEELF..EYSRESDRTK.QFL...QNAFHSI---------------------------------
A7F3E3_SCLS1/4-241--LVFGDQSLD.THTFLTDFC...QHRRPSVLSRSFL...EQAGSAL---------------------------------
N1RV88_FUSC4/8-242--YVFGDQSTP.VLDKLQTLL...RVKDNALLT.SFL...GEAFLAV---------------------------------
S3EB79_GLAL2/16-254--LLFGDQTDS.WVDGIDQLY..KQAASTPWLK.LFL...DKLYDAI---------------------------------
G4UHA1_NEUT9/13-252--YLFGDQSLD.THAFLASAF...LKPKKGTLAKAYL...DQVGYAI---------------------------------
B6HKK0_PENCW/8-244--YLFGDQTAE.FDSGLRRLL...HAKNDSLLA.AFF...QKSYYAL---------------------------------
E9F7M7_METRA/10-244--YVFGDRTFN.YEHSLAQLLCCH....NTFLT.LFF...RKCYSAI---------------------------------
WA_EMENI/8-244--YLFGDQTGD.FEVGLRRLL...QAKNHSLLS.SFL...QRSYHAV---------------------------------
V5GBX6_BYSSN/4-246--LLFGDQTDPEIISYLHGLL...SAPVDTPLVSSFL...KATSCAL---------------------------------
G2QWR8_THITE/16-254--LLLGDQSLD.THGFLVRFF...GQEQHGELAKAFL...RQAAYAL---------------------------------
M3CY75_SPHMS/5-242--LLFGDQTAE.QYPLLHKVT...LHRDNVLVS.NFV...QRSALAL---------------------------------
M2RQ22_COCSN/4-241--LIFGDQTAD.QYPLLRKAC...TWKNNATLT.TFL...DRISVVI---------------------------------
B8LZ55_TALSN/27-260--YIFGDQTVS.FEDTLRSLL...NIKDNAALS.DFF...NKVGLRL---------------------------------
S3D9A7_GLAL2/4-237--LLLGDQTTD.YLPTLRKLL...RRNRSPYFS.IFL...EEATALI---------------------------------
G7XN60_ASPKW/8-244--YLFGDQTSD.IEAGLRRLL...QAKNSTIVQ.SFF...QQCFHAI---------------------------------
M2T1K1_COCSN/8-240--YLFGDQTFD.VEPHFSGLL...EARNNLFLH.TLL...HGAYNAI---------------------------------
E9DR08_METAQ/20-259--LLFGDLSASGFEEDLRRLL...HIKTDPLLS.SFL...EQAGLSL---------------------------------
S3CWG8_GLAL2/8-245--FLFGDQTYD.FASDFKKLL...REENNPILT.AFL...NQSCFAI---------------------------------
F2PW05_TRIEC/6-242--LLFGDQTYD.FRPGLRQLL...QREPIPVLA.GFF...ARVHRAL---------------------------------
H1VJ39_COLHI/10-255--YVFGDQTHD.IADTLSGLA...QSHHDPLVI.NFL...ERSCGVL---------------------------------
U1GE50_ENDPU/4-243--YIFGDQTAD.CRSFLAKAV...GRKENVLLN.VFL...EKAAFAI---------------------------------
A1C888_ASPCL/9-246--YLFGDQTIS.CDEGLRNLL...QAKNHTIVA.SFF...ERCFHAL---------------------------------
R0KB98_SETT2/8-242--YLFGDQTYE.VQSRLKELL...QYRTNPVLD.DFL...LKSYDAI---------------------------------
E4V2N2_ARTGP/10-256--FFGNEFPSDDLKDLFRRLYQHSKDRRFRLLS.AFL...EESTTVL---------------------------------
L8G4G9_PSED2/24-270--YFSNDFPKDELGDIFRRLHNHSKDKHFPILA.QFI...REATWAI---------------------------------
M2ZZX0_PSEFD/5-242--LLFGDQTAE.QYPLLRKVA...LHKDNVLVH.NFV...QRCALAL---------------------------------
Q2GV63_CHAGB/785-1022--LLFGDYSVE.KLPAIKALA..QHARTTPAAE.RFL...REITAVI---------------------------------
B8N7H8_ASPFN/9-246--LLFGDVTDR.WVSSIDYVY..SQAATKPWLQ.SFL...DSLFSAI---------------------------------
Q2UA48_ASPOR/8-244--YLFGDQTSD.FDAGLRRLL...QVKNNTIVA.SFF...QRCFHAL---------------------------------
N4VBL7_COLOR/10-255--YVFGDQAHD.VADDLSSLL...QSRTDPLVV.SFL...ESSCVVL---------------------------------
B2B495_PODAN/8-245--LLFGDQSLD.THGFLAEFF...RQEKQGILAKAFL...EQAGHEL---------------------------------
A0A0C4E4Q7_MAGP6/8-245--LLFGDQSLD.THGFLADFY...RREDQGILAKAFL...DQAGEAL---------------------------------
R7YU14_CONA1/7-242--YLFGDQTHS.FDAGLRRLY...QQKENGPLT.AFF...EKVHFAL---------------------------------
R0KD65_SETT2/13-258--LLFGDQTDG.FFAPIKQLY..DQAANDAFLC.KFL...QDAATVL---------------------------------
V5G4B2_BYSSN/8-244--YLFGDQTGE.FEPGLRQLL...QAKNNGFLT.SFF...EKCFYAL---------------------------------
H1VY29_COLHI/8-245--LLFGDQSLD.THGFLAEFY...RSGNPSTLAKTFL...DQAGQAL---------------------------------
L8GBJ0_PSED2/42-283--LLFGDLSLLRFKDRLRRLL...HVETNPLLT.SFF...DRVSYAL---------------------------------
B6QC69_PENMQ/7-243--LLFGDQTVD.LVPSLHRLL..SISQSSQTVR.RFL...QSTLDVV---------------------------------
G3JFQ9_CORMM/16-246--LVFGDLTAS.FEEELRQLL...HVRGNEAMT.SFF...ERVAFSL---------------------------------
F9XMW3_ZYMTI/5-242--LLFGDQTAE.QYPLLHRIV...LRKDNVLLL.SFV...ERCALAL---------------------------------
G9MXY7_HYPVG/19-259--FVFGDQSSC.SLSNLQLLL...LKKDNPYLI.SFI...DQANYIL---------------------------------
G0RW83_HYPJQ/19-262--IVFGDQSSC.SLSKLQQLL...LKKDSPYLT.SFI...DRVNHTL---------------------------------
C5G0R3_ARTOC/8-243--YLFGDVTYD.ISTKLQPLL...HSESSPLLR.SFF...DCACDKL---------------------------------
K1WM58_MARBU/4-242--ILFGDQTAD.PQQFLTKVL...RRKGSPLLS.SFL...EQAQVVL---------------------------------
G9NQM0_HYPAI/19-259--FVFGDQSSF.SLSNLQLLL...LKKNNPYLT.LFT...DRVNVAL---------------------------------
A2QH36_ASPNC/29-262--FLFGDQTVV.FESTLHSLL...HVKDNAVLT.DFF...DRVGFQL---------------------------------
STCA_EMENI/11-251--FLFGDQTYD.FVADLRDLL...NIRNNPILV.AFL...EQSHHVI---------------------------------
Q8EYQ4_LEPIN/19-271--LQFGGQGS....PFLKEISKLYES..EPSLK.EFF...DTSFKAI---------------------------------
C7ZNQ1_NECH7/8-238--YLFGDQTFD.IKPHLQKLF...QQRDHLFLQ.DFL...TKAYNAI---------------------------------
M2N8F6_BAUCO/8-232--FLFGDQTYD.FVPDLRKLL...AIKTKPVLN.AFF...EQAHYVI---------------------------------
G7Y059_ASPKW/7-243--LCFGDQTTD.SCSRIKDLY..AKATQYNRLR.DFLTVVDRLVRSQ---------------------------------
E4V6P4_ARTGP/8-243--YLFGDLTYD.VSPKLQPLL...HSELYPLLR.SFF...DRACDKL---------------------------------
U1GYJ0_ENDPU/26-259--FLFGDLTTS.FEQDLRRLL...HVKDNATLH.SFF...EKVSAAF---------------------------------
H6BVA1_EXODN/5-241--YVFGDQTAD.CRAFFTKVF...TRKDNVLLQ.SFL...ERAGEAV---------------------------------
E3R122_COLGM/12-243--YLFGDQTFD.IAEQFKDLL...RYRNNPLVE.NFL...EKSYQLM---------------------------------
G2WRK7_VERDV/8-245--LLFGDQSLN.THAFLAEFY...RLGAPSILAKTFL...EQAGQAL---------------------------------
G0SDA9_CHATD/19-258--FYLGDQSLD.IHGFITDYL...GHGSRGILGRAFL...DQAAHAL---------------------------------
B6QHV7_PENMQ/4-241--LIYGDQTVD.VCPFLDHLF...KKKRTPLLQ.NFL...ERSKIVL---------------------------------
Q2UG06_ASPOR/8-245--FLFGDQTAD.FVPKLRSLL...SVQDSPILA.AFL...DQSHYVV---------------------------------
C5FQT2_ARTOC/8-245--CLFGDQTND.FVPGLRQLL...RIKDGPLLL.SFF...EKTHITL---------------------------------
E9D5J9_COCPS/7-242--LLFGDQTET.NFN.VRALF..EYSKQSDRLR.SYI...QRSQESA---------------------------------
N1PC72_DOTSN/5-242--LLFGDQTAE.QYPLLHRLC...LRKDNALVS.NFI...ERVALAL---------------------------------
E3R0Q2_COLGM/12-250--LLFGDQTDS.WNDGLDQVY..KLAGSMPWLQ.EFL...GGLTRTV---------------------------------
R8BTJ4_TOGMI/8-245--LLFGDQSTD.THGFLAEFF...RHGNQGLLAKAFL...EQAGRRL---------------------------------
G4MU27_MAGO7/14-251--LLFGDQSLD.THGFLAEFY...RHEDRGILAKAFL...DQAAQAL---------------------------------
R7YTG2_CONA1/4-241--LLFGDQTAD.QYPLLRKIS...QRKDNALLS.TFL...ERVSVAL---------------------------------
U7PRD0_SPOS1/5-267--LLFGDQTAE.VLPSIESLN..AHALHSAALR.QFF...DKCTDGL---------------------------------
E5A495_LEPMJ/4-241--LIFGDQTSD.QYALLRKAC...TLRSNSSLT.TFL...DRISVVI---------------------------------
B8NVD5_ASPFN/5-241--YIFGDQTVR.VDDAVHKLL...HVKNNPILK.SFL...DESFAAI---------------------------------
B8MV60_TALSN/15-255--TFFGDQTVD.TLLCIKDLA..NRSHQLPILR.RYL...REAADKL---------------------------------
E9FC93_METRA/16-256--IAFGDLAASECLDSLQGLL...HSKNNANLS.DFF...VRVSFGL---------------------------------
G9NBV5_HYPVG/10-247--LLFGDQTVE.KLSSIQALV..RNAKSSPAAK.RFL...QEITDVI---------------------------------
R1G9D8_BOTPV/4-241--LIFGDQTAE.QYPLLRKAV...LRKDNALLS.TFL...ERVGVTL---------------------------------
S3CAW2_OPHP1/8-244--LLFGDQSLD.TYGFLSGFY...RQTDQGILARVFL...SQTGEAL---------------------------------
B2B664_PODAN/7-242--LLFGDQTGE.VLPSIQSLS..RNASSNQTLA.TFL...RKATDRL---------------------------------
M1WG96_CLAP2/23-272--FFGNELPNDDLQTHFRRLHTRSKDKNHPLLA.RFI...DEATLVL---------------------------------
E9F5C9_METRA/8-246--LLFGDQTET.NLS.IQALY..NHANTSERLL.GYI...DAAYEAA---------------------------------
A0A098D9G9_GIBZA/4-241--FVFGDQSTR.FAPPLKDLL...LKGNSPYLT.HFV...KQVHALL---------------------------------
G2YLD0_BOTF4/4-242--ILFGDQTAD.CQSFLKKAL...RRKNCPILS.TFL...EQAHAAL---------------------------------
B2W1Q0_PYRTR/9-246--LLFGDVTDS.WVEGIDHVY..MQAATKPWLQ.SFL...DNLFSAI---------------------------------
C7Z6X3_NECH7/7-240--LLFGDLSVP.FEGQLQALL...HVHDNPLLT.SFL...EQAGAKI---------------------------------
E3QS53_COLGM/10-256--YVFGDQTYD.STEALRSLS...QTHNDPLLM.DFI...ERSCAVL---------------------------------
G9NGU8_HYPAI/9-247--IFFGDQTVD.TLQNIKVLA..NQARTSPIIA.RFL...RECADVV---------------------------------
B8MYS6_ASPFN/10-247--IVFGDLTCD.SVAGLRTLV...TVKDNPLLI.SFF...ERVTTGL---------------------------------
G2RCG6_THITE/8-247--VLFGDLTCD.YVSGLRSLV...PVRDNPLLT.SFF...ERVAFGL---------------------------------
S0DTP6_GIBF5/8-239--YLFGDQTFD.VQPHLQHLL...QKRDNLFLH.EFL...NQSYNAL---------------------------------
G2QMK9_THIHA/8-254--IVFGDQAVP.YAAELRRFI...AKREDFTLA.KLL...SEAYHAL---------------------------------
F0XGQ5_GROCL/8-244--LLFGDQSLD.TYAFLSGLC...RQDNTGILAQAFL...NQATEAL---------------------------------
T0KJR9_COLGC/11-253--LLFGGYTEP.WLESIDRIH..EQAGKCAWLR.LFL...DDVAAVV---------------------------------
M2RHZ9_COCSN/9-246--FLFGDQADAPL.PMIRRVA..EKARHSKNLQ.SFL...QSAIDNV---------------------------------
R0JX83_SETT2/4-242--VLFPDHVTD.TRSILRQVH...EARNTSTLVKSFL...EKAYHAL---------------------------------
L8G0G7_PSED2/41-278--LLFGEQSLD.TQGFLADFC...RNGNPSVLSHAFL...NRVASTL---------------------------------
Q2HGW2_CHAGB/17-254--LLFGDQSLD.SHGFFAQFY...RQSKHGELARVFL...QQANHAL---------------------------------
B8MF01_TALSN/8-245--YVFGDLNND.FDSSLRALC...KSQGNPLLV.SFL...DRAAFAL---------------------------------
N4VM62_COLOR/16-257--LLFGDQTDG.FHASIRQLY..HDASKDPILG.AFL...QDASVVL---------------------------------
S3DAZ0_GLAL2/11-247--FLFGDQSLD.TYGFLANFL...HRSSPSLLSKTFI...EQASDAL---------------------------------
E3SAD1_PYRTT/8-240--FLFGDQTFD.IRPHFSGLL...EARDNLFLH.AFL...RAAYNAL---------------------------------
U7PK37_SPOS1/8-244--LLFGDQSLD.TYDFLSGFY...REGHQGILATAFL...NQAGEAL---------------------------------
B2B6C8_PODAN/41-279--FLFGDQTFD.FVPKLRELL...TVQDCPLLA.AFL...GQAHYVV---------------------------------
V5G236_BYSSN/6-248--VLFGDTSIS.VQPALSLLLSSSSQKELPLLR.QFL...ERSCEVL---------------------------------
M2NM35_BAUCO/5-243--LLFGDQTAE.QYTLLHKII...LRKEDALVR.SFV...ERISVVL---------------------------------
B6QAB8_PENMQ/31-263--YVFGDQTAA.FEDTLKSLL...SVKDNATLS.DFF...RRVGFQL---------------------------------
M2XHZ5_DOTSN/10-247--LVFGDQTYD.FVPKLRELF...HVKDNPILT.AFL...EQSHYVV---------------------------------
R7YHB3_CONA1/8-244--LLFGDQSKD.VSSDLRELV...SVKDNPLLL.SFF...EKAYITL---------------------------------

PF01735

PLB2_SCHPO/134-617LAG---------------------------------------------------------------------ILQS--AM
PLB5_SCHPO/125-607LGG---------------------------------------------------------------------ILQS--SM
PLB1_YEAST/99-586LGG---------------------------------------------------------------------LLQG--AT
PA24A_CHICK/190-675ESG---------------------------------------------------------------------VLDC--AT
PLB_NEUCR/121-606IGG---------------------------------------------------------------------LLQS--ST
PLB_KLULA/102-589LGG---------------------------------------------------------------------LLQS--ST
PLB6_SCHPO/114-600LGG---------------------------------------------------------------------LLQS--AH
PA24A_DANRE/185-664ESG---------------------------------------------------------------------VFDC--AT
PLB1_CANAL/88-565LAG---------------------------------------------------------------------ILQA--SS
PLB3_YEAST/105-592LGG---------------------------------------------------------------------LLQS--TT
PLB1_SCHPO/114-593LTG---------------------------------------------------------------------LLQA--SD
PLB2_YEAST/101-588LGG---------------------------------------------------------------------LLQS--ST
B6HB59_PENCW/114-597LGG---------------------------------------------------------------------LLQS--AT
G8ZY27_TORDC/97-584LGG---------------------------------------------------------------------LLQS--TT
Q59W34_CANAL/88-564LSG---------------------------------------------------------------------ILQS--SS

PF01734

Q9N5Z7_CAEEL/97-269GKK---------------------------------------------------------------------LMKR--VE
Q8F079_LEPIN/12-165.SE---------------------------------------------------------------------IGFR--PS
B8GC44_CHLAD/8-228DHL---------------------------------------------------------------------SVNE--FD
C1DSE3_AZOVD/14-206.ED---------------------------------------------------------------------GRLD--FT
A9BEP0_PETMO/3-174..A---------------------------------------------------------------------KKEN--AL
A9B328_HERA2/4-179.LE---------------------------------------------------------------------AGII--PD
B2U808_RALPJ/9-214QPE---------------------------------------------------------------------LGLA--PR
Q3AAC7_CARHZ/6-206.EK---------------------------------------------------------------------EGLK--PS
A6CHF0_9BACI/8-175.LE---------------------------------------------------------------------KEIE--FP
Q2GUC2_CHAGB/19-224SPR---------------------------------------------------------------------PCDI--FD
Q9XAG3_STRCO/16-207AGV---------------------------------------------------------------------DLAD--AD
Q2JEY3_FRASC/11-221.GR---------------------------------------------------------------------DLSG--AD
Q8R6F6_FUSNN/65-256.ER---------------------------------------------------------------------ENIK--ID
Q9ZCV7_RICPR/15-214GKP---------------------------------------------------------------------TCKV--FD
Q038G8_LACC3/6-159...---------------------------------------------------------------------...R--PT
D5T6X7_LEGP2/25-249DTG---------------------------------------------------------------------VFKG--VE
Q4UJC7_RICFE/42-240GKS---------------------------------------------------------------------ISEL--FP
Q54HM9_DICDI/140-357GLD---------------------------------------------------------------------IIDK--AH
Q2K9E1_RHIEC/30-248EAG---------------------------------------------------------------------LLAK--LD
A4IAC8_LEIIN/190-378.YD---------------------------------------------------------------------AGLL--PP
Q21S96_RHOFT/26-231...---------------------------------------------------------------------.KLA--PS
A5GF97_GEOUR/15-187.EE---------------------------------------------------------------------KGLN--IR
Q1CW69_MYXXD/353-514.VS---------------------------------------------------------------------QGVP--ID
A6NV66_9FIRM/7-176.LA---------------------------------------------------------------------ADIM--PD
I6YB49_MYCTU/181-420.LA---------------------------------------------------------------------AGQV--PD
A0YM74_LYNSP/12-230.AE---------------------------------------------------------------------LNFQ--PK
A0A0C9NUJ5_LEGPN/27-309EQG---------------------------------------------------------------------VLEN--IE
Q2GS92_CHAGB/73-327QYL---------------------------------------------------------------------PCHY--FD
Q1ZT25_PHOAS/33-203.EH---------------------------------------------------------------------EFDP--FA
Q5CY77_CRYPI/46-241DSG---------------------------------------------------------------------KKLR--WD
PATA2_SOLTU/32-227DAR---------------------------------------------------------------------LADY--FD
A6G7S9_9DELT/458-735.WK---------------------------------------------------------------------TGYR--PD
A0A0E1WDL8_BURPE/13-264MTR---------------------------------------------------------------------TVPR--VD
A4F8K0_SACEN/17-281AGY---------------------------------------------------------------------DSVA--VD
Q2R2X0_ORYSJ/139-303DRG---------------------------------------------------------------------YLTE--RT
Q0A7T0_ALKEH/6-219PRD---------------------------------------------------------------------RGNP--FP
Q3Y1A6_ENTFC/138-323.KE---------------------------------------------------------------------HDIN--FE
M6BTQ1_LEPBO/13-188TLV---------------------------------------------------------------------SPKH--YD
YL620_MIMIV/38-270VYI---------------------------------------------------------------------KLQD--VD
Q0FZD9_9RHIZ/20-226...---------------------------------------------------------------------.RLM--PK
Q5A7P0_CANAL/211-417.FE---------------------------------------------------------------------ANLL--PR
Q11UC9_CYTH3/381-624NGA---------------------------------------------------------------------MFKQ--TR
A6ASA3_VIBCY/5-186ETK---------------------------------------------------------------------IKQQ--CD
Q1D826_MYXXD/142-382.GE---------------------------------------------------------------------YGLE--PR
A4HB10_LEIBR/40-220RWY---------------------------------------------------------------------SEGK--RV
Q0RZB6_RHOJR/7-221...---------------------------------------------------------------------.GRS--PT
A3QTZ2_9VIRU/28-255YKD---------------------------------------------------------------------DGYT--FD
Q1D5W1_MYXXD/154-432ADL---------------------------------------------------------------------GNPA--PR
Q09D74_STIAD/17-214.PG---------------------------------------------------------------------FVER--AQ
A4BNM2_9GAMM/38-218..E---------------------------------------------------------------------LKQH--IS
Q4LA62_STAHJ/11-202..I---------------------------------------------------------------------DVRH--AD
Q5ZPA4_9DELT/22-208.PG---------------------------------------------------------------------FLDQ--VD
Q6A6E2_PROAC/25-319...---------------------------------------------------------------------.GIT--PT
NTE1_PICST/1239-1403.ER---------------------------------------------------------------------HGIP--VD
A4SJS7_AERS4/8-174.AQ---------------------------------------------------------------------GRTA--FD
Q1I961_PSEE4/42-302.EQ---------------------------------------------------------------------AGIR--FL
A7RB12_PBCVA/19-192RNG---------------------------------------------------------------------QLKN--LK
Q0VPN6_ALCBS/36-193.LD---------------------------------------------------------------------HGLQ--PA
A6G1N7_9DELT/36-362KQG---------------------------------------------------------------------LVDR--VR
A6QA07_SULNB/41-281NVD---------------------------------------------------------------------IRPD--LL
Q5WWS2_LEGPL/304-496.NE---------------------------------------------------------------------AGMK--PT
A0Z6H0_9GAMM/8-199GHR---------------------------------------------------------------------AADL--FD
A6LMU7_THEM4/5-176.EE---------------------------------------------------------------------NNIK--VD
A7I0A5_CAMHC/6-211.GE---------------------------------------------------------------------FEIL--PA
Q2YJ28_BRUA2/13-187.NE---------------------------------------------------------------------LGIQ--PV
A6G3Y0_9DELT/12-216...---------------------------------------------------------------------..PP--IE
A1DP95_NEOFI/20-225PPR---------------------------------------------------------------------PCEV--FD
A5K2I7_PLAVS/1168-1482KKN---------------------------------------------------------------------IFEY--FD
TEG_BACME/7-180.PK---------------------------------------------------------------------LISE--TN
Q2W5X1_MAGSA/6-225.DE---------------------------------------------------------------------AGVK--FD
A4U0C8_9PROT/5-257HEE---------------------------------------------------------------------EDIR--FD
A5N2W9_CLOK5/4-191.IE---------------------------------------------------------------------EGYK--FH
A4JJZ7_BURVG/8-242.AE---------------------------------------------------------------------VGAQ--ID
A6R0J1_AJECN/673-891NCP---------------------------------------------------------------------VVDL--CE
Q6MR93_BDEBA/72-224.QR---------------------------------------------------------------------AKVP--VY
A5P920_9SPHN/106-312NGL---------------------------------------------------------------------AMKN--VK
Q2C291_9GAMM/11-214.NE---------------------------------------------------------------------KGFT--PD
A7BB55_9ACTO/26-199.IA---------------------------------------------------------------------EGIN--FP
A5I1W5_CLOBH/6-200.EK---------------------------------------------------------------------EGMM--WQ
A8GLS3_RICAH/7-147DKD---------------------------------------------------------------------CLKN--IQ
A4T0K7_POLSQ/80-285.LD---------------------------------------------------------------------MAQI--PE
A6DDL8_9PROT/5-162.LK---------------------------------------------------------------------EGVE--IK
A4CKZ2_ROBBH/4-195MEQ---------------------------------------------------------------------RGYD--YD
Q18D71_PEPD6/5-179YDG---------------------------------------------------------------------GINK--FY
Q7CIX4_YERPE/86-275ETG---------------------------------------------------------------------KRPV--FK
M6C3B5_LEPBO/36-250.KS---------------------------------------------------------------------WGLK--FR
Q12EZ0_POLSJ/6-228EHG---------------------------------------------------------------------ALEH--VS
Q1GX66_SPHAL/43-328NVR---------------------------------------------------------------------LRVF--TD
Q4RS54_TETNG/14-183.PF---------------------------------------------------------------------LVHN--AR
Q5C8M6_LEGPN/32-295ERG---------------------------------------------------------------------KIKN--LT
Q6JBI3_DICVI/201-395GKK---------------------------------------------------------------------ICEL--FD
Q0FKF7_PELBH/6-360..A---------------------------------------------------------------------RSYR--LR
Q8Z7F2_SALTI/8-168.KQ---------------------------------------------------------------------TGID--ID
Q6ASS6_ORYSJ/60-258DAR---------------------------------------------------------------------VADF--FD
A6QX75_AJECN/242-440.FL---------------------------------------------------------------------RGLL--PR
Q74A07_GEOSL/58-306RHR---------------------------------------------------------------------LLDD--VE
Q54XY1_DICDI/13-231GSD---------------------------------------------------------------------FTKH--VD
Q55G69_DICDI/65-250GFD---------------------------------------------------------------------IGVN--CD
Q5Z158_NOCFA/22-193ELG---------------------------------------------------------------------LSAV--FD
Q54QX6_DICDI/893-1088DIP---------------------------------------------------------------------IISL--FD
A0A0D5GHL8_BURML/413-612.EQ---------------------------------------------------------------------HGVR--PD
A2QZY6_ASPNC/473-679GCL---------------------------------------------------------------------VQDM--VD
A4XTW9_PSEMY/15-385...---------------------------------------------------------------------...R--LR
Q0E508_SFAVA/27-224...---------------------------------------------------------------------ELCR--VD
A6GI17_9DELT/71-215RKG---------------------------------------------------------------------LFEH--VD
A7IE20_XANP2/6-198GFS---------------------------------------------------------------------VLRQ--ID
Q1DCU7_MYXXD/197-406EGC---------------------------------------------------------------------GDAR--ID
Q6MAN6_PARUW/474-738EHE---------------------------------------------------------------------ALKN--LE
Q4Z1R8_PLABA/352-558TIN---------------------------------------------------------------------LIDC--FD
A4RTL4_OSTLU/164-398EAG---------------------------------------------------------------------YYDC--FD
A0JUC4_ARTS2/74-249.AE---------------------------------------------------------------------EGLH--FD

PF00698

FAS_HUMAN/493-810-KP.FGLKVSQLLLSTDE.....................................................STFDD--IV
STCK_EMENI/1547-1902-RSQYGISLLHIVRENPTSLTVNFGSRRGRQIRDIYLSMSD........SDPSMLPGLTRDSRSYTFNYPSGLLMS--TQ
FAS_CHICK/492-809-KS.TGLKVSDLLLNADE.....................................................NTFDD--TV
FAS1_YEAST/1663-2037-KDTYGFSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSA--TQ
A4F7N8_SACEN/109-425-EPVTDWTLAQVLDSPE.......................................................QSRR--VE
A4F7P0_SACEN/560-880-APMQDWKVSDVLRQAPGA....................................................PGLDR--VD
I6Y231_MYCTU/534-851-AAESGFSVTEAITAQQ.......................................................TVTG--ID
PPSA_MYCTU/632-950-VEQAGFSLHDVLANGE.......................................................ELVG--IE

PF16073

E9F646_METRA/19-261-RH---------------------------------------------------------------------EIAR..LT
E9F8F0_METRA/9-244-QL---------------------------------------------------------------------QVSKLPLH
B8MGX9_TALSN/8-250-QA---------------------------------------------------------------------EATN..LS
B6HLN4_PENCW/17-255-NA---------------------------------------------------------------------ETKTILLD
E9D6Y9_COCPS/8-245-RA---------------------------------------------------------------------QSAT..WL
K1X7W5_MARBU/800-1037-RE---------------------------------------------------------------------EVDR..LS
L8G6V9_PSED2/30-264-RQ---------------------------------------------------------------------EFGN..LP
B6QFH1_PENMQ/10-246-RH---------------------------------------------------------------------EVTQ..LP
B6QER4_PENMQ/12-248-QL---------------------------------------------------------------------VIETLTE.
A7F3E3_SCLS1/4-241-RE---------------------------------------------------------------------EIDR..LP
N1RV88_FUSC4/8-242-RH---------------------------------------------------------------------EIVS..LS
S3EB79_GLAL2/16-254-KA---------------------------------------------------------------------ELKITTLD
G4UHA1_NEUT9/13-252-RR---------------------------------------------------------------------EIDQ..LP
B6HKK0_PENCW/8-244-RK---------------------------------------------------------------------EITS..LP
E9F7M7_METRA/10-244-RT---------------------------------------------------------------------EPGR..LP
WA_EMENI/8-244-RQ---------------------------------------------------------------------EISH..LP
V5GBX6_BYSSN/4-246-RR---------------------------------------------------------------------NIAD..LP
G2QWR8_THITE/16-254-KW---------------------------------------------------------------------EIQR..LP
M3CY75_SPHMS/5-242-RE---------------------------------------------------------------------ETRA..LP
M2RQ22_COCSN/4-241-RE---------------------------------------------------------------------EVQK..LP
B8LZ55_TALSN/27-260-RS---------------------------------------------------------------------YIGG..LP
S3D9A7_GLAL2/4-237-QN---------------------------------------------------------------------EVLI..LP
G7XN60_ASPKW/8-244-RQ---------------------------------------------------------------------EIAK..LP
M2T1K1_COCSN/8-240-RT---------------------------------------------------------------------EIYT..LP
E9DR08_METAQ/20-259-RR---------------------------------------------------------------------LIGN..LP
S3CWG8_GLAL2/8-245-RA---------------------------------------------------------------------ELNH..SL
F2PW05_TRIEC/6-242-RQ---------------------------------------------------------------------EISK..LP
H1VJ39_COLHI/10-255-KH---------------------------------------------------------------------EVAR..LS
U1GE50_ENDPU/4-243-RD---------------------------------------------------------------------EISR..RA
A1C888_ASPCL/9-246-RR---------------------------------------------------------------------EISK..LP
R0KB98_SETT2/8-242-RT---------------------------------------------------------------------NISN..LP
E4V2N2_ARTGP/10-256-KD---------------------------------------------------------------------EIAK..LP
L8G4G9_PSED2/24-270-KD---------------------------------------------------------------------EVRQ..LP
M2ZZX0_PSEFD/5-242-RE---------------------------------------------------------------------EARA..LP
Q2GV63_CHAGB/785-1022-QL---------------------------------------------------------------------EFSR..AD
B8N7H8_ASPFN/9-246-RS---------------------------------------------------------------------GTRA..MD
Q2UA48_ASPOR/8-244-RQ---------------------------------------------------------------------EIAR..LS
N4VBL7_COLOR/10-255-KT---------------------------------------------------------------------ETAH..LS
B2B495_PODAN/8-245-RK---------------------------------------------------------------------EVEK..LP
A0A0C4E4Q7_MAGP6/8-245-RA---------------------------------------------------------------------EVDR..LP
R7YU14_CONA1/7-242-RR---------------------------------------------------------------------EIGQ..LP
R0KD65_SETT2/13-258-RR---------------------------------------------------------------------ELSS..LE
V5G4B2_BYSSN/8-244-RQ---------------------------------------------------------------------EISK..LP
H1VY29_COLHI/8-245-RE---------------------------------------------------------------------EIDG..LG
L8GBJ0_PSED2/42-283-RR---------------------------------------------------------------------LLGT..LP
B6QC69_PENMQ/7-243-QA---------------------------------------------------------------------NISA..LG
G3JFQ9_CORMM/16-246-RQ---------------------------------------------------------------------ELGR..LP
F9XMW3_ZYMTI/5-242-RE---------------------------------------------------------------------ETRT..LS
G9MXY7_HYPVG/19-259-RH---------------------------------------------------------------------EIAQ..LT
G0RW83_HYPJQ/19-262-RH---------------------------------------------------------------------EVAR..LT
C5G0R3_ARTOC/8-243-RA---------------------------------------------------------------------EIGR..LP
K1WM58_MARBU/4-242-QE---------------------------------------------------------------------EVSS..QS
G9NQM0_HYPAI/19-259-RQ---------------------------------------------------------------------EIAQ..LT
A2QH36_ASPNC/29-262-RR---------------------------------------------------------------------HVGN..LP
STCA_EMENI/11-251-RA---------------------------------------------------------------------QMIR..EL
Q8EYQ4_LEPIN/19-271-AE---------------------------------------------------------------------EVPK..L.
C7ZNQ1_NECH7/8-238-RV---------------------------------------------------------------------EMYR..LP
M2N8F6_BAUCO/8-232-RA---------------------------------------------------------------------QAQQ..WL
G7Y059_ASPKW/7-243-RL---------------------------------------------------------------------GISTTDN.
E4V6P4_ARTGP/8-243-RA---------------------------------------------------------------------EIGR..LP
U1GYJ0_ENDPU/26-259-RT---------------------------------------------------------------------EFGK..LP
H6BVA1_EXODN/5-241-RF---------------------------------------------------------------------ENQN..RS
E3R122_COLGM/12-243-RK---------------------------------------------------------------------ELYL..LP
G2WRK7_VERDV/8-245-RE---------------------------------------------------------------------EIDG..LG
G0SDA9_CHATD/19-258-IK---------------------------------------------------------------------EVSQ..LP
B6QHV7_PENMQ/4-241-QD---------------------------------------------------------------------EICR..LS
Q2UG06_ASPOR/8-245-RA---------------------------------------------------------------------QMLQ..SM
C5FQT2_ARTOC/8-245-RQ---------------------------------------------------------------------EITR..QS
E9D5J9_COCPS/7-242-RR---------------------------------------------------------------------AFENAAV.
N1PC72_DOTSN/5-242-RE---------------------------------------------------------------------EVRS..LA
E3R0Q2_COLGM/12-250-NE---------------------------------------------------------------------ETRAIVID
R8BTJ4_TOGMI/8-245-KK---------------------------------------------------------------------EIDQ..LP
G4MU27_MAGO7/14-251-RK---------------------------------------------------------------------EIER..LP
R7YTG2_CONA1/4-241-RD---------------------------------------------------------------------EVTR..LP
U7PRD0_SPOS1/5-267-RT---------------------------------------------------------------------VIAR..LP
E5A495_LEPMJ/4-241-RE---------------------------------------------------------------------EVQK..LP
B8NVD5_ASPFN/5-241-RK---------------------------------------------------------------------QIFR..LP
B8MV60_TALSN/15-255-QL---------------------------------------------------------------------LLSQ..IE
E9FC93_METRA/16-256-RQ---------------------------------------------------------------------FLGC..LP
G9NBV5_HYPVG/10-247-QL---------------------------------------------------------------------EFST..LS
R1G9D8_BOTPV/4-241-RN---------------------------------------------------------------------EVKR..LS
S3CAW2_OPHP1/8-244-RK---------------------------------------------------------------------EIET..LG
B2B664_PODAN/7-242-RS---------------------------------------------------------------------AVLQ..AP
M1WG96_CLAP2/23-272-KE---------------------------------------------------------------------EISA..LS
E9F5C9_METRA/8-246-NQ---------------------------------------------------------------------ALDQQDVN
A0A098D9G9_GIBZA/4-241-RR---------------------------------------------------------------------EISS..LP
G2YLD0_BOTF4/4-242-QD---------------------------------------------------------------------ELSS..LP
B2W1Q0_PYRTR/9-246-KT---------------------------------------------------------------------ETKA..MD
C7Z6X3_NECH7/7-240-RD---------------------------------------------------------------------EIGL..LT
E3QS53_COLGM/10-256-KR---------------------------------------------------------------------EIAQ..LP
G9NGU8_HYPAI/9-247-QV---------------------------------------------------------------------NLSE..LD
B8MYS6_ASPFN/10-247-RE---------------------------------------------------------------------EIGL..LP
G2RCG6_THITE/8-247-RQ---------------------------------------------------------------------EIGL..LT
S0DTP6_GIBF5/8-239-RA---------------------------------------------------------------------ELFK..IP
G2QMK9_THIHA/8-254-RA---------------------------------------------------------------------EIAR..LP
F0XGQ5_GROCL/8-244-RK---------------------------------------------------------------------EVEG..LH
T0KJR9_COLGC/11-253-RA---------------------------------------------------------------------ETRH..MH
M2RHZ9_COCSN/9-246-QL---------------------------------------------------------------------EVSR..LT
R0JX83_SETT2/4-242-RH---------------------------------------------------------------------ETWN..LN
L8G0G7_PSED2/41-278-QN---------------------------------------------------------------------EIER..LP
Q2HGW2_CHAGB/17-254-LG---------------------------------------------------------------------VVEK..LP
B8MF01_TALSN/8-245-RA---------------------------------------------------------------------EIGA..LP
N4VM62_COLOR/16-257-RR---------------------------------------------------------------------ELAS..LE
S3DAZ0_GLAL2/11-247-CR---------------------------------------------------------------------EVNA..LS
E3SAD1_PYRTT/8-240-RK---------------------------------------------------------------------EIFT..LS
U7PK37_SPOS1/8-244-WR---------------------------------------------------------------------EIEG..LG
B2B6C8_PODAN/41-279-RA---------------------------------------------------------------------QMIR..SL
V5G236_BYSSN/6-248-RD---------------------------------------------------------------------EVVR..LR
M2NM35_BAUCO/5-243-RE---------------------------------------------------------------------ETRA..LP
B6QAB8_PENMQ/31-263-RS---------------------------------------------------------------------HVGR..LP
M2XHZ5_DOTSN/10-247-RA---------------------------------------------------------------------QMIQ..TL
R7YHB3_CONA1/8-244-RD---------------------------------------------------------------------EVAR..DP

PF01735

PLB2_SCHPO/134-617YIAGLSGG-------SWL-V---------------------------------------------------GSV------
PLB5_SCHPO/125-607YLTGLSGG-------SWL-V---------------------------------------------------GSV------
PLB1_YEAST/99-586YLAGLSGG-------NWL-T---------------------------------------------------STL------
PA24A_CHICK/190-675YIAGLSGS-------TWY-M---------------------------------------------------STL------
PLB_NEUCR/121-606YLAGLSGG-------GWL-V---------------------------------------------------GSL------
PLB_KLULA/102-589YLAGLSGG-------NWL-V---------------------------------------------------GTL------
PLB6_SCHPO/114-600YITGADGG-------SWL-L---------------------------------------------------SSL------
PA24A_DANRE/185-664YVAGLSGS-------TWY-M---------------------------------------------------SML------
PLB1_CANAL/88-565YIAGLSGG-------SWL-V---------------------------------------------------GSL------
PLB3_YEAST/105-592YLSGASGG-------NWL-V---------------------------------------------------GTL------
PLB1_SCHPO/114-593YLVGTDGS-------AWT-V---------------------------------------------------GGI------
PLB2_YEAST/101-588YLSGLSGG-------NWL-T---------------------------------------------------GTL------
B6HB59_PENCW/114-597YISGLSGG-------SWL-L---------------------------------------------------GSI------
G8ZY27_TORDC/97-584YLAGLSGG-------NWL-V---------------------------------------------------GTL------
Q59W34_CANAL/88-564YIVGLSGG-------SWL-V---------------------------------------------------GSL------

PF01734

Q9N5Z7_CAEEL/97-269RYSGCSSG-------SLV-A...................................................AMF------
Q8F079_LEPIN/12-165KITGCSSG-------ALI-G...................................................SLV------
B8GC44_CHLAD/8-228IYVGTSAG-------ALI-N...................................................ACL------
C1DSE3_AZOVD/14-206GISGTSAG-------AMN-A...................................................TML------
A9BEP0_PETMO/3-174NLYTSSLG-------SLR-G...................................................LFY------
A9B328_HERA2/4-179LVVGSSVG-------SIN-G...................................................AVL------
B2U808_RALPJ/9-214VIAGISAG-------AST-A...................................................CML------
Q3AAC7_CARHZ/6-206IVSGTSVG-------GII-A...................................................LLY------
A6CHF0_9BACI/8-175YVIGVSAG-------ACI-A...................................................ASY------
Q2GUC2_CHAGB/19-224LIAGTSTG-------GII-A......................................................------
Q9XAG3_STRCO/16-207VLAGTSAG-------SLL-A...................................................LDL------
Q2JEY3_FRASC/11-221LVVGTSAG-------SVV-A...................................................ALL------
Q8R6F6_FUSNN/65-256YITGTSIG-------AFI-G...................................................TLY------
Q9ZCV7_RICPR/15-214FTGGTSVG-------GLI-L...................................................ILL------
Q038G8_LACC3/6-159FVIGSSIG-------AIN-A...................................................AGT------
D5T6X7_LEGP2/25-249ELSGASAG-------AIT-S...................................................TML------
Q4UJC7_RICFE/42-240IISGTSVG-------GLI-A...................................................GLL------
Q54HM9_DICDI/140-357MVCGTSTG-------SII-A......................................................------
Q2K9E1_RHIEC/30-248MISSVSGG-------SIA-S...................................................GLL------
A4IAC8_LEIIN/190-378VVYGSGSG-------ALV-A...................................................TLV------
Q21S96_RHOFT/26-231GVVAVSAG-------SAI-A...................................................CAL------
A5GF97_GEOUR/15-187KIVGSSTG-------SII-G...................................................SLY------
Q1CW69_MYXXD/353-514IVSGASMG-------SLV-G...................................................AYF------
A6NV66_9FIRM/7-176YCVGVSAG-------IAY-G...................................................VSY------
I6YB49_MYCTU/181-420YMIGSSFG-------SII-G...................................................SLV------
A0YM74_LYNSP/12-230IIAGTSVG-------ALN-G...................................................AVL------
A0A0C9NUJ5_LEGPN/27-309NVAGSSAG-------AMT-A...................................................AIV------
Q2GS92_CHAGB/73-327YIAGTSVG-------GLI-A......................................................------
Q1ZT25_PHOAS/33-203LYIGTSAG-------ALN-L...................................................SSF------
Q5CY77_CRYPI/46-241LVGGTSVG-------AIN-A...................................................LAS------
PATA2_SOLTU/32-227VIGGTSTG-------GLL-T...................................................AMI------
A6G7S9_9DELT/458-735IICGVSVG-------AVN-A...................................................IKL------
A0A0E1WDL8_BURPE/13-264VISGTSAG-------GIN-G...................................................AAL------
A4F8K0_SACEN/17-281VLAGASAG-------GLN-A...................................................TLL------
Q2R2X0_ORYSJ/139-303PLAGSSAG-------AII-C...................................................AVI------
Q0A7T0_ALKEH/6-219VIIGTSAG-------AIN-A...................................................AVL------
Q3Y1A6_ENTFC/138-323IITGTSVG-------ALN-G...................................................ALI------
M6BTQ1_LEPBO/13-188LVVAVSSG-------ACS-A...................................................AYY------
YL620_MIMIV/38-270IFGGTSVG-------SIL-A...................................................VGL------
Q0FZD9_9RHIZ/20-226RITGASGG-------AMS-A....................................................AC------
Q5A7P0_CANAL/211-417IISGSSAG-------SIV-A...................................................SIL------
Q11UC9_CYTH3/381-624LMTGASGG-------IIG-ASYF............................................RELCLLK------
A6ASA3_VIBCY/5-186CIAGTSIG-------GII-A...................................................IGL------
Q1D826_MYXXD/142-382LLAGTSMG-------AIL-A...................................................IMR------
A4HB10_LEIBR/40-220RFTGVSAG-------ALA-A...................................................TCL------
Q0RZB6_RHOJR/7-221ILVGTSAG-------ALN-V...................................................VGL------
A3QTZ2_9VIRU/28-255QIGGSSTG-------CLV-G...................................................LLV------
Q1D5W1_MYXXD/154-432VWTGASAG-------AVN-A...................................................LLG------
Q09D74_STIAD/17-214MFSGTSTG-------AFV-S...................................................LYL------
A4BNM2_9GAMM/38-218ELWGTSAG-------AIV-G...................................................GSW------
Q4LA62_STAHJ/11-202LMIGTSGG-------AQA-A...................................................TGL------
Q5ZPA4_9DELT/22-208LVAGTSAG-------AIS-A...................................................LII------
Q6A6E2_PROAC/25-319SMVATSAG-------SIV-A...................................................CTL------
NTE1_PICST/1239-1403LIGGTSIG-------SLV-G...................................................GLY------
A4SJS7_AERS4/8-174HCIGVSAG-------AVN-L...................................................AAF------
Q1I961_PSEE4/42-302GVGGTSAG-------SIN-A..................................................LLLA------
A7RB12_PBCVA/19-192VVAGTSAG-------SIV-A...................................................AGV------
Q0VPN6_ALCBS/36-193RFCGSSAG-------ALV-G...................................................GCM------
A6G1N7_9DELT/36-362YISAVSGG-------SWA-T...................................................SLF------
A6QA07_SULNB/41-281SVAGASAG-------SIN-T...................................................LLS------
Q5WWS2_LEGPL/304-496KFAGSSAG-------AIM-S...................................................LMC------
A0Z6H0_9GAMM/8-199LMVGTSTG-------GIL-A...................................................LGL------
A6LMU7_THEM4/5-176IITGSSAG-------AIV-A...................................................ALY------
A7I0A5_CAMHC/6-211TISGTSIG-------AIN-G...................................................AFL------
Q2YJ28_BRUA2/13-187AIAGSSIG-------SII-G...................................................SSM------
A6G3Y0_9DELT/12-216RWSAVSAG-------VAM-A...................................................LAR------
A1DP95_NEOFI/20-225VIGGVGSG-------GLI-A......................................................------
A5K2I7_PLAVS/1168-1482IICGTSTG-------AII-S...................................................ILI------
TEG_BACME/7-180VFSGNSIG-------SFT-A...................................................LAL------
Q2W5X1_MAGSA/6-225VISATGGG-------GGV-AL.................................................SYLA------
A4U0C8_9PROT/5-257VWSLACIG-------AWL-GIVWNQAEPGHEAETSE..................AFFRQIFRPDDVYDRFPIAA------
A5N2W9_CLOK5/4-191GIVGTSIG-------AIN-G...................................................AVI------
A4JJZ7_BURVG/8-242MVAGASIG-------ALN-G...................................................AIV------
A6R0J1_AJECN/673-891LVMGTSSG-------GII-A...................................................HAL------
Q6MR93_BDEBA/72-224AIGGVEFA-------APM-A...................................................ALY------
A5P920_9SPHN/106-312VITGISTG-------SLQ-T...................................................LLL------
Q2C291_9GAMM/11-214SIIGISIG-------AIN-A....................................................AI------
A7BB55_9ACTO/26-199HISGVSAG-------SSH-L....................................................CN------
A5I1W5_CLOBH/6-200RLAGTSAG-------AII-A...................................................AFL------
A8GLS3_RICAH/7-147KVVGASGG-------AIA-A...................................................FSI------
A4T0K7_POLSQ/80-285MVVGTSAG-------SYV-G...................................................SSL------
A6DDL8_9PROT/5-162EISGSSAG-------AIV-A...................................................GAI------
A4CKZ2_ROBBH/4-195LLLGTSTG-------SLL-I...................................................SHL------
Q18D71_PEPD6/5-179SISGTSIG-------AIN-G...................................................YYL------
Q7CIX4_YERPE/86-275VVSGVSTG-------ALI-A...................................................PFA------
M6C3B5_LEPBO/36-250EVSGVSAG-------AAM-V...................................................LCL------
Q12EZ0_POLSJ/6-228KVSTVSGG-------SLL-V..................................................GLLL------
Q1GX66_SPHAL/43-328IVAGASAG-------GIN-G...................................................IFL------
Q4RS54_TETNG/14-183HIYGASAG-------ALT-A...................................................TAL------
Q5C8M6_LEGPN/32-295HVSGASAG-------AMT-A...................................................SIL------
Q6JBI3_DICVI/201-395HVVGVSTG-------SII-A......................................................------
Q0FKF7_PELBH/6-360SIGGSSAG-------AIA-AALAAAAEYRRQSSPQKDDMGGFDEIEKIAGELAEDLGKLLQPAPPFAGLFKLLL------
Q8Z7F2_SALTI/8-168IVAGCSIG-------SLV-G....................................................AA------
Q6ASS6_ORYSJ/60-258VAAGAGAG-------GVL-A...................................................AML------
A6QX75_AJECN/242-440IITGTATG-------ALV-A...................................................ALV------
Q74A07_GEOSL/58-306IISSVSGG-------SFT-S...................................................AYY------
Q54XY1_DICDI/13-231LFGGTSTG-------GIL-S...................................................IAK------
Q55G69_DICDI/65-250IVCGTSTG-------GIV-T...................................................YAK------
Q5Z158_NOCFA/22-193AVYGTSAG-------AIN-G...................................................AWL------
Q54QX6_DICDI/893-1088LIVGTSAG-------GLV-A...................................................LAL------
A0A0D5GHL8_BURML/413-612VISAVSIG-------AFN-G...................................................AIV------
A2QZY6_ASPNC/473-679VAFGTSGG-------GIA-V......................................................------
A4XTW9_PSEMY/15-385SIGGTSAG-------AIA-AAAAAAAELGRQRYLAGELSEDP......QGFAEIERLPCQLCLPATECRGTRLL------
Q0E508_SFAVA/27-224CYAGTSCG-------AAL-C...................................................ALM------
A6GI17_9DELT/71-215YLSTVSGG-------GFT-GS.................................................MLSA------
A7IE20_XANP2/6-198LFAGTSNG-------AVN-A...................................................LLL------
Q1DCU7_MYXXD/197-406LAAGSSTG-------ALI-S...................................................TLV------
Q6MAN6_PARUW/474-738RIAGTSSG-------AIF-A...................................................SLI------
Q4Z1R8_PLABA/352-558MVCGTSAG-------GLI-S...................................................LAL------
A4RTL4_OSTLU/164-398AAYGSSAG-------AMN-L....................................................TY------
A0JUC4_ARTS2/74-249HVDGTSGG-------ILT-A...................................................GMM------

PF00698

FAS_HUMAN/493-810HSFVSLTAIQIGLI-DLL.S---------------------------------------------------CMG..LRPD
STCK_EMENI/1547-1902FAQPALAVMEIAEY-AHL.Q---------------------------------------------------AQGVVQTQA
FAS_CHICK/492-809HAFVGLAAIQIAQI-DVL.K---------------------------------------------------AAG..LQPD
FAS1_YEAST/1663-2037FTQPALTLMEKAAF-EDL.K---------------------------------------------------SKGLIPADA
A4F7N8_SACEN/109-425VVQPALFAVQTSLA-ALW.R---------------------------------------------------SFG..VTPD
A4F7P0_SACEN/560-880VVQPVLFAVMVSLA-ELW.R---------------------------------------------------SYG..VEPA
I6Y231_MYCTU/534-851KVQPAVFAVQVALA-ATMEQ---------------------------------------------------TYG..VRPG
PPSA_MYCTU/632-950QIQLGLIGMQLALT-ELW.C---------------------------------------------------SYG..VRPD

PF16073

E9F646_METRA/19-261AAERQSFP.A...F.SSV-Q---------------------------------------------------NLV......
E9F8F0_METRA/9-244SEQRSNIG.N...F.DSI-L---------------------------------------------------RLA......
B8MGX9_TALSN/8-250VIERKELP.S...L.TDL-Y---------------------------------------------------SLS......
B6HLN4_PENCW/17-255RALQNSLG.H...F.TSL-Q---------------------------------------------------ELG......
E9D6Y9_COCPS/8-245SPEEQQRS.R...S.SNL-A---------------------------------------------------HLL......
K1X7W5_MARBU/800-1037TIERQRVP.T...F.SSI-K---------------------------------------------------DLN......
L8G6V9_PSED2/30-264RSQQDLFP.R...F.TTL-V---------------------------------------------------DLV......
B6QFH1_PENMQ/10-246PSDRRKFP.R...F.TSI-V---------------------------------------------------SLL......
B6QER4_PENMQ/12-248PERSK.YK.....F.DSF-E---------------------------------------------------EAS......
A7F3E3_SCLS1/4-241SLQRNRIP.E...F.TTI-L---------------------------------------------------ELN......
N1RV88_FUSC4/8-242SIERKSIP.E...A.ESL-S---------------------------------------------------LLL......
S3EB79_GLAL2/16-254RALQTSLG.H...F.SSL-Q---------------------------------------------------ELG......
G4UHA1_NEUT9/13-252RTERSKLP.E...F.LNL-Q---------------------------------------------------QLN......
B6HKK0_PENCW/8-244PSERQGFP.R...F.TSI-V---------------------------------------------------DLL......
E9F7M7_METRA/10-244LHTRDTTA.K...F.SSV-A---------------------------------------------------DLL......
WA_EMENI/8-244PSERSTFP.R...F.TSI-G---------------------------------------------------DLL......
V5GBX6_BYSSN/4-246AYLRQQLP.P...F.ASL-E---------------------------------------------------EFI......
G2QWR8_THITE/16-254AAEARRLP.D...F.LTL-K---------------------------------------------------QLN......
M3CY75_SPHMS/5-242RSQRDAMP.D...F.LTL-T---------------------------------------------------SLV......
M2RQ22_COCSN/4-241RTQRDQIP.N...F.LTT-W---------------------------------------------------DLV......
B8LZ55_TALSN/27-260LHERDFFP.Q...F.TTL-V---------------------------------------------------DLF......
S3D9A7_GLAL2/4-237KHKNINFP.P...F.STM-E---------------------------------------------------ELV......
G7XN60_ASPKW/8-244PSQRKLFP.R...F.TSI-V---------------------------------------------------DLL......
M2T1K1_COCSN/8-240PEVRNELP.R...F.TCL-E---------------------------------------------------DLA......
E9DR08_METAQ/20-259SRQQDLFP.R...F.TTL-I---------------------------------------------------DLV......
S3CWG8_GLAL2/8-245PLKERKAS.F...A.PTI-A---------------------------------------------------DLL......
F2PW05_TRIEC/6-242MREAQSLQ.A...F.TGI-L---------------------------------------------------DLL......
H1VJ39_COLHI/10-255PEQQERCP.R...F.VTL-A---------------------------------------------------DLL......
U1GE50_ENDPU/4-243YIQSD.IP.N...F.STV-Q---------------------------------------------------ELA......
A1C888_ASPCL/9-246PSQRSLFP.R...F.TSI-A---------------------------------------------------DLL......
R0KB98_SETT2/8-242IQIRDNLP.R...F.TAI-D---------------------------------------------------DLL......
E4V2N2_ARTGP/10-256WPLKELVP.P...F.NSV-L---------------------------------------------------DLAD.....
L8G4G9_PSED2/24-270TELKQLIP.P...F.NTI-L---------------------------------------------------AWAE.....
M2ZZX0_PSEFD/5-242RTQRVLIP.D...F.LTL-N---------------------------------------------------NLI......
Q2GV63_CHAGB/785-1022RAIHGWDR.G...C.GSL-L---------------------------------------------------EMA......
B8N7H8_ASPFN/9-246RAMQDSLR.N...C.SSF-Q---------------------------------------------------ELP......
Q2UA48_ASPOR/8-244PSERKIFP.R...F.TSI-V---------------------------------------------------DLL......
N4VBL7_COLOR/10-255PEQRARCP.R...F.GSM-A---------------------------------------------------DLL......
B2B495_PODAN/8-245RVERSRLP.I...F.RTL-Q---------------------------------------------------QLN......
A0A0C4E4Q7_MAGP6/8-245RLERSKLP.I...F.RNL-R---------------------------------------------------QLN......
R7YU14_CONA1/7-242VAERQWFP.A...F.TSV-V---------------------------------------------------DLL......
R0KD65_SETT2/13-258PRMRDSMG.G..SF.SDL-L---------------------------------------------------QLA......
V5G4B2_BYSSN/8-244PSQRQIFP.R...F.TSV-I---------------------------------------------------DLL......
H1VY29_COLHI/8-245KLERSKLP.T...F.LSL-R---------------------------------------------------QLN......
L8GBJ0_PSED2/42-283EEEQNLFP.R...F.TTL-I---------------------------------------------------DLV......
B6QC69_PENMQ/7-243SDERVRIG.H...F.GSF-E---------------------------------------------------DLL......
G3JFQ9_CORMM/16-246SAVQNMFT.R...F.TTL-I---------------------------------------------------DLV......
F9XMW3_ZYMTI/5-242RSQREVMP.D...F.LTL-S---------------------------------------------------NLI......
G9MXY7_HYPVG/19-259TTERQLFP.A...F.SSI-Q---------------------------------------------------NLV......
G0RW83_HYPJQ/19-262TAERQSFP.A...F.CSI-Q---------------------------------------------------NLV......
C5G0R3_ARTOC/8-243AQEKEIFP.R...F.SSI-A---------------------------------------------------ELL......
K1WM58_MARBU/4-242PSHRRELP.A...F.SNI-A---------------------------------------------------ELV......
G9NQM0_HYPAI/19-259IAERQWFP.A...F.SSI-K---------------------------------------------------NLV......
A2QH36_ASPNC/29-262LHQQEWFP.Y...F.TTL-I---------------------------------------------------DLL......
STCA_EMENI/11-251PPKEHKQA.R...T.ASL-A---------------------------------------------------ELL......
Q8EYQ4_LEPIN/19-271..DKKIIY.GGYDF.E..-.---------------------------------------------------.........
C7ZNQ1_NECH7/8-238FKVRNDLP.R...F.TCQ-E---------------------------------------------------DLL......
M2N8F6_BAUCO/8-232GPVKAEKA.R...S.ASL-A---------------------------------------------------DLL......
G7Y059_ASPKW/7-243PLFDD........Y.DSM-D---------------------------------------------------TVA......
E4V6P4_ARTGP/8-243AQDKEFFP.R...F.SSI-A---------------------------------------------------ELL......
U1GYJ0_ENDPU/26-259ARQQALLP.R...F.TTI-T---------------------------------------------------DLL......
H6BVA1_EXODN/5-241HPSKA.VP.N...F.STI-Q---------------------------------------------------ELV......
E3R122_COLGM/12-243SAVREGLP.R...F.TCI-E---------------------------------------------------DFV......
G2WRK7_VERDV/8-245KLDRAQLP.I...F.RTL-Q---------------------------------------------------QLN......
G0SDA9_CHATD/19-258KAEQSKIP.V...F.RSI-Q---------------------------------------------------QLS......
B6QHV7_PENMQ/4-241RTERVGIP.Q...F.SSL-R---------------------------------------------------GLV......
Q2UG06_ASPOR/8-245NTVDHKLA.R...T.ADL-R---------------------------------------------------QMV......
C5FQT2_ARTOC/8-245REIQELLP.R...F.SGI-A---------------------------------------------------DLL......
E9D5J9_COCPS/7-242PDVKK.YA.....F.DSY-L---------------------------------------------------GLE......
N1PC72_DOTSN/5-242RSQRNTIP.D...F.LTV-S---------------------------------------------------NLV......
E3R0Q2_COLGM/12-250PFLQDSLG.T...F.SSL-H---------------------------------------------------ELG......
R8BTJ4_TOGMI/8-245KVERVKLP.A...F.LTL-Q---------------------------------------------------QLN......
G4MU27_MAGO7/14-251RLERSRLP.V...F.RTL-Q---------------------------------------------------QLN......
R7YTG2_CONA1/4-241RSHRDSIP.D...F.LTV-Q---------------------------------------------------HLV......
U7PRD0_SPOS1/5-267AADRRQCPAS...F.TSP-L---------------------------------------------------ELARWAASP
E5A495_LEPMJ/4-241RTQRDQIP.D...F.LTT-W---------------------------------------------------DLV......
B8NVD5_ASPFN/5-241ANERTSLP.D...A.HTL-P---------------------------------------------------LLL......
B8MV60_TALSN/15-255LGDYECYR.N...F.ETI-V---------------------------------------------------ELA......
E9FC93_METRA/16-256STQQQLFP.R...F.STL-V---------------------------------------------------DLL......
G9NBV5_HYPVG/10-247KSEHGWTG.N...F.DTL-L---------------------------------------------------GLA......
R1G9D8_BOTPV/4-241RSQRDSIP.E...F.NTV-S---------------------------------------------------SLM......
S3CAW2_OPHP1/8-244QLERAKLP.V...F.KTL-Q---------------------------------------------------QLN......
B2B664_PODAN/7-242AHYRRSFP.N...F.TSL-S---------------------------------------------------ELA......
M1WG96_CLAP2/23-272TDLGRLIP.T...F.ETV-L---------------------------------------------------QWSED....
E9F5C9_METRA/8-246PDVRAVYH.....F.ASW-I---------------------------------------------------ELE......
A0A098D9G9_GIBZA/4-241AVQQKLFP.N...F.ADI-Q---------------------------------------------------ELV......
G2YLD0_BOTF4/4-242STARQHVA.V...F.SSV-S---------------------------------------------------EFT......
B2W1Q0_PYRTR/9-246RVLQESCK.G...C.SSL-Q---------------------------------------------------ELA......
C7Z6X3_NECH7/7-240TQQQSLFP.R...F.TTL-I---------------------------------------------------DLV......
E3QS53_COLGM/10-256SAQQSRCP.R...F.AKI-V---------------------------------------------------DLL......
G9NGU8_HYPAI/9-247TKEKQPYL.R...F.ESI-L---------------------------------------------------ELA......
B8MYS6_ASPFN/10-247FSQRQRFI.R...F.TTF-E---------------------------------------------------ELL......
G2RCG6_THITE/8-247TSEQAKFV.G...F.TTF-Q---------------------------------------------------ELL......
S0DTP6_GIBF5/8-239YSIRKDLP.R...F.TCQ-E---------------------------------------------------DLL......
G2QMK9_THIHA/8-254YSQRTQFP.S...S.STL-T---------------------------------------------------ELL......
F0XGQ5_GROCL/8-244RIERAKLP.V...F.KTI-Q---------------------------------------------------QLN......
T0KJR9_COLGC/11-253PKIRDSLG.PSGIF.SSV-Q---------------------------------------------------EVA......
M2RHZ9_COCSN/9-246PAERDTIG.P...F.HSL-Q---------------------------------------------------GLT......
R0JX83_SETT2/4-242PDVRHHIP.P...F.NSV-F---------------------------------------------------DLS......
L8G0G7_PSED2/41-278SLERRHIP.P...F.TTI-E---------------------------------------------------ELS......
Q2HGW2_CHAGB/17-254ALERATLP.N...F.RTL-R---------------------------------------------------QLN......
B8MF01_TALSN/8-245LAQRSVFP.S...F.TTL-P---------------------------------------------------ELL......
N4VM62_COLOR/16-257AKLREALG.G..PF.TDL-L---------------------------------------------------QLA......
S3DAZ0_GLAL2/11-247NLERNKIP.R...F.SSL-E---------------------------------------------------DLN......
E3SAD1_PYRTT/8-240PEVRKDLP.R...F.TCL-E---------------------------------------------------DLA......
U7PK37_SPOS1/8-244RLERAKLP.L...F.RTL-Q---------------------------------------------------QLN......
B2B6C8_PODAN/41-279PPQEHKLS.R...T.ANL-A---------------------------------------------------EML......
V5G236_BYSSN/6-248RQDREGLP.S...FASDL-Y---------------------------------------------------EL.......
M2NM35_BAUCO/5-243RSQRDVIP.D...F.LTL-N---------------------------------------------------DLV......
B6QAB8_PENMQ/31-263LHEQDLFP.Q...F.TTL-V---------------------------------------------------DLF......
M2XHZ5_DOTSN/10-247PPAEHKAA.R...T.FDL-A---------------------------------------------------DML......
R7YHB3_CONA1/8-244RTARD.LP.G...F.TSV-E---------------------------------------------------NLL......

PF01735

PLB2_SCHPO/134-617-------------AVNNFANITYLRD......NVWNLEHSVFA.P..HGDNVV.ENLAYYDDLDDEIDQKKDAGFDTSLT
PLB5_SCHPO/125-607-------------AVNNFANITFLHDD......VWNLDHSLFA.P...YDDAF.ENFYIYQEWFEQVLQKKNAGFNVSIT
PLB1_YEAST/99-586-------------AWNNWTSVQAIVDNTTESNSIWDISHSILT.P..DGINIF.KTGSRWDDISDDVQDKKDAGFNISLA
PA24A_CHICK/190-675-------------.....YSHPDFPEKGPKEINQELMNSVSHN.P..LLLLTP.QKVKRY...IEALWNKKSSGQPVTFT
PLB_NEUCR/121-606-------------FSNNFSSIETLLS....ENKVWDFENSIFKGPKEAGLSTV.NRIQYWSEVAKEVAKKKDAGFETSIT
PLB_KLULA/102-589-------------AYNNWTSVQAIINNMTDDNSIWDISNSIVN.P..GGINIF.SSISRWDDISDAVEEKKKAGFNTSIT
PLB6_SCHPO/114-600-------------AVNEFRTIQNISK......SIWYTRLGIFF.I..EETHFG.DLKNYYTNVVDEVNQKAAAGFNVSLT
PA24A_DANRE/185-664-------------.....YSHPEFPAKGPGDINKELMNRVSNN.P..LKLLLP.QNINRY...VKALWKKKSAGQPVTFT
PLB1_CANAL/88-565-------------ASNNLNSVDDMLS..QG...LWELTHSFLS.Y..YGIEHPIKQVEEWVNVGNQVASKRNANFNVSLT
PLB3_YEAST/105-592-------------ALNNWTSVQDILNNMQNDDSIWDLSDSIVT.P..GGINIF.KTAKRWDHISNAVESKQNADYNTSLA
PLB1_SCHPO/114-593-------------ALNNFSTINDFSK.......LWAFNHPLMY.P...KSAIV.FNAHFYSSIMNEVAEKANAGFNISLS
PLB2_YEAST/101-588-------------AWNNWTSVQEIVDHMSESDSIWNITKSIVN.P..GGSNLT.YTIERWESIVQEVQAKSDAGFNISLS
B6HB59_PENCW/114-597-------------YINNFTTVDKLQT..HEAGSVWQFGNSIIEGPDAGGIQLL.DSAGYYKDLADAVDGKKKAGFDTTLT
G8ZY27_TORDC/97-584-------------AWNNWTSVQDIVNNMTADDSIWDISNSIIN.P..GGFMIV.TTIKRWDHISDAVEGKQDAGFNVSLT
Q59W34_CANAL/88-564-------------ASNDLIPVDQLLR....EDKLWDIQNSLVA.Y..YGVNIV.RNTAMWGNINLQVQTKQLAGFTVSIT

PF01734

Q9N5Z7_CAEEL/97-269-------------IFN...-----------------------------------..PEKISEAVEEIYKMADEVND....
Q8F079_LEPIN/12-165-------------AAG...-----------------------------------IPIDTMTDLILNLKKKDFWEGN....
B8GC44_CHLAD/8-228-------------ANN...-----------------------------------MSPRTLISVLERSLLGIDQLEP....
C1DSE3_AZOVD/14-206-------------AHGLLQ-----------------------------------GGRDGAREALASFWQAVASSAP....
A9BEP0_PETMO/3-174-------------ALY..G-----------------------------------VNFFGRLKDFIYEKNNPLREVITN..
A9B328_HERA2/4-179-------------ACH...-----------------------------------PNLAGIQRIAQRWKSVKREDIF....
B2U808_RALPJ/9-214-------------HAW...-----------------------------------.NSAELMDYYGEALRQNTRNAH....
Q3AAC7_CARHZ/6-206-------------GAG...-----------------------------------LSPKDMEELALQIKPKDLYNCLFTAG
A6CHF0_9BACI/8-175-------------LSK...-----------------------------------QKGRNKKVNIGFAGNPKYLSWR....
Q2GUC2_CHAGB/19-224-------------VML...-----------------------------------GRLHMTIDECIEVYERLGKDVF....
Q9XAG3_STRCO/16-207-------------ARG...-----------------------------------AAPAGLYKEQLDRERPMLDVDF....
Q2JEY3_FRASC/11-221-------------GLGIGI-----------------------------------DVMANSERGIYEAGDPVLDYRDLGAS
Q8R6F6_FUSNN/65-256-------------SIG...-----------------------------------YTVDEIEKFLDDVNVSNFLETITDNT
Q9ZCV7_RICPR/15-214-------------NLP...-----------------------------------DSDNPGKPLFSAEQAQTLFERMV...
Q038G8_LACC3/6-159-------------ARM...-----------------------------------.....LPEQVPQWWQHFSEAKV....
D5T6X7_LEGP2/25-249-------------ALG...-----------------------------------MPSAVFRDKLLTTNLKNLMGSRIGSL
Q4UJC7_RICFE/42-240-------------TIP...-----------------------------------KEQGSNIAKYSAKDALKIFTDA....
Q54HM9_DICDI/140-357-------------.MG...-----------------------------------RSKPLPYDEIVEIYKNFGKVIF....
Q2K9E1_RHIEC/30-248-------------AHV...-----------------------------------WPRLAFENEVAVNFRAQYVDRI....
A4IAC8_LEIIN/190-378-------------CCS...-----------------------------------TDLASLFHSSSGSNSIAEANALL...
Q21S96_RHOFT/26-231-------------FAG...-----------------------------------.TFEACFTGYKRAVAENVHNLY....
A5GF97_GEOUR/15-187-------------ASG...-----------------------------------ISPSEIQQETLTVDTNRFKDFN....
Q1CW69_MYXXD/353-514-------------CGS...-----------------------------------ALDGHDGLEGLRRLEERAMSRQ....
A6NV66_9FIRM/7-176-------------ISK...-----------------------------------QSGRNLEILTHYANDKRYMGVN....
I6YB49_MYCTU/181-420-------------ARE...-----------------------------------LPVPI..DEYAEWAKTVSYRAILGPE
A0YM74_LYNSP/12-230-------------ASD...-----------------------------------RPFSNAVQQLNELWTNLGEVEILKPN
A0A0C9NUJ5_LEGPN/27-309-------------ACG...-----------------------------------GSAELMDYFCSANSLADFVDNRLTKK
Q2GS92_CHAGB/73-327-------------IML...-----------------------------------GMFGKTVDDCINEFHRQNKSIPLADD
Q1ZT25_PHOAS/33-203-------------ISR...-----------------------------------QPRFGYKFIQNYTTTDKFFSLY....
Q5CY77_CRYPI/46-241-------------QFY...-----------------------------------PPGEELAWTTELVILWKMARQKDITT
PATA2_SOLTU/32-227-------------TTP...-----------------------------------NENNRPFAAANEIVPFYFEHGP....
A6G7S9_9DELT/458-735-------------AEG...-----------------------------------APDSA..EQLVAMWRAFSADRNAIFW
A0A0E1WDL8_BURPE/13-264-------------AIS...-----------------------------------LLYDGEFSELREVWMKTATFND....
A4F8K0_SACEN/17-281-------------STS...-----------------------------------MVYGMPFDRMRRMWVRLADLEAM...
Q2R2X0_ORYSJ/139-303-------------ASG...-----------------------------------NTMRDALQVTKDLADNCRSNGT....
Q0A7T0_ALKEH/6-219-------------ACY...-----------------------------------ATHFQRGVANMEAVWANFRCQHIYRT
Q3Y1A6_ENTFC/138-323-------------LQG...-----------------------------------.DMKKAVNLWKKLSTRQVLALPE...
M6BTQ1_LEPBO/13-188-------------VTM...-----------------------------------PKPEP..EKSLKTLAIWYIELA....
YL620_MIMIV/38-270-------------SLG...-----------------------------------YQKKDFEKFVETFDLSKFVDSK....
Q0FZD9_9RHIZ/20-226-------------FIA...-----------------------------------QREVKLLETMGAAFLDRDENIS....
Q5A7P0_CANAL/211-417-------------CCH...-----------------------------------.NNEETFELLSTITTKKFNIFDVVD.
Q11UC9_CYTH3/381-624-------------AQG...-----------------------------------KIKSPHEFQYLSDISEDVLNPIVFSM
A6ASA3_VIBCY/5-186-------------ALG...-----------------------------------KSSDDIITAFQTYKADIFKSKG....
Q1D826_MYXXD/142-382-------------SRL...-----------------------------------TRFDA..TDMINIVRGLSFRKLFR..
A4HB10_LEIBR/40-220-------------ASG...-----------------------------------QYDILSVKKFSLAAAEDYRSSI....
Q0RZB6_RHOJR/7-221-------------AAGA.H-----------------------------------HGIDQAAERVVSLWDSVSLGDVFSV.
A3QTZ2_9VIRU/28-255-------------SLD...-----------------------------------IPPVKLEKLIYKLNIFKHTVNFDT..
Q1D5W1_MYXXD/154-432-------------GLA...-----------------------------------SCDTAFAQPTWSPEQSLFWTVWI...
Q09D74_STIAD/17-214-------------AHA...-----------------------------------LSLRQRQGVQAPGCLDIIDGCIAF..
A4BNM2_9GAMM/38-218-------------TTG...-----------------------------------TTAAEMLATIRNLDSKDTVDLC....
Q4LA62_STAHJ/11-202-------------TSD...-----------------------------------KSFDVIYDEQIAPKSNETPPVK....
Q5ZPA4_9DELT/22-208-------------AAA...-----------------------------------REPAVGLEQARQIWFTPGLFDS....
Q6A6E2_PROAC/25-319-------------AQW...-----------------------------------TDPAKQSAALRQLEAMWLEMTDQSDM
NTE1_PICST/1239-1403-------------AKD...-----------------------------------YNIVSIYGRAKKFSKRVASLWR....
A4SJS7_AERS4/8-174-------------LAG...-----------------------------------QRGRNHSVITDYSCRPEFISLA....
Q1I961_PSEE4/42-302-------------SLD...-----------------------------------EPGKPKGEKLLAELANTNLRDFVDGD
A7RB12_PBCVA/19-192-------------ALN...-----------------------------------KDPVSMCKAFIDEVYKPSFDIS....
Q0VPN6_ALCBS/36-193-------------ASG...-----------------------------------ASVNAIEDTLLGLDRAQFWDPS....
A6G1N7_9DELT/36-362-------------TYY...-----------------------------------RAGARDDAQFLDLGLDAPTDPGTLSL
A6QA07_SULNB/41-281-------------AMY...-----------------------------------WCQKESVPYQNRVDDNLFYETW....
Q5WWS2_LEGPL/304-496-------------YLG...-----------------------------------YTADEISELFQHFKQEHLVQFD....
A0Z6H0_9GAMM/8-199-------------AQP...-----------------------------------DTEKPENSRFSARDLADLYANR....
A6LMU7_THEM4/5-176-------------GLY...-----------------------------------GNSKIVYKKFSNAVEKFFPNLK....
A7I0A5_CAMHC/6-211-------------SAY...-----------------------------------KDPIKTAEILQNLWLNTNVLDVFKLK
Q2YJ28_BRUA2/13-187-------------ANG...-----------------------------------MSGKDIYDYMASIFTNRSEVVR....
A6G3Y0_9DELT/12-216-------------CTG...-----------------------------------LFPETMQVFLDEVDRNESNIYP....
A1DP95_NEOFI/20-225-------------IML...-----------------------------------GRLKMDVEQCINAYQNLLECSFQ...
A5K2I7_PLAVS/1168-1482-------------GLE...-----------------------------------RAHLNEVEFLYNLLINKIFQKD....
TEG_BACME/7-180-------------ASG...-----------------------------------RSPEETFDFFKDQILPAFSVSRP...
Q2W5X1_MAGSA/6-225-------------PKG...-----------------------------------MSRQDSLRNSVNFGVSDEIYKYIPMN
A4U0C8_9PROT/5-257-------------AFA...-----------------------------------PDYQASATNMVEFILDPASYRNLVVP
A5N2W9_CLOK5/4-191-------------AQG...-----------------------------------.DFEKGYNWWTKIDISTIFNLEKIHM
A4JJZ7_BURVG/8-242-------------ASA...-----------------------------------VTPQKAHAHLALLWDRLAQTSPVEFQ
A6R0J1_AJECN/673-891-------------VNL...-----------------------------------RWDVATCSDVFERLARRVFHRARR..
Q6MR93_BDEBA/72-224-------------ANK...-----------------------------------ELANDVEWQMFKLKDEEVLKKS....
A5P920_9SPHN/106-312-------------MVA...-----------------------------------LDGNAKRQTRDYAMRQLEWGYSP...
Q2C291_9GAMM/11-214-------------IAG...-----------------------------------NKPENRLKNLEIFWERVTSSISFSNL
A7BB55_9ACTO/26-199-------------FTS...-----------------------------------RDAARSHDTFVDLVEDPEFGGL....
A5I1W5_CLOBH/6-200-------------AVG...-----------------------------------YRGKEIKKIMYDLDYEKVGNIT....
A8GLS3_RICAH/7-147-------------VLG...-----------------------------------YQSEKIEDILKKIKFLDRTSKW....
A4T0K7_POLSQ/80-285-------------LSG...-----------------------------------EFYRLRKEFDFFGKFPEIFSQIAPLA
A6DDL8_9PROT/5-162-------------ACK...-----------------------------------IPLKDIFEIVKSKEFKSIFKFS....
A4CKZ2_ROBBH/4-195-------------AL....-----------------------------------QKIEKIRKVYTSVNQQSIFSNLPFTI
Q18D71_PEPD6/5-179-------------YTG...-----------------------------------.NVDNLEKMWTNIKDIQNGNVK....
Q7CIX4_YERPE/86-275-------------FLG...-----------------------------------SDHDKALHDFYTTTTTRDIFHI....
M6C3B5_LEPBO/36-250-------------ICG...-----------------------------------.DEEECVSFFENIVRKNPANFYLSRL
Q12EZ0_POLSJ/6-228-------------QLN...-----------------------------------GMRWPTSDEYLEALLPKLKDVLT...
Q1GX66_SPHAL/43-328-------------ARA...-----------------------------------LATGESLDPLTDLWLDSADVDNLLDP
Q4RS54_TETNG/14-183-------------VTG...-----------------------------------VCLGETGASIIDVAKEARKRFL....
Q5C8M6_LEGPN/32-295-------------AVG...-----------------------------------MDIKDIKKLIEGLDITKLLDNSGVGF
Q6JBI3_DICVI/201-395-------------SLL...-----------------------------------IGKGYTVEDCRTIYVDVSKRLF....
Q0FKF7_PELBH/6-360-------------AAV...-----------------------------------SDPAGGRSKIRGLLSAATGLWKRPIL
Q8Z7F2_SALTI/8-168-------------YAC...-----------------------------------NKLSALEQWVCSFRYWDVLRLM....
Q6ASS6_ORYSJ/60-258-------------FLR...-----------------------------------GPDGRPRYTAEEALEFVAASVG....
A6QX75_AJECN/242-440-------------AVH...-----------------------------------KDDDLIPVLNGEGIDEAVSDRLSKQK
Q74A07_GEOSL/58-306-------------ALY...-----------------------------------PDRFF..DDFPGTFLYRDIQGG....
Q54XY1_DICDI/13-231-------------SKE...-----------------------------------ISNSELLNMYEGKESKKIFGSL....
Q55G69_DICDI/65-250-------------LFS...-----------------------------------VDNDELLRLYCEFGKKIFPSSS....
Q5Z158_NOCFA/22-193-------------LCG...-----------------------------------RAVPGMRSWSNPDIMRAVIDPA....
Q54QX6_DICDI/893-1088-------------AST..P-----------------------------------KTPVQLSTAMESLSKSAFVKHP....
A0A0D5GHL8_BURML/413-612-------------ASH...-----------------------------------..PKGATKALEAFWRELSIALPLPYE
A2QZY6_ASPNC/473-679-------------LKA...-----------------------------------FRQRRPISECQQTLADLIVRFFQG..
A4XTW9_PSEMY/15-385-------------ALF...-----------------------------------RPAPALRSLFDSFTAALDARRNPLGL
Q0E508_SFAVA/27-224-------------CAG...-----------------------------------ATPLSILKRIVNQRKNLGVCSDALES
A6GI17_9DELT/71-215-------------VLN...-----------------------------------DPRQT..KEPFPVRKETGESEP....
A7IE20_XANP2/6-198-------------AWF...-----------------------------------DDPVLAFEAVLRFDDEVRESQT....
Q1DCU7_MYXXD/197-406-------------DLF...-----------------------------------HTPGHEEAARQLLVSNYTCSVE....
Q6MAN6_PARUW/474-738-------------SVG...-----------------------------------YTSSEIRDILDEIDLNKILDYPDDLR
Q4Z1R8_PLABA/352-558-------------LEG...-----------------------------------YSLQEISALLPFIMEKTFEGNR....
A4RTL4_OSTLU/164-398-------------YLS...-----------------------------------KQPEGIFAYEEDLCDGSFLDLKRHVS
A0JUC4_ARTS2/74-249-------------LSG...-----------------------------------VSPADMCRNWSAVNVKDFGSAL....

PF00698

FAS_HUMAN/493-810GIVGHSLGEVACGYAD--------------------------------------GCLSQEEAVLAAYWRGQCIKEA----
STCK_EMENI/1547-1902IFAGHSLGEYSSLGAC--------------------------------------TTIMPFESLLSLILYRGLKMQN----
FAS_CHICK/492-809GILGHSVGELACGYAD--------------------------------------NSLSHEEAVLAAYWRGRCVKEA----
FAS1_YEAST/1663-2037TFAGHSLGEYAALASL--------------------------------------ADVMSIESLVEVVFYRGMTMQV----
A4F7N8_SACEN/109-425AVVGHSIGELAAAHVC--------------------------------------GAAGAADAARAAALWSREMIPL----
A4F7P0_SACEN/560-880AVVGHSQGEIAAAHVA--------------------------------------GALTLEDAAKLVVGRSRLMRSL----
I6Y231_MYCTU/534-851AVVGHSMGESAAAVVA--------------------------------------GALSLEDAARVICRRSKLMTRI----
PPSA_MYCTU/632-950LVIGHSMGEVAAAVVA--------------------------------------GALTPAEGLRVTATRSRLMAPL----

PF16073

E9F646_METRA/19-261..ARALK......KD.--------------------------------------.TSVALESTLATIYHLCCFINY----
E9F8F0_METRA/9-244..ENNARL.....EE.--------------------------------------.PNEIIATVLMNIARLGELILY----
B8MGX9_TALSN/8-250..ESENGN.....AS.--------------------------------------.DHPILSPALLVILQLGQFISW----
B6HLN4_PENCW/17-255..DRYRH......SND--------------------------------------E.FGVARALLLHTLRVGTLLQW----
E9D6Y9_COCPS/8-245..QKYSDG.....DL.--------------------------------------..NPAFQVALHSLTQLACFINH----
K1X7W5_MARBU/800-1037..ENYQAK.....KI.--------------------------------------.KNSAVDSALLCITQLAHYIDR----
L8G6V9_PSED2/30-264..SKLAE......TE.--------------------------------------.GNPVLRFTLLPVCEIGQFIRY----
B6QFH1_PENMQ/10-246..SRYREL.....G..--------------------------------------.PNPALESALTTLYQLASFISY----
B6QER4_PENMQ/12-248..KRLA.......VDS--------------------------------------SPDVVLRTIVLCAAQLGYLIA.----
A7F3E3_SCLS1/4-241..KLYHAR.....NI.--------------------------------------.RNPAVDSALLCITQLSQYIDR----
N1RV88_FUSC4/8-242..EGVRRS.....E..--------------------------------------.PHAALDSAFVCIYEIGYYIDY----
S3EB79_GLAL2/16-254..ERYRN......STD--------------------------------------D.LGVVRSLLLHTVRAGNLLQW----
G4UHA1_NEUT9/13-252..ERYHGQ.....PI.--------------------------------------.KHPGIDGALLCISQLAHYIDH----
B6HKK0_PENCW/8-244..ARFKES.....G..--------------------------------------.PNPALESALTTIYQLGCFIHY----
E9F7M7_METRA/10-244..MRKRDG....C...--------------------------------------.LSPALEQVLCLVHTLAAFIWQ----
WA_EMENI/8-244..ARHCES.....P..--------------------------------------.GNPAIESVLTCIYQLGCFINY----
V5GBX6_BYSSN/4-246..RCYNN......SDP--------------------------------------CKNAVVESTLLCVAQLADYIS.----
G2QWR8_THITE/16-254..ERYNKS.....DY.--------------------------------------.KHAAVDAALLTISQLAHFLDH----
M3CY75_SPHMS/5-242..EAYYQK.....GE.--------------------------------------.KVPMLESALVTIAQLGHYIGY----
M2RQ22_COCSN/4-241..EAYYAK.....GL.--------------------------------------.KIPEIESCMVTIAQLAHYIGY----
B8LZ55_TALSN/27-260..ARHDQ......FA.--------------------------------------.GAPALKFTLLCVTQIGQWIRY----
S3D9A7_GLAL2/4-237..DRYEFS.....DK.--------------------------------------.RNAVLDSTLACLAQIAHFVMF----
G7XN60_ASPKW/8-244..SRSRES.....G..--------------------------------------.PSPVLESALTCIYQLGCFIHF----
M2T1K1_COCSN/8-240...SWKHS.....GTG--------------------------------------KRCIALDMAMTTLWQLGMFVL.----
E9DR08_METAQ/20-259..SWLES......TP.--------------------------------------.GAPVLKFFALCVYEIAQFIVK----
S3CWG8_GLAL2/8-245..HKYRQG.....SL.--------------------------------------..SPAFQTALSCCYQLASFISH----
F2PW05_TRIEC/6-242..HQCEQS.....Q..--------------------------------------.PHPALAGALTCIYQIASYIQF----
H1VJ39_COLHI/10-255..SPY........RSE--------------------------------------TLNPCFVQGLTCITQLGLFIRQ----
U1GE50_ENDPU/4-243..ERYYKS.....ES.--------------------------------------.PDTAIESSLVCLAQLIHFIGC----
A1C888_ASPCL/9-246..ARHRES.....G..--------------------------------------.TNPALGSALTCIHQLGCFIDY----
R0KB98_SETT2/8-242........LM.EPTSG--------------------------------------KRCIPLEMALTCMYQLGVFIS.----
E4V2N2_ARTGP/10-256.V.DFRQG....P...--------------------------------------.LGAAMESSMLTILELGMFIG.----
L8G4G9_PSED2/24-270.NSQLREG....L...--------------------------------------.ICGAVDGVLLIVVQLATYIG.----
M2ZZX0_PSEFD/5-242..EAYYQK.....GD.--------------------------------------.KLPALESALVTIAQLGHYIGY----
Q2GV63_CHAGB/785-1022..EAVDS......PGG--------------------------------------N.NLAVSTVLLCAGRLGQLIVH----
B8N7H8_ASPFN/9-246..AKYRY......TGD--------------------------------------E.FGMAHAMLIYVIRAVDLLKA----
Q2UA48_ASPOR/8-244..ARHRES.....D..--------------------------------------.PNPALESALTCIYQLGCFINY----
N4VBL7_COLOR/10-255..SPY........RNR--------------------------------------TLNPCLVQALTCVTQLGLFIRQ----
B2B495_PODAN/8-245..ERYYAQ.....KL.--------------------------------------.KHPGIDGALLCISQLAHYIDH----
A0A0C4E4Q7_MAGP6/8-245..ERYHSH.....AT.--------------------------------------.KHSGIDSALLALSQLVDYIDH----
R7YU14_CONA1/7-242..ARHREL.....G..--------------------------------------.NNPALEGALTCIHHLACFISH----
R0KD65_SETT2/13-258..ERFRS......QDD--------------------------------------V.VGLAHAVLVGIVRAAKLVQF----
V5G4B2_BYSSN/8-244..ARHRES.....G..--------------------------------------.PNPALESALTCIYHFACFINH----
H1VY29_COLHI/8-245..ERYHAQ.....GI.--------------------------------------.KHPGVDSALLCITQLAHYIDR----
L8GBJ0_PSED2/42-283..AKFGE......TD.--------------------------------------.CASVLGFFLLSVHEVAQSIVY----
B6QC69_PENMQ/7-243..QRYSG......TED--------------------------------------T.IGVIHTVVICACRLAELILL----
G3JFQ9_CORMM/16-246..AGFGDK.....IE.--------------------------------------.GAPVMQFCLMTVCQLAKFI.H----
F9XMW3_ZYMTI/5-242..EAYYQK.....GE.--------------------------------------.KVLMLESAFLTIAQLGHYIGY----
G9MXY7_HYPVG/19-259..TRGIKK.....DK.--------------------------------------..NAALESTLATVYQICCFLNY----
G0RW83_HYPJQ/19-262..SRVLKT.....DKH--------------------------------------TENAAVESTLATVYQLCCFFSH----
C5G0R3_ARTOC/8-243..TWRGRH.....NR.--------------------------------------.SNPPVENALTCVYQLGQFINQ----
K1WM58_MARBU/4-242..ERYYKA.....DR.--------------------------------------.PNIAIESTVTCLAQLVHFIGY----
G9NQM0_HYPAI/19-259..ARGLKK.....DK.--------------------------------------..NAALDSTLTTIYQICAFINY----
A2QH36_ASPNC/29-262..AQHEN......CY.--------------------------------------.AAPALKLPLLCATELGQFIRH----
STCA_EMENI/11-251..QKYVDR.....KL.--------------------------------------..PSAFQTALSCVTQIGLFMRQ----
Q8EYQ4_LEPIN/19-271..SWVKNPDSAPDENY--------------------------------------LCSAPVSIVGIFLTQIGNYIA.----
C7ZNQ1_NECH7/8-238...RWDE.......SG--------------------------------------KRCIALDMAMTTLYHLGTFIS.----
M2N8F6_BAUCO/8-232..QKYTEG.....HL.--------------------------------------..SPAFQVALHSLTQLGAVIRH----
G7Y059_ASPKW/7-243..EAYA.......QRT--------------------------------------DYGVVMPTVLLCVAQLGGLIL.----
E4V6P4_ARTGP/8-243..TWRNSH.....SR.--------------------------------------.SNPAIENALTCIYQLGQFIHQ----
U1GYJ0_ENDPU/26-259..ANLGE......TE.--------------------------------------.GKPALSFALHCLCEIGQFIRY----
H6BVA1_EXODN/5-241..DRYYRG.....DA.--------------------------------------.KDAATESALVCISQFCHFIGA----
E3R122_COLGM/12-243........LL.GPQNI--------------------------------------GKCNALELALTCIYQIGTFIR.----
G2WRK7_VERDV/8-245..ERYHAQ.....SR.--------------------------------------.KHSGVDSALLCVAQLAHYIDR----
G0SDA9_CHATD/19-258..TRYRAQ.....QQ.--------------------------------------.KHTGIDGALLCAAQIVHYLDH----
B6QHV7_PENMQ/4-241..DEYQRR.....CP.--------------------------------------.RVASLESALTCLAQLAHFIGL----
Q2UG06_ASPOR/8-245..QKYVDG.....KL.--------------------------------------..TPAFRTALVCLCQLGCFIRE----
C5FQT2_ARTOC/8-245..ASYSTD.....LD.--------------------------------------.STPVLASTLTAIYQLGSFISY----
E9D5J9_COCPS/7-242..ERIL.......AEK--------------------------------------VPDVVLRTLLLCFTQLGHLIM.----
N1PC72_DOTSN/5-242..EAYYQK.....GD.--------------------------------------.KVPMLESAFVTIAQIGHYIGY----
E3R0Q2_COLGM/12-250..ERYRN......TTD--------------------------------------E.LGMAHCLLLHTVRASNLLLW----
R8BTJ4_TOGMI/8-245..ERYYAQ.....GN.--------------------------------------.KHPGVDGALLCIAQLAHYIDH----
G4MU27_MAGO7/14-251..ERYHAQ.....IT.--------------------------------------.KHSGLDGALLCVAQLAHYIDH----
R7YTG2_CONA1/4-241..EAYYEK.....GL.--------------------------------------.KMPQLESCLVTIAQLAHFIGY----
U7PRD0_SPOS1/5-267ASDSVSGGIPGGTLLR--------------------------------------KISPALSAALLCMAQLGHVIV.----
E5A495_LEPMJ/4-241..EAYFAQ.....GV.--------------------------------------.KVPQLESCMVTIAQLAHFIGY----
B8NVD5_ASPFN/5-241..EAVRRG.....R..--------------------------------------.RHVALESALVCLCEIGQYIAL----
B8MV60_TALSN/15-255..EIYSK......QDG--------------------------------------T.YEPIGCALWTISQFADYLSR----
E9FC93_METRA/16-256..DNWECA.....P..--------------------------------------.GRPALQLFLLSVLQSAQFIHH----
G9NBV5_HYPVG/10-247..EENEE......QHG--------------------------------------A.NALISTVLMCIGRLGELIVY----
R1G9D8_BOTPV/4-241..EAYYEK.....GV.--------------------------------------.KVPQIESSFVTIAQLSHYIGY----
S3CAW2_OPHP1/8-244..ERYHSQ.....DL.--------------------------------------.KHPGLDGALLCVTQLAHYIDH----
B2B664_PODAN/7-242..AAVS.......KQD--------------------------------------HPSPALYAALLCIAQIGDVII.----
M1WG96_CLAP2/23-272ANASLREG....L...--------------------------------------.LCGAIDGVLLVVLQLASYIC.----
E9F5C9_METRA/8-246..KTIA.......SQE--------------------------------------VPDVVLRTTALCFAQLGHFIR.----
A0A098D9G9_GIBZA/4-241..S...KS.....DWG--------------------------------------SGNPALTSALACFYHLCSFIHF----
G2YLD0_BOTF4/4-242..ERYFEA.....DH.--------------------------------------.PDLAVESAITCLAQLTHFIGF----
B2W1Q0_PYRTR/9-246..ERYRH......TGD--------------------------------------E.FGMAHAMLIYAVRAVVLLEA----
C7Z6X3_NECH7/7-240..SKLGE......TE.--------------------------------------.GTPVLRFCLLPVCQIGQFINY----
E3QS53_COLGM/10-256..SQS........RAG--------------------------------------ALNPCISQALTCISQLGLFIRQ----
G9NGU8_HYPAI/9-247..EIFAE......QNT--------------------------------------P.FEAVSTILFFIAQFGDLLFR----
B8MYS6_ASPFN/10-247..ARVQRS.....TC.--------------------------------------.PHPALEKALACTYQLACFIRQ----
G2RCG6_THITE/8-247..AGVQQV.....SS.--------------------------------------.RHPALEKALACTYQLACFIKY----
S0DTP6_GIBF5/8-239...LWDQ.......SG--------------------------------------PRCVALDMAMTTLYQLGTFIS.----
G2QMK9_THIHA/8-254..NAHCS......SST--------------------------------------TPSCALDSALACLHQIAAFVSY----
F0XGQ5_GROCL/8-244..EKYHSQ.....DI.--------------------------------------.KHPGLDGALLCITQLAHYIDH----
T0KJR9_COLGC/11-253..DLYRD......HDD--------------------------------------D.VGFVQCIMSYIVRAVILLRW----
M2RHZ9_COCSN/9-246..NALK.......EKS--------------------------------------DRHGIAQMVSVFIARIGELIL.----
R0JX83_SETT2/4-242..ERYA.......ACE--------------------------------------VQRLEVSSALLCIAQLAQYIG.----
L8G0G7_PSED2/41-278..QRYHTR.....DV.--------------------------------------.THSAIDSALLVTTQLAHYIDR----
Q2HGW2_CHAGB/17-254..EQYHST.....EQ.--------------------------------------.KHSGIDAALLTISQIAHYLDH----
B8MF01_TALSN/8-245..AKLQSD.....SV.--------------------------------------.PHPALETALVCVLQFASFIKY----
N4VM62_COLOR/16-257..DRFRT......KED--------------------------------------S.FGLAHALFVGIVRAAKLLQF----
S3DAZ0_GLAL2/11-247..ERYHIS.....GI.--------------------------------------.KHSGIESALLCATQIAHYLDR----
E3SAD1_PYRTT/8-240...SWKDG.....GSG--------------------------------------KQCLALDMAMTTLWQLGRYIL.----
U7PK37_SPOS1/8-244..ERYHAQ.....DL.--------------------------------------.KHPAVDGALLCITQLVHYIDH----
B2B6C8_PODAN/41-279..QKYADG.....KL.--------------------------------------..NPAFQTALSCISQLGSFMQT----
V5G236_BYSSN/6-248...CRNDK.....KP.--------------------------------------.ENPILSPVMLVIVQLGQFIAW----
M2NM35_BAUCO/5-243..EAYYQK.....GS.--------------------------------------.KVPMLESTFVTIAQIGHYIGY----
B6QAB8_PENMQ/31-263..ARHEQ......FA.--------------------------------------.GSPALKFTLLCVTQIAQFIKY----
M2XHZ5_DOTSN/10-247..KKYVAG.....KL.--------------------------------------..NPAFQTALSCITQLGVFMRE----
R7YHB3_CONA1/8-244..WRYSES.....GV.--------------------------------------.RHPAIESALACIYQIASLLRY----

PF01735

PLB2_SCHPO/134-617DLWGRALSRKLVD.ATQGGPNITFSSIRNQTWFQNADYPYPIIISDSRL....EEEKAIPANTSIFEFTPYEFGTWDNGI
PLB5_SCHPO/125-607DLWGRALALKLVN.PLTGGANTTFSSVTNETWFQDGEFPFPIIIADNVI....EGETVIPLNDTVFEFTPIEFGTWDTGV
PLB1_YEAST/99-586DVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGRY....PGTTVINLNATLFEFNPFEMGSWDPTL
PA24A_CHICK/190-675DIFGMLIGETLIH....NRMDTTLSDMK..EKVSEAQCALPLFTCLHVK....PDVSELMF.ADWVEFSPYEIG..MAKY
PLB_NEUCR/121-606DYWGRALSYQLIG.ADMGGPAYTFSSIAQTDNFQKAETPFPILVADGRA....PGDTIISLNATNYEFNPFETGSWDPTV
PLB_KLULA/102-589DVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMPFPISVAVGRY....PGTQVVNLNATVFEFNPFEMGSWDYTL
PLB6_SCHPO/114-600DYWGRAIARHFVG.QLRGGPNLTYSSVQNASWFQTAEYPYPLIVTQGLTGGLPDGSNGTATNSSIYEISPYYLTSFDNNV
PA24A_DANRE/185-664DIFGMLIGETLIP....GRMNIKLSSLK..GKINEGQSPLPLFTCLHVK....PDVSELMF.ADWVEFSPYEIG..MAKY
PLB1_CANAL/88-565DIYGRLLSYPLLTNTEDEGDAYLWSDVTSASNFQSHQMPFPILISDGRA....PDTTIINLNSTVIELTPYEFGSWDPSL
PLB3_YEAST/105-592DIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMPFPISVADGRY....PGTKVINLNATVFEFNPFEMGSWDPSL
PLB1_SCHPO/114-593DYWGRVISRTLGD.TTYGFPNVSLSSITSQEWYRNANFPYPIITFATQN....YGEDISNVNTTFFEASPNVFGTFDHGI
PLB2_YEAST/101-588DLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVADGRY....PGTTVINLNATLFEFTPFEMGSWDPSL
B6HB59_PENCW/114-597DIWGRALSYQMFN.ASNGGLSYTWSSIADTPEFQDGDYPMPFVVADGRN....PGELVIGSNSTVYEFNPWEFGTFDPTI
G8ZY27_TORDC/97-584DIWGRALSYNFFPSLYSGDVAYTWSTLRDVEVFQNGEMPFPISVADGRY....PGTQIIDLNATVFEFNPFEMGSWDPTL
Q59W34_CANAL/88-564DVYGRALSHQLLTNFDNQRASFLWSDVTETTSFQNNEMPYPILAALGRE....PNTVLMNFNSTVFELTPYEVGSWDPSL

PF01734

Q9N5Z7_CAEEL/97-269.................................................----...........................
Q8F079_LEPIN/12-165.................................................----.....................LVTNFV
B8GC44_CHLAD/8-228.................................................----........................HHL
C1DSE3_AZOVD/14-206.................................................----.......................LLNA
A9BEP0_PETMO/3-174................................................T----E.................LYNSRYAQT
A9B328_HERA2/4-179.................................................----......................PGGSL
B2U808_RALPJ/9-214.................................................----...........................
Q3AAC7_CARHZ/6-206...............................................VG----I.F..............IISYNLLKLF
A6CHF0_9BACI/8-175.................................................----...........................
Q2GUC2_CHAGB/19-224.................................................----....................GRPVGGQ
Q9XAG3_STRCO/16-207.................................................----.........................TF
Q2JEY3_FRASC/11-221LPPR......................................PRMRMGS----P.RLL...........TASARHPRRSS
Q8R6F6_FUSNN/65-256N............................................LSLE----K.KE.............SLKKYSVHLS
Q9ZCV7_RICPR/15-214.................................................----H.................NIFPEGLTF
Q038G8_LACC3/6-159.................................................----...........................
D5T6X7_LEGP2/25-249FGTNP.....................................PGVSAIT----R.DGK...........PLEDFIRENII
Q4UJC7_RICFE/42-240.................................................----....................APKIFEH
Q54HM9_DICDI/140-357.................................................----...........................
Q2K9E1_RHIEC/30-248.................................................----......................LAFSQ
A4IAC8_LEIIN/190-378.................................................----...................GTPTADSR
Q21S96_RHOFT/26-231.................................................----...........................
A5GF97_GEOUR/15-187.................................................----...........................
Q1CW69_MYXXD/353-514.................................................----...........................
A6NV66_9FIRM/7-176.................................................----...........................
I6YB49_MYCTU/181-420RRRS......................................RHGLAGM----F.TL............RFDQFAHTLLS
A0YM74_LYNSP/12-230TEQI......................................YHLISYA----A.QTF...........IPTFREWMLDF
A0A0C9NUJ5_LEGPN/27-309LLPKSEKS..............................PQAGSSVDYSS----I.SHEQ.........KGSQLDTESSLA
Q2GS92_CHAGB/73-327AS...........................................VVSS----I.DF.............PLIYRRSTWP
Q1ZT25_PHOAS/33-203.................................................----..........................K
Q5CY77_CRYPI/46-241...............................................CK----T.P...............LKKNYARWA
PATA2_SOLTU/32-227.................................................----..........................H
A6G7S9_9DELT/458-735RNYHLWLLEAAVQRALDS...........AEDAALWGGVAKLFMGLLNP----V.SMFSDDV...TAVATTLLTAEANGL
A0A0E1WDL8_BURPE/13-264.................................................----..........................L
A4F8K0_SACEN/17-281.................................................----...................ARQVPKLW
Q2R2X0_ORYSJ/139-303.................................................----...........................
Q0A7T0_ALKEH/6-219G.............................................WRH----N.L..............TTGLHWMAAM
Q3Y1A6_ENTFC/138-323.................................................----M.................AAVEDLRER
M6BTQ1_LEPBO/13-188.................................................----........................GRK
YL620_MIMIV/38-270.................................................----........................YYA
Q0FZD9_9RHIZ/20-226.................................................----...........................
Q5A7P0_CANAL/211-417...............................................CD----T.S...............QIQGSFKKV
Q11UC9_CYTH3/381-624V............................................VNDL----F.FR.............FQKFTDGNHE
A6ASA3_VIBCY/5-186.................................................----...........................
Q1D826_MYXXD/142-382................................................F----I.S...............TESRYGLPA
A4HB10_LEIBR/40-220.................................................----..........................F
Q0RZB6_RHOJR/7-221................................................T----G.S...............LTRGGLRYL
A3QTZ2_9VIRU/28-255.................................................----G.................LFDEMPEKA
Q1D5W1_MYXXD/154-432.................................................----..................DQLDLGRLL
Q09D74_STIAD/17-214................................................N----E.R...............MTRQFKVKA
A4BNM2_9GAMM/38-218.................................................----...................HVAILRSL
Q4LA62_STAHJ/11-202.................................................----.......................DMSG
Q5ZPA4_9DELT/22-208.................................................----.........................PL
Q6A6E2_PROAC/25-319FTPRAWFSRLLEIGPEWMSLLNREAAKTKSQRPWLSLPFHRGPEQTKVP----DPAEPVAGRDDDRLTGQARTLEIATRD
NTE1_PICST/1239-1403.................................................----...........................
A4SJS7_AERS4/8-174.................................................----..........................R
Q1I961_PSEE4/42-302ADV........................................QDFIES----W.LG............GAGKFKLAFKA
A7RB12_PBCVA/19-192.................................................----...........................
Q0VPN6_ALCBS/36-193.................................................----...........................
A6G1N7_9DELT/36-362DAL........................................GAELPA----G.SM............ASVITSSLRDA
A6QA07_SULNB/41-281.................................................----...................VHLGLEDL
Q5WWS2_LEGPL/304-496.................................................----...........................
A0Z6H0_9GAMM/8-199.................................................----.....................GSQIFG
A6LMU7_THEM4/5-176.................................................----.....................IYTEKL
A7I0A5_CAMHC/6-211KPQNLKLE...............................NFGHFSKIPN----F.KKDF.........DFCAPQKFFYQL
Q2YJ28_BRUA2/13-187.................................................----.....................RMWQTR
A6G3Y0_9DELT/12-216.................................................----...........................
A1DP95_NEOFI/20-225.................................................----Q.................RSLHLRHGK
A5K2I7_PLAVS/1168-1482.................................................----.........................MY
TEG_BACME/7-180.................................................----...................GGPVFNQQ
Q2W5X1_MAGSA/6-225...............................................YK----V.F..............MKGSKVAEAY
A4U0C8_9PROT/5-257A.............................................AIQ----E.A..............WMDILRFAGD
A5N2W9_CLOK5/4-191..............................................QKF----M.N..............RNIDKETLIY
A4JJZ7_BURVG/8-242AFGYLTLLS.............................SAGAVLAPTRA----L.GRVL.........KAARVAAAMLDV
A6R0J1_AJECN/673-891................................................A----L.................LVRKSFAGR
Q6MR93_BDEBA/72-224.................................................----...........................
A5P920_9SPHN/106-312.................................................----...................EDEGEVVD
Q2C291_9GAMM/11-214FFNFNNE.................................MKNWADAQQ----A.IWQ..........GQPGFFKPKLWP
A7BB55_9ACTO/26-199.................................................----...........................
A5I1W5_CLOBH/6-200.................................................----....................AIKKFPL
A8GLS3_RICAH/7-147.................................................----...........................
A4T0K7_POLSQ/80-285...............................................TP----N.I...............SQMRADQIN
A6DDL8_9PROT/5-162.................................................----...........................
A4CKZ2_ROBBH/4-195...............................................SH----K.Y..............GVDSIGINHW
Q18D71_PEPD6/5-179.................................................----...........................
Q7CIX4_YERPE/86-275.................................................----...........................
M6C3B5_LEPBO/36-250FKGGR....................................VFPHEEMY----R.KTI...........RFGMDFQKIVK
Q12EZ0_POLSJ/6-228.................................................----..................QTDLQKAAM
Q1GX66_SPHAL/43-328DARP.......................................LSRMTK----F.WA............VPIAGWAMKRR
Q4RS54_TETNG/14-183.................................................----...........................
Q5C8M6_LEGPN/32-295RARGDRFRNILDV....................IYMMQMKKHLESVQQP----I.PPEQQ......MNYGILKQKIALYE
Q6JBI3_DICVI/201-395.................................................----.......................SQNR
Q0FKF7_PELBH/6-360LGAGTALAGLIAAAV.................LCDLGWLFFGALFGLVL----T.VGLIAL.....DLRRLVVRDLPANR
Q8Z7F2_SALTI/8-168.................................................----...........................
Q6ASS6_ORYSJ/60-258.................................................----.........................RD
A6QX75_AJECN/242-440HFK........................................GWNILS----L.LA............RDNGYGRLPSL
Q74A07_GEOSL/58-306.................................................----..........................L
Q54XY1_DICDI/13-231.................................................----...........................
Q55G69_DICDI/65-250.................................................----...........................
Q5Z158_NOCFA/22-193.................................................----...........................
Q54QX6_DICDI/893-1088.................................................----...........................
A0A0D5GHL8_BURML/413-612SQWREA...................................WLSSYVLS----F.GVP...........NFLKPQWSQLG
A2QZY6_ASPNC/473-679.................................................----H.................PPLRTTWNK
A4XTW9_PSEMY/15-385PRALLAHYWRAAGVGALLGG.......GPLWPVALHGGNPLLWLWLLGC----A.GIGALTAI.GWRMLRQISREMPANG
Q0E508_SFAVA/27-224K............................................LKLS----I.T..............PMVRSNRVTI
A6GI17_9DELT/71-215.................................................----...........................
A7IE20_XANP2/6-198.................................................----..........................P
Q1DCU7_MYXXD/197-406.................................................----...................SDLYCVNN
Q6MAN6_PARUW/474-738LDIEKLKKVLLDA....................KEEVGLIQKKGVSNSK----F.KIAFNL.....IFNWVDWWGIPCDQ
Q4Z1R8_PLABA/352-558.................................................----.....................NIISGI
A4RTL4_OSTLU/164-398RRMTVI...................................KEAHIDLV----R.PFV...........RFGRRSRNALA
A0JUC4_ARTS2/74-249.................................................----...........................

PF00698

FAS_HUMAN/493-810-------------------------------------------HLPPGA------MAAVGL....SWEECKQR.CPPGVV
STCK_EMENI/1547-1902-------------------------------------------T.LPRN------ANGRTD..................Y
FAS_CHICK/492-809-------------------------------------------KLPPGG------MAAVGL....TWEECKQR.CPPNVV
FAS1_YEAST/1663-2037-------------------------------------------A.VPRD------ELGRSN..................Y
A4F7N8_SACEN/109-425-------------------------------------------V.GNGD------MAAVALS..ADEIEPRIARWDDDVV
A4F7P0_SACEN/560-880-------------------------------------------S.GEGG------MAAVALG..EAAVRERLRPWQDRLS
I6Y231_MYCTU/534-851-------------------------------------------A.GAGA------MGSVELPAKQVNSELMAR.GIDDVV
PPSA_MYCTU/632-950-------------------------------------------S.GQGG------MALLEL...DAPTTEALIADFPQVT

PF16073

E9F646_METRA/19-261-------------------------------------------...F.G......DGQEAY..PTG.........PTTHV
E9F8F0_METRA/9-244-------------------------------------------...A.E......QDPTVL.ASKG.........NRNCI
B8MGX9_TALSN/8-250-------------------------------------------...YEE......HPERRY..PES.........DSTLI
B6HLN4_PENCW/17-255-------------------------------------------............A.....KQEPSLLG..PNAR.SEWL
E9D6Y9_COCPS/8-245-------------------------------------------...Y.E......EPGRPY..PSP.........GRKYV
K1X7W5_MARBU/800-1037-------------------------------------------...T.E......KVPEDITNPT...........ETVL
L8G6V9_PSED2/30-264-------------------------------------------...F.G......EGSRLY..PSA.........TDSYC
B6QFH1_PENMQ/10-246-------------------------------------------...Y.G......DGGQVY..PVG.........SQSHV
B6QER4_PENMQ/12-248-------------------------------------------.................ILEKDPELRE.VWAAQKTLI
A7F3E3_SCLS1/4-241-------------------------------------------...Y.E......KEHGDSTSPS...........ETCL
N1RV88_FUSC4/8-242-------------------------------------------............LARSDKQHPSA.........SPSFL
S3EB79_GLAL2/16-254-------------------------------------------............V.....KREPHLID..PTSH.TEWL
G4UHA1_NEUT9/13-252-------------------------------------------...I.E......SNHDDLARPE...........NTCL
B6HKK0_PENCW/8-244-------------------------------------------...Y.G......DLGHAY..PSG.........DESCI
E9F7M7_METRA/10-244-------------------------------------------............HSERKLSFPTP.........QDSVL
WA_EMENI/8-244-------------------------------------------...Y.G......DLGHTF..PSH.........SQSQL
V5GBX6_BYSSN/4-246-------------------------------------------...L.T......ENVRDF..PDR..........ERII
G2QWR8_THITE/16-254-------------------------------------------...V.E......KHSEDIPHPE...........HTVA
M3CY75_SPHMS/5-242-------------------------------------------...F.S......EHPDEL..PAT.........SNTRV
M2RQ22_COCSN/4-241-------------------------------------------...F.A......ENPTEL..PNP.........SNTRV
B8LZ55_TALSN/27-260-------------------------------------------...Y.G......KGPKVY..PSP.........TSTYL
S3D9A7_GLAL2/4-237-------------------------------------------...L.ERRQVKKEHQPEF.................RV
G7XN60_ASPKW/8-244-------------------------------------------...Y.G......DLGHDY..PTP.........SNSHL
M2T1K1_COCSN/8-240-------------------------------------------............QAEACYIAPKC...........SVV
E9DR08_METAQ/20-259-------------------------------------------...Y.G......SNSKSY..PSS.........TGTCI
S3CWG8_GLAL2/8-245-------------------------------------------...F.G......EIGRSY..PQP.........HDTYI
F2PW05_TRIEC/6-242-------------------------------------------...VYD......DGGKYPSIPAA...........GQV
H1VJ39_COLHI/10-255-------------------------------------------...H.S......SGCQVY..PTP.........ENSLL
U1GE50_ENDPU/4-243-------------------------------------------...F.E......EQPRTY.IPSSF......SRPDAKI
A1C888_ASPCL/9-246-------------------------------------------...H.G......DRGHPY..PSA.........EDSLL
R0KB98_SETT2/8-242-------------------------------------------............QEESDY..PSS.........DNSRF
E4V2N2_ARTGP/10-256-------------------------------------------..............HYQ.AEDVEWD....LIPERTLL
L8G4G9_PSED2/24-270-------------------------------------------..............YVE.SRSGDLF.....DFSTTSL
M2ZZX0_PSEFD/5-242-------------------------------------------...F.S......EHPSEL..PAA.........SNTRV
Q2GV63_CHAGB/785-1022-------------------------------------------............A.....DADPTILG..SPTN.PVDI
B8N7H8_ASPFN/9-246-------------------------------------------............I.....DREPQLLDP.NRPR.PEVI
Q2UA48_ASPOR/8-244-------------------------------------------...Y.G......DLGNVY..PSA.........SDCHI
N4VBL7_COLOR/10-255-------------------------------------------...H.S......SGNHVY..PVQ.........DSSCL
B2B495_PODAN/8-245-------------------------------------------...A.E......KNFEDVTRHD...........STHL
A0A0C4E4Q7_MAGP6/8-245-------------------------------------------...A.E......KHYEDVTQHE...........NTHL
R7YU14_CONA1/7-242-------------------------------------------...F.G......EGSRIY..PAP.........VDSIA
R0KD65_SETT2/13-258-------------------------------------------............VLTHLINAYPRLLT..ANSL.PTYL
V5G4B2_BYSSN/8-244-------------------------------------------...Y.G......DGGHTY..PSA.........SESHI
H1VY29_COLHI/8-245-------------------------------------------...A.E......KEPQDAAPHD...........HTFF
L8GBJ0_PSED2/42-283-------------------------------------------...F.T......EGSKPY..PPP.........PGTYV
B6QC69_PENMQ/7-243-------------------------------------------............V.....ENDPSLLGS.SSKV...TA
G3JFQ9_CORMM/16-246-------------------------------------------...F.A......TG.RPF..PSP.........ENSYL
F9XMW3_ZYMTI/5-242-------------------------------------------...F.S......ENPSEL..PAV.........SDTRV
G9MXY7_HYPVG/19-259-------------------------------------------...F.G......DGQQAY..PTG.........PNNYV
G0RW83_HYPJQ/19-262-------------------------------------------...F.G......NGQETY..PTG.........PDTHV
C5G0R3_ARTOC/8-243-------------------------------------------...H.E......GIGQTYFSP...........LETCV
K1WM58_MARBU/4-242-------------------------------------------...Y.E......QYPLEY..PRS.........ASSQI
G9NQM0_HYPAI/19-259-------------------------------------------...F.G......DCDEIY..PSN.........LNNYV
A2QH36_ASPNC/29-262-------------------------------------------...Y.G......QAGRTY..PAP.........ESTFL
STCA_EMENI/11-251-------------------------------------------...F.D......DPRVLY..PHA.........NDSYV
Q8EYQ4_LEPIN/19-271-------------------------------------------...................FTNKGFPVSELISNSIGA
C7ZNQ1_NECH7/8-238-------------------------------------------............QAGISSYDAQS...........SRV
M2N8F6_BAUCO/8-232-------------------------------------------VLFY.D......EPGRLY..PTQ.........GSTYL
G7Y059_ASPKW/7-243-------------------------------------------.................HLEENPTLL..WGETSKLHI
E4V6P4_ARTGP/8-243-------------------------------------------...Y.E......GIGQAYLTP...........QETCV
U1GYJ0_ENDPU/26-259-------------------------------------------...F.G......EGSRPY..PSD.........ANTYL
H6BVA1_EXODN/5-241-------------------------------------------...F.E......ERRPSYIQPNS..........DARL
E3R122_COLGM/12-243-------------------------------------------.......................RNDLGSYNDGECRV
G2WRK7_VERDV/8-245-------------------------------------------...A.E......KEPQDVVAHE...........DTYI
G0SDA9_CHATD/19-258-------------------------------------------...V.E......RNFEDVPKPDG..........QSLL
B6QHV7_PENMQ/4-241-------------------------------------------...A.E......ENPQYYIK............KGSHI
Q2UG06_ASPOR/8-245-------------------------------------------...Y.E......ESGNMY..PQP.........SDSYV
C5FQT2_ARTOC/8-245-------------------------------------------...Y.G......DGSRPY..PTG.........QSHTL
E9D5J9_COCPS/7-242-------------------------------------------.................RLEKDDRVRA.LWSKQKLLI
N1PC72_DOTSN/5-242-------------------------------------------...F.S......EHQSEL..PPA.........TNTRV
E3R0Q2_COLGM/12-250-------------------------------------------............A.....RRDASILS..NNGN.TEWL
R8BTJ4_TOGMI/8-245-------------------------------------------...A.E......RHYEDVTKHD...........HTFL
G4MU27_MAGO7/14-251-------------------------------------------...A.E......KNHEDVTQHD...........KTYL
R7YTG2_CONA1/4-241-------------------------------------------...F.E......EHPFEL..PNP.........SNTRI
U7PRD0_SPOS1/5-267-------------------------------------------.......................DLENNPSRLADTVI
E5A495_LEPMJ/4-241-------------------------------------------...Y.G......ENPTEL..PSP.........ANTRV
B8NVD5_ASPFN/5-241-------------------------------------------............LQTTDLCHPPT.........G.SIL
B8MV60_TALSN/15-255-------------------------------------------............S.....ETDPSILTLSDSAAQPTYV
E9FC93_METRA/16-256-------------------------------------------...YGG......NAATEY..PSA.........ADACI
G9NBV5_HYPVG/10-247-------------------------------------------............A.....ERDPTILG..TSER.PVEI
R1G9D8_BOTPV/4-241-------------------------------------------...F.S......ENPTEL..PSQ.........ANTRA
S3CAW2_OPHP1/8-244-------------------------------------------...A.E......RNWEDITKHD...........HTFL
B2B664_PODAN/7-242-------------------------------------------...................YLENNPGLLDASKDRLAI
M1WG96_CLAP2/23-272-------------------------------------------..............YHEILTYDKE......ECVHIAL
E9F5C9_METRA/8-246-------------------------------------------.................LLETDTHLRQ.AWVSQKLIL
A0A098D9G9_GIBZA/4-241-------------------------------------------...Y.D......GQGRTF..PSE..........NSRI
G2YLD0_BOTF4/4-242-------------------------------------------...F.E......ENPLAY..LEP.........SNTEV
B2W1Q0_PYRTR/9-246-------------------------------------------............V.....NREPHILDS.SRPR.PEII
C7Z6X3_NECH7/7-240-------------------------------------------...Y.G......RNGRQY..PSP.........DEAYC
E3QS53_COLGM/10-256-------------------------------------------...H.S......SGCQIY..PTP.........EQSCL
G9NGU8_HYPAI/9-247-------------------------------------------............A.....ENDPSFFKA.SRNS.PSYS
B8MYS6_ASPFN/10-247-------------------------------------------...Y.T......SPGHKY..PST.........QQTCL
G2RCG6_THITE/8-247-------------------------------------------...H.T......APGRTY..PAP.........QDTWL
S0DTP6_GIBF5/8-239-------------------------------------------............QAGISSYDAQN...........SRV
G2QMK9_THIHA/8-254-------------------------------------------...F.N......DTGKKY..PKS.........PSSCL
F0XGQ5_GROCL/8-244-------------------------------------------...G.E......KHYEDIIRHD...........QTFL
T0KJR9_COLGC/11-253-------------------------------------------............V.....DDSPDALK..TNPR.PEGL
M2RHZ9_COCSN/9-246-------------------------------------------....................HAENDPALLDSSTPLLS
R0JX83_SETT2/4-242-------------------------------------------....................HNERNDQLRLDANSDLL
L8G0G7_PSED2/41-278-------------------------------------------...A.E......KVPEDATSPQ...........ETWA
Q2HGW2_CHAGB/17-254-------------------------------------------...A.E......KNCGDITRPH...........KTFL
B8MF01_TALSN/8-245-------------------------------------------...I.S......QAGQLY..PTN.........ANERL
N4VM62_COLOR/16-257-------------------------------------------............A.....QVYPAILNG.SDDA.PVYL
S3DAZ0_GLAL2/11-247-------------------------------------------...A.E......KVPEDSASPN...........NTTL
E3SAD1_PYRTT/8-240-------------------------------------------............QGESNYKTPGS...........SVF
U7PK37_SPOS1/8-244-------------------------------------------...A.E......KHWEDVTQHE...........HTYL
B2B6C8_PODAN/41-279-------------------------------------------...YEE......DSTKPY..PRA.........NDSYV
V5G236_BYSSN/6-248-------------------------------------------...YEK......RAGEKY..PDT.........SSTII
M2NM35_BAUCO/5-243-------------------------------------------...F.N......VNRKEL..PAT.........NNIRV
B6QAB8_PENMQ/31-263-------------------------------------------...Y........GGRGTY..PPL.........TSTYL
M2XHZ5_DOTSN/10-247-------------------------------------------...F.H......DFTKPY..PRH.........DSSYV
R7YHB3_CONA1/8-244-------------------------------------------...L.G......DGSEEY..PSA.........ENTRL

PF01735

PLB2_SCHPO/134-617KAFLPMEYVGTHLKNGVPP.DHK---------CIRNYDNAG-----------------------FVMGTSATLFNTFLLE
PLB5_SCHPO/125-607ESFIPMEYTGTHLINGIPL.NES---------CVRNFDNAG-----------------------FLMGTSSNVFSGILPA
PLB1_YEAST/99-586NAFTDVKYLGTNVTNGKPVNKGQ---------CIAGFDNTG-----------------------FITATSSTLFNQFLLR
PA24A_CHICK/190-675GTFMSPDLFGSKFFMGTVVKKYS---------ENPLHFLMG-----------------------VWGSAFSILFNRVLGV
PLB_NEUCR/121-606YGFAPTKYLGANFSNGVIPSGGK---------CVEGLDQAG-----------------------FVMGTSSTLFNQFLLA
PLB_KLULA/102-589HTFTDVRYAGTNVTNGTPNVTGK---------CVAGFDNTG-----------------------FVMGTSSSLFNQFLLQ
PLB6_SCHPO/114-600RSYTPTQYLGTNYSNGTAV.DGK---------CVTQFDNVG-----------------------FLVGTSSTRYNEALID
PA24A_DANRE/185-664GTFMSPGLFGSKFFMGSVVKQYE---------ENPLHFLMG-----------------------VWGSAFSILFNRVLGV
PLB1_CANAL/88-565NEFVDTRYLGTKLDNGRPT..GK---------CYNGFDNAG-----------------------FFMGTSSALFNEAVLS
PLB3_YEAST/105-592NSFANVKYLGTNVSNGVPLERGK---------CTAGFDNAG-----------------------FIMGTSSTLFNQFLLR
PLB1_SCHPO/114-593NSFIPTEYLGTTLNNGASS.NGS---------CVINYDNFG-----------------------FMMGASSTYFNKIMRN
PLB2_YEAST/101-588NAFTDVKYLGTNVTNGKPVNKDQ---------CVSGYDNAG-----------------------FVIATSASLFNEFSLE
B6HB59_PENCW/114-597FGFVPLEYLGSKFEGGSLPSNES---------CIRGFDSAG-----------------------FVIGTSSSLFNQFLLQ
G8ZY27_TORDC/97-584NAFTDVKYLGTKVSNGEPVNKGQ---------CVAGYDNTG-----------------------FIMGTSSSLFNQFLLQ
Q59W34_CANAL/88-564RSFVDTKYIGTRLDDGAPV.SKR---------CVNGFDNAG-----------------------FFMGTSSSLFNIVLQQ

PF01734

Q9N5Z7_CAEEL/97-269.......KTLGAMSPGFVISDRL---------R......KV.......................VEKFLPDDVAKANDLL
Q8F079_LEPIN/12-165KPIRKGLKNYSGILSGKNVKELL---------K......PH.......................LGHKKIEELSIPMGIS
B8GC44_CHLAD/8-228YQLNLADLVRRGLQLPGAVVQAL---------R......RW.......................LREGQEASLLDLLETL
C1DSE3_AZOVD/14-206GANIRSGHPATGLKLMLYWAQML---------S.....PRQ.......................LNPLNVNPLRDILASL
A9BEP0_PETMO/3-174TALIRLGRGKMSLYNPDNLKKFL---------E......GY.......................FGNQTLSSLRKNVSFE
A9B328_HERA2/4-179RSAWRVVRGRGSLHHNHGLRRFI---------L......SL.......................LPPNIRRFSDLAIPFF
B2U808_RALPJ/9-214..WGNLLRGERVFPHYGMYRTAL---------L......TV.......................FSEGRFGRLAQAPEIR
Q3AAC7_CARHZ/6-206GYQNNKLKLPLGIFRPIGLQRKI---------V......RE.......................LGTLNINQLKEQVAVI
A6CHF0_9BACI/8-175.....NYIRNRELFGMDFVFDEI---------P......NK.......................IVPYDYEAFHNNQSEF
Q2GUC2_CHAGB/19-224VGRVLRGMTSSPFYDIADLQQSI---------R......SV.......................LRARGIESDEPFIERE
Q9XAG3_STRCO/16-207GMTVRYLWAALGSRDPETVVRRL---------G......RL.......................ALSVRDVPQSAVFAAI
Q2JEY3_FRASC/11-221PMVTLAAMLPQGRGKISAVGDLV---------T......AA.......................MDRKGLDPTEWPTRPA
Q8R6F6_FUSNN/65-256FDNELNFSFPKGLRGTGEAYLLL---------K......GL.......................LGKYEHMDNFDNFPIP
Q9ZCV7_RICPR/15-214RKLWSCNGLFSYKFSPDPLVKLL---------K......KY.......................CKDYTLKDLIGEVIVT
Q038G8_LACC3/6-159.........NGPIFLRRHFVPVL---------D......RM.......................LQAPKLDSRAVLAVTT
D5T6X7_LEGP2/25-249SSVKTNIASIEKIETIAASDQTL---------Q......DL.......................LAKLKTKFPVITFGDL
Q4UJC7_RICFE/42-240HWYDGIKQIFTHKHSQGPLKEIL---------E......QH.......................LAGLRLDDTTSRLIIP
Q54HM9_DICDI/140-357KGTVKNFLVGATLANSDKKEQEL---------I......KV.......................FGNNTMGNFAQNKKLF
Q2K9E1_RHIEC/30-248IFADGPSFLKGAFNPFSSAAEEV---------A......KL.......................YERHLFDGRSPSLSDL
A4IAC8_LEIIN/190-378WKRFHRLLHTGEVCDPVALADFL---------Q......RS.......................IGDVTFAEAFARTGRV
Q21S96_RHOFT/26-231..LRNLLREQPIFPHGDIYRDAI---------L......GS.......................IDEQALSRLHQGPKIS
A5GF97_GEOUR/15-187...IKSVFTGKGIYEGKALESWV---------D......EK.......................LKGQKFSDDFRIPPHV
Q1CW69_MYXXD/353-514....LTLAATAAIVTTYSLERFV---------E......QD.......................LGRLCLEELAIRFLPV
A6NV66_9FIRM/7-176..NLLRPGNHRCYFGLQFTYDTI---------P......NE.......................LIPFDYETFAAFPGEV
I6YB49_MYCTU/181-420RADGERMRMSDLAIPFDVVVAGV---------R......RQ.......................PYAALPSRFRHRERST
A0YM74_LYNSP/12-230LVESGILKDRTAIYDPTPIESLV---------R......ET.......................INPVELRRGIELWVTV
A0A0C9NUJ5_LEGPN/27-309EAKLVTKPSKLTFAIASKGAKLV---------EAMEHVMRMAIFTHFPESLDNELKNVHEKLNAIEDKGSAEYINLAKRQ
Q2GS92_CHAGB/73-327TKRTSSFFDTFAKFTVTATGRTL---------P......GA.......................LASPTVSRASSQASAA
Q1ZT25_PHOAS/33-203YLSKQQPMNLDWALQVVSPSGEL---------A...............................LDFHTAKRTLKHRQAF
Q5CY77_CRYPI/46-241VSFLKGWISSRNPFRYLCDNSPA---------R......KL.......................LRELFLHRKHKQRLFF
PATA2_SOLTU/32-227IFNSSTGQFFGPKYDGKYLMQVL---------Q......EK.......................LGETRVHQALTEVAIS
A6G7S9_9DELT/458-735DDHLRRVLNLATMTHGMHCMEPL---------R......RL.......................ITEHTRPALIRAAGTV
A0A0E1WDL8_BURPE/13-264LRPPLGKNPGSLLKGDEYFLPGI---------R......NA.......................LQHMARNRDAARTDLP
A4F8K0_SACEN/17-281DARPPSLLEGDGYFRTELARTIS---------E......GV.......................AEGDGARDVSRRADLL
Q2R2X0_ORYSJ/139-303...........AFRLGAVLKDVL---------D......RF.......................LPDDVHIRCNGRIRVA
Q0A7T0_ALKEH/6-219ALGGLGGHNPRSLLDNEPLAELL---------R......RN.......................LPLDGIRMAIHRGALR
Q3Y1A6_ENTFC/138-323FYRERRQMTKTALIEGGVSSAPL---------E......KM.......................VKDNLDLSLLKHNPKI
M6BTQ1_LEPBO/13-188LISPFHPFQGKTFLDQEYLVDDL---------F......GH.......................KYPLPAENFEKFGLPE
YL620_MIMIV/38-270PFTLYRFLTKGHLYDDTNRQTLV---------K......K........................ILNINIETIRSHLDLP
Q0FZD9_9RHIZ/20-226.TTLNEIQEDGLTPHQRIYREVV---------T......EV.......................LDDDAIQAVIDGPQFQ
Q5A7P0_CANAL/211-417LYYLGHWIQYGTIFDIEGLQDTM---------I......GF.......................LGDLTFREAYNRTGKI
Q11UC9_CYTH3/381-624YYKDRGYAFEQKLHENTNYVLYK---------R...............................ISDYKKPEEEAQIPML
A6ASA3_VIBCY/5-186...WYHNYLYSSRYTNDGLKEAI---------N......AIF....................GDFAQKTMQDLKAHSGID
Q1D826_MYXXD/142-382ALRLFLRAGLGRFFSAGPENSGM---------R...............................LKDLPVPTLIAVGGIR
A4HB10_LEIBR/40-220HWFRLGKYLMAAIDDFGASLRAI---------DTDPRMRQV.......................LASGSLEIGVTVLPKL
Q0RZB6_RHOJR/7-221GQLAGLPMRLPSLFDTTRMRETI---------G......AL.......................VSFEKVQENIDRGLVE
A3QTZ2_9VIRU/28-255STYMWITSILKTFNLISKTQTLL---------D......LW.......................LDSDSPGLSTEDTLLR
Q1D5W1_MYXXD/154-432PEERNEPPQGTHLFSEPHMQDTL---------Q......LI.......................LKKAQTTRFKEDCTFA
Q09D74_STIAD/17-214INILRLISGLVPMYDGKAIREIL---------E......ET.......................FGEAKLCELEKMVVIE
A4BNM2_9GAMM/38-218LLRPFGRFLPDGLIQGRRLALLI---------D......AG.......................LKVKDFQSCTIPFRCI
Q4LA62_STAHJ/11-202IFERYAQIQEHSKSPKEWIENYS---------V......YA.......................LEDHKFNESVHITRLE
Q5ZPA4_9DELT/22-208SNQLGALVGQSALMPSENMARAL---------T......HI.......................LGDKTLRDLKRKVVIP
Q6A6E2_PROAC/25-319DPITGGSWTPGVILQLLSALSRL---------SRDGGDIST.......................IVRGAETSASTYRAGP
NTE1_PICST/1239-1403.SVFDLTYPVTSYITGYEFNRGI---------W......KI.......................FGFTEIEDFWIRYFCN
A4SJS7_AERS4/8-174FVRGGHWLDLDWLWEITIRECRL---------D...............................LARFAVNQVPLTVVTT
Q1I961_PSEE4/42-302AQVIDNLQNDLGLNPGTAFSVWL---------E......QL.......................MAREGVHDFASLAKRM
A7RB12_PBCVA/19-192.....NFVNTFGLDTGVHLSRWI---------D......IV.......................LGNKSYTFQSILEETG
Q0VPN6_ALCBS/36-193........PGLGLLSGQSFRTML---------A......AL.......................LPIQRMEHTLAPLAVS
A6G1N7_9DELT/36-362LFEAIREGGEQNIWNRAVAKIYL---------EPFGLVDPQKVLAPCLDAATRDAIRARPGNAGVPGLEPDNFIFPRPGR
A6QA07_SULNB/41-281IIEGADPDNHSTLFTRKPLVKKA---------Q......KI.......................MQHMKKPVFREGCEIP
Q5WWS2_LEGPL/304-496.......IDRNGLSDTHSLKTAL---------D......YA.......................IANKVRQIVNKYKIPY
A0Z6H0_9GAMM/8-199KNLWRQFRSALGIFDESYSASPL---------E......AA.......................LADYFDNNVLGDCRCP
A6LMU7_THEM4/5-176EKSNLWSIFQRALVPIDEYYKFF---------K......YL.......................FERKKFSDLKYKIGIV
A7I0A5_CAMHC/6-211ANAALPNFINEGFFKRENLANFL---------R......TN.......................ISTSKILNGIPLFIAL
Q2YJ28_BRUA2/13-187PAHWAELFKGGLRVSQFNIEKVL---------D......VF.......................LPDSFPSNVEDLKIPM
A6G3Y0_9DELT/12-216..RRVFSRRDRAFPHDGIYRGTI---------A......AI.......................LERGGFERVRESVPVH
A1DP95_NEOFI/20-225SEPQRSLHLGHAKFDPQRCASEL---------R......SI.......................LVQSGYEENALFGESE
A5K2I7_PLAVS/1168-1482AVRNTRYLFKHSYYDANILSNIL---------NSFFKNMKMFHYNADFFTPYVFTVSTQMNVTPLQPVILKNYTANLGKI
TEG_BACME/7-180VPYSGLIKAIRTFFPRDLRLRDL---------K......KR.......................IVVPAFHLFAPELNRW
Q2W5X1_MAGSA/6-225RWLISKLPGYNRIMNQFSMTKRQ---------KFWSDLIQM.......................FWALTTPSTVNVFSKG
A4U0C8_9PROT/5-257PSQWTQANFNSLILNQVLAVNPL---------S......RF.......................VTSLMYKSKTRGLSRI
A5N2W9_CLOK5/4-191ILSAMKNIIENRGIDTKKMREIL---------N......NI.......................IDEDKLRKSKIDFGMV
A4JJZ7_BURVG/8-242TLPKSLDMLANGLASDKPLKALM---------D......EY.......................LDPAALNAGLPLYVSL
A6R0J1_AJECN/673-891LYGWLTWWLYDGLYDSAVLESLL---------K......EI.......................FGEFRRTFHAAGPDGS
Q6MR93_BDEBA/72-224.....LLGGVNKNNEVTVLKDFV---------G......VA.......................FNRTKVEDFKIPFACP
A5P920_9SPHN/106-312NKGMFQMLLRGAQAGTAPLRKRI---------R......HA.......................IYENGSAEFLDAIRNS
Q2C291_9GAMM/11-214SEFETYKTSELSYYDTSPLKETL---------N......EL.......................IDFDYLNQKEVRLSLC
A7BB55_9ACTO/26-199....KHFRKGHGYFNAEYIYERI---------CY....PDG.......................ILPFNMDAFLANPART
A5I1W5_CLOBH/6-200AKKSLGLILEKGIFSTVYIEKYL---------E......EM.......................FKNKGKTKFKHISLNG
A8GLS3_RICAH/7-147.DQVYNLVFYGWLNSEKYLEEFL---------G......QL.......................LKDNGFDPDITFKQLH
A4T0K7_POLSQ/80-285MSATDGSIETRKIIGAAALAADN---------K...............................LNSNHIEKLAGLLTGD
A6DDL8_9PROT/5-162........LKTGLFKIDLNSTIL---------D......KF.......................FLYDDLSKSDIPLFIC
A4CKZ2_ROBBH/4-195NVLRNFMRGSKTFGESHNLLKLI---------R......KT.......................ITKEEFQTLKTGPKDL
Q18D71_PEPD6/5-179.......IVNNTVDNSPAIDNLR---------E...............................LDDSNIEEMNFYVNYV
Q7CIX4_YERPE/86-275NNLLFRLFFRESLADTSPLSQLI---------D......GH.......................ITPQLLSEIAKAHKGG
M6C3B5_LEPBO/36-250SEIKVFIHTLKAIPKEDSLRNKF---------R...............................LARLIAETAKAFLEDE
Q12EZ0_POLSJ/6-228LAMLRPANWRFALSRANVLASAI---------GSTWGVDAL.......................LDELPASPVWSINATT
Q1GX66_SPHAL/43-328GNSIDRTVGEAAQDEVRAKLSRF---------VRARWFEPP.......................FGGETFSHLLFDAFAA
Q4RS54_TETNG/14-183..........GPMHPSFNLVKIV---------R......HM.......................MGRTLPDGCHHQASGR
Q5C8M6_LEGPN/32-295DKLSRAGIVINNVDDIINLTKSV---------KDLEKLDKA.......................LNSIPTELKGAKGEQL
Q6JBI3_DICVI/201-395LSGVSGVVLNHSYYDTKKWVKML---------K......ET.......................IGEELTLIDTSKESVP
Q0FKF7_PELBH/6-360FGLLPGTTQPGG..EGPGLTDWL---------ADKIDIVAGNLGADGKPGPPLTVGALDERNIELAAMTTDLTSKRPFQL
Q8Z7F2_SALTI/8-168....DVSWGRGGLLRGKRVFNHY---------R......DI.......................MPVTDFDHCSRRFGAV
Q6ASS6_ORYSJ/60-258WAGRRGRWARLFRGGARGAERSF---------R......RV.......................FGDATLKDTVAPLLVP
A6QX75_AJECN/242-440IRRTEEYIRESYFPDLKLLEEYV---------K......ST.......................VGEMTFEEAFAKTKRC
Q74A07_GEOSL/58-306VRRLFNPYNWWRLASPDFSRIDM---------AEEYYNDTV.......................FGGKTFADLVAAPGKR
Q54XY1_DICDI/13-231WDEVKGVFTRGEMFNSDELINIA---------NSWFPSSPD.......................GADTQITELNEKKFFV
Q55G69_DICDI/65-250MGIMYNVYEESTLCSTKELISTL---------E......TN.......................FQGKIMSDRKGFVVTV
Q5Z158_NOCFA/22-193.....RLLRGGAAFDVRYLVHRV---------Y......DG.......................VEPMDFDAILNHATTF
Q54QX6_DICDI/893-1088.FNFITYPLIKPKYRRDKLRESF---------K......TI......................FPSDEKLKNSFSKIRVA
A0A0D5GHL8_BURML/413-612FDADRLRAKWTSFFDATAIEQLI---------A......RY.......................VDFDSLGMSPTRLLIG
A2QZY6_ASPNC/473-679LIRTILCWWKDGWYDAGLWDGLL---------Q......KE.......................FGVDQGMFDVQPVSGT
A4XTW9_PSEMY/15-385FALCSGMPGPDDQAPDEVLTPWL---------T......EYLDRLCGQRQACASNADSIERERPLTFGELRRHGIDLQMM
Q0E508_SFAVA/27-224GASVMTLFNMLALFGVAKFIEEF---------E......DF.......................IFDLGHDRKITFEELH
A6GI17_9DELT/71-215.PALHHLRDASRYLSSGSLLESL---------R......LP.......................M...............
A7IE20_XANP2/6-198WSIAGTVLGNNAAMTTGRIKTFC---------D......EV.......................FGAGAILADVKRPVLV
Q1DCU7_MYXXD/197-406TWIWKIASNLRGLVQFDGIYGKL---------R......AA.......................VVPEQLTNGTELVAVS
Q6MAN6_PARUW/474-738KKILKERYASGGLCKGEYLRELI---------E......KK.......................LTEKVEKHQGTKINHL
Q4Z1R8_PLABA/352-558FFEGYDINNVKELFMEHIGNKFL---------ASCKNLYCF.......................VTATDVKHNPYKLFLL
A4RTL4_OSTLU/164-398ARNGASTIETATMADVGTLAETL---------SDDDGDSKF.......................AVDPAMNVNYLLETVM
A0JUC4_ARTS2/74-249.PLGDYVKGPWSLPAIGDAGGLL---------G......KV.......................FPALGINEGEIRRRAA

PF00698

FAS_HUMAN/493-810PACHNSKDTVTISGPQAPVFEFVEQLRKEGVFAKEVRTGGM-----------------------AFHSYFMEAIAPPLLQ
STCK_EMENI/1547-1902GMVAADPSRIRSDFTEDRLIELVRLVSQAT..GVLLEVVNY-----------------------NVHSRQYVCAGHVRSL
FAS_CHICK/492-809PACHNSEDTVTVSGPLDSVSEFVTKLKKDGVFAKEVRRAGV-----------------------AFHSYYMASIAPALLS
FAS1_YEAST/1663-2037GMIAINPGRVAASFSQEALQYVVERVGKRT..GWLVEIVNY-----------------------NVENQQYVAAGDLRAL
A4F7N8_SACEN/109-425LAGVNGPRSVLLTGSPEPVARRVQELSAEG.VRAQVINVSM-----------------------AAHSAQVDDIAEGMRS
A4F7P0_SACEN/560-880VAAVNGPRSVVVSGEPGALRAFSEDCAAEG.IRVRDIDVDY-----------------------ASHSPQIERVREELLE
I6Y231_MYCTU/534-851VSVVASPQSTVIGGTSDTVRDLIARWEQRD.VMAREVAVDV-----------------------ASHSPQVDPILDDLAA
PPSA_MYCTU/632-950LGIYNSPRQTVIAGPTEQIDELIARVRAQN.RFASRVNIEV-----------------------APHNPAMDALQPAMRS

PF16073

E9F646_METRA/19-261SGLCIGALAAAAVSSSKSLAELV---------QAGIDAVRV-----------------------SLKVGLLVARTAALFS
E9F8F0_METRA/9-244LGFCTGEVAAAVAAVAQDTNELV---------ELGVEVTHI-----------------------IFRMARELNRRSLMVD
B8MGX9_TALSN/8-250AGICVGQISATAISLAKSLTELL---------PLAVDAVRI-----------------------AFRLGTLTTTARNDLE
B6HLN4_PENCW/17-255.GISGGLISLSALAVAEDFDTLV---------DACLEVTRV-----------------------LMRLCKLTSVRSRSME
E9D6Y9_COCPS/8-245VGLCTGALAAAAISSSSSLSELL---------PAAVHTVQV-----------------------ALRLGLLANDMKDRIE
K1X7W5_MARBU/800-1037VGLCTGLFAAAAISSSQSLSTLI---------PIAVQVSLM-----------------------AFRAGAYVTAMAERLH
L8G6V9_PSED2/30-264LGLCAGGFAAAAVSTSHTLAELI---------PAGVEAVIT-----------------------AFRTALCTVGICNDIE
B6QFH1_PENMQ/10-246IGLCTGLLASAAIASSRTIGELV---------PLAVEAVVV-----------------------ALRLGLCAYKVRDYVG
B6QER4_PENMQ/12-248VASCAGQLPAAIAACSHTIDELV---------DLAPETVAI-----------------------AFRIGMDVDRRTASL.
A7F3E3_SCLS1/4-241VGLCTGLFAAAAIASSPSISQLI---------PIAIQVVLM-----------------------AFRTGAHVAALADRLN
N1RV88_FUSC4/8-242LGICTGSIAAAAVSCAKDVFEIS---------KLGVEAATV-----------------------AFRLGMHVRRRAENLG
S3EB79_GLAL2/16-254.GISGGLLTLSALAIAGDFDALY---------EACLEVGRL-----------------------VFRVSKLASVRSRAVE
G4UHA1_NEUT9/13-252VGLCSGLFAATAIACTKSLSELV---------PLAVQVTLM-----------------------SFRVGRHVYKVAEQIY
B6HKK0_PENCW/8-244IGLCTGQLASAAVSSSRTIGELI---------PAGVETVIV-----------------------ALRLGMCVLKVQELIE
E9F7M7_METRA/10-244LGFCTGSLAAAAVSSSQDLVSFI---------PAAVHAVVV-----------------------ALYTGLRAAQEAQSIH
WA_EMENI/8-244VGLCTGLLSCAAVSCASNIGELL---------KPAVEVVVV-----------------------ALRLGLCVYRVRKLFG
V5GBX6_BYSSN/4-246LGLSPGLIAGATASVLPPGSAGI---------PFAVEAVQI-----------------------AFRLALYIGRCADRLH
G2QWR8_THITE/16-254VGLCSGLWAGAAISVTPSLPDLV---------PVGVQTVIL-----------------------AFKLGSYVQTIAQQFS
M3CY75_SPHMS/5-242LGLCTGLLAAAAVVSARTIDELV---------LLGVDFVRV-----------------------AFRSGAAVDGIRSVLA
M2RQ22_COCSN/4-241VGLCTGLLAGSVVASARSLSELL---------PLATEAVRV-----------------------AFRAGTCVGAAKEALE
B8LZ55_TALSN/27-260AGACTGSFAVAAISTSRSIGELL---------SPAVEAVLI-----------------------AFKTASYSLSLRKDLG
S3D9A7_GLAL2/4-237VGVCTGLLAAAAAASCESLETFI---------PLALETIRV-----------------------AFRVGFLVATRAEELI
G7XN60_ASPKW/8-244VGLCTGVLSCTAVSCARNVGELI---------PVAVEAIVI-----------------------ALRLGICVFRVRELVA
M2T1K1_COCSN/8-240VGLCTGTFAAAAVSCSKNTTELI---------PLAIEAVIA-----------------------SFKTGVLVQDVAQRLA
E9DR08_METAQ/20-259IGPCTGGFAAAAISCSQTLSDLI---------PVAVQACLA-----------------------AFRTALRSWLAGQDLS
S3CWG8_GLAL2/8-245IGLCTGALAAAAIGSCSTLSELL---------PAAVQTVQV-----------------------AFRLGLCVVDVCSRIE
F2PW05_TRIEC/6-242IGLCTGLLAAAAVAVSHSLDDLI---------EPAIEVTLV-----------------------ALRIGLSSLRIAHQIG
H1VJ39_COLHI/10-255AGACTGALAAAAVSCAHSAPGLL---------QPALHAVAV-----------------------AIRLGALAWDVADRVA
U1GE50_ENDPU/4-243VGLCTGLIAASAVASADSLTALV---------PLAVEAVRV-----------------------AFRTGAHVGRVAQQVE
A1C888_ASPCL/9-246LGSCTGLLSCAAVSSCRNVGELL---------PLAVEVVAM-----------------------AIHLGLCVMTVRDLVD
R0KB98_SETT2/8-242LGLCTGTLAAAAVSCSRSTLDLI---------PLGVAAVVT-----------------------AFKTGMHVTDVAQRVE
E4V2N2_ARTGP/10-256AGLSIGILAAAAVALSSSLADVS---------KNGAEAVRV-----------------------SFRLGIYVADISSKLE
L8G4G9_PSED2/24-270AGLGTGLLASSAVSLSKTLADLP---------LAGADAVRL-----------------------AFRLGIHVLDISENLE
M2ZZX0_PSEFD/5-242LGLCTGLLAAAAVVSSKTIDELV---------GLGVDFVRI-----------------------AFRSGAAVDRVRSVLG
Q2GV63_CHAGB/785-1022IGFCGGLLPAAVALAAHDTSQLF---------ALGREIVSI-----------------------SFRLACEVAQRKGLID
B8N7H8_ASPFN/9-246.GIPGGLSSAAVVPTSTNLKSLY---------DACLEAGRV-----------------------WARLCNLILVRLRAME
Q2UA48_ASPOR/8-244VGLCAGLLSSAAVSCSNNVGELL---------PAAVEAVVV-----------------------ALRLGLCVLKVRELVS
N4VBL7_COLOR/10-255AGVCTGALAAAAVSCSHSAPSLL---------SAGLHAVAV-----------------------AVRVGALAWDVAERVS
B2B495_PODAN/8-245VGLCSGLFAASAIASTPSLSALV---------PVAVQAVLL-----------------------AFRTGSYVHTLGDRLC
A0A0C4E4Q7_MAGP6/8-245VGLCSGLFAASAIACTTSVSSLV---------PLAVQTVLM-----------------------AFRTGSQVAALAERLE
R7YU14_CONA1/7-242AGACIGLLAAAAISSAQTVIDLL---------PPAVEAVLV-----------------------AFYTGLRTMETRDYIE
R0KD65_SETT2/13-258VGACGGLLAASAMMVANNLPSLY---------QSSLEMIRV-----------------------TCRLSNLMISRSMAVE
V5G4B2_BYSSN/8-244LGLCTGLLASAAIGSSRTVGELI---------PAAVETVVV-----------------------ALRLGLCVLRARDLVD
H1VY29_COLHI/8-245MGLCTGLFAAAAIASTPSVSTLI---------PIAVQVVLM-----------------------AFRTGSHVGSLAERLS
L8GBJ0_PSED2/42-283IGPCTGGFAAAAISCSQSLSDLV---------SNGVHAVLA-----------------------AFSAALRSFLVGQSLL
B6QC69_PENMQ/7-243LGLCTGLLPAAALAGSQNITELI---------AIGTETIAV-----------------------CFRLALELYRRTRRIE
G3JFQ9_CORMM/16-246LGICTGSFAASAICVSQSIPEVV---------VAGVEATIA-----------------------AFRTALRSFL......
F9XMW3_ZYMTI/5-242LGLCTGLLAASAVVSAKTVEELA---------IVGVDFVRI-----------------------AFRSGAVVDNVRSMLG
G9MXY7_HYPVG/19-259SGLCIGALAAAAVSSSNSLSELV---------QAGIDAVRV-----------------------SLRVGLLVARTAALFG
G0RW83_HYPJQ/19-262SGLCIGALAAAAVSSSRSLGELV---------EAGIDAVRV-----------------------SLRVGLLVARTAALFG
C5G0R3_ARTOC/8-243SGFCTGALSAAAVSCCRTPSELI---------PMAVQTVLV-----------------------AFRMGLRTLHTATAVD
K1WM58_MARBU/4-242LGICTGLLSASVAASSNSLSSFV---------PLAVQAVRI-----------------------AFRTGSRVSTIAEQLE
G9NQM0_HYPAI/19-259SGLCIGTLAAAAVGSSKSLGELV---------QAGVDAVRV-----------------------SLKIGLLAARTAALFG
A2QH36_ASPNC/29-262IGACTGAFAAAAVATSLTLAELV---------PAAVEAVTV-----------------------AFRTALRSLILRSDLV
STCA_EMENI/11-251LGVCTGSLAAAAISCSTSLSELL---------PIAVQTVLV-----------------------AFRLGLWAEKVRDNLE
Q8EYQ4_LEPIN/19-271TGHSQGVISSALIALGKEGSDFY---------SAFSKFLKF-----------------------VLYIGYRAQELV....
C7ZNQ1_NECH7/8-238VGLCTGAFAAAAISCSSFTADLI---------PMAVYSVIA-----------------------AFRTGMLVTDVAKRVD
M2N8F6_BAUCO/8-232VGLCTGALAAAAIASSGSLSELL---------PAAVHTVQL-----------------------ALRLGLHAIDVRDRIY
G7Y059_ASPKW/7-243VGLCTGLFPAALAATVPSPAELL---------PLSLLMVML-----------------------SLRLAIQVDRRS.RY.
E4V6P4_ARTGP/8-243SGICTGALSAAAVSCCRTTSEIV---------PIAVQTILV-----------------------AFRLGMCTLRASGAID
U1GYJ0_ENDPU/26-259VALCTGSFAAAAISTSRTLSELI---------PAGIEAVLA-----------------------AFRTGLCSLELRNDIE
H6BVA1_EXODN/5-241VGLCTGLIAATAVAASDSLTALI---------PLAVEAVRI-----------------------AFRAGAHVGKVAQQTE
E3R122_COLGM/12-243IGLCTGALSAAAVSCSTSPLDLI---------CTGIIAVKT-----------------------AFRIGLKVTEVAGRLA
G2WRK7_VERDV/8-245LGLCTGLFAAAAVASTGSVSTLI---------PLAVQTVLM-----------------------AFRIGSHVASLAERLC
G0SDA9_CHATD/19-258AAICSGLFAAWAISVAPSLPAVV---------PIGVQAVLL-----------------------AFRTGLYVHKLATRMF
B6QHV7_PENMQ/4-241VGVCIGLLSASAIACSHSLVHLI---------PLAVETVRT-----------------------AFRLGSCVGRMARLQE
Q2UG06_ASPOR/8-245LGFCMGSLAAVAVSCSRSLSELL---------PIAVQTVLI-----------------------AFRLGLCALEMRDRVD
C5FQT2_ARTOC/8-245IGLCTGQLAACAVASASTAGELV---------SLAIEAVVI-----------------------AYRTGLHVTKTRRLLE
E9D5J9_COCPS/7-242VASCAGQIPAALAAATQSLDELA---------DAASDIVAT-----------------------SVRAGLDVDRRTSEY.
N1PC72_DOTSN/5-242LGLCTGLLAATAIVSAKTVEELV---------TLGVEFVRV-----------------------AFRSGAAVETLRSVLG
E3R0Q2_COLGM/12-250.GISGGLISMSAWAVSEDFDTLR---------AALLEIARL-----------------------LVRLCKFTSIKSRSVE
R8BTJ4_TOGMI/8-245VGLCSGLFAAAAITSTPSLSALV---------PVAVQMVLM-----------------------AFRTGRHVASLAERLC
G4MU27_MAGO7/14-251VGLCSGLFAASAIASTPSLSSLV---------PVAVQTVLM-----------------------AFRTGAHVAALAERLE
R7YTG2_CONA1/4-241LGLCTGLLAASAVASARSLADLL---------PLAVEAVRI-----------------------AFRAGTCVGTAKEALE
U7PRD0_SPOS1/5-267LGTCTGLLAAVAVACSDNLADVL---------AIADHVVVL-----------------------AFRVGYEGVRRTARLD
E5A495_LEPMJ/4-241VGLCTGLLAASVVASARSLSELL---------PLSTEAVRI-----------------------AFRVGCMTGAARDALE
B8NVD5_ASPFN/5-241VGFCTGSLAAAAVSCARTSIDLL---------TLGIEAVVV-----------------------AFRVGMHVARRANALG
B8MV60_TALSN/15-255VGVCGGLLLGAAAATARDINELL---------DIGRKLVDV-----------------------SFNLGVAQWKRAMDIE
E9FC93_METRA/16-256ISSCAGNFTAAAASCSSSVTSFV---------PLAVESALA-----------------------AFRTGLKSFLVGETIA
G9NBV5_HYPVG/10-247LGFCTGLLPATAVVAAKDTSELH---------TLAREIVSI-----------------------TFRMTREIVRQTKMVE
R1G9D8_BOTPV/4-241LGLCTGLLAASAVASAKTLSDLL---------PLGVEAVRI-----------------------AFRTGAVVGNVKEALE
S3CAW2_OPHP1/8-244VGLCSGMFAASAIASTPSLSALV---------PVATQAVLM-----------------------AFRTGLHVSKLADQLG
B2B664_PODAN/7-242VGLCTGLLPAAVVSCSRNLTEVI---------ALADETVHL-----------------------AFQVGLAASKRSHEVD
M1WG96_CLAP2/23-272TGLGIGLLSSTAVSLAPTPSHLP---------LAGADVVRL-----------------------AFRLGIHVLGVSELLE
E9F5C9_METRA/8-246AASCAGQVPAALAASTQSLDQFV---------LAAPELVSI-----------------------AARIGLEINRRANSF.
A0A098D9G9_GIBZA/4-241IGLCVGSLAAAAVSCSTSLSELV---------SAGVDAVRV-----------------------ALHVGLRVWRTTSLFD
G2YLD0_BOTF4/4-242LAVCTGLLAASAVASSKSLTSLI---------PLAVQAVRI-----------------------AFRLGSRVAAVGNQLE
B2W1Q0_PYRTR/9-246.GISGGLFSAAVMSISTNFETLY---------AACIEAGRI-----------------------WSRLCNLTLVRSRAME
C7Z6X3_NECH7/7-240LGICAGAFSAAAVSSSSSLSELV---------NIASETVII-----------------------AFRTALHSFSIKTDTV
E3QS53_COLGM/10-256AGVCTGALAAAAVSCAHSVSSLV---------EPAVHAVAI-----------------------AVRLGALAWDVSSRID
G9NGU8_HYPAI/9-247IGLCTGLLPAAAAATAGDVGELL---------TIGRVLIPV-----------------------AYRLGVQQWRSAHEIE
B8MYS6_ASPFN/10-247VGLCTGLLSAAAVGCCQSITDLL---------PLATHTVLI-----------------------AFRAGLFVADVRDRLE
G2RCG6_THITE/8-247VGLCTGLLSAAPVSCCQSITDLI---------PLAAHTVLV-----------------------AFRAGLCVGEVRNRIE
S0DTP6_GIBF5/8-239VGLCTGAFAAAAVSCSSFTADLI---------PMAVSSVVA-----------------------AFRTGLLVTDTARRVD
G2QMK9_THIHA/8-254VGTCIGLLSAFAISCSESILDLV---------DLAPDLILL-----------------------AFRLGLVVQNRTASVV
F0XGQ5_GROCL/8-244AGLCSGLFAAVAIASTPSLSSLV---------PVGVQAVLM-----------------------AFRTGSHVAKLADRLS
T0KJR9_COLGC/11-253.GISGGLINAAVLAISDDFESLR---------EASVVTAGF-----------------------VCRLCEVAGHVSRAVE
M2RHZ9_COCSN/9-246LGICGGLLPAAAVAVATNIHELI---------EVASYLARV-----------------------NCRVAVAISRRSLGIE
R0JX83_SETT2/4-242VGTGIGQLCAAAVACTATVVKLP---------DLAAEAVRL-----------------------AFRIGSVVETYSV...
L8G0G7_PSED2/41-278VGLCTGLFAAVAVSIAPSLSALV---------NIGAEFVLL-----------------------AFRTGRHVSALAENIH
Q2HGW2_CHAGB/17-254VGLCSGLWAAAAISVAPSLPDLV---------HIGVQAVLL-----------------------AFKTGSYVHAIGERLS
B8MF01_TALSN/8-245TGLCTGLLTAVTVSCCRSLSELI---------PLAVHTVII-----------------------ALHTGFLVNAVRLRIE
N4VM62_COLOR/16-257AGACGGLLVASALVIADDVQSLY---------QGSLEMVRV-----------------------TCRLSSLMIARSRAVE
S3DAZ0_GLAL2/11-247VGLSTGLFAAAAISCSASLSALI---------QVGVQATVL-----------------------AFRTGSYVAALADQLG
E3SAD1_PYRTT/8-240VGLCTGTFAAAAASCSANTTELV---------PLAVEAVVA-----------------------SFKTGILVENVARRLT
U7PK37_SPOS1/8-244VGLCSGLFAAAAIASTPSLSALV---------PVAVQAVLM-----------------------SFRTGLYVATLADRLC
B2B6C8_PODAN/41-279LGVCTGSLAAAAISCSSSLSELL---------PIAVQTALI-----------------------AFRLGLCALEMRDSLE
V5G236_BYSSN/6-248IGLCIGQLSATAVSLTKSLVELI---------PFAVEAVRI-----------------------AFRVGVVVTNVKKELE
M2NM35_BAUCO/5-243LGLCTGMLAAAAVVSAKTIEELV---------ILGVQFVRI-----------------------AFRSGAAVDAARGVLS
B6QAB8_PENMQ/31-263TGACTGSFAVAAISSSRSIGELL---------APAVEAVIA-----------------------AFKTAIYSLNLRNDTD
M2XHZ5_DOTSN/10-247LGICTGSLAAAAVSSSNSLSELL---------PIAVQTALI-----------------------AFRLGLCVTDMRDRLE
R7YHB3_CONA1/8-244VGSCTGLLTAAAVSCSRTYLDLV---------NMSVEILKI-----------------------AFRVGAQVAEAGDELE

PF01735

PLB2_SCHPO/134-617.WSQEV....TSNSTLYDIIHKVFE.KLSEDQN.DIAPYP..NPYQNFTTT.NTTVKN.........PFERFDTIDLVDG
PLB5_SCHPO/125-607.TNASL...TASNNTFNNAVLSFLE.MLAEDQL.DVGLYP..NPYQGYGNASNTTTTN.........PLEPYPIIELIDG
PLB1_YEAST/99-586.LNSTD.....LPSFIANLATDFLE.DLSDNSD.DIAIYA.PNPFKEANFL.QKNATS.........SIIESEYLFLVDG
PA24A_CHICK/190-675.SNSQNKGPTMEEELENIRLKHLVS.NDSSDSE.DESQHPKGTENSEANEE.YQNSSQESWVQRMLMALVGDSALFNTRE
PLB_NEUCR/121-606NISSYD....GVPDVLIEAVTSVLK.EIGAKRD.DVSQII.PNPFLDWN.....NRTN.........PNADTLELDLVDG
PLB_KLULA/102-589.LNTTD.....LPSFLYNLLHGFLT.DASDDYD.DISIWA.PNPFYEITNI.PSNYSQ.........SISEDDTLYLVDG
PLB6_SCHPO/114-600.VSLRQS..RMS.RRLGFTLRHMRI.NGSS.....VSFYP..NPYTDATDI.AGNATAV......SEDIVDTPYLDLFDG
PA24A_DANRE/185-664.KETTSS.STMEEELEQIKPEHIVG.DDSADNE.EETQRG.GTESADAEDE.RQRHAQASWVQRMLTSIMGDTTLFTTRE
PLB1_CANAL/88-565.ITEAN.....IPSFLKDIIDDILV.DPILKSNIDVSAYN.PNPFFKSS.....GSNT.........AISQSKNLYLVDG
PLB3_YEAST/105-592.INSTH.....LPSFITRLARHFLK.DLSQDFN.DIAVYS.PNPFKDTKFL.DSDYTT.........SIVDSDSLFLVDG
PLB1_SCHPO/114-593.FNDSS.......TKNGRIIQQYLKGNFSENGQ.QIISIP..NPFQGVESA.NSDAAN.........NLGSSSSLNLVDT
PLB2_YEAST/101-588.ASTST.....YYKMINSFANKYVN.NLSQDDD.DIAIYA.ANPFKDTEFV.DRNYTS.........SIVDADDLFLVDG
B6HB59_PENCW/114-597.INTTS.....LPSFIKDVFNGILF.DLDKSQN.DIASYD.PNPFYKYN.....EHSS.........PYAAQKLLDVVDG
G8ZY27_TORDC/97-584.INSTS.....LPSFIKNLVTGFLD.DLSEDED.DIAIYA.PNPFKDTSYI.HDNFSK.........SISESDYLYLVDG
Q59W34_CANAL/88-564.LNNMP.....IPPFLKELISKFTL.DPVEKLNIDIAQYN.PNPFHKSN.....NSDT.........KIAQSRTLYLADG

PF01734

Q9N5Z7_CAEEL/97-269-............................................................................FVS
Q8F079_LEPIN/12-165-...............................................................................
B8GC44_CHLAD/8-228-AVGLPTGIYDSQ..........................ALERYVRV.AL..........EQPGRSNRFHDLDRELLIIA
C1DSE3_AZOVD/14-206-V.................................................................DFERLRTDCPLKL
A9BEP0_PETMO/3-174-...............................................................................
A9B328_HERA2/4-179-..............................................................................V
B2U808_RALPJ/9-214-IGVAHIPRWLG.............................ARSAVA.AG...........LIAYNIEKHVRKTLHPTLG
Q3AAC7_CARHZ/6-206-..................................................................SVDLYSGKRVVFG
A6CHF0_9BACI/8-175-............................................................................VIG
Q2GUC2_CHAGB/19-224-GP..............................................................GCKVILCATRVETGK
Q9XAG3_STRCO/16-207-GA...............................................................QLPVRDWPDRTVRM
Q2JEY3_FRASC/11-221-..........................................................................LRVVA
Q8R6F6_FUSNN/65-256-...............................................................................
Q9ZCV7_RICPR/15-214-.......................................................................GYDLNNQQ
Q038G8_LACC3/6-159-...............................................................................
D5T6X7_LEGP2/25-249-ALL.............................................................NHHFPDKFKQLNMPA
Q4UJC7_RICFE/42-240-..........................................................................VTDLA
Q54HM9_DICDI/140-357-VVVSKLKHNNSLLQ.......................QQQTPQQTF.INQ.........STPSSLQQPQQQQILINQQQ
Q2K9E1_RHIEC/30-248-PVSP...........................................................WFVFCASNLSTGSLFR
A4IAC8_LEIIN/190-378-..................................................................LNIPFVSASPVMP
Q21S96_RHOFT/26-231-VLISYPPPWAC.............................AHMAML.LG...........MLAYGLKACNKDAVHSLTG
A5GF97_GEOUR/15-187-.............................................................................IA
Q1CW69_MYXXD/353-514-...............................................................................
A6NV66_9FIRM/7-176-..........................................................................EAVVT
I6YB49_MYCTU/181-420-LTLRSLP.....................................FL.P.............IGIGPWVAARMWQVAAFI
A0YM74_LYNSP/12-230-FPS............................................................LKIPGLGYDWLIDFIR
A0A0C9NUJ5_LEGPN/27-309-QILEDTQKIING..........................LHDPNFDL.TF..........GHLHTLHQYDPQRFKELYVT
Q2GS92_CHAGB/73-327-SSEFR........................................................TDTYQCQTLAWCTEVETR
Q1ZT25_PHOAS/33-203-...............................................................................
Q5CY77_CRYPI/46-241-.............................................................................TN
PATA2_SOLTU/32-227-.........................................................................SFDIKT
A6G7S9_9DELT/458-735-LRLGISDAKS..............................GTFFSV.GE...........PIADGDLANYGYIDPEPDM
A0A0E1WDL8_BURPE/13-264-IDLRLTTTLLSGVQ.......................GNTVDDLGT.PVH.........DVDYRAYFHFTNMASHGTPS
A4F8K0_SACEN/17-281-LTATLLDPVI..............................ERHFDG.RS...........RPLTQERRTASFRFRHRGE
Q2R2X0_ORYSJ/139-303-..............................................................................I
Q0A7T0_ALKEH/6-219-AVG............................................................VTGAGYTSGRAVTFFQ
Q3Y1A6_ENTFC/138-323-.........................................................................RLYTVS
M6BTQ1_LEPBO/13-188-LRIA...........................................................VSNL............
YL620_MIMIV/38-270-IDSDFEGTD................................ITFWH.LK...........KLIKKYPQIYKHLLINSVD
Q0FZD9_9RHIZ/20-226-VLIAHPPTEIL.............................PKWSTF.PM...........MAAYLLDLTVRSTPHVEWP
Q5A7P0_CANAL/211-417-.........................................................................LNITVS
Q11UC9_CYTH3/381-624-ILSPTIINDGR.............................KLYISP.LN...........ISYMTTASTTSTSSTNFRQ
A6ASA3_VIBCY/5-186-........................................................................LLITTVE
Q1D826_MYXXD/142-382-RGMLPRPLEYYER.........................LLGTSPLG.LLN.........PVGVARRIQAAMGAMAELFT
A4HB10_LEIBR/40-220-...............................................................................
Q0RZB6_RHOJR/7-221-AV...............................................................AVAATSVATGGTVV
A3QTZ2_9VIRU/28-255-LLNEIILPLSP.............................HRDLIE.NL..........KSITFLDLKHITNHELRCFS
Q1D5W1_MYXXD/154-432-YGITVTNLRGREVPFGEGGPDA......QFKLKRVTEKLVVQVMTQ.GEGKLT...ARLPFMEGAASASFPHIGVKPKE
Q09D74_STIAD/17-214-...........................................................................AFDS
A4BNM2_9GAMM/38-218-...............................................................................
Q4LA62_STAHJ/11-202-H.................................................................RIKGIEWPSNLMI
Q5ZPA4_9DELT/22-208-A................................................................FQLDDGDPDEDRRG
Q6A6E2_PROAC/25-319-ILAKLLDR..................................GFFK.S............ELLATSGMSVRIATVALES
NTE1_PICST/1239-1403-...............................................................................
A4SJS7_AERS4/8-174-...............................................................................
Q1I961_PSEE4/42-302-QTMPDGLRL................................RSGVP.ID...........KPVEALFRLAIIATDVTTQ
A7RB12_PBCVA/19-192-........................................................................MFLVICA
Q0VPN6_ALCBS/36-193-...............................................................................
A6G1N7_9DELT/36-362-PFLVVNACIVEPDDTRAFAAQNPISLQCTPLYVGSLQPLKIRYAGEPFGDVVLPMGGGAVESFAFGGEGPAQVQSGELS
A6QA07_SULNB/41-281-MAFAVTKVTPIVE.........................EYQGIKIK.NQA.........FSVPLTFKVTQGRVSIINRK
Q5WWS2_LEGPL/304-496-PKGKITFS...................................TLA.S.............LREQFPDCGIGKELIVTA
A0Z6H0_9GAMM/8-199-........................................................................TIVTAYD
A6LMU7_THEM4/5-176-...............................................................................
A7I0A5_CAMHC/6-211-...............................................................................
Q2YJ28_BRUA2/13-187-...............................................................................
A6G3Y0_9DELT/12-216-MLISHIEPGY..............................PLVRTS.AV...........AVRNHMIARRRRDLHGPGH
A1DP95_NEOFI/20-225-PS..............................................................CRVVIYLTDWKTQKS
A5K2I7_PLAVS/1168-1482-KGGKEADGGDAYTSSNYDHVGDGEEQEGGDAEGWDGQQNGEVGVEDAEGANGANAANTANPANTANTANPANTANTANT
TEG_BACME/7-180-...............................................................................
Q2W5X1_MAGSA/6-225-LCANA.........................................................PFIQEMVDFDALKTVEE
A4U0C8_9PROT/5-257-YYPDSAF....................................LQQ.I.............DFKRLSEPGRPVLYHNAY
A5N2W9_CLOK5/4-191-..............................................................................T
A4JJZ7_BURVG/8-242-FRS.............................................................QTPFDDLLRIAAAEV
A6R0J1_AJECN/673-891-GALISGT.....................................KV.G.............VVATSISRETSTFVFGNF
Q6MR93_BDEBA/72-224-...............................................................................
A5P920_9SPHN/106-312-SI..............................................................EGYVGFVEANCGHFH
Q2C291_9GAMM/11-214-...............................................................................
A7BB55_9ACTO/26-199-..........................................................................RVAAF
A5I1W5_CLOBH/6-200-.......................................................................QSPLKIIA
A8GLS3_RICAH/7-147-...............................................................................
A4T0K7_POLSQ/80-285-SK...............................................................TNWPASRMFTTGID
A6DDL8_9PROT/5-162-...............................................................................
A4CKZ2_ROBBH/4-195-...........................................................................VVTV
Q18D71_PEPD6/5-179-.............................................................................EV
Q7CIX4_YERPE/86-275-R.................................................................RLYMGTVDLDSQR
M6C3B5_LEPBO/36-250-RD...............................................................KKRGLNTERMQRIL
Q12EZ0_POLSJ/6-228-.......................................................................AKTGKRAC
Q1GX66_SPHAL/43-328-MDAAPRGPVLVPDG.......................QPVDLFVSV.TDF........AGHSVPLALNSPPRVTENEHR
Q4RS54_TETNG/14-183-...........................................................................LGIS
Q5C8M6_LEGPN/32-295-ENPRLTLG..................................DLGR.L............RELLPEENKHLIKNLSVVV
Q6JBI3_DICVI/201-395-RLS............................................................IVAAIVNFPVIQPYAF
Q0FKF7_PELBH/6-360-PLRSGHHFF................................SAQEF.E............ALFPPRIMAYLIGEATPFD
Q8Z7F2_SALTI/8-168-...............................................................................
Q6ASS6_ORYSJ/60-258-.........................................................................CYDLAT
A6QX75_AJECN/242-440-.........................................................................LNITIP
Q74A07_GEOSL/58-306-A................................................................PFLVLNATDISIAH
Q54XY1_DICDI/13-231-VSLKKTGE..................................KNDI.L............TPVIISNYKFDETTTIAGN
Q55G69_DICDI/65-250-....................................................................AQDKISAEKSV
Q5Z158_NOCFA/22-193-...........................................................................HPIA
Q54QX6_DICDI/893-1088-VTS............................................................VTQESGNLEECLFLNY
A0A0D5GHL8_BURML/413-612-...............................................................................
A2QZY6_ASPNC/473-679-...................................................................KVAVTAVADQPV
A4XTW9_PSEMY/15-385-TTCASMARPFRLPFR....................NDEKVRENNQF.HFSE.......SEFGALFPQRVVNWMRARQRP
Q0E508_SFAVA/27-224-...................................................................RKTGKNLAIVAT
A6GI17_9DELT/71-215-...............................................................................
A7IE20_XANP2/6-198-..................................................................NTVQLDNALSDGQ
Q1DCU7_MYXXD/197-406-....................................................................VDFDTGDVFGI
Q6MAN6_PARUW/474-738-TFGELR.......................................E...............LIKTEKNSPFKHLYIVAA
Q4Z1R8_PLABA/352-558-.............................................................................RN
A4RTL4_OSTLU/164-398-GGETG........................................................RPLRWKDVITSSVPLKVV
A0JUC4_ARTS2/74-249-.........................................................................LPGAVE

PF00698

FAS_HUMAN/493-810-----------------------------------ELKKVIREPKPRSARWLSTSIPEAQWHSSLARTSSAEYNVNNLVS
STCK_EMENI/1547-1902-----------------------------------WVLS.HA......CDDLSRSTSPN.....SPQTMSECIAHHIPSS
FAS_CHICK/492-809-----------------------------------ALKKVIPHPKPRSARWISTSIPESQWQSDLARNSSAEYHVNNLVN
FAS1_YEAST/1663-2037-----------------------------------DTVT.NVLNFIKLQKIDIIELQKSLSLEEVEGHLFEIIDEASKKS
A4F7N8_SACEN/109-425-----------------------------------ALAW.FAPGGSEVPFYASLTGGAV.....DTRELVADYWRRSFRL
A4F7P0_SACEN/560-880-----------------------------------TTGD.IAPRPARVTFHSTVESRSM.....DGTELDARYWYRNLRE
I6Y231_MYCTU/534-851-----------------------------------ALAD.IAPMTPKVPYYSATLFDPR.....EQPVCDGAYWVDNLRN
PPSA_MYCTU/632-950-----------------------------------ELAD.LTPRTPTIGIISTTYADLH.....TQPVFDAEHWATNMRN

PF16073

E9F646_METRA/19-261-----------------------------------HQ..........ES---------------NGTSSS..PWSYALPD
E9F8F0_METRA/9-244-----------------------------------.R............---------------.TNGP....WARTI..
B8MGX9_TALSN/8-250-----------------------------------.............A---------------SLHEA....WAVVI..
B6HLN4_PENCW/17-255-----------------------------------D.............---------------.HPGI....WGWAV..
E9D6Y9_COCPS/8-245-----------------------------------TP..........TQ---------------ESPRE....WSAAF..
K1X7W5_MARBU/800-1037-----------------------------------.Q..........NI---------------DSSDP....WTYVL..
L8G6V9_PSED2/30-264-----------------------------------GP.........NHD---------------RHHQS....WSAVV..
B6QFH1_PENMQ/10-246-----------------------------------.Q..........YS---------------GQSQS....WSAVI..
B6QER4_PENMQ/12-248-----------------------------------............GD---------------DRSQS....WAKAV..
A7F3E3_SCLS1/4-241-----------------------------------.N..........QS---------------ESPES....WTYVV..
N1RV88_FUSC4/8-242-----------------------------------YS..........TT---------------SS.......WSMIL..
S3EB79_GLAL2/16-254-----------------------------------D.............---------------.KPGV....WGWAV..
G4UHA1_NEUT9/13-252-----------------------------------.P..........TA---------------EKSES....WTYIF..
B6HKK0_PENCW/8-244-----------------------------------.P..........SK---------------SATPS....WSVLI..
E9F7M7_METRA/10-244-----------------------------------..............---------------...GNASSPWSLLV..
WA_EMENI/8-244-----------------------------------.Q..........DQ---------------AAPLS....WSALV..
V5GBX6_BYSSN/4-246-----------------------------------............LA---------------TDAANP.EPWTITV..
G2QWR8_THITE/16-254-----------------------------------HS..........AQ---------------DESES....WTYLF..
M3CY75_SPHMS/5-242-----------------------------------.Q..........PG---------------QEKTP....WSAIV..
M2RQ22_COCSN/4-241-----------------------------------.Q..........SS---------------TSKDS....WSTIV..
B8LZ55_TALSN/27-260-----------------------------------FT..........VS---------------GGPNS....WSVVV..
S3D9A7_GLAL2/4-237-----------------------------------.Q..........D.---------------SSDQL....WSTVI..
G7XN60_ASPKW/8-244-----------------------------------.S..........AD---------------SESTC....WSALV..
M2T1K1_COCSN/8-240-----------------------------------..............---------------.PSQDLDQSWAILI..
E9DR08_METAQ/20-259-----------------------------------PH..........QP---------------SDTSS....WSAAV..
S3CWG8_GLAL2/8-245-----------------------------------SP..........TG---------------DAAQS....WSAVF..
F2PW05_TRIEC/6-242-----------------------------------..............---------------TSIDPY.KQWSVAA..
H1VJ39_COLHI/10-255-----------------------------------IKHE.....GPGSS---------------NSFD....SWSRVA..
U1GE50_ENDPU/4-243-----------------------------------.C..........E.---------------PGRKS....WSTIV..
A1C888_ASPCL/9-246-----------------------------------.S..........SS---------------SSTGS....WSVLV..
R0KB98_SETT2/8-242-----------------------------------.............P---------------SQGAQTDRSWSMLV..
E4V2N2_ARTGP/10-256-----------------------------------TP..........QS---------------D..GTL.KSWAHVV..
L8G4G9_PSED2/24-270-----------------------------------AR..........DL---------------S..ESP.DSWAYVV..
M2ZZX0_PSEFD/5-242-----------------------------------.Q..........TG---------------EDKEP....WSTIV..
Q2GV63_CHAGB/785-1022-----------------------------------A.............---------------.TPTS....WGKTY..
B8N7H8_ASPFN/9-246-----------------------------------E.............---------------.CPGT....WGWAV..
Q2UA48_ASPOR/8-244-----------------------------------.S..........DQ---------------ASSTS....WSVLI..
N4VBL7_COLOR/10-255-----------------------------------NL.........DGD---------------SAEAASFESWSRAV..
B2B495_PODAN/8-245-----------------------------------.P..........AN---------------EQSES....WTYIF..
A0A0C4E4Q7_MAGP6/8-245-----------------------------------.P..........TT---------------DRSES....WTYIV..
R7YU14_CONA1/7-242-----------------------------------.R..........AP---------------S.TAN....WCMVV..
R0KD65_SETT2/13-258-----------------------------------D.............---------------.TVDS....WGWSI..
V5G4B2_BYSSN/8-244-----------------------------------.H..........GK---------------EKSQS....WSIVV..
H1VY29_COLHI/8-245-----------------------------------.P..........PV---------------GQSEP....WTHIL..
L8GBJ0_PSED2/42-283-----------------------------------PRAK......STQT---------------QPNKS....WS.AV..
B6QC69_PENMQ/7-243-----------------------------------E.............---------------.TPGH....WAHTV..
G3JFQ9_CORMM/16-246-----------------------------------.QRG......IITT---------------AGNRP....WSAVV..
F9XMW3_ZYMTI/5-242-----------------------------------.Q..........SS---------------QDKST....WSTII..
G9MXY7_HYPVG/19-259-----------------------------------HP..........ES---------------DGTAS....WSYVVPE
G0RW83_HYPJQ/19-262-----------------------------------QP..........QS---------------TGTSS....WSYVVPE
C5G0R3_ARTOC/8-243-----------------------------------............PS---------------EGS......WSMVV..
K1WM58_MARBU/4-242-----------------------------------.R..........TT---------------DQSKT....WSTVV..
G9NQM0_HYPAI/19-259-----------------------------------HH..........RS---------------NGPSS....WSYVVAE
A2QH36_ASPNC/29-262-----------------------------------PT.........V.E---------------ETPEP....WSAIV..
STCA_EMENI/11-251-----------------------------------IS..........ET---------------NQTQP....WSAVC..
Q8EYQ4_LEPIN/19-271-----------------------------------.GTYNPSEALLKAN---------------EEVGDKQPAPMVAV..
C7ZNQ1_NECH7/8-238-----------------------------------..............---------------.QSQDLDQSWALLV..
M2N8F6_BAUCO/8-232-----------------------------------SS..........VS---------------SEQEP....WSVLY..
G7Y059_ASPKW/7-243-----------------------------------............IE---------------ASTQS....WAVSV..
E4V6P4_ARTGP/8-243-----------------------------------............PS---------------EGA......WSMVV..
U1GYJ0_ENDPU/26-259-----------------------------------RP.........S.S---------------RIPRS....WSAIV..
H6BVA1_EXODN/5-241-----------------------------------.C..........D.---------------SKTQS....WSTIV..
E3R122_COLGM/12-243-----------------------------------..............---------------.ASDHQHQNWSLIV..
G2WRK7_VERDV/8-245-----------------------------------.P..........AT---------------DRSDP....WTHVL..
G0SDA9_CHATD/19-258-----------------------------------.P..........AS---------------ESLDK...FWTYVF..
B6QHV7_PENMQ/4-241-----------------------------------.P..........VV---------------HESKS....WTSLV..
Q2UG06_ASPOR/8-245-----------------------------------GC..........SD---------------DRGDP....WSTIV..
C5FQT2_ARTOC/8-245-----------------------------------.N..........DT---------------DRNKN....WSYIV..
E9D5J9_COCPS/7-242-----------------------------------............SD---------------DRSES....WATAV..
N1PC72_DOTSN/5-242-----------------------------------.Q..........AG---------------QEKVP....WSTIV..
E3R0Q2_COLGM/12-250-----------------------------------D.............---------------.RRGV....WGWAV..
R8BTJ4_TOGMI/8-245-----------------------------------.P..........SV---------------QRSQS....WTYIL..
G4MU27_MAGO7/14-251-----------------------------------.P..........VS---------------ERSES....WTYIV..
R7YTG2_CONA1/4-241-----------------------------------............QA---------------NSRES....WSTIV..
U7PRD0_SPOS1/5-267-----------------------------------D...........TA---------------STSSTTTAAWATLVTN
E5A495_LEPMJ/4-241-----------------------------------.R..........AP---------------NSKQS....WST.V..
B8NVD5_ASPFN/5-241-----------------------------------GD..........GG---------------SQWKP....WSLAV..
B8MV60_TALSN/15-255-----------------------------------G.............---------------.KPGR....WAVAI..
E9FC93_METRA/16-256-----------------------------------VE..........RS---------------DASMT....WSASV..
G9NBV5_HYPVG/10-247-----------------------------------D.............---------------.SSGD....WARTY..
R1G9D8_BOTPV/4-241-----------------------------------............HA---------------EEAQS....WSTIV..
S3CAW2_OPHP1/8-244-----------------------------------.P..........SE---------------KASGS....WTYIF..
B2B664_PODAN/7-242-----------------------------------..............---------------....PSTGSWATLV..
M1WG96_CLAP2/23-272-----------------------------------AR..........DV---------------S..GKP.ASWAYLV..
E9F5C9_METRA/8-246-----------------------------------............ND---------------DRTKS....WATAV..
A0A098D9G9_GIBZA/4-241-----------------------------------.V..........PD---------------RPSAT....WSIIVPE
G2YLD0_BOTF4/4-242-----------------------------------.T..........AS---------------DRQKT....WSTIV..
B2W1Q0_PYRTR/9-246-----------------------------------E.............---------------.RPGT....WGWAI..
C7Z6X3_NECH7/7-240-----------------------------------GN.........N.E---------------EHERS....WSVII..
E3QS53_COLGM/10-256-----------------------------------NDD........ENS---------------GGSASEFAAWSYAV..
G9NGU8_HYPAI/9-247-----------------------------------S.............---------------.APGS....WAVAI..
B8MYS6_ASPFN/10-247-----------------------------------.............P---------------QTGAPL..AWSVLI..
G2RCG6_THITE/8-247-----------------------------------.P..........QP---------------QTGPPA..SWSVLI..
S0DTP6_GIBF5/8-239-----------------------------------..............---------------.PSQDLNRSWALLV..
G2QMK9_THIHA/8-254-----------------------------------ASGLAAGSSSTTAS---------------DSTSV.....SYAV..
F0XGQ5_GROCL/8-244-----------------------------------.P..........AT---------------GRSES....WTYIF..
T0KJR9_COLGC/11-253-----------------------------------DG..........DS---------------GSSSS....WGCAV..
M2RHZ9_COCSN/9-246-----------------------------------..............---------------....SGTGSWAFSVLG
R0JX83_SETT2/4-242-----------------------------------............QN---------------QRSAHSNESWSISV..
L8G0G7_PSED2/41-278-----------------------------------.E..........SG---------------DAAKS....WTYVV..
Q2HGW2_CHAGB/17-254-----------------------------------.P..........AF---------------ERSES....WSYIF..
B8MF01_TALSN/8-245-----------------------------------L...........SG---------------NASDS....WSMVI..
N4VM62_COLOR/16-257-----------------------------------D.............---------------.SSDS....WGWSI..
S3DAZ0_GLAL2/11-247-----------------------------------.G..........AN---------------DNANP....WAYSI..
E3SAD1_PYRTT/8-240-----------------------------------..............---------------.SSQNLDQSWAMLI..
U7PK37_SPOS1/8-244-----------------------------------.P..........PS---------------EKSES....WTYVY..
B2B6C8_PODAN/41-279-----------------------------------TS..........AP---------------DRARP....WSVVV..
V5G236_BYSSN/6-248-----------------------------------.............P---------------G.HEG....QTWAM..
M2NM35_BAUCO/5-243-----------------------------------.Q..........IG---------------EEKAP....WSTIV..
B6QAB8_PENMQ/31-263-----------------------------------YR..........GS---------------TGSNS....WSVVV..
M2XHZ5_DOTSN/10-247-----------------------------------SS..........EE---------------DRTQP....WSVVL..
R7YHB3_CONA1/8-244-----------------------------------.Q..........TS---------------TNSAS....WSAIF..

PF01735

PLB2_SCHPO/134-617GEDD..E--NIPIWPLLHP----------------QRFVDV------------------------------IFAVDATY.
PLB5_SCHPO/125-607GSDS..E--GIPFWPLLHP----------------QRDVDV------------------------------IFAIDGGYQ
PLB1_YEAST/99-586GEDN..Q--NIPLVPLLQK----------------ERELDV------------------------------IFALDNSA.
PA24A_CHICK/190-675GRAGKVH--NFMLGLNLNS----------------CYPLSP------------------------------LADLLTQE.
PLB_NEUCR/121-606GEDL..Q--NIPLNPLTQP----------------VRAVDV------------------------------IFAVDSSA.
PLB_KLULA/102-589GEDG..Q--NIPLTPLLQT----------------EREIDV------------------------------IFALDNSA.
PLB6_SCHPO/114-600GYDG..Q--NIPIWPLLQP----------------ERKLDV------------------------------VFAFDSSG.
PA24A_DANRE/185-664GRAGKVH--NFMLGLNLNS----------------TLPFSP------------------------------FSGITHQT.
PLB1_CANAL/88-565GEDG..Q--NIPISPLLH.----------------.RNVSA------------------------------IFAFDNSN.
PLB3_YEAST/105-592GEDD..E--NVPVLPLIQK----------------ERDVDI------------------------------IFAVDNSA.
PLB1_SCHPO/114-593FLTG..E--KIPLWPLLQK----------------GRDVDV------------------------------IVAVDNGD.
PLB2_YEAST/101-588GEDG..Q--NLPLVPLIKK----------------ERDLDV------------------------------VFALDISD.
B6HB59_PENCW/114-597GEDG..Q--NVPLHPLIQP----------------ERHVDV------------------------------IFAVDSSA.
G8ZY27_TORDC/97-584GEDN..Q--NIPLVPLVQD----------------ERNIDV------------------------------IFALDNSA.
Q59W34_CANAL/88-564GEDG..Q--NVPLLPLIH.----------------.RKVSA------------------------------IFAFDQSA.

PF01734

Q9N5Z7_CAEEL/97-269VTKLKTW--KNELISNFES..----------....KIDLID..............................CLM...AS-
Q8F079_LEPIN/12-165....VSN--ITKQIRELKT..----------....KGDLID..............................QIL...AS-
B8GC44_CHLAD/8-228TDLDSGE--RAVFGLPPLD..----------....QVPISL..............................AVC...AS-
C1DSE3_AZOVD/14-206FIAATNA--NTGRLRLFRS..----------....HELSVD..............................CVL...AS-
A9BEP0_PETMO/3-174...VFEL--KNKEVIILKN..----------....ETKIVD..............................MLM...ME-
A9B328_HERA2/4-179TATNYRT--GDMHLFGDDP..----------....RERLVD..............................ALM...AS-
B2U808_RALPJ/9-214KRLGFTA--EIVRAQDCAT..----------....PEDLAD..............................LLL...QS-
Q3AAC7_CARHZ/6-206NFPGEFL--RGINDYIAVR..----------....DALLVT..............................ALE...AT-
A6CHF0_9BACI/8-175TTDCHTG--EPVYHYKKDY..----------....GKDVLT..............................PIR...AS-
Q2GUC2_CHAGB/19-224ADVLRNY--KSGHPTAENY..----------....SCRIWE..............................AAS...AT-
Q9XAG3_STRCO/16-207FAVDALT--GEPTAFDADS..----------....GVDLLH..............................AMS...AT-
Q2JEY3_FRASC/11-221MNFDTGE--RVLFGVADAP..----------....RATLSE..............................AVM...AS-
Q8R6F6_FUSNN/65-256LRIIATN--LNTGETKAFS..----------....KGDVAK..............................ILI...AS-
Q9ZCV7_RICPR/15-214NPLITFS--TIEARKSQDN..----------....NYYLSD..............................IIQ...GI-
Q038G8_LACC3/6-159.SVPDFQ--AHVTRLDVLT..----------....APEARE..............................WLL...AS-
D5T6X7_LEGP2/25-249VEFPNGA--IQVFNSTLTP..----------....DVEIAL..............................ACR...AS-
Q4UJC7_RICFE/42-240SKDKEVK--IFDSHDSYSP..----------....HIRVQD..............................VLL...AT-
Q54HM9_DICDI/140-357ESEFKTK--IISNYNKKYE..----------....NVKVSE..............................ALN...AS-
Q2K9E1_RHIEC/30-248MSNRYIA--DYRIGLSFHP..----------....ALSLAT..............................AVA...AS-
A4IAC8_LEIIN/190-378RRNADVD--VQLLNYLTSP..----------....DVLVRS..............................AVL..CAI-
Q21S96_RHOFT/26-231QRVGFRP--LFISVQECVT..----------....PGDLAD..............................LII...AS-
A5GF97_GEOUR/15-187TDILNYK--PVIFSAKTFP..----------....DLKVAT..............................AAR...FS-
Q1CW69_MYXXD/353-514....TTD--LTSGDCVALE..----------....QGPVAL..............................AVR...AS-
A6NV66_9FIRM/7-176NMDTGKA--EYLPVPKQDE..----------....HFELLQ....................................AT-
I6YB49_MYCTU/181-420DLRVVKP--IVISADGATR..----------....DVNVVD..............................AAS...FS-
A0YM74_LYNSP/12-230AKTGTGA--EWLCIQDCPD..----------....NETIYN..............................LLL...AS-
A0A0C9NUJ5_LEGPN/27-309GTDENGE--LRIFSHEKDA..----------....DMPVSI..............................AVR...IS-
Q2GS92_CHAGB/73-327RSRRPYA--FCTYAEDEND..----------....PEQLIS..............................IPE...VA-
Q1ZT25_PHOAS/33-203......A--CATRKDTLKDIY----------MPMFQDDWYE..............................VLR...AS-
Q5CY77_CRYPI/46-241TMRYTDR--TAHVFTEQLE..----------....LEEIIE..............................AVI...GS-
PATA2_SOLTU/32-227NKPVIFT--KSNLAKSPEL..----------....DAKMYD..............................ICY...SA-
A6G7S9_9DELT/458-735ALSADWL--RQPAFGCKRF..----------....AMRLRD..............................AVY...AS-
A0A0E1WDL8_BURPE/13-264PQSAFDS--TNDFDDRTDV..----------....LDRLAR..............................AAR...ST-
A4F8K0_SACEN/17-281AGDPLSD--FGTGTAFDET..----------....VRRLAH..............................AAR...TT-
Q2R2X0_ORYSJ/139-303TQLSWRP--RGLLVDQFDS..----------....KDDVIS..............................AVI...TS-
Q0A7T0_ALKEH/6-219AAPDVEG--WLKGKRVGRP..----------....VRLGVQ..............................HLL...AS-
Q3Y1A6_ENTFC/138-323TKLPELA--EVVTDIQQTK..----------....TEEIPD..............................WIL...AS-
M6BTQ1_LEPBO/13-188......Q--TRTIEYVRAT..----------....SSNIFD..............................LLK...AA-
YL620_MIMIV/38-270ISREQQI--FMTTLDDNWD..----------....NIKLYD..............................SIL...AS-
Q0FZD9_9RHIZ/20-226AKLGADS--SLVDAREAAK..----------....QGKLID..............................LIC...AA-
Q5A7P0_CANAL/211-417PASVHEQ--TRLLNYLTAP..----------....NCLIWS..............................AVC...AS-
Q11UC9_CYTH3/381-624KLKGIEF--KKFFEEQDAN..----------....DLHFMS..............................ALR...MS-
A6ASA3_VIBCY/5-186MNTGKTL--LINTIDEDYR..----------....YWTLEQ..............................VAL...AT-
Q1D826_MYXXD/142-382RPEITAR--LYLGADDTTG..----------....DFDALD..............................AAG...FS-
A4HB10_LEIBR/40-220.......--RSHLINSFSS..----------....YAAIRE..............................TLI...AS-
Q0RZB6_RHOJR/7-221FVHKHPA--IALPPFDANRNI----------TYVETTLQPE..............................HVL...AS-
A3QTZ2_9VIRU/28-255TQLNDMV--IYEFSVSRTP..----------....DEYVTK..............................AVY...AS-
Q1D5W1_MYXXD/154-432LAYYPAL--GAQPTGDGGH..----------....EVSLSN..............................LLLTPQAS-
Q09D74_STIAD/17-214TVWRKAT--YHQFPPDADF..----------....VTTLVD..............................AAL...AS-
A4BNM2_9GAMM/38-218...ACSD--DGRNRRKVFR..----------....KGLLLP..............................AIL...SS-
Q4LA62_STAHJ/11-202TAINARK--AERVALTSDS..----------....QVNLHR..............................AMA...SS-
Q5ZPA4_9DELT/22-208WRPRIFH--NFPGDTFVNL..----------....DDYLVD..............................LAL...RS-
Q6A6E2_PROAC/25-319GELRYMT--ESGVLVDRDNNP----------IGSSTFDVSR..............................GVL...AS-
NTE1_PICST/1239-1403....TTN--ITNSTMDIHE..----------....SGYSWR..............................FIR...AS-
A4SJS7_AERS4/8-174....RVS--DGQAAYLKGN..----------....AAELEQ..............................QIK...AS-
Q1I961_PSEE4/42-302TKVEFPR--MASLYWDDVD..----------....SVHPAM..............................FAR...AS-
A7RB12_PBCVA/19-192TNLTEHC--PEYFSPTETP..----------....DMDVRT..............................AIR...MS-
Q0VPN6_ALCBS/36-193....AWH--GRSRRTHVLR..----------....SGNLVE..............................SVY...AS-
A6G1N7_9DELT/36-362CVPTNPV--NIQARQTLEF..----------....AVGCSS..............................AAY...GA-
A6QA07_SULNB/41-281MPPSTAF--YISIPGIEKD..----------....TAKITD..............................VLF...AS-
Q5WWS2_LEGPL/304-496TNKRSGK--TIYLSANRYP..----------....LLEVSE..............................AVK...IS-
A0Z6H0_9GAMM/8-199LEARSTT--FFKSFKPEHA..----------....QVLCKS..............................AAR...AT-
A6LMU7_THEM4/5-176....TFD--TLDGNSLLIT..----------....EGFLVD..............................AVM...AS-
A7I0A5_CAMHC/6-211TESSDFS--PFFVNVQSLD..----------....KNEIID..............................YLL...SS-
Q2YJ28_BRUA2/13-187.TITAVD--FHGAREIHIS..----------....DGDLRS..............................AIA...AS-
A6G3Y0_9DELT/12-216LAPGLGY--RALSSHDAQS..----------....PAELID..............................WIV...AS-
A1DP95_NEOFI/20-225FPLTSYE--SKRCPSELSM..----------....TATIVQ..............................AGQ...AC-
A5K2I7_PLAVS/1168-1482ANTANTA--NPANTANPAN..----------....AANVLEKTPHTSDIYVNQNINSVSIYKSFYNIFVKYVLR...CT-
TEG_BACME/7-180...NPVL--FHNFLGSPYL..----------....NEKASD..............................VIL...RS-
Q2W5X1_MAGSA/6-225DVYLNAY--NLTDHKMAIF..----------....GKDVLD..............................YPH...FG-
A4U0C8_9PROT/5-257NLTDDRL--ELFSNKDGKY..----------....QGISAQ..............................TLC...AC-
A5N2W9_CLOK5/4-191VSISDFK--PLNLYKEDIP..----------....NGKMIN..............................YLM...AS-
A4JJZ7_BURVG/8-242GIEDTPA--STYVHVQGLP..----------....EAEQKA..............................ALL...AS-
A6R0J1_AJECN/673-891NGAECGK--QRVRPEDDGD..----------....DPFVWQ..............................SAR...AT-
Q6MR93_BDEBA/72-224....SYN--LKKNQVYLMN..----------....RGGIDQ..............................LMY...LC-
A5P920_9SPHN/106-312YADVREL--VRKAPNNESA..----------....VEALTA..............................AAM...AS-
Q2C291_9GAMM/11-214.AVDLES--GDFKTFDSFN..----------....ETITAE..............................HIM...AS-
A7BB55_9ACTO/26-199NASRGEV--RWFSKEDMST..----------....LDTLGP..............................IIR...AS-
A5I1W5_CLOBH/6-200SDVTNKR--LLILPDDIRKYG----------MDPMELEISK..............................AVT...MS-
A8GLS3_RICAH/7-147.......--.....DSQKT..----------....NIDLYV..............................VIL...IS-
A4T0K7_POLSQ/80-285CYSGERL--VVGQQTAQKN..----------....NIALAH..............................GAA...AS-
A6DDL8_9PROT/5-162....VTD--FQEEKALYLN..----------....AGDPKK..............................IIP...AS-
A4CKZ2_ROBBH/4-195SNLSLNQ--VEYKSINDFD..----------....YDEFCE..............................WIW...IS-
Q18D71_PEPD6/5-179DNKVVSE--KIVDVSKMPR..----------....NEAIIS..............................ISY...SG-
Q7CIX4_YERPE/86-275FIVWNMG--LIASKGTPEA..----------....LMLFRK..............................VML...AS-
M6C3B5_LEPBO/36-250RKWNMKE--VLFMEKDFDD..----------....EKTVEQ..............................IIL...NS-
Q12EZ0_POLSJ/6-228IEGGQLR--DWTLGSTPMK..----------....RFPLRD..............................AMA...VS-
Q1GX66_SPHAL/43-328LILHFRE--DGRTGKRLDD..----------....VPGLAA..............................AAR...AT-
Q4RS54_TETNG/14-183LTRVTDG--ENVLVTHFDD..----------....KEELVQ..............................ACV...CS-
Q5C8M6_LEGPN/32-295TNQTKHE--LERYSEDTTP..----------....QQSIAQ..............................VVQ...WS-
Q6JBI3_DICVI/201-395RNYEPPA--GRDSHYRGST..----------....GHYLWK..............................AIQ...AS-
Q0FKF7_PELBH/6-360ASAAGGP--TDLYPMRIEE..----------....DFPLLL..............................VAR...LS-
Q8Z7F2_SALTI/8-168....ATN--LSTGRELWFT..----------....EGDLHL..............................AVR...AS-
Q6ASS6_ORYSJ/60-258AAPFMFS--RADAVESDSY..----------....DFALRD..............................VCA...AT-
A6QX75_AJECN/242-440TAGRAGT--PNLLNYLTAP..----------....NVLIWS..............................AAA...AS-
Q74A07_GEOSL/58-306RFEFTQD--QFDLLCSDLA..----------....GVSVAR..............................AVA...AS-
Q54XY1_DICDI/13-231NNNNNNH--FIKGEEIERLYT----------IGEEALSLAD..............................AIR...AT-
Q55G69_DICDI/65-250KIFANYQ--NPSTNLHDDD..----------....STSVVD..............................IIR...ST-
Q5Z158_NOCFA/22-193TDARTGN--AVDLRPHIYD..----------....KRSLMR..............................ALR...AS-
Q54QX6_DICDI/893-1088QKKTNPT--RCSEQRKFIT..----------....NSNVID..............................AAE...AT-
A0A0D5GHL8_BURML/413-612.AVDVET--GEPRIFDSYV..----------....DRLSPA..............................HVL...AS-
A2QZY6_ASPNC/473-679LLINYRR--VVDPPGQRCV..----------....DHEMQT..............................TGV...AS-
A4XTW9_PSEMY/15-385AQQGERS--DGLYRLPLPD..----------....DLPVVV..............................AVR...MS-
Q0E508_SFAVA/27-224DIVSKFE--PYVMSTSTTP..----------....NMSISE..............................GFS...AS-
A6GI17_9DELT/71-215.......--............----------......VIIR..............................GII...LS-
A7IE20_XANP2/6-198RSWLPRT--FSNFPGDLGR..----------....VELIAD..............................VVL...RT-
Q1DCU7_MYXXD/197-406SDQDPAN--FDPNATEQQR..----------....VEGIIN..............................GVV...AS-
Q6MAN6_PARUW/474-738KLGPQHG--VRIFSSEDPNC.----------...DDIIISD..............................AVR...AS-
Q4Z1R8_PLABA/352-558YTHKYNA--INGESYGGLN..----------....KIPLWL..............................AAW...AT-
A4RTL4_OSTLU/164-398ATSLDTL--TTVILDDFKD..----------....EADLKK..............................SLL...AS-
A0JUC4_ARTS2/74-249GTFNVVE--FTEKRCHAID..----------....ARDVDA..............................ELL...AA-

PF00698

FAS_HUMAN/493-810PVLFQEA--LWHV.....PEH--AVVLEIAPHALLQAVLKR------------------------------GLK.....-
STCK_EMENI/1547-1902CSVTNET--ELSR..GRATIP--LAGVDIPFHSQMLRGHID------------------------------GYRQYLRH-
FAS_CHICK/492-809PVLFHEG--LKHI.....PEN--AVVVEIAPHALLQAILRR------------------------------TLK.....-
FAS1_YEAST/1663-2037AVKPRPL--KLER..GFACIP--LVGISVPFHSTYLMNGVK------------------------------PFKSFLKK-
A4F7N8_SACEN/109-425PVRFDEA--IRSA...LEVGP--GTFVEASPHPVLAAALQQ------------------------------TLD.....-
A4F7P0_SACEN/560-880TVRFADA--VTRL...AESGY--DAFIEVSPHPVVVQAVEE------------------------------AVEE....-
I6Y231_MYCTU/534-851TVQFAAA--VQAA...MEDGY--RVFAELSPHPLLTHAVEQ------------------------------TGRS....-
PPSA_MYCTU/632-950PVRFQQA--IASAGSGADGAY--HTFIEISAHPLLTQAIID------------------------------TLHS....-

PF16073

E9F646_METRA/19-261SQLPLAL..AEEAIESYQ.AK..TN...IP.PL..SLPYIS------------------------------AKGQ.NS.-
E9F8F0_METRA/9-244LGISVDR..VREILQDFH.EN..QS...IP.RA..RQVCIG------------------------------FVSD.GW.-
B8MGX9_TALSN/8-250PRDITIP..TEDVLDGIV.KE..SE......ILGRKKPYIT------------------------------AYFP.KT.-
B6HLN4_PENCW/17-255LGISADD..LRTALDQFQ.QS..VG...IP.PI..KRAKVG------------------------------VSG....V-
E9D6Y9_COCPS/8-245FDMTEAA..AVSALVEFD.SV..TP...VP.CK..LRPWIG------------------------------ATSS.KA.-
K1X7W5_MARBU/800-1037PTIGEKE..TKSIIDSFH.ND..AG...IP.SA..NHVYIS------------------------------AITN.SS.-
L8G6V9_PSED2/30-264.NIQDDE..ASKLIKQFI.LE..KG...LP.HI..SKPYLS------------------------------AITP.SN.-
B6QFH1_PENMQ/10-246SGISEEK..ALSIIAEFS.TK..KD...IS.PS..SRPYVS------------------------------AVSY.NG.-
B6QER4_PENMQ/12-248FGVSAPD..AQKMVDKFL.IR..EG...ID.AK..KGVYVA------------------------------ATSA.WA.-
A7F3E3_SCLS1/4-241PAAQESE..VNSILNDFH.KE..NA...TP.LV..NQAYIS------------------------------AITS.KS.-
N1RV88_FUSC4/8-242SSNQEEL..VSEALQEFS.KD..KN...LT.SS..TRPYIS------------------------------AVGP.GF.-
S3EB79_GLAL2/16-254LGISADD..LRKAMEQFQ.EN..AG...IP.PT..KRAKVG------------------------------VTG....A-
G4UHA1_NEUT9/13-252TNISEGA..ASQVVHDFN.KK..SG...WN.RV..NRLYLS------------------------------ASSS.QS.-
B6HKK0_PENCW/8-244SGMREAE..AQDLIQQYA.EK..NA...LP.RV..SQPYIS------------------------------AVSP.NG.-
E9F7M7_METRA/10-244LGISGDQ..MTTILEGFN.SR..NV...L......IRTILP------------------------------CIHQRLWN-
WA_EMENI/8-244SGLSESE..GTSLIDKFT.RR..NV...IP.PS..SRPYIS------------------------------AVCA.NT.-
V5GBX6_BYSSN/4-246AGLTEEG..ARSLLEHFD.EA..VA...LP.GP..NRPYIS------------------------------AISH.SA.-
G2QWR8_THITE/16-254PLLSHEE..TAVKLAEFQ.ES..TG...IP.PA..NRAYVS------------------------------AVSS.SG.-
M3CY75_SPHMS/5-242TGTTQED..AKLALSAFH.EE..KG...IP.LS..NQAYIS------------------------------AVSV.MA.-
M2RQ22_COCSN/4-241TNISEDA..AKDAIAAFH.EE..QK...IP.TL..AQAYIS------------------------------AVST.MA.-
B8LZ55_TALSN/27-260.GVQESE..AARLVENFN.SA..KG...LP.VV..SSIYLS------------------------------CMNR.NN.-
S3D9A7_GLAL2/4-237ARHINDD..PDIEITSLN.EK..LN...LK.HG..RKLYIS------------------------------SIGP.ST.-
G7XN60_ASPKW/8-244SGISEAE..AGRLIDEYS.SK..KA...TP.PS..SKPYIS------------------------------AVSA.NG.-
M2T1K1_COCSN/8-240EGAA.....SASLLSNFN.DE..IS...MP.SI..NKPYIS------------------------------AYAP.SG.-
E9DR08_METAQ/20-259.RPKELNESVESLLKELD.TS..VT...HR.EQ..ARLYIS------------------------------VTTPDHP.-
S3CWG8_GLAL2/8-245PGLGTSE..AASLIKDFS.ES..KN...IP.KT..SQPWIG------------------------------ATAG.KS.-
F2PW05_TRIEC/6-242AGLLKEA..AEALISRHF.EE..TG...IS.PS..ARLYVS------------------------------AVAS.GS.-
H1VJ39_COLHI/10-255TGSSRKI..LADALLQYA.AD..TG...LP.VI..TTPYIS------------------------------AIIGTTQ.-
U1GE50_ENDPU/4-243AA.DVKA..VEAALSEFH.EE..NG...IC.TS..NRLWIS------------------------------AASA.TA.-
A1C888_ASPCL/9-246SDLNEED..AINRIAQFH.EK..RG...IN.PS..SRPYIS------------------------------AVGS.KG.-
R0KB98_SETT2/8-242GGTDS....ATEAVNKFL.QE..TD...LP.LT..DRPYIS------------------------------AVAP.SG.-
E4V2N2_ARTGP/10-256TEMTQAS..VQDELNQFN.TD..TH...SP.EL..TKVFIS------------------------------AADK.TS.-
L8G4G9_PSED2/24-270HNVDPAA..AYQELDDMH.SR..MK...TP.NT..GKIFIS------------------------------AVSR.TS.-
M2ZZX0_PSEFD/5-242TGIDGAS..AKKALDAFH.KE..KG...IP.QS..NQAYVS------------------------------AVSV.MA.-
Q2GV63_CHAGB/785-1022VGLATDH..VQDILDKFH.ES..QN...IP.KF..RRITIG------------------------------VVA....Q-
B8N7H8_ASPFN/9-246LGIPAKE..LGKTLEQFQ.NV..MG...VP.SP..KRAKVG------------------------------VNE....D-
Q2UA48_ASPOR/8-244SGISEKD..ASQLIGEFT.AE..RA...IP.PS..SKPYIS------------------------------AVGY.NS.-
N4VBL7_COLOR/10-255TGCCLTA..LADTLLWHA.SD..NG...LP.AI..KAPYIS------------------------------AVVGPTQ.-
B2B495_PODAN/8-245PGLKEDD..ATAALESFH.RE..NG...IP.QA..SRAYVS------------------------------AASA.SS.-
A0A0C4E4Q7_MAGP6/8-245PGLTEEA..AEAEISEFH.RS..QG...IS.PA..SRAWVS------------------------------ATST.AN.-
R7YU14_CONA1/7-242AAPDEHM..VSAAIEDYA.CA..KC...LS.RS..SRPYIS------------------------------AVST.SS.-
R0KD65_SETT2/13-258LGVSTSN..LQGYLDAFH.NT..QK...TS.PH..RRVKIG------------------------------ASG..VDD-
V5G4B2_BYSSN/8-244SGISEQK..SDALIHEFC.QK..KF...LA.PS..SRPYVS------------------------------AVNT.HS.-
H1VY29_COLHI/8-245PGLKESD..AKEALTNFH.ES..NY...IP.IA..SQAYVS------------------------------AVSA.SS.-
L8GBJ0_PSED2/42-283.LIAQGDISVEKMVQEYT.NI..KT...PL.HN..AALWIS------------------------------AITP.KT.-
B6QC69_PENMQ/7-243LGVPARE..MDVILKEFH.AS..MN...VP.TH..RQVFIG------------------------------VED....E-
G3JFQ9_CORMM/16-246....SRDKLVDKLIEKFT.ED..NK...PY.HSKLSNLYIS------------------------------ATTP.FT.-
F9XMW3_ZYMTI/5-242SGPSEVD..VKDALTSFH.EA..SG...IP.RS..NQAYVS------------------------------AVST.MA.-
G9MXY7_HYPVG/19-259SQFPLEL..AEKTIASYT.DK..AN...IP.RL..SSPYVS------------------------------AKGQ.NS.-
G0RW83_HYPJQ/19-262SQIPLAF..AEKAISSYN.DE..SN...IP.PL..SSPYIS------------------------------AKGQ.NS.-
C5G0R3_ARTOC/8-243SCDSIDN..IESILCQFS.RD..NN...LP.VT..SRPWIS------------------------------AYGEESW.-
K1WM58_MARBU/4-242VGITRDD..AEIALAEFN.RA..HG...LS.KS..KCLYTS------------------------------AVGS.MS.-
G9NQM0_HYPAI/19-259SQYPLAL..AEKAIAAYK.DS..SM...IP.PL..SSPYVS------------------------------AKGQ.NS.-
A2QH36_ASPNC/29-262.GVSETE..ATSAIQGFN.AE..KG...LP.PV..YRLYLS------------------------------SVSR.TN.-
STCA_EMENI/11-251H.VPPEE..VAIAIDRFS.HK..KVRSPVY.RA..QRPWIT------------------------------ATSA.KT.-
Q8EYQ4_LEPIN/19-271IGYSQKE..LEDRVKQTN.DSLGLS......GS..KAIYVS------------------------------LYNTPDS.-
C7ZNQ1_NECH7/8-238PGSK.....SAAAVEKFC.EE..SN...LP.LT..SRPYIS------------------------------AYAP.NG.-
M2N8F6_BAUCO/8-232FGVDEPA..AAAALEKFS.RE....................------------------------------.....KA.-
G7Y059_ASPKW/7-243KRASAGE..LERVIASFN.EE..QE...LP.EH..KRAYIS------------------------------AELD.TS.-
E4V6P4_ARTGP/8-243SCDSTDK..IQERLSKFS.RE..NN...LP.VT..SRPWIS------------------------------AYGEENW.-
U1GYJ0_ENDPU/26-259.SASEAQ..AAELLQSFN.SK..NT...LS.GS..SRLFLS------------------------------AVSP.NS.-
H6BVA1_EXODN/5-241AA.DEKS..AQEALDAFH.KE..KG...TS.PI..NQLWIS------------------------------ASSA.TS.-
E3R122_COLGM/12-243SGIG.....ISEIINEFC.HE..TS...LS.AA..SRPYIS------------------------------AYME.KS.-
G2WRK7_VERDV/8-245VDVTEAD..VNKALQSFH.SS..HS...VP.PP..SQAYIS------------------------------AVST.HR.-
G0SDA9_CHATD/19-258PGQEEKA..LAERLTAAQ.DQ..HN...IP.GA..NRAYIS------------------------------AVSA.NS.-
B6QHV7_PENMQ/4-241TGVDLQA..VASAIHAFN.RT..QR...LQ.NA..NKLYVS------------------------------AVAS.NS.-
Q2UG06_ASPOR/8-245WGLDPQQ..ARDQIEVFC.QT..TN...VP.QT..RRPWIS------------------------------CISK.NA.-
C5FQT2_ARTOC/8-245PKLQVDL..AASRIEQFS.QS..AN...LP.IG..FRPFIG------------------------------IVAP.CS.-
E9D5J9_COCPS/7-242.GVSLEE..AQGVVATFN.QS..KD...LS.AA..KGLYCG------------------------------ATSA.WA.-
N1PC72_DOTSN/5-242TGTTESA..ARESLAAFH.TE..RG...IA.QS..NQAYIS------------------------------AVST.MA.-
E3R0Q2_COLGM/12-250VGVALED..LSKSLEEFQ.QS..VG...IP.PL..KRAKPG------------------------------VTG....A-
R8BTJ4_TOGMI/8-245PGVKQDQ..ARLILDEFH.HA..NG...TP.LA..ARAYVS------------------------------AVSA.SN.-
G4MU27_MAGO7/14-251PGFTEEA..AQKEIAGFH.ES..HG...IP.QA..SQVYVS------------------------------ASSS.AN.-
R7YTG2_CONA1/4-241TGISEQS..ANAALADFH.SE..KG...IP.IS..QQAYVS------------------------------AVST.MA.-
U7PRD0_SPOS1/5-267ITADRAA..IDAALADFN.QT........RVLAADRRVYIS------------------------------SASS.TLS-
E5A495_LEPMJ/4-241TGVSEDV..AKDALASFH.EQ..RR...IP.PA..AQAYIS------------------------------AVST.MA.-
B8NVD5_ASPFN/5-241TDGSESE..TEKILEEFT.RD..EG...LP.AI..MKPYVS------------------------------AAGS.NT.-
B8MV60_TALSN/15-255VNVPPKQ..IRNIITAFN.ED..MA...IP.KH..RQFYIS------------------------------FLA....K-
E9FC93_METRA/16-256LPTTSAT..VEELLASFT.KS..AT...VLEDY..EAIWVT------------------------------ARTPTEV.-
G9NBV5_HYPVG/10-247VGITREK..MKSILDEFH.SS..NN...IP.PI..RQISIG------------------------------VVS....E-
R1G9D8_BOTPV/4-241AGISEES..AKTALADFH.QE..KG...IA.LS..NQAWVS------------------------------AVSV.MA.-
S3CAW2_OPHP1/8-244PNQTEEK..VSNVLSDFN.KS..NG...IP.AA..SSAYIS------------------------------AVSS.SN.-
B2B664_PODAN/7-242SQVDISA..AREAIGIFN.RN..........SIPRHQVYIS------------------------------AESP.NS.-
M1WG96_CLAP2/23-272QIADSDA..AQAELDLLYGNA..ES...SA.NS..NKIIIS------------------------------AVSQ.TS.-
E9F5C9_METRA/8-246.GTDLKS..AQSVVDGFN.RS..KD...LS.QS..EGLYVG------------------------------VTSA.WA.-
A0A098D9G9_GIBZA/4-241AVLPRES..AQDRLDSFI.IE..MG...LA.RS..SVPYIS------------------------------SVAH.HN.-
G2YLD0_BOTF4/4-242MGISSEA..AEHALAEFN.ES..RG...LV.QS..TRLYIS------------------------------AIGT.SS.-
B2W1Q0_PYRTR/9-246LGISAAE..LGETLEQFQ.SS..MG...IP.SS..KRAKVG------------------------------VLG....D-
C7Z6X3_NECH7/7-240.PGEEKE..IQEKLDRWG.AS..GN...LH.DL..WRPYIS------------------------------ATAP.NN.-
E3QS53_COLGM/10-256ASSSPKA..LADALKQYA.AE..TR...LP.IV..SVPYIS------------------------------AIVGPTQ.-
G9NGU8_HYPAI/9-247VSVDPQE..IENIINAFN.DD..MA...IP.QH..RHIYIS------------------------------TLA....H-
B8MYS6_ASPFN/10-247PGLDGDT..ASLTLQKYN.EE..KG...LP.AT..SAPYIS------------------------------TYAN.TG.-
G2RCG6_THITE/8-247PNSGGED..PGPVIGRYN.EE..KG...LP.AT..SAAYIS------------------------------SYAN.TS.-
S0DTP6_GIBF5/8-239PGQK.....AAKAFQEFW.DA..ND...GGVLT..SMPYIS------------------------------AYAP.NG.-
G2QMK9_THIHA/8-254SGIDGAT..AASLVDQFC.RS..RS...LA.PA..ARVYVS------------------------------AVGN.GN.-
F0XGQ5_GROCL/8-244PSQKEEE..TRKVLSEFC.HG..KS...LP.QA..SQIYIS------------------------------AVSA.SS.-
T0KJR9_COLGC/11-253VGITPEK..LDGILHQIQ.ES..SK...VP.SL..KRARVG------------------------------IRG....D-
M2RHZ9_COCSN/9-246KDIVAQ...LPDILNQFH.RE..QS......IPRHRRAWIA------------------------------VST....P-
R0JX83_SETT2/4-242.PVPFEK..LQEELQTVQ.DD..AN...LS.VA..GRAFIT------------------------------TVGI.ST.-
L8G0G7_PSED2/41-278PGLNESA..ARSLLADFN.ES..KG...YT.TT..SQAYIS------------------------------AITS.TS.-
Q2HGW2_CHAGB/17-254SVSSVED..VTQTLDAFH.DT..SN...LP.PA..SRAYIS------------------------------AVSD.NG.-
B8MF01_TALSN/8-245PGLKEDP..AIAVLEKFS.SE..MG...IP.VA..SRPYIS------------------------------ASSH.SG.-
N4VM62_COLOR/16-257IGMTRVD..LQSHLDSFH.QQ..HH...IQ.AH..RRAKIG------------------------------VSD..VDD-
S3DAZ0_GLAL2/11-247.SADEAQ..AASKLDEFH.AE..KA...IS.HA..SRAYIS------------------------------ATTP.DS.-
E3SAD1_PYRTT/8-240ESAA.....SAQLIHEFN.EK..SS...MP.SI..SKPYIS------------------------------AYAP.GA.-
U7PK37_SPOS1/8-244PNQQEED..IRRVLSEFC.RS..NS...IP.PA..ATGYIS------------------------------AVSS.GN.-
B2B6C8_PODAN/41-279SGLMPQV..AEAFVKEFC.DG..NA...LP.KT..RYPWIT------------------------------ATAA.KS.-
V5G236_BYSSN/6-248SRDKNAV..DDEVLKRIQ.ED..LV......STVDTKVYIS------------------------------GEFP.KT.-
M2NM35_BAUCO/5-243TGTTEQA..AKEALAAFH.QE..KG...IP.QS..NQAYVS------------------------------AVSV.MA.-
B6QAB8_PENMQ/31-263.GIHESE..AAQLVTTFN.AG..KR...LP.PV..SAIYLS------------------------------CITH.SN.-
M2XHZ5_DOTSN/10-247FDTDEQT..VTKAIKDFC.TS..NV...LP.KT..KQPWIT------------------------------SASS.KT.-
R7YHB3_CONA1/8-244PGIDKEA..AFMAHEDFC.TT..HG...IP.PA..SGLFVS------------------------------ATSS.NA.-

PF01735

PLB2_SCHPO/134-617DDSNGWPD.GSSIVTTYERIITYNANKSV.DVRGFPYIPDEDTIIS.LGLNTHPTFFGCDGRNTTAGNHTVDNNTPPLLV
PLB5_SCHPO/125-607SATSGWPD.GSSLVSTYERVLA...TNSS.GVRGFPYIPDTNTFLA.LGLNTHPTFFGCDGRNTTAGNHTVNDDTPPLVV
PLB1_YEAST/99-586DTDDYWPD.GASLVNTYQRQFG....SQG.LNLSFPYVPDVNTFVN.LGLNKKPTFFGCDARNLTDL.....EYIPPLIV
PA24A_CHICK/190-675SVEEDELDAAVADPDEFERIYE...PLDV.KSKKIHIVDSGLTFNLPYPLILRP.QRGVDLIISFDFSARPSDSSPPFKE
PLB_NEUCR/121-606DVTN.WPN.GTALRATYERTFG....SIS.NGTLFPSIPDDWTFIN.LGLNNRPSFFGCDVKNFTLN...ANQKVPPLIV
PLB_KLULA/102-589DTDQSWPD.GFSLTQTYARQFG....LQG.KGIAFPYVPDVNTFTN.LGLNTRPTFFGCDARNLTDL.....ESIPPLVV
PLB6_SCHPO/114-600DTSNFWPN.GSSLVATYERVTQR.ASDAVYDVEDFVHVPTPETFVN.LGLNANPTFFGCDGRNTTRGDVPVDHNTPPLVV
PA24A_DANRE/185-664SLEE.EVD.AVTDPDEFERIYE...PLDV.KSKKIHVVDSGLTFNLPYPLILRC.QRGVDLIISFDFSARPSDSSPPFKE
PLB1_CANAL/88-565DVLN.WPD.GTSLVKTYERQFS....SQG.NGIAFPYVPDQYTFRN.LNLTSKPTFFGCDAKNLTSL..TKDIYDVPLVI
PLB3_YEAST/105-592DMRLAWPD.GSSLVHTYERQFV....KQG.QGMSFPYVPDTNTFVN.LGLNKKPTFFGCDANNLTDL.....QYIPPLVV
PLB1_SCHPO/114-593DSEWLWPN.GNSLVQTYERVVAAQAAGNT.NVKGFPYVPSQQSFVS.LHFNDRPVFFGCDGRNTTAGNHTVTRDTPPLVI
PLB2_YEAST/101-588NTDESWPS.GVCMTNTYERQYS....KQG.KGMAFPYVPDVNTFLN.LGLTNKPTFFGCDAKNLTDL.....EYIPPLVV
B6HB59_PENCW/114-597DTDYFWPN.GTSLVATYERSLN..SSGIA.NGTAFPAVPDQNTFIN.LGLSTRPSFFGCDSSNQTGP........SPLVV
G8ZY27_TORDC/97-584DTDYYWPD.GASLVSTYERQFS....SQG.MNMSFPYVPDKRTFVN.LGLADKPSFFGCDAQNLTDL.....NYIPPLVV
Q59W34_CANAL/88-564DKNN.WPD.GSALIKTFERQFS....SQG.DGIAFPYVPDQNTFRN.LNLTSKPTFFGCDAQNLTSL..TENIYDVPVVI

PF01734

Q9N5Z7_CAEEL/97-269------------------------------C..YHPMYSSG...............................LNGKAPIL
Q8F079_LEPIN/12-165------------------------------.....PMFL.........................................
B8GC44_CHLAD/8-228------------------------------A..AIPIFY....................................RPVRI
C1DSE3_AZOVD/14-206------------------------------A..CLPTFH....................................HTVEI
A9BEP0_PETMO/3-174------------------------------L..AFPPYY....................................SYYEY
A9B328_HERA2/4-179------------------------------A..AVPPYL....................................PAYHY
B2U808_RALPJ/9-214------------------------------A..STPPFT....................................PVLRR
Q3AAC7_CARHZ/6-206------------------------------S..AVPGIF....................................TPVKF
A6CHF0_9BACI/8-175------------------------------S..SLPFVA....................................PIVEF
Q2GUC2_CHAGB/19-224------------------------------A..AAPMYF....................................KSVKF
Q9XAG3_STRCO/16-207------------------------------C..ALPPLF....................................PPISI
Q2JEY3_FRASC/11-221------------------------------C..AIPGWY....................................APVTV
Q8R6F6_FUSNN/65-256------------------------------M..SIPSIF....................................EPMKI
Q9ZCV7_RICPR/15-214------------------------------T..AAPGYF.....................................PSHH
Q038G8_LACC3/6-159------------------------------S..AMPGVF....................................SPVER
D5T6X7_LEGP2/25-249------------------------------A..SIPVIL....................................KPVTI
Q4UJC7_RICFE/42-240------------------------------T..AAPTYF....................................KPVTN
Q54HM9_DICDI/140-357------------------------------S..AAPIYF....................................KPVEI
Q2K9E1_RHIEC/30-248------------------------------A..AFPPVLSPLRLDL.....................SKFPWKREKLDDT
A4IAC8_LEIIN/190-378------------------------------C..PTAAVH....................................PASSS
Q21S96_RHOFT/26-231------------------------------S..CVPPLT....................................PQARR
A5GF97_GEOUR/15-187------------------------------T..GVPWVY....................................AYRQF
Q1CW69_MYXXD/353-514------------------------------G..SAPGIW....................................GPTVV
A6NV66_9FIRM/7-176------------------------------C..ALPFLF....................................PVYHI
I6YB49_MYCTU/181-420------------------------------S..AIPGVLHHETSDP.....................RMLPILDELCADQ
A0YM74_LYNSP/12-230------------------------------V..AIPLAF....................................PCRSV
A0A0C9NUJ5_LEGPN/27-309------------------------------A..SLPGVF....................................DPVIY
Q2GS92_CHAGB/73-327------------------------------KAITTPSRYS..................................FKPFKL
Q1ZT25_PHOAS/33-203------------------------------C..AIPVLY...................................NLPVNM
Q5CY77_CRYPI/46-241------------------------------G..TIPGIF....................................PIKYL
PATA2_SOLTU/32-227------------------------------A..AAPTYF....................................PPHYF
A6G7S9_9DELT/458-735------------------------------S..IMPLFM....................................EPMEM
A0A0E1WDL8_BURPE/13-264------------------------------A..SFPFAFEPSL...........................VGTDGKPSSL
A4F8K0_SACEN/17-281------------------------------S..SFPFAF....................................EPSRV
Q2R2X0_ORYSJ/139-303------------------------------S..FIPGYLA.................................PRPATFF
Q0A7T0_ALKEH/6-219------------------------------S..ALPFIF....................................PARRV
Q3Y1A6_ENTFC/138-323------------------------------A..SFYPAM....................................AYRKI
M6BTQ1_LEPBO/13-188------------------------------T..SLPIAT...................................RGKHKV
YL620_MIMIV/38-270------------------------------S..AFPFVFPSSKFYY......................NSTTQKYQYESL
Q0FZD9_9RHIZ/20-226------------------------------A..VIPPVF....................................NVEGW
Q5A7P0_CANAL/211-417------------------------------C..SVPGIFPSCS............................VYEKNPKTN
Q11UC9_CYTH3/381-624------------------------------A..TFPYIT....................................PNVDL
A6ASA3_VIBCY/5-186------------------------------S..AAPTFF....................................PAFTR
Q1D826_MYXXD/142-382------------------------------S..ALPGVIHYDVL..........................REDPGMHTLV
A4HB10_LEIBR/40-220------------------------------C.CLVPLVG....................................LPFKM
Q0RZB6_RHOJR/7-221------------------------------A..AVPALF....................................RPIHI
A3QTZ2_9VIRU/28-255------------------------------M..TLPGIF...................................KPLSDG
Q1D5W1_MYXXD/154-432------------------------------G..AFPLAF....................................PPVPV
Q09D74_STIAD/17-214------------------------------S..AFPVLM....................................PIYRS
A4BNM2_9GAMM/38-218------------------------------M..SLPGIL...................................APRPAL
Q4LA62_STAHJ/11-202------------------------------G..SLPGVW....................................PATTI
Q5ZPA4_9DELT/22-208------------------------------S..SLPIV.....................................SPVHQ
Q6A6E2_PROAC/25-319------------------------------C..SIPGVF....................................RPVDL
NTE1_PICST/1239-1403------------------------------M..SLAGLL....................................PPIAF
A4SJS7_AERS4/8-174------------------------------C..SVPLVY...................................RDFVRI
Q1I961_PSEE4/42-302------------------------------M..SIPYFFHPLKVGNIPS...............DQAAEARWQAWAGYHT
A7RB12_PBCVA/19-192------------------------------C..SIPVYF....................................SAIKH
Q0VPN6_ALCBS/36-193------------------------------C..AVPLLF....................................QPARI
A6G1N7_9DELT/36-362------------------------------VADELPILD....................................DMRQY
A6QA07_SULNB/41-281------------------------------S..AFPGAF....................................QQVKL
Q5WWS2_LEGPL/304-496------------------------------A..SFPVLY....................................RDTLL
A0Z6H0_9GAMM/8-199------------------------------S..AAPTFF....................................EPAQL
A6LMU7_THEM4/5-176------------------------------S..SVPGVF....................................SPLWI
A7I0A5_CAMHC/6-211------------------------------A..SFAFGF.........................................
Q2YJ28_BRUA2/13-187------------------------------C..AIPPVF....................................APVRR
A6G3Y0_9DELT/12-216------------------------------S..TIPPFT....................................RIQRE
A1DP95_NEOFI/20-225------------------------------L..ASLAGY....................................KPVTI
A5K2I7_PLAVS/1168-1482------------------------------T..AAPGFF....................................NFFSF
TEG_BACME/7-180------------------------------S..AAPATQ....................................RAYQN
Q2W5X1_MAGSA/6-225------------------------------ATLAYPFIY....................................PPAEV
A4U0C8_9PROT/5-257------------------------------S..ALPYIE....................................EPVIM
A5N2W9_CLOK5/4-191------------------------------A..NFPIFR.....................................IEPL
A4JJZ7_BURVG/8-242------------------------------A..AIPAIY....................................AAKTV
A6R0J1_AJECN/673-891------------------------------S..AAPSIF....................................PPAYI
Q6MR93_BDEBA/72-224------------------------------M..AYPPFF....................................KPHQN
A5P920_9SPHN/106-312------------------------------S..AMPVFH....................................QQLRV
Q2C291_9GAMM/11-214------------------------------G..AMPPGF....................................PPVEI
A7BB55_9ACTO/26-199------------------------------S..TLPILM....................................PPVDI
A5I1W5_CLOBH/6-200------------------------------I..SIPFFF....................................TPVKL
A8GLS3_RICAH/7-147------------------------------V.LNFQKLY.........................................
A4T0K7_POLSQ/80-285------------------------------S..SLPGVA....................................GPTLL
A6DDL8_9PROT/5-162------------------------------C..AIYPFF....................................EPIVY
A4CKZ2_ROBBH/4-195------------------------------C..NYIPFM....................................SLVRK
Q18D71_PEPD6/5-179------------------------------LLPSNPNATL.................................GFKEQFV
Q7CIX4_YERPE/86-275------------------------------S..SVPVAF....................................SPVFF
M6C3B5_LEPBO/36-250------------------------------S..SVPPVV....................................SVQSH
Q12EZ0_POLSJ/6-228------------------------------A..AFPGLIGPYVLQ.......................ADSFDWDLPMYA
Q1GX66_SPHAL/43-328------------------------------A..SFPGAFPPFTLREIDRVLE..........KRGLDWPGRDAFVRAQLP
Q4RS54_TETNG/14-183------------------------------A..FIPVYCG..................................IIPPTL
Q5C8M6_LEGPN/32-295------------------------------G..AHPVLF...................................VPGRNA
Q6JBI3_DICVI/201-395------------------------------A..AAPLYF....................................EEVKL
Q0FKF7_PELBH/6-360------------------------------L..SFPGLIQ..................................AVPLWR
Q8Z7F2_SALTI/8-168------------------------------C..SMPGLM....................................SPVEH
Q6ASS6_ORYSJ/60-258------------------------------C..AAGSTA...................................AAVRSV
A6QX75_AJECN/242-440------------------------------N..VSSATS....................................SRVTL
Q74A07_GEOSL/58-306------------------------------S..NFPVAFAPLTLTIHKEPCGPLPEWIGLGLDRESNPKRRVADAEAGRS
Q54XY1_DICDI/13-231------------------------------S..SIPAAF....................................QKHKQ
Q55G69_DICDI/65-250------------------------------A..GIPGLF....................................HLYEN
Q5Z158_NOCFA/22-193------------------------------A..NLPILA...................................GGPILL
Q54QX6_DICDI/893-1088------------------------------S..AAPTFF....................................SKFEF
A0A0D5GHL8_BURML/413-612------------------------------G..SLPPGM....................................PWTVV
A2QZY6_ASPNC/473-679------------------------------L..AHSGGYYRV..............................YTAPDPEH
A4XTW9_PSEMY/15-385------------------------------L..SFPLLLSA...............................MPLHAVDY
Q0E508_SFAVA/27-224------------------------------CSLAVPVRV.........................................
A6GI17_9DELT/71-215------------------------------LLIVLPTIM....................................IAVFL
A7IE20_XANP2/6-198------------------------------M..AMPLQYP.................................IYQSGAQ
Q1DCU7_MYXXD/197-406------------------------------I..VEPVLA....................................DPVPW
Q6MAN6_PARUW/474-738------------------------------M..SIPIVFSPHT...........................LCKKVNGMRI
Q4Z1R8_PLABA/352-558------------------------------A..SAPTYL...................................KGPNED
A4RTL4_OSTLU/164-398------------------------------A..RVPALAG..................................SSPVTH
A0JUC4_ARTS2/74-249------------------------------G.MSLPIFL....................................TPLRR

PF00698

FAS_HUMAN/493-810------------------------------.......--------------------------------------PSCTI
STCK_EMENI/1547-1902------------------------------HLRVSDI--------------------------------------KPEEL
FAS_CHICK/492-809------------------------------.......--------------------------------------PTCTI
FAS1_YEAST/1663-2037------------------------------NIIKENV--------------------------------------KVARL
A4F7N8_SACEN/109-425------------------------------....AEG--------------------------------------SSAAV
A4F7P0_SACEN/560-880------------------------------...ADGA--------------------------------------EDAVV
I6Y231_MYCTU/534-851------------------------------....LDM--------------------------------------SVAAL
PPSA_MYCTU/632-950------------------------------...AQPG--------------------------------------ARYTS

PF16073

E9F646_METRA/19-261------------------------------..WTVSG--------------------------------------PPAIV
E9F8F0_METRA/9-244------------------------------..LTLFG--------------------------------------PPTTL
B8MGX9_TALSN/8-250------------------------------..VTIQG--------------------------------------PPSTL
B6HLN4_PENCW/17-255------------------------------GWNTVIG--------------------------------------PPSVI
E9D6Y9_COCPS/8-245------------------------------..ITISG--------------------------------------PPSVL
K1X7W5_MARBU/800-1037------------------------------..IAVSG--------------------------------------PPASL
L8G6V9_PSED2/30-264------------------------------..VTISG--------------------------------------PPSIL
B6QFH1_PENMQ/10-246------------------------------..LTISA--------------------------------------PPPVL
B6QER4_PENMQ/12-248------------------------------..STVVG--------------------------------------PPPVL
A7F3E3_SCLS1/4-241------------------------------..IAISG--------------------------------------PPSTL
N1RV88_FUSC4/8-242------------------------------..TTISG--------------------------------------PPSIL
S3EB79_GLAL2/16-254------------------------------GWSTIIG--------------------------------------PPSVL
G4UHA1_NEUT9/13-252------------------------------..VAISG--------------------------------------PPSSL
B6HKK0_PENCW/8-244------------------------------..LTISG--------------------------------------PPTFL
E9F7M7_METRA/10-244------------------------------GWCDISG--------------------------------------PPEVL
WA_EMENI/8-244------------------------------..LTISG--------------------------------------PPVVL
V5GBX6_BYSSN/4-246------------------------------..VSLSG--------------------------------------PPSTL
G2QWR8_THITE/16-254------------------------------..IAVSG--------------------------------------PPVTL
M3CY75_SPHMS/5-242------------------------------..ITISG--------------------------------------PPTTL
M2RQ22_COCSN/4-241------------------------------..LTISG--------------------------------------PPATT
B8LZ55_TALSN/27-260------------------------------..TSVCG--------------------------------------PPELL
S3D9A7_GLAL2/4-237------------------------------..ITISG--------------------------------------PPSSL
G7XN60_ASPKW/8-244------------------------------..VTVSA--------------------------------------PPTVL
M2T1K1_COCSN/8-240------------------------------..VTVSG--------------------------------------PPDSI
E9DR08_METAQ/20-259------------------------------..TTISG--------------------------------------PPSSL
S3CWG8_GLAL2/8-245------------------------------..TTISA--------------------------------------PPSIL
F2PW05_TRIEC/6-242------------------------------..VSLSG--------------------------------------PLPTL
H1VJ39_COLHI/10-255------------------------------..ATISG--------------------------------------PPMVL
U1GE50_ENDPU/4-243------------------------------..VTVSG--------------------------------------PPSIK
A1C888_ASPCL/9-246------------------------------..LTISA--------------------------------------PPEIL
R0KB98_SETT2/8-242------------------------------..ITVSG--------------------------------------PPNAL
E4V2N2_ARTGP/10-256------------------------------..VSVSG--------------------------------------PPSRV
L8G4G9_PSED2/24-270------------------------------..VTVSG--------------------------------------PPSRL
M2ZZX0_PSEFD/5-242------------------------------..ITVSG--------------------------------------PPTTL
Q2GV63_CHAGB/785-1022------------------------------GWLTLIG--------------------------------------PPSSM
B8N7H8_ASPFN/9-246------------------------------RWSTVIG--------------------------------------PPSSL
Q2UA48_ASPOR/8-244------------------------------..ITISA--------------------------------------PPKVL
N4VBL7_COLOR/10-255------------------------------..ATVSG--------------------------------------PPDVL
B2B495_PODAN/8-245------------------------------..LAISG--------------------------------------PPTTL
A0A0C4E4Q7_MAGP6/8-245------------------------------..CAISG--------------------------------------PPSTL
R7YU14_CONA1/7-242------------------------------..LAISG--------------------------------------PPRVL
R0KD65_SETT2/13-258------------------------------GWHTIIG--------------------------------------PPSML
V5G4B2_BYSSN/8-244------------------------------..LTISA--------------------------------------PPLIL
H1VY29_COLHI/8-245------------------------------..LAISG--------------------------------------PPATL
L8GBJ0_PSED2/42-283------------------------------..TTLSG--------------------------------------RPSVL
B6QC69_PENMQ/7-243------------------------------SWLTLFG--------------------------------------PPPEL
G3JFQ9_CORMM/16-246------------------------------..ATVSG--------------------------------------PPDVL
F9XMW3_ZYMTI/5-242------------------------------..LTVSG--------------------------------------PPITV
G9MXY7_HYPVG/19-259------------------------------..WTISG--------------------------------------PPTTV
G0RW83_HYPJQ/19-262------------------------------..WTLSG--------------------------------------PPAVV
C5G0R3_ARTOC/8-243------------------------------..VSISA--------------------------------------PASVL
K1WM58_MARBU/4-242------------------------------..VTISG--------------------------------------PPSVR
G9NQM0_HYPAI/19-259------------------------------..WTVSG--------------------------------------PPETV
A2QH36_ASPNC/29-262------------------------------..VSISG--------------------------------------PPHLL
STCA_EMENI/11-251------------------------------..TTVSA--------------------------------------SPDIL
Q8EYQ4_LEPIN/19-271------------------------------..NIVSG--------------------------------------NPESL
C7ZNQ1_NECH7/8-238------------------------------..ITVSG--------------------------------------PPKTL
M2N8F6_BAUCO/8-232------------------------------..LTISG--------------------------------------PPSTL
G7Y059_ASPKW/7-243------------------------------..VTISG--------------------------------------PPSTL
E4V6P4_ARTGP/8-243------------------------------..VSISA--------------------------------------PASTL
U1GYJ0_ENDPU/26-259------------------------------..ITISG--------------------------------------PPSIL
H6BVA1_EXODN/5-241------------------------------..VTISG--------------------------------------PPSTK
E3R122_COLGM/12-243------------------------------..MTLSG--------------------------------------PPPVL
G2WRK7_VERDV/8-245------------------------------..LAVSG--------------------------------------PPTTL
G0SDA9_CHATD/19-258------------------------------..IAVSG--------------------------------------PPLTL
B6QHV7_PENMQ/4-241------------------------------..TAVSG--------------------------------------PPSVH
Q2UG06_ASPOR/8-245------------------------------..ITLSG--------------------------------------SPSTL
C5FQT2_ARTOC/8-245------------------------------..VTICG--------------------------------------PPRVL
E9D5J9_COCPS/7-242------------------------------..TTIIG--------------------------------------PPRLL
N1PC72_DOTSN/5-242------------------------------..LTISG--------------------------------------PPTTV
E3R0Q2_COLGM/12-250------------------------------GWSTIIG--------------------------------------PPSVL
R8BTJ4_TOGMI/8-245------------------------------..VAVSG--------------------------------------PPATL
G4MU27_MAGO7/14-251------------------------------..VAISG--------------------------------------PPTTL
R7YTG2_CONA1/4-241------------------------------..LTISG--------------------------------------PPSTT
U7PRD0_SPOS1/5-267------------------------------SVITLSG--------------------------------------PPSTT
E5A495_LEPMJ/4-241------------------------------..ITISG--------------------------------------PPSTT
B8NVD5_ASPFN/5-241------------------------------..LTISG--------------------------------------TPRVL
B8MV60_TALSN/15-255------------------------------GWAAISG--------------------------------------PPSIF
E9FC93_METRA/16-256------------------------------..TTLGG--------------------------------------RPLVL
G9NBV5_HYPVG/10-247------------------------------KWTTIIG--------------------------------------APSSL
R1G9D8_BOTPV/4-241------------------------------..ITISG--------------------------------------PPATT
S3CAW2_OPHP1/8-244------------------------------..VAVSG--------------------------------------PPSTL
B2B664_PODAN/7-242------------------------------..VTISG--------------------------------------PPSAT
M1WG96_CLAP2/23-272------------------------------..IVASG--------------------------------------PPSRL
E9F5C9_METRA/8-246------------------------------..TTIIG--------------------------------------SPRLH
A0A098D9G9_GIBZA/4-241------------------------------..MTISG--------------------------------------PPSVL
G2YLD0_BOTF4/4-242------------------------------..VTISG--------------------------------------TPTLR
B2W1Q0_PYRTR/9-246------------------------------RWSTIIG--------------------------------------PPSVI
C7Z6X3_NECH7/7-240------------------------------..ITLSG--------------------------------------PPRVL
E3QS53_COLGM/10-256------------------------------..TTISG--------------------------------------PPDIV
G9NGU8_HYPAI/9-247------------------------------RWAVISG--------------------------------------PPSLF
B8MYS6_ASPFN/10-247------------------------------..VTLSG--------------------------------------LPSAL
G2RCG6_THITE/8-247------------------------------..FTLSG--------------------------------------PPTSL
S0DTP6_GIBF5/8-239------------------------------..ITVSG--------------------------------------PPQRL
G2QMK9_THIHA/8-254------------------------------..VTVSG--------------------------------------PPAQL
F0XGQ5_GROCL/8-244------------------------------..VAVSG--------------------------------------PPPSL
T0KJR9_COLGC/11-253------------------------------HWGTVVG--------------------------------------PPSVL
M2RHZ9_COCSN/9-246------------------------------TWATVFG--------------------------------------PPSVL
R0JX83_SETT2/4-242------------------------------..CIISG--------------------------------------NPRRL
L8G0G7_PSED2/41-278------------------------------..IAFSG--------------------------------------PPPTL
Q2HGW2_CHAGB/17-254------------------------------..IVVSG--------------------------------------PPSTL
B8MF01_TALSN/8-245------------------------------..VTLSG--------------------------------------PPQTL
N4VM62_COLOR/16-257------------------------------GWHTVIG--------------------------------------PPSIL
S3DAZ0_GLAL2/11-247------------------------------..VAISG--------------------------------------PPSTL
E3SAD1_PYRTT/8-240------------------------------..VTVSG--------------------------------------PPTSL
U7PK37_SPOS1/8-244------------------------------..VAVSG--------------------------------------PPTTL
B2B6C8_PODAN/41-279------------------------------..TTITG--------------------------------------SPRVL
V5G236_BYSSN/6-248------------------------------..ITLQG--------------------------------------PPSTL
M2NM35_BAUCO/5-243------------------------------..ITISG--------------------------------------PPTTV
B6QAB8_PENMQ/31-263------------------------------..TSICG--------------------------------------PPELL
M2XHZ5_DOTSN/10-247------------------------------..ITISG--------------------------------------APRVL
R7YHB3_CONA1/8-244------------------------------..VTISG--------------------------------------PPHIL

PF01735

PLB2_SCHPO/134-617YFPNYPWVYYSNISTFTMSMNDTLSSGILEN.AALSATQNN...SDSFAVCL-ACAMIQRSLERKNMSTPSQCSSCFEQY
PLB5_SCHPO/125-607YFPNYPWTMYANVTTYTVQLEDTLSSGMIEN.AAVAATQNN...SDSFAVCV-ACALVQRSLERKNMSTPSQCASCFNQY
PLB1_YEAST/99-586YIPNSRHSFNGNQSTFKMSYSDSERLGMIKN.GFEAATMGNFTDDSDFLGCV-GCAIIRRKQQNLNATLPSECSQCFTNY
PA24A_CHICK/190-675ILLAEKWAKMNKLPFPKIDPNVFDREGLKECYVFKPKDTSSEKDCPTIIHFV-LANINFRKYKAPGLPRESKEEKDFADF
PLB_NEUCR/121-606YVPNAPYTALSNVSTFDPSYTMSQRNDIIGN.GWNSATQGNGTLDSEWPTCV-ACAVISRSLDRLGRQTPAACKTCFERY
PLB_KLULA/102-589YMPNTRESFNSNTSTFKMSYSTSERFKMIQN.GFEAVTMKNLTKDENFMGCI-SCAILRRKQESLNYTLPSECDACFEKY
PLB6_SCHPO/114-600YMPNTPWTMKSNLVDHRYRIANSEIQALIQN.GFVATTQDN...STDFASCL-ACAVVQRSLERRNQSTSAACQQCFSQY
PA24A_DANRE/185-664LLLAEKWARMNKLPFPKIDSKVFDREGLKECYVFKPAKGD..KNCPTIIHFV-LANINFRNFKAPGVPRDSDKDIEFGDF
PLB1_CANAL/88-565YLANRPFTYWSNTSTFKLTYDDNERQGMISN.GFEIATRSSGSLDDEWAACV-GCAIIRREQERQGIEQTEQCKRCFENY
PLB3_YEAST/105-592YLPNAEYSFNSNQSAFKL