Sequence alignment for CL0324

PF03161

E2JE69_RHIID/38-210-------------I-S---ILIGSLLGDG--SM...........EKD--..GNGSR----------F-------------
D1AAC0_THECD/316-492-------------W-Q---VVLGSVMGDG--SL..S........PNR--RGRTGVR----------F-------------
F2WVM1_MONRO/53-226-------------I-S---VIFGSLLGDA--HA...........ERR--LKGLGTR----------I-------------
E6ZZ92_SPORE/48-221-------------L-S---ILFGSLLGDS--HA...........ERR--AIGNGTR----------I-------------
M0UAK9_MUSAM/455-621-------------R-E---ILVGLLLGGV--RI..ES.......DEE--RRNHIIL----------F-------------
A9TWX7_PHYPA/130-304-------------K-S---VILGSLLGDS--TL...........QIV--KGENDCR----------F-------------
Q6U7Y1_MONPE/84-248-------------Q-Q---ILVGILLGDA--NI...........RKI--GNNGKPH----------I-------------
RECA_MYCLE/317-494-------------F-Q---VVLGSLMGDG--NL..S........PNL--CDRNGVR----------F-------------
K5WT44_AGABU/33-209-------------F-E---AAIGLMLGDA--SL...........QTQ--NKGKTYR----------M-------------
D3DFV7_HYDTT/7-179-------------K-E---IIIGTLLGDG--YL............QS--TGKRNAR----------L-------------
M5BUR5_THACB/35-205-------------K-E---ILVGLILGDL--HI.............F--KNPTNVR----------L-------------
SCE4_YEAST/424-601-------------L-Y---IMTGILLTDG--WI..DYTSKKDLDKKT--IMEINCR----------F-------------
K9TPD0_9CYAN/12-180-------------R-G---VLVGMLLGQG--KR..............--...NQNN----------F-------------
Q02672_PODAN/51-225-------------K-E---ILIGILLGDA--HI...........VRR--SPTANSR----------L-------------
SCE1_YEAST/34-208-------------F-E---AGIGLILGDA--YI...........RSR--DEGKTYC----------M-------------
Q85QA0_CANGA/78-255-------------L-Y---IIVGILLMDG--QI..NYSSKKNLDNKN--IIDINCK----------F-------------
Q6ZEW6_SYNY3/132-296-------------L-E---FLTGSLLGDG--SL...........EKG--KKKLNAR----------Y-------------
K7N0N6_SOYBN/532-697-------------R-E---ILIGLLLGGL--QI..DS.......DDQ--RRNHIIR----------F-------------
AI7_USTMA/402-564-------------.-.---VVVGLMLSDA--WM...........NKK--NMNGQAR----------L-------------
G4U3E9_PIRID/59-232-------------I-S---IIFGSLLGDA--HG...........EKR--STSGGTR----------I-------------
M1CIN2_SOLTU/404-569-------------R-E---VLTGLLLGGV--QI..RS.......DGE--RRLHAIH----------Y-------------
Q9B6C9_YARLI/213-390-------------I-S---IIYGTLLGDG--NA...........EKR--TVVGGTR----------I-------------
PP154_ARATH/632-795-------------R-E---VLVGLLLGGL--QI..ES.......DKE--KKSHMIK----------F-------------
G4U3G4_PIRID/70-243-------------R-S---IIIGLILSDG--WF...........NLR--DGRLNPS----------I-------------
M5BJL1_THACB/29-201-------------K-E---VLIGLLLGDL--HA...........AKQ--KKSINVR----------L-------------
MBI2_DEBHA/69-242-------------L-E---MMYGSLLGDA--SA...........EKR--KGGKGTR----------M-------------
K5XIF0_AGABU/77-253-------------.-.---.LIGILLSDG--CITINNSSKLLMAEQY--PKDIGAR----------F-------------
D8RW96_SELML/689-854-------------R-A---ILAGVLLAGT--RM..T........AAS--YNGACIH----------F-------------
C7U019_PICSO/188-361-------------M-E---MMYGSLLGDA--HA...........EKR--SQGKGTR----------I-------------
M5BJK2_THACB/16-192-------------I-S---VLIGILLGDG--GI...........YRT--SSTSNCR----------F-------------
F6FSE8_ISOV2/317-493-------------W-Q---MVLGGLLGDA--NL..S........PNP--RGRRGVR----------F-------------
C5Y0D4_SORBI/581-747-------------R-E---ILIGLLLGGT--QI..ES.......HAQ--KGVYIVN----------F-------------
K9PLK5_9CYAN/22-190-------------R-G---ILVGMLLGDG--GR..............--...SKKN----------F-------------
B9S769_RICCO/624-785-------------R-E---ILVGLLLGGL--RV..ES.......DDN--RKKHMIR----------F-------------
C5GYP6_AJEDR/59-232-------------V-S---VLVGSLLGDS--Y............GNR--RSVEGTR----------F-------------
W1NZZ2_AMBTC/553-719-------------R-E---ILIGLLLGGT--RI..KS.......DEA--KKNHTIH----------F-------------
MBI2_YEAST/223-403-------------L-S---IIYGSMLGDG--HA...........EKR--KGGKGTR----------I-------------
D7TPM6_VITVI/580-745-------------R-E---ILIGLLLGGL--QM..ES.......DEE--RKNHVIY----------F-------------
A9T5I5_PHYPA/473-637-------------R-E---ILVGVLLGGA--KI..TS.......HDN--NRTYEVG----------F-------------
A5J053_GIBZE/61-229-------------K-S---VIIGILLSDG--NL...........SSS--KSHENPH----------L-------------
G4U3F9_PIRID/38-207-------------K-Q---VMTGIILSDG--SL..............--..RMNGN----------L-------------
F7WD24_SORMK/296-466-------------R-S---VIIGLILSDG--WL..R........FVG--ARSKNAQ----------L-------------
F4FCR9_VERMA/317-493-------------W-Q---VVLGSLMGDG--AL..S........PNR--QDRNGVR----------F-------------
M5BL22_THACB/82-251-------------I-E---ILVGLLLGDL--HS...........QKQ--EKSVNPR----------L-------------
M4DFG8_BRARP/597-757-------------R-E---VLVGLLLGGL--RV..ES.......DRE--RKSHKIM----------F-------------
G4U3E2_PIRID/85-256-------------I-S---IIFGLLLSDG--WL.........QVDST--SKNPNAR----------F-------------
A9REG1_PHYPA/473-637-------------R-Q---ILVGVLLGGA--QI..IS.......HDC--NRTYEVC----------F-------------
Y1098_METJA/58-223-------------.-.---FIDGLLLGDA--CI..............--..TEKGN----------L-------------
E2JE43_RHIID/15-185-------------R-E---ILVGGLLGDL--SI...........YRA--KVTHNAR----------L-------------

PF10298

WHIA_MYCS2/17-102---------VSARR-A...EVASLLRFAG--GL-------------H--IV..AGR---------.V-------------
WHIA_PEPD6/19-107---------ECCNI-A...ELSALVKSGG--SI-------------Q--IV.GYKK---------.L-------------
WHIA_FRASC/17-102---------PCCRR-A...EMAALLRFGG--GL-------------H--IV..GGR---------.I-------------
WHIA_COREF/19-104---------QSAKA-A...EVSALLRFAG--EM-------------Q--AI..AGR---------.L-------------
A7HM71_FERNB/21-101---------SKEAQ-T...ELIGYLKGKG--II-------------V--KS..STD---------.V-------------
WHIA_ARTS2/19-104---------SSVRK-A...EVSAMLRFAG--GL-------------H--II..SGR---------.I-------------
WHIA_ACIC1/19-104---------TCCRK-A...EVAATLRFAG--GL-------------H--LV..GGR---------.I-------------
WHIA_CLONN/19-107---------REEAI-A...ELSGIMKVSG--TL-------------G--FS.GDMK---------.M-------------
WHIA_CLOCE/19-106---------ECCMK-S...EILGVILIGN--LF-------------S--NE..KIL---------.R-------------
WHIA_BIFAA/19-105---------PIAKK-A...QATAMIRFGN--GL-------------H--SV..DHH---------.I-------------
A6LMS1_THEM4/20-100---------EIEAK-S...ELSGFLKSKG--IL-------------I--KT..YRG---------.L-------------
WHIA_NOCSJ/19-104---------TCCRK-A...EVASMLRFAG--GL-------------H--IV..SGR---------.I-------------
WHIA_BACSU/18-103---------DCCIN-A...ELSALIRMNG--AL-------------S--FT..NRH---------.L-------------
WHIA_LACC3/19-104---------PEHAK-A...ELSALIRMNG--SL-------------T--LM..AHR---------.F-------------
WHIA_PEDPA/18-103---------EKNAK-A...ELMALIRMNG--AI-------------G--IN..NRQ---------.L-------------
WHIA_LACBA/18-103---------RENAK-A...ELVALIRMNG--AL-------------G--LA..NRH---------.F-------------
WHIA_LEUMM/18-103---------AGNAK-A...ELAALMRMNG--VS-------------T--LG...FD---------.Q-------------
WHIA_OENOB/18-106---------VKTSK-S...ELSAIFRLNG--IY-------------H--LG..TAV---------GN-------------
WHIA_SYNWW/19-108---------ECCRK-A...ELAALLAISG--DL-------------V--VG.EDGR---------.R-------------
WHIA_SALTO/19-104---------PCCRR-A...EMAALLRFAG--GL-------------H--IV..SGR---------.V-------------
WHIA_RHOSR/17-102---------VSCRK-A...EVSSLLRFAG--GL-------------H--IV..GGR---------.V-------------
WHIA_ALKOO/19-108---------RCCQL-A...ELAALIRMCG--TL-------------Q--LVGGAQK---------.L-------------
WHIA_CLOPH/19-107---------RHCRL-A...EIAALLSACG--HV-------------I--QK..DGE---------IK-------------
WHIA_LACDA/19-104---------PEHAK-A...ELAAFLRMNA--VL-------------S--RH..DGQ---------.M-------------
WHIA_LACS1/18-103---------FGNAK-A...ELMALIRMNG--SL-------------S--IV..NKQ---------.F-------------
WHIA_HALOH/19-107---------KMCQL-A...ELSALIMMNG--SI-------------Q--II..NKN---------.L-------------
WHIA_MOOTA/23-103---------PCCRQ-A...ELVAFLRLGN--LD-------------G--GQ..PGE---------.E-------------
WHIA_CLOB8/19-106---------KEEAL-A...EISAIMKVSG--TL-------------A--FS..GSG---------.L-------------
WHIA_CALS8/19-106---------SCCRK-A...AIAAFLKFAG--VI-------------Y--KS..EGI---------.F-------------
WHIA_LACSS/19-104---------PEHAR-A...ELAALIRMNG--SL-------------S--LM..NHQ---------.F-------------
WHIA_CARHZ/19-103---------SCCQR-A...ELGAYVKMLG--DL-------------G--IS..NKK---------.L-------------
WHIA_ALKMQ/19-107---------SCCVR-A...ELAALIRMSG--TL-------------Q--LV.GSQK---------.L-------------
WHIA_KINRD/19-104---------TAARK-A...EVSVMLRFAG--GL-------------H--IV..SGR---------.I-------------
WHIA_EXIS2/18-104---------DHEMK-A...ELAALARMNG--AI-------------S--FG.LGRG---------.L-------------
WHIA_THEFY/19-104---------PCCRK-A...EVSTILRFTG--GL-------------H--LV..GGR---------.I-------------
WHIA_CLOTH/18-106---------RSSSL-F...ELAAAARISG--LI-------------K--VV.NANE---------.I-------------
WHIA_CORJK/19-104---------HDVMT-A...EVASLLRYTA--AL-------------H--LV..GKK---------.I-------------
WHIA_LACAC/19-104---------PEHAK-A...ELAAFLRMNG--VL-------------N--LH..DHQ---------.F-------------
WHIA_GEOKA/18-103---------PCCLR-A...ELSALLRMNG--SL-------------S--FS..GGR---------.M-------------
WHIA_BACSK/18-104---------SCCAR-A...ELSALIRMNG--SL-------------S--LG..NKQ---------.V-------------
WHIA_SYMTH/23-111---------PCCRR-M...ELAGLVRALG--RL-------------E--LS.GRGR---------.F-------------
WHIA_PROAC/19-105---------LCCRR-S...EIAATLRFAG--GI-------------H--LV..QHR---------HL-------------
WHIA_LEIXX/19-104---------TTVRA-A...ELATILRFSG--GL-------------H--LI..GGR---------.I-------------
Q6F251_MESFL/18-103---------DNLGQ-A...FLAGFIKYNG--DF-------------I--WG..SGT---------.E-------------
WHIA_CORDI/20-105---------QRSRI-A...ELASIIRFAG--SI-------------D--SA..LGK---------.T-------------
Q6YQD5_ONYPE/20-106---------PIENF-F...ELTALLHFGC--EL-------------E--KN..HQK---------.T-------------
WHIA_ENTFA/18-103---------REHAK-A...ELAALIRMNG--SL-------------S--LV..NQQ---------.F-------------
WHIA_LACPL/18-103---------RENAK-A...ELMALIRMNG--AI-------------S--IA..NHH---------.F-------------
WHIA_CLOTE/19-107---------EKEAM-A...LLSAIMRASG--TL-------------T--FG.RNKG---------.I-------------
WHIA_STRMU/15-100---------DSADK-N...ELSAIIKMSG--SL-------------G--LA..DKK---------.L-------------
WHIA_OCEIH/18-103---------ECCQL-A...ELAALVRMNG--AI-------------S--IS..RQG---------.Y-------------
WHIA_BIFLO/19-105---------PAAIK-A...QAAAMIRFGG--GL-------------R--PV..QNT---------.Y-------------
WHIA_CORGL/19-104---------NSVRA-A...EVSAILRFAG--EM-------------Q--AV..GGK---------.L-------------
WHIA_THETN/19-107---------RESKI-A...ELAAIIRMIG--SV-------------S--FY.GNNK---------.L-------------
WHIA_CLOAB/19-107---------KGEAI-A...VLSAVMKASG--TL-------------A--LE.GNRK---------.I-------------
WHIA_LACLA/11-98---------LTSNL-ATTGALLALVRMNG--SV-------------G--IF...NG---------.L-------------
WHIA_BACHD/18-104---------LCCSK-A...ELAALIRMNG--SL-------------S--FV..NKQ---------.L-------------
WHIA_STRCO/17-102---------TCCRK-A...EVSAVLRFAG--GL-------------H--LV..SGR---------.I-------------
WHIA_STRSY/16-99---------.SQNK-S...ELSAIIKLSG--SL-------------G--LA..SSG---------.L-------------
WHIA_LACRD/19-103---------.DNAK-A...ELMALIRMNG--SI-------------G--IA..DHQ---------.L-------------
C3ASX9_BACMY/18-103---------ECCEK-A...ELSALLRMNG--SL-------------S--FS..NRR---------.L-------------
WHIA_DESHY/19-104---------RCCNL-A...ELAALVRMDG--TL-------------Q--IA..NHS---------.Y-------------
WHIA_STAA8/19-103---------.MNAK-A...ELSALIRMNG--AL-------------S--LS..NQQ---------.F-------------
WHIA_STRT2/17-99---------..KDI-A...ELSALIKMSG--SV-------------G--LT..NQG---------.L-------------
Q6MS46_MYCMS/19-102---------.EQKL-A...YLSGFIRYSS--NI-------------I--FS..NNT---------.S-------------
WHIA_TROWT/25-105---------..TRS-A...ELTALLRFGA--DL-------------N--II..KRR---------.V-------------
WHIA_STRR6/19-99---------....W-H...ELSAIIKMSG--SI-------------G--LS..TSG---------.L-------------
WHIA_STRA5/16-99---------.SENK-M...ELSAIIKMSG--SL-------------G--LA..NHG---------.L-------------
WHIA_LISMO/20-103---------..DAK-V...ELAAFIRMNG--AI-------------S--FS..SQL---------.V-------------
WHIA_STRP1/19-99---------....N-N...ELAAIIKLSG--SL-------------G--LA..HQS---------.L-------------
U5LEB5_9BACI/18-103---------DCCGK-A...ELSALIRMNG--SL-------------S--FS..SRK---------.L-------------

PF14528

A0R7F4_MYCS2/756-836-------------A.L---FLRHLWATDG..SV-------------R..W..DAKV........GQG-------------
A1T108_MYCVP/351-426-------------R.A---FLQALFEGDG..SC-------------S..A..LPRN.........TI-------------
A1TJY2_ACIAC/534-628-------------V.G---LLRGLFDTDG..SV-------------Q..G..RQDK.........GV-------------
A1VTS3_POLNA/517-611-------------R.G---YLQGLFQTDG..TV-------------N..V..SSNS........QSC-------------
A1WUS3_HALHL/509-591-------------A.R---FLNRLFSSDG..WV-------------T..H..LASG.........QG-------------
A6UT61_META3/576-653-------------LSH---FIAGLFDSDG..YI-------------N..A..NRK............-------------
A6UTA4_META3/359-447-------------R.N---FLAGLFGADG..SK-------------I.CF..RKYT.........PM-------------
A6UW46_META3/1255-1348-------------...---MLSAYFTGDG..SA-------------V..K..TRP............-------------
A6WG57_KINRD/634-715-------------A.L---FLRHLWATDG..SV-------------T..L..TRQS........RGG-------------
A9AYW4_HERA2/898-979-------------R.S---YLEGYFLGDG..TL-------------S..D..ST.............-------------
B1I483_DESAP/488-582-------------R.G---FLRGLFDADG..TI-------------I..G..EQQK.........GV-------------
B2TL46_CLOBB/6-88-------------K.A---YIAGIIDGEG..SI-------------M..L..QKFHSN....EHPSP-------------
B3QY00_CHLT3/668-763-------------A.A---LLRGLFTADG..TV-------------A..N..YGEK.........SQ-------------
B3QY00_CHLT3/1267-1342-------------T.A---FLRGLFEADG..TV-------------T..N..GV.............-------------
B6IYQ9_RHOCS/502-596-------------A.A---FLRGLFDADG..RV-------------Q..G..SQAK.........GV-------------
B7KBB5_CYAP7/899-980-------------L.G---FLEGYFLGDG..TT-------------N..G..QS.............-------------
B8GMT3_THISH/545-639-------------R.S---FLRGFYDADG..SV-------------Q..G..SQIK.........GV-------------
B8HS23_CYAP4/403-485-------------A.L---FLNRLFATDG..WA-------------T..V..LASG.........QS-------------
B8HS23_CYAP4/996-1078-------------A.L---FLRHLWSTDG..CI-------------R..P..SKKGI.......VYP-------------
C0QPU4_PERMH/910-980-------------S.K---FLAYYWDCDG..YI-------------G..E..KL.............-------------
C4XRN9_DESMR/481-575-------------R.G---FLGGLFDADG..SV-------------Q..G..TRQK.........GV-------------
C7LZ05_ACIFD/594-691-------------VGA---FLRGLFDADG..TV-------------I..V..DRNK.........GS-------------
C9RBG7_AMMDK/493-587-------------V.G---FLRALFSADG..RV-------------E..K..GSGS.........RY-------------
D0MFS7_RHOM4/597-691-------------A.A---LLRGLFTADG..TV-------------A..N..YGRK.........SQ-------------
D0MJZ2_RHOM4/916-989-------------R.L---FLGRLWSTDG..SI-------------E..K..KR.............-------------
D0MK11_RHOM4/641-722-------------..T---FLRHLWATDG..CI-------------Q..M..RRGKK.......PYP-------------
D1ABC6_THECD/789-863-------------S.A---FLRGLFEADG..TV-------------A..E..GV.............-------------
D2Q3V0_KRIFD/773-854-------------VGS---FIRHLWATDG..SV-------------R..W..DDKA........GQA-------------
D2RDQ6_ARCPA/351-432-------------L.M---WLFGLYLAEG..HA-------------S..H..TEKEMK.....KGLK-------------
D2RF09_ARCPA/632-722-------------I.E---FLSGYFDGDG..YF-------------E..V..RNGR.........IY-------------
D2RGZ0_ARCPA/317-397-------------VAE---FIKGYFDADA..TV-------------N..K..RSV............-------------
D2RHT0_ARCPA/583-657-------------L.A---YLAGLIAGDG..CI-------------V..G..NFDR..........F-------------
D2RHT0_ARCPA/681-772-------------LAG---FIRGLFDCDG..CV-------------V..I..RRKG.........SS-------------
D2RHU0_ARCPA/357-445-------------R.N---FLAGLFGADG..SK-------------V.VF..KGYTPLPI.NITQSK-------------
D2RHU9_ARCPA/799-879-------------A.K---VLQGYFSGDG..SF-------------Y..L..KNHK........RSA-------------
D2RI62_ARCPA/1107-1187-------------N.A---MIAGYIDTDG..CI-------------S..L..MFDKRT....GKHNL-------------
D3PLE6_MEIRD/901-979-------------A.S---FLQALFEGDG..SI-------------S..R..RRGT..........T-------------
D3RNR6_ALLVD/922-1001-------------R.L---FIGTLWSTDG..TF-------------D..T..SIG............-------------
D3RUR0_ALLVD/939-1021-------------A.L---FLRHLWATDG..TI-------------S..L..RKPGQ......KGSH-------------
D3SD26_THISK/547-641-------------R.G---FLRGMFDADG..SV-------------Q..G..GQQK.........GV-------------
D3SVT9_NATMM/650-744-------------R.G---FLQSLFTADG..CV-------------Q..G..NVEK.........GV-------------
D3SWA2_NATMM/649-723-------------S.A---FIRALADSEG..TV-------------D..K..RA.............-------------
D5BWU6_NITHN/1168-1260-------------A.A---YLRGLYQADG..HI-------------Q..A..SREV..........T-------------
D5C1W3_NITHN/655-749-------------I.G---FLQGWFDADG..SV-------------Q..G..AQNK.........GV-------------
D5MER0_9BACT/526-620-------------Q.G---FLRGLFDADG..SV-------------Q..G..SQKK.........GV-------------
D5UE80_CELFN/877-950-------------A.L---FLRTLLTANG..AV-------------V..L..GGTT..........G-------------
D5WTP6_KYRT2/749-844-------------R.A---FLQALFSSDG..TV-------------Y..E..NDEH.........HR-------------
D7B342_NOCDD/1193-1267-------------A.A---FLRGLFEADG..TV-------------L..E..GV.............-------------
D7CX96_TRURR/597-691-------------C.G---LLCGLFDTDG..SV-------------Q..G..NQDK.........GF-------------
D9T2Z6_MICAI/361-436-------------R.A---FLQALFEGDG..SS-------------S..L..LPRR.........TI-------------
E4NRK9_HALBP/486-562-------------L.A---RLLGYVAAEG..YV-------------E..R..RDSG.........SA-------------
E4NRK9_HALBP/587-658-------------R.G---FLRAFVDAEG..TV-------------S..P..SQR............-------------
E4NRK9_HALBP/1125-1201-------------A.A---FVRAMADSEG..SV-------------D..T..DSG............-------------
E6N2P5_9ARCH/184-275-------------A.M---FLRGFFDSEG..SV-------------S..K..LG.............-------------
E6N3C0_9ARCH/300-389-------------A.S---ICRGYFDGDG..GV-------------F..S..RGG............-------------
E6N4J4_9ARCH/190-281-------------A.M---FLRGFFDSEG..CV-------------D..K..RG.............-------------
F0S203_DESTD/591-669-------------K.L---FVKHLWATDG..NI-------------S..I..SKGN..........V-------------
F2KME6_ARCVS/484-560-------------F.W---RFIALFIAEG..YA-------------Q..K..SESG.........CA-------------
F2KME6_ARCVS/583-665-------------R.A---FLSAFFDAEA..SV-------------D..R..KKP............-------------
F2KME6_ARCVS/1131-1201-------------V.A---FLRAAFMGDG..SV-------------E..S..EA.............-------------
H3ZK26_THELN/701-790-------------R.A---FLRGLFTADG..YV-------------D..N..DS.............-------------
H3ZL75_THELN/1325-1406-------------..A---FLRGLFSADG..TV-------------T..I..RKG..........VP-------------
APE1_AERPE/108-183-------------I.E---YVKGFVDAEG..SV-------------I..K..SSKG..........V-------------
DNAB_MYCTU/615-694-------------..L---FLRHLWSAGG..SV-------------R..W..DPTN........GQG-------------
Q0A8L7_ALKEH/547-641-------------K.G---FLRGLYDADG..SV-------------Q..G..SQRK.........GV-------------
Q0AB46_ALKEH/513-595-------------A.L---FLSRLFACDGSAFV-------------Q..G..NGQ...........A-------------
Q0AB46_ALKEH/1102-1181-------------A.L---FLRHLWATDG..SI-------------T..Q..GSAG.........RP-------------
Q122S1_POLSJ/523-616-------------..G---LLRGLFDADG..SV-------------Q..G..SQEK.........GV-------------
Q18E84_HALWD/891-971-------------D.A---FIRGLFDTGG..RI-------------D..N..KNT...........P-------------
Q251D1_DESHY/495-588-------------..G---LLRGLYDTDG..TV-------------T..G..TQEK.........GV-------------
Q2J782_FRASC/310-390-------------A.A---YLRSLFQADG..YV-------------S..R..RERS..........T-------------
Q31MT0_SYNE7/625-718-------------..G---FLRGLFDADG..SV-------------Q..G..SQEK.........GV-------------
Q3AEA3_CARHZ/467-554-------------K.A---LLRGLFSADG..SV-------------Y..D..ANGS..........I-------------
Q3ASQ1_CHLCH/668-763-------------A.A---LLRGLFTADG..TV-------------A..N..YSDK.........SQ-------------
Q4Z9C2_BPTWO/367-442-------------L.A---FVSGYLECES..SI-------------S..E..KN.............-------------
DNAB_SYNY3/596-678-------------A.I---FLRHLWSTDG..CV-------------K..LIVEKSS.........RP-------------
IF2P_METJA/324-403-------------VAE---FIKGYFDADG..YV-------------N..L..RQN............-------------
RTCB_METJA/360-448-------------R.N---FLAGLFGADG..SR-------------AVFK..NYTPLPI..NLTMSK-------------
RPOA2_METJA/245-317-------------F.G---YFIGIYLAEG..SV-------------T..K..YF.............-------------
RPOA2_METJA/338-408-------------R.G---LIRGYFDGDG..NV-------------N..A..DRK............-------------
Y1054_METJA/466-543-------------..A---RLIGYYLSEG..WI-------------S..K..DYGRNGV...VRKRI-------------
HELS_METJA/542-629-------------A.Y---LIAGLFDSDG..YI-------------Y..L..NRK............-------------
GLMS_METJA/275-347-------------L.M---QIIGYIIGDG..HF-------------P..S..NR.............-------------
GLMS_METJA/371-449-------------A.S---YLRGIFDAEG..YI-------------R..A..EAK............-------------
RFCS_METJA/176-249-------------L.A---EWLGYFIGDG..HA-------------D..K..ESN............-------------
RFCS_METJA/271-346-------------R.A---FLRAYFDCDG..GI-------------E..K..HS.............-------------
RFCS_METJA/1454-1542-------------R.E---FLRGLFGADG..TK-------------P.YI..KKYNIN.....GIKL-------------
Q5JE24_THEKO/618-702-------------A.A---FLAGYYDADG..HI-------------G..T..KPTGGK....KSHSP-------------
Q5JEN0_THEKO/799-877-------------R.Y---FIAGLFDADG..SV-------------D..E..TGP............-------------
RADA_THEKO/370-442-------------A.A---FLAGYLDGDG..YL-------------T..E..SI.............-------------
Q5JGJ5_THEKO/164-258-------------A.E---FLRGFFDSEGFPVV-------------S..A..GKRF.........RV-------------
IF2P_THEKO/319-390-------------VSR---FLRGYFDADG..HV-------------S..L..KDA............-------------
HELS_THEKO/594-678-------------L.G---LLRGLIEGDG..YV-------------R..R..ESQR........RAN-------------
RFCS_THEKO/180-253-------------L.A---EWLGYFIGDG..HA-------------D..S..KNK............-------------
RFCS_THEKO/273-346-------------R.S---FLRAYFDCDA..GV-------------D..K..NA.............-------------
Q5SLW3_THET8/981-1051-------------A.L---FLGRLFSTDG..SV-------------E..K..KR.............-------------
Q5SLW3_THET8/1451-1528-------------A.R---FLGRLWTGDG..GV-------------D..P..KGR............-------------
Q5SM68_THET8/531-609-------------A.A---FLRGLFEADG..TI-------------T..A..GY.............-------------
Q5SM68_THET8/1139-1233-------------V.G---FLQGLFSADG..SV-------------Q..I..NEKK........QDA-------------
Q5SM68_THET8/1696-1769-------------L.A---LFLGMLAADG..ST-------------V..E..ATG............-------------
Q5UYX8_HALMA/481-557-------------L.A---RLIGYIVAEG..YV-------------E..Q..RPDN.........TG-------------
Q5UYX8_HALMA/582-653-------------T.G---FIRGYIEGEG..HV-------------S..T..SQR............-------------
Q604J6_METCA/507-601-------------R.G---LLRGMFDADG..SV-------------Q..G..SQRK.........GV-------------
RGYR_THEKO/1239-1317-------------N.A---MIAGYFDTDG..TF-------------S..I..LNDRK......GPNF-------------
Q7NEB4_GLOVI/421-498-------------G.A---FLSGYFDADG..CV-------------R..G..GKG............-------------
Q7NEB4_GLOVI/968-1061-------------R.G---FLRGLFDADG..SV-------------Q..G..DQQK.........GV-------------
Q8EQH2_OCEIH/74-143-------------M.A---YILGFFIADG..TV-------------A..K..GAQ............-------------
RTCB_METKA/361-448-------------R.N---FLAGLFAADG..SV-------------V..K..FKRYTPLPINLTQAK-------------
VATB_METKA/488-560-------------V.M---YVAGLIASDG..SV-------------D..T..ERG............-------------
Q8TY20_METKA/847-927-------------A.A---ALRGYYTGDG..SF-------------S..V..KPHG........RSA-------------
RTCB_PYRFU/366-453-------------R.N---FLAGFFGADG..SI-------------V..E..FKGTTPLPIHLTQAK-------------
Q8U412_PYRFU/161-255-------------R.E---FIRGFFDSEG..YV-------------F..V..DPKDP.......RMA-------------
Q8ZWC8_PYRAE/132-209-------------T.A---IIRGLLDTEG..SV-------------K..K..ISRT..........L-------------
Q9RRW1_DEIRA/735-829-------------R.G---VLQGLFDADG..SV-------------Q..G..TQSK.........GV-------------
W6G9Y3_NODSP/613-705-------------..G---FLQGLFSADG..CV-------------N..V..KGR............-------------

PF09062

Q5JJ43_THEKO/430-527-------PSDDDYEFLLDYWLAGFIAGDG--SI-------------DKYRSHVKGH------EYVYD-------------
NDRZ_PYRFU/430-527-------PDGEDYKFIFDYWLAGFIAGDG--CF-------------DKYHSHVKGH------EYIYD-------------

PF14527

WHIA_MYCS2/124-216-------------AEA---AWRGAFLAHG--SL-------------T--EP.GRS.------------------------
Q4A5P3_MYCS5/94-186-------------LTF---FFSGIFFGSG--SL-------------N--L..SVGS------------------------
WHIA_STRMU/121-214-------------GRS---YLKGAFLSTG--SI-------------R--DP.ESGK------------------------
WHIA_CALS8/130-222-------------KKA---FLQATFLSCG--SI-------------T--NP.EKM.------------------------
WHIA_HALOH/128-220-------------QKS---YVRGAFLGGG--SV-------------N--NP.RGE.------------------------
Q98QY4_MYCPU/96-191-------------FTS---FYAGVFVARG--SI-------------S--KE.EANS------------------------
WHIA_CLONN/131-223-------------RRV---FIRGVFLGGG--SI-------------S--NP.EKT.------------------------
WHIA_BIFLO/127-219-------------IKA---AWRGAFMARG--FL-------------S--DPGKAS.------------------------
WHIA_MOOTA/117-209-------------QAA---YMRGAFLVTG--SV-------------N--KP.SGT.------------------------
WHIA_CARHZ/124-216-------------RRS---FLRGVFLAGG--SL-------------N--DP.AGD.------------------------
WHIA_SYNWW/130-222-------------KRA---YLRGIFLSRG--SI-------------N--RP.EGE.------------------------
A6LMS1_THEM4/115-208-------------FAA---FLRGVFVSSG--SI-------------T--DP.AKN.------------------------
Q9PR72_UREPA/135-227-------------CSN---FLIGAMLSGG--SI-------------A--HP.LEN.------------------------
WHIA_LEUMM/122-215-------------RRS---FLRGAFLAAG--SV-------------N--SP.ERAN------------------------
WHIA_TROWT/128-220-------------LKG---LVRGAILASG--VF-------------T--E..STRK------------------------
WHIA_CLOPH/130-222-------------KRA---FVRGLFLAAG--SM-------------S--DP.EKT.------------------------
Q1AUH5_RUBXD/45-136-------------LAG---YLRGAFAGAG--SV-------------T--RPGGAGG------------------------
A7HM71_FERNB/116-209-------------FGA---FLRGLFVSSG--SV-------------T--DP.SKH.------------------------
WHIA_OENOB/125-220-------------QQA---FLRAAFLSTG--SV-------------N--AP.NSKN------------------------
Q4A984_MYCHJ/93-186-------------.QY---FFAGLFIGGG--SI-------------S--HL.ESKR------------------------
WHIA_LACJO/126-219-------------.MS---YLRGAFLASG--SV-------------N--NP.ETSR------------------------
WHIA_BACCR/125-217-------------.RS---YLRGAFLAGG--SV-------------N--NP.ETSS------------------------

PF05204

Q874G4_9SACH/619-731AIPMHLSYDDIEVREQ---FIAGLVDSIG--HV-------------K--RTSNGTI------------------------
Q8J0H1_9SACH/320-431NIPSFLSTDNIGTRET---FLAGLIDSDG--YV-------------T--DEHGI..------------------------
F2Z6H8_CANGA/308-425QVPEFMWHEDIEIREA---FLAGLIDSDG--YV-------------V--KRKENPD------------------------
Q874F9_SACPS/464-565KSKFHLTIEGPKVL.A---YLLGLWIGDG--LS-------------D--RA.....------------------------
Q8J2S8_SACPA/309-426QIPEFMYGEHIEVREA---FLAGLIDSDG--YV-------------V--KKGEGPE------------------------
Q8J0H3_KLULC/295-382GIPSFMMSENINVRES---FLAGIVDSQN--QK-------------L--DD.....------------------------
Q874G2_SACEX/606-728KIAHELAGDAFEVREQ---FVAGLVDATG--YV-------------R--KDVYDHA------------------------
A7TLB5_VANPO/570-682TVPSFLSSDLIEIRET---FLAGLIDSNG--SV-------------D--NNKQDI.------------------------
Q8J0H0_NAUCA/385-494SVPLHLSYDDIEVREQ---FIAGLIDSDG--YV-------------K--SADNRF.------------------------
A5DXZ0_LODEL/565-659VIPSSIAVENIEVRES---FLAGFVDASQ--TE-------------L--KQDSA..------------------------
Q8J0G4_ZYGBA/322-433NVPSYLFSDSICHREV---FLAGLIDSDG--HV-------------R--GDDGL..------------------------
Q8J0G7_9SACH/280-391TIPKELVSDSISVREH---FIAGLVDTQG--NV-------------K--RASTGAV------------------------
A3LP04_PICST/578-697SVPSFLRSESIAVREY---FISGLVDSDG--HV-------------K--RDEADKC------------------------
Q2P9R3_DEBHA/255-353AIPSFLRTESFEVREQ---FLAGLIDSDG--IV-------------T--KNPL...------------------------
Q8J0G5_9SACH/322-432NVPTYLLSDAIPHREI---FLAGLIDSDG--FV-------------R--SEDGC..------------------------
Q8J0G3_ZYGBI/311-419NVPAYLSSDCFENREM---FLAGLVDSEG--HV-------------R--GE.....------------------------
Q8J0G2_ZYGRO/322-427NVPGYICSDSFQHREV---FLAGIIDSTG--YV-------------S--DE.....------------------------
Q8J0G3_ZYGBI/204-305NSKFASGTEATRAL.S---YFLGLWIGGG--LT-------------D--KT.....------------------------
A7TIB9_VANPO/308-425QIPTFMWSEDVEVREA---FMAGLIDADG--YV-------------V--KRKEGPD------------------------
Q707X4_ZYGRO/36-153QIPSFMWTEDLEVREA---FLAGLIDSDG--YV-------------S--KRKNPLD------------------------
Q8J0G4_ZYGBA/215-316NSKFALRSEASTAL.A---YLLGLWVGDG--LS-------------D--RA.....------------------------
Q8J0G6_9SACH/322-433HVPSYLLTDSIPHREV---FLAGLIDSDG--YV-------------R--GEEAP..------------------------
Q8J0G5_9SACH/215-316DSKFGLTSEAPLAL.A---YLLGLWAGDV--SS-------------E--ET.....------------------------
VATA_CANTR/603-713SIPQHIAVDDIVVRES---LIAGLVDAAG--NV-------------E--TKSNGSI------------------------

PF00961

IEND2_NEUCR/150-252--------------------ITGFSDAEG--SF-------------V--VTILKNP........RYKIGWN.........
IEND3_NEUCR/248-349--------------------WSGLIDGEG--SF-------------N--IIVDRNK........SRKLGWR.........
IEND2_NEUCR/320-414--------------------VAGFSSGEA--NF-------------F--ITMSGTK........................
IEND3_NEUCR/408-508--------------------ISGFVSAEG--NF-------------D--VRMPSTN.........SKLGYR.........
IEND4_NEUCR/418-514--------------------LSGFTDAEG--CF-------------T--CSVYDNK.........SNTAKL.........
SCE3_YEAST/113-209--------------------LAGLIEGDG--TI-------------T--VQNSSSM.........KKSKYR.........
MBI3_YEAST/268-369--------------------IGGLFEGDG--WI-------------T--ISKKGKY........................
YMC1_SCHPO/111-209--------------------LVGFTDGDG--CF-------------S--ISKQKIK........NGKNKWS.........
YMN3_PODAN/147-246--------------------ISGFVDGEG--SF-------------M--LTIIKDN........KYKLGWR.........
Q02694_PODAN/137-238--------------------VVGFSDAES--SF-------------M--IRIRKNS........KYKTGWT.........
YMN4_PODAN/337-438--------------------ITGFVDAEG--CF-------------M--IGLTKSE........LYRSGYQ.........
Q02690_PODAN/82-182--------------------ITGFTDGEG--SF-------------G--IKIYKAK........GHKLGWR.........
Q02693_PODAN/59-159--------------------ITGFTDGEG--CF-------------W--IGVRRDP........RNKLGWC.........
Q02692_PODAN/142-243--------------------WSGLIDGEG--SF-------------S--IILVRNS........TRKLGWR.........
YMN3_PODAN/304-404--------------------LSGFVDAEG--CF-------------S--VVVFKSK........TSKLGEA.........
Q02693_PODAN/220-320--------------------MAGFTSGEG--SF-------------F--VNIFKSS........HHKVGYQ.........
Q02694_PODAN/296-397--------------------LAGFVSGEG--CF-------------K--SILKKSS........SVKVGFQ.........
Q02692_PODAN/304-403--------------------ISGFVSAEG--NF-------------D--VRTPKTN.........SKTGYR.........
Q02690_PODAN/239-345--------------------LVGFIDGEG--SF-------------N--IITVEKKSSD..APSILSTSYK.........
Q02695_PODAN/90-183--------------------FSGFTDAEG--NF-------------L--ISIDRNY........................
Q02704_PODAN/111-209--------------------FVGFTDAEG--SF-------------S--INPMLTK.........DGSTLS.........
Q02696_PODAN/261-370--------------------LLGFIEGEG--CF-------------S--INKGNSY........RLDFSLT.........
Q02704_PODAN/265-379--------------------LLGFIEGDG--SF-------------F--IRRDNLTPT....FSIENTGVQL........
YMC2_SCHPO/201-295--------------------LAGFSDADA--SF-------------Q--IKILNRD..............K.........
Q02684_PODAN/188-285--------------------LAGFAQADG--CF-------------Y--ISVVKSK........THKAGYS.........
Q02673_PODAN/152-245--------------------LSGFVDAEG--CF-------------N--VYVSKTN..............K.........
Q02683_PODAN/191-286--------------------LTGFTDGEG--CF-------------T--CSINKDK..............G.........
Q02678_PODAN/149-269--------------------LAGFTDGDG--NF-------------S--ITLTDRK.......KKGVVTSK.........
Q02686_PODAN/199-321--------------------LSGFTDADG--CF-------------G--ITVYDRKKNGVFLRTSVKTSFRIEV.....K
Q02679_PODAN/177-282--------------------LAGFIDADG--SF-------------S--IKGFSSN........NLRTYLGF........
Q02680_PODAN/145-255--------------------LSGFIDSDG--SF-------------S--VLHTKLEN......GAKKRKIAC........
Q02687_PODAN/214-318--------------------LSGFIESDG--HF-------------S--LRSTESG............KYP.........
Q02687_PODAN/93-190--------------------IAGLIEGDG--TI-------------H--VPKSERS.........NKGKLN.........
AI2B_DICDI/119-215--------------------LSGFFDGVG--SI-------------V--INQTTLE........................
Q02676_PODAN/69-164--------------------WVGLMDGDG--SI-------------Q--VNHWRKQ........S...............
AI3_DICDI/13-108--------------------WVGLMDGVG--SI-------------E--VNHYRMK........N...............
RGYR_METJA/1152-1248--------------------IAGYFDTDG--CF-------------S--LLYDKKA........................
H9D0N7_EMENI/31-126--------------------LVGLFEGDG--YF-------------S--ITKKGKY........................
H9D0P6_EMENI/44-138--------------------LAGLIEGDG--TI-------------I--VPNTLRS.........PKGKLN.........
H9D0P7_EMENI/159-267--------------------LAGFSDADA--SG-------------A--GLHPGCV........SPKASFQIKILNRNKK
AI3_KLULA/142-233--------------------FVGLFDSNG--NI-------------Q--INKYKSK............YLQ.........

PF03161

E2JE69_RHIID/38-210----AFYQ.EKTNG----EYLL--------WLHQV-I-S-SLGYSKPEIPIIQTRKGTNGQ..IR-----------YSY-
D1AAC0_THECD/316-492----RMGH.GAGQA----AYLD--------WKVSL-L-G-NIPCTRSVN..............AK-----------GAV-
F2WVM1_MONRO/53-226----GFYQ.EDVHV----EYIL--------YLHKF-L-S-DLGYCNPKVPESTKRLGFKGK..IR-----------KIV-
E6ZZ92_SPORE/48-221----SFTQ.EAIHK----EYLI--------WLHNL-I-F-NLGYSTPNLPKIQTRLGLGGK..LR-----------YVL-
M0UAK9_MUSAM/455-621----EFSENSNIHS----VLRV--------HIHER-F-Y-EWLTLSSRSNDDD..........NE-----------MPY-
A9TWX7_PHYPA/130-304----FFRI.SKVDE----EYFK--------WKAAS-L-K-EISAMNSVHLG............AS-----------NKF-
Q6U7Y1_MONPE/84-248----QYNQ.GFIHL----EHIL--------YLSYL-L-S-PILTHLPSLVQQRD.........LS-----------TYL-
RECA_MYCLE/317-494----RLLGYGCKQV----EYLQ--------WKKAL-M-G-NIRHTVREN..............SM-----------GAS-
K5WT44_AGABU/33-209----KFEW.GDKNK----PYLD--------HVYNL-F-N-EWVLAQPHFKSRINLNGN.....QV-----------NNW-
D3DFV7_HYDTT/7-179----KLEH.SERQK----DYIF--------WKWEE-L-K-NLMQDKPRRIERYNPRWGK....SY-----------TYY-
M5BUR5_THACB/35-205----MFKQ.GICNK----DYLM--------HLYEI-F-S-AYCSSEPNFTNAAPDKRTGV...VY-----------TGI-
SCE4_YEAST/424-601----RLKQ.SMIHS----EYLM--------YVFML-L-S-HYCMSYPKMKIAKVKGK......SY-----------NQL-
K9TPD0_9CYAN/12-180----YISH.RATQE----NYVL--------FKKQL-L-E-QITQQPVSIRPRTTNR.......GE-----------QLL-
Q02672_PODAN/51-225----VYAQTAIKHK----EYFD--------YVFSF-F-L-PFCANDYKPQSRLVVDNSTKK..IY-----------SAI-
SCE1_YEAST/34-208----QFEW...KNK----AYMD--------HVCLL-Y-D-QWVLSPPHKKERVNHLGN.....LV-----------ITW-
Q85QA0_CANGA/78-255----KLKL.SMKNK----EYLI--------YVYKL-L-E-HYCISMPKLKKDMMRGK......EY-----------LKL-
Q6ZEW6_SYNY3/132-296----AE...GGANK----EYIN--------WKFNF-L-K-DYFYCTFQECLSSPHVKSGK...QY-----------QGW-
K7N0N6_SOYBN/532-697----DFDRNSGSHY----VLKS--------HIYHQ-F-Y-EWLHPTCKPGDNS..........EN-----------IPD-
AI7_USTMA/402-564----FLKQ.SINNA----FYLF--------YTFSL-L-S-HYCSSYPYIVNSR..........GF-----------IAV-
G4U3E9_PIRID/59-232----SFYQ.ESTHV----SYLL--------WLHSY-L-S-FRGYCNIIIPAITTRLGVKGV..VR-----------QII-
M1CIN2_SOLTU/404-569----EFNEESRIHS----IFKK--------HIHDE-F-H-EWLGSHDMMVDST..........AD-----------IPN-
Q9B6C9_YARLI/213-390----NIYQ.EGSHK----SYLL--------YLHSL-F-A-NLGYCNTKIPNITTRLGNKGK..IR-----------KII-
PP154_ARATH/632-795----EFRENSQAHL----VLKQ--------NIHDQ-F-R-EWLHPLSNFQE............DI-----------IPF-
G4U3G4_PIRID/70-243----GFEQ.SIKHF----AYFW--------YVFNI-L-K-PYLSNWFNFRIRTKYFKNMGKPIIT-----------CSM-
M5BJL1_THACB/29-201----DFEQ.GFVHK----DYLY--------HLFDL-F-K-SYCLAAPKIANRLPDKRTGK...IY-----------TRI-
MBI2_DEBHA/69-242----LFYQ.EGSHN----EYLL--------FLHRL-I-A-NLGYCNTNIPKLQTRISNNGK..IR-----------KII-
K5XIF0_AGABU/77-253----RFKQ.SIKRS----DYVF--------NVFSL-I-S-HYCISYPTLVKTRVNRK......DF-----------VGI-
D8RW96_SELML/689-854----EQDAESYKGQ----ALIH--------NLYEI-F-T-DWAVETPKVVEDSGG........QG-----------RKL-
C7U019_PICSO/188-361----TFYQ.EGSHN----DYTL--------YLHSL-I-A-NLGFCNTNIPKMYTRLGKKGK..MR-----------KIM-
M5BJK2_THACB/16-192----EMSF.GQHSQ----QFAE--------KIGEL-F-K-DYMSNPVKSVTLKVRDK......TY-----------TNY-
F6FSE8_ISOV2/317-493----RMGH.GPKQV----AYLD--------WKASM-F-G-NIGQTRSER..............SS-----------GSV-
C5Y0D4_SORBI/581-747----KFQEDSNAHS----VLRV--------HIHER-F-F-EWLPSACRSLNRE..........SE-----------IPY-
K9PLK5_9CYAN/22-190----FIQH.SSKQE----EYIL--------FKKYL-L-E-EITGKSVNIRRWDTKE.......GY-----------SLI-
B9S769_RICCO/624-785----EFNENSSTHA----ILRR--------HLYDK-Y-H-EWLHPSCKLSDGS..........DG-----------ASY-
C5GYP6_AJEDR/59-232----CYRQ.SIVHK----DYLF--------WLYNF-F-Y-TRGYCSNLKPIKYSRLLKNQSK.EY-----------YGY-
W1NZZ2_AMBTC/553-719----EFNENSDAHG----ALKV--------HIYER-F-Y-EWLTPFGNISDRN..........DE-----------IPC-
MBI2_YEAST/223-403----VFQQ.EYCNI----NYLY--------YLHSL-L-A-NLGYCNTNLPLIKTRLGKKGK..IR-----------QYL-
D7TPM6_VITVI/580-745----EFNENSGAHS----VLRR--------HIHEQ-Y-H-EWLNSSSKLSDDN..........DD-----------VPY-
A9T5I5_PHYPA/473-637----ELTDATEAGP----VLID--------HLYDI-F-A-DWAQQAPRTEVNDD.........SR-----------KTY-
A5J053_GIBZE/61-229----TFKQ.GLKNS----NYVW--------FAYFI-L-A-HYCNLHPSLVKSFRKNR......VA-----------FAI-
G4U3F9_PIRID/38-207----ALLSIQLINL----ELAM--------GLWTM-C-K-ELQLVTNEILTLHRNN.......WQ-----------PIY-
F7WD24_SORMK/296-466----GFLQ.SGANG----KYFW--------FVFWS-I-S-HYCSANPKLRVRSRFGK......EN-----------ISW-
F4FCR9_VERMA/317-493----RLGH.GEQQV----DYLD--------WKVSL-L-G-NISHSRRTD..............SR-----------GAA-
M5BL22_THACB/82-251----IFQQ.GIIHK----EYFD--------YLYEL-F-K-FYGTMMPKISISKPHPKTGN...LY-----------TTI-
M4DFG8_BRARP/597-757----EFREKSQAHL----ILRQ--------HIHDQ-F-R-EWLPHSEE...............ED-----------IPL-
G4U3E2_PIRID/85-256----GLKQ.SIINF----AFIW--------HVFQL-L-S-HYCQSLPFWGSSIMRGK......LF-----------TSV-
A9REG1_PHYPA/473-637----KLTDATEAGP----ILIN--------HLYDM-F-A-DWSQQAPRMEVDDD.........LG-----------KKY-
Y1098_METJA/58-223----LITQ..NKRY----DWLE--------YVKHR-F-Q-QFGLNVYFHCYKYKRRTSEV...IA-----------DLY-
E2JE43_RHIID/15-185----YVQQ.GSVHK----EYLN--------HLYSV-F-Q-NLCSSEPKWSLSLDKRSNT....TY-----------ETL-

PF10298

WHIA_MYCS2/17-102----VVEA-EVDLG----IIAR--------RLRKD-I-Y-DLY--------------------.G-----------YNA-
WHIA_PEPD6/19-107----NLKI-TTELN----SIAR--------KVFKL-L-K-KNF--------------------.N-----------INT-
WHIA_FRASC/17-102----VVEA-ELDTG----ATAR--------RLRRE-V-A-EVF--------------------.G-----------FPS-
WHIA_COREF/19-104----VIEV-NLDSM----AVAR--------RLQEF-I-S-QLY--------------------.D-----------TDV-
A7HM71_FERNB/21-101----YIQL-EVGFI----PAAR--------RIMNL-M-H-YL.--------------------.G-----------VDK-
WHIA_ARTS2/19-104----VIEA-EVDLA----STAR--------RLRAA-I-A-EVY--------------------.G-----------HQS-
WHIA_ACIC1/19-104----VVEA-ELDTG----AAAR--------RLRTA-L-A-ELY--------------------.G-----------QHA-
WHIA_CLONN/19-107----NFRV-STENP----AIAR--------LTFKL-L-K-DHF--------------------.N-----------IHT-
WHIA_CLOCE/19-106----NTKV-VTENA----AFAR--------RIYSI-F-R-RIY--------------------.G-----------ICP-
WHIA_BIFAA/19-105----LVQA-QLDSQ----DAAI--------WLQDT-I-R-NLY--------------------.G-----------HEA-
A6LMS1_THEM4/20-100----HVKL-EIGFI----PAAR--------RVMNL-M-G-IV.--------------------.E-----------VNK-
WHIA_NOCSJ/19-104----VVEA-EFDTG----AAAR--------RLRTN-I-A-EVY--------------------.G-----------HQS-
WHIA_BACSU/18-103----VLDV-QTENA----AIAR--------RIYTL-L-K-KQY--------------------.D-----------VSV-
WHIA_LACC3/19-104----VLNI-QTENP----AIAR--------RIYSL-I-R-QVY--------------------.H-----------HEA-
WHIA_PEDPA/18-103----TLNT-QTENP----AIAR--------RIYSL-L-K-EFY--------------------.H-----------LEA-
WHIA_LACBA/18-103----VLNV-QTENP----AIAR--------RMYQL-L-K-QFY--------------------.D-----------LES-
WHIA_LEUMM/18-103----TIRV-QTENA----AIAR--------RIYTL-L-K-ETY--------------------VE-----------VEV-
WHIA_OENOB/18-106----TLEV-QTQNP----ASAR--------RTYQL-L-S-QTY--------------------.E-----------ADI-
WHIA_SYNWW/19-108----ILKV-QADNA----ATAR--------KIITL-L-K-ENY--------------------.Q-----------IPS-
WHIA_SALTO/19-104----VVEA-ELDTG----AVAR--------RLRRE-I-A-EVY--------------------.G-----------YPS-
WHIA_RHOSR/17-102----VVEA-EVDLG----STAR--------RLRRE-I-F-DLF--------------------.T-----------YSA-
WHIA_ALKOO/19-108----NIKL-TTENP----AIAR--------KLFKL-F-K-DLF--------------------.G-----------VHI-
WHIA_CLOPH/19-107----SIVL-QTENI----LVAR--------KYFTL-L-K-KTF--------------------.N-----------INT-
WHIA_LACDA/19-104----SLDI-VTENP----AIAR--------RIFSL-I-K-TAY--------------------.G-----------FDP-
WHIA_LACS1/18-103----VLSV-QTENP----AIAR--------RIYRL-L-K-QFY--------------------.D-----------IES-
WHIA_HALOH/19-107----AVKV-RLYHG----DLAR--------KVYKL-I-K-ERF--------------------.E-----------LNI-
WHIA_MOOTA/23-103----TVLF-TTPYP----ALAR--------KVYSL-A-R-EFL--------------------..-----------.AC-
WHIA_CLOB8/19-106----SFKM-TTENP----ASAR--------LIFTL-L-K-DHF--------------------.N-----------IHS-
WHIA_CALS8/19-106----SFKA-SFENA----QTAR--------AYFLL-M-K-NGF--------------------.S-----------KHC-
WHIA_LACSS/19-104----VLNV-QTENP----AIAR--------RIYSL-L-K-QNY--------------------.Q-----------VES-
WHIA_CARHZ/19-103----KLSL-KTPLS----FLAR--------KILIL-L-K-NN.--------------------.G-----------FKT-
WHIA_ALKMQ/19-107----NIKV-TTENP----AIAR--------RLFKI-I-K-KQY--------------------.N-----------IHA-
WHIA_KINRD/19-104----VIEA-ELDSA----SIAR--------RLRRD-I-A-DVF--------------------.G-----------HPS-
WHIA_EXIS2/18-104----TLDI-STENA----SIAR--------RIYSL-L-K-RAY--------------------.A-----------VHL-
WHIA_THEFY/19-104----VIES-ELDTG----VAAR--------RLRKD-I-A-EVF--------------------.G-----------HES-
WHIA_CLOTH/18-106----NLRL-VTENA----AFAR--------RIFSQ-I-K-DLY--------------------.G-----------INA-
WHIA_CORJK/19-104----VVES-EVDSA----ETAR--------RLTDM-V-E-QLY--------------------.K-----------IEP-
WHIA_LACAC/19-104----SLDI-TTENP----AIAR--------RIFKL-I-K-VAY--------------------.G-----------IEP-
WHIA_GEOKA/18-103----AIDV-QTENA----AIAR--------RIYTL-L-K-KGY--------------------.D-----------VAV-
WHIA_BACSK/18-104----GLDV-TTENA----AIAR--------RIYTL-I-K-HLY--------------------PN-----------IHI-
WHIA_SYMTH/23-111----ALTL-STDSA----PVSR--------KVIRL-L-K-SVS--------------------.P-----------VRY-
WHIA_PROAC/19-105----TIEA-EVDTG----GAAR--------RLRQS-I-Q-EVF--------------------.G-----------FDT-
WHIA_LEIXX/19-104----AVES-ELDTP----ELAR--------RVRKD-L-A-ELY--------------------.G-----------VRG-
Q6F251_MESFL/18-103----KLKL-TSISN----KIAR--------SIFGL-C-K-KMF--------------------.D-----------GHI-
WHIA_CORDI/20-105----VIEI-ELDNE----AVAI--------RVAKE-I-E-ELF--------------------.A-----------ISA-
Q6YQD5_ONYPE/20-106----LLWF-QTKSI----KIAR--------RFLIL-I-K-TFY--------------------PN-----------TNS-
WHIA_ENTFA/18-103----VLNV-QTENA----AIAR--------RMYSL-L-K-DHY--------------------.H-----------AQA-
WHIA_LACPL/18-103----ILNI-QTENP----AIAR--------RIYRL-L-K-QFY--------------------.D-----------VDS-
WHIA_CLOTE/19-107----GFKI-ATENA----AITR--------LVFKI-L-K-NIL--------------------.D-----------IHT-
WHIA_STRMU/15-100----SLSI-ITENA----KIAR--------HIYAL-L-E-RLY--------------------.R-----------INP-
WHIA_OCEIH/18-103----SLDV-QTENA----AIAR--------RIYTL-I-K-DNY--------------------.S-----------IAV-
WHIA_BIFLO/19-105----VIQA-VFTSL----DVAE--------WLKNT-L-R-NTF--------------------.G-----------HEA-
WHIA_CORGL/19-104----VIEA-NLDSM----QVGM--------RLQEF-I-Q-GLY--------------------.N-----------SRV-
WHIA_THETN/19-107----SLTL-STENA----SVAR--------LTFKL-L-K-DLF--------------------.K-----------VAP-
WHIA_CLOAB/19-107----SFKI-ITENP----AIAR--------LIFKL-L-K-KYF--------------------.D-----------IHT-
WHIA_LACLA/11-98----TLSI-TTENA----GTAK--------YIYQM-L-R-ELY--------------------.D-----------VHA-
WHIA_BACHD/18-104----GLDV-TTENA----AIAR--------RIYTL-I-K-KVF--------------------PM-----------MFV-
WHIA_STRCO/17-102----VIEA-ELDTG----NAAR--------RLKRD-I-L-EIF--------------------.G-----------HSS-
WHIA_STRSY/16-99----TLSI-STENA----KIAR--------HIYEL-L-L-HFY--------------------.Q-----------IKA-
WHIA_LACRD/19-103----VLNV-QTENP----AIAR--------RIYSL-L-K-QFY--------------------.G-----------VES-
C3ASX9_BACMY/18-103----SIDI-QTENA----AIAR--------RIYTL-L-K-KGY--------------------.D-----------VTV-
WHIA_DESHY/19-104----ALNV-ITESA----PVAR--------KVYRL-A-K-NLL--------------------.G-----------LPV-
WHIA_STAA8/19-103----VINV-QTENA----TTAR--------RIYSL-I-K-RVF--------------------.N-----------VEV-
WHIA_STRT2/17-99----TLSI-STENA----KIAR--------HIYQL-I-E-NRY--------------------.R-----------CNP-
Q6MS46_MYCMS/19-102----KIRF-STISN----KIAR--------TLLSF-C-R-QLF--------------------.D-----------GQV-
WHIA_TROWT/25-105----VIEV-KLCGS----LLLN--------RVESV-L-R-NIY--------------------.G-----------ITP-
WHIA_STRR6/19-99----TLSV-VTENA----KLAR--------HLYES-F-L-HFY--------------------.E-----------IKS-
WHIA_STRA5/16-99----NLSI-TTENA----KIAR--------HIYSM-L-E-EHY--------------------.H-----------LQP-
WHIA_LISMO/20-103----IMDV-QTENA----AIAR--------RMYQL-L-K-DLY--------------------.E-----------VPI-
WHIA_STRP1/19-99----HLSI-TTENA----KIAR--------YIYSL-I-E-DAY--------------------.V-----------IVP-
U5LEB5_9BACI/18-103----IVDI-QTENA----AIAR--------RIYTL-T-K-KNY--------------------.T-----------VQV-

PF14528

A0R7F4_MYCS2/756-836----RVYY-ATTSR....QLAD........DVVQL.L.L.R.V---------------------G-----------VYA.
A1T108_MYCVP/351-426----QVSY-STRSG....QLAK........DVQQM.L.L.E.F---------------------G-----------VIS.
A1TJY2_ACIAC/534-628----SVRL-AQSNP....ALLQ........TVQRM.L.L.R.L---------------------G-----------IAS.
A1VTS3_POLNA/517-611----SVRL-SSSHR....PLLQ........DVQVL.L.A.N.F---------------------G-----------VFS.
A1WUS3_HALHL/509-591----QIGY-TTVSE....ALAR........QIQHL.L.L.R.F---------------------G-----------VLA.
A6UT61_META3/576-653----KIGF-SSISE....NLIK........KLQLA.L.L.R.F---------------------G-----------IHS.
A6UTA4_META3/359-447----PISF-TQSKS....DVLKDSLLNYLADIKKM.L.S.E.F---------------------G-----------ICS.
A6UW46_META3/1255-1348----IVVI-YSANK....KLLE........DIDTLMI.S.K.F---------------------G-----------LYG.
A6WG57_KINRD/634-715----RIYY-ASTSL....QLIQ........DVSRL.L.L.R.F---------------------G-----------IST.
A9AYW4_HERA2/898-979----.ISM-TTNST....ELKD........GLLYL.L.G.Q.L---------------------G-----------VFA.
B1I483_DESAP/488-582----SIRL-TQSNR....DLLG........IVQRM.L.A.R.L---------------------G-----------IIS.
B2TL46_CLOBB/6-88----CISI-ASTTL....ELLT........WIKIV.V.G.N..---------------------G-----------IIKK
B3QY00_CHLT3/668-763----YVAL-DSVSL....PLLG........QVQLL.L.L.N.F---------------------G-----------IKA.
B3QY00_CHLT3/1267-1342----.PCW-TSSQK....EFAL........QVKSL.M.L.A.L---------------------G-----------FPT.
B6IYQ9_RHOCS/502-596----SIWL-AQSDL....ERLR........AVQRM.L.L.R.L---------------------G-----------IVS.
B7KBB5_CYAP7/899-980----.LSL-TTNSK....QLKD........GLLYL.L.G.Q.L---------------------G-----------LIA.
B8GMT3_THISH/545-639----SVRL-AQSDI....ARLE........AVQRM.L.L.R.L---------------------G-----------IAS.
B8HS23_CYAP4/403-485----QLGF-ATVSE....KLAR........QVQHL.L.L.R.F---------------------G-----------IIA.
B8HS23_CYAP4/996-1078----AIYY-ATSSE....RLAR........DVQSL.L.L.R.L---------------------S-----------ING.
C0QPU4_PERMH/910-980----.AHI-KTISK....DLAY........GLYYL.L.L.R.L---------------------G-----------IKA.
C4XRN9_DESMR/481-575----SIRL-SQSDL....ATLE........AVQRM.L.L.R.H---------------------G-----------IAS.
C7LZ05_ACIFD/594-691----YVSL-GSIST....GLLR........SVQRL.L.T.T.F---------------------G-----------ITS.
C9RBG7_AMMDK/493-587----AVVL-TSVDR....DFLR........DVQRL.L.L.N.F---------------------G-----------IYS.
D0MFS7_RHOM4/597-691----YISL-ESTSR....ELLK........QVQLL.L.L.G.F---------------------G-----------IKS.
D0MJZ2_RHOM4/916-989----.LSY-CSTSM....ELIE........DIAHL.L.L.R.L---------------------G-----------INT.
D0MK11_RHOM4/641-722----AVYY-ATSSY....QLAR........DVQSL.L.L.R.L---------------------G-----------INA.
D1ABC6_THECD/789-863----.PSL-STSSE....SFAG........EIRTL.L.L.A.L---------------------G-----------MVT.
D2Q3V0_KRIFD/773-854----RIHY-ASTSR....RLVD........DLARL.L.L.R.F---------------------N-----------IFS.
D2RDQ6_ARCPA/351-432----KVVI-TTKDL....KALQ........KAKEI.L.E.RYF---------------------R-----------YRK.
D2RF09_ARCPA/632-722----SASF-TTFSK....NFAE........GLRNL.L.L.H.F---------------------G-----------IVS.
D2RGZ0_ARCPA/317-397----RIEV-SSASH....EFIL........KLSLV.L.L.R.F---------------------G-----------ILS.
D2RHT0_ARCPA/583-657----VIRF-TNSCD....ELRR........RFKEL.L.RDI.F---------------------G-----------IEA.
D2RHT0_ARCPA/681-772----IVEL-DTTSK....NLAK........KLQLA.L.L.R.F---------------------G-----------IVA.
D2RHU0_ARCPA/357-445----SKEL-ESNLR....EFME........DIKGL.L.K.E.F---------------------E-----------IES.
D2RHU9_ARCPA/799-879----FIEA-VTTSR....QLAN........ELLVA.L.Q.R.F---------------------G-----------IVA.
D2RI62_ARCPA/1107-1187----RIAI-SSKDR....EKLE........KVGYY.L.H.S.I---------------------G-----------ILN.
D3PLE6_MEIRD/901-979----YIRF-ATASL....QLAK........DVQRM.L.L.N.F---------------------G-----------IAS.
D3RNR6_ALLVD/922-1001----HADY-TSTSR....RMIE........QLQHL.L.L.R.L---------------------G-----------IVAL
D3RUR0_ALLVD/939-1021----GVHL-STNSR....GLAE........DVAAV.L.M.R.L---------------------G-----------IVG.
D3SD26_THISK/547-641----SVRL-SQSDM....SRLE........AVQRM.L.L.R.L---------------------G-----------IAS.
D3SVT9_NATMM/650-744----SVRL-WSSDA....DLLS........EVQQL.L.L.N.F---------------------G-----------IAS.
D3SWA2_NATMM/649-723----.VKL-FSSSY....ELLL........GTKML.L.L.E.F---------------------G-----------ISS.
D5BWU6_NITHN/1168-1260----SMVF-ASHNK....EFIR........ELQIL.W.A.N.F---------------------G-----------VKT.
D5C1W3_NITHN/655-749----SIRL-ASSIY....QNLQ........AAQRM.L.A.R.L---------------------G-----------IIS.
D5MER0_9BACT/526-620----SIRL-SQSDR....ERLL........ATQRM.L.L.R.L---------------------G-----------IVS.
D5UE80_CELFN/877-950----RVSL-HADDR....RVLE........GVSRL.L.L.R.F---------------------G-----------IST.
D5WTP6_KYRT2/749-844----TVRM-TSASK....SLLQ........DVQLL.L.L.N.F---------------------G-----------IHG.
D7B342_NOCDD/1193-1267----.PSI-STAHA....SFAG........EVRTL.L.L.T.L---------------------G-----------MAS.
D7CX96_TRURR/597-691----SVRL-AQSDA....ELLV........RAQRM.L.A.R.L---------------------G-----------IVS.
D9T2Z6_MICAI/361-436----QVSY-STRSE....RLAR........EVQQL.L.L.E.F---------------------G-----------VVS.
E4NRK9_HALBP/486-562----FVSI-TNSDR....EILD........DVADA.L.D.E.L---------------------G-----------LRA.
E4NRK9_HALBP/587-658----EVTV-SSTSR....DVLE........GVRSL.L.L.A.F---------------------G-----------ISS.
E4NRK9_HALBP/1125-1201----NVKI-SSSSY....ELVL........GIKSL.L.L.E.F---------------------D-----------ITT.
E6N2P5_9ARCH/184-275----TITV-YNTDY....QLLV........YVIYL.L.K.K.L---------------------G-----------IET.
E6N3C0_9ARCH/300-389----IVFA-GGTNY....KIVN........YVSGI.L.D.N.L---------------------K-----------IHH.
E6N4J4_9ARCH/190-281----AMTV-YNTDY....QLLL........YVMYL.L.K.K.L---------------------G-----------IET.
F0S203_DESTD/591-669----SIYY-SSTSK....ILIH........QLQHL.L.L.R.L---------------------G-----------ILS.
F2KME6_ARCVS/484-560----TVFF-TNNDE....KLLS........EFLMY.A.K.K.L---------------------G-----------LNP.
F2KME6_ARCVS/583-665----KITV-TSASQ....ELLR........QIQHL.L.L.R.F---------------------G-----------IIS.
F2KME6_ARCVS/1131-1201----.LCY-RTSSR....GLAE........DYQDL.L.L.T.L---------------------G-----------IHS.
H3ZK26_THELN/701-790----AIRL-TSRDR....ELLR........DVQDL.L.L.L.F---------------------G-----------ILS.
H3ZL75_THELN/1325-1406----EIRL-TNIDA....DFLR........EVRKL.L.W.I.V---------------------G-----------ISN.
APE1_AERPE/108-183----QVDV-SQQIM....EPLK........FLAQV.L.E.K.V---------------------G-----------VKV.
DNAB_MYCTU/615-694----RVYY-GSTSR....RLID........DVAQL.L.L.R.V---------------------G-----------IFS.
Q0A8L7_ALKEH/547-641----SVRL-AQSDS....DNLE........AAQRM.L.L.R.L---------------------G-----------IAS.
Q0AB46_ALKEH/513-595----RISY-ATSSR....ALAR........DVQHL.L.L.R.F---------------------G-----------ILS.
Q0AB46_ALKEH/1102-1181----RIYF-STASR....HLIQ........DVAAL.L.L.R.F---------------------G-----------IVG.
Q122S1_POLSJ/523-616----SLRL-SQSDL....SLLQ........TAQRM.L.L.R.L---------------------G-----------IAS.
Q18E84_HALWD/891-971----QIAI-GTASE....PLAE........QIQLL.L.E.T.Y---------------------G-----------IGS.
Q251D1_DESHY/495-588----SVRL-WQTDL....AGLK........VVQRM.L.Q.R.L---------------------G-----------IIS.
Q2J782_FRASC/310-390----LIGL-DMISE....GLIR........GVQGL.L.A.R.F---------------------G-----------IFA.
Q31MT0_SYNE7/625-718----SVRL-AQSDL....GLLE........AVQRM.L.L.R.L---------------------G-----------IAS.
Q3AEA3_CARHZ/467-554----TVAL-SSTSY....PLLR........KVQIL.L.L.S.L---------------------G-----------IPS.
Q3ASQ1_CHLCH/668-763----YIAL-DATSL....ELLQ........QVQLL.L.F.N.F---------------------G-----------IKS.
Q4Z9C2_BPTWO/367-442----.LEV-TSASK....DLLK........DLQLI.L.S.N.I---------------------G-----------IVS.
DNAB_SYNY3/596-678----VAYY-ATSSE....KLAK........DVQSL.L.L.K.L---------------------G-----------INA.
IF2P_METJA/324-403----RIEV-ISASK....EFIE........GLSIL.L.L.R.F---------------------E-----------ITS.
RTCB_METJA/360-448----SEEL-KENIL....EFLN........EIKLL.L.A.E.F---------------------D-----------IES.
RPOA2_METJA/245-317----.VSI-SNVDE....LILN........KIRAF.A.D.K.L---------------------G-----------LNY.
RPOA2_METJA/338-408----VIRV-TSNSK....ELID........GIAIL.L.A.R.F---------------------N-----------IFS.
Y1054_METJA/466-543----GLCF-GIHEE....EYIN........DVKNI.L.N.K.L---------------------G-----------IKY.
HELS_METJA/542-629----NIEF-YSISE....KLVE........QLQFV.L.L.R.F---------------------G-----------IHS.
GLMS_METJA/275-347----MLRL-KDERK....EVLE........EYNQL.F.KTV.F---------------------N-----------LEG.
GLMS_METJA/371-449----QIGI-GMTSK....CFIK........EIQFL.L.L.R.F---------------------G-----------ILA.
RFCS_METJA/176-249----KITF-TNGDE....KLRK........RFAEL.T.E.K.L---------------------F-----------KDA.
RFCS_METJA/271-346----.IVL-STASK....EMAE........DLVYA.L.L.R.F---------------------G-----------IIA.
RFCS_METJA/1454-1542----GIRV-ENISKDKTLEFFE........EVKKM.L.E.E.F---------------------E-----------VES.
Q5JE24_THEKO/618-702----QIVL-TSKNR....MAIY........TVKQM.W.Q.L.L---------------------G-----------VGT.
Q5JEN0_THEKO/799-877----AVIL-TTKSE....SAAR........KIWYA.L.Q.R.L---------------------G-----------IIS.
RADA_THEKO/370-442----.VEL-VTKSR....ELAD........GLVFL.L.K.R.L---------------------G-----------ITP.
Q5JGJ5_THEKO/164-258----YVEA-VNSNL....KLLE........FSRKL.L.ETK.F---------------------K-----------ITS.
IF2P_THEKO/319-390----RIEV-TSASQ....EFLE........DLSLL.L.L.R.F---------------------G-----------IVS.
HELS_THEKO/594-678----YISY-STVSP....SLAY........QLQLL.V.A.S.L---------------------G-----------YTS.
RFCS_THEKO/180-253----VITF-TNTDP....SLRQ........RFMEL.T.E.R.L---------------------F-----------PDA.
RFCS_THEKO/273-346----.VVL-ATASR....EMAE........QVTYA.L.A.G.F---------------------G-----------ITS.
Q5SLW3_THET8/981-1051----.ISY-SSASL....GLAQ........DVAHL.L.L.R.L---------------------G-----------ITS.
Q5SLW3_THET8/1451-1528----LIHY-ATASK....ELAW........GVQHL.L.L.R.L---------------------G-----------LQS.
Q5SM68_THET8/531-609----.PML-TTASK....RLAQ........DVMVL.L.G.G.L---------------------G-----------IPS.
Q5SM68_THET8/1139-1233----TIRL-ASSSL....ALLQ........DVQLL.L.L.N.L---------------------G-----------ILG.
Q5SM68_THET8/1696-1769----FVGI-ATKDP....DVER........VFQEV.AGR.L.F---------------------G-----------VEP.
Q5UYX8_HALMA/481-557----YVSI-TNNDR....EVLD........DAKSV.L.E.T.L---------------------N-----------LNV.
Q5UYX8_HALMA/582-653----EITV-ASMSK....PLLE........DVRTL.L.V.T.Q---------------------G-----------ITA.
Q604J6_METCA/507-601----SIRL-PQTDL....GNLQ........TVQRM.L.L.R.L---------------------G-----------VAS.
RGYR_THEKO/1239-1317----RGIL-TSKRG....DVLR........MLSVY.L.Y.Q.I---------------------G-----------IMN.
Q7NEB4_GLOVI/421-498----GYGF-DCTSK....AFVG........AVQLL.L.L.A.E---------------------G-----------IVS.
Q7NEB4_GLOVI/968-1061----SVRL-SQSDL....PTLE........AVQRM.L.L.R.L---------------------G-----------IAS.
Q8EQH2_OCEIH/74-143----FVSL-AQKEK....YILE........QIRDE.L.A.S..---------------------.-----------.NQ.
RTCB_METKA/361-448----VEEL-EENLR....EFMN........DVAKL.L.R.E.F---------------------G-----------IET.
VATB_METKA/488-560----FVMF-SNTER....ELLS........AFEEI.VTE.E.F---------------------G-----------VDA.
Q8TY20_METKA/847-927----IIEA-TTVSK....RLAD........ELLVA.L.Q.I.L---------------------D-----------IVA.
RTCB_PYRFU/366-453----DVAL-EENLK....EFLY........DISRI.L.E.E.F---------------------G-----------VKT.
Q8U412_PYRFU/161-255----YISV-WNYDR....ELLE........ICRRLLL.N.N.F---------------------N-----------IHS.
Q8ZWC8_PYRAE/132-209----GIVV-KQRNK....DIAM........FYAQC.I.S.L.L---------------------G-----------FTP.
Q9RRW1_DEIRA/735-829----SVRL-AQSDL....SLLK........RAQRM.L.S.R.L---------------------G-----------IMS.
W6G9Y3_NODSP/613-705----NIEL-RNRSR....QLLS........QIQII.L.L.N.L---------------------G-----------IKS.

PF09062

Q5JJ43_THEKO/430-527----RLRI-YDYTT----ETLG--------IINDH-L-E-KTF---------------------G-----------KRY-
NDRZ_PYRFU/430-527----RLRI-YDYRI----ETFE--------IINDY-L-E-KTF---------------------G-----------RKY-

PF14527

WHIA_MYCS2/124-216--S-ALEVSCPGP-----EAAL--------ALVGA-AR..RL.---------------------G-----------VSA-
Q4A5P3_MYCS5/94-186--F-HLEFSSRYY-----EILM--------QIQKK-LN..EY.---------------------D-----------FNF-
WHIA_STRMU/121-214--Y-QLEIFSVYL-----DHAE--------DLAKL-MQ..KF.---------------------M-----------LDT-
WHIA_CALS8/130-222--Y-HLEFDMKTK-----EDAE--------FLQKV-LR..SF.---------------------E-----------FEA-
WHIA_HALOH/128-220--Y-HLEFRCEHE-----SFAE--------DLLML-LK..RF.---------------------G-----------LEG-
Q98QY4_MYCPU/96-191--Y-HLEFSSNYQ-----DYFN--------LIMER-ILKHEY.---------------------D-----------FHF-
WHIA_CLONN/131-223--Y-HLEFVTHHE-----DYAK--------ELSEV-IN..TY.---------------------G-----------LNS-
WHIA_BIFLO/127-219--.-FLEIACPTE-----EAAM--------ALCGV-AR..RL.---------------------G-----------IQA-
WHIA_MOOTA/117-209--H-HLELIFPDA-----AMAG--------QMQGL-MQ..QQ.---------------------E-----------LEP-
WHIA_CARHZ/124-216--Y-HLELNLPDE-----AFAR--------QVSKV-LQ..KY.---------------------H-----------FTF-
WHIA_SYNWW/130-222--Y-HLELVLNDS-----RMAL--------AVQKM-LD..KF.---------------------A-----------LEP-
A6LMS1_THEM4/115-208--Y-HFEIISHNE-----EFLN--------TIKNY-LS..ENL---------------------G-----------ING-
Q9PR72_UREPA/135-227--Y-HLEIRCDSN-----NYIP--------LLTKA-LA..RY.---------------------G-----------LEY-
WHIA_LEUMM/122-215--Y-HLEIYTTHE-----ELAE--------QLMIM-MQ..EF.---------------------D-----------LPS-
WHIA_TROWT/128-220--F-AMEVYAPSN-----ETAL--------CLQGS-IN..KL.---------------------N-----------VIA-
WHIA_CLOPH/130-222--Y-HYEIVFPDL-----ERAS--------QLQEI-IN..SF.---------------------L-----------IDA-
Q1AUH5_RUBXD/45-136--H-HLEFVHPDE-----EFVR--------RVA..-....RFS---------------------R-----------APL-
A7HM71_FERNB/116-209--Y-HLEFVSYNE-----SLLR--------YVDEL-LD..EML---------------------G-----------VSG-
WHIA_OENOB/125-220--Y-HLEISAADE-----DLIE--------QIFSI-MNNRNF.---------------------N-----------LGA-
Q4A984_MYCHJ/93-186--Y-HLEISFLDK-----EKCE--------KVSEI-LQKNEL.---------------------E-----------FTF-
WHIA_LACJO/126-219--Y-HLEIYSLYE-----DHNQ--------DLLKL-MN..NFF---------------------Y-----------LNA-
WHIA_BACCR/125-217--Y-HLEIFSLYK-----EHND--------AICEL-MN..GF.---------------------D-----------LNS-

PF05204

Q874G4_9SACH/619-731--E.CAAISTAYK-----SVSE--------GLIRL-AR--SL----------------------G-----------IKV-
Q8J0H1_9SACH/320-431--..TATVKTIHT-----SVRD--------GLVSV-AR--SL----------------------G-----------LVI-
F2Z6H8_CANGA/308-425--VYKVSIQTIYP-----SVMN--------AIVHI-AR--SL----------------------G-----------ISA-
Q874F9_SACPS/464-565--..TFSVDSRDT-----SLME--------RVTEY-AE--KL----------------------N-----------LCA-
Q8J2S8_SACPA/309-426--SYKIAIQTVYS-----SIMD--------GIVHI-SR--SL----------------------G-----------MSA-
Q8J0H3_KLULC/295-382--..TVALKTLSV-----KTHD--------GIARL-AR--SL----------------------G-----------IRV-
Q874G2_SACEX/606-728--S.EATVSIESK-----STVL--------GLVKI-AR--SL----------------------G-----------IKI-
A7TLB5_VANPO/570-682--..SCTIELEDN-----KVMS--------GIVSL-IR--SL----------------------G-----------LKA-
Q8J0H0_NAUCA/385-494--..SATVTTIYK-----GVSE--------GLIRL-AR--SL----------------------G-----------IRV-
A5DXZ0_LODEL/565-659--..IINIGASNK-----SIIA--------NIVKL-AR--SL----------------------G-----------IKA-
Q8J0G4_ZYGBA/322-433--..SVTIKTIHK-----TVME--------GTVAV-AR--SL----------------------G-----------LIV-
Q8J0G7_9SACH/280-391--E.TASISTVYE-----RISN--------DLVKL-AR--SL----------------------G-----------IKA-
A3LP04_PICST/578-697--Y.SATVKTIYP-----AVRD--------GLVSV-AR--SL----------------------G-----------IQT-
Q2P9R3_DEBHA/255-353--..SASVRTNSS-----KVGE--------GVIAV-SR--SL----------------------G-----------ICT-
Q8J0G5_9SACH/322-432--..SATIKTTLK-----TVMA--------GTVAV-AR--SL----------------------G-----------LNV-
Q8J0G3_ZYGBI/311-419--..VATINTCHH-----SVMT--------GVVAV-AR--SL----------------------G-----------ITV-
Q8J0G2_ZYGRO/322-427--..TATVKTIDQ-----SVMT--------GTVAV-AR--SL----------------------G-----------INV-
Q8J0G3_ZYGBI/204-305--..TLSVDSEDT-----SLFD--------RINQF-AE--IL----------------------G-----------LSA-
A7TIB9_VANPO/308-425--SFKVAIQTIYP-----SIMN--------GVINI-SR--SL----------------------G-----------INA-
Q707X4_ZYGRO/36-153--SFKVSIQTVYP-----SIMG--------GIVHI-TR--SL----------------------G-----------MPV-
Q8J0G4_ZYGBA/215-316--..VLSVDSEDS-----SLLE--------RITGY-AD--IL----------------------D-----------LSA-
Q8J0G6_9SACH/322-433--..AATIKTIHK-----TVME--------GTVAV-AR--SL----------------------G-----------LTV-
Q8J0G5_9SACH/215-316--..VFSVNSEDG-----SLYE--------RITQF-AD--IL----------------------G-----------LSA-
VATA_CANTR/603-713--..EAVVRTSFR-----HVAR--------GLVKI-AH--SL----------------------G-----------IES-

PF00961

IEND2_NEUCR/150-252..V-QARFQIKLN.....EKDR--------ALLLL-IQ--NYF---------------------D...........NIG-
IEND3_NEUCR/248-349..A-QLKFQLSLH.....TKDL--------NLLYL-LQ--QYL---------------------G...........GIG-
IEND2_NEUCR/320-414..V-WLRFSIAQD.....SRDI--------LLLKS-LV--KFF---------------------N............CG-
IEND3_NEUCR/408-508..V-QLRFRISTL.....RVDI--------RLMEK-IV--EYF---------------------G............SG-
IEND4_NEUCR/418-514..V-RLRYILSQK......GNS--------SCMEY-LA--EIL---------------------G.............G-
SCE3_YEAST/113-209...-.PLIVVVFK.....LEDL--------ELANY-LC--NLT---------------------K............CG-
MBI3_YEAST/268-369..L-LYELGIEMH.....IRDI--------QLLYK-IK--NIL---------------------GIG.......KVTIK-
YMC1_SCHPO/111-209...-.LTFKLTQN.....LYNY--------RILYF-IK--RNL---------------------G............IG-
YMN3_PODAN/147-246..V-VCRFVISLH.....KKDL--------SLLNK-IK--EFF---------------------D............VG-
Q02694_PODAN/137-238..V-VAVFSIAVD.....KKDL--------FLLES-IK--TFF---------------------G...........GLG-
YMN4_PODAN/337-438..V-TAIFKISLRR...TRKDY--------TLLCQ-IR--DYF---------------------G............IG-
Q02690_PODAN/82-182..L-DPFFQIKLN.....ARDL--------DILYR-IK--EYF---------------------G...........GVG-
Q02693_PODAN/59-159..V-QAFFQIALH.....KKDE--------ALLKA-IQ--KYF---------------------G...........GIG-
Q02692_PODAN/142-243..I-EPKFQLGLH.....KKDY--------DVLLQ-LQ--LFL---------------------G...........GAG-
YMN3_PODAN/304-404..V-KLSFILTQS.....NRDE--------YLIKS-LI--EYL---------------------G............CG-
Q02693_PODAN/220-320..I-RLEFEIAQH.....IRDE--------LLMLS-FT--EFF---------------------G............CG-
Q02694_PODAN/296-397..S-ILIFQVTQH.....ARDE--------KLMES-LI--SYF---------------------K............CG-
Q02692_PODAN/304-403..V-QLRFRITQH.....VRDI--------ILMEK-LV--QYL---------------------G............GG-
Q02690_PODAN/239-345..V-WLHFQITQH.....SRDT--------TLMER-IV--TFF---------------------D............CG-
Q02695_PODAN/90-183..V-KLRFKISLH.....IDDL--------KVLQV-IQ--SNL---------------------N............IG-
Q02704_PODAN/111-209.KV-GFMFKIALH.....IDDE--------KVLRY-IS--AKL---------------------G............VG-
Q02696_PODAN/261-370.QA-YSNLELMKKI...KSYLE--------NLPNA-GG--NYA---------------------NA.........LGIS-
Q02704_PODAN/265-379.PV-LLKIKEFLEN..SLGFDK--------YSLYK-IK--NSS---------------------II..........LLT-
YMC2_SCHPO/201-295.KI-EVRLNYQID.....QKKE--------YLLSL-IK--DNL---------------------G.............G-
Q02684_PODAN/188-285..V-RLEFSLKQN.......DE--------LPLRL-LY--NSL---------------------D............MG-
Q02673_PODAN/152-245.SI-SLRFIVDQQ......YGL--------SLFND-LR--DLL---------------------D............SG-
Q02683_PODAN/191-286..F-SFNFNISQK....WEKNI--------VILEH-LC--VLF---------------------K............GG-
Q02678_PODAN/149-269.RV-QAFFRIELRQ..NYHREV--------SINQG-GI--SYF---------------------EILDKIARYLKVNLY-
Q02686_PODAN/199-321QNY-SREVTLEQDG..RSTSFF--------FIMSE-IA--AFF---------------------TV..........NLY-
Q02679_PODAN/177-282QLY-LAQRSIYLN....GQSLE--------GLMQI-IS--NFF---------------------K.............S-
Q02680_PODAN/145-255.RL-RIEQRILDPI..SNESYE--------PVLTS-IA--NFL---------------------N...........CSL-
Q02687_PODAN/214-318.KI-ECKFELSQKQKNGNKDNL--------FFLEE-IA--ISL---------------------YS..........VVK-
Q02687_PODAN/93-190...-YPSIQIVFH.....LKDL--------PLALL-IQ--KEL---------------------G............HG-
AI2B_DICDI/119-215..N-KKQLVLTFN.....QKNN--------QILIK-IQ--RIV---------------------G.............G-
Q02676_PODAN/69-164..L-QYRLVIKLSN...IQSNY--------NMLVQ-IA--KII---------------------G.............G-
AI3_DICDI/13-108..L-QYRLVLNVND...SSENM--------AMLLK-IQ--QVI---------------------G.............G-
RGYR_METJA/1152-1248..K-KHNLRMVLT.....SKRR--------DVLEK-IG--IYL---------------------N...........SIG-
H9D0N7_EMENI/31-126..L-TYELGIELS.....IKDV--------QLIYK-IK--KIL---------------------G............IG-
H9D0P6_EMENI/44-138...-YPSIQIVFH.....LKDL--------PLALM-IQ--KEL---------------------G............FG-
H9D0P7_EMENI/159-267IEV-RLNFQIDQK.......KE--------YILLL-IK--EFL---------------------G.............G-
AI3_KLULA/142-233..F-RLIIKLNNN.....KENI--------NILNN-IK--HYL---------------------K.............G-

PF03161

E2JE69_RHIID/38-210-RFRTYTYSSFN------------W------------------------------------------I------------
D1AAC0_THECD/316-492-FADFTPLPELD------------E------------------------------------------L------------
F2WVM1_MONRO/53-226-RFSTWTYTSFN------------W------------------------------------------I------------
E6ZZ92_SPORE/48-221-RFHTFTYSSLN------------W------------------------------------------I------------
M0UAK9_MUSAM/455-621-RFSTIAHSYFG------------F------------------------------------------F------------
A9TWX7_PHYPA/130-304-LFQSRAVDSLT------------K------------------------------------------I------------
Q6U7Y1_MONPE/84-248-HLHTRALSCLI------------P------------------------------------------L------------
RECA_MYCLE/317-494-FIDFTPLPELV------------E------------------------------------------L------------
K5WT44_AGABU/33-209-GFQTISHEAFN------------I------------------------------------------L------------
D3DFV7_HYDTT/7-179-RCQSHSMPFLG------------K------------------------------------------L------------
M5BUR5_THACB/35-205-YFNTYSLPCFN------------E------------------------------------------F------------
SCE4_YEAST/424-601-EFYTRSLPCFT------------I------------------------------------------L------------
K9TPD0_9CYAN/12-180-CLEPKLIPLTR------------V------------------------------------------L------------
Q02672_PODAN/51-225-SFTTMQLPCFN------------V------------------------------------------Y------------
SCE1_YEAST/34-208-GAQTFKHQAFN------------K------------------------------------------L------------
Q85QA0_CANGA/78-255-EFYTRSLPCFT------------L------------------------------------------L------------
Q6ZEW6_SYNY3/132-296-WIRTGVHPILT------------D------------------------------------------L------------
K7N0N6_SOYBN/532-697-KFCTIASSHFG------------F------------------------------------------Y------------
AI7_USTMA/402-564-AFVTRTLTCFT------------E------------------------------------------L------------
G4U3E9_PIRID/59-232-RFHTWTYSSFN------------W------------------------------------------I------------
M1CIN2_SOLTU/404-569-SFTTISHSYFT------------F------------------------------------------Y------------
Q9B6C9_YARLI/213-390-RFSTWSYHSFN------------F------------------------------------------I------------
PP154_ARATH/632-795-EFYSVPHSYFG------------F------------------------------------------Y------------
G4U3G4_PIRID/70-243-ALATRFLPCFI------------E------------------------------------------L------------
M5BJL1_THACB/29-201-TFRTIALPCFN------------E------------------------------------------L------------
MBI2_DEBHA/69-242-KFSTWTYDQFN------------E------------------------------------------M------------
K5XIF0_AGABU/77-253-EIITRSLPCFL------------V------------------------------------------L------------
D8RW96_SELML/689-854-HFQTTPNVKFY------------F------------------------------------------Y------------
C7U019_PICSO/188-361-RFSTWTYTQFN------------Y------------------------------------------M------------
M5BJK2_THACB/16-192-RLKTATLSLFN------------Q------------------------------------------Y------------
F6FSE8_ISOV2/317-493-HLDLTPLPELA------------E------------------------------------------L------------
C5Y0D4_SORBI/581-747-RFSTIPHAHFG------------F------------------------------------------F------------
K9PLK5_9CYAN/22-190-RIDPKLIPLTR------------I------------------------------------------L------------
B9S769_RICCO/624-785-RFSTISHSYFS------------F------------------------------------------Y------------
C5GYP6_AJEDR/59-232-EFNTFTFRSFN------------W------------------------------------------I------------
W1NZZ2_AMBTC/553-719-HFSSKAHPHFG------------F------------------------------------------F------------
MBI2_YEAST/223-403-KFNTWTYDSFN------------M------------------------------------------I------------
D7TPM6_VITVI/580-745-KFSTISHSYFG------------F------------------------------------------Y------------
A9T5I5_PHYPA/473-637-RFSTVSHGSLR------------F------------------------------------------Y------------
A5J053_GIBZE/61-229-YFRTRGLPCFN------------E------------------------------------------L------------
G4U3F9_PIRID/38-207-TFQTLTLPFFT------------E------------------------------------------L------------
F7WD24_SORMK/296-466-ELYTRVMPCLT------------E------------------------------------------L------------
F4FCR9_VERMA/317-493-FVDFTPLSELG------------E------------------------------------------L------------
M5BL22_THACB/82-251-RFSTLALPCFA------------E------------------------------------------L------------
M4DFG8_BRARP/597-757-EFSSISHSCFG------------F------------------------------------------Y------------
G4U3E2_PIRID/85-256-TVQTRTYPFFN------------F------------------------------------------A------------
A9REG1_PHYPA/473-637-HFSTVSHVSLQ------------F------------------------------------------Y------------
Y1098_METJA/58-223-VLSTSRYELFR------------Q------------------------------------------L------------
E2JE43_RHIID/15-185-RFNSRSLPCFN------------Y------------------------------------------Y------------

PF10298

WHIA_MYCS2/17-102-VVHVLSASGIR------------K------------------------------------------.------------
WHIA_PEPD6/19-107-TISVNKNQMLK------------R------------------------------------------.------------
WHIA_FRASC/17-102-TVAVLAAGGLR------------R------------------------------------------.------------
WHIA_COREF/19-104-QVHTVTPGGAR------------K------------------------------------------.------------
A7HM71_FERNB/21-101-KRLTLLKNKLQ------------K------------------------------------------.------------
WHIA_ARTS2/19-104-EIIVVSGGGLR------------R------------------------------------------.------------
WHIA_ACIC1/19-104-ELAVIAPGGLH------------R------------------------------------------.------------
WHIA_CLONN/19-107-KIFVKKSNSLK------------K------------------------------------------.------------
WHIA_CLOCE/19-106-EVSIRRSSKLK------------K------------------------------------------.------------
WHIA_BIFAA/19-105-TLTPVSRQTPT------------G------------------------------------------V------------
A6LMS1_THEM4/20-100-EKLTLIKNKLK------------K------------------------------------------.------------
WHIA_NOCSJ/19-104-DVVMVQGNGIR------------K------------------------------------------.------------
WHIA_BACSU/18-103-ELLVRKKMRLK------------K------------------------------------------.------------
WHIA_LACC3/19-104-NLVVHRKMKLK------------K------------------------------------------.------------
WHIA_PEDPA/18-103-ELSVRRKMKLK------------K------------------------------------------.------------
WHIA_LACBA/18-103-ELLVRRKMKLK------------K------------------------------------------.------------
WHIA_LEUMM/18-103-EVSVTDHNHLS------------Q------------------------------------------.------------
WHIA_OENOB/18-106-QTNIERGGSAK------------I------------------------------------------.------------
WHIA_SYNWW/19-108-TFKALEQKRFK------------R------------------------------------------.------------
WHIA_SALTO/19-104-EIHVLASGGLR------------K------------------------------------------.------------
WHIA_RHOSR/17-102-DVHVLSAGGLR------------K------------------------------------------.------------
WHIA_ALKOO/19-108-EVMIRRNPRLR------------K------------------------------------------.------------
WHIA_CLOPH/19-107-EILIRKNKAGK------------N------------------------------------------.------------
WHIA_LACDA/19-104-QLIVTRKMKLK------------K------------------------------------------.------------
WHIA_LACS1/18-103-ELIVRRKMKLK------------K------------------------------------------.------------
WHIA_HALOH/19-107-EIMVRRRNHFS------------T------------------------------------------Y------------
WHIA_MOOTA/23-103-PVKVRNSRRQG------------K------------------------------------------G------------
WHIA_CLOB8/19-106-KLMVKKSNSLK------------K------------------------------------------.------------
WHIA_CALS8/19-106-EVTIKKNSKLN------------K------------------------------------------.------------
WHIA_LACSS/19-104-ELLVRRKMKLK------------K------------------------------------------.------------
WHIA_CARHZ/19-103-KTLVQDHGRLS------------Q------------------------------------------.------------
WHIA_ALKMQ/19-107-EVMIRRNARLK------------K------------------------------------------.------------
WHIA_KINRD/19-104-DLLVVQAGGLR------------R------------------------------------------.------------
WHIA_EXIS2/18-104-DLLVRKKMRLK------------K------------------------------------------.------------
WHIA_THEFY/19-104-EVLVLSPSGLR------------K------------------------------------------.------------
WHIA_CLOTH/18-106-EISIRRSPKLK------------K------------------------------------------.------------
WHIA_CORJK/19-104-EHQIIGAGNLR------------R------------------------------------------.------------
WHIA_LACAC/19-104-LLIVSRKMKLK------------K------------------------------------------.------------
WHIA_GEOKA/18-103-ELFVRKKMRLK------------K------------------------------------------.------------
WHIA_BACSK/18-104-ELLVQKKMRLK------------K------------------------------------------.------------
WHIA_SYMTH/23-111-EVMVMRRRKLR------------K------------------------------------------.------------
WHIA_PROAC/19-105-DLVVVNGAGLH------------S------------------------------------------.------------
WHIA_LEIXX/19-104-VVSVISTSGVR------------R------------------------------------------.------------
Q6F251_MESFL/18-103-EISVSQTQTLK------------Q------------------------------------------.------------
WHIA_CORDI/20-105-KLVDLGPMATR------------R------------------------------------------.------------
Q6YQD5_ONYPE/20-106-FLMTSKEYNLP------------H------------------------------------------.------------
WHIA_ENTFA/18-103-ELLVRKKMKLK------------K------------------------------------------.------------
WHIA_LACPL/18-103-ELIVRRKMKLN------------K------------------------------------------.------------
WHIA_CLOTE/19-107-NIMIKKSNSFK------------K------------------------------------------.------------
WHIA_STRMU/15-100-EIKYHHKTNLR------------K------------------------------------------.------------
WHIA_OCEIH/18-103-ELLVRKKMKLK------------K------------------------------------------.------------
WHIA_BIFLO/19-105-EVNHLTRQTPN------------G------------------------------------------P------------
WHIA_CORGL/19-104-DVHTVNPTVSR------------K------------------------------------------.------------
WHIA_THETN/19-107-EVMVRRGKYLK------------K------------------------------------------.------------
WHIA_CLOAB/19-107-EIMMKKSNSLK------------K------------------------------------------.------------
WHIA_LACLA/11-98-EIRVHQKTTLS------------K------------------------------------------.------------
WHIA_BACHD/18-104-ELLVRKKMRLK------------K------------------------------------------.------------
WHIA_STRCO/17-102-ELIVMAPGGLR------------R------------------------------------------.------------
WHIA_STRSY/16-99-EIRHHQKPNLK------------K------------------------------------------.------------
WHIA_LACRD/19-103-EIVVRRKMKLK------------K------------------------------------------.------------
C3ASX9_BACMY/18-103-ELLVRKKMRLK------------K------------------------------------------.------------
WHIA_DESHY/19-104-DIMVRRKLRLK------------K------------------------------------------.------------
WHIA_STAA8/19-103-EILVRKKMKLK------------K------------------------------------------.------------
WHIA_STRT2/17-99-ELRHYNKTNLK------------K------------------------------------------.------------
Q6MS46_MYCMS/19-102-EISIIQSQVLK------------K------------------------------------------.------------
WHIA_TROWT/25-105-KLIRSTPRNDI------------G------------------------------------------.------------
WHIA_STRR6/19-99-EIRHHQRSNLR------------K------------------------------------------.------------
WHIA_STRA5/16-99-EIKYHQKTNLR------------K------------------------------------------.------------
WHIA_LISMO/20-103-ELLVRRKMKLK------------K------------------------------------------.------------
WHIA_STRP1/19-99-EIRYHQKTNLR------------K------------------------------------------.------------
U5LEB5_9BACI/18-103-ELLVRKKMRLK------------K------------------------------------------.------------

PF14528

A0R7F4_MYCS2/756-836.RIK.....R.A............K....................K.....................AG...........
A1T108_MYCVP/351-426.RRY....................L....................H.....................A............
A1TJY2_ACIAC/534-628.TLY.....P.D............R....................R.....................TAGLRLLPDG..R
A1VTS3_POLNA/517-611.RIH.....E.R............R..........................................EAGPRSLPDG..Q
A1WUS3_HALHL/509-591.KLRHRSVRY.Q............D....................G.....................R............
A6UT61_META3/576-653.TIR.....K.R............K....................G.....................KVM..........
A6UTA4_META3/359-447.MVY.....E.I............KA..................VE.....................N............
A6UW46_META3/1255-1348.NWG.....A.D............K....................NANGRKGNVVMKYHEKRETEIPK............
A6WG57_KINRD/634-715.RVR.....T.T............TP.................KGD.....................H............
A9AYW4_HERA2/898-979.GVS.....K.I............KPNLPA..........DAPIQT.....................V............
B1I483_DESAP/488-582.TIY.....E.G............R..........................................RPAGLKSLPD.GN
B2TL46_CLOBB/6-88KKNY.....N.I............E....................K.....................H............
B3QY00_CHLT3/668-763.KIY.....E.N............R....................R.....................AGNLTAILPD.GK
B3QY00_CHLT3/1267-1342.TTK.......E............DIS................GWG.....................Q............
B6IYQ9_RHOCS/502-596.TLA.....A.D............R....................R.....................ARSLRLLPEG..R
B7KBB5_CYAP7/899-980.SPT.....E.H............QPSTPP..........DASIQT.....................R............
B8GMT3_THISH/545-639.KLY.....R.N............RRIERECYLP..DGKGGEKAYT.....................T............
B8HS23_CYAP4/403-485.TLKHRQVKY.Q............D....................H.....................R............
B8HS23_CYAP4/996-1078.RLL.....V.S............SQ.................AGK.....................G............
C0QPU4_PERMH/910-980.NIY.......K............S....................Y.....................Y............
C4XRN9_DESMR/481-575.TIY.....R.N............R....................R.....................EAGQSLLPDG..K
C7LZ05_ACIFD/594-691.RIY.....K.T............R....................S.....................GSSNGSFSYTGRD
C9RBG7_AMMDK/493-587.RIF.....R.G............R....................H.....................RSELRALPNG..R
D0MFS7_RHOM4/597-691.KLY.....E.N............R..........................................RLTDRALLPD.GR
D0MJZ2_RHOM4/916-989IRRQ.....R.T............T....................T.....................H............
D0MK11_RHOM4/641-722.RLK.....T.V............AQ.................GEK.....................G............
D1ABC6_THECD/789-863.TTR.....R.T............A....................S.....................GF...........
D2Q3V0_KRIFD/773-854.RIE.....V.A............R....................K.....................TG...........
D2RDQ6_ARCPA/351-432AQIR.......R............K....................D.....................K............
D2RF09_ARCPA/632-722.SIR.....V.R............NYDEIQI.......FRGREIKK.....................R............
D2RGZ0_ARCPA/317-397.KIYRI.SKC.Y............N....................G.....................K............
D2RHT0_ARCPA/583-657.KDV....................A....................R.....................K............
D2RHT0_ARCPA/681-772.HLR.....K.R............DVKGKTNV......INGKDVVS.....................R............
D2RHU0_ARCPA/357-445.TIY.....E.V............K....................S.....................L............
D2RHU9_ARCPA/799-879.NLK.....V.R............R....................N.....................R............
D2RI62_ARCPA/1107-1187.TLH.......E............D....................K.....................R............
D3PLE6_MEIRD/901-979.TRS.....A.E............PR..................GQ.....................H............
D3RNR6_ALLVD/922-1001FNIK.....T.I............QY.................QGQ.....................P............
D3RUR0_ALLVD/939-1021.RIQA...VC.Q............A....................S.....................Y............
D3SD26_THISK/547-641.SIY.....R.N............R....................R.....................SAGMRHLPDG..N
D3SVT9_NATMM/650-744.KVY.....E.N............R....................K.....................EAGTRELSDG..C
D3SWA2_NATMM/649-723.QIQ.....T.R............P....................R.....................DG...........
D5BWU6_NITHN/1168-1260.SIN.....Q.M............R....................G.....................HRQQLLPDG...R
D5C1W3_NITHN/655-749.TIY.....K.N............R....................R.....................SAGKRMLPNG..K
D5MER0_9BACT/526-620.TLY.....E.G............R....................R.....................PSQVRLLPDQ..R
D5UE80_CELFN/877-950.RLR.....I.S.......................................................A............
D5WTP6_KYRT2/749-844.KIY.......D............RPKRNQAKFQYQTISGESRVYE.....................S............
D7B342_NOCDD/1193-1267.TTR.....T.T............R....................S.....................GY...........
D7CX96_TRURR/597-691.TRY.....E.N............R....................R.....................PEGWRTLPDG..N
D9T2Z6_MICAI/361-436.RQC....................R....................Y.....................D............
E4NRK9_HALBP/486-562.TER.....S.T............H....................D.....................D............
E4NRK9_HALBP/587-658.QLR....................T....................K.....................A............
E4NRK9_HALBP/1125-1201.QIQ.....H.R............E....................RS...................GK............
E6N2P5_9ARCH/184-275.TSY.....A.P............K....................T.....................KQLAGGPFRN.PR
E6N3C0_9ARCH/300-389.TVE.....K.E............KLPPMFEAY....GRIYERDTS.....................E............
E6N4J4_9ARCH/190-281.TSD.....T.P............KIKTRGGTSF.KDPKKGKTYHH.....................N............
F0S203_DESTD/591-669.KIA.....I.S............K....................K.....................EN...........
F2KME6_ARCVS/484-560.NVR.....N.P............H....................K.....................G............
F2KME6_ARCVS/583-665.QLH.....E.T............Q....................S.....................RATNS........
F2KME6_ARCVS/1131-1201.RIV.......V............D....................S.....................S............
H3ZK26_THELN/701-790.KIY.....E.R............P....................Y.....................KGTFEYTTK...D
H3ZL75_THELN/1325-1406.SIF.....A.E............T....................TPNR..............YNGVS............
APE1_AERPE/108-183TGIY....................L....................G.....................S............
DNAB_MYCTU/615-694.WIT.....H.A............P....................KL...................GG............
Q0A8L7_ALKEH/547-641.TLY.....R.D............R..........................................RPAGNTVLPD.GN
Q0AB46_ALKEH/513-595.KLR.....E.K............R....................N.....................RYP..........
Q0AB46_ALKEH/1102-1181RTKH.....I.T............H...................GD.....................G............
Q122S1_POLSJ/523-616.TIY.....P.N............RRLAQARPLP..DGRGGLRVYE.....................T............
Q18E84_HALWD/891-971.CRD.....T.G............DQSH.............TGTST.....................T............
Q251D1_DESHY/495-588.TLY.....E.E............R....................K.....................PAGQKLMPDG..Q
Q2J782_FRASC/310-390.RVR.....R.E............ADP................RPD.....................R............
Q31MT0_SYNE7/625-718.TIY.....Q.E............R....................R.....................PAGERLLPDS..Q
Q3AEA3_CARHZ/467-554.TLT.....G.E............KDQDVKI........IKGNEYE.....................T............
Q3ASQ1_CHLCH/668-763.KIY.....E.N............R..........................................RVGELVSLLPDGK
Q4Z9C2_BPTWO/367-442.TNK.....E.K............VVK................KYK.....................H............
DNAB_SYNY3/596-678.RLSK..ISQ.N............G....................K.....................G............
IF2P_METJA/324-403.KIY.....E.I............KKS...............YKET.....................K............
RTCB_METJA/360-448.MIY.....E.I............K....................S.....................L............
RPOA2_METJA/245-317.GEY....................D....................N.....................NN...........
RPOA2_METJA/338-408.........I.K............T....................K.....................T............
Y1054_METJA/466-543..IE....................K....................I.....................K............
HELS_METJA/542-629.SIR.....K.K............K....................T.....................KTMVSPT......
GLMS_METJA/275-347.NIK....................K....................G.....................D............
GLMS_METJA/371-449.SYSKI.KRK.E............E....................N.....................W............
RFCS_METJA/176-249.KIK.....E.R............I....................H.....................K............
RFCS_METJA/271-346.KLR.....E.KV..........NK....................N.....................N............
RFCS_METJA/1454-1542.YIK.....V.S............KI..................DN.....................K............
Q5JE24_THEKO/618-702.YLW.....E.K............K....................D.....................R............
Q5JEN0_THEKO/799-877.TVS.....R.V............RNR................GFK.....................E............
RADA_THEKO/370-442.RIS.....Q.K............T....................I.....................E............
Q5JGJ5_THEKO/164-258.AIF.....K.MYSKGQRVVIRGRE....................Y.....................K............
IF2P_THEKO/319-390.KIY...............................................................R............
HELS_THEKO/594-678.SIH.....R.SIRT.....EGIGK....................T.....................R............
RFCS_THEKO/180-253.KIR.....E.R............I....................H.....................K............
RFCS_THEKO/273-346.KIR.....E.K............K....................V.....................R............
Q5SLW3_THET8/981-1051.QLR....................S....................R.....................G............
Q5SLW3_THET8/1451-1528.RLV.....E.K............R....................F.....................SG...........
Q5SM68_THET8/531-609.KLL.....R.Y............NPLP..............GRFS.....................K............
Q5SM68_THET8/1139-1233.KIH.....K.R............R..........................................EAARKALPDG..K
Q5SM68_THET8/1696-1769.KCT.......V............D....................K.....................R............
Q5UYX8_HALMA/481-557.TER.....S.S............H....................E.....................G............
Q5UYX8_HALMA/582-653.QLQ....................P....................R.....................N............
Q604J6_METCA/507-601.TIH.....Q.N............R..........................................RPGGTKVLPD.GE
RGYR_THEKO/1239-1317.YLR.......R............D....................E.....................R............
Q7NEB4_GLOVI/421-498.NLH.....T.T............D....................R.....................SRQ..........
Q7NEB4_GLOVI/968-1061.DIY.....K.R............R..........................................EAQVRMLPDS..R
Q8EQH2_OCEIH/74-143.PIY.......K............N....................E.....................N............
RTCB_METKA/361-448.TLY.....E.V............K....................S.....................K............
VATB_METKA/488-560.SKT....................E....................N.....................Q............
Q8TY20_METKA/847-927.RRY.....E.C............DD..................TK.....................G............
RTCB_PYRFU/366-453.TIY.....K.V............N....................S.....................K............
Q8U412_PYRFU/161-255.TIF.....L.K............R....................E.....................KNSEVIIR.....
Q8ZWC8_PYRAE/132-209.RIY.....QWN............E....................K.....................N............
Q9RRW1_DEIRA/735-829.SLY.....A.E............R....................RLAGTSTLPD...GKGGSAEYPT............
W6G9Y3_NODSP/613-705.SLL.....I.K............QKPGSIGVPY.TLKDGTKKISQ.....................N............

PF09062

Q5JJ43_THEKO/430-527-SLQ-------R------------D-------------------------------------------------------
NDRZ_PYRFU/430-527-SIQ-------K------------D-------------------------------------------------------

PF14527

WHIA_MYCS2/124-216-KARE---VRGS--------------------------------------------------------------------
Q4A5P3_MYCS5/94-186-KLLK---RNQK--------------------------------------------------------------------
WHIA_STRMU/121-214-KVIE---HKHG--------------------------------------------------------------------
WHIA_CALS8/130-222-KIVE---RKSH--------------------------------------------------------------------
WHIA_HALOH/128-220-HLTE---HRKK--------------------------------------------------------------------
Q98QY4_MYCPU/96-191-NILT---KKNK--------------------------------------------------------------------
WHIA_CLONN/131-223-KVIQ---RKSS--------------------------------------------------------------------
WHIA_BIFLO/127-219-KHRT---LRSS--------------------------------------------------------------------
WHIA_MOOTA/117-209-RLSR---RQRG--------------------------------------------------------------------
WHIA_CARHZ/124-216-RLLK---RKTA--------------------------------------------------------------------
WHIA_SYNWW/130-222-GLVE---RKNY--------------------------------------------------------------------
A6LMS1_THEM4/115-208-KVAR---FNNN--------------------------------------------------------------------
Q9PR72_UREPA/135-227-KIIY---RNKK--------------------------------------------------------------------
WHIA_LEUMM/122-215-KISE---RGNG--------------------------------------------------------------------
WHIA_TROWT/128-220-KIKE---VRGS--------------------------------------------------------------------
WHIA_CLOPH/130-222-KIVL---RKKY--------------------------------------------------------------------
Q1AUH5_RUBXD/45-136-SVTR---RRGR--------------------------------------------------------------------
A7HM71_FERNB/116-209-KISK---MNYN--------------------------------------------------------------------
WHIA_OENOB/125-220-KIAD---RRNK--------------------------------------------------------------------
Q4A984_MYCHJ/93-186-RQIF---HQNY--------------------------------------------------------------------
WHIA_LACJO/126-219-KETR---RRSG--------------------------------------------------------------------
WHIA_BACCR/125-217-KTLE---RRKG--------------------------------------------------------------------

PF05204

Q874G4_9SACH/619-731-SVTT...KRECLDKHNVKHQIC..-------------------------------------------------------
Q8J0H1_9SACH/320-431-SVNA...EPAKIDMSGTSHKMC..-------------------------------------------------------
F2Z6H8_CANGA/308-425-TVTTRSARNEVIEGRRVQCRFT..-------------------------------------------------------
Q874F9_SACPS/464-565-EYKD...RKEPQVAKTVNL.....-------------------------------------------------------
Q8J2S8_SACPA/309-426-TVTTRSAREEIIEGRKVQCQFT..-------------------------------------------------------
Q8J0H3_KLULC/295-382-SGKK...QNQE.............-------------------------------------------------------
Q874G2_SACEX/606-728-VVTSNDYQDPEDHDHGHDHGSCGH-------------------------------------------------------
A7TLB5_VANPO/570-682-DVTQ.........SSGKLNDVC..-------------------------------------------------------
Q8J0H0_NAUCA/385-494-SVST...EKEHVDKNNVKHKSC..-------------------------------------------------------
A5DXZ0_LODEL/565-659-ACKDDGL.................-------------------------------------------------------
Q8J0G4_ZYGBA/322-433-SVNT...EEAKIDKNDVNHRFV..-------------------------------------------------------
Q8J0G7_9SACH/280-391-SVSQ...QEEHVDAKGVDQQQT..-------------------------------------------------------
A3LP04_PICST/578-697-SVSV...EEAK.EVNSVKHQES..-------------------------------------------------------
Q2P9R3_DEBHA/255-353-SVKA...ENES.............-------------------------------------------------------
Q8J0G5_9SACH/322-432-SVNT...EEAKVD.NGVDQRLS..-------------------------------------------------------
Q8J0G3_ZYGBI/311-419-TVNT...KGEKFGNIGANQDSG..-------------------------------------------------------
Q8J0G2_ZYGRO/322-427-SVDV...E...VDEDGVDRSFV..-------------------------------------------------------
Q8J0G3_ZYGBI/204-305-EQEA...KEESKRAKKVNL.....-------------------------------------------------------
A7TIB9_VANPO/308-425-TVTTRSAKPSIIAGRKVNCQFT..-------------------------------------------------------
Q707X4_ZYGRO/36-153-TVTTRSAKTATIVGRTVSCHFT..-------------------------------------------------------
Q8J0G4_ZYGBA/215-316-EYKD...REIPKRAKTVCL.....-------------------------------------------------------
Q8J0G6_9SACH/322-433-SVNI...EEAKVDKDGVNHRPA..-------------------------------------------------------
Q8J0G5_9SACH/215-316-EFKD...REAPKQGKTVYL.....-------------------------------------------------------
VATA_CANTR/603-713-SINI...KDTHIDAAGVRQEFA..-------------------------------------------------------

PF00961

IEND2_NEUCR/150-252-YISK---INDRS..TVE--------------------------------------------------------------
IEND3_NEUCR/248-349-SIHL---ARNRD..IVN--------------------------------------------------------------
IEND2_NEUCR/320-414-YIAQ---YKNRK..VCE--------------------------------------------------------------
IEND3_NEUCR/408-508-KIYK---YGGKS..AVS--------------------------------------------------------------
IEND4_NEUCR/418-514-KKHL---LKS....YEG--------------------------------------------------------------
SCE3_YEAST/113-209-KVYK---KINRN..YVL--------------------------------------------------------------
MBI3_YEAST/268-369-KLKM---KDGTIKEMCK--------------------------------------------------------------
YMC1_SCHPO/111-209-SLYK---ESSTN..TVI--------------------------------------------------------------
YMN3_PODAN/147-246-NVFL---MTKD...SAQ--------------------------------------------------------------
Q02694_PODAN/137-238-SIKK---HGKG...TFS--------------------------------------------------------------
YMN4_PODAN/337-438-IITK---HGET...TLQ--------------------------------------------------------------
Q02690_PODAN/82-182-TISF---EKN....TAK--------------------------------------------------------------
Q02693_PODAN/59-159-AVKI---RGD....KCT--------------------------------------------------------------
Q02692_PODAN/142-243-GIYS---ARNGE..FVN--------------------------------------------------------------
YMN3_PODAN/304-404-NTSL---DPRG...TID--------------------------------------------------------------
Q02693_PODAN/220-320-IISR---YSSD...MVK--------------------------------------------------------------
Q02694_PODAN/296-397-YIEK---DPRGP..WLS--------------------------------------------------------------
Q02692_PODAN/304-403-KVYK---YTRS...GVH--------------------------------------------------------------
Q02690_PODAN/239-345-SVKK---RNTD...AVD--------------------------------------------------------------
Q02695_PODAN/90-183-RITV---EEVR...SRC--------------------------------------------------------------
Q02704_PODAN/111-209-GVRL---YKN....ECI--------------------------------------------------------------
Q02696_PODAN/261-370-IIKY---SNINHQSTVR--------------------------------------------------------------
Q02704_PODAN/265-379-TVKA---RCVNGKSSVS--------------------------------------------------------------
YMC2_SCHPO/201-295-NIGY---RKSQ...DTY--------------------------------------------------------------
Q02684_PODAN/188-285-NISQ---YHTG...VWC--------------------------------------------------------------
Q02673_PODAN/152-245-SIYA---RKNE...NYR--------------------------------------------------------------
Q02683_PODAN/191-286-IVSK---HAIDN..VNE--------------------------------------------------------------
Q02678_PODAN/149-269-SRSR---EQKDKIFYSF--------------------------------------------------------------
Q02686_PODAN/199-321-TRTR---KTEDKVFYAF--------------------------------------------------------------
Q02679_PODAN/177-282-KLMN---RDIRG..FKQ--------------------------------------------------------------
Q02680_PODAN/145-255-LIKN---QKSTG..NNY--------------------------------------------------------------
Q02687_PODAN/214-318-SIRM---DSK....NPQ--------------------------------------------------------------
Q02687_PODAN/93-190-SISR---KKGLN..AYI--------------------------------------------------------------
AI2B_DICDI/119-215-NFYI---NTNTQSGKYK--------------------------------------------------------------
Q02676_PODAN/69-164-TVRV---TGKGG..DVI--------------------------------------------------------------
AI3_DICDI/13-108-YLIK---RKEKA..LIA--------------------------------------------------------------
RGYR_METJA/1152-1248-ILNT---LHKSR.EVYS--------------------------------------------------------------
H9D0N7_EMENI/31-126-IVSF---RKRNEIEMVA--------------------------------------------------------------
H9D0P6_EMENI/44-138-SLSR---KKGVN..AYI--------------------------------------------------------------
H9D0P7_EMENI/159-267-NIGY---RKSQ...DTY--------------------------------------------------------------
AI3_KLULA/142-233-NINI---NNN....YVI--------------------------------------------------------------

PF03161

E2JE69_RHIID/38-210--------YEE---F--YPN......KRKVV-PR.I.IDQYL.SPLALAVWIMDDA.....TLHKNK.......GLRFCT
D1AAC0_THECD/316-492--------RRV---V--YFG.....DGKKHL-TW.D.YLKAL.TPLALAIWYMDDGHLAVPSKELQDRTAGGSGRVEICV
F2WVM1_MONRO/53-226--------HDM---W--YEN......NIKRV-PE.S.IGKYL.TPLALAIWIMDDG.....AKVGK........GLKFCT
E6ZZ92_SPORE/48-221--------HDL---W--YVN......GVKCV-PK.N.IGEFI.TPLALAIWIMDDG.....GRVGK........GLKFAT
M0UAK9_MUSAM/455-621--------ADQ---F--WLK......GRLMI-PK.L.VHRWL.SARVLAYWYMYGG.....LRSSSG.......DILLRL
A9TWX7_PHYPA/130-304--------YQV---T--HSR.......EELI-LR.KRWLSHL.TPQSLAVWWCDAG.....SLVAGGR......KGELRT
Q6U7Y1_MONPE/84-248--------YEL---F--IRN......GVKKI-SS.S.IVDWL.TPISLAFWAMDDG.....SSTPE........GFYLNT
RECA_MYCLE/317-494--------QRA---V--YLG.....DGKKFL-SE.E.YLKAL.TPLVLAIWYMDDGSFTVGSKRVQERTAGGSGRIEICV
K5WT44_AGABU/33-209--------SEL---F--LIK......NKKSI-SN.ELIKNHL.TGRGLAFWFCDDGGKLDYNKNSKNL......SVVLNT
D3DFV7_HYDTT/7-179--------KML---F--YDQ.....KGKKRV-PE.K.IEALLKSPLSLAVWYMDDG.....YYYRRDK......VAYIYL
M5BUR5_THACB/35-205--------YNL---F--YKG......GVKIV-PS.N.IFELL.TPLGLAYFICDDG.....LFDKWNK......TVKLCT
SCE4_YEAST/424-601--------RYM---F--YNG......RVKIV-PN.N.LYDLL.NYESLAHMIMCDG.....SFVKGG.......GLYLNL
K9TPD0_9CYAN/12-180--------VKK---L--YCG......GIKTV-TP.K.FLNLL.TPAGIALWFLDRGS....KSLKKRQGKIHALEVYLNT
Q02672_PODAN/51-225--------REL---F--YDL.....NRKKIV-PE.N.IRELL.TPRGLAFWIMDDG.....SKQGS........GLHISV
SCE1_YEAST/34-208--------ANL---F--IVN......NKKTI-PN.NLVENYL.TPMSLAYWFMDDGGKWDYNKNSTNK......SIVLNT
Q85QA0_CANGA/78-255--------RKH---F--YKG......RMKIV-PN.D.LYDLL.NYESLAHMIMCNS.....SFIKNK.......GIYLNM
Q6ZEW6_SYNY3/132-296--------HCI---W--YLE.......KKLL-PR.KFVEKYL.TEFAFCIWFYDDG.....CSSS.........GLSLYP
K7N0N6_SOYBN/532-697--------ADQ---F--WSK......GEPTI-PK.L.VHRWL.SPCVLAYWYMYGG.....HRNSSG.......DILLKI
AI7_USTMA/402-564--------YNN---F--YEN......GKKCV-PS.D.IYNML.TIQGLSHWICGDG.....TFVKGG.......GIYLQA
G4U3E9_PIRID/59-232--------YDL---F--YVN......GIKMV-PS.N.IAEYL.TPLALAVWIMDDG.....TKASA........GLRLCT
M1CIN2_SOLTU/404-569--------ADQ---F--WPN......GRPCI-PK.L.IHRWL.SPRVLAYWYMYGG.....YRTSSG.......DILLRV
Q9B6C9_YARLI/213-390--------YQA---W--YIK..TNKGFIKIL-PK.N.IEYFL.NPLSMAIWIMDDG.....KKVGE........GLKIAT
PP154_ARATH/632-795--------AEH---Y--WPK......GQPEI-PK.L.IHRWL.SPHSLAYWYMYSG.....VKTSSG.......DIILRL
G4U3G4_PIRID/70-243--------YNL---F--VVN......KIKTI-QV.D.LINYF.DAVVFAHWIMGDG.....TAGVSG.......GLILCT
M5BJL1_THACB/29-201--------YDI---F--YLE......GKKII-PK.N.IGELL.TPLGLAYWLCDDG.....TFCKSTH......RVHLCT
MBI2_DEBHA/69-242--------HKN---W--YIN......GKKVL-PN.D.IDQFL.SPLALAIWIMDDG.....GKMGK........GLKLAT
K5XIF0_AGABU/77-253--------FRK---F--YFK......GKKII-PL.D.FYDLI.TYEGLAHWIMGDG.....SFVKGG.......GLYLQT
D8RW96_SELML/689-854--------YHQ---Y--RPN......GEQKI-PR.L.VHRWI.PELTLAYWYMYGG.....HRSLDGR......SMVFNA
C7U019_PICSO/188-361--------HYA---W--YSN......NVKML-PH.N.LSNYL.TPLALSIWMMDDG.....CKMNN........SLKLAT
M5BJK2_THACB/16-192--------HDM---F--YNWNPEKGKYIKIV-PK.N.ISEFM.DPIVLAYLIMSDG.....NFDKNRN......RVRIFT
F6FSE8_ISOV2/317-493--------HQV---V--YFG.....DGKKHI-TE.D.YLKAL.TPLALAVWYMDDFSFQVRSKGLQTRTAGGSGRAEACV
C5Y0D4_SORBI/581-747--------ADQ---F--FQK......GQPVL-PK.L.VHRWL.SPRVLAYWFMFGG.....FRLQSG.......DIVLKV
K9PLK5_9CYAN/22-190--------VKK---L--YKA......GTRTI-TR.K.FLNLL.TPQGIAIWFMDDGS....KSFKKKNGKIHAVEITLNT
B9S769_RICCO/624-785--------AEQ---F--WPK......GQPMI-PK.L.IHRWL.SPQVLAFWYMYAG.....HRTSSG.......DILLKL
C5GYP6_AJEDR/59-232--------YDM---F--YRK......GKKII-RP.E.LEKYL.TPLALTVWIMDDG.....GWANP........GVRIST
W1NZZ2_AMBTC/553-719--------ADQ---F--WPK......RRLVI-PK.L.IHRWL.SSRVLAYWYMYGG.....YTTSSG.......DILLKL
MBI2_YEAST/223-403--------YSE---W--YIKNMSGKGNIKVI-PK.S.LDNYL.TPLALAIWIMDDG.....CKLGK........GLKFTT
D7TPM6_VITVI/580-745--------ADQ---F--WPR......GRPMI-PK.L.IHRWL.SPRVLAYWYMYGG.....HRTSSG.......DILLKL
A9T5I5_PHYPA/473-637--------AHQ---Y--RPE......GLPVI-PR.L.IHRWL.NPLSLAYWYMYGG.....EKCKETG......GIVLNA
A5J053_GIBZE/61-229--------RHL---F--YKD......KVKVV-PE.D.IYNLL.TPVALAHLIMGDG.....SAKEY........GLIICT
G4U3F9_PIRID/38-207--------FKA---W--YIK..VDGRNIKIL-PF.N.IFDLF.TPLAFAFLIMGDG.....SWDKHSS......RIVLHL
F7WD24_SORMK/296-466--------HSL---F--YSK.....EGVKVI-PE.N.IYELL.TPVALAHIIMGDG.....QGSRH........GLLLCT
F4FCR9_VERMA/317-493--------RRA---V--YLG.....DGKKHL-SW.D.YLKAL.TPLALAVWYMDDGCFTLRSKGVQARTAGGSGRIEICV
M5BL22_THACB/82-251--------HNS---F--YPE......DKKIV-PV.N.IADLL.TPRGLGFLICDDG.....SFDKPSG......RISIST
M4DFG8_BRARP/597-757--------ADN---F--WPN......GRPEI-PK.L.IHRWL.SPESLAYWYMYSG.....YRTSSG.......DVILRL
G4U3E2_PIRID/85-256--------LKY---F--YFN......GIKVL-PPIDWLFSYI.NPISLAFLITGDG.....AYSHG........GLILCT
A9REG1_PHYPA/473-637--------AQQ---Y--RPE......GQPVI-PR.L.IHRWL.NPLSLAYWYMYGG.....EKCKETR......GIILNA
Y1098_METJA/58-223--------RER---W--YPD......GIKRI-PN.....DLVINDEGLAQWYLGDG.....SLTKQKNGY....KLELST
E2JE43_RHIID/15-185--------RDV---F--YPE......GVKIV-PA.N.IGELL.TARGLAYWSMDDG.....YKDRG........NFRLAT

PF10298

WHIA_MYCS2/17-102--------NTR---Y--VVRVAND..GEALA-RQ---T.GLL--------------------------------------
WHIA_PEPD6/19-107--------NNS---Y--VLMVTSEMGSEMLL-KK---L.GIL--------------------------------------
WHIA_FRASC/17-102--------SVR---Y--IVRVERD..GEQLA-RS---T.GLL--------------------------------------
WHIA_COREF/19-104--------NPK---Y--LVRIVHN..ADEVA-RR---A.GLV--------------------------------------
A7HM71_FERNB/21-101--------KRV---Q--IFI......PVSIL-DK---L.GIS--------------------------------------
WHIA_ARTS2/19-104--------GNR---Y--VVRVVRD..GEALA-RQ---T.GLL--------------------------------------
WHIA_ACIC1/19-104--------GNR---Y--VVRVSRD..GETLA-KQ---T.GLL--------------------------------------
WHIA_CLONN/19-107--------NNI---Y--LVVIDNNMGVKDLL-KE---V.GVL--------------------------------------
WHIA_CLOCE/19-106--------HVS---Y--SLTLVPNQMINKIL-YD---F.GIS--------------------------------------
WHIA_BIFAA/19-105--------VQR---F--IVRVPKG..SAALV-LQ---T.GLY--------------------------------------
A6LMS1_THEM4/20-100--------KRV---Q--IFI......PFSIL-EK---L.EVS--------------------------------------
WHIA_NOCSJ/19-104--------GSR---Y--IVRVVKD..GEALA-RQ---T.GLL--------------------------------------
WHIA_BACSU/18-103--------NNV---Y--IVRFSEN..AKAIL-ED---L.KIL--------------------------------------
WHIA_LACC3/19-104--------NYQ---Y--IVRLTEG..VNDIL-SD---L.SIL--------------------------------------
WHIA_PEDPA/18-103--------NNL---Y--IVRLRTG..VKELL-ND---L.SIL--------------------------------------
WHIA_LACBA/18-103--------NNL---Y--IVRVKTG..VTEVL-SD---L.GIF--------------------------------------
WHIA_LEUMM/18-103--------HKS---Y--GVLLKTK..IDEVL-DD---L.GID--------------------------------------
WHIA_OENOB/18-106--------FGL---H--RYGVITMKQADQIL-AD---I.QLD--------------------------------------
WHIA_SYNWW/19-108--------KRI---Y--EVNVLLDGEDEALN-KE---LEEIL--------------------------------------
WHIA_SALTO/19-104--------GSH---F--IVRVVKD..GEFLA-RQ---T.GLL--------------------------------------
WHIA_RHOSR/17-102--------SSR---Y--IVRVAKE..GEALA-RQ---T.GLL--------------------------------------
WHIA_ALKOO/19-108--------NNH---Y--LMVVTHGMGSTDIL-EK---V.KIL--------------------------------------
WHIA_CLOPH/19-107--------SLL---F--LLVVKLPKQVSLLY-QA---T.KLS--------------------------------------
WHIA_LACDA/19-104--------NHQ---Y--LVRVAQM..VSEIM-AD---L.EIY--------------------------------------
WHIA_LACS1/18-103--------NNF---Y--IVRLKTG..TNEIL-KD---L.DIL--------------------------------------
WHIA_HALOH/19-107--------QNI---Y--DLFLPPQPGIEVFL-KK---V.GVL--------------------------------------
WHIA_MOOTA/23-103--------RPV---F--RVV......ARARL-KE---I.QDW--------------------------------------
WHIA_CLOB8/19-106--------NNI---Y--MVVISEEMGVRGLL-SD---T.GIL--------------------------------------
WHIA_CALS8/19-106--------NYV---Y--TIILPPSTDNLQIL-KE---L.HFV--------------------------------------
WHIA_LACSS/19-104--------NNQ---Y--IVRLKYD..TNTVL-ND---L.NIV--------------------------------------
WHIA_CARHZ/19-103--------KNF---Y--YIEVEEH..VDELL-KE---Y.GFI--------------------------------------
WHIA_ALKMQ/19-107--------NNY---Y--LLVITHSMGSSEVL-AD---L.GIM--------------------------------------
WHIA_KINRD/19-104--------ATR---Y--VLRVARD..GESLA-RQ---T.GLL--------------------------------------
WHIA_EXIS2/18-104--------NNV---Y--IVRVKQQ..ADKIL-QD---L.GIL--------------------------------------
WHIA_THEFY/19-104--------GNR---Y--VVRVIKE..GESLA-RQ---T.GLI--------------------------------------
WHIA_CLOTH/18-106--------NIV---Y--IIVLTSSKGLMRIL-ED---I.NIK--------------------------------------
WHIA_CORJK/19-104--------RPR---H--VLRWTEG..GMELA-RR---T.ELI--------------------------------------
WHIA_LACAC/19-104--------NNQ---Y--LVRLNQQ..VQEIL-EN---L.QIW--------------------------------------
WHIA_GEOKA/18-103--------NNV---Y--IVRVTDG..AASLL-RE---L.HIV--------------------------------------
WHIA_BACSK/18-104--------NNV---Y--MVRISKE..ARQLL-ED---L.RIL--------------------------------------
WHIA_SYMTH/23-111--------NLV---Y--RVHIPHQPGVAELL-QL---A.GFI--------------------------------------
WHIA_PROAC/19-105--------NTR---Y--LIRMVRG..GADLA-RL---T.GLL--------------------------------------
WHIA_LEIXX/19-104--------ASQ---Y--LVRVLDG..GETLA-RQ---T.GLL--------------------------------------
Q6F251_MESFL/18-103--------NKT---Y--QITLIGK..ISEFL-RE---L.NIW--------------------------------------
WHIA_CORDI/20-105--------TPR---H--VVRIAED..AETLI-RR---V.GLV--------------------------------------
Q6YQD5_ONYPE/20-106--------LKS---I--HVGIEKD..IPLIL-EK---H.HFF--------------------------------------
WHIA_ENTFA/18-103--------NNV---Y--IVRLKQD..TQKIL-AD---L.DIM--------------------------------------
WHIA_LACPL/18-103--------NNL---Y--IVRLKTG..TDMVL-AD---L.GIL--------------------------------------
WHIA_CLOTE/19-107--------NNV---Y--IIVINEEEGVKKLL-EK---T.EVV--------------------------------------
WHIA_STRMU/15-100--------NRV---Y--TVFLDDN..VEQIL-AD---L.QLS--------------------------------------
WHIA_OCEIH/18-103--------NNV---Y--IVRLKEE..VQLLL-EE---L.DLI--------------------------------------
WHIA_BIFLO/19-105--------VET---Y--VVLVTRN..VVALA-LQ---T.GLV--------------------------------------
WHIA_CORGL/19-104--------TPR---Y--LVRIIDN..ADEIA-RR---T.GLV--------------------------------------
WHIA_THETN/19-107--------ALT---Y--ILFVSDTKAVRDIL-EE---T.KIL--------------------------------------
WHIA_CLOAB/19-107--------NNV---Y--VVSITEDMGVRELL-KT---V.GVM--------------------------------------
WHIA_LACLA/11-98--------NRV---Y--TVFITEG..ASELL-DE---L.SLA--------------------------------------
WHIA_BACHD/18-104--------NNV---Y--LVRLKQE..AETLL-KE---L.KII--------------------------------------
WHIA_STRCO/17-102--------GSR---F--VVRVVAG..GDQLA-RQ---T.GLV--------------------------------------
WHIA_STRSY/16-99--------NRV---Y--AVLIEDG..VNEIL-ND---L.HL.--------------------------------------
WHIA_LACRD/19-103--------NNQ---Y--IVRLRYH..AQHVL-DD---L.GIL--------------------------------------
C3ASX9_BACMY/18-103--------NNV---Y--IVRLVEK..SREIL-AD---L.HIV--------------------------------------
WHIA_DESHY/19-104--------NNS---Y--MVKIYPR..TLEDL-QQ---L.GLL--------------------------------------
WHIA_STAA8/19-103--------NNI---Y--ICRTKMK..AKEIL-DE---L.GIL--------------------------------------
WHIA_STRT2/17-99--------NRV---Y--TVFVAEN..VNDIL-SD---L.QL.--------------------------------------
Q6MS46_MYCMS/19-102--------NKN---F--VLTLIGN..INKFL-QK---L.RI.--------------------------------------
WHIA_TROWT/25-105--------ESC---F--LLRIDDP....SLA-RK---L.GL.--------------------------------------
WHIA_STRR6/19-99--------NRV---Y--TVFTDEK..VQDLL-SD---L.HL.--------------------------------------
WHIA_STRA5/16-99--------NRV---Y--TVFIEEK..VDVIL-AD---L.KL.--------------------------------------
WHIA_LISMO/20-103--------NNV---Y--IVRLKSG..TRGIL-ED---L.RIL--------------------------------------
WHIA_STRP1/19-99--------NRV---Y--TVYVEQG..VETIL-AD---L.KL.--------------------------------------
U5LEB5_9BACI/18-103--------NNV---Y--IVRLAQQ..AQEIL-AD---L.KIL--------------------------------------

PF14528

A0R7F4_MYCS2/756-836.......YRDC...W..HVLI.YG.REN.QK.RF---VAHVG--------------------------------------
A1T108_MYCVP/351-426........TGE...H..KVVI.TN..RS.SAEAF---CTRVG--------------------------------------
A1TJY2_ACIAC/534-628GGQEPYAIRAQ...H..ELVV.SG..DN.LR.VF---AERIG--------------------------------------
A1VTS3_POLNA/517-611GGQRDYLCQTQ...H..ELIV.DG..ES.RE.AF---MREIG--------------------------------------
A1WUS3_HALHL/509-591........RPA...W..QLDI.TH.AES.IL.TF---AEQIG--------------------------------------
A6UT61_META3/576-653......KLNKT...F..RF.C.KS..RR.NR.RF---RESAN--------------------------------------
A6UTA4_META3/359-447........KVV...Y..RLSIVNE..KS.IK.LF---LGHIG--------------------------------------
A6UW46_META3/1255-1348........STV...Y..RIDY.NG..IQ.AM.KY---FENIG--------------------------------------
A6WG57_KINRD/634-715........RPG...Y..TLDV.SG.VDD.QR.RF---LQEIG--------------------------------------
A9AYW4_HERA2/898-979........HDY...Y..NIAI.SG..KQ.QL.EQ---LSGVW--------------------------------------
B1I483_DESAP/488-582GGNKEYHIKAQ...H..ELVI.SR..DN.IS.VF---AERIG--------------------------------------
B2TL46_CLOBB/6-88........SDC...Y..SYIL.KH..DN.AI.DL---LKQIH--------------------------------------
B3QY00_CHLT3/668-763GGVKEYPVLEM...H..SLRI.SR..SS.RV.RF---EAEIG--------------------------------------
B3QY00_CHLT3/1267-1342........STL...Y..VLRL.LN..RNYTH.AF---KEKIG--------------------------------------
B6IYQ9_RHOCS/502-596GGRRPCAGAAD...H..ELII.AR..DN.VG.RF---AARIG--------------------------------------
B7KBB5_CYAP7/899-980........YPY...Y..TITI.CG..KA.QL.KT---CRSIW--------------------------------------
B8GMT3_THISH/545-639........RAQ...H..ELII.SG..EN.IL.RF---AEFVG--------------------------------------
B8HS23_CYAP4/403-485........RQA...W..QLDI.TD.HLS.IK.SF---IDEIG--------------------------------------
B8HS23_CYAP4/996-1078........RDQ...Y..HVWV.SG..KS.DIEKF---VQQVG--------------------------------------
C0QPU4_PERMH/910-980........DDK...T..SYQV.TV..YD.LK.NF---KKYIL--------------------------------------
C4XRN9_DESMR/481-575GGVKAYAVKSQ...H..ELVI.AG..EN.MA.RF---REVVG--------------------------------------
C7LZ05_ACIFD/594-691GDVRVYPNHDA...Y..QLRI.TS..AS.IV.RF---AEHVG--------------------------------------
C9RBG7_AMMDK/493-587GGRSEYPCQEV...C..DLRI.SG..ES.LI.TF---YQEIG--------------------------------------
D0MFS7_RHOM4/597-691GGVKEYRVQPL...Y..SLRI.SR..SS.RV.RF---EREIG--------------------------------------
D0MJZ2_RHOM4/916-989........RPA...F..ELVI.TD.QRD.IV.LF---ARQIG--------------------------------------
D0MK11_RHOM4/641-722........RVQ...Y..HVKV.SG.RED.LL.RF---VEKIG--------------------------------------
D1ABC6_THECD/789-863.......GGPV...F..QVRL.RN..TD.HALRF---EEIVG--------------------------------------
D2Q3V0_KRIFD/773-854.......YRDG...Y..HLHI.YG.AEN.QL.RF---CDEIG--------------------------------------
D2RDQ6_ARCPA/351-432........LGT...Y..QLEF.GG..KI.LH.AI---FSEWG--------------------------------------
D2RF09_ARCPA/632-722........GKC...Y..TVTV.LG.GEY.LR.KF---LKILK--------------------------------------
D2RGZ0_ARCPA/317-397........MCK...Y.SLLII.SG.KRN.LE.NY---AKYIG--------------------------------------
D2RHT0_ARCPA/583-657........NKV...P..TVEF.SS..KI.VA.HL---LRKLG--------------------------------------
D2RHT0_ARCPA/681-772........HDR...Y..SLII.YG..EN.IE.KF---AKYIG--------------------------------------
D2RHU0_ARCPA/357-445........EGS...VTLRLAI.VG.EEN.VR.KF---LAKIG--------------------------------------
D2RHU9_ARCPA/799-879........CGN...Y..EYRI.LIGRTEFIR.IF---AEEIG--------------------------------------
D2RI62_ARCPA/1107-1187........NGV...W..TLIV.SN..RS.LK.TF---KEKIG--------------------------------------
D3PLE6_MEIRD/901-979........KTS...H..ILLI.GE.PSD.VE.RF---AKHIG--------------------------------------
D3RNR6_ALLVD/922-1001........HRS...Y..RAQI.TG..RE.EMLKF---YDRIQ--------------------------------------
D3RUR0_ALLVD/939-1021........RTT...Y..MVWV.RG..ADNQR.RF---LSQVG--------------------------------------
D3SD26_THISK/547-641GGAKEYAIKAQ...H..ELIV.RG..EN.LQ.RF---LQQVG--------------------------------------
D3SVT9_NATMM/650-744GGTKAYETKAQ...H..ELVI.VK..DN.LE.RF---ADEIG--------------------------------------
D3SWA2_NATMM/649-723.......GRDL...F..ILAI.TS..RE.SLEAF---KRSIG--------------------------------------
D5BWU6_NITHN/1168-1260GGKRKYWVKPL...Y..RLLI.TS..IQ.GC.RI---AEDIT--------------------------------------
D5C1W3_NITHN/655-749GGFSEYECNPD...N..ELII.SG..AN.IT.RF---NFRIG--------------------------------------
D5MER0_9BACT/526-620GGQRGYATAEQ...H..ELVI.SG..DN.LL.RF---AERVG--------------------------------------
D5UE80_CELFN/877-950........QG....P..RLDVVEK..DD.LR.RL---LQEIG--------------------------------------
D5WTP6_KYRT2/749-844........KGF...Y..ELIL.SD..NN.VA.VF---AEKIG--------------------------------------
D7B342_NOCDD/1193-1267.......GGDC...H..VVRL.RN..VDHAL.RF---DETVG--------------------------------------
D7CX96_TRURR/597-691GGSRAYRCRAE...H..ELVI.SC..DN.LA.VF---AALVG--------------------------------------
D9T2Z6_MICAI/361-436........DGE...I..KVVV.TN.RRD.AR.IF---AAHVG--------------------------------------
E4NRK9_HALBP/486-562........KTT...R..ELIC.SS..SE.LV.SL---LEKIE--------------------------------------
E4NRK9_HALBP/587-658........DGS...F..RLRV.SG..DD.FA.RY---TAQIG--------------------------------------
E4NRK9_HALBP/1125-1201........RDL...Y..VLAV.TA.AES.LQ.RF---NRHIG--------------------------------------
E6N2P5_9ARCH/184-275TGKTYHYNKDY...Y..YLRI.RR..SS.NE.SY---YNLVG--------------------------------------
E6N3C0_9ARCH/300-389........QTL...Y..RIYI.RR..CC.FI.RF---AQLVG--------------------------------------
E6N4J4_9ARCH/190-281........KDY...Y..YLRI.RM..PS.NE.TF---YNWVG--------------------------------------
F0S203_DESTD/591-669.......FRPT...Y..QLHI.TD..RNNQL.KF---LKEIG--------------------------------------
F2KME6_ARCVS/484-560........KSA...R..EVIV.PG..VE.LY.NF---FELLG--------------------------------------
F2KME6_ARCVS/583-665....RTPEMRT...Y.FRLTI.TG..EN.AL.KF---VREIG--------------------------------------
F2KME6_ARCVS/1131-1201........TNS...Y..KVYI.TG..DC.LE.RF---VEMVL--------------------------------------
H3ZK26_THELN/701-790GEKKIYEAQGY...Y..ELVI.AN..YS.RK.LF---AEKIG--------------------------------------
H3ZL75_THELN/1325-1406........TGT...Y..SKHL.RI..KN.KW.RF---AERIG--------------------------------------
APE1_AERPE/108-183........DGV...W..RLRI.AS.LAS.LR.RF---AHYIG--------------------------------------
DNAB_MYCTU/615-694........HDS...W..RLHI.HG.AKD.QV.RF---LRHVG--------------------------------------
Q0A8L7_ALKEH/547-641GGSAEYATRAQ...H..ELVI.SG..EN.LA.RF---RDLIG--------------------------------------
Q0AB46_ALKEH/513-595.....GLQHAP...W..ELEV.MD.QAS.LR.AF---CEEIG--------------------------------------
Q0AB46_ALKEH/1102-1181........EGW...F..TLDI.SG.AVQ.QQ.RY---LEKIG--------------------------------------
Q122S1_POLSJ/523-616........ASQ...H..ELVI.SA..DN.LR.IY---AERIG--------------------------------------
Q18E84_HALWD/891-971........QGQ...Y...LTL.TG..SD.AQ.AY---RTTIG--------------------------------------
Q251D1_DESHY/495-588GGSKEYPVQAG...H..ELVI.SQ..DN.IE.IF---AEKVG--------------------------------------
Q2J782_FRASC/310-390........HDL...W..SLGI.QN.AGD.RR.TF---ADEIG--------------------------------------
Q31MT0_SYNE7/625-718RQPKAYFCKAQ...H..ELAI.AN..DN.LQ.IF---AELIG--------------------------------------
Q3AEA3_CARHZ/467-554........LPT...Y..RLII.SG..ER.AS.LF---FNKIG--------------------------------------
Q3ASQ1_CHLCH/668-763GGIKEYPVQQM...H..SLRI.SR..SS.RI.LF---EQQIG--------------------------------------
Q4Z9C2_BPTWO/367-442........NKY...Y..RLIV.NR..KE.LI.KL---LPLLR--------------------------------------
DNAB_SYNY3/596-678........RDN...Y..HVTI.TG.QAD.LQ.IF---VDQIG--------------------------------------
IF2P_METJA/324-403........KKY...Y..QLNI.VG..KR.NL.KN---FKNIG--------------------------------------
RTCB_METJA/360-448........DGRV.SY..RLAI.VG.EES.IK.NF---LGRIN--------------------------------------
RPOA2_METJA/245-317......GFAES...H..DIRI.YS..ST.LA.EF---LSNFG--------------------------------------
RPOA2_METJA/338-408........KNQ...F..VLII.PH..RY.AK.KF---HEEIN--------------------------------------
Y1054_METJA/466-543........DGS...H..SILI.SS..KI.LA.YV---FENI.--------------------------------------
HELS_METJA/542-629.NGKEYKCKDI...Y..VLTI.RD.FMS.IK.RF---YENIP--------------------------------------
GLMS_METJA/275-347........GNY...Y..ILEI.NS..KY.LIDWF---RENIP--------------------------------------
GLMS_METJA/371-449........NNT...H..KLLI.SD..KK.SFELF---KKYIG--------------------------------------
RFCS_METJA/176-249........DRT...P..DIYV.NS..KE.AV.EF---IDKLG--------------------------------------
RFCS_METJA/271-346........NKV...Y.YHIVI.SN.SSN.LR.TF---LDNIG--------------------------------------
RFCS_METJA/1454-1542........NLT..EL..IVKA.NN..KN.YL.KY---LSRIS--------------------------------------
Q5JE24_THEKO/618-702........NGNFMAY..ELKV.YS..RD.AW.RF---YEVMK--------------------------------------
Q5JEN0_THEKO/799-877........GHI...F..RVII.SS.VED.LK.KF---DALIP--------------------------------------
RADA_THEKO/370-442........GSV...Y.YRIYI.TG..ED.RK.TF---EKVLE--------------------------------------
Q5JGJ5_THEKO/164-258........SNVD.MF..GLRI.TR.LMD.IK.RF---HEEIG--------------------------------------
IF2P_THEKO/319-390........SDY...T..TLVI.SG.RRN.LD.LF---RRYIG--------------------------------------
HELS_THEKO/594-678........KPI...Y..DVKV.SG..KS.YY.SL---LEELG--------------------------------------
RFCS_THEKO/180-253........NRA...P..DVYV.NS..RR.AW.EL---VSSLG--------------------------------------
RFCS_THEKO/273-346........GKT...Y.YHVTI.SG.SEN.LE.RF---LSEIG--------------------------------------
Q5SLW3_THET8/981-1051........PRA...H..EVLI.SG.RED.IL.RF---AELIG--------------------------------------
Q5SLW3_THET8/1451-1528......GYKG....Y..AVYL.LGGLEA.AR.RF---AETVG--------------------------------------
Q5SM68_THET8/531-609........AEH...Y..RVRVVTA..KG.LE.RY---LERIG--------------------------------------
Q5SM68_THET8/1139-1233GALREYPVAPQ...Y..ELIL.GG..EN.RD.RF---AEVVG--------------------------------------
Q5SM68_THET8/1696-1769........TGV...R..NLYL.TS..RR.LV.RF---VEALI--------------------------------------
Q5UYX8_HALMA/481-557........KTA...R..ELLC.SA..GE.FV.SF---LASLD--------------------------------------
Q5UYX8_HALMA/582-653........NGS...Y..RLRI.SG..QS.FH.DY---AEQIG--------------------------------------
Q604J6_METCA/507-601GGAKGHSCQAA...H..ELII.SG..EN.VV.RY---AERIG--------------------------------------
RGYR_THEKO/1239-1317........TGV...W..DLII.SN..RS.LE.KF---REKIY--------------------------------------
Q7NEB4_GLOVI/421-498......GWRTI...Y..RLNV.CG..TE.FK.RR---FQTLC--------------------------------------
Q7NEB4_GLOVI/968-1061RQSAPYPCKSQ...Y..ELVI.AK..DN.LQ.VF---AQLVG--------------------------------------
Q8EQH2_OCEIH/74-143........TGV...Y..ILSI.NS..RI.LK.KD---LTEIH--------------------------------------
RTCB_METKA/361-448........KNV..VY..KLAI.VG.EEN.IK.RF---LGKVG--------------------------------------
VATB_METKA/488-560........NGV...T..MLRV.NS..RV.LA.RV---FERLA--------------------------------------
Q8TY20_METKA/847-927........STR...Y..RVMI.TK.SEY.IR.TF---VEKVG--------------------------------------
RTCB_PYRFU/366-453........KSV..TY..RLSI.VG.EEN.IR.NF---LGKIN--------------------------------------
Q8U412_PYRFU/161-255.GKVYKYNGDL...Y..ELRI.YR..RE.SVKAF---GEEIG--------------------------------------
Q8ZWC8_PYRAE/132-209........KPI...Y..AVVV.LG..KD.VVEDF---LRTIK--------------------------------------
Q9RRW1_DEIRA/735-829........QAQ...H..ELII.SG..SN.LA.VF---AERVG--------------------------------------
W6G9Y3_NODSP/613-705........RGS...W..RLII.YS.GNE.AR.KF---WEFIG--------------------------------------

PF09062

Q5JJ43_THEKO/430-527--------RNI---H--YIDIKAKGITSHYI-EL---LRGITNG------------------------------------
NDRZ_PYRFU/430-527--------RNI---Y--YIDIKARNITSHYL-KL---LEGIDNG------------------------------------

PF14527

WHIA_MYCS2/124-216--------------D--RVVVRDGEAIGALL-TR---MGAQDT-RLTWEERRMR--REVR--------------------
Q4A5P3_MYCS5/94-186--------------Y--TLYIKKQEQILDFL-AA---INAKEA-WSLVQQQKID--KDMN--------------------
WHIA_STRMU/121-214--------------A--VTYLQKAEDIMDFL-II---IGSMEG-MEAFENIKVM--RETR--------------------
WHIA_CALS8/130-222--------------Y--VVYLKEGEQIVDFL-NI---IGAHAA-LLELENIRIV--KELR--------------------
WHIA_HALOH/128-220--------------Y--VVYFKSFSEVATIL-NI---IGAHKA-LLKLEDNKVL--KEVK--------------------
Q98QY4_MYCPU/96-191--------------Y--VAYLKRVSSISTFL-QG---IGALNN-YFIFEERKIN--RDMK--------------------
WHIA_CLONN/131-223--------------F--VIYLKEGEQIVDLL-NI---IGAHDS-LLELENVRIM--KEMR--------------------
WHIA_BIFLO/127-219--------------E--RVTLKDPDAIERML-KL---MGATRS-AREWTGKRSD--GEAR--------------------
WHIA_MOOTA/117-209--------------Y--VLYLKDSEQIIRAL-SL---MGAYSA-VLAYENVLIF--KDMR--------------------
WHIA_CARHZ/124-216--------------P--FLYLKDAEQILSFL-SL---IGAHQS-LLKFENVRVV--KEVR--------------------
WHIA_SYNWW/130-222--------------L--VVYLKESEKIVDFL-RV---VEASRA-LLNFENVRII--KSVR--------------------
A6LMS1_THEM4/115-208--------------F--RFYVKRARDIIELL-NF---LGAQRN-ANKMERMVST--REVK--------------------
Q9PR72_UREPA/135-227--------------T--IVYFKKSEIISDFL-KA---IRTQNS-LFEFENIRIQ--RDFN--------------------
WHIA_LEUMM/122-215--------------F--IVYLKRAEKIVDFL-QT---IGATQS-MLKFEDIRMM--RDMR--------------------
WHIA_TROWT/128-220--------------Y--KVVIRDIDNVAPLL-RN---VGARNS-VEKIEQFIKL--RHPE--------------------
WHIA_CLOPH/130-222--------------Y--VVYVKEGSQIVDLL-NI---MEAHTS-LMDFENVRIL--KEMR--------------------
Q1AUH5_RUBXD/45-136--------------W--VAYTKSADGVTTLL-SQ---MGLHDA-VLEYEARAVL--GEAK--------------------
A7HM71_FERNB/116-209--------------Y--RYYIKRGRDIQEIL-EL---MGAIRG-AAHFEKILTS--REIK--------------------
WHIA_OENOB/125-220--------------L--IVYLKTGERISDFL-SI---IQATSS-MLHFEDARIM--SDMR--------------------
Q4A984_MYCHJ/93-186--------------F--RLYLKKVNEIIYFL-MV---IGALEQ-ASKLEILRIK--RDH.--------------------
WHIA_LACJO/126-219--------------Y--IVYLKEAEKIGDFL-HI---VGAVNA-MLAFEDLRIM--RDMR--------------------
WHIA_BACCR/125-217--------------Y--ITYLKEAEKITEFL-NI---IGAHNA-LLRFEDIRIV--RDMR--------------------

PF05204

Q874G4_9SACH/619-731--------......Y--SICLS.GATLSGAL-RF---CALDKN-NANSK.......KPFV--------------------
Q8J0H1_9SACH/320-431--------......Y--AIYMSGGDILLNVL-SK---CASFKK-FRPAPV......APPV--------------------
F2Z6H8_CANGA/308-425--------......Y--DCNISGSTPLQNVL-SY---CRSGHK-RKPAP.......EVVI--------------------
Q874F9_SACPS/464-565--------......Y--SKVVRGNGVRNNLN-TE---NPLWDA-IIG.........LGFL--------------------
Q8J2S8_SACPA/309-426--------......Y--DCNVAGGTTLQNVL-SY---CRSGHK-TREVP.......LIVK--------------------
Q8J0H3_KLULC/295-382--------......Y--TLTLS.GDALKSVS-NW---TST...-............SNIE--------------------
Q874G2_SACEX/606-728--------DEVATGY--TAVMT.GDALTNSM-RF---CAIGRN-RVTA........KQFM--------------------
A7TLB5_VANPO/570-682--------......Y--NVTVKGGELLKSVL-SR---CSAINY-TKCESRDLLREPVEFY--------------------
Q8J0H0_NAUCA/385-494--------......Y--RVFLS.GEALIGVL-RF---CALDRK-RTAF........KEFT--------------------
A5DXZ0_LODEL/565-659--------......N--RITLE.GPALAGVL-SK---CSSSSV-DA..........KSFA--------------------
Q8J0G4_ZYGBA/322-433--------......Y--AIYISGGDALLSVL-AH---CAAAKK-FRAPPS......NEVV--------------------
Q8J0G7_9SACH/280-391--------......Y--NIKLT.GSALNGVV-RL---SALSKN-RDEP........VSFE--------------------
A3LP04_PICST/578-697--------......Y--AIYMANSSALDSVL-SK---CAAPRK-RAEEPVCVNREPHPYT--------------------
Q2P9R3_DEBHA/255-353--------......Y--IISMTRNSALESVL-SK---CALAEK-TTSVP.......SHIT--------------------
Q8J0G5_9SACH/322-432--------......Y--AISISVSDALLSVL-AK---CAGAEM-FRELPA......SEVV--------------------
Q8J0G3_ZYGBI/311-419--------......Y--VIQLSSCDALLSVL-AN---CGAVDK-RREAPA......HGVI--------------------
Q8J0G2_ZYGRO/322-427--------......Y--AIYMDRSDALLAVL-AN---CASNNK-QIEAPP......HGVI--------------------
Q8J0G3_ZYGBI/204-305--------......H--PKTNGAEDADRSLN-IG---NPLWNA-IVD.........LEYL--------------------
A7TIB9_VANPO/308-425--------......F--DCNIAGRAPLQSIL-SY---CTSGHK-RRDRP.......VLIA--------------------
Q707X4_ZYGRO/36-153--------......Y--DCHLAGRTPMQKVL-SY---CRSGHK-VKTEP.......EYVE--------------------
Q8J0G4_ZYGBA/215-316--------......Y--PKTIRGNDIRRNLN-TD---NPVWNA-IVD.........LGYL--------------------
Q8J0G6_9SACH/322-433--------......Y--AIYISGGDALLSVL-AN---CASAKK-HRAAPT......KEVV--------------------
Q8J0G5_9SACH/215-316--------......H--PKAIGGNDIQENSN-ND---NPLRNA-IVD.........LGYL--------------------
VATA_CANTR/603-713--------......C--IVNLT.GAPLAGVL-SK---CALARN-QTPV........VKFT--------------------

PF00961

IEND2_NEUCR/150-252--------------F--RVSD.ITSLNNIII-PH---FEKYQ..LITNKYGDLVIFKQIV--------------------
IEND3_NEUCR/248-349--------------Y--SIDS..IEDLNKLI-IH---LENYP..LLTQKAADFFLFKQAV--------------------
IEND2_NEUCR/320-414--------------F--IVTK.INDIIIYII-PF---FDQYK..IEGSKYNDYVKFKEAA--------------------
IEND3_NEUCR/408-508--------------L--TIVD.FTDITNILV-PF---FNKYP..IIGIKLYDYLDWCKIH--------------------
IEND4_NEUCR/418-514--------------Y--NVTV.NTTKLSPIV-QY---FNLYP..LKTKKYITYFNWIKIY--------------------
SCE3_YEAST/113-209--------------W--TIHD..LKGVYTLL-NI---INGY...MRTPKYEAFVRGAEFM--------------------
MBI3_YEAST/268-369--------------F--NVRN.KNHLKNIII-PI---FDKYP..MLTNKHYDYLYFKDNL--------------------
YMC1_SCHPO/111-209--------------Y--RLRR..REHLKKII-DI---FDQFP..LLTKKYWDYYLFKKAF--------------------
YMN3_PODAN/147-246--------------Y--RVES..LKGLDLII-NH---FDKYP..LITKKQADYKLFKMAH--------------------
Q02694_PODAN/137-238--------------Y--RIES.SEQIMKFII-PF---FDKYP..LITEKLGDYLLFKKVV--------------------
YMN4_PODAN/337-438--------------Y--MVRS..IKDLNVIL-SH---FDAYP..LFSQKRSDYILFKQAI--------------------
Q02690_PODAN/82-182--------------Y--IIRK.LSDIVDILI-PH---FEAYP..LLTKKFADFELFRQII--------------------
Q02693_PODAN/59-159--------------F--IVSS.LSQITKVII-PH---FDSYP..LITNKLADYFLWKGII--------------------
Q02692_PODAN/142-243--------------Y--IISS..IKDLNKLV-VH---LEHYP..LLTQKSVDFFFFKQII--------------------
YMN3_PODAN/304-404--------------F--KVTN.FSSIKDIIV-PF---FIKYP..LKGNKNLDFTDFCEVV--------------------
Q02693_PODAN/220-320--------------F--RCTK.FSDISTIIV-PF---FKEYL..PEGNKIKDFQDFCKVC--------------------
Q02694_PODAN/296-397--------------Y--IVSN.FTDIYTKII-PF---FLQYN..IIGSKNLDFNDWCKIA--------------------
Q02692_PODAN/304-403--------------L--SIVD.FSLITNRII-PI---FKENP..LVGVKSKDFEDWCKIH--------------------
Q02690_PODAN/239-345--------------F--KLNK.FELLENIII-PF---FQKYP..LQSAKVFDFLSFIEAA--------------------
Q02695_PODAN/90-183--------------S--FIVE.DISGINTIC-SI---FNNYP..LHTSKKLDFQDFYEAL--------------------
Q02704_PODAN/111-209--------------F--SVTD..KKGILLLI-SI---FDKYN..LNTSKYLDYLDFKQAF--------------------
Q02696_PODAN/261-370--------------I--ETTR.IPYITNILI-PF---LENLT..WHSKKQLDFQDWKIIL--------------------
Q02704_PODAN/265-379--------------L--IINN.INVLYNYLI-PF---FSHAE..FLTKKGKDFNDFKIIS--------------------
YMC2_SCHPO/201-295--------------Y--YGST.SFGSAKKVI-NY---FDNYH..LLSSKYISYLKWRKAY--------------------
Q02684_PODAN/188-285--------------Y--KSSG..YKTAAVLI-NY---FDKYN..VFSGKYVDYIKFRKVY--------------------
Q02673_PODAN/152-245--------------F--AITN..LNKLRLVI-EY---FNVYM..LRTKKTISIWKMTSIL--------------------
Q02683_PODAN/191-286--------------Y--RLGG..IYNCKNVF-PY---FDNYP..LMTKKSASYIAWKEIH--------------------
Q02678_PODAN/149-269--------------M--VISH.NSESHTKVI-DY---FNRYP..LYSSKYLAYKDWKYVV--------------------
Q02686_PODAN/199-321--------------A--AVAH.NSRSHEILR-NY---FDNYP..LYSSKHLAYKDWCLVQ--------------------
Q02679_PODAN/177-282--------------F--VVNTSSKESNLILV-DY---LTTYP..LISSKYLDFKCWEKCL--------------------
Q02680_PODAN/145-255--------------Y--TLAASSQNSLKIIV-DY---LEKYP..LYSSKFLDYRDWKEVV--------------------
Q02687_PODAN/214-318--------------Y--RIRTTNLKANLAVV-DY---LTKYP..LFGTKLLDFNDWAKVV--------------------
Q02687_PODAN/93-190--------------Y--TVNS..IEGVMLFI-NL---LNGK...MKTNKIFALHKLIDWY--------------------
AI2B_DICDI/119-215--------------Y--ALYFTSKEEILQLY-EY---FKKYP..SRAYKNKRIGLIPQYY--------------------
Q02676_PODAN/69-164--------------W--VVNK..KQEVEEII-KI---YDTYP..PLTSKKICQLAFLKTC--------------------
AI3_DICDI/13-108--------------W--TINN..KMQIEDVI-KI---FEDYN..LVTVRKRNQLQFLKEN--------------------
RGYR_METJA/1152-1248--------------L--IISN...KSLETFK-EK---IAKYLKIRKEAFINGYKTYKKEH--------------------
H9D0N7_EMENI/31-126--------------L--RIRD.KNHLKSFIL-PI---FEKYP..MFSNKQYDYLRFRNA.--------------------
H9D0P6_EMENI/44-138--------------L--TINN..KEGILFVI-SL---LNGN...MRTPKINSLYKLI...--------------------
H9D0P7_EMENI/159-267--------------Y--YGST.SFGSAKNVI-NY---FDYFH..LLSSKHVNYLKWRKAY--------------------
AI3_KLULA/142-233--------------W--IIND..IKNINNLI-KL---FNKYP..LITINKKLQLAFIK..--------------------

PF03161

E2JE69_RHIID/38-210NCFTLKEVQYLASVLEKKYSLNTSIHKTGVVN......Q...YGLYIPKSSMANL
D1AAC0_THECD/316-492EAFSPGSRERLVEYLRDTHGLDVRLIERGARK.....A....GVLQFTTAASAKF
F2WVM1_MONRO/53-226NSFSYNECLILIKALNDNFNIKSSVQSAGTKD......Q...YIIYIWKESMDDL
E6ZZ92_SPORE/48-221NSFSYEDCLLLSNVLFDKYNLRTSVQSAGIEN......Q...YIIYVFKESMPAL
M0UAK9_MUSAM/455-621KGGSREDTERIIRAFQAK.SLGCRVKRKGRV...........FWMGFQGTNADMF
A9TWX7_PHYPA/130-304DPFSEDRVILISRYLEDEWKVHAHVGQVKSTNNDRSVKEAFVYRLSFRTEELKKF
Q6U7Y1_MONPE/84-248HSFSYEEQIILQKALLYKFGLECNIYKHGKH...........FKLYIKAKSKLLF
RECA_MYCLE/317-494DAMTEGTRVRLRDYLCDTHGLDVRLREVGSAG.....K....AVLVFSTAATAKF
K5WT44_AGABU/33-209HCFTKEEVETMAVELSIKFKLNCSTRSNKGK...........SVIVIDSSSFETF
D3DFV7_HYDTT/7-179PKYEEEELQRLIRTLEVNFSLKPKLVWKKGY...........PVLYFPKEETQKL
M5BUR5_THACB/35-205ENFIESDVDLLITVLENKLNLECRKEKRGKG...........FRIVIKNKSLGAL
SCE4_YEAST/424-601QSFTTKELIFIMNILKIKFNLNCTLHKSRNK...........YTIYMRVESVKRL
K9TPD0_9CYAN/12-180N.LSESENEIIIDYFSEIWGFKWGMSKTADA...........YRLRMGTQEGKRF
Q02672_PODAN/51-225YGFSNTDVDKLMFTLQDKFNLKCSIHYNRDNK..........PRIYIFKESMDTL
SCE1_YEAST/34-208QSFTFEEVEYLVKGLRNKFQLNCYVKINKNK...........PIIYIDSMSYLIF
Q85QA0_CANGA/78-255TSFTLKEMIFIMNIFIIKFNLNCTLHKLNNN...........YIIYIKFKSIKLL
Q6ZEW6_SYNY3/132-296MSFSEDDVNFLSLIILQKFNLKNSVLKTKQGH..........FFIRISQKA....
K7N0N6_SOYBN/532-697K.GSREGVENIVRKFKAM.SMDCKVKRKGRV...........FWIGILGSNSTWF
AI7_USTMA/402-564QSFTVIEVVHLINVLIIKFNCKCTIHYQEGK...........PVIYISSRSVRKL
G4U3E9_PIRID/59-232NSFTYSDCLLLVKALNDNFSLKATVQSAGAPN......Q...YCIYIWKESMPLL
M1CIN2_SOLTU/404-569K.GSSEGVVSILKALKAK.SLNCRVKKRGRV...........FWIGFLGDNATFF
Q9B6C9_YARLI/213-390NNFTSEEVNILVSIITRKFNLKCVKQSSGSKN......Q...YIIYFWKESIPDL
PP154_ARATH/632-795K.GSLEGVEKVVKALQAK.SMECRVKKKGKV...........FWIGLQGTNSALF
G4U3G4_PIRID/70-243DSFTLVEVVLLMNILMIKYDLKCSIQDHKGK...........YRIYIHVESMNT.
M5BJL1_THACB/29-201ESFTLAEVNLLVKTINDKWNLNCHKVTRGSG...........YRVVISRKSLPIL
MBI2_DEBHA/69-242NNFTLNEVKQLMAMLDVKYNIKSTMHKTGAMD......Q...YNMYMLSDSMPIL
K5XIF0_AGABU/77-253QSFTVKECVFIINTFYIKFGIESKIHFQRGL...........PVLYVTVESIRKI
D8RW96_SELML/689-854EAYDHKELCLVVEAMYER.RIQCRIMRDERGK..........HYLEISSES....
C7U019_PICSO/188-361NNFTLNENEYLIYLLKSKYNINASMHKTGVKD......Q...FNIYMFVDSMPTL
M5BJK2_THACB/16-192NSFTKEEVQILADAINAKLGIYVGVLHDRKDQ..........WILTIGAKQLDLL
F6FSE8_ISOV2/317-493DAMSPGSRERLVEYLRDTHGIDCSLRQRGARQ.....Q....WVLQLTTAGTARF
C5Y0D4_SORBI/581-747SGGNIDGVERIVKSLQTQ.SLTCKVKRKGRF...........FWIGFQGSNGDSF
K9PLK5_9CYAN/22-190Y.ISKEENEIVISYFLEVWGIKWGLNKSKGS...........YRLRMGTQEGKKF
B9S769_RICCO/624-785K.GSREGVEKVFKTLKSK.SLNCKVKRKGRV...........FWIGFLGND....
C5GYP6_AJEDR/59-232YNFSLDETKFLVFLLKKLYDLDCTIQILKNGI......Q...SSVYIKKESVPKL
W1NZZ2_AMBTC/553-719RDCSHEDAERVIKTLKAK.SLDCRFKRKGRV...........FWIACQGNNATWF
MBI2_YEAST/223-403NCFSYKDVQYLTYLLHNKYNIKSTITKGNKEN.....TQ...FVIYVWKESMPIL
D7TPM6_VITVI/580-745K.GSREGVEKVVRTLKAQ.SMDCRVKRKGTV...........FWIGLLGSNSTWF
A9T5I5_PHYPA/473-637CQYTSKELTLVVKALKAR.TVDCVIRRRKAG...........NVICFKDES....
A5J053_GIBZE/61-229DSYKLIDIVRLMNVLMIRYNLNCKLRFHTPTQ..........PRIYISQHSMPVL
G4U3F9_PIRID/38-207NNFTETEVKTIKDILISKFNIESYLVKVSKTD......PLRGFVLKIPSRD....
F7WD24_SORMK/296-466DSFTIPEVIKIMNVLIIRYQLNCTLRFHTPTQ..........PRIYIREGSMPKL
F4FCR9_VERMA/317-493EAMAEGSRERLVEHLRDAYGMDVKLVSRGARQ.....T....ASIIFTTEASAKF
M5BL22_THACB/82-251NCFSLDDVKLLVSVLTDKFDLKCTISRERSG...........HIIRITRKSL...
M4DFG8_BRARP/597-757K.GSVEGVEKVVKALRAK.SMECRVKKKGNV...........FWIGLQGTNSVLF
G4U3E2_PIRID/85-256DNFTDKEVVLLISVLMYKFDLDCTLQYNGTK...........PRIYIRRNSMTKL
A9REG1_PHYPA/473-637CQYTSMELTLVVKSLKAG.TVDCFVRKRRSG...........NVLCFTGES....
Y1098_METJA/58-223HGFTLDENKFLQQKLKLLYGFDFRISKKHQYR..........YLRLFKSKQVHAF
E2JE43_RHIID/15-185QSFSRNDVLLLIKLLKDNFSLDCSLNTVKSTQ..........YRIYVRANSMVQF

PF10298

WHIA_MYCS2/17-102-------------------------------------------------------
WHIA_PEPD6/19-107-------------------------------------------------------
WHIA_FRASC/17-102-------------------------------------------------------
WHIA_COREF/19-104-------------------------------------------------------
A7HM71_FERNB/21-101-------------------------------------------------------
WHIA_ARTS2/19-104-------------------------------------------------------
WHIA_ACIC1/19-104-------------------------------------------------------
WHIA_CLONN/19-107-------------------------------------------------------
WHIA_CLOCE/19-106-------------------------------------------------------
WHIA_BIFAA/19-105-------------------------------------------------------
A6LMS1_THEM4/20-100-------------------------------------------------------
WHIA_NOCSJ/19-104-------------------------------------------------------
WHIA_BACSU/18-103-------------------------------------------------------
WHIA_LACC3/19-104-------------------------------------------------------
WHIA_PEDPA/18-103-------------------------------------------------------
WHIA_LACBA/18-103-------------------------------------------------------
WHIA_LEUMM/18-103-------------------------------------------------------
WHIA_OENOB/18-106-------------------------------------------------------
WHIA_SYNWW/19-108-------------------------------------------------------
WHIA_SALTO/19-104-------------------------------------------------------
WHIA_RHOSR/17-102-------------------------------------------------------
WHIA_ALKOO/19-108-------------------------------------------------------
WHIA_CLOPH/19-107-------------------------------------------------------
WHIA_LACDA/19-104-------------------------------------------------------
WHIA_LACS1/18-103-------------------------------------------------------
WHIA_HALOH/19-107-------------------------------------------------------
WHIA_MOOTA/23-103-------------------------------------------------------
WHIA_CLOB8/19-106-------------------------------------------------------
WHIA_CALS8/19-106-------------------------------------------------------
WHIA_LACSS/19-104-------------------------------------------------------
WHIA_CARHZ/19-103-------------------------------------------------------
WHIA_ALKMQ/19-107-------------------------------------------------------
WHIA_KINRD/19-104-------------------------------------------------------
WHIA_EXIS2/18-104-------------------------------------------------------
WHIA_THEFY/19-104-------------------------------------------------------
WHIA_CLOTH/18-106-------------------------------------------------------
WHIA_CORJK/19-104-------------------------------------------------------
WHIA_LACAC/19-104-------------------------------------------------------
WHIA_GEOKA/18-103-------------------------------------------------------
WHIA_BACSK/18-104-------------------------------------------------------
WHIA_SYMTH/23-111-------------------------------------------------------
WHIA_PROAC/19-105-------------------------------------------------------
WHIA_LEIXX/19-104-------------------------------------------------------
Q6F251_MESFL/18-103-------------------------------------------------------
WHIA_CORDI/20-105-------------------------------------------------------
Q6YQD5_ONYPE/20-106-------------------------------------------------------
WHIA_ENTFA/18-103-------------------------------------------------------
WHIA_LACPL/18-103-------------------------------------------------------
WHIA_CLOTE/19-107-------------------------------------------------------
WHIA_STRMU/15-100-------------------------------------------------------
WHIA_OCEIH/18-103-------------------------------------------------------
WHIA_BIFLO/19-105-------------------------------------------------------
WHIA_CORGL/19-104-------------------------------------------------------
WHIA_THETN/19-107-------------------------------------------------------
WHIA_CLOAB/19-107-------------------------------------------------------
WHIA_LACLA/11-98-------------------------------------------------------
WHIA_BACHD/18-104-------------------------------------------------------
WHIA_STRCO/17-102-------------------------------------------------------
WHIA_STRSY/16-99-------------------------------------------------------
WHIA_LACRD/19-103-------------------------------------------------------
C3ASX9_BACMY/18-103-------------------------------------------------------
WHIA_DESHY/19-104-------------------------------------------------------
WHIA_STAA8/19-103-------------------------------------------------------
WHIA_STRT2/17-99-------------------------------------------------------
Q6MS46_MYCMS/19-102-------------------------------------------------------
WHIA_TROWT/25-105-------------------------------------------------------
WHIA_STRR6/19-99-------------------------------------------------------
WHIA_STRA5/16-99-------------------------------------------------------
WHIA_LISMO/20-103-------------------------------------------------------
WHIA_STRP1/19-99-------------------------------------------------------
U5LEB5_9BACI/18-103-------------------------------------------------------

PF14528

A0R7F4_MYCS2/756-836-------------------------------------------------------
A1T108_MYCVP/351-426-------------------------------------------------------
A1TJY2_ACIAC/534-628-------------------------------------------------------
A1VTS3_POLNA/517-611-------------------------------------------------------
A1WUS3_HALHL/509-591-------------------------------------------------------
A6UT61_META3/576-653-------------------------------------------------------
A6UTA4_META3/359-447-------------------------------------------------------
A6UW46_META3/1255-1348-------------------------------------------------------
A6WG57_KINRD/634-715-------------------------------------------------------
A9AYW4_HERA2/898-979-------------------------------------------------------
B1I483_DESAP/488-582-------------------------------------------------------
B2TL46_CLOBB/6-88-------------------------------------------------------
B3QY00_CHLT3/668-763-------------------------------------------------------
B3QY00_CHLT3/1267-1342-------------------------------------------------------
B6IYQ9_RHOCS/502-596-------------------------------------------------------
B7KBB5_CYAP7/899-980-------------------------------------------------------
B8GMT3_THISH/545-639-------------------------------------------------------
B8HS23_CYAP4/403-485-------------------------------------------------------
B8HS23_CYAP4/996-1078-------------------------------------------------------
C0QPU4_PERMH/910-980-------------------------------------------------------
C4XRN9_DESMR/481-575-------------------------------------------------------
C7LZ05_ACIFD/594-691-------------------------------------------------------
C9RBG7_AMMDK/493-587-------------------------------------------------------
D0MFS7_RHOM4/597-691-------------------------------------------------------
D0MJZ2_RHOM4/916-989-------------------------------------------------------
D0MK11_RHOM4/641-722-------------------------------------------------------
D1ABC6_THECD/789-863-------------------------------------------------------
D2Q3V0_KRIFD/773-854-------------------------------------------------------
D2RDQ6_ARCPA/351-432-------------------------------------------------------
D2RF09_ARCPA/632-722-------------------------------------------------------
D2RGZ0_ARCPA/317-397-------------------------------------------------------
D2RHT0_ARCPA/583-657-------------------------------------------------------
D2RHT0_ARCPA/681-772-------------------------------------------------------
D2RHU0_ARCPA/357-445-------------------------------------------------------
D2RHU9_ARCPA/799-879-------------------------------------------------------
D2RI62_ARCPA/1107-1187-------------------------------------------------------
D3PLE6_MEIRD/901-979-------------------------------------------------------
D3RNR6_ALLVD/922-1001-------------------------------------------------------
D3RUR0_ALLVD/939-1021-------------------------------------------------------
D3SD26_THISK/547-641-------------------------------------------------------
D3SVT9_NATMM/650-744-------------------------------------------------------
D3SWA2_NATMM/649-723-------------------------------------------------------
D5BWU6_NITHN/1168-1260-------------------------------------------------------
D5C1W3_NITHN/655-749-------------------------------------------------------
D5MER0_9BACT/526-620-------------------------------------------------------
D5UE80_CELFN/877-950-------------------------------------------------------
D5WTP6_KYRT2/749-844-------------------------------------------------------
D7B342_NOCDD/1193-1267-------------------------------------------------------
D7CX96_TRURR/597-691-------------------------------------------------------
D9T2Z6_MICAI/361-436-------------------------------------------------------
E4NRK9_HALBP/486-562-------------------------------------------------------
E4NRK9_HALBP/587-658-------------------------------------------------------
E4NRK9_HALBP/1125-1201-------------------------------------------------------
E6N2P5_9ARCH/184-275-------------------------------------------------------
E6N3C0_9ARCH/300-389-------------------------------------------------------
E6N4J4_9ARCH/190-281-------------------------------------------------------
F0S203_DESTD/591-669-------------------------------------------------------
F2KME6_ARCVS/484-560-------------------------------------------------------
F2KME6_ARCVS/583-665-------------------------------------------------------
F2KME6_ARCVS/1131-1201-------------------------------------------------------
H3ZK26_THELN/701-790-------------------------------------------------------
H3ZL75_THELN/1325-1406-------------------------------------------------------
APE1_AERPE/108-183-------------------------------------------------------
DNAB_MYCTU/615-694-------------------------------------------------------
Q0A8L7_ALKEH/547-641-------------------------------------------------------
Q0AB46_ALKEH/513-595-------------------------------------------------------
Q0AB46_ALKEH/1102-1181-------------------------------------------------------
Q122S1_POLSJ/523-616-------------------------------------------------------
Q18E84_HALWD/891-971-------------------------------------------------------
Q251D1_DESHY/495-588-------------------------------------------------------
Q2J782_FRASC/310-390-------------------------------------------------------
Q31MT0_SYNE7/625-718-------------------------------------------------------
Q3AEA3_CARHZ/467-554-------------------------------------------------------
Q3ASQ1_CHLCH/668-763-------------------------------------------------------
Q4Z9C2_BPTWO/367-442-------------------------------------------------------
DNAB_SYNY3/596-678-------------------------------------------------------
IF2P_METJA/324-403-------------------------------------------------------
RTCB_METJA/360-448-------------------------------------------------------
RPOA2_METJA/245-317-------------------------------------------------------
RPOA2_METJA/338-408-------------------------------------------------------
Y1054_METJA/466-543-------------------------------------------------------
HELS_METJA/542-629-------------------------------------------------------
GLMS_METJA/275-347-------------------------------------------------------
GLMS_METJA/371-449-------------------------------------------------------
RFCS_METJA/176-249-------------------------------------------------------
RFCS_METJA/271-346-------------------------------------------------------
RFCS_METJA/1454-1542-------------------------------------------------------
Q5JE24_THEKO/618-702-------------------------------------------------------
Q5JEN0_THEKO/799-877-------------------------------------------------------
RADA_THEKO/370-442-------------------------------------------------------
Q5JGJ5_THEKO/164-258-------------------------------------------------------
IF2P_THEKO/319-390-------------------------------------------------------
HELS_THEKO/594-678-------------------------------------------------------
RFCS_THEKO/180-253-------------------------------------------------------
RFCS_THEKO/273-346-------------------------------------------------------
Q5SLW3_THET8/981-1051-------------------------------------------------------
Q5SLW3_THET8/1451-1528-------------------------------------------------------
Q5SM68_THET8/531-609-------------------------------------------------------
Q5SM68_THET8/1139-1233-------------------------------------------------------
Q5SM68_THET8/1696-1769-------------------------------------------------------
Q5UYX8_HALMA/481-557-------------------------------------------------------
Q5UYX8_HALMA/582-653-------------------------------------------------------
Q604J6_METCA/507-601-------------------------------------------------------
RGYR_THEKO/1239-1317-------------------------------------------------------
Q7NEB4_GLOVI/421-498-------------------------------------------------------
Q7NEB4_GLOVI/968-1061-------------------------------------------------------
Q8EQH2_OCEIH/74-143-------------------------------------------------------
RTCB_METKA/361-448-------------------------------------------------------
VATB_METKA/488-560-------------------------------------------------------
Q8TY20_METKA/847-927-------------------------------------------------------
RTCB_PYRFU/366-453-------------------------------------------------------
Q8U412_PYRFU/161-255-------------------------------------------------------
Q8ZWC8_PYRAE/132-209-------------------------------------------------------
Q9RRW1_DEIRA/735-829-------------------------------------------------------
W6G9Y3_NODSP/613-705-------------------------------------------------------

PF09062

Q5JJ43_THEKO/430-527-------------------------------------------------------
NDRZ_PYRFU/430-527-------------------------------------------------------

PF14527

WHIA_MYCS2/124-216-------------------------------------------------------
Q4A5P3_MYCS5/94-186-------------------------------------------------------
WHIA_STRMU/121-214-------------------------------------------------------
WHIA_CALS8/130-222-------------------------------------------------------
WHIA_HALOH/128-220-------------------------------------------------------
Q98QY4_MYCPU/96-191-------------------------------------------------------
WHIA_CLONN/131-223-------------------------------------------------------
WHIA_BIFLO/127-219-------------------------------------------------------
WHIA_MOOTA/117-209-------------------------------------------------------
WHIA_CARHZ/124-216-------------------------------------------------------
WHIA_SYNWW/130-222-------------------------------------------------------
A6LMS1_THEM4/115-208-------------------------------------------------------
Q9PR72_UREPA/135-227-------------------------------------------------------
WHIA_LEUMM/122-215-------------------------------------------------------
WHIA_TROWT/128-220-------------------------------------------------------
WHIA_CLOPH/130-222-------------------------------------------------------
Q1AUH5_RUBXD/45-136-------------------------------------------------------
A7HM71_FERNB/116-209-------------------------------------------------------
WHIA_OENOB/125-220-------------------------------------------------------
Q4A984_MYCHJ/93-186-------------------------------------------------------
WHIA_LACJO/126-219-------------------------------------------------------
WHIA_BACCR/125-217-------------------------------------------------------

PF05204

Q874G4_9SACH/619-731-------------------------------------------------------
Q8J0H1_9SACH/320-431-------------------------------------------------------
F2Z6H8_CANGA/308-425-------------------------------------------------------
Q874F9_SACPS/464-565-------------------------------------------------------
Q8J2S8_SACPA/309-426-------------------------------------------------------
Q8J0H3_KLULC/295-382-------------------------------------------------------
Q874G2_SACEX/606-728-------------------------------------------------------
A7TLB5_VANPO/570-682-------------------------------------------------------
Q8J0H0_NAUCA/385-494-------------------------------------------------------
A5DXZ0_LODEL/565-659-------------------------------------------------------
Q8J0G4_ZYGBA/322-433-------------------------------------------------------
Q8J0G7_9SACH/280-391-------------------------------------------------------
A3LP04_PICST/578-697-------------------------------------------------------
Q2P9R3_DEBHA/255-353-------------------------------------------------------
Q8J0G5_9SACH/322-432-------------------------------------------------------
Q8J0G3_ZYGBI/311-419-------------------------------------------------------
Q8J0G2_ZYGRO/322-427-------------------------------------------------------
Q8J0G3_ZYGBI/204-305-------------------------------------------------------
A7TIB9_VANPO/308-425-------------------------------------------------------
Q707X4_ZYGRO/36-153-------------------------------------------------------
Q8J0G4_ZYGBA/215-316-------------------------------------------------------
Q8J0G6_9SACH/322-433-------------------------------------------------------
Q8J0G5_9SACH/215-316-------------------------------------------------------
VATA_CANTR/603-713-------------------------------------------------------

PF00961

IEND2_NEUCR/150-252-------------------------------------------------------
IEND3_NEUCR/248-349-------------------------------------------------------
IEND2_NEUCR/320-414-------------------------------------------------------
IEND3_NEUCR/408-508-------------------------------------------------------
IEND4_NEUCR/418-514-------------------------------------------------------
SCE3_YEAST/113-209-------------------------------------------------------
MBI3_YEAST/268-369-------------------------------------------------------
YMC1_SCHPO/111-209-------------------------------------------------------
YMN3_PODAN/147-246-------------------------------------------------------
Q02694_PODAN/137-238-------------------------------------------------------
YMN4_PODAN/337-438-------------------------------------------------------
Q02690_PODAN/82-182-------------------------------------------------------
Q02693_PODAN/59-159-------------------------------------------------------
Q02692_PODAN/142-243-------------------------------------------------------
YMN3_PODAN/304-404-------------------------------------------------------
Q02693_PODAN/220-320-------------------------------------------------------
Q02694_PODAN/296-397-------------------------------------------------------
Q02692_PODAN/304-403-------------------------------------------------------
Q02690_PODAN/239-345-------------------------------------------------------
Q02695_PODAN/90-183-------------------------------------------------------
Q02704_PODAN/111-209-------------------------------------------------------
Q02696_PODAN/261-370-------------------------------------------------------
Q02704_PODAN/265-379-------------------------------------------------------
YMC2_SCHPO/201-295-------------------------------------------------------
Q02684_PODAN/188-285-------------------------------------------------------
Q02673_PODAN/152-245-------------------------------------------------------
Q02683_PODAN/191-286-------------------------------------------------------
Q02678_PODAN/149-269-------------------------------------------------------
Q02686_PODAN/199-321-------------------------------------------------------
Q02679_PODAN/177-282-------------------------------------------------------
Q02680_PODAN/145-255-------------------------------------------------------
Q02687_PODAN/214-318-------------------------------------------------------
Q02687_PODAN/93-190-------------------------------------------------------
AI2B_DICDI/119-215-------------------------------------------------------
Q02676_PODAN/69-164-------------------------------------------------------
AI3_DICDI/13-108-------------------------------------------------------
RGYR_METJA/1152-1248-------------------------------------------------------
H9D0N7_EMENI/31-126-------------------------------------------------------
H9D0P6_EMENI/44-138-------------------------------------------------------
H9D0P7_EMENI/159-267-------------------------------------------------------
AI3_KLULA/142-233-------------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window