Sequence alignment for CL0323

PF01735

PLB2_SCHPO/134-617LGLAFSGGGLRAM----VHGGGVLNAFDSRN-------------------------------------------------
PLB5_SCHPO/125-607LGIAISGGGFPAM----LTGAGAINAFDARN-------------------------------------------------
PLB1_PENCH/88-571IGIAVSGGGWRAL----MNGAGAVKAFDSRT-------------------------------------------------
PLB1_YEAST/99-586IAVACSGGGYRAM----LSGAGMLAAMDNRT-------------------------------------------------
PLB2_CANAX/87-564IGLAFSGGGYRAM----LAGAGELLALDSRA-------------------------------------------------
PA24A_CHICK/190-675IAVLGSGGGFRAM----VGFAGVMKALY...-------------------------------------------------
PLB1_TORDE/97-584IAVACSGGGYRAM----LSGAGMLAAMDNRT-------------------------------------------------
PLB_NEUCR/121-606VAIAISGGGYRAL----MNGAGFVAAADNRI-------------------------------------------------
PLB_KLULA/102-589VAIACSGGGYRAM----LSGAGMISAMDNRT-------------------------------------------------
PLB6_SCHPO/114-600LGIAVSGGGWRSM----LFGGGALAALDSRS-------------------------------------------------
PA24A_DANRE/185-664IAILGSGGGFRAM----VGFSGVMKALY...-------------------------------------------------
PLB1_CANAL/88-565IGLAFSGGGYRAM----LTGAGEISSLDSRT-------------------------------------------------
PLB3_YEAST/105-592IAVAVSGGGYRSM----LTGAGVLAAMDNRT-------------------------------------------------
PLB1_SCHPO/114-593IGIALSGGGLRAM----ILGSGALSAMDARH-------------------------------------------------
PLB2_YEAST/101-588IGIACSGGGYRAM----LGGAGMIAAMDNRT-------------------------------------------------

PF01734

Q9N5Z7_CAEEL/97-269--LSFGGCGFL.G....SYQFGAAKM....IF......................--------------------------
Q8F079_LEPIN/12-165--LTFNSAFFG.F....YAHAGFAKG....L.......................--------------------------
B8GC44_CHLAD/8-228--LVLAGGGVAGA....AYEIGALCAIDQVL.......................--------------------------
C1DSE3_AZOVD/14-206--LALQGGGAH.G....AFTWGVLDA...LL.......................--------------------------
A9BEP0_PETMO/3-174--LVMGGFFEG.F....YWESGVLES....I.......................--------------------------
A9B328_HERA2/4-179--IVFSGGANR.G....SLQAGAALA....L.......................--------------------------
B2U808_RALPJ/9-214--MVFAGGGNR.C....WWQAGWWDV....V.......................--------------------------
Q3AAC7_CARHZ/6-206--LALGGGFLR.G....AAHIGVLKV....L.......................--------------------------
A6CHF0_9BACI/8-175--LVLEGGGMR.G....VYTAGVLEF....F.......................--------------------------
Q2GUC2_CHAGB/19-224--LCIDGGGIK.G....YTALLILRRIFRTLSADM...................--------------------------
Q9XAG3_STRCO/16-207--LVLGGGGLTAY....GWQIGVLAG....LA......................--------------------------
Q2JEY3_FRASC/11-221--LVLGAGGVLGS....AWMIGAMRAVETAT.......................--------------------------
Q8R6F6_FUSNN/65-256--LVLSGGGVK.G....YAHLGVLRV....L.......................--------------------------
Q9ZCV7_RICPR/15-214--ALLEGGGVK.G....EIHLEKLKVIEEIT.......................--------------------------
Q038G8_LACC3/6-159--VVFGGGAAH.G....AYQAGVWAVLGPRL.......................--------------------------
A5IE43_LEGPC/25-249--VVCSGGGAK.G....VVYPGSYKA....M.......................--------------------------
Q4UJC7_RICFE/42-240--LSLSGGGVK.G....IAELVVLAEIEERT.......................--------------------------
Q54HM9_DICDI/140-357--VTLDGGGIR.G....IVTLTILRELQKMM.......................--------------------------
Q2K9E1_RHIEC/30-248--LCLSGGYRA.M....LFHAGSLAR....L.......................--------------------------
A4IAC8_LEIIN/190-378--LLLQGGVLA.S....SAHFGVAKA....L.......................--------------------------
Q21S96_RHOFD/26-231--VVFAGGGNR.C....FWQAGFWSVAAVAL.......................--------------------------
A5GF97_GEOUR/15-187--LMLLGGGIR.F....PAFTGALKA....I.......................--------------------------
Q1CW69_MYXXD/353-514--LALSGGGVW.G....FYHVHILRW....L.......................--------------------------
A6NV66_9FIRM/7-176--LVLEGGAFR.T....IFSSGACDG....L.......................--------------------------
O05770_MYCTU/181-420--TVLGGGGGA.G....FVYIGGMQR....L.......................--------------------------
A0YM74_LYNSP/12-230--LVLTGGGAK.G....AYQAGALRY....L.......................--------------------------
Q5X5T5_LEGPA/27-309--LVFRGGGSK.G....VAYVGALQS....L.......................--------------------------
Q2GS92_CHAGB/73-327--LTIDGGGIR.G....YSSLIVLRALMQEIERIEQSLEPRASASTQTDRIPRE--------------------------
Q1ZT25_PHOAS/33-203--LVVQGGGQR.G....IFSAGVLDS...FL.......................--------------------------
Q5CY77_CRYPI/46-241--LIMSSGSNK.G....PWQAGVVRGIAQKY.......................--------------------------
A1KQ60_MYCBP/806-965--LVLSGGAAR.A....CAHLGVLEE....L.......................--------------------------
PATA2_SOLTU/32-227--LSIDGGGIK.G....IIPGTILEFLEGQLQKM....................--------------------------
A6G7S9_9DELT/458-735--LVLSGGGAK.G....AFEAGAVAE....L.......................--------------------------
Q3JTM5_BURP1/13-264--LVMNGGVSL.A....IWMGGVTNEIFRLVKEQHPV.................--------------------------
A4F8K0_SACEN/17-281--LAMRGGASL.A....VWIGGAVAEINHLRSALAEPGPA..............--------------------------
Q2R2X0_ORYSJ/139-303--FSFSAAGLL.F....PYHIGVAQC....L.......................--------------------------
Q0A7T0_ALHEH/6-219--LVLPGGGAR.G....AYQVGVLKAVAALT.......................--------------------------
Q3Y1A6_ENTFC/138-323--LVLGGGGAH.G....AYQIGVWQA....L.......................--------------------------
Q052F4_LEPBL/13-188--LLVEGGGMK.G....AFAGGALHA....L.......................--------------------------
YL620_MIMIV/38-270--FFIEGGGTK.G....VYAMGVLNYLYDEN.......................--------------------------
Q0FZD9_9RHIZ/20-226--LVFSGGGTR.C....FWHGGFCEHVRKPL.......................--------------------------
Q5A7P0_CANAL/211-417--LVLSGGSTF.G....IFHIGVLTT....L.......................--------------------------
Q11UC9_CYTH3/381-624--ICSSGGGQRAA....VWTLRTLQYADSMT.......................--------------------------
A6ASA3_VIBHA/5-186--LCLTGGGYR.G....IYTAAVIRNLEKEF.......................--------------------------
Q1D826_MYXXD/142-382--LVTGGGGGT.A....YVYLGVMSL....L.......................--------------------------
A0AZM8_BURCH/61-294--LTISGGGSRAA....YLGARVISE....LKD.....................--------------------------
Q5CE49_CRYHO/149-342--LTVSGGGAK.G....SFSAGLLNGLAFIY.......................--------------------------
A4HB10_LEIBR/40-220--VSFSCGGWF.Q....MYFFGVAYA....LIDS....................--------------------------
Q0RZB6_RHOSR/7-221--LVVAGGGAR.G....AYEAGAITSLLPRL.......................--------------------------
A3QTZ2_9VIRU/28-255--LALEGGGTQ.A....ISYIGALLA....LKD.....................--------------------------
Q1D5W1_MYXXD/154-432--LVVSGGISL.G....AYQAGFLSTLVRFWSVAQ...................--------------------------
Q09D74_STIAD/17-214--ISFDGGPSA......LITLRVLRQLEARF.......................--------------------------
A4BNM2_9GAMM/38-218--VSLGGGSTA.GLCGNIALIHLLEE....L.......................--------------------------
Q4LA62_STAHJ/11-202--IVLGGGGSLAI....GWELGYLLTLSNQG.......................--------------------------
Q5ZPA4_9DELT/22-208--LSLDGGGLR.T....LLSIGLLKRIDQLR.......................--------------------------
Q6A6E2_PROAC/25-319--LVLAGGGSR.A....SFQMGALRHLYDVV.......................--------------------------
NTE1_PICST/1239-1403--LVLGGGGSR.G....ISHVGIVTA....L.......................--------------------------
A4SJS7_AERS4/8-174--LVVEGRAMR.G....IFAAGVLDA...FL.......................--------------------------
Q1I961_PSEE4/42-302--LVMEGGGML.G....IALVGYTYV....L.......................--------------------------
A7RB12_PBCVA/19-192--IVVAGGGAK.S....MSGLGAIHV....L.......................--------------------------
Q0VPN6_ALCBS/36-193--LAMSSGFFG.F....FAHFGTVRA....L.......................--------------------------
A6G1N7_9DELT/36-362--LCFSGGGSRAM....SASLGYLRG....L.......................--------------------------
A6QA07_SULNB/41-281--LVISGGVSL.G....AYEAGYNWALIKMISKI....................--------------------------
Q5WWS2_LEGPL/304-496--LVFCGGGAK.I....FAHVGVWKA....L.......................--------------------------
A0Z6H0_9GAMM/8-199--LSIDGGGIR.G....IIPAMVLDHLETRT.......................--------------------------
A6LMU7_THEM4/5-176--LSLAAGGVK.G....FSHIATLNF....L.......................--------------------------
A7I0A5_CAMHC/6-211--VVLSGGGLK.G....AYEIGFLKA....L.......................--------------------------
Q579N6_BRUAB/13-187--VAFGGGGAR.G....IAHIHVVDV....L.......................--------------------------
A6G3Y0_9DELT/12-216--LVLSGGGCK.T....FWGMGAYEVLEDLL.......................--------------------------
A1DP95_NEOFI/20-225--LSLDGGGIR.G....LSSLHMLKYMMQAIDP.....................--------------------------
A5K2I7_PLAVS/1168-1482--LCLDGGGIR.G....LLSIEILKCINSHL.......................--------------------------
TEG_BACME/7-180--ITFDGGGTL.G....ALSLQLLNRLAYQN.......................--------------------------
Q2W5X1_MAGSA/6-225--LVLGGGAPN.F....TLMTGALLA....F.......................--------------------------
A4U0C8_9PROT/5-257--ICLAGGGPAVG.....LSLGALKR....L.......................--------------------------
A5N2W9_CLOK5/4-191--LALEGGGAK.G....AFHMGATKA....F.......................--------------------------
A4JJZ7_BURVG/8-242--LVLSGGGAK.G....AYQVGVMRA....L.......................--------------------------
A6R0J1_AJECN/673-891--LAIDGGGVR.G....VIPLEFLLLVQEKLG......................--------------------------
Q6MR93_BDEBA/72-224--VILGGGGAK.T....YAHIGFLHE....L.......................--------------------------
A5P920_9SPHN/106-312--LMLSGGGQW.G....AYGAGLFRALHDAS.......................--------------------------
Q2C291_9GAMM/11-214--YVFQGGGAL.G....SYQLGAFQA....L.......................--------------------------
A1VHY7_DESVV/116-308--IVFKGGGIK.G....LAYAGALRA....M.......................--------------------------
A7BB55_9ACTO/26-199--LVFEGGGMR.N....AYTAALVSR....L.......................--------------------------
A5I1W5_CLOBH/6-200--GVFQGGGVK.A....TAFTGAICR....L.......................--------------------------
A8GLS3_RICAH/7-147--LAFAGGGVK.V....IAYAWALKV....L.......................--------------------------
A4T0K7_POLSQ/80-285--MVLGGGGEYYI....AWYCGFFHGLYEAG.......................--------------------------
A6DDL8_9PROT/5-162--IALSGGAAR.G....VFHLGFLDV....L.......................--------------------------
A4CKZ2_ROBBH/4-195--LVISGGGSK.G....AFAGGVAQF....L.......................--------------------------
Q18D71_CLOD6/5-179--LCLEGGGAK.G....AYQAGVVKA....L.......................--------------------------
A7FHA4_YERP3/86-275--LALSGGGPN.G....AFGAGFLNG.....W......................--------------------------
A6S7X3_BOTFB/21-291--LSLDGGGVR.G....YSMLIIIQELMHRTYVEIEG.................--------------------------
Q04WY0_LEPBL/36-250--FAIAGGGCK.A....FYGLGFGHE....M.......................--------------------------
Q12EZ0_POLSJ/6-228--LALSGGGMRAM....VFHCGVLKS....L.......................--------------------------
Q1GX66_SPHAL/43-328--GAIGGTGAV.Y....RDLLGAIAA.....H......................--------------------------
Q4RS54_TETNG/14-183--ISFAGCGFL.G....IYHVGVASCLLEQA.......................--------------------------
Q5C8M6_LEGPN/32-295--LVLSGGGAK.G....ISYLGMIQA....L.......................--------------------------
Q6JBI3_DICVI/201-395--LSIDGGGTR.G....LMGLEVLEQLEKIS.......................--------------------------
Q0FKF7_9RHOB/6-360--LIMKGGITS.G....VVYPYAITA....L.......................--------------------------
Q8Z7F2_SALTI/8-168--LALGSGAAR.G....WSHIGVIKA....L.......................--------------------------
Q6ASS6_ORYSJ/60-258--LAIDGCGSS.GAGDALLAAAALARLEAGLRKR....................--------------------------
A6QX75_AJECN/242-440--LILQGGAVY.G....TCHLGVVKA....L.......................--------------------------
Q74A07_GEOSL/58-306--LAFSGGGTRAA....AFSFGLMEE....LNRVEY..................--------------------------
Q54XY1_DICDI/13-231--LSLDGGGTK.G....LYTIEVIEHFVKLS.......................--------------------------
Q55G69_DICDI/65-250--VSFDGGGMR.G....IVSILLLKEIQNIL.......................--------------------------
Q5Z158_NOCFA/22-193--LVIEGGGSR.G....VYSSGMVQG....L.......................--------------------------
Q54QX6_DICDI/893-1088--LSLDGGGVR.G....ILHCDALEQIQKQL.......................--------------------------
Q629U3_BURMA/413-612--LILQGGGAL.G....AFECGAVKA....L.......................--------------------------
A2QZY6_ASPNC/473-679--ITIDGGGVR.A....IMPLRFLGYMQKILG......................--------------------------
A4XTW9_PSEMY/15-385--LVMKGGITS.G....IVYPLAISEIAKAF.......................--------------------------
Q0E508_SFAVA/27-224--LVISGGGFK.A....LYFVGAVDA....M.......................--------------------------
A6GI17_9DELT/71-215--MCLSGGGIRSA....TFGLGVIQA....L.......................--------------------------
A7IE20_XANP2/6-198--LSLDGGNGGKA....GVFLSTLERRAEVL.......................--------------------------
Q1DCU7_MYXXD/197-406--IVLSGGGAN.G....AFSAGAIWRLLGVLEQCR...................--------------------------
Q6MAN6_PARUW/474-738--LVIKGGGPK.G....IAYIAVLKK....L.......................--------------------------
Q4Z1R8_PLABA/352-558--LSLDSGGVL.A....TSTLIVLTRIEHELRKE....................--------------------------
A4RTL4_OSTLU/164-398--LVVEGGGMR.G....VISAGAAGA....L.......................--------------------------
A0JUC4_ARTS2/74-249--LVLAGGGMR.V....AWQAGVVRA....L.......................--------------------------

PF00698

FAS_HUMAN/493-810-WFICSGMGTQWR----GMGLSLMRL.DRFRDSILRSDEAVKP.FGLKVSQLLL..STDE....................
STCK_EMENI/1547-1902-TYVFTGQGTQER----GMGMALYDTNAAARAVWDRAERHFRSQYGISLLHIVR..ENPTSLTVNFGSRRGRQIRDIYLS
ERYA2_SACER/2014-2333-VLVFPGQGAQWV----GMARDLLESSEVFAESMSRCAEALSPHTDWKLLDVVRGDGGPD....................
ERYA2_SACER/560-881-VFLFPGQGSQWA----GMGAELLSSSPVFAGKIRACDESMAPMQDWKVSDVLR..QAPGA...................
FAS_CHICK/492-809-WYICSGMGTQWK----GMGLSLMKL.DLFRQSILRSDEALKS.TGLKVSDLLL..NADE....................
FAS1_YEAST/1663-2037-TFVFTGQGSQEQ----GMGMDLYKTSKAAQDVWNRADNHFKDTYGFSILDIVI..NNPVNLTIHFGGEKGKRIRENYSA
PPSA_MYCTU/632-952-VFVYSGRGSQWA----GMGRQLLADEPAFAAAVAELEPVFVEQAGFSLHDVLA..NGE.....................
MCAS_MYCBO/534-852-VWVFSGQGSQWA----AMGTQLLASEPVFAATIAKLEPVIAAESGFSVTEAIT..AQQ.....................
MSAS_PENPA/567-882-VWVFSGHGAQWP----DMGKQLIHN.PVFFAAIQPLDELIQAEIGLSPIELLR..TGD.....................
ERYA1_SACER/57-373-VFVFPGQGAQWA----GMAGELLGESRVFAAAMDACARAFEPVTDWTLAQVLD..SPE.....................
ERYA1_SACER/2508-2828-VFVFPGQGAQWE----G.MARELLPVPVFAESIAECDAVLSEVAGFSVSEVLE..PRPDA...................
ERYA1_SACER/1031-1354-VFVFPGQGWQWA----GMAVDLLDTSPVFAAALRECADALEPHLDFEVIPFLR..AEAARREQ................

PF01735

PLB2_SCHPO/134-617--------------------------------------------------.GNGS...SLAGILQSAMYIAGLSGGSWLV
PLB5_SCHPO/125-607--------------------------------------------------.GNTT...SLGGILQSSMYLTGLSGGSWLV
PLB1_PENCH/88-571--------------------------------------------------.DNATATGHLGGLLQSATYISGLSGGSWLL
PLB1_YEAST/99-586--------------------------------------------------.DGANE.HGLGGLLQGATYLAGLSGGNWLT
PLB2_CANAX/87-564--------------------------------------------------.TNPS...VLSGILQSSSYIVGLSGGSWLV
PA24A_CHICK/190-675--------------------------------------------------.........ESGVLDCATYIAGLSGSTWYM
PLB1_TORDE/97-584--------------------------------------------------.DGANE.HGLGGLLQSTTYLAGLSGGNWLV
PLB_NEUCR/121-606--------------------------------------------------.QNTTGAGGIGGLLQSSTYLAGLSGGGWLV
PLB_KLULA/102-589--------------------------------------------------.DGAND.HGLGGLLQSSTYLAGLSGGNWLV
PLB6_SCHPO/114-600--------------------------------------------------.NETT....LGGLLQSAHYITGADGGSWLL
PA24A_DANRE/185-664--------------------------------------------------.........ESGVFDCATYVAGLSGSTWYM
PLB1_CANAL/88-565--------------------------------------------------KTNTP...VLAGILQASSYIAGLSGGSWLV
PLB3_YEAST/105-592--------------------------------------------------.EGAYE.HGLGGLLQSTTYLSGASGGNWLV
PLB1_SCHPO/114-593--------------------------------------------------.DNHT...VLTGLLQASDYLVGTDGSAWTV
PLB2_YEAST/101-588--------------------------------------------------.DGANE.HGLGGLLQSSTYLSGLSGGNWLT

PF01734

Q9N5Z7_CAEEL/97-269-------------------------------------------------........DHGKKLMKRVERYSGCSSGSLVA
Q8F079_LEPIN/12-165-------------------------------------------------...........SEIGFRPSKITGCSSGALIG
B8GC44_CHLAD/8-228-------------------------------------------------..........DHLSVNEFDIYVGTSAGALIN
C1DSE3_AZOVD/14-206-------------------------------------------------...........EDGRLDFTGISGTSAGAMNA
A9BEP0_PETMO/3-174-------------------------------------------------............AKKENALNLYTSSLGSLRG
A9B328_HERA2/4-179-------------------------------------------------...........LEAGIIPDLVVGSSVGSING
B2U808_RALPJ/9-214-------------------------------------------------..........QPELGLAPRVIAGISAGASTA
Q3AAC7_CARHZ/6-206-------------------------------------------------...........EKEGLKPSIVSGTSVGGIIA
A6CHF0_9BACI/8-175-------------------------------------------------...........LEKEIEFPYVIGVSAGACIA
Q2GUC2_CHAGB/19-224-------------------------------------------------......GGNLSPRPCDIFDLIAGTSTGGIIA
Q9XAG3_STRCO/16-207-------------------------------------------------.........DAGVDLADADVLAGTSAGSLLA
Q2JEY3_FRASC/11-221-------------------------------------------------...........GRDLSGADLVVGTSAGSVVA
Q8R6F6_FUSNN/65-256-------------------------------------------------...........ERENIKIDYITGTSIGAFIG
Q9ZCV7_RICPR/15-214-------------------------------------------------..........GKPTCKVFDFTGGTSVGGLIL
Q038G8_LACC3/6-159-------------------------------------------------................RPTFVIGSSIGAINA
A5IE43_LEGPC/25-249-------------------------------------------------.........EDTGVFKGVEELSGASAGAITS
Q4UJC7_RICFE/42-240-------------------------------------------------..........GKSISELFPIISGTSVGGLIA
Q54HM9_DICDI/140-357-------------------------------------------------..........GLDIIDKAHMVCGTSTGSIIA
Q2K9E1_RHIEC/30-248-------------------------------------------------.........NEAGLLAKLDMISSVSGGSIAS
A4IAC8_LEIIN/190-378-------------------------------------------------...........YDAGLLPPVVYGSGSGALVA
Q21S96_RHOFD/26-231-------------------------------------------------..............KLAPSGVVAVSAGSAIA
A5GF97_GEOUR/15-187-------------------------------------------------...........EEKGLNIRKIVGSSTGSIIG
Q1CW69_MYXXD/353-514-------------------------------------------------...........VSQGVPIDIVSGASMGSLVG
A6NV66_9FIRM/7-176-------------------------------------------------...........LAADIMPDYCVGVSAGIAYG
O05770_MYCTU/181-420-------------------------------------------------...........LAAGQVPDYMIGSSFGSIIG
A0YM74_LYNSP/12-230-------------------------------------------------...........AELNFQPKIIAGTSVGALNG
Q5X5T5_LEGPA/27-309-------------------------------------------------.........SEQGVLENIENVAGSSAGAMTA
Q2GS92_CHAGB/73-327-------------------------------------------------QIPDDVFREGQYLPCHYFDYIAGTSVGGLIA
Q1ZT25_PHOAS/33-203-------------------------------------------------...........EHEFDPFALYIGTSAGALNL
Q5CY77_CRYPI/46-241-------------------------------------------------.........HDSGKKLRWDLVGGTSVGAINA
A1KQ60_MYCBP/806-965-------------------------------------------------...........EAAGVTVDRFAGTSMGAIIA
PATA2_SOLTU/32-227-------------------------------------------------......DNNADARLADYFDVIGGTSTGGLLT
A6G7S9_9DELT/458-735-------------------------------------------------...........WKTGYRPDIICGVSVGAVNA
Q3JTM5_BURP1/13-264-------------------------------------------------....YAALLAMTRTVPRVDVISGTSAGGING
A4F8K0_SACEN/17-281-------------------------------------------------RHPWGALARLAGYDSVAVDVLAGASAGGLNA
Q2R2X0_ORYSJ/139-303-------------------------------------------------.........IDRGYLTERTPLAGSSAGAIIC
Q0A7T0_ALHEH/6-219-------------------------------------------------..........PRDRGNPFPVIIGTSAGAINA
Q3Y1A6_ENTFC/138-323-------------------------------------------------...........KEHDINFEIITGTSVGALNG
Q052F4_LEPBL/13-188-------------------------------------------------.........HTLVSPKHYDLVVAVSSGACSA
YL620_MIMIV/38-270-------------------------------------------------..........VYIKLQDVDIFGGTSVGSILA
Q0FZD9_9RHIZ/20-226-------------------------------------------------..............RLMPKRITGASGGAMSA
Q5A7P0_CANAL/211-417-------------------------------------------------...........FEANLLPRIISGSSAGSIVA
Q11UC9_CYTH3/381-624-------------------------------------------------..........NGAMFKQTRLMTGASGGIIGA
A6ASA3_VIBHA/5-186-------------------------------------------------..........ETKIKQQCDCIAGTSIGGIIA
Q1D826_MYXXD/142-382-------------------------------------------------...........GEYGLEPRLLAGTSMGAILA
A0AZM8_BURCH/61-294-------------------------------------------------........VDGTDLTNYINVVSSVSGGSLAA
Q5CE49_CRYHO/149-342-------------------------------------------------.........RYHGIKLRWDVTSGVSIGTLNT
A4HB10_LEIBR/40-220-------------------------------------------------......GVLRRWYSEGKRVRFTGVSAGALAA
Q0RZB6_RHOSR/7-221-------------------------------------------------..............GRSPTILVGTSAGALNV
A3QTZ2_9VIRU/28-255-------------------------------------------------.......TGYYKDDGYTFDQIGGSSTGCLVG
Q1D5W1_MYXXD/154-432-------------------------------------------------.....REGAQADLGNPAPRVWTGASAGAVNA
Q09D74_STIAD/17-214-------------------------------------------------...........PGFVERAQMFSGTSTGAFVS
A4BNM2_9GAMM/38-218-------------------------------------------------............ELKQHISELWGTSAGAIVG
Q4LA62_STAHJ/11-202-------------------------------------------------............IDVRHADLMIGTSGGAQAA
Q5ZPA4_9DELT/22-208-------------------------------------------------...........PGFLDQVDLVAGTSAGAISA
Q6A6E2_PROAC/25-319-------------------------------------------------..............GITPTSMVATSAGSIVA
NTE1_PICST/1239-1403-------------------------------------------------...........ERHGIPVDLIGGTSIGSLVG
A4SJS7_AERS4/8-174-------------------------------------------------...........AQGRTAFDHCIGVSAGAVNL
Q1I961_PSEE4/42-302-------------------------------------------------...........EQAGIRFLGVGGTSAGSINA
A7RB12_PBCVA/19-192-------------------------------------------------.........KRNGQLKNLKVVAGTSAGSIVA
Q0VPN6_ALCBS/36-193-------------------------------------------------...........LDHGLQPARFCGSSAGALVG
A6G1N7_9DELT/36-362-------------------------------------------------.........TKQGLVDRVRYISAVSGGSWAT
A6QA07_SULNB/41-281-------------------------------------------------.......KSMNVDIRPDLLSVAGASAGSINT
Q5WWS2_LEGPL/304-496-------------------------------------------------...........NEAGMKPTKFAGSSAGAIMS
A0Z6H0_9GAMM/8-199-------------------------------------------------..........GHRAADLFDLMVGTSTGGILA
A6LMU7_THEM4/5-176-------------------------------------------------...........EENNIKVDIITGSSAGAIVA
A7I0A5_CAMHC/6-211-------------------------------------------------...........GEFEILPATISGTSIGAING
Q579N6_BRUAB/13-187-------------------------------------------------...........NELGIQPVAIAGSSIGSIIG
A6G3Y0_9DELT/12-216-------------------------------------------------...............PPIERWSAVSAGVAMA
A1DP95_NEOFI/20-225-------------------------------------------------........RQPPRPCEVFDVIGGVGSGGLIA
A5K2I7_PLAVS/1168-1482-------------------------------------------------..........KKNIFEYFDIICGTSTGAIIS
TEG_BACME/7-180-------------------------------------------------...........PKLISETNVFSGNSIGSFTA
Q2W5X1_MAGSA/6-225-------------------------------------------------...........DEAGVKFDVISATGGGGGVA
A4U0C8_9PROT/5-257-------------------------------------------------..........HEEEDIRFDVWSLACIGAWLG
A5N2W9_CLOK5/4-191-------------------------------------------------...........IEEGYKFHGIVGTSIGAING
A4JJZ7_BURVG/8-242-------------------------------------------------...........AEVGAQIDMVAGASIGALNG
A6R0J1_AJECN/673-891-------------------------------------------------.........ANCPVVDLCELVMGTSSGGIIA
Q6MR93_BDEBA/72-224-------------------------------------------------...........QRAKVPVYAIGGVEFAAPMA
A5P920_9SPHN/106-312-------------------------------------------------.........GNGLAMKNVKVITGISTGSLQT
Q2C291_9GAMM/11-214-------------------------------------------------...........NEKGFTPDSIIGISIGAINA
A1VHY7_DESVV/116-308-------------------------------------------------.........GRHGMLRDVRRTAGTSSGAMAA
A7BB55_9ACTO/26-199-------------------------------------------------...........IAEGINFPHISGVSAGSSHL
A5I1W5_CLOBH/6-200-------------------------------------------------...........EKEGMMWQRLAGTSAGAIIA
A8GLS3_RICAH/7-147-------------------------------------------------.........KDKDCLKNIQKVVGASGGAIAA
A4T0K7_POLSQ/80-285-------------------------------------------------...........LDMAQIPEMVVGTSAGSYVG
A6DDL8_9PROT/5-162-------------------------------------------------...........LKEGVEIKEISGSSAGAIVA
A4CKZ2_ROBBH/4-195-------------------------------------------------..........MEQRGYDYDLLLGTSTGSLLI
Q18D71_CLOD6/5-179-------------------------------------------------..........YDGGINKFYSISGTSIGAING
A7FHA4_YERP3/86-275-------------------------------------------------.........TETGKRPVFKVVSGVSTGALIA
A6S7X3_BOTFB/21-291-------------------------------------------------...KAPRRDQIPKPADHFDLICGTGTGGLIA
Q04WY0_LEPBL/36-250-------------------------------------------------...........KSWGLKFREVSGVSAGAAMV
Q12EZ0_POLSJ/6-228-------------------------------------------------.........AEHGALEHVSKVSTVSGGSLLV
Q1GX66_SPHAL/43-328-------------------------------------------------.........GNVRLRVFTDIVAGASAGGING
Q4RS54_TETNG/14-183-------------------------------------------------...........PFLVHNARHIYGASAGALTA
Q5C8M6_LEGPN/32-295-------------------------------------------------.........QERGKIKNLTHVSGASAGAMTA
Q6JBI3_DICVI/201-395-------------------------------------------------..........GKKICELFDHVVGVSTGSIIA
Q0FKF7_9RHOB/6-360-------------------------------------------------............ARSYRLRSIGGSSAGAIAA
Q8Z7F2_SALTI/8-168-------------------------------------------------...........KQTGIDIDIVAGCSIGSLVG
Q6ASS6_ORYSJ/60-258-------------------------------------------------......TGDSDARVADFFDVAAGAGAGGVLA
A6QX75_AJECN/242-440-------------------------------------------------...........FLRGLLPRIITGTATGALVA
Q74A07_GEOSL/58-306-------------------------------------------------....AGRDGARHRLLDDVEIISSVSGGSFTS
Q54XY1_DICDI/13-231-------------------------------------------------..........GSDFTKHVDLFGGTSTGGILS
Q55G69_DICDI/65-250-------------------------------------------------..........GFDIGVNCDIVCGTSTGGIVT
Q5Z158_NOCFA/22-193-------------------------------------------------.........EELGLSAVFDAVYGTSAGAING
Q54QX6_DICDI/893-1088-------------------------------------------------.........FDIPIISLFDLIVGTSAGGLVA
Q629U3_BURMA/413-612-------------------------------------------------...........EQHGVRPDVISAVSIGAFNG
A2QZY6_ASPNC/473-679-------------------------------------------------.........PGCLVQDMVDVAFGTSGGGIAV
A4XTW9_PSEMY/15-385-------------------------------------------------................RLRSIGGTSAGAIAA
Q0E508_SFAVA/27-224-------------------------------------------------.............ELCRVDCYAGTSCGAALC
A6GI17_9DELT/71-215-------------------------------------------------.........ARKGLFEHVDYLSTVSGGGFTG
A7IE20_XANP2/6-198-------------------------------------------------..........GFSVLRQIDLFAGTSNGAVNA
Q1DCU7_MYXXD/197-406-------------------------------------------------.....GKPAPEGCGDARIDLAAGSSTGALIS
Q6MAN6_PARUW/474-738-------------------------------------------------.........EEHEALKNLERIAGTSSGAIFA
Q4Z1R8_PLABA/352-558-------------------------------------------------......LGNDTINLIDCFDMVCGTSAGGLIS
A4RTL4_OSTLU/164-398-------------------------------------------------.........LEAGYYDCFDAAYGSSAGAMNL
A0JUC4_ARTS2/74-249-------------------------------------------------...........AEEGLHFDHVDGTSGGILTA

PF00698

FAS_HUMAN/493-810.................................STFDDIVHSFVSLTAIQIGLIDLL.SCMG..LRPDGIVGHSLGEVAC
STCK_EMENI/1547-1902MSD........SDPSMLPGLTRDSRSYTFNYPSGLLMSTQFAQPALAVMEIAEYAHL.QAQGVVQTQAIFAGHSLGEYSS
ERYA2_SACER/2014-2333..................................PHERVDVLQPVLFSIMVSLAELW.RAHG..VTPAAVVGHSQGEIAA
ERYA2_SACER/560-881.................................PGLDRVDVVQPVLFAVMVSLAELW.RSYG..VEPAAVVGHSQGEIAA
FAS_CHICK/492-809.................................NTFDDTVHAFVGLAAIQIAQIDVL.KAAG..LQPDGILGHSVGELAC
FAS1_YEAST/1663-2037MIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDL.KSKGLIPADATFAGHSLGEYAA
PPSA_MYCTU/632-952..................................ELVGIEQIQLGLIGMQLALTELW.CSYG..VRPDLVIGHSMGEVAA
MCAS_MYCBO/534-852..................................TVTGIDKVQPAVFAVQVALAATMEQTYG..VRPGAVVGHSMGESAA
MSAS_PENPA/567-882...................................FESSDRVQILTYVMQIGLSALL.QSNG..ITPQAVIGHSVGEIAA
ERYA1_SACER/57-373..................................QSRRVEVVQPALFAVQTSLAALW.RSFG..VTPDAVVGHSIGELAA
ERYA1_SACER/2508-2828.................................PSLERVDVVQPVLFAVMVSLARLW.RACG..AVPSAVIGHSQGEIAA
ERYA1_SACER/1031-1354..............................DAALSTERVDVVQPVMFAVMVSLASMW.RAHG..VEPAAVIGHSQGEIAA

PF01735

PLB2_SCHPO/134-617---------------------------------------------------GSVAVNNFANITYLRD......NVWNLEH
PLB5_SCHPO/125-607---------------------------------------------------GSVAVNNFANITFLHDD......VWNLDH
PLB1_PENCH/88-571---------------------------------------------------GSIYINNFTTVDKLQTH..EAGSVWQFGN
PLB1_YEAST/99-586---------------------------------------------------STLAWNNWTSVQAIVDNTTESNSIWDISH
PLB2_CANAX/87-564---------------------------------------------------GSLASNDLIPVDQLLR....EDKLWDIQN
PA24A_CHICK/190-675---------------------------------------------------STL.....YSHPDFPEKGPKEINQELMNS
PLB1_TORDE/97-584---------------------------------------------------GTLAWNNWTSVQDIVNNMTEDDSIWDISN
PLB_NEUCR/121-606---------------------------------------------------GSLFSNNFSSIETLLS....ENKVWDFEN
PLB_KLULA/102-589---------------------------------------------------GTLAYNNWTSVQAIINNMTDDNSIWDISN
PLB6_SCHPO/114-600---------------------------------------------------SSLAVNEFRTIQNISK......SIWYTRL
PA24A_DANRE/185-664---------------------------------------------------SML.....YSHPEFPAKGPGDINKELMNR
PLB1_CANAL/88-565---------------------------------------------------GSLASNNLNSVDDMLS..QG...LWELTH
PLB3_YEAST/105-592---------------------------------------------------GTLALNNWTSVQDILNNMQNDDSIWDLSD
PLB1_SCHPO/114-593---------------------------------------------------GGIALNNFSTINDFSK.......LWAFNH
PLB2_YEAST/101-588---------------------------------------------------GTLAWNNWTSVQEIVDHMSESDSIWNITK

PF01734

Q9N5Z7_CAEEL/97-269...................................................AMFIFN...--------------------
Q8F079_LEPIN/12-165...................................................SLVAAG...--------------------
B8GC44_CHLAD/8-228...................................................ACLANN...--------------------
C1DSE3_AZOVD/14-206...................................................TMLAHGLLQ--------------------
A9BEP0_PETMO/3-174...................................................LFYALY..G--------------------
A9B328_HERA2/4-179...................................................AVLACH...--------------------
B2U808_RALPJ/9-214...................................................CMLHAW...--------------------
Q3AAC7_CARHZ/6-206...................................................LLYGAG...--------------------
A6CHF0_9BACI/8-175...................................................ASYLSK...--------------------
Q2GUC2_CHAGB/19-224......................................................VML...--------------------
Q9XAG3_STRCO/16-207...................................................LDLARG...--------------------
Q2JEY3_FRASC/11-221...................................................ALLGLGIGI--------------------
Q8R6F6_FUSNN/65-256...................................................TLYSIG...--------------------
Q9ZCV7_RICPR/15-214...................................................ILLNLP...--------------------
Q038G8_LACC3/6-159...................................................AGTARM...--------------------
A5IE43_LEGPC/25-249...................................................TMLALG...--------------------
Q4UJC7_RICFE/42-240...................................................GLLTIP...--------------------
Q54HM9_DICDI/140-357.......................................................MG...--------------------
Q2K9E1_RHIEC/30-248...................................................GLLAHV...--------------------
A4IAC8_LEIIN/190-378...................................................TLVCCS...--------------------
Q21S96_RHOFD/26-231...................................................CALFAG...--------------------
A5GF97_GEOUR/15-187...................................................SLYASG...--------------------
Q1CW69_MYXXD/353-514...................................................AYFCGS...--------------------
A6NV66_9FIRM/7-176...................................................VSYISK...--------------------
O05770_MYCTU/181-420...................................................SLVARE...--------------------
A0YM74_LYNSP/12-230...................................................AVLASD...--------------------
Q5X5T5_LEGPA/27-309...................................................AIVACG...--------------------
Q2GS92_CHAGB/73-327......................................................IML...--------------------
Q1ZT25_PHOAS/33-203...................................................SSFISR...--------------------
Q5CY77_CRYPI/46-241...................................................LASQFY...--------------------
A1KQ60_MYCBP/806-965...................................................ALAASG...--------------------
PATA2_SOLTU/32-227...................................................AMITTP...--------------------
A6G7S9_9DELT/458-735...................................................IKLAEG...--------------------
Q3JTM5_BURP1/13-264...................................................AALAIS...--------------------
A4F8K0_SACEN/17-281...................................................TLLSTS...--------------------
Q2R2X0_ORYSJ/139-303...................................................AVIASG...--------------------
Q0A7T0_ALHEH/6-219...................................................AVLACY...--------------------
Q3Y1A6_ENTFC/138-323...................................................ALILQG...--------------------
Q052F4_LEPBL/13-188...................................................AYYVTM...--------------------
YL620_MIMIV/38-270...................................................VGLSLG...--------------------
Q0FZD9_9RHIZ/20-226....................................................ACFIA...--------------------
Q5A7P0_CANAL/211-417...................................................SILCCH...--------------------
Q11UC9_CYTH3/381-624SYF............................................RELCLLKAQG...--------------------
A6ASA3_VIBHA/5-186...................................................IGLALG...--------------------
Q1D826_MYXXD/142-382...................................................IMRSRL...--------------------
A0AZM8_BURCH/61-294...................................................ALYGIS...--------------------
Q5CE49_CRYHO/149-342I.................................................WSQFYHV...--------------------
A4HB10_LEIBR/40-220...................................................TCLASG...--------------------
Q0RZB6_RHOSR/7-221...................................................VGLAAGA.H--------------------
A3QTZ2_9VIRU/28-255...................................................LLVSLD...--------------------
Q1D5W1_MYXXD/154-432...................................................LLGGLA...--------------------
Q09D74_STIAD/17-214...................................................LYLAHA...--------------------
A4BNM2_9GAMM/38-218...................................................GSWTTG...--------------------
Q4LA62_STAHJ/11-202...................................................TGLTSD...--------------------
Q5ZPA4_9DELT/22-208...................................................LIIAAA...--------------------
Q6A6E2_PROAC/25-319...................................................CTLAQW...--------------------
NTE1_PICST/1239-1403...................................................GLYAKD...--------------------
A4SJS7_AERS4/8-174...................................................AAFLAG...--------------------
Q1I961_PSEE4/42-302..................................................LLLASLD...--------------------
A7RB12_PBCVA/19-192...................................................AGVALN...--------------------
Q0VPN6_ALCBS/36-193...................................................GCMASG...--------------------
A6G1N7_9DELT/36-362...................................................SLFTYY...--------------------
A6QA07_SULNB/41-281...................................................LLSAMY...--------------------
Q5WWS2_LEGPL/304-496...................................................LMCYLG...--------------------
A0Z6H0_9GAMM/8-199...................................................LGLAQP...--------------------
A6LMU7_THEM4/5-176...................................................ALYGLY...--------------------
A7I0A5_CAMHC/6-211...................................................AFLSAY...--------------------
Q579N6_BRUAB/13-187...................................................SSMANG...--------------------
A6G3Y0_9DELT/12-216...................................................LARCTG...--------------------
A1DP95_NEOFI/20-225......................................................IML...--------------------
A5K2I7_PLAVS/1168-1482...................................................ILIGLE...--------------------
TEG_BACME/7-180...................................................LALASG...--------------------
Q2W5X1_MAGSA/6-225L.................................................SYLAPKG...--------------------
A4U0C8_9PROT/5-257IVWNQAEPGHEAETSE..................AFFRQIFRPDDVYDRFPIAAAFA...--------------------
A5N2W9_CLOK5/4-191...................................................AVIAQG...--------------------
A4JJZ7_BURVG/8-242...................................................AIVASA...--------------------
A6R0J1_AJECN/673-891...................................................HALVNL...--------------------
Q6MR93_BDEBA/72-224...................................................ALYANK...--------------------
A5P920_9SPHN/106-312...................................................LLLMVA...--------------------
Q2C291_9GAMM/11-214....................................................AIIAG...--------------------
A1VHY7_DESVV/116-308...................................................VFLALG...--------------------
A7BB55_9ACTO/26-199....................................................CNFTS...--------------------
A5I1W5_CLOBH/6-200...................................................AFLAVG...--------------------
A8GLS3_RICAH/7-147...................................................FSIVLG...--------------------
A4T0K7_POLSQ/80-285...................................................SSLLSG...--------------------
A6DDL8_9PROT/5-162...................................................GAIACK...--------------------
A4CKZ2_ROBBH/4-195...................................................SHLAL....--------------------
Q18D71_CLOD6/5-179...................................................YYLYTG...--------------------
A7FHA4_YERP3/86-275...................................................PFAFLG...--------------------
A6S7X3_BOTFB/21-291......................................................IML...--------------------
Q04WY0_LEPBL/36-250...................................................LCLICG...--------------------
Q12EZ0_POLSJ/6-228..................................................GLLLQLN...--------------------
Q1GX66_SPHAL/43-328...................................................IFLARA...--------------------
Q4RS54_TETNG/14-183...................................................TALVTG...--------------------
Q5C8M6_LEGPN/32-295...................................................SILAVG...--------------------
Q6JBI3_DICVI/201-395......................................................SLL...--------------------
Q0FKF7_9RHOB/6-360ALAAAAEYRRQSSPQKDDMGGFDEIEKIAGELAEDLGKLLQPAPPFAGLFKLLLAAV...--------------------
Q8Z7F2_SALTI/8-168....................................................AAYAC...--------------------
Q6ASS6_ORYSJ/60-258...................................................AMLFLR...--------------------
A6QX75_AJECN/242-440...................................................ALVAVH...--------------------
Q74A07_GEOSL/58-306...................................................AYYALY...--------------------
Q54XY1_DICDI/13-231...................................................IAKSKE...--------------------
Q55G69_DICDI/65-250...................................................YAKLFS...--------------------
Q5Z158_NOCFA/22-193...................................................AWLLCG...--------------------
Q54QX6_DICDI/893-1088...................................................LALAST..P--------------------
Q629U3_BURMA/413-612...................................................AIVASH...--------------------
A2QZY6_ASPNC/473-679......................................................LKA...--------------------
A4XTW9_PSEMY/15-385AAAAAAELGRQRYLAGELSEDP......QGFAEIERLPCQLCLPATECRGTRLLALF...--------------------
Q0E508_SFAVA/27-224...................................................ALMCAG...--------------------
A6GI17_9DELT/71-215S.................................................MLSAVLN...--------------------
A7IE20_XANP2/6-198...................................................LLLAWF...--------------------
Q1DCU7_MYXXD/197-406...................................................TLVDLF...--------------------
Q6MAN6_PARUW/474-738...................................................SLISVG...--------------------
Q4Z1R8_PLABA/352-558...................................................LALLEG...--------------------
A4RTL4_OSTLU/164-398....................................................TYYLS...--------------------
A0JUC4_ARTS2/74-249...................................................GMMLSG...--------------------

PF00698

FAS_HUMAN/493-810---------------------------------------------------GYADGC-----------------------
STCK_EMENI/1547-1902---------------------------------------------------LGACTT-----------------------
ERYA2_SACER/2014-2333---------------------------------------------------AHVAGA-----------------------
ERYA2_SACER/560-881---------------------------------------------------AHVAGA-----------------------
FAS_CHICK/492-809---------------------------------------------------GYADNS-----------------------
FAS1_YEAST/1663-2037---------------------------------------------------LASLAD-----------------------
PPSA_MYCTU/632-952---------------------------------------------------AVVAGA-----------------------
MCAS_MYCBO/534-852---------------------------------------------------AVVAGA-----------------------
MSAS_PENPA/567-882---------------------------------------------------SVVAGA-----------------------
ERYA1_SACER/57-373---------------------------------------------------AHVCGA-----------------------
ERYA1_SACER/2508-2828---------------------------------------------------AVVAGA-----------------------
ERYA1_SACER/1031-1354---------------------------------------------------ACVAGA-----------------------

PF01735

PLB2_SCHPO/134-617SVFA.P..HGDNVV.ENLAYYDDLDDEIDQKKDAGFDTSLTDLWGRALSRKLVD.ATQGGPNITFSSIRNQTWFQNADYP
PLB5_SCHPO/125-607SLFA.P...YDDAF.ENFYIYQEWFEQVLQKKNAGFNVSITDLWGRALALKLVN.PLTGGANTTFSSVTNETWFQDGEFP
PLB1_PENCH/88-571SIIEGPDAGGIQLL.DSAGYYKDLADAVDGKKKAGFDTTLTDIWGRALSYQMFN.ASNGGLSYTWSSIADTPEFQDGDYP
PLB1_YEAST/99-586SILT.P..DGINIF.KTGSRWDDISDDVQDKKDAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMP
PLB2_CANAX/87-564SLVA.Y..YGVNIV.RNTAMWGNINLQVQTKQLAGFTVSITDVYGRALSHQLLTNFDNQGASFLWSDVTETTSFQNNEMP
PA24A_CHICK/190-675VSHN.P..LLLLTP.QKVKRY...IEALWNKKSSGQPVTFTDIFGMLIGETLIH....NRMDTTLSDMK..EKVSEAQCA
PLB1_TORDE/97-584SIIN.P..GGFMIV.TTIKRWDHISDAVEGKQDAGFNVSLTDIWGRALSYNFFPSLYRGGVAYTWSTLRDVEVFQNGEMP
PLB_NEUCR/121-606SIFKGPKEAGLSTV.NRIQYWSEVAKEVAKKKDAGFETSITDYWGRALSYQLIG.ADMGGPAYTFSSIAQTDNFQKAETP
PLB_KLULA/102-589SIVN.P..GGINIF.SSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMP
PLB6_SCHPO/114-600GIFF.I..EETHFG.DLKNYYTNVVDEVNQKAAAGFNVSLTDYWGRAIARHFVG.QLRGGPNLTYSSVQNASWFQTAEYP
PA24A_DANRE/185-664VSNN.P..LKLLLP.QNINRY...VKALWKKKSAGQPVTFTDIFGMLIGETLIP....GRMNIKLSSLK..GKINEGQSP
PLB1_CANAL/88-565SFLS.Y..YGIEHPIKQVEEWVNVGNQVASKRNANFNVSLTDIYGRLLSYPLLTNTEDEGDAYLWSDVTSASNFQSHQMP
PLB3_YEAST/105-592SIVT.P..GGINIF.KTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMP
PLB1_SCHPO/114-593PLMY.P...KSAIV.FNAHFYSSIMNEVAEKANAGFNISLSDYWGRVISRTLGD.TTYGFPNVSLSSITSQEWYRNANFP
PLB2_YEAST/101-588SIVN.P..GGSNLT.YTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMP

PF01734

Q9N5Z7_CAEEL/97-269---------------..PEKISEAVEEIYKMADEVND...........................................
Q8F079_LEPIN/12-165---------------IPIDTMTDLILNLKKKDFWEGN...........................................
B8GC44_CHLAD/8-228---------------MSPRTLISVLERSLLGIDQLEP...........................................
C1DSE3_AZOVD/14-206---------------GGRDGAREALASFWQAVASSAP...........................................
A9BEP0_PETMO/3-174---------------VNFFGRLKDFIYEKNNPLREVITN.........................................
A9B328_HERA2/4-179---------------PNLAGIQRIAQRWKSVKREDIF...........................................
B2U808_RALPJ/9-214---------------.NSAELMDYYGEALRQNTRNAH...........................................
Q3AAC7_CARHZ/6-206---------------LSPKDMEELALQIKPKDLYNCLFTAG.......................................
A6CHF0_9BACI/8-175---------------QKGRNKKVNIGFAGNPKYLSWR...........................................
Q2GUC2_CHAGB/19-224---------------GRLHMTIDECIEVYERLGKDVF...........................................
Q9XAG3_STRCO/16-207---------------AAPAGLYKEQLDRERPMLDVDF...........................................
Q2JEY3_FRASC/11-221---------------DVMANSERGIYEAGDPVLDYRDLGASLPPR...................................
Q8R6F6_FUSNN/65-256---------------YTVDEIEKFLDDVNVSNFLETITDNTN......................................
Q9ZCV7_RICPR/15-214---------------DSDNPGKPLFSAEQAQTLFERMV..........................................
Q038G8_LACC3/6-159---------------.....LPEQVPQWWQHFSEAKV...........................................
A5IE43_LEGPC/25-249---------------MPSAVFRDKLLTTNLKNLMGSRIGSLFGTNP..................................
Q4UJC7_RICFE/42-240---------------KEQGSNIAKYSAKDALKIFTDA...........................................
Q54HM9_DICDI/140-357---------------RSKPLPYDEIVEIYKNFGKVIF...........................................
Q2K9E1_RHIEC/30-248---------------WPRLAFENEVAVNFRAQYVDRI...........................................
A4IAC8_LEIIN/190-378---------------TDLASLFHSSSGSNSIAEANALL..........................................
Q21S96_RHOFD/26-231---------------.TFEACFTGYKRAVAENVHNLY...........................................
A5GF97_GEOUR/15-187---------------ISPSEIQQETLTVDTNRFKDFN...........................................
Q1CW69_MYXXD/353-514---------------ALDGHDGLEGLRRLEERAMSRQ...........................................
A6NV66_9FIRM/7-176---------------QSGRNLEILTHYANDKRYMGVN...........................................
O05770_MYCTU/181-420---------------LPVPI..DEYAEWAKTVSYRAILGPERRRS...................................
A0YM74_LYNSP/12-230---------------RPFSNAVQQLNELWTNLGEVEILKPNTEQI...................................
Q5X5T5_LEGPA/27-309---------------GSAELMDYFCSANSLADFVDNRLTKKLLPKSEKS..............................P
Q2GS92_CHAGB/73-327---------------GMFGKTVDDCINEFHRQNKSIPLADDAS.....................................
Q1ZT25_PHOAS/33-203---------------QPRFGYKFIQNYTTTDKFFSLY...........................................
Q5CY77_CRYPI/46-241---------------PPGEELAWTTELVILWKMARQKDITT.......................................
A1KQ60_MYCBP/806-965---------------LDAAGVDAQIYEHFVRKSHGDY...........................................
PATA2_SOLTU/32-227---------------NENNRPFAAANEIVPFYFEHGP...........................................
A6G7S9_9DELT/458-735---------------APDSA..EQLVAMWRAFSADRNAIFWRNYHLWLLEAAVQRALDS...........AEDAALWGGV
Q3JTM5_BURP1/13-264---------------LLYDGEFSELREVWMKTATFND...........................................
A4F8K0_SACEN/17-281---------------MVYGMPFDRMRRMWVRLADLEAM..........................................
Q2R2X0_ORYSJ/139-303---------------NTMRDALQVTKDLADNCRSNGT...........................................
Q0A7T0_ALHEH/6-219---------------ATHFQRGVANMEAVWANFRCQHIYRTG......................................
Q3Y1A6_ENTFC/138-323---------------.DMKKAVNLWKKLSTRQVLALPE..........................................
Q052F4_LEPBL/13-188---------------PKPEP..EKSLKTLAIWYIELA...........................................
YL620_MIMIV/38-270---------------YQKKDFEKFVETFDLSKFVDSK...........................................
Q0FZD9_9RHIZ/20-226---------------QREVKLLETMGAAFLDRDENIS...........................................
Q5A7P0_CANAL/211-417---------------.NNEETFELLSTITTKKFNIFDVVD........................................
Q11UC9_CYTH3/381-624---------------KIKSPHEFQYLSDISEDVLNPIVFSMV......................................
A6ASA3_VIBHA/5-186---------------KSSDDIITAFQTYKADIFKSKG...........................................
Q1D826_MYXXD/142-382---------------TRFDA..TDMINIVRGLSFRKLFR.........................................
A0AZM8_BURCH/61-294---------------TDRTT..GDSWRPVWNDSLIRTR..........................................
Q5CE49_CRYHO/149-342---------------GQSTHFSTEGASIWSNFTHKNV...........................................
A4HB10_LEIBR/40-220---------------QYDILSVKKFSLAAAEDYRSSI...........................................
Q0RZB6_RHOSR/7-221---------------HGIDQAAERVVSLWDSVSLGDVFSV........................................
A3QTZ2_9VIRU/28-255---------------IPPVKLEKLIYKLNIFKHTVNFDT.........................................
Q1D5W1_MYXXD/154-432---------------SCDTAFAQPTWSPEQSLFWTVWI..........................................
Q09D74_STIAD/17-214---------------LSLRQRQGVQAPGCLDIIDGCIAF.........................................
A4BNM2_9GAMM/38-218---------------TTAAEMLATIRNLDSKDTVDLC...........................................
Q4LA62_STAHJ/11-202---------------KSFDVIYDEQIAPKSNETPPVK...........................................
Q5ZPA4_9DELT/22-208---------------REPAVGLEQARQIWFTPGLFDS...........................................
Q6A6E2_PROAC/25-319---------------TDPAKQSAALRQLEAMWLEMTDQSDMFTPRAWFSRLLEIGPEWMSLLNREAAKTKSQRPWLSLPF
NTE1_PICST/1239-1403---------------YNIVSIYGRAKKFSKRVASLWR...........................................
A4SJS7_AERS4/8-174---------------QRGRNHSVITDYSCRPEFISLA...........................................
Q1I961_PSEE4/42-302---------------EPGKPKGEKLLAELANTNLRDFVDGDADV....................................
A7RB12_PBCVA/19-192---------------KDPVSMCKAFIDEVYKPSFDIS...........................................
Q0VPN6_ALCBS/36-193---------------ASVNAIEDTLLGLDRAQFWDPS...........................................
A6G1N7_9DELT/36-362---------------RAGARDDAQFLDLGLDAPTDPGTLSLDAL....................................
A6QA07_SULNB/41-281---------------WCQKESVPYQNRVDDNLFYETW...........................................
Q5WWS2_LEGPL/304-496---------------YTADEISELFQHFKQEHLVQFD...........................................
A0Z6H0_9GAMM/8-199---------------DTEKPENSRFSARDLADLYANR...........................................
A6LMU7_THEM4/5-176---------------GNSKIVYKKFSNAVEKFFPNLK...........................................
A7I0A5_CAMHC/6-211---------------KDPIKTAEILQNLWLNTNVLDVFKLKKPQNLKLE...............................
Q579N6_BRUAB/13-187---------------MSGKDIYDYMASIFTNRSEVVR...........................................
A6G3Y0_9DELT/12-216---------------LFPETMQVFLDEVDRNESNIYP...........................................
A1DP95_NEOFI/20-225---------------GRLKMDVEQCINAYQNLLECSFQ..........................................
A5K2I7_PLAVS/1168-1482---------------RAHLNEVEFLYNLLINKIFQKD...........................................
TEG_BACME/7-180---------------RSPEETFDFFKDQILPAFSVSRP..........................................
Q2W5X1_MAGSA/6-225---------------MSRQDSLRNSVNFGVSDEIYKYIPMN.......................................
A4U0C8_9PROT/5-257---------------PDYQASATNMVEFILDPASYRNLVVPA......................................
A5N2W9_CLOK5/4-191---------------.DFEKGYNWWTKIDISTIFNLEKIHM.......................................
A4JJZ7_BURVG/8-242---------------VTPQKAHAHLALLWDRLAQTSPVEFQAFGYLTLLS.............................S
A6R0J1_AJECN/673-891---------------RWDVATCSDVFERLARRVFHRARR.........................................
Q6MR93_BDEBA/72-224---------------ELANDVEWQMFKLKDEEVLKKS...........................................
A5P920_9SPHN/106-312---------------LDGNAKRQTRDYAMRQLEWGYSP..........................................
Q2C291_9GAMM/11-214---------------NKPENRLKNLEIFWERVTSSISFSNLFFNFNNE................................
A1VHY7_DESVV/116-308---------------ATPDQMVDILLRTPFHKFMDGS...........................................
A7BB55_9ACTO/26-199---------------RDAARSHDTFVDLVEDPEFGGL...........................................
A5I1W5_CLOBH/6-200---------------YRGKEIKKIMYDLDYEKVGNIT...........................................
A8GLS3_RICAH/7-147---------------YQSEKIEDILKKIKFLDRTSKW...........................................
A4T0K7_POLSQ/80-285---------------EFYRLRKEFDFFGKFPEIFSQIAPLA.......................................
A6DDL8_9PROT/5-162---------------IPLKDIFEIVKSKEFKSIFKFS...........................................
A4CKZ2_ROBBH/4-195---------------QKIEKIRKVYTSVNQQSIFSNLPFTI.......................................
Q18D71_CLOD6/5-179---------------.NVDNLEKMWTNIKDIQNGNVK...........................................
A7FHA4_YERP3/86-275---------------SDHDKALHDFYTTTTTRDIFHI...........................................
A6S7X3_BOTFB/21-291---------------GRLRLDLETCKEVYVRMTRKVF...........................................
Q04WY0_LEPBL/36-250---------------.DEEECVSFFENIVRKNPANFYLSRLFKGGR..................................
Q12EZ0_POLSJ/6-228---------------GMRWPTSDEYLEALLPKLKDVLT..........................................
Q1GX66_SPHAL/43-328---------------LATGESLDPLTDLWLDSADVDNLLDPDARP...................................
Q4RS54_TETNG/14-183---------------VCLGETGASIIDVAKEARKRFL...........................................
Q5C8M6_LEGPN/32-295---------------MDIKDIKKLIEGLDITKLLDNSGVGFRARGDRFRNILDV....................IYMMQM
Q6JBI3_DICVI/201-395---------------IGKGYTVEDCRTIYVDVSKRLF...........................................
Q0FKF7_9RHOB/6-360---------------SDPAGGRSKIRGLLSAATGLWKRPILLGAGTALAGLIAAAV.................LCDLGWL
Q8Z7F2_SALTI/8-168---------------NKLSALEQWVCSFRYWDVLRLM...........................................
Q6ASS6_ORYSJ/60-258---------------GPDGRPRYTAEEALEFVAASVG...........................................
A6QX75_AJECN/242-440---------------KDDDLIPVLNGEGIDEAVSDRLSKQKHFK....................................
Q74A07_GEOSL/58-306---------------PDRFF..DDFPGTFLYRDIQGG...........................................
Q54XY1_DICDI/13-231---------------ISNSELLNMYEGKESKKIFGSL...........................................
Q55G69_DICDI/65-250---------------VDNDELLRLYCEFGKKIFPSSS...........................................
Q5Z158_NOCFA/22-193---------------RAVPGMRSWSNPDIMRAVIDPA...........................................
Q54QX6_DICDI/893-1088---------------KTPVQLSTAMESLSKSAFVKHP...........................................
Q629U3_BURMA/413-612---------------..PKGATKALEAFWRELSIALPLPYESQWREA.................................
A2QZY6_ASPNC/473-679---------------FRQRRPISECQQTLADLIVRFFQG.........................................
A4XTW9_PSEMY/15-385---------------RPAPALRSLFDSFTAALDARRNPLGLPRALLAHYWRAAGVGALLGG.......GPLWPVALHGGN
Q0E508_SFAVA/27-224---------------ATPLSILKRIVNQRKNLGVCSDALESK......................................
A6GI17_9DELT/71-215---------------DPRQT..KEPFPVRKETGESEP...........................................
A7IE20_XANP2/6-198---------------DDPVLAFEAVLRFDDEVRESQT...........................................
Q1DCU7_MYXXD/197-406---------------HTPGHEEAARQLLVSNYTCSVE...........................................
Q6MAN6_PARUW/474-738---------------YTSSEIRDILDEIDLNKILDYPDDLRLDIEKLKKVLLDA....................KEEVGL
Q4Z1R8_PLABA/352-558---------------YSLQEISALLPFIMEKTFEGNR...........................................
A4RTL4_OSTLU/164-398---------------KQPEGIFAYEEDLCDGSFLDLKRHVSRRMTVI.................................
A0JUC4_ARTS2/74-249---------------VSPADMCRNWSAVNVKDFGSAL...........................................

PF00698

FAS_HUMAN/493-810---------------LSQEEAVLAAYWRGQCIKEAHLPPGAM--------------------------------------
STCK_EMENI/1547-1902---------------IMPFESLLSLILYRGLKMQNT.LPRNA--------------------------------------
ERYA2_SACER/2014-2333---------------LSLEAAAKVVALRSQVLRELD.DQGGM--------------------------------------
ERYA2_SACER/560-881---------------LTLEDAAKLVVGRSRLMRSLS.GEGGM--------------------------------------
FAS_CHICK/492-809---------------LSHEEAVLAAYWRGRCVKEAKLPPGGM--------------------------------------
FAS1_YEAST/1663-2037---------------VMSIESLVEVVFYRGMTMQVA.VPRDE--------------------------------------
PPSA_MYCTU/632-952---------------LTPAEGLRVTATRSRLMAPLS.GQGGM--------------------------------------
MCAS_MYCBO/534-852---------------LSLEDAARVICRRSKLMTRIA.GAGAM--------------------------------------
MSAS_PENPA/567-882---------------LSPAEGALIVTRRALLYRQVM.GKGGM--------------------------------------
ERYA1_SACER/57-373---------------AGAADAARAAALWSREMIPLV.GNGDM--------------------------------------
ERYA1_SACER/2508-2828---------------LSLEDGMRVVARRSRAVRAVA.GRGSM--------------------------------------
ERYA1_SACER/1031-1354---------------LSLDDAARVVALRSRVIATMP.GNKGM--------------------------------------

PF01735

PLB2_SCHPO/134-617YPIIISDSRL....EEEKAIPANTSIFEFTPYEFGTWDNGIKAFLPMEYVGTHLKNGVPP.DHKCIRNYDNAG-------
PLB5_SCHPO/125-607FPIIIADNVI....EGETVIPLNDTVFEFTPIEFGTWDTGVESFIPMEYTGTHLINGIPL.NESCVRNFDNAG-------
PLB1_PENCH/88-571MPFVVADGRN....PGELVIGSNSTVYEFNPWEFGTFDPTIFGFVPLEYLGSKFEGGSLPSNESCIRGFDSAG-------
PLB1_YEAST/99-586FPITVADGRY....PGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTG-------
PLB2_CANAX/87-564YPILAALGRE....PNTVLMNFNSTVFELTPYEVGSWDPSLRSFVDTKYIGTRLDDGAPV.SKRCVNGFDNAG-------
PA24A_CHICK/190-675LPLFTCLHVK....PDVSELMF.ADWVEFSPYEIG..MAKYGTFMSPDLFGSKFFMGTVVKKYSENPLHFLMG-------
PLB1_TORDE/97-584FPISVADGRY....PGTQIIDLNATVFEFNPFEMGSWDPTLNAFTDVKYLGTKVSNGEPVNKGQCVAGYDNTG-------
PLB_NEUCR/121-606FPILVADGRA....PGDTIISLNATNYEFNPFETGSWDPTVYGFAPTKYLGANFSNGVIPSGGKCVEGLDQAG-------
PLB_KLULA/102-589FPISVAVGRY....PGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGTNVTNGTPNVTGKCVAGFDNTG-------
PLB6_SCHPO/114-600YPLIVTQGLTGGLPDGSNGTATNSSIYEISPYYLTSFDNNVRSYTPTQYLGTNYSNGTAV.DGKCVTQFDNVG-------
PA24A_DANRE/185-664LPLFTCLHVK....PDVSELMF.ADWVEFSPYEIG..MAKYGTFMSPGLFGSKFFMGSVVKQYEENPLHFLMG-------
PLB1_CANAL/88-565FPILISDGRA....PDTTIINLNSTVIELTPYEFGSWDPSLNEFVDTRYLGTKLDNGRPT..GKCYNGFDNAG-------
PLB3_YEAST/105-592FPISVADGRY....PGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKCTAGFDNAG-------
PLB1_SCHPO/114-593YPIITFATQN....YGEDISNVNTTFFEASPNVFGTFDHGINSFIPTEYLGTTLNNGASS.NGSCVINYDNFG-------
PLB2_YEAST/101-588LPITVADGRY....PGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDNAG-------

PF01734

Q9N5Z7_CAEEL/97-269..........----..................................KTLGAMSPGFVISDRLR......KV.......
Q8F079_LEPIN/12-165..........----.....................LVTNFVKPIRKGLKNYSGILSGKNVKELLK......PH.......
B8GC44_CHLAD/8-228..........----........................HHLYQLNLADLVRRGLQLPGAVVQALR......RW.......
C1DSE3_AZOVD/14-206..........----.......................LLNAGANIRSGHPATGLKLMLYWAQMLS.....PRQ.......
A9BEP0_PETMO/3-174.........T----E.................LYNSRYAQTTALIRLGRGKMSLYNPDNLKKFLE......GY.......
A9B328_HERA2/4-179..........----......................PGGSLRSAWRVVRGRGSLHHNHGLRRFIL......SL.......
B2U808_RALPJ/9-214..........----.............................WGNLLRGERVFPHYGMYRTALL......TV.......
Q3AAC7_CARHZ/6-206........VG----I.F..............IISYNLLKLFGYQNNKLKLPLGIFRPIGLQRKIV......RE.......
A6CHF0_9BACI/8-175..........----................................NYIRNRELFGMDFVFDEIP......NK.......
Q2GUC2_CHAGB/19-224..........----....................GRPVGGQVGRVLRGMTSSPFYDIADLQQSIR......SV.......
Q9XAG3_STRCO/16-207..........----.........................TFGMTVRYLWAALGSRDPETVVRRLG......RL.......
Q2JEY3_FRASC/11-221...PRMRMGS----P.RLL...........TASARHPRRSSPMVTLAAMLPQGRGKISAVGDLVT......AA.......
Q8R6F6_FUSNN/65-256......LSLE----K.KE.............SLKKYSVHLSFDNELNFSFPKGLRGTGEAYLLLK......GL.......
Q9ZCV7_RICPR/15-214..........----H.................NIFPEGLTFRKLWSCNGLFSYKFSPDPLVKLLK......KY.......
Q038G8_LACC3/6-159..........----....................................NGPIFLRRHFVPVLD......RM.......
A5IE43_LEGPC/25-249...PGVSAIT----R.DGK...........PLEDFIRENIISSVKTNIASIEKIETIAASDQTLQ......DL.......
Q4UJC7_RICFE/42-240..........----....................APKIFEHHWYDGIKQIFTHKHSQGPLKEILE......QH.......
Q54HM9_DICDI/140-357..........----...........................KGTVKNFLVGATLANSDKKEQELI......KV.......
Q2K9E1_RHIEC/30-248..........----......................LAFSQIFADGPSFLKGAFNPFSSAAEEVA......KL.......
A4IAC8_LEIIN/190-378..........----...................GTPTADSRWKRFHRLLHTGEVCDPVALADFLQ......RS.......
Q21S96_RHOFD/26-231..........----.............................LRNLLREQPIFPHGDIYRDAIL......GS.......
A5GF97_GEOUR/15-187..........----..............................IKSVFTGKGIYEGKALESWVD......EK.......
Q1CW69_MYXXD/353-514..........----...............................LTLAATAAIVTTYSLERFVE......QD.......
A6NV66_9FIRM/7-176..........----.............................NLLRPGNHRCYFGLQFTYDTIP......NE.......
O05770_MYCTU/181-420...RHGLAGM----F.TL............RFDQFAHTLLSRADGERMRMSDLAIPFDVVVAGVR......RQ.......
A0YM74_LYNSP/12-230...YHLISYA----A.QTF...........IPTFREWMLDFLVESGILKDRTAIYDPTPIESLVR......ET.......
Q5X5T5_LEGPA/27-309QAGSSVDYSS----I.SHEQ.........KGSQLDTESSLAEAKLVTKPSKLTFAIASKGAKLVEAMEHVMRMAIFTHFP
Q2GS92_CHAGB/73-327......VVSS----I.DF.............PLIYRRSTWPTKRTSSFFDTFAKFTVTATGRTLP......GA.......
Q1ZT25_PHOAS/33-203..........----..........................KYLSKQQPMNLDWALQVVSPSGELA...............
Q5CY77_CRYPI/46-241........CK----T.P...............LKKNYARWAVSFLKGWISSRNPFRYLCDNSPAR......KL.......
A1KQ60_MYCBP/806-965..........----.................................TLPSKGLIRGKRTQSTLR......TI.......
PATA2_SOLTU/32-227..........----..........................HIFNSSTGQFFGPKYDGKYLMQVLQ......EK.......
A6G7S9_9DELT/458-735AKLFMGLLNP----V.SMFSDDV...TAVATTLLTAEANGLDDHLRRVLNLATMTHGMHCMEPLR......RL.......
Q3JTM5_BURP1/13-264..........----..........................LLRPPLGKNPGSLLKGDEYFLPGIR......NA.......
A4F8K0_SACEN/17-281..........----...................ARQVPKLWDARPPSLLEGDGYFRTELARTISE......GV.......
Q2R2X0_ORYSJ/139-303..........----......................................AFRLGAVLKDVLD......RF.......
Q0A7T0_ALHEH/6-219.......WRH----N.L..............TTGLHWMAAMALGGLGGHNPRSLLDNEPLAELLR......RN.......
Q3Y1A6_ENTFC/138-323..........----M.................AAVEDLRERFYRERRQMTKTALIEGGVSSAPLE......KM.......
Q052F4_LEPBL/13-188..........----........................GRKLISPFHPFQGKTFLDQEYLVDDLF......GH.......
YL620_MIMIV/38-270..........----........................YYAPFTLYRFLTKGHLYDDTNRQTLVK......K........
Q0FZD9_9RHIZ/20-226..........----............................TTLNEIQEDGLTPHQRIYREVVT......EV.......
Q5A7P0_CANAL/211-417........CD----T.S...............QIQGSFKKVLYYLGHWIQYGTIFDIEGLQDTMI......GF.......
Q11UC9_CYTH3/381-624......VNDL----F.FR.............FQKFTDGNHEYYKDRGYAFEQKLHENTNYVLYKR...............
A6ASA3_VIBHA/5-186..........----..............................WYHNYLYSSRYTNDGLKEAIN......AIF......
Q1D826_MYXXD/142-382.........F----I.S...............TESRYGLPAALRLFLRAGLGRFFSAGPENSGMR...............
A0AZM8_BURCH/61-294..........----L.................AENLKFDMAEQLANPEFLGGYIFGHTNRTDAFF......AA.......
Q5CE49_CRYHO/149-342..........----.....................HDCKKTLSKNAPLFIFRAITEGKKLPNYLCSTYPMLIF.......
A4HB10_LEIBR/40-220..........----..........................FHWFRLGKYLMAAIDDFGASLRAIDTDPRMRQV.......
Q0RZB6_RHOSR/7-221.........T----G.S...............LTRGGLRYLGQLAGLPMRLPSLFDTTRMRETIG......AL.......
A3QTZ2_9VIRU/28-255..........----G.................LFDEMPEKASTYMWITSILKTFNLISKTQTLLD......LW.......
Q1D5W1_MYXXD/154-432..........----..................DQLDLGRLLPEERNEPPQGTHLFSEPHMQDTLQ......LI.......
Q09D74_STIAD/17-214.........N----E.R...............MTRQFKVKAINILRLISGLVPMYDGKAIREILE......ET.......
A4BNM2_9GAMM/38-218..........----...................HVAILRSLLLRPFGRFLPDGLIQGRRLALLID......AG.......
Q4LA62_STAHJ/11-202..........----.......................DMSGIFERYAQIQEHSKSPKEWIENYSV......YA.......
Q5ZPA4_9DELT/22-208..........----.........................PLSNQLGALVGQSALMPSENMARALT......HI.......
Q6A6E2_PROAC/25-319HRGPEQTKVP----DPAEPVAGRDDDRLTGQARTLEIATRDDPITGGSWTPGVILQLLSALSRLSRDGGDIST.......
NTE1_PICST/1239-1403..........----............................SVFDLTYPVTSYITGYEFNRGIW......KI.......
A4SJS7_AERS4/8-174..........----..........................RFVRGGHWLDLDWLWEITIRECRLD...............
Q1I961_PSEE4/42-302....QDFIES----W.LG............GAGKFKLAFKAAQVIDNLQNDLGLNPGTAFSVWLE......QL.......
A7RB12_PBCVA/19-192..........----................................NFVNTFGLDTGVHLSRWID......IV.......
Q0VPN6_ALCBS/36-193..........----...................................PGLGLLSGQSFRTMLA......AL.......
A6G1N7_9DELT/36-362....GAELPA----G.SM............ASVITSSLRDALFEAIREGGEQNIWNRAVAKIYLEPFGLVDPQKVLAPCL
A6QA07_SULNB/41-281..........----...................VHLGLEDLIIEGADPDNHSTLFTRKPLVKKAQ......KI.......
Q5WWS2_LEGPL/304-496..........----..................................IDRNGLSDTHSLKTALD......YA.......
A0Z6H0_9GAMM/8-199..........----.....................GSQIFGKNLWRQFRSALGIFDESYSASPLE......AA.......
A6LMU7_THEM4/5-176..........----.....................IYTEKLEKSNLWSIFQRALVPIDEYYKFFK......YL.......
A7I0A5_CAMHC/6-211NFGHFSKIPN----F.KKDF.........DFCAPQKFFYQLANAALPNFINEGFFKRENLANFLR......TN.......
Q579N6_BRUAB/13-187..........----.....................RMWQTRPAHWAELFKGGLRVSQFNIEKVLD......VF.......
A6G3Y0_9DELT/12-216..........----.............................RRVFSRRDRAFPHDGIYRGTIA......AI.......
A1DP95_NEOFI/20-225..........----Q.................RSLHLRHGKSEPQRSLHLGHAKFDPQRCASELR......SI.......
A5K2I7_PLAVS/1168-1482..........----.........................MYAVRNTRYLFKHSYYDANILSNILNSFFKNMKMFHYNADF
TEG_BACME/7-180..........----...................GGPVFNQQVPYSGLIKAIRTFFPRDLRLRDLK......KR.......
Q2W5X1_MAGSA/6-225........YK----V.F..............MKGSKVAEAYRWLISKLPGYNRIMNQFSMTKRQKFWSDLIQM.......
A4U0C8_9PROT/5-257.......AIQ----E.A..............WMDILRFAGDPSQWTQANFNSLILNQVLAVNPLS......RF.......
A5N2W9_CLOK5/4-191.......QKF----M.N..............RNIDKETLIYILSAMKNIIENRGIDTKKMREILN......NI.......
A4JJZ7_BURVG/8-242AGAVLAPTRA----L.GRVL.........KAARVAAAMLDVTLPKSLDMLANGLASDKPLKALMD......EY.......
A6R0J1_AJECN/673-891.........A----L.................LVRKSFAGRLYGWLTWWLYDGLYDSAVLESLLK......EI.......
Q6MR93_BDEBA/72-224..........----................................LLGGVNKNNEVTVLKDFVG......VA.......
A5P920_9SPHN/106-312..........----...................EDEGEVVDNKGMFQMLLRGAQAGTAPLRKRIR......HA.......
Q2C291_9GAMM/11-214.MKNWADAQQ----A.IWQ..........GQPGFFKPKLWPSEFETYKTSELSYYDTSPLKETLN......EL.......
A1VHY7_DESVV/116-308..........----........................RWLGGDLQRLVRDFGWFKGEVLERWAR......SN.......
A7BB55_9ACTO/26-199..........----...............................KHFRKGHGYFNAEYIYERICY....PDG.......
A5I1W5_CLOBH/6-200..........----....................AIKKFPLAKKSLGLILEKGIFSTVYIEKYLE......EM.......
A8GLS3_RICAH/7-147..........----............................DQVYNLVFYGWLNSEKYLEEFLG......QL.......
A4T0K7_POLSQ/80-285........TP----N.I...............SQMRADQINMSATDGSIETRKIIGAAALAADNK...............
A6DDL8_9PROT/5-162..........----...................................LKTGLFKIDLNSTILD......KF.......
A4CKZ2_ROBBH/4-195........SH----K.Y..............GVDSIGINHWNVLRNFMRGSKTFGESHNLLKLIR......KT.......
Q18D71_CLOD6/5-179..........----..................................IVNNTVDNSPAIDNLRE...............
A7FHA4_YERP3/86-275..........----...........................NNLLFRLFFRESLADTSPLSQLID......GH.......
A6S7X3_BOTFB/21-291..........----.........................ETDKTIAGIPYRSTLFKASKLEEAIKECVREHTL.......
Q04WY0_LEPBL/36-250..VFPHEEMY----R.KTI...........RFGMDFQKIVKSEIKVFIHTLKAIPKEDSLRNKFR...............
Q12EZ0_POLSJ/6-228..........----..................QTDLQKAAMLAMLRPANWRFALSRANVLASAIGSTWGVDAL.......
Q1GX66_SPHAL/43-328....LSRMTK----F.WA............VPIAGWAMKRRGNSIDRTVGEAAQDEVRAKLSRFVRARWFEPP.......
Q4RS54_TETNG/14-183..........----.....................................GPMHPSFNLVKIVR......HM.......
Q5C8M6_LEGPN/32-295KKHLESVQQP----I.PPEQQ......MNYGILKQKIALYEDKLSRAGIVINNVDDIINLTKSVKDLEKLDKA.......
Q6JBI3_DICVI/201-395..........----.......................SQNRLSGVSGVVLNHSYYDTKKWVKMLK......ET.......
Q0FKF7_9RHOB/6-360FFGALFGLVL----T.VGLIAL.....DLRRLVVRDLPANRFGLLPGTTQPGG..EGPGLTDWLADKIDIVAGNLGADGK
Q8Z7F2_SALTI/8-168..........----...............................DVSWGRGGLLRGKRVFNHYR......DI.......
Q6ASS6_ORYSJ/60-258..........----.........................RDWAGRRGRWARLFRGGARGAERSFR......RV.......
A6QX75_AJECN/242-440....GWNILS----L.LA............RDNGYGRLPSLIRRTEEYIRESYFPDLKLLEEYVK......ST.......
Q74A07_GEOSL/58-306..........----..........................LVRRLFNPYNWWRLASPDFSRIDMAEEYYNDTV.......
Q54XY1_DICDI/13-231..........----...........................WDEVKGVFTRGEMFNSDELINIANSWFPSSPD.......
Q55G69_DICDI/65-250..........----...........................MGIMYNVYEESTLCSTKELISTLE......TN.......
Q5Z158_NOCFA/22-193..........----................................RLLRGGAAFDVRYLVHRVY......DG.......
Q54QX6_DICDI/893-1088..........----............................FNFITYPLIKPKYRRDKLRESFK......TI.......
Q629U3_BURMA/413-612..WLSSYVLS----F.GVP...........NFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIA......RY.......
A2QZY6_ASPNC/473-679..........----H.................PPLRTTWNKLIRTILCWWKDGWYDAGLWDGLLQ......KE.......
A4XTW9_PSEMY/15-385PLLWLWLLGC----A.GIGALTAI.GWRMLRQISREMPANGFALCSGMPGPDDQAPDEVLTPWLT......EYLDRLCGQ
Q0E508_SFAVA/27-224......LKLS----I.T..............PMVRSNRVTIGASVMTLFNMLALFGVAKFIEEFE......DF.......
A6GI17_9DELT/71-215..........----............................PALHHLRDASRYLSSGSLLESLR......LP.......
A7IE20_XANP2/6-198..........----..........................PWSIAGTVLGNNAAMTTGRIKTFCD......EV.......
Q1DCU7_MYXXD/197-406..........----...................SDLYCVNNTWIWKIASNLRGLVQFDGIYGKLR......AA.......
Q6MAN6_PARUW/474-738IQKKGVSNSK----F.KIAFNL.....IFNWVDWWGIPCDQKKILKERYASGGLCKGEYLRELIE......KK.......
Q4Z1R8_PLABA/352-558..........----.....................NIISGIFFEGYDINNVKELFMEHIGNKFLASCKNLYCF.......
A4RTL4_OSTLU/164-398..KEAHIDLV----R.PFV...........RFGRRSRNALAARNGASTIETATMADVGTLAETLSDDDGDSKF.......
A0JUC4_ARTS2/74-249..........----............................PLGDYVKGPWSLPAIGDAGGLLG......KV.......

PF00698

FAS_HUMAN/493-810--------------AAVGL....SWEECKQR.CPPGVVPACHNSKDTVTISGPQAPVFEFVEQLRKEGVFAKE-------
STCK_EMENI/1547-1902--------------NGRTD..................YGMVAADPSRIRSDFTEDRLIELVRLVSQAT..GVL-------
ERYA2_SACER/2014-2333--------------VSVGAS..RDELETVLARWDGRVAVAAVNGPGTSVVAGPTAELDEFFAEAEARE.MKPR-------
ERYA2_SACER/560-881--------------AAVALG..EAAVRERLRPWQDRLSVAAVNGPRSVVVSGEPGALRAFSEDCAAEG.IRVR-------
FAS_CHICK/492-809--------------AAVGL....TWEECKQR.CPPNVVPACHNSEDTVTVSGPLDSVSEFVTKLKKDGVFAKE-------
FAS1_YEAST/1663-2037--------------LGRSN..................YGMIAINPGRVAASFSQEALQYVVERVGKRT..GWL-------
PPSA_MYCTU/632-952--------------ALLEL...DAPTTEALIADFPQVTLGIYNSPRQTVIAGPTEQIDELIARVRAQN.RFAS-------
MCAS_MYCBO/534-852--------------GSVELPAKQVNSELMAR.GIDDVVVSVVASPQSTVIGGTSDTVRDLIARWEQRD.VMAR-------
MSAS_PENPA/567-882--------------ILVNLP..SAETEEILG.SRSDLVVAIDSSPSSCVVAGDKELVAETAEALKARG.VKTF-------
ERYA1_SACER/57-373--------------AAVALS..ADEIEPRIARWDDDVVLAGVNGPRSVLLTGSPEPVARRVQELSAEG.VRAQ-------
ERYA1_SACER/2508-2828--------------LSVRGGRSDVEKLLADDSWTGRLEVAAVNGPDAVVVAGDAQAAREFLEYCEGVG.IRAR-------
ERYA1_SACER/1031-1354--------------ASIAA....PAGEVRAR.IGDRVEIAAVNGPRSVVVAGDSDELDRLVASCTTEC.IRAK-------

PF01735

PLB2_SCHPO/134-617----------------FVMGTSATLFNTFLLE.WSQEV....TSNSTLYDIIHKVFE.KLSEDQN.DIAPYP..NPYQNF
PLB5_SCHPO/125-607----------------FLMGTSSNVFSGILPA.TNASL...TASNNTFNNAVLSFLE.MLAEDQL.DVGLYP..NPYQGY
PLB1_PENCH/88-571----------------FVIGTSSSLFNQFLLQ.INTTS.....LPSFIKDVFNGILF.DLDKSQN.DIASYD.PNPFYKY
PLB1_YEAST/99-586----------------FITATSSTLFNQFLLR.LNSTD.....LPSFIANLATDFLE.DLSDNSD.DIAIYA.PNPFKEA
PLB2_CANAX/87-564----------------FFMGTSSSLFNIVLQQ.LNNMP.....IPPFLKELISKFTL.DPVEKLNIDIAQYN.PNPFHKS
PA24A_CHICK/190-675----------------VWGSAFSILFNRVLGV.SNSQNKGPTMEEELENIRLKHLVS.NDSSDSE.DESQHPKGTENSEA
PLB1_TORDE/97-584----------------FIMGTSSSLFNQFLLQ.INSTS.....LPSFIKNLVTGFLD.DLSEDED.DIAIYA.PNPFKDT
PLB_NEUCR/121-606----------------FVMGTSSTLFNQFLLANISSYD....GVPDVLIEAVTSVLK.EIGAKRD.DVSQII.PNPFLDW
PLB_KLULA/102-589----------------FVMGTSSSLFNQFLLQ.LNTTD.....LPSFLYNLLHGFLT.DASDDYD.DISIWA.PNPFYEI
PLB6_SCHPO/114-600----------------FLVGTSSTRYNEALID.VSLRQS..RMS.RRLGFTLRHMRI.NGSS.....VSFYP..NPYTDA
PA24A_DANRE/185-664----------------VWGSAFSILFNRVLGV.KETTSS.STMEEELEQIKPEHIVG.DDSADNE.EETQRG.GTESADA
PLB1_CANAL/88-565----------------FFMGTSSALFNEAVLS.ITEAN.....IPSFLKDIIDDILV.DPILKSNIDVSAYN.PNPFFKS
PLB3_YEAST/105-592----------------FIMGTSSTLFNQFLLR.INSTH.....LPSFITRLARHFLK.DLSQDFN.DIAVYS.PNPFKDT
PLB1_SCHPO/114-593----------------FMMGASSTYFNKIMRN.FNDSS.......TKNGRIIQQYLKGNFSENGQ.QIISIP..NPFQGV
PLB2_YEAST/101-588----------------FVIATSASLFNEFSLE.ASTST.....YYKMINSFANKYVN.NLSQDDD.DIAIYA.ANPFKDT

PF01734

Q9N5Z7_CAEEL/97-269................VEKFLPDDVAKANDLL-...............................................
Q8F079_LEPIN/12-165................LGHKKIEELSIPMGIS-...............................................
B8GC44_CHLAD/8-228................LREGQEASLLDLLETL-AVGLPTGIYDSQ..........................ALERYVRV.
C1DSE3_AZOVD/14-206................LNPLNVNPLRDILASL-V..............................................
A9BEP0_PETMO/3-174................FGNQTLSSLRKNVSFE-...............................................
A9B328_HERA2/4-179................LPPNIRRFSDLAIPFF-...............................................
B2U808_RALPJ/9-214................FSEGRFGRLAQAPEIR-IGVAHIPRWLG.............................ARSAVA.
Q3AAC7_CARHZ/6-206................LGTLNINQLKEQVAVI-...............................................
A6CHF0_9BACI/8-175................IVPYDYEAFHNNQSEF-...............................................
Q2GUC2_CHAGB/19-224................LRARGIESDEPFIERE-GP.............................................
Q9XAG3_STRCO/16-207................ALSVRDVPQSAVFAAI-GA.............................................
Q2JEY3_FRASC/11-221................MDRKGLDPTEWPTRPA-...............................................
Q8R6F6_FUSNN/65-256................LGKYEHMDNFDNFPIP-...............................................
Q9ZCV7_RICPR/15-214................CKDYTLKDLIGEVIVT-...............................................
Q038G8_LACC3/6-159................LQAPKLDSRAVLAVTT-...............................................
A5IE43_LEGPC/25-249................LAKLKTKFPVITFGDL-ALL............................................
Q4UJC7_RICFE/42-240................LAGLRLDDTTSRLIIP-...............................................
Q54HM9_DICDI/140-357................FGNNTMGNFAQNKKLF-VVVSKLKHNNSLLQ.......................QQQTPQQTF.
Q2K9E1_RHIEC/30-248................YERHLFDGRSPSLSDL-PVSP...........................................
A4IAC8_LEIIN/190-378................IGDVTFAEAFARTGRV-...............................................
Q21S96_RHOFD/26-231................IDEQALSRLHQGPKIS-VLISYPPPWAC.............................AHMAML.
A5GF97_GEOUR/15-187................LKGQKFSDDFRIPPHV-...............................................
Q1CW69_MYXXD/353-514................LGRLCLEELAIRFLPV-...............................................
A6NV66_9FIRM/7-176................LIPFDYETFAAFPGEV-...............................................
O05770_MYCTU/181-420................PYAALPSRFRHRERST-LTLRSLP.....................................FL.
A0YM74_LYNSP/12-230................INPVELRRGIELWVTV-FPS............................................
Q5X5T5_LEGPA/27-309ESLDNELKNVHEKLNAIEDKGSAEYINLAKRQ-QILEDTQKIING..........................LHDPNFDL.
Q2GS92_CHAGB/73-327................LASPTVSRASSQASAA-SSEFR..........................................
Q1ZT25_PHOAS/33-203................LDFHTAKRTLKHRQAF-...............................................
Q5CY77_CRYPI/46-241................LRELFLHRKHKQRLFF-...............................................
A1KQ60_MYCBP/806-965................FGDHLVEELPKHFRCV-...............................................
PATA2_SOLTU/32-227................LGETRVHQALTEVAIS-...............................................
A6G7S9_9DELT/458-735................ITEHTRPALIRAAGTV-LRLGISDAKS..............................GTFFSV.
Q3JTM5_BURP1/13-264................LQHMARNRDAARTDLP-IDLRLTTTLLSGVQ.......................GNTVDDLGT.
A4F8K0_SACEN/17-281................AEGDGARDVSRRADLL-LTATLLDPVI..............................ERHFDG.
Q2R2X0_ORYSJ/139-303................LPDDVHIRCNGRIRVA-...............................................
Q0A7T0_ALHEH/6-219................LPLDGIRMAIHRGALR-AVG............................................
Q3Y1A6_ENTFC/138-323................VKDNLDLSLLKHNPKI-...............................................
Q052F4_LEPBL/13-188................KYPLPAENFEKFGLPE-LRIA...........................................
YL620_MIMIV/38-270................ILNINIETIRSHLDLP-IDSDFEGTD................................ITFWH.
Q0FZD9_9RHIZ/20-226................LDDDAIQAVIDGPQFQ-VLIAHPPTEIL.............................PKWSTF.
Q5A7P0_CANAL/211-417................LGDLTFREAYNRTGKI-...............................................
Q11UC9_CYTH3/381-624................ISDYKKPEEEAQIPML-ILSPTIINDGR.............................KLYISP.
A6ASA3_VIBHA/5-186..............GDFAQKTMQDLKAHSGID-...............................................
Q1D826_MYXXD/142-382................LKDLPVPTLIAVGGIR-RGMLPRPLEYYER.........................LLGTSPLG.
A0AZM8_BURCH/61-294................LNSSVLFGLSPAKRQL-TLGDFNPNR................................PQIII.
Q5CE49_CRYHO/149-342................MRHLLQNRKRFKGPKW-...............................................
A4HB10_LEIBR/40-220................LASGSLEIGVTVLPKL-...............................................
Q0RZB6_RHOSR/7-221................VSFEKVQENIDRGLVE-AV.............................................
A3QTZ2_9VIRU/28-255................LDSDSPGLSTEDTLLR-LLNEIILPLSP.............................HRDLIE.
Q1D5W1_MYXXD/154-432................LKKAQTTRFKEDCTFA-YGITVTNLRGREVPFGEGGPDA......QFKLKRVTEKLVVQVMTQ.
Q09D74_STIAD/17-214................FGEAKLCELEKMVVIE-...............................................
A4BNM2_9GAMM/38-218................LKVKDFQSCTIPFRCI-...............................................
Q4LA62_STAHJ/11-202................LEDHKFNESVHITRLE-H..............................................
Q5ZPA4_9DELT/22-208................LGDKTLRDLKRKVVIP-A..............................................
Q6A6E2_PROAC/25-319................IVRGAETSASTYRAGP-ILAKLLDR..................................GFFK.
NTE1_PICST/1239-1403................FGFTEIEDFWIRYFCN-...............................................
A4SJS7_AERS4/8-174................LARFAVNQVPLTVVTT-...............................................
Q1I961_PSEE4/42-302................MAREGVHDFASLAKRM-QTMPDGLRL................................RSGVP.
A7RB12_PBCVA/19-192................LGNKSYTFQSILEETG-...............................................
Q0VPN6_ALCBS/36-193................LPIQRMEHTLAPLAVS-...............................................
A6G1N7_9DELT/36-362DAATRDAIRARPGNAGVPGLEPDNFIFPRPGR-PFLVVNACIVEPDDTRAFAAQNPISLQCTPLYVGSLQPLKIRYAGEP
A6QA07_SULNB/41-281................MQHMKKPVFREGCEIP-MAFAVTKVTPIVE.........................EYQGIKIK.
Q5WWS2_LEGPL/304-496................IANKVRQIVNKYKIPY-PKGKITFS...................................TLA.
A0Z6H0_9GAMM/8-199................LADYFDNNVLGDCRCP-...............................................
A6LMU7_THEM4/5-176................FERKKFSDLKYKIGIV-...............................................
A7I0A5_CAMHC/6-211................ISTSKILNGIPLFIAL-...............................................
Q579N6_BRUAB/13-187................LPDSFPSNVEDLKIPM-...............................................
A6G3Y0_9DELT/12-216................LERGGFERVRESVPVH-MLISHIEPGY..............................PLVRTS.
A1DP95_NEOFI/20-225................LVQSGYEENALFGESE-PS.............................................
A5K2I7_PLAVS/1168-1482FTPYVFTVSTQMNVTPLQPVILKNYTANLGKI-KGGKEADGGDAYTSSNYDHVGDGEEQEGGDAEGWDGQQNGEVGVEDA
TEG_BACME/7-180................IVVPAFHLFAPELNRW-...............................................
Q2W5X1_MAGSA/6-225................FWALTTPSTVNVFSKG-LCANA..........................................
A4U0C8_9PROT/5-257................VTSLMYKSKTRGLSRI-YYPDSAF....................................LQQ.
A5N2W9_CLOK5/4-191................IDEDKLRKSKIDFGMV-...............................................
A4JJZ7_BURVG/8-242................LDPAALNAGLPLYVSL-FRS............................................
A6R0J1_AJECN/673-891................FGEFRRTFHAAGPDGS-GALISGT.....................................KV.
Q6MR93_BDEBA/72-224................FNRTKVEDFKIPFACP-...............................................
A5P920_9SPHN/106-312................IYENGSAEFLDAIRNS-SI.............................................
Q2C291_9GAMM/11-214................IDFDYLNQKEVRLSLC-...............................................
A1VHY7_DESVV/116-308................IGVLTGKPHMTFGELR-QR.............................................
A7BB55_9ACTO/26-199................ILPFNMDAFLANPART-...............................................
A5I1W5_CLOBH/6-200................FKNKGKTKFKHISLNG-...............................................
A8GLS3_RICAH/7-147................LKDNGFDPDITFKQLH-...............................................
A4T0K7_POLSQ/80-285................LNSNHIEKLAGLLTGD-SK.............................................
A6DDL8_9PROT/5-162................FLYDDLSKSDIPLFIC-...............................................
A4CKZ2_ROBBH/4-195................ITKEEFQTLKTGPKDL-...............................................
Q18D71_CLOD6/5-179................LDDSNIEEMNFYVNYV-...............................................
A7FHA4_YERP3/86-275................ITPQLLSEIAKAHKGG-R..............................................
A6S7X3_BOTFB/21-291................FEKEGNDGDKSATGSA-FPGSPISPFSPTARGEPRRHSSNASVASFSNRNPASYQNKPYMSSRW
Q04WY0_LEPBL/36-250................LARLIAETAKAFLEDE-RD.............................................
Q12EZ0_POLSJ/6-228................LDELPASPVWSINATT-...............................................
Q1GX66_SPHAL/43-328................FGGETFSHLLFDAFAA-MDAAPRGPVLVPDG.......................QPVDLFVSV.
Q4RS54_TETNG/14-183................MGRTLPDGCHHQASGR-...............................................
Q5C8M6_LEGPN/32-295................LNSIPTELKGAKGEQL-ENPRLTLG..................................DLGR.
Q6JBI3_DICVI/201-395................IGEELTLIDTSKESVP-RLS............................................
Q0FKF7_9RHOB/6-360PGPPLTVGALDERNIELAAMTTDLTSKRPFQL-PLRSGHHFF................................SAQEF.
Q8Z7F2_SALTI/8-168................MPVTDFDHCSRRFGAV-...............................................
Q6ASS6_ORYSJ/60-258................FGDATLKDTVAPLLVP-...............................................
A6QX75_AJECN/242-440................VGEMTFEEAFAKTKRC-...............................................
Q74A07_GEOSL/58-306................FGGKTFADLVAAPGKR-A..............................................
Q54XY1_DICDI/13-231................GADTQITELNEKKFFV-VSLKKTGE..................................KNDI.
Q55G69_DICDI/65-250................FQGKIMSDRKGFVVTV-...............................................
Q5Z158_NOCFA/22-193................VEPMDFDAILNHATTF-...............................................
Q54QX6_DICDI/893-1088...............FPSDEKLKNSFSKIRVA-VTS............................................
Q629U3_BURMA/413-612................VDFDSLGMSPTRLLIG-...............................................
A2QZY6_ASPNC/473-679................FGVDQGMFDVQPVSGT-...............................................
A4XTW9_PSEMY/15-385RQACASNADSIERERPLTFGELRRHGIDLQMM-TTCASMARPFRLPFR....................NDEKVRENNQF.
Q0E508_SFAVA/27-224................IFDLGHDRKITFEELH-...............................................
A6GI17_9DELT/71-215................M...............-...............................................
A7IE20_XANP2/6-198................FGAGAILADVKRPVLV-...............................................
Q1DCU7_MYXXD/197-406................VVPEQLTNGTELVAVS-...............................................
Q6MAN6_PARUW/474-738................LTEKVEKHQGTKINHL-TFGELR.......................................E.
Q4Z1R8_PLABA/352-558................VTATDVKHNPYKLFLL-...............................................
A4RTL4_OSTLU/164-398................AVDPAMNVNYLLETVM-GGETG..........................................
A0JUC4_ARTS2/74-249................FPALGINEGEIRRRAA-...............................................

PF00698

FAS_HUMAN/493-810----------------VRTGGMAFHSYFMEAI--------------------------------------APPLLQELKK
STCK_EMENI/1547-1902----------------LEVVNYNVHSRQYVCA--------------------------------------GHVRSLWVLS
ERYA2_SACER/2014-2333----------------RIAVRYASHSPEVARI--------------------------------------EDRLAAELGT
ERYA2_SACER/560-881----------------DIDVDYASHSPQIERV--------------------------------------REELLETTGD
FAS_CHICK/492-809----------------VRRAGVAFHSYYMASI--------------------------------------APALLSALKK
FAS1_YEAST/1663-2037----------------VEIVNYNVENQQYVAA--------------------------------------GDLRALDTVT
PPSA_MYCTU/632-952----------------RVNIEVAPHNPAMDAL--------------------------------------QPAMRSELAD
MCAS_MYCBO/534-852----------------EVAVDVASHSPQVDPI--------------------------------------LDDLAAALAD
MSAS_PENPA/567-882----------------TVKSDIAFHSPTLNGL--------------------------------------VDPLRDVLAE
ERYA1_SACER/57-373----------------VINVSMAAHSAQVDDI--------------------------------------AEGMRSALAW
ERYA1_SACER/2508-2828----------------AIPVDYASHTAHVEPV--------------------------------------RDELVQALAG
ERYA1_SACER/1031-1354----------------RLAVDYASHSSHVETI--------------------------------------RDALHAELGE

PF01735

PLB2_SCHPO/134-617TTT.NTTVKN.........PFERFDTIDLVDGGEDD..ENIPIWPLLHP------QRFVDV-------------------
PLB5_SCHPO/125-607GNASNTTTTN.........PLEPYPIIELIDGGSDS..EGIPFWPLLHP------QRDVDV-------------------
PLB1_PENCH/88-571N.....EHSS.........PYAAQKLLDVVDGGEDG..QNVPLHPLIQP------ERHVDV-------------------
PLB1_YEAST/99-586NFL.QKNATS.........SIIESEYLFLVDGGEDN..QNIPLVPLLQK------ERELDV-------------------
PLB2_CANAX/87-564N.....NSDT.........KIAQSRTLYLADGGEDG..QNVPLLPLIH.------.RKVSA-------------------
PA24A_CHICK/190-675NEE.YQNSSQESWVQRMLMALVGDSALFNTREGRAGKVHNFMLGLNLNS------CYPLSP-------------------
PLB1_TORDE/97-584SYI.QDNFSK.........SISESDYLYLVDGGEDN..QNIPLVPLVQD------ERNVDV-------------------
PLB_NEUCR/121-606N.....NRTN.........PNADTLELDLVDGGEDL..QNIPLNPLTQP------VRAVDV-------------------
PLB_KLULA/102-589TNI.PSNYSQ.........SISEDDTLYLVDGGEDG..QNIPLTPLLQT------EREIDV-------------------
PLB6_SCHPO/114-600TDI.AGNATAV......SEDIVDTPYLDLFDGGYDG..QNIPIWPLLQP------ERKLDV-------------------
PA24A_DANRE/185-664EDE.RQRHAQASWVQRMLTSIMGDTTLFTTREGRAGKVHNFMLGLNLNS------TLPFSP-------------------
PLB1_CANAL/88-565S.....GSNT.........AISQSKNLYLVDGGEDG..QNIPISPLLH.------.RNVSA-------------------
PLB3_YEAST/105-592KFL.DSDYTT.........SIVDSDSLFLVDGGEDD..ENVPVLPLIQK------ERDVDI-------------------
PLB1_SCHPO/114-593ESA.NSDAAN.........NLGSSSSLNLVDTFLTG..EKIPLWPLLQK------GRDVDV-------------------
PLB2_YEAST/101-588EFV.DRNYTS.........SIVDADDLFLVDGGEDG..QNLPLVPLIKK------ERDLDV-------------------

PF01734

Q9N5Z7_CAEEL/97-269.............................FVSVTKLKTWKNELISNFES......KIDLID...................
Q8F079_LEPIN/12-165....................................VSNITKQIRELKT......KGDLID...................
B8GC44_CHLAD/8-228AL..........EQPGRSNRFHDLDRELLIIATDLDSGERAVFGLPPLD......QVPISL...................
C1DSE3_AZOVD/14-206...................DFERLRTDCPLKLFIAATNANTGRLRLFRS......HELSVD...................
A9BEP0_PETMO/3-174...................................VFELKNKEVIILKN......ETKIVD...................
A9B328_HERA2/4-179...............................VTATNYRTGDMHLFGDDP......RERLVD...................
B2U808_RALPJ/9-214AG...........LIAYNIEKHVRKTLHPTLGKRLGFTAEIVRAQDCAT......PEDLAD...................
Q3AAC7_CARHZ/6-206...................SVDLYSGKRVVFGNFPGEFLRGINDYIAVR......DALLVT...................
A6CHF0_9BACI/8-175.............................VIGTTDCHTGEPVYHYKKDY......GKDVLT...................
Q2GUC2_CHAGB/19-224.................GCKVILCATRVETGKADVLRNYKSGHPTAENY......SCRIWE...................
Q9XAG3_STRCO/16-207..................QLPVRDWPDRTVRMFAVDALTGEPTAFDADS......GVDLLH...................
Q2JEY3_FRASC/11-221...........................LRVVAMNFDTGERVLFGVADAP......RATLSE...................
Q8R6F6_FUSNN/65-256................................LRIIATNLNTGETKAFS......KGDVAK...................
Q9ZCV7_RICPR/15-214........................GYDLNNQQNPLITFSTIEARKSQDN......NYYLSD...................
Q038G8_LACC3/6-159.................................SVPDFQAHVTRLDVLT......APEARE...................
A5IE43_LEGPC/25-249.................NHHFPDKFKQLNMPAVEFPNGAIQVFNSTLTP......DVEIAL...................
Q4UJC7_RICFE/42-240...........................VTDLASKDKEVKIFDSHDSYSP......HIRVQD...................
Q54HM9_DICDI/140-357INQ.........STPSSLQQPQQQQILINQQQESEFKTKIISNYNKKYE......NVKVSE...................
Q2K9E1_RHIEC/30-248................WFVFCASNLSTGSLFRMSNRYIADYRIGLSFHP......ALSLAT...................
A4IAC8_LEIIN/190-378...................LNIPFVSASPVMPRRNADVDVQLLNYLTSP......DVLVRS...................
Q21S96_RHOFD/26-231LG...........MLAYGLKACNKDAVHSLTGQRVGFRPLFISVQECVT......PGDLAD...................
A5GF97_GEOUR/15-187..............................IATDILNYKPVIFSAKTFP......DLKVAT...................
Q1CW69_MYXXD/353-514....................................TTDLTSGDCVALE......QGPVAL...................
A6NV66_9FIRM/7-176...........................EAVVTNMDTGKAEYLPVPKQDE......HFELLQ...................
O05770_MYCTU/181-420P.............IGIGPWVAARMWQVAAFIDLRVVKPIVISADGATR......DVNVVD...................
A0YM74_LYNSP/12-230................LKIPGLGYDWLIDFIRAKTGTGAEWLCIQDCPD......NETIYN...................
Q5X5T5_LEGPA/27-309TF..........GHLHTLHQYDPQRFKELYVTGTDENGELRIFSHEKDA......DMPVSI...................
Q2GS92_CHAGB/73-327..............TDTYQCQTLAWCTEVETRRSRRPYAFCTYAEDEND......PEQLIS...................
Q1ZT25_PHOAS/33-203......................................ACATRKDTLKDIYMPMFQDDWYE...................
Q5CY77_CRYPI/46-241..............................TNTMRYTDRTAHVFTEQLE......LEEIIE...................
A1KQ60_MYCBP/806-965....................................SVDLLARRPVVHR......QGPLAD...................
PATA2_SOLTU/32-227..........................SFDIKTNKPVIFTKSNLAKSPEL......DAKMYD...................
A6G7S9_9DELT/458-735GE...........PIADGDLANYGYIDPEPDMALSADWLRQPAFGCKRF......AMRLRD...................
Q3JTM5_BURP1/13-264PVH.........DVDYRAYFHFTNMASHGTPSPQSAFDSTNDFDDRTDV......LDRLAR...................
A4F8K0_SACEN/17-281RS...........RPLTQERRTASFRFRHRGEAGDPLSDFGTGTAFDET......VRRLAH...................
Q2R2X0_ORYSJ/139-303...............................ITQLSWRPRGLLVDQFDS......KDDVIS...................
Q0A7T0_ALHEH/6-219................VTGAGYTSGRAVTFFQAAPDVEGWLKGKRVGRP......VRLGVQ...................
Q3Y1A6_ENTFC/138-323..........................RLYTVSTKLPELAEVVTDIQQTK......TEEIPD...................
Q052F4_LEPBL/13-188................VSNL..................QTRTIEYVRAT......SSNIFD...................
YL620_MIMIV/38-270LK...........KLIKKYPQIYKHLLINSVDISREQQIFMTTLDDNWD......NIKLYD...................
Q0FZD9_9RHIZ/20-226PM...........MAAYLLDLTVRSTPHVEWPAKLGADSSLVDAREAAK......QGKLID...................
Q5A7P0_CANAL/211-417..........................LNITVSPASVHEQTRLLNYLTAP......NCLIWS...................
Q11UC9_CYTH3/381-624LN...........ISYMTTASTTSTSSTNFRQKLKGIEFKKFFEEQDAN......DLHFMS...................
A6ASA3_VIBHA/5-186.........................LLITTVEMNTGKTLLINTIDEDYR......YWTLEQ...................
Q1D826_MYXXD/142-382LLN.........PVGVARRIQAAMGAMAELFTRPEITARLYLGADDTTG......DFDALD...................
A0AZM8_BURCH/61-294N............STVATAEGTTAFQPRPFGSLFTFSPSDLDSIGVNYS......TLPLSR...................
Q5CE49_CRYHO/149-342.............................NALAYHFKSALSYYFNEEVP......RSIIPS...................
A4HB10_LEIBR/40-220.......................................RSHLINSFSS......YAAIRE...................
Q0RZB6_RHOSR/7-221..................AVAATSVATGGTVVFVHKHPAIALPPFDANRNITYVETTLQPE...................
A3QTZ2_9VIRU/28-255NL..........KSITFLDLKHITNHELRCFSTQLNDMVIYEFSVSRTP......DEYVTK...................
Q1D5W1_MYXXD/154-432GEGKLT...ARLPFMEGAASASFPHIGVKPKELAYYPALGAQPTGDGGH......EVSLSN...................
Q09D74_STIAD/17-214............................AFDSTVWRKATYHQFPPDADF......VTTLVD...................
A4BNM2_9GAMM/38-218...................................ACSDDGRNRRKVFR......KGLLLP...................
Q4LA62_STAHJ/11-202...................RIKGIEWPSNLMITAINARKAERVALTSDS......QVNLHR...................
Q5ZPA4_9DELT/22-208..................FQLDDGDPDEDRRGWRPRIFHNFPGDTFVNL......DDYLVD...................
Q6A6E2_PROAC/25-319S............ELLATSGMSVRIATVALESGELRYMTESGVLVDRDNNPIGSSTFDVSR...................
NTE1_PICST/1239-1403....................................TTNITNSTMDIHE......SGYSWR...................
A4SJS7_AERS4/8-174....................................RVSDGQAAYLKGN......AAELEQ...................
Q1I961_PSEE4/42-302ID...........KPVEALFRLAIIATDVTTQTKVEFPRMASLYWDDVD......SVHPAM...................
A7RB12_PBCVA/19-192.........................MFLVICATNLTEHCPEYFSPTETP......DMDVRT...................
Q0VPN6_ALCBS/36-193....................................AWHGRSRRTHVLR......SGNLVE...................
A6G1N7_9DELT/36-362FGDVVLPMGGGAVESFAFGGEGPAQVQSGELSCVPTNPVNIQARQTLEF......AVGCSS...................
A6QA07_SULNB/41-281NQA.........FSVPLTFKVTQGRVSIINRKMPPSTAFYISIPGIEKD......TAKITD...................
Q5WWS2_LEGPL/304-496S.............LREQFPDCGIGKELIVTATNKRSGKTIYLSANRYP......LLEVSE...................
A0Z6H0_9GAMM/8-199.........................TIVTAYDLEARSTTFFKSFKPEHA......QVLCKS...................
A6LMU7_THEM4/5-176....................................TFDTLDGNSLLIT......EGFLVD...................
A7I0A5_CAMHC/6-211................................TESSDFSPFFVNVQSLD......KNEIID...................
Q579N6_BRUAB/13-187.................................TITAVDFHGAREIHIS......DGDLRS...................
A6G3Y0_9DELT/12-216AV...........AVRNHMIARRRRDLHGPGHLAPGLGYRALSSHDAQS......PAELID...................
A1DP95_NEOFI/20-225.................CRVVIYLTDWKTQKSFPLTSYESKRCPSELSM......TATIVQ...................
A5K2I7_PLAVS/1168-1482EGANGANAANTANPANTANTANPANTANTANTANTANTANPANTANPAN......AANVLEKTPHTSDIYVNQNINSVSI
TEG_BACME/7-180...................................NPVLFHNFLGSPYL......NEKASD...................
Q2W5X1_MAGSA/6-225...............PFIQEMVDFDALKTVEEDVYLNAYNLTDHKMAIF......GKDVLD...................
A4U0C8_9PROT/5-257I.............DFKRLSEPGRPVLYHNAYNLTDDRLELFSNKDGKY......QGISAQ...................
A5N2W9_CLOK5/4-191...............................TVSISDFKPLNLYKEDIP......NGKMIN...................
A4JJZ7_BURVG/8-242.................QTPFDDLLRIAAAEVGIEDTPASTYVHVQGLP......EAEQKA...................
A6R0J1_AJECN/673-891G.............VVATSISRETSTFVFGNFNGAECGKQRVRPEDDGD......DPFVWQ...................
Q6MR93_BDEBA/72-224....................................SYNLKKNQVYLMN......RGGIDQ...................
A5P920_9SPHN/106-312.................EGYVGFVEANCGHFHYADVRELVRKAPNNESA......VEALTA...................
Q2C291_9GAMM/11-214.................................AVDLESGDFKTFDSFN......ETITAE...................
A1VHY7_DESVV/116-308.................AEVEPGRFLDLTVVGANLSRETPELFNAERTP......DTPIHE...................
A7BB55_9ACTO/26-199...........................RVAAFNASRGEVRWFSKEDMST......LDTLGP...................
A5I1W5_CLOBH/6-200........................QSPLKIIASDVTNKRLLILPDDIRKYGMDPMELEISK...................
A8GLS3_RICAH/7-147............................................DSQKT......NIDLYV...................
A4T0K7_POLSQ/80-285..................TNWPASRMFTTGIDCYSGERLVVGQQTAQKN......NIALAH...................
A6DDL8_9PROT/5-162....................................VTDFQEEKALYLN......AGDPKK...................
A4CKZ2_ROBBH/4-195............................VVTVSNLSLNQVEYKSINDFD......YDEFCE...................
Q18D71_CLOD6/5-179..............................EVDNKVVSEKIVDVSKMPR......NEAIIS...................
A7FHA4_YERP3/86-275...................RLYMGTVDLDSQRFIVWNMGLIASKGTPEA......LMLFRK...................
A6S7X3_BOTFB/21-291GNPNARL.YDNRPERTKTAVTAIYKGTRKGGMPAILRSYDSRKEPSPEY......DCKIWE...................
Q04WY0_LEPBL/36-250..................KKRGLNTERMQRILRKWNMKEVLFMEKDFDD......EKTVEQ...................
Q12EZ0_POLSJ/6-228........................AKTGKRACIEGGQLRDWTLGSTPMK......RFPLRD...................
Q1GX66_SPHAL/43-328TDF........AGHSVPLALNSPPRVTENEHRLILHFREDGRTGKRLDD......VPGLAA...................
Q4RS54_TETNG/14-183............................LGISLTRVTDGENVLVTHFDD......KEELVQ...................
Q5C8M6_LEGPN/32-295L............RELLPEENKHLIKNLSVVVTNQTKHELERYSEDTTP......QQSIAQ...................
Q6JBI3_DICVI/201-395................IVAAIVNFPVIQPYAFRNYEPPAGRDSHYRGST......GHYLWK...................
Q0FKF7_9RHOB/6-360E............ALFPPRIMAYLIGEATPFDASAAGGPTDLYPMRIEE......DFPLLL...................
Q8Z7F2_SALTI/8-168....................................ATNLSTGRELWFT......EGDLHL...................
Q6ASS6_ORYSJ/60-258..........................CYDLATAAPFMFSRADAVESDSY......DFALRD...................
A6QX75_AJECN/242-440..........................LNITIPTAGRAGTPNLLNYLTAP......NVLIWS...................
Q74A07_GEOSL/58-306..................PFLVLNATDISIAHRFEFTQDQFDLLCSDLA......GVSVAR...................
Q54XY1_DICDI/13-231L............TPVIISNYKFDETTTIAGNNNNNNNHFIKGEEIERLYTIGEEALSLAD...................
Q55G69_DICDI/65-250.....................AQDKISAEKSVKIFANYQNPSTNLHDDD......STSVVD...................
Q5Z158_NOCFA/22-193............................HPIATDARTGNAVDLRPHIYD......KRSLMR...................
Q54QX6_DICDI/893-1088................VTQESGNLEECLFLNYQKKTNPTRCSEQRKFIT......NSNVID...................
Q629U3_BURMA/413-612.................................AVDVETGEPRIFDSYV......DRLSPA...................
A2QZY6_ASPNC/473-679....................KVAVTAVADQPVLLINYRRVVDPPGQRCV......DHEMQT...................
A4XTW9_PSEMY/15-385HFSE.......SEFGALFPQRVVNWMRARQRPAQQGERSDGLYRLPLPD......DLPVVV...................
Q0E508_SFAVA/27-224....................RKTGKNLAIVATDIVSKFEPYVMSTSTTP......NMSISE...................
A6GI17_9DELT/71-215.........................................................VIIR...................
A7IE20_XANP2/6-198...................NTVQLDNALSDGQRSWLPRTFSNFPGDLGR......VELIAD...................
Q1DCU7_MYXXD/197-406.....................VDFDTGDVFGISDQDPANFDPNATEQQR......VEGIIN...................
Q6MAN6_PARUW/474-738..............LIKTEKNSPFKHLYIVAAKLGPQHGVRIFSSEDPNC....DDIIISD...................
Q4Z1R8_PLABA/352-558..............................RNYTHKYNAINGESYGGLN......KIPLWL...................
A4RTL4_OSTLU/164-398..............RPLRWKDVITSSVPLKVVATSLDTLTTVILDDFKD......EADLKK...................
A0JUC4_ARTS2/74-249..........................LPGAVEGTFNVVEFTEKRCHAID......ARDVDA...................

PF00698

FAS_HUMAN/493-810VIREPKPRSARWLSTSIPEAQWHSSLARTSSAEYNVNNLVSPVLFQEALWHV.....PEHA-------------------
STCK_EMENI/1547-1902.HA......CDDLSRSTSPN.....SPQTMSECIAHHIPSSCSVTNETELSR..GRATIPL-------------------
ERYA2_SACER/2014-2333.ITAVRGSVPLHSTVTGEVI.....DTSAMDASYWYRNLRRPVLFEQAVRGL...VEQGFD-------------------
ERYA2_SACER/560-881.IAPRPARVTFHSTVESRSM.....DGTELDARYWYRNLRETVRFADAVTRL...AESGYD-------------------
FAS_CHICK/492-809VIPHPKPRSARWISTSIPESQWQSDLARNSSAEYHVNNLVNPVLFHEGLKHI.....PENA-------------------
FAS1_YEAST/1663-2037.NVLNFIKLQKIDIIELQKSLSLEEVEGHLFEIIDEASKKSAVKPRPLKLER..GFACIPL-------------------
PPSA_MYCTU/632-952.LTPRTPTIGIISTTYADLH.....TQPVFDAEHWATNMRNPVRFQQAIASAGSGADGAYH-------------------
MCAS_MYCBO/534-852.IAPMTPKVPYYSATLFDPR.....EQPVCDGAYWVDNLRNTVQFAAAVQAA...MEDGYR-------------------
MSAS_PENPA/567-882TLSPVSPNVKLYSTALADPR.....GQDLRDVEYWAGNMVNRVRLTSAVKAA...VEDGYR-------------------
ERYA1_SACER/57-373.FAPGGSEVPFYASLTGGAV.....DTRELVADYWRRSFRLPVRFDEAIRSA...LEVGPG-------------------
ERYA1_SACER/2508-2828.ITPRRAEVPFFSTLTGDFL.....DGTELDAGYWYRNLRHPVEFHSAVQAL...TDQGYA-------------------
ERYA1_SACER/1031-1354DFHPLPGFVPFFSTVTGRWT.....QPDELDAGYWYRNLRRTVRFADAVRAL...AEQGYR-------------------

PF01735

PLB2_SCHPO/134-617-----------IFAVDATY.DDSNGWPD.GSSIVTTYERIITYNANKSV.DVRGFPYIPDEDTIIS.LGLNTHPTFFGCD
PLB5_SCHPO/125-607-----------IFAIDGGYQSATSGWPD.GSSLVSTYERVLA...TNSS.GVRGFPYIPDTNTFLA.LGLNTHPTFFGCD
PLB1_PENCH/88-571-----------IFAVDSSA.DTDYFWPN.GTSLVATYERSLN..SSGIA.NGTAFPAVPDQNTFIN.LGLSTRPSFFGCD
PLB1_YEAST/99-586-----------IFALDNSA.DTDDYWPD.GASLVNTYQRQFG....SQG.LNLSFPYVPDVNTFVN.LGLNKKPTFFGCD
PLB2_CANAX/87-564-----------IFAFDQSA.DKNN.WPD.GSALIKTFERQFS....SQG.DGIAFPYVPDQNTFRN.TNLTSKPTFFGCD
PA24A_CHICK/190-675-----------LADLLTQE.SVEEDELDAAVADPDEFERIYE...PLDV.KSKKIHIVDSGLTFNLPYPLILRP.QRGVD
PLB1_TORDE/97-584-----------IFALDNSA.DTDYYWPD.GASLVSTYERQFS....SQG.LNMSFPYVPDKRTFVN.LGLADKPSFFGCD
PLB_NEUCR/121-606-----------IFAVDSSA.DVTN.WPN.GTALRATYERTFG....SIS.NGTLFPSIPDDWTFIN.LGLNNRPSFFGCD
PLB_KLULA/102-589-----------IFALDNSA.DTDQSWPD.GFSLTQTYARQFG....LQG.KGIAFPYVPDVNTFTN.LGLNTRPTFFGCD
PLB6_SCHPO/114-600-----------VFAFDSSG.DTSNFWPN.GSSLVATYERVTQR.ASDAVYDVEDFVHVPTPETFVN.LGLNANPTFFGCD
PA24A_DANRE/185-664-----------FSGITHQT.SLEE.EVD.AVTDPDEFERIYE...PLDV.KSKKIHVVDSGLTFNLPYPLILRC.QRGVD
PLB1_CANAL/88-565-----------IFAFDNSN.DVLN.WPD.GTSLVKTYERQFS....SQG.NGIAFPYVPDQYTFRN.LNLTSKPTFFGCD
PLB3_YEAST/105-592-----------IFAVDNSA.DMRLAWPD.GSSLVHTYERQFV....KQG.QGMSFPYVPDTNTFVN.LGLNKKPTFFGCD
PLB1_SCHPO/114-593-----------IVAVDNGD.DSEWLWPN.GNSLVQTYERVVAAQAAGNT.NVKGFPYVPSQQSFVS.LHFNDRPVFFGCD
PLB2_YEAST/101-588-----------VFALDISD.NTDESWPS.GVCMTNTYERQYS....KQG.KGMAFPYVPDVNTFLN.LGLTNKPTFFGCD

PF01734

Q9N5Z7_CAEEL/97-269...........CLM...AS-------------------------------C..YHPMYSSG...................
Q8F079_LEPIN/12-165...........QIL...AS-------------------------------.....PMFL.....................
B8GC44_CHLAD/8-228...........AVC...AS-------------------------------A..AIPIFY.....................
C1DSE3_AZOVD/14-206...........CVL...AS-------------------------------A..CLPTFH.....................
A9BEP0_PETMO/3-174...........MLM...ME-------------------------------L..AFPPYY.....................
A9B328_HERA2/4-179...........ALM...AS-------------------------------A..AVPPYL.....................
B2U808_RALPJ/9-214...........LLL...QS-------------------------------A..STPPFT.....................
Q3AAC7_CARHZ/6-206...........ALE...AT-------------------------------S..AVPGIF.....................
A6CHF0_9BACI/8-175...........PIR...AS-------------------------------S..SLPFVA.....................
Q2GUC2_CHAGB/19-224...........AAS...AT-------------------------------A..AAPMYF.....................
Q9XAG3_STRCO/16-207...........AMS...AT-------------------------------C..ALPPLF.....................
Q2JEY3_FRASC/11-221...........AVM...AS-------------------------------C..AIPGWY.....................
Q8R6F6_FUSNN/65-256...........ILI...AS-------------------------------M..SIPSIF.....................
Q9ZCV7_RICPR/15-214...........IIQ...GI-------------------------------T..AAPGYF.....................
Q038G8_LACC3/6-159...........WLL...AS-------------------------------S..AMPGVF.....................
A5IE43_LEGPC/25-249...........ACR...AS-------------------------------A..SIPVIL.....................
Q4UJC7_RICFE/42-240...........VLL...AT-------------------------------T..AAPTYF.....................
Q54HM9_DICDI/140-357...........ALN...AS-------------------------------S..AAPIYF.....................
Q2K9E1_RHIEC/30-248...........AVA...AS-------------------------------A..AFPPVLSPLRLDL..............
A4IAC8_LEIIN/190-378...........AVL..CAI-------------------------------C..PTAAVH.....................
Q21S96_RHOFD/26-231...........LII...AS-------------------------------S..CVPPLT.....................
A5GF97_GEOUR/15-187...........AAR...FS-------------------------------T..GVPWVY.....................
Q1CW69_MYXXD/353-514...........AVR...AS-------------------------------G..SAPGIW.....................
A6NV66_9FIRM/7-176.................AT-------------------------------C..ALPFLF.....................
O05770_MYCTU/181-420...........AAS...FS-------------------------------S..AIPGVLHHETSDP..............
A0YM74_LYNSP/12-230...........LLL...AS-------------------------------V..AIPLAF.....................
Q5X5T5_LEGPA/27-309...........AVR...IS-------------------------------A..SLPGVF.....................
Q2GS92_CHAGB/73-327...........IPE...VA-------------------------------KAITTPSRYS....................
Q1ZT25_PHOAS/33-203...........VLR...AS-------------------------------C..AIPVLY.....................
Q5CY77_CRYPI/46-241...........AVI...GS-------------------------------G..TIPGIF.....................
A1KQ60_MYCBP/806-965...........VVG...CS-------------------------------M..RLPFLY.....................
PATA2_SOLTU/32-227...........ICY...SA-------------------------------A..AAPTYF.....................
A6G7S9_9DELT/458-735...........AVY...AS-------------------------------S..IMPLFM.....................
Q3JTM5_BURP1/13-264...........AAR...ST-------------------------------A..SFPFAFEPSL.................
A4F8K0_SACEN/17-281...........AAR...TT-------------------------------S..SFPFAF.....................
Q2R2X0_ORYSJ/139-303...........AVI...TS-------------------------------S..FIPGYLA....................
Q0A7T0_ALHEH/6-219...........HLL...AS-------------------------------S..ALPFIF.....................
Q3Y1A6_ENTFC/138-323...........WIL...AS-------------------------------A..SFYPAM.....................
Q052F4_LEPBL/13-188...........LLK...AA-------------------------------T..SLPIAT.....................
YL620_MIMIV/38-270...........SIL...AS-------------------------------S..AFPFVFPSSKFYY..............
Q0FZD9_9RHIZ/20-226...........LIC...AA-------------------------------A..VIPPVF.....................
Q5A7P0_CANAL/211-417...........AVC...AS-------------------------------C..SVPGIFPSCS.................
Q11UC9_CYTH3/381-624...........ALR...MS-------------------------------A..TFPYIT.....................
A6ASA3_VIBHA/5-186...........VAL...AT-------------------------------S..AAPTFF.....................
Q1D826_MYXXD/142-382...........AAG...FS-------------------------------S..ALPGVIHYDVL................
A0AZM8_BURCH/61-294...........AVA...AS-------------------------------A..AFPGLLSPVV.................
Q5CE49_CRYHO/149-342...........IIR...SS-------------------------------S..AFPLVL.....................
A4HB10_LEIBR/40-220...........TLI...AS-------------------------------C.CLVPLVG.....................
Q0RZB6_RHOSR/7-221...........HVL...AS-------------------------------A..AVPALF.....................
A3QTZ2_9VIRU/28-255...........AVY...AS-------------------------------M..TLPGIF.....................
Q1D5W1_MYXXD/154-432...........LLLTPQAS-------------------------------G..AFPLAF.....................
Q09D74_STIAD/17-214...........AAL...AS-------------------------------S..AFPVLM.....................
A4BNM2_9GAMM/38-218...........AIL...SS-------------------------------M..SLPGIL.....................
Q4LA62_STAHJ/11-202...........AMA...SS-------------------------------G..SLPGVW.....................
Q5ZPA4_9DELT/22-208...........LAL...RS-------------------------------S..SLPIV......................
Q6A6E2_PROAC/25-319...........GVL...AS-------------------------------C..SIPGVF.....................
NTE1_PICST/1239-1403...........FIR...AS-------------------------------M..SLAGLL.....................
A4SJS7_AERS4/8-174...........QIK...AS-------------------------------C..SVPLVY.....................
Q1I961_PSEE4/42-302...........FAR...AS-------------------------------M..SIPYFFHPLKVGNIPS...........
A7RB12_PBCVA/19-192...........AIR...MS-------------------------------C..SIPVYF.....................
Q0VPN6_ALCBS/36-193...........SVY...AS-------------------------------C..AVPLLF.....................
A6G1N7_9DELT/36-362...........AAY...GA-------------------------------VADELPILD.....................
A6QA07_SULNB/41-281...........VLF...AS-------------------------------S..AFPGAF.....................
Q5WWS2_LEGPL/304-496...........AVK...IS-------------------------------A..SFPVLY.....................
A0Z6H0_9GAMM/8-199...........AAR...AT-------------------------------S..AAPTFF.....................
A6LMU7_THEM4/5-176...........AVM...AS-------------------------------S..SVPGVF.....................
A7I0A5_CAMHC/6-211...........YLL...SS-------------------------------A..SFAFGF.....................
Q579N6_BRUAB/13-187...........AIA...AS-------------------------------C..AIPPVF.....................
A6G3Y0_9DELT/12-216...........WIV...AS-------------------------------S..TIPPFT.....................
A1DP95_NEOFI/20-225...........AGQ...AC-------------------------------L..ASLAGY.....................
A5K2I7_PLAVS/1168-1482YKSFYNIFVKYVLR...CT-------------------------------T..AAPGFF.....................
TEG_BACME/7-180...........VIL...RS-------------------------------S..AAPATQ.....................
Q2W5X1_MAGSA/6-225...........YPH...FG-------------------------------ATLAYPFIY.....................
A4U0C8_9PROT/5-257...........TLC...AC-------------------------------S..ALPYIE.....................
A5N2W9_CLOK5/4-191...........YLM...AS-------------------------------A..NFPIFR.....................
A4JJZ7_BURVG/8-242...........ALL...AS-------------------------------A..AIPAIY.....................
A6R0J1_AJECN/673-891...........SAR...AT-------------------------------S..AAPSIF.....................
Q6MR93_BDEBA/72-224...........LMY...LC-------------------------------M..AYPPFF.....................
A5P920_9SPHN/106-312...........AAM...AS-------------------------------S..AMPVFH.....................
Q2C291_9GAMM/11-214...........HIM...AS-------------------------------G..AMPPGF.....................
A1VHY7_DESVV/116-308...........ALR...IS-------------------------------M..SIPLFF.....................
A7BB55_9ACTO/26-199...........IIR...AS-------------------------------S..TLPILM.....................
A5I1W5_CLOBH/6-200...........AVT...MS-------------------------------I..SIPFFF.....................
A8GLS3_RICAH/7-147...........VIL...IS-------------------------------V.LNFQKLY.....................
A4T0K7_POLSQ/80-285...........GAA...AS-------------------------------S..SLPGVA.....................
A6DDL8_9PROT/5-162...........IIP...AS-------------------------------C..AIYPFF.....................
A4CKZ2_ROBBH/4-195...........WIW...IS-------------------------------C..NYIPFM.....................
Q18D71_CLOD6/5-179...........ISY...SG-------------------------------LLPSNPNATL....................
A7FHA4_YERP3/86-275...........VML...AS-------------------------------S..SVPVAF.....................
A6S7X3_BOTFB/21-291...........AGR...AT-------------------------------S..ATGLAF.....................
Q04WY0_LEPBL/36-250...........IIL...NS-------------------------------S..SVPPVV.....................
Q12EZ0_POLSJ/6-228...........AMA...VS-------------------------------A..AFPGLIGPYVLQ...............
Q1GX66_SPHAL/43-328...........AAR...AT-------------------------------A..SFPGAFPPFTLREIDRVLE........
Q4RS54_TETNG/14-183...........ACV...CS-------------------------------A..FIPVYCG....................
Q5C8M6_LEGPN/32-295...........VVQ...WS-------------------------------G..AHPVLF.....................
Q6JBI3_DICVI/201-395...........AIQ...AS-------------------------------A..AAPLYF.....................
Q0FKF7_9RHOB/6-360...........VAR...LS-------------------------------L..SFPGLIQ....................
Q8Z7F2_SALTI/8-168...........AVR...AS-------------------------------C..SMPGLM.....................
Q6ASS6_ORYSJ/60-258...........VCA...AT-------------------------------C..AAGSTA.....................
A6QX75_AJECN/242-440...........AAA...AS-------------------------------N..VSSATS.....................
Q74A07_GEOSL/58-306...........AVA...AS-------------------------------S..NFPVAFAPLTLTIHKEPCGPLPEWIGL
Q54XY1_DICDI/13-231...........AIR...AT-------------------------------S..SIPAAF.....................
Q55G69_DICDI/65-250...........IIR...ST-------------------------------A..GIPGLF.....................
Q5Z158_NOCFA/22-193...........ALR...AS-------------------------------A..NLPILA.....................
Q54QX6_DICDI/893-1088...........AAE...AT-------------------------------S..AAPTFF.....................
Q629U3_BURMA/413-612...........HVL...AS-------------------------------G..SLPPGM.....................
A2QZY6_ASPNC/473-679...........TGV...AS-------------------------------L..AHSGGYYRV..................
A4XTW9_PSEMY/15-385...........AVR...MS-------------------------------L..SFPLLLSA...................
Q0E508_SFAVA/27-224...........GFS...AS-------------------------------CSLAVPVRV.....................
A6GI17_9DELT/71-215...........GII...LS-------------------------------LLIVLPTIM.....................
A7IE20_XANP2/6-198...........VVL...RT-------------------------------M..AMPLQYP....................
Q1DCU7_MYXXD/197-406...........GVV...AS-------------------------------I..VEPVLA.....................
Q6MAN6_PARUW/474-738...........AVR...AS-------------------------------M..SIPIVFSPHT.................
Q4Z1R8_PLABA/352-558...........AAW...AT-------------------------------A..SAPTYL.....................
A4RTL4_OSTLU/164-398...........SLL...AS-------------------------------A..RVPALAG....................
A0JUC4_ARTS2/74-249...........ELL...AA-------------------------------G.MSLPIFL.....................

PF00698

FAS_HUMAN/493-810-----------VVL---EI-------------------------------A--PHALLQ---------------------
STCK_EMENI/1547-1902-----------AGV---DI-------------------------------P--FHSQML---------------------
ERYA2_SACER/2014-2333-----------TFV---EV-------------------------------S--PHPVLL---------------------
ERYA2_SACER/560-881-----------AFI---EV-------------------------------S--PHPVVV---------------------
FAS_CHICK/492-809-----------VVV---EI-------------------------------A--PHALLQ---------------------
FAS1_YEAST/1663-2037-----------VGI---SV-------------------------------P--FHSTYL---------------------
PPSA_MYCTU/632-952-----------TFI---EI-------------------------------S--AHPLLT---------------------
MCAS_MYCBO/534-852-----------VFA---EL-------------------------------S--PHPLLT---------------------
MSAS_PENPA/567-882-----------LFL---EV-------------------------------S--THPVVS---------------------
ERYA1_SACER/57-373-----------TFV---EA-------------------------------S--PHPVLA---------------------
ERYA1_SACER/2508-2828-----------TFI---EV-------------------------------S--PHPVLA---------------------
ERYA1_SACER/1031-1354-----------TFL---EV-------------------------------S--AHPILT---------------------

PF01735

PLB2_SCHPO/134-617GRNTTAGNHTVDNNTPPLLVYFPNYPWVYYSNISTFTMSMNDTLSSGILEN.AALSATQNN...SDSFAVCL-ACAMIQR
PLB5_SCHPO/125-607GRNTTAGNHTVNDDTPPLVVYFPNYPWTMYANVTTYTVQLEDTLSSGMIEN.AAVAATQNN...SDSFAVCV-ACALVQR
PLB1_PENCH/88-571SSNQTGP........SPLVVYIPNAPYSYHSNISTFQLSTDDAERDNIILN.GYEVATMANSTLDDNWTACV-ACAILSR
PLB1_YEAST/99-586ARNLTDL.....EYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKN.GFEAATMGNFTDDSDFLGCV-GCAIIRR
PLB2_CANAX/87-564AQNLTSL..TENIYDVPVVIYLANRPFTYFSNISTFKLKYSDTERQGMISN.GYDVASRLNGKLDNEWAACV-GCAIIRR
PA24A_CHICK/190-675LIISFDFSARPSDSSPPFKEILLAEKWAKMNKLPFPKIDPNVFDREGLKECYVFKPKDTSSEKDCPTIIHFV-LANINFR
PLB1_TORDE/97-584AQNLTDL.....NYIPPLVVYIPNARHSYNSNTSTFKLSYTDDERLKMIKN.GFEAATRGNLTDDSSFMGCV-ACAVMRR
PLB_NEUCR/121-606VKNFTLN...ANQKVPPLIVYVPNAPYTALSNVSTFDPSYTMSQRNDIIGN.GWNSATQGNGTLDSEWPTCV-ACAVISR
PLB_KLULA/102-589ARNLTDL.....ESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQN.GFEAVTMKNLTKDENFMGCI-SCAILRR
PLB6_SCHPO/114-600GRNTTRGDVPVDHNTPPLVVYMPNTPWTMKSNLVDHRYRIANSEIQALIQN.GFVATTQDN...STDFASCL-ACAVVQR
PA24A_DANRE/185-664LIISFDFSARPSDSSPPFKELLLAEKWARMNKLPFPKIDSKVFDREGLKECYVFKPAKGD..KNCPTIIHFV-LANINFR
PLB1_CANAL/88-565AKNLTSL..TKDIYDVPLVIYLANRPFTYWSNTSTFKLTYDDNERQGMISN.GFEIATRSSGSLDDEWAACV-GCAIIRR
PLB3_YEAST/105-592ANNLTDL.....QYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQN.GFEIATRNNFTDDPEFMGCV-GCAIIRR
PLB1_SCHPO/114-593GRNTTAGNHTVTRDTPPLVIYLPNVPYNYFTNISTDRTYYTEDMIQQLLTN.GLISSTVDN...DTYFGQCF-ACAVVKR
PLB2_YEAST/101-588AKNLTDL.....EYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRN.GFEAATMGNFTDDSNFLGCI-GCAIIRR

PF01734

Q9N5Z7_CAEEL/97-269............LNGKAPIL........RGE.......AY..........IDGG......YS.NM....IPE.FLDM---
Q8F079_LEPIN/12-165.............................................................V.SS....PPV.IFLH---
B8GC44_CHLAD/8-228...............RPVRI........GDR.......DY..........IDGG......LR.GT....ASL.DIAI---
C1DSE3_AZOVD/14-206...............HTVEI........DGE.......PY..........WDGA......FS.AN....PAV.FPLV---
A9BEP0_PETMO/3-174...............SYYEY........Q.......................GG......FF.......IPT.SYLS---
A9B328_HERA2/4-179...............PAYHY........RGE.......TY..........LDGG......FV.SN....LPI.GVAL---
B2U808_RALPJ/9-214...............PVLRR........AGR.......PV..........LDGG......MV.DN....VPV.HALD---
Q3AAC7_CARHZ/6-206...............TPVKF........YDY.......LL..........TDGG......VV.EN....VPV.RILA---
A6CHF0_9BACI/8-175...............PIVEF........QSR.......HL..........LDGG......IS.SP....IPV.KKAE---
Q2GUC2_CHAGB/19-224...............KSVKFA......SGGE.......RW..........CDGA......IR.RN....NPI.DEAL---
Q9XAG3_STRCO/16-207...............PPISI........GAG.......RW..........MDGG......VR.ST....TNA.DLVD---
Q2JEY3_FRASC/11-221...............APVTV........DGQ.......RF..........VDGG......TR.......SPA.SVDL---
Q8R6F6_FUSNN/65-256...............EPMKI........DGE.......IY..........VDGL......VS.RN....LPV.EEAY---
Q9ZCV7_RICPR/15-214................PSHH........FSNITNTKVHTI..........IDGG......IY.AN....DPT.LQTW---
Q038G8_LACC3/6-159...............SPVER........AGV.......SY..........VDGG......VV.ND....LPV.DIAR---
A5IE43_LEGPC/25-249...............KPVTI........TINGV...EKQF..........VDGG......LY.DN....LPT.DYFD---
Q4UJC7_RICFE/42-240...............KPVTNQEHIKGYENQEDA...LYAY..........ADGG......LG.AN....RPA.YEAL---
Q54HM9_DICDI/140-357...............KPVEI........NGH.......KY..........VDGG......IGYQN....NPI.LLAH---
Q2K9E1_RHIEC/30-248.......SKFPWKREKLDDT........VGDPVAPERAIL..........SDGG......VY.DN....HGI.EPAL---
A4IAC8_LEIIN/190-378...............PASSS........SYG...................PAGG......AA.......PPT.RTLL---
Q21S96_RHOFD/26-231...............PQARR........NGI.......AL..........LDGS......LV.SN....VPI.EGVA---
A5GF97_GEOUR/15-187...............AYRQF........THKGK...KHIF..........IDGT......LM.SG....LIE.ESLA---
Q1CW69_MYXXD/353-514...............GPTVV........PPA.......RY..........VDGA......FT.SM....VPA.HVLL---
A6NV66_9FIRM/7-176...............PVYHI........NGK.......PY..........MDGG......AA.DA....IPY.DHAV---
O05770_MYCTU/181-420.......RMLPILDELCADQ........DVA.......AM..........VDGG......AA.SN....VPV.ELAW---
A0YM74_LYNSP/12-230...............PCRSV........NGK.......NY..........VDGG......LV.DN....VPL.GALA---
Q5X5T5_LEGPA/27-309...............DPVIY........EGR.......KY..........IDGG......AA.NN....LPV.NIFF---
Q2GS92_CHAGB/73-327..............FKPFKL........GSG.......QF..........VDGSK....QIR.......DPT.LEVL---
Q1ZT25_PHOAS/33-203..............NLPVNM........NEL.......EW..........VDGG......VS.AA....IPA.KEAW---
Q5CY77_CRYPI/46-241...............PIKYL........RNL.......GY.........HVDGG......FI.AA....GDL.ETAI---
A1KQ60_MYCBP/806-965...............APLPY........GGT.......LH..........VDGG......VL.DN....VPV.TTLV---
PATA2_SOLTU/32-227...............PPHYF........ATNTINGDKYEFN........LVDGA......VA.......TVA.DPAL---
A6G7S9_9DELT/458-735...............EPMEM........QLGS.....PRL..........VDTEHGRVGLLH.GD....VPE.AVRN---
Q3JTM5_BURP1/13-264..........VGTDGKPSSL........KGR........FGDDLKVPRYVVDGG......VL.DN....KPF.RGAL---
A4F8K0_SACEN/17-281...............EPSRVYSSTGEVPPGEPNMSGLFSELNTTGSPYRVIDGG......VL.DN....IPV.AAAV---
Q2R2X0_ORYSJ/139-303.............PRPATFF........RNR.......LC..........IDGG......LT.LF....MPP.TSAS---
Q0A7T0_ALHEH/6-219...............PARRV........GHE.......YF..........GDGG......LR.QT....TPL.SPAI---
Q3Y1A6_ENTFC/138-323...............AYRKI........GKN.......KY..........ADGG......YR.NK....IPI.DIAI---
Q052F4_LEPBL/13-188..............RGKHKV........DGK.......LY..........SDAA......IL.NP....LPL.GDLI---
YL620_MIMIV/38-270........NSTTQKYQYESL........TDTNDKITENSF..........IDGG......VA.NN....IPL.DYLI---
Q0FZD9_9RHIZ/20-226...............NVEGW........EGK.......KV..........IDGG......MT.SK....APL.PSPD---
Q5A7P0_CANAL/211-417...........VYEKNPKTNEIHEWNNDESM.......KY..........VDGS......VD.ND....LPI.TRLS---
Q11UC9_CYTH3/381-624...............PNVDL........PSEP....AMEI..........MDAG......LS.DN....FGV.KDAT---
A6ASA3_VIBHA/5-186...............PAFTR........SKI.......RY..........IDGG......VI.CN....MPD.IVAA---
Q1D826_MYXXD/142-382..........REDPGMHTLV........EGLMGQHGVARL..........IDGG......LV.DN....LPA.KAAW---
A0AZM8_BURCH/61-294...........LNRFRLGST........ERELGKPRFIHL..........IDGG......NV.DN....LGL.LAVK---
Q5CE49_CRYHO/149-342...............EPAEI........SGI......GIF..........GDGA......IS.KT....IDL.RGAV---
A4HB10_LEIBR/40-220...............LPFKM........ESTGE...WC............ADGG......IS.NF....TPR.MGEE---
Q0RZB6_RHOSR/7-221...............RPIHI........DTPAA..WAGWY..........VDGG......VR.LN....MPL.KPAV---
A3QTZ2_9VIRU/28-255..............KPLSDG........QGN.......TL..........IDGG......FL.YN....FPI.TMND---
Q1D5W1_MYXXD/154-432...............PPVPV........EVSF....FNQTQWGPLESLKLIDGG......VL.NN....NPV.DLAV---
Q09D74_STIAD/17-214...............PIYRS........GNTVGRHKNDLM..........MDGA......LS.NN....STA.MTAL---
A4BNM2_9GAMM/38-218..............APRPAL........EGEE.....CGY..........YDGG......LV.EK....TPL.ISPI---
Q4LA62_STAHJ/11-202...............PATTI........ESD.......KH..........FDGG......CH.SM....ENA.DLAK---
Q5ZPA4_9DELT/22-208...............SPVHQ..................GY..........VDGG......LF.AN....NPT.MSAV---
Q6A6E2_PROAC/25-319...............RPVDL........DGE.......HY..........VDGG......LR.EN....VPA.EMAI---
NTE1_PICST/1239-1403...............PPIAF........QGC.......ML..........LDGG......YL.DN....LPV.SEMK---
A4SJS7_AERS4/8-174..............RDFVRI........GGE.......AM..........TDGG......VA.DS....IPV.RYAY---
Q1I961_PSEE4/42-302....DQAAEARWQAWAGYHT........VDEGRLPDEVLF..........IDGG......IM.SN....FPI.DVFH---
A7RB12_PBCVA/19-192...............SAIKH........NDC.......IF..........VDGA......LT.DA....FPY.DYVD---
Q0VPN6_ALCBS/36-193...............QPARI........GKN.......YY..........WDGG......IA.DR....HGL.AATY---
A6G1N7_9DELT/36-362...............DMRQY........TPTLPYWPVREGAVPETRVFDVADGG......VL.EN....YGL.LAML---
A6QA07_SULNB/41-281...............QQVKLRYEYKGKIASE.......YF..........IDGG......TY.NN....VPL.QQAT---
Q5WWS2_LEGPL/304-496...............RDTLL........DGE.......EH..........NDGG......IL.SN....FPT.EVFF---
A0Z6H0_9GAMM/8-199...............EPAQL........EVAGR...STSL..........IDGA......VF.LN....SPV.VSAY---
A6LMU7_THEM4/5-176...............SPLWI........AGT.......QN..........TDGG......VL.SP....SPI.NEAI---
A7I0A5_CAMHC/6-211............................ENT......NGF..........IDGA......ISGEN....IPI.TPLL---
Q579N6_BRUAB/13-187...............APVRR........NGR.......IL..........VDGG......LF.NP....VPF.DLLF---
A6G3Y0_9DELT/12-216...............RIQRE........GGR.......TF..........LDGG......LV.DN....TPI.RALP---
A1DP95_NEOFI/20-225...............KPVTIG......PDGK.......KY..........CDSS......RN.IV....NPV.RQVW---
A5K2I7_PLAVS/1168-1482...............NFFSF........DSN.......IY..........ADGA......IC.FN....NPT.LVSL---
TEG_BACME/7-180...............RAYQN...................Y..........VDGY......TVATN........TSTA---
Q2W5X1_MAGSA/6-225...............PPAEV........DGK.......LY..........LEGA......AE.DA....FNF.QGLL---
A4U0C8_9PROT/5-257...............EPVIM........DGK.......TY..........CEGA......TV.DT....VNF.EDLM---
A5N2W9_CLOK5/4-191................IEPL........DDR.......YY..........IDGG......FY.DN....CPI.NLLV---
A4JJZ7_BURVG/8-242...............AAKTV........NGE.......RY..........SDGGIGGWRKMQ.GN....TPA.GALL---
A6R0J1_AJECN/673-891...............PPAYI........RAI......GTF..........QDGG......LR.EN....NPA.GIAR---
Q6MR93_BDEBA/72-224...............KPHQN........S.....................VAGV...............RDI.TALA---
A5P920_9SPHN/106-312...............QQLRV........TGLAS..GDRSL..........YDGG......VR.RS....VFF.ERAI---
Q2C291_9GAMM/11-214...............PPVEI........DGK.......YY..........IDGG......LY.SN....TPI.MSIL---
A1VHY7_DESVV/116-308..............TAVRNS........RGE.......VL..........VDGS......VI.WN....YPI.SLYD---
A7BB55_9ACTO/26-199...............PPVDI........DGD.......TY..........VDGA......LG.PNG..GLPF.DQPL---
A5I1W5_CLOBH/6-200...............TPVKL........KYMGK...EAYI..........VDGG......IT.SN....YPI.WIFD---
A8GLS3_RICAH/7-147............................................................LI...........KMLL---
A4T0K7_POLSQ/80-285...............GPTLL........GQR.......YV..........MDGG......IC.SN.....PAHVDLV---
A6DDL8_9PROT/5-162...............EPIVY........KDK.......IL..........VDGG......YK.DN....LPS.SPLN---
A4CKZ2_ROBBH/4-195...............SLVRK........NGC.......EY..........ADGG......LG.SM....VPV.EEAI---
Q18D71_CLOD6/5-179.............GFKEQFV........KDVQEGIYDGFK..........LDGG......LI.RS....ALI.EPLI---
A7FHA4_YERP3/86-275...............SPVFFDVVANGKHYDE.......MH..........VDGG...............VAA.RVFY---
A6S7X3_BOTFB/21-291...............KPIQI........GQS.......VF..........IDEG......AG.QY....NPA.PFAL---
Q04WY0_LEPBL/36-250...............SVQSH........EKE.......YY..........FDGG......LT.NN....LLL.EVFP---
Q12EZ0_POLSJ/6-228........ADSFDWDLPMYA........SGDEARPAEDRFAR.....IHLYDGG......VY.DN....LGL.EPFF---
Q1GX66_SPHAL/43-328..KRGLDWPGRDAFVRAQLP........RGEAGDAADRVL..........IDGS......VL.AN....APF.RPAI---
Q4RS54_TETNG/14-183..............IIPPTL........RGV.......RY..........VDGG......IS.DN....LPQ.YELK---
Q5C8M6_LEGPN/32-295..............VPGRNA........KGE.......YI..........ADGG......IL.DN....MPE.IEGL---
Q6JBI3_DICVI/201-395...............EEVKL........DHL.......LL..........QDGG......VV.AN....NPT.AIGI---
Q0FKF7_9RHOB/6-360..............AVPLWRKDYELKTPAGENGLWCRCLF..........SDGG......IS.SN....LPI.HLFD---
Q8Z7F2_SALTI/8-168...............SPVEH........NGY.......WL..........VDGA......VV.NP....VPV.SLTR---
Q6ASS6_ORYSJ/60-258..............AAVRSV........DGRTA..IAA............ASGG......VAAMG....NPA.AAAI---
A6QX75_AJECN/242-440...............SRVTL........YCK...................DETG......AI.......VPW.PDAK---
Q74A07_GEOSL/58-306GLDRESNPKRRVADAEAGRS........YREPDR.LYAHL..........LDGG......LS.DNLGLRGPF.QAVT---
Q54XY1_DICDI/13-231...............QKHKQ........GDE.......EY..........LDGG......FK.YN....NPM.EIAY---
Q55G69_DICDI/65-250...............HLYEN........DKY.......IY..........YDGG......FQ.YN....CNL.PIAL---
Q5Z158_NOCFA/22-193..............GGPILL........DGV.......PY..........FDGG......IA.EP....IPI.HAAV---
Q54QX6_DICDI/893-1088...............SKFEF........NNR.......QF..........QDGG......LK.NN....NPC.KVAM---
Q629U3_BURMA/413-612...............PWTVV........DGR.......PY..........WDGG......VV.SN....SPL.DLVI---
A2QZY6_ASPNC/473-679............YTAPDPEH........EPQ.......LWK.......CCADGG......LK.HN....NPA.LICR---
A4XTW9_PSEMY/15-385............MPLHAVDY........RSDDRRLERCWF..........TDGG......IA.SN....FPI.HFFD---
Q0E508_SFAVA/27-224............................GHK.......LL..........MDGY......YS.DN....FPV.HVAM---
A6GI17_9DELT/71-215...............IAVFL........TEL.......AY...........EGGLWPDYAVL.SG....RTH.LNVF---
A7IE20_XANP2/6-198.............IYQSGAQ........TGP.......AY..........VDGA......VA.SN....NPA.LTAI---
Q1DCU7_MYXXD/197-406...............DPVPW........LPSHTGRMKGSF..........FDGG......VR.SG....LPL.LQAV---
Q6MAN6_PARUW/474-738..........LCKKVNGMRI........QDES....LGTY..........VDGG......IL.MN....YPI.GIFD---
Q4Z1R8_PLABA/352-558..............KGPNED........DFK.......KYGFNIKPEIHLVDGA......LK.AS....NPA.LIAL---
A4RTL4_OSTLU/164-398..............SSPVTH........RGH.......RL..........VDAA......VL.EP....VPV.HAAA---
A0JUC4_ARTS2/74-249...............TPLRR........EGK.......VW..........TDAV......WI.RD....ANV.AEAL---

PF00698

FAS_HUMAN/493-810-----------AVLKRGLK............PSCTIIPLM----------KKDHRD..NLEFFLAGIGRLHLSGIDA---
STCK_EMENI/1547-1902-----------RGHIDGYRQYLRHHLRVSDIKPEELVGRW----------IPNVTGKPFALDAPYIRLVQGVTQSRP---
ERYA2_SACER/2014-2333-----------MAVEETAE.........HAGAEVTCVPTL----------RREQSG...PHEFLRNLLRAHVHGVGA---
ERYA2_SACER/560-881-----------QAVEEAVEE.......ADGAEDAVVVGSL----------HRDGGD...LSAFLRSMATAHVSGVDI---
FAS_CHICK/492-809-----------AILRRTLK............PTCTILPLM----------KKDHKN..NLEFFLTQTGKIHLTGINV---
FAS1_YEAST/1663-2037-----------MNGVKPFKSFLKKNIIKENVKVARLAGKY----------IPNLTAKPFQVTKEYFQDVYDLTGSEP---
PPSA_MYCTU/632-952-----------QAIIDTLHS.......AQPGARYTSLGTL----------QRDTDD...VVTFRTNLNKAHTIHPPH---
MCAS_MYCBO/534-852-----------HAVEQTGRS........LDMSVAALAG.M----------RREQPL...PHGLRGLLTELHRAGAAL---
MSAS_PENPA/567-882-----------HSINETLMD........AGMEDFAVIPTL----------LRKKPT...EKHILHSIAQLHCRGAEV---
ERYA1_SACER/57-373-----------AALQQTLD.........AEGSSAAVVPTL----------QRGQGG...MRRFLLAAAQAFTGGVAV---
ERYA1_SACER/2508-2828-----------SSVQETLD.........DAESDAAVLGTL----------ERDAGD...ADRFLTALADAHTRGVAV---
ERYA1_SACER/1031-1354-----------AAIEEIGD.........GSGADLSAIHSL----------RRGDGS...LADFGEALSRAFAAGVAV---

PF01735

PLB2_SCHPO/134-617SLERKNMSTPSQCSSCFEQYCWNGTTV
PLB5_SCHPO/125-607SLERKNMSTPSQCASCFNQYCWNGTIA
PLB1_PENCH/88-571SFERTGTTLPDICSQCFDRYCWNGTVN
PLB1_YEAST/99-586KQQNLNATLPSECSQCFTNYCWNGTID
PLB2_CANAX/87-564EQERLGIEQTEQCKKCFENYCWDGTIY
PA24A_CHICK/190-675KYKAPGLPRESKEEKDFADFDIFDDPN
PLB1_TORDE/97-584KQQSLNATLPEECSTCFTNYCWNGTID
PLB_NEUCR/121-606SLDRLGRQTPAACKTCFERYCWNGTVN
PLB_KLULA/102-589KQESLNYTLPSECDACFEKYCWNGTVD
PLB6_SCHPO/114-600SLERRNQSTSAACQQCFSQYCWNGTVD
PA24A_DANRE/185-664NFKAPGVPRDSDKDIEFGDFDIFDEPA
PLB1_CANAL/88-565EQERQGIEQTEQCKRCFENYCWDGTIY
PLB3_YEAST/105-592KQQALNITLPPECETCFKNYCWNGTLD
PLB1_SCHPO/114-593TLERNNITASPECQQCYYNYCWSGLYD
PLB2_YEAST/101-588KQESLNATLPPECTKCFADYCWNGTLS

PF01734

Q9N5Z7_CAEEL/97-269---------------------------
Q8F079_LEPIN/12-165---------------------------
B8GC44_CHLAD/8-228---------------------------
C1DSE3_AZOVD/14-206---------------------------
A9BEP0_PETMO/3-174---------------------------
A9B328_HERA2/4-179---------------------------
B2U808_RALPJ/9-214---------------------------
Q3AAC7_CARHZ/6-206---------------------------
A6CHF0_9BACI/8-175---------------------------
Q2GUC2_CHAGB/19-224---------------------------
Q9XAG3_STRCO/16-207---------------------------
Q2JEY3_FRASC/11-221---------------------------
Q8R6F6_FUSNN/65-256---------------------------
Q9ZCV7_RICPR/15-214---------------------------
Q038G8_LACC3/6-159---------------------------
A5IE43_LEGPC/25-249---------------------------
Q4UJC7_RICFE/42-240---------------------------
Q54HM9_DICDI/140-357---------------------------
Q2K9E1_RHIEC/30-248---------------------------
A4IAC8_LEIIN/190-378---------------------------
Q21S96_RHOFD/26-231---------------------------
A5GF97_GEOUR/15-187---------------------------
Q1CW69_MYXXD/353-514---------------------------
A6NV66_9FIRM/7-176---------------------------
O05770_MYCTU/181-420---------------------------
A0YM74_LYNSP/12-230---------------------------
Q5X5T5_LEGPA/27-309---------------------------
Q2GS92_CHAGB/73-327---------------------------
Q1ZT25_PHOAS/33-203---------------------------
Q5CY77_CRYPI/46-241---------------------------
A1KQ60_MYCBP/806-965---------------------------
PATA2_SOLTU/32-227---------------------------
A6G7S9_9DELT/458-735---------------------------
Q3JTM5_BURP1/13-264---------------------------
A4F8K0_SACEN/17-281---------------------------
Q2R2X0_ORYSJ/139-303---------------------------
Q0A7T0_ALHEH/6-219---------------------------
Q3Y1A6_ENTFC/138-323---------------------------
Q052F4_LEPBL/13-188---------------------------
YL620_MIMIV/38-270---------------------------
Q0FZD9_9RHIZ/20-226---------------------------
Q5A7P0_CANAL/211-417---------------------------
Q11UC9_CYTH3/381-624---------------------------
A6ASA3_VIBHA/5-186---------------------------
Q1D826_MYXXD/142-382---------------------------
A0AZM8_BURCH/61-294---------------------------
Q5CE49_CRYHO/149-342---------------------------
A4HB10_LEIBR/40-220---------------------------
Q0RZB6_RHOSR/7-221---------------------------
A3QTZ2_9VIRU/28-255---------------------------
Q1D5W1_MYXXD/154-432---------------------------
Q09D74_STIAD/17-214---------------------------
A4BNM2_9GAMM/38-218---------------------------
Q4LA62_STAHJ/11-202---------------------------
Q5ZPA4_9DELT/22-208---------------------------
Q6A6E2_PROAC/25-319---------------------------
NTE1_PICST/1239-1403---------------------------
A4SJS7_AERS4/8-174---------------------------
Q1I961_PSEE4/42-302---------------------------
A7RB12_PBCVA/19-192---------------------------
Q0VPN6_ALCBS/36-193---------------------------
A6G1N7_9DELT/36-362---------------------------
A6QA07_SULNB/41-281---------------------------
Q5WWS2_LEGPL/304-496---------------------------
A0Z6H0_9GAMM/8-199---------------------------
A6LMU7_THEM4/5-176---------------------------
A7I0A5_CAMHC/6-211---------------------------
Q579N6_BRUAB/13-187---------------------------
A6G3Y0_9DELT/12-216---------------------------
A1DP95_NEOFI/20-225---------------------------
A5K2I7_PLAVS/1168-1482---------------------------
TEG_BACME/7-180---------------------------
Q2W5X1_MAGSA/6-225---------------------------
A4U0C8_9PROT/5-257---------------------------
A5N2W9_CLOK5/4-191---------------------------
A4JJZ7_BURVG/8-242---------------------------
A6R0J1_AJECN/673-891---------------------------
Q6MR93_BDEBA/72-224---------------------------
A5P920_9SPHN/106-312---------------------------
Q2C291_9GAMM/11-214---------------------------
A1VHY7_DESVV/116-308---------------------------
A7BB55_9ACTO/26-199---------------------------
A5I1W5_CLOBH/6-200---------------------------
A8GLS3_RICAH/7-147---------------------------
A4T0K7_POLSQ/80-285---------------------------
A6DDL8_9PROT/5-162---------------------------
A4CKZ2_ROBBH/4-195---------------------------
Q18D71_CLOD6/5-179---------------------------
A7FHA4_YERP3/86-275---------------------------
A6S7X3_BOTFB/21-291---------------------------
Q04WY0_LEPBL/36-250---------------------------
Q12EZ0_POLSJ/6-228---------------------------
Q1GX66_SPHAL/43-328---------------------------
Q4RS54_TETNG/14-183---------------------------
Q5C8M6_LEGPN/32-295---------------------------
Q6JBI3_DICVI/201-395---------------------------
Q0FKF7_9RHOB/6-360---------------------------
Q8Z7F2_SALTI/8-168---------------------------
Q6ASS6_ORYSJ/60-258---------------------------
A6QX75_AJECN/242-440---------------------------
Q74A07_GEOSL/58-306---------------------------
Q54XY1_DICDI/13-231---------------------------
Q55G69_DICDI/65-250---------------------------
Q5Z158_NOCFA/22-193---------------------------
Q54QX6_DICDI/893-1088---------------------------
Q629U3_BURMA/413-612---------------------------
A2QZY6_ASPNC/473-679---------------------------
A4XTW9_PSEMY/15-385---------------------------
Q0E508_SFAVA/27-224---------------------------
A6GI17_9DELT/71-215---------------------------
A7IE20_XANP2/6-198---------------------------
Q1DCU7_MYXXD/197-406---------------------------
Q6MAN6_PARUW/474-738---------------------------
Q4Z1R8_PLABA/352-558---------------------------
A4RTL4_OSTLU/164-398---------------------------
A0JUC4_ARTS2/74-249---------------------------

PF00698

FAS_HUMAN/493-810---------------------------
STCK_EMENI/1547-1902---------------------------
ERYA2_SACER/2014-2333---------------------------
ERYA2_SACER/560-881---------------------------
FAS_CHICK/492-809---------------------------
FAS1_YEAST/1663-2037---------------------------
PPSA_MYCTU/632-952---------------------------
MCAS_MYCBO/534-852---------------------------
MSAS_PENPA/567-882---------------------------
ERYA1_SACER/57-373---------------------------
ERYA1_SACER/2508-2828---------------------------
ERYA1_SACER/1031-1354---------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window