Sequence alignment for CL0325

PF05221

E6S782_INTC7/4-477DHKVADLSLAA..AGRHQLRLAEHEMPGLMALRAEYADSQPLMGARIAGSLHMTVQTAVLIETLTALGAEVRWASCNIF.
A0JU72_ARTS2/4-491DYKVADISLAE..AGRHQIRLAEHEMPGLMSLREEFGASQPLKGARIAGSLHMTVQTAVLIETLTALGAEVRWASCNIF.
D6Y6B5_THEBD/2-474DFKVADLSLAE..FGRKEIRLAEHEMPGLMATRREYAAAKPLKGAKIAGSLHMTVQTAVLIETLVELGAEVRWASCNIF.
D1BWJ6_XYLCX/10-497RYKVRSLALAE..SGRHQIRLAEHEMPGLMALRAEYGESKPLAGARIAGSLHMTVQTAVLIETLVALGAEVRWASCNIF.
F6FRM5_ISOV2/23-520RYKVRSLALAE..AGRHQIRLAEHEMPGLMALREEYGEAQPLAGARIAGSLHMTVQTAVLIETLVALGAQVRWASCNIF.
E4NC13_KITSK/8-481DFKVADLSLAP..FGRKEIQLAEHEMPGLMSIRAEYAASQPLAGARITGSLHMTVQTAVLIETLTALGAEVRWCSCNIF.
D7B5R0_NOCDD/4-477DFKVADLSLAA..FGRDEIRLAEHEMPGLMATRAEYGDSKPLQGARIMGSLHMTVQTAVLIETLVALGAEVRWVSCNIF.
R4LG47_9ACTO/12-485DFAVADLSLAK..AGRHQMRLAEHEMPGLMSIREEFKAAQPLAGARIAGSLHMTIQTAVLIETLTALGAEVRWVSCNIF.
A4X3J2_SALTO/22-495DYKVADLSLAE..FGRKEIRLAEHEMPGLMALRREFGQSRPLAGARISGSLHMTVQTAVLIETLVVLGARVRWASCNIF.
C5C1M6_BEUC1/15-511AYRVADLALAE..AGRHQIRLAEHEMPGLMALRREYAQVQPLAGARIAGSLHMTVQTAVLIETLVALGADVRWASCNIF.
F4CRV7_PSEUX/22-502EFAVADLGLAD..FGRKEIRLAEHEMPGLMALRREYAEARPLHGARIAGSLHMTVQTAVLIETLTALGADVRWVSCNIF.
K0KB99_SACES/13-486DFAVADLSLAE..FGRKEIRLAEHEMPGLMALRREYSEVYPLKGARVSGSLHMTVQTAVLIETLVSLGAEVRWASCNIF.
A0LS32_ACIC1/2-475DYKVADLALAE..FGRKEIRLAEHEMPGLMALRRQYRESQPLAGARITGSLHMTVQTAVLIETLVDLGAQVRWASCNIF.
F6EFW8_AMYSD/14-489DYKVADLSLAE..FGRKEIRLAEHEMPGLMTLRREYAEVQPLKGARITGSLHMTVQTAVLIETLTALGASVRWASCNIF.
C7MUK9_SACVD/12-484EFAVADLSLAE..AGRHQIRLAEHEMPGLMATRKEYAASKPLKGAKIAGSLHMTVQTAVLIETLVDLGAEVRWASCNIY.
A4FNJ5_SACEN/13-486EFAIADPGAAT..AGRHQIRLAEHEMPGLMALRREYAEVFPLRGARVSGSLHMTVQTAVLIETLVALGAEVRWASCNIF.
F5XQ99_MICPN/10-486DYKVADLGLAD..FGRKEITLAEHEMPGLMAMRAQFGESKPLAGARIAGSLHMTVQTAVLIETLVALGAEVRWASCNIF.
SAHH_MYCMM/17-491DFKIADLSLAD..FGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIF.
R4T8V2_AMYOR/12-490EFAVADLSLAE..AGRKQLRLAEVEMPGLMALRREYADSQPLKGARVAGSLHMTVQTAVLIETLVALGAEVRWVSCNIF.
J9SDU9_9ACTO/17-488DYKVADLSLAD..FGRKEIELAEHEMPGLMALRREYADVLPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIF.
F4H4D2_CELFA/46-530RYRVRDLGLAA..AGRHQVRLAEHEMPGLMALRAELGGAQPLAGARITGSLHMTVQTAVLVETLVALGAQVRWASCNIF.
C7QZI2_JONDD/10-493RYKVRDLNLAE..AGRHQIRLAEHEMPGLMALREEYGDSKPLAGARIAGSLHMTVQTAVLIETLTTLGAQVRWASCNIF.
A1SGL1_NOCSJ/2-475DYKVADLSLAD..FGRTEIQLAEHEMPGLMAMRERYAAEQPLAGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIF.
A6WER2_KINRD/4-486EYRVRDLSLAE..AGRHELRLAEHEMPGLMALRAEFGDSKPLAGARIAGSLHMTVQTAVLIETLLALGAEVRWASCNIF.
I4F357_MODMB/14-493DFKVADLSLAG..FGRKEISLAEHEMPGLMALREEYGDAQPLAGARIAGSLHMTVQTAVLIETLTALGADVRWVSCNIF.
C8XJI5_NAKMY/22-497DYKVASMALAD..FGRKEITLAEHEMPGLMALRREYAEVQPLAGARISGSLHMTVQTAVLIETLVELGADVRWASCNIF.
I6X351_PROPF/4-475DFRVADLSLAG..FGREEITLAEHEMPGLMAMRERYAASKPLAGARIAGSIHMTVQTAVLIETLVALGAEVRWASCNIF.
M5A353_9ACTN/11-489DWRVADLSMAP..FGRKEMLLAEHEMPGLMALREEYGDSKPLAGARISGSLHMTIQTAVLIETLTALGAEVRWASCNIF.
W0RH07_9BACT/19-492AFKVRDLSLAE..WGRNEIRLAEQEMPGLMALRQRYAGKKPLAGAKIMGSLHMTIQTAVLIETLTALGADVRWVSCNIF.
SAHH_COREF/6-477DFKVADLSLAE..AGRHQIRLAEYEMPGLMQLRREYAEEQPLKGARIAGSIHMTVQTAVLIETLTALGAEVRWASCNIF.
E2SDU6_9ACTO/5-482DYNVADLSLAE..YGRKEIELAEHEMPGLMMMRERFGAQQPLAGARIAGSLHMTIQTAVLIETLVELGADVRWATCNIF.
X5E7G5_9CORY/23-501QYKVRDLSLAE..AGRHQIRLAEYEMPGLMELRREYADEQPLAGARIAGSIHMTVQTAVLIETLTALGAEVRWASCNIF.
G0HF72_CORVD/28-503QYKVRDLSLAE..SGRHQIRLAEYEMPGLMELRREYADEQPLAGAKIAGSIHMTVQTAVLIETLTALGAEVRWASCNIF.
A7H6N3_ANADF/19-492EHRVKDLALAE..WGRKEIELAEKEMPGLMAVRREYARKRPLAGQRITGSLHMTVQTAVLIETLADLGADVRWASCNIF.
D9SB20_FIBSS/15-498EYKIKDINLAI..EGRKELDLAETEMPGLMALRKEYAGKKPLAGARIMGSLHMTVQTAILIETLVDLGADVRWVSCNIF.
L0GYM4_9GAMM/6-467DYKVADLSLAE..WGRREIRIAETEMPGLMALREKYGAAKPLAGARVTGSLHMTIQTAVLIETLVALGAEVRWASCNIF.
B9S9Y6_RICCO/13-484EYKVKDMSQAD..FGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIF.
S6BUQ9_9GAMM/6-466DYKVADLSLAD..WGRKEIAIAETEMPGLMALREKYGRDKPLTGARITGSLHMTIQTAVLIETLVELGAEVRWCSCNIF.
K0C944_CYCSP/5-466DYKVADMSLAE..WGHKEIAIAESEMPGLMALQEEFGESKPLAGARVAGSLHMTIQTAVLIKTLVALGAEVRWCSCNIF.
E6WQA4_PSEUU/13-480PYKVADISLAD..WGRKEIDIAEHEMPGLMSIRRKYAAAQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIF.
H3G8U2_PHYRM/6-480DYRVADISLAD..FGRKEIEMAQIEMPGLMQSRTEFGPSQPLKGARVAGSLHMTIQTAVLIETLKELGGDMRWCSCNIF.
A8IXE0_CHLRE/12-482EYKVKDIAEAD..FGRLEIDLAEAEMPGLMACRSEFGPAQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIF.
X5DXZ4_9BACT/10-471DYKVADISLAE..FGRKEIEIAEKEMPGLMAIREKFGPRKPLDGVRVMGSLHMTVQTAVLIETLVSLGADVRWASCNIF.
R7L6X2_9BACT/8-471DYKIADIKLAD..WGRKELDIAEHEMPGLIAIREKYAKQKPLKGVRISGSLHMTIQTAVLIETLKALGADVRWASCNIF.
B4S716_PROA2/10-471DYKVADISLAE..WGRKEIEIAEKEMPGLMATRAKYEGQQPLKGARITGSLHMTIQTAVLIETLVELGAEVRWASCNIF.
I4BAF3_TURPD/15-478DYKVADINLAD..WGRKELDIAEHEMPGLMSLRKKYGPEKPLKGAKIMGSLHMTIQTAVLIETLKELGADVRWCSCNIF.
F0VM57_NEOCL/4-476QSKVKDLTLSA..FGRKEIELAEGEMPGLMALREEFGASQPLKGAKISGSLHMTVQTAVLIETLKALGAELRWCSCNIF.
D5EQ42_CORAD/10-478DYKVKDISLAD..FGRKEIEIAQHEMPGLMATREKYSKEQPLKGVRIMGSLHMTVQTAVLIETLKDLGADVRWCSCNIF.
C7LQI3_DESBD/10-472DNKVADMSLAD..WGSKEMQLSEREMPGLMALIDKYGSDKPLQGLRVTGSLHMTIQTAMLIKTLHALGADVRWASCNIF.
F3YYZ8_DESAF/11-474SYKVKDMSLAD..LGRKYMQLSENEMPGLMALREKYGPQKPLAGKRVMGSLHMTIQTAMLIETLHALGADIRWCSCNIF.
D4H862_DENA2/6-469QYKVADINLAD..FGRKEIAIAEHEMPGLMATREKYAKLQPLKGVRITGSLHMTIQTAVLIETLVALGADVRWASCNIF.
F8E7L7_FLESM/7-469NYKIKDITLAD..WGRKEIKIAEKEMPGLIAIREKYADEKPLKGVKISGSLHMTIQTAVLIETLVELGANVRWASCNIF.
C8X588_DESRD/10-472ESKIADPGQAH..WGRQEMRLAEKEMPGLMALREKYGPDKPLSGMKITGSLHMTIQTAMLIETLYALGADIRWASCNIF.
G8NVU2_GRAMM/12-476AYKVADISLAE..WGRKELTIAEAEMPGLMSIRRKYAPSQPLKGVRITGSLHMTIQTGVLIETLVALGAVVRWASCNIF.
E4TFL4_CALNY/3-466DYKVKDISLWE..LGRKEIEIAEQEMPGLMAIRKKYAKEKPLKGARISGSLHMTIQTAVLIETLVDLGAEVRWSSCNIF.
SAHH_DESAD/9-471DYKVADISLAD..WGNKEMQLSEREMPGLMSIREKYGKEKPLKGLKVMGSLHMTIQTAMLIETLHALGADIRWASCNIF.
G0GAZ7_SPITZ/7-470PYRVKEIGLAE..AGRAAIEMAEKEMPGLMALREKYGDAKPLAGARISGSLHMTVETAVLIETLRLLGAEVRWASCNIY.
B0VFI4_CLOAI/2-465DYKIADLSLAE..WGRKEIDLAEAEMPGLVALKERYRHRKPLAGAKITGSLHMTIQTAVLIETLVELGAQVRWASCNIF.
SAHH_DESAG/15-478ENKVKDLSQAD..FGYKEMQLSEREMPGLMELIAKHGAEKPLKGLKVTGSLHMTIQTAMLIKTLYELGADIRWASCNIF.
H8L337_FRAAD/12-476DYKVKDLSLAA..LGRRRIRMAEEEMPGLMQIRARYAEAKPLKGVRLSGSLHVTKETAVLAETLRELGASVRWASCNIF.
A0BCF6_PARTE/5-476DYKVKDITQAD..FGRKEINLAEVEMPGLMSAREEYGPQQILKGARISGSLHMTIQTAVLIETLQALGAQVRWCSCNIF.
M4NS42_9GAMM/11-478DYKVRDIALAD..FGRKELDIAEHEMPGLMSIRRKYAPQQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIF.
T2GAN7_DESGI/2-464EYKVADMALAD..WGLKEMQLAENEMPGLMETIKKYGPQQPLKGLKITGSLHMTIQTAMLIKALHALGADLRWASCNIF.
D7G8Q4_ECTSI/5-478DYRVADISLAD..FGRREIDIAEHEMPGLMSCREEFPGQ..LEGARVSGSLHMTIQTAVLIETLKALSSDIRWCSCNIF.
SAHH_PELCD/9-474NYVVKDMGLAE..WGRREIRMAEAEMPGLMAIREEYRGTKPLAGARITGSLHMTIQTAVLIETLAELGADLRWASCNIY.
D0LJJ9_HALO1/23-511PYKVADLSEKTVRFGRKELDLALVEMPGLAALREEYKGKAPLEGAKIMGSLHMTVQTAVLIETLVELGADVRWVSCNIF.
F0XY15_AURAN/5-479DYRVADISLAD..FGRREIELAEYEMPGLMKTVEEYGAAQPLKGARIAGSLHMTIQTAVLIETLKKLGGDIRWCSCNIF.
C5K5D1_PERM5/3-480DYKVADIGEAE..FGRKEITLAEVEMPGLMASRKEFGPSQPLKGANITGSLHMTVQTAVLIETLKELGANIRWCSCNIY.
SAHH_METCA/12-471DHKVADLSLAG..WGRKEIAIAETEMPGLMAIREEYRAAQPLKGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIF.
B7FT14_PHATC/5-480DYKVADISLAD..YGRKDIELAEVEMPGLMACREEYGPAKPFGGARISGSLHMTIQTAVLIETLKDLGGDIRWCSCNIF.
W0IVC4_9BACT/19-482DYAIRDIALAE..WGRKEIAVSEHEMPGLMAIRKKFGPSRPLAGVRITGSLHMTIQTAILIETLTALGADVRWASCNIF.
D7E778_METEZ/5-466DYKIKDIGLAE..LGRKQINMAEKEMPGLIATREKYGPQKPLKGARVSGSLHMTVQTAVLIETLVELGADVRWASCNIF.
C4LU18_ENTHI/5-465DYKIKDIKLAD..WGRKELTLAEYEMPGLMAVREKYGKEHALQGARITGSLHMTIQTGVLIETLKALGANLRWASCNIF.
B2UR10_AKKM8/7-470QYKVRDIGLAD..FGRRELDIAEHEMPGLMAVREKYAAARPLEGVRIMGSLHMTVQTAVLIETLTALGASVRWASCNIF.
D5MJ17_9BACT/14-479DFKVADLSLAD..FGRKEIEIAEKEMPGLMAVREKYGKLKSLKGVRITGSLHMTIQTAVLIETLVDLGADVRWASCNIF.
E1QFH0_DESB2/14-475AYKVKDIALAD..WGRKEIEIAEQEMPGLMATREKYGPQKPLAGARISGSLHMTIQTAVLIETLVALGADVRWASCNIF.
D6Z0B0_DESAT/10-434DYKVADMNLAD..WGRKEVLIAETEMPGLMALREEYGASKPLKGARIAGCLHMTIQTAVLMETLTALGAEVRWSSCNIF.
F4GUC2_PUSST/14-474DYKIADISLAG..WGRREIAIAETEMPGLMATREEYAAAQPLKGARIAGSLHMTIQTAVLIETLKALGAEVRWASCNIF.
SAHH_LEPIN/11-435SYKVKDLSQAE..WGRQEIILAEKEMPGLMALRQEYKGKKPLAGARIAGSLHMTIQTAVLIETLTELGAEVRWSSCNIF.
B4RBP7_PHEZH/3-462DYVVKDISLAD..WGRKEIEIAETEMPGLMAVREEFAKAQPLKGARVAGSLHMTIQTAVLIETLEALGAEVRWASCNIF.
C1EH64_MICSR/17-486EYKVRDMAQAD..FGRMEIELAQVEMPGLMSMIKEFGPAQPLKGANISGSLHMTIQTAVLIETLVALGAKVRWCSCNIF.
D5BW57_NITHN/12-436DYKVADISLAD..WGHKEIAIAETEMPGLMALREEYQGQKPLAGARIAGCLHMTIQTAVLIDTLVALGAEVRWSSCNIF.
E1WZA8_BACMS/5-430DYKVKDISLAD..WGRKEITIAESEMPGLMALREEFGPSQPLKGAKIAGCLHMTIQTAVLMETLVALGAEVRWSSCNIF.
V6F3C0_9PROT/3-464DYKVADIGLAA..WGRKELDIAESEMPGLMATREEFGPSQPLKGARIAGSLHMTIQTGVLIETLQALGADIRWASCNIF.
Q2L174_BORA1/11-472DYIVADMSLAG..WGRRELAIAETEMPGLMAIRDEYAAAQPLKGARIAGSLHMTIQTGVLIETLVALGAEVRWASCNIF.
A9GFA1_SORC5/8-437SYKVADITLAD..WGRKEIRIAEKEMPGLMALRAEYGPTQPLKGARVAGCLHMTIQTAVLIETLVALGAEVTWTSCNIY.
D2W1E4_NAEGR/11-472DYEVKDISQAS..LGRKRIEMAEKEMPGLMACRAKYGEEKPLNNVRISGSLHMTVETAVLIETLKTVGGNIRWCSCNIY.
B1ZZ56_OPITP/11-473TYRVKDISLAD..WGRKEISIAEHEMPGLMAVRKKFGPVKPLAGVRITGSLHMTIQTAVLIETLRELGADVRWASCNIF.
W0BHF8_9GAMM/12-436DYKVADLSLAE..WGRKEIAIAETEMPGLMALRKQYGHDKPLRGARIAGCLHMTIQTAVLIETLIALGAEVRWSSCNIF.
S6AB36_9PROT/9-467DCKVADMSLAV..WGRKEILMAEVEMPGLMAIRQENAKAQPLKGARIAGSLHMTIQTAVLIETLTALGAEVRWASCNIY.
G7Z7L3_AZOL4/7-431DYKVKDISLAN..WGRKEITIAETEMPGLMALRSEFGDSKPLAGARIVGCLHMTIQTAVLIETLTALGATVRWSSCNIF.
G4R9F7_PELHB/6-465NYAVKDISLAP..YGRKEIEMAEIEMPGLMAIRSEYAASQPLKGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIF.
E6W439_DESIS/5-431DYKVADMSLAE..FGRKEIRIAEKEMPGLMYIREKYRASQPLKGARIAGCIHMTIQTAVLIETLVDLGAQVRWSSCNIY.
A0LCX4_MAGSM/15-440DFKVADIGLAA..WGRKEIEIAETEMPGLVSLRSEYGAEQPLKGARVAGCLHMTIQTAVLIETLTALGAEVRWSSCNIF.
V5S8R2_9RHIZ/6-467DYVVKDISLAD..WGRKEIAIAETEMPGLMATREEYGPSQPLKGARIAGSLHMTIQTAVLIETLKALGADIRWVSCNIY.
C7R7A8_KANKD/3-464DHIIKDIALAD..WGHKEIDMAKSEMPGLMAVREEYGSEQPLKGARIAGSLHMTIQTAMLIETLISLGAEVRWASCNIY.
W8L8P3_HALHR/11-470DYAVADINQAD..FGRKEIAIAETEMPGLMATREEYAKDQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIF.
SAHH_RHOCB/3-462DYIVKDIKLAE..FGRKELDIAETEMPGLMACREEFGPSQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIF.
I1XLP2_METNJ/11-435DYKVADISLAK..WGHQEIKIAESEMPGLMALREEYADQYPLKGARIAGCLHMTIQTAVLIETLVELGAEVRWSSCNIF.
SAHH_RHILO/6-465DYVVADISLAG..WGRKELDIAETEMPGLMACREEFGAKKPLKGARITGSLHMTIQTAVLIETLKALGADIRWASCNIF.
E3I6Z6_RHOVT/4-465DFLVKDLSLAD..WGRKEMDIAETEMPGLMAVREKFGKEQPLKGARVAGCLHMTIQTAVLIESLQALGADVRWASCNIF.
H6L1E3_SAPGL/8-437NYKVKDISLAD..WGRKEITLAEAEMPGLMALREKYGESKPLKGARIAGCLHMTIQTAVLIETLVALGADVTWSSCNIF.
D5BCE6_ZUNPS/5-432AYKVKDISLAA..WGRKEIELAEAEMPGLMALREEYKEEQPLKGARIAGCLHMTIQTAVLIETLKALGAEVTWSSCNIF.
E8UEX5_TAYEM/4-465NYKIADIGLAD..WGRKEISIAEHEMPGLMATREEFSSSKPLKGARIAGSLHMTIQTAVLIETLVELGAEVRWASCNIF.
F8GKE5_NITSI/14-476DYKVADISLAE..WGRKEIAIAETEMPGLMALRKEYANQKPLAGARIAGSLHMTIQTAVLIETLVSLGAEVRWASCNIF.
Q0A6D2_ALKEH/11-469DYIVRDIGLAD..WGRKEIAIAETEMPGLMAVREEYRNEQPLKGARIAGSLHMTIQTAVLIEALIELGAEVRWASCNIY.
SAHH_MARMM/9-468PYIVKDMSLAK..WGRIEFDMAEIEMPGLMALREEYKDSQPLKGARIAGSLHMTVQTAILIETLTALGAEVRWASCNIF.
SAHH_HALHL/5-429DYKVADISLAD..WGRKEIKIAESEMPGLMETRREFAAQKPLKGARIAGCLHMTIQTAVLIETLQELGAEVRWSSCNIF.
G4SUH2_META2/5-429DYKIADINLAE..WGRKEINIAETEMPGLMALREEFGGEQPLKGARIAGCLHMTIQTAVLIETLIALGAEVRWSSCNIF.
SAHH_BURXL/13-472DFIVADMSLAD..WGRKELNIAETEMPGLVQTREEYKVQQPLKGARIAGSLHMTIQTGVLIETLTALGADVRWASCNIF.
W5XC25_9BACT/19-478DFYVADLSLAD..WGRKEMRIAETEMPGLMAIREEFAASKPLTGARIAGSLHMTIQTAVLIETLTALGAEVRWASCNIY.
SAHH_HYPNA/9-468DYFVKDISLAE..YGRKEIAIAETEMPGLMAAREEFGPSQPLKGARICGSLHMTIQTAVLIQTLEALGAQVRWVSCNIY.
M4S945_9SPHN/11-468DYLVHDISLAA..FGRKEIEIAETEMPGLMALRKEYGPSQPLKGARITGSLHMTIQTAVLIETLVHLGAEVRWASCNIF.
SAHH_SYNPW/16-475DYVIADINQAE..FGRKELDIAETEMPGLMALREKYGTEKPLKGARIAGSLHMTIQTACLIETLVELGAEVRWASCNIF.
A7HPA7_PARL1/11-471DYAIKDINLAD..WGRKELDIAETEMPGLMATREEYGAKKPLKGARIAGSLHMTIQTAVLIETLAELGADIRWASCNIY.
SAHH_RALME/10-471DYIVADIGLAG..WGRKEIAIAETEMPGLMAIRDEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIF.
Q09BK3_STIAD/11-470DYKVADISLAD..WGRKEIAIAETEMPGLMAIRDEFAKTQPLKGARIAGSLHMTIQTAVLIQTLEAIGAEIRWASCNIF.
I4AIU9_FLELS/9-439RYKVKDITLAE..WGRREMQLAEAEMPGLMALREEYGASQPLKGARIAGCLHMTIQTAILIETLTALGAEVTWSSCNIF.
SAHH_BARHE/5-464DYVVKDIALAA..YGRKELDIAETEMPGLMACREEFSSSQPLRGARISGSLHMTIQTAVLIETLKAIGANVRWSSSNIF.
F2IVA0_POLGS/3-461DYIVKDIKLAD..WGRTEIEIAETEMPGLMACRAEFGAAKPLKGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIF.
SAHH_DICDI/5-430HYKVKDISLAA..WGRKEIEIAENEMPGLMTLRKKYGPAQILKGARIAGCLHMTIQTAVLIETLTALGAQVQWSSCNIF.
Q4P829_USTMA/3-430NYKVADISLAA..FGRKEIEIAEGEMPGLMALRTKYGAEQPLKGARIAGSLHMTIQTAVLIETLVALGAQVTWASCNIF.
B3QUB9_CHLT3/8-434KYKVKDISLAE..WGRKEIRLAEAEMPGLMQIREEYKAQQPLKGARIAGCLHMTIQTAVLIETLVELGAEVQWSSCNIY.
SAHH_ACISJ/10-475DSAIADISLAD..WGRKEIRIAETEMPGLMAIREEFAAKQPLKGARITGSLHMTIQTAVLIETLKALGADVRWASCNIF.
SAHH_COXBU/13-437DYHIANINLAD..WGRKEIEIAETEMPGLMALRKKYKNAKPLKGARIAGCIHMTIQTAVLIETLMLLGAEVRWSSCNIF.
U9U9F5_RHIID/3-430NFKVADISLAA..WGRKEIEIAENEMPGLMTLRKKYSNTNPLEGARIAGCLHMTIQTAVLIETLTHLGAEVAWSSCNIF.
SAHH_PLAF7/5-478KSKVKDISLAP..FGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETLQKLGAQIRWCSCNIY.
R7KIX3_9BURK/4-463PYIIADIGLAD..WGRKEIQIAETEMPGLMAIREEYAAAQPLKGARISGSLHMTIQTAVLIETLVALGAEVRWASCNIF.
E4TS79_MARTH/6-432NYKVKDISLAA..WGRKEITLAEAEMPGLMALREEYGKEQPLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIF.
F2IAQ7_FLUTR/9-436AYKVKDISLAE..WGRKEIVLAEAEMPGLMSLRADYGAKKPLKGARIAGCLHMTIQTAVLIETLVELGAEVTWSSCNIF.
SAHH_METPP/12-476DHHVADLSLAD..WGRKEIKIAETEMPGLMAIRQEFAASQPLKGARITGSLHMTIQTAVLVETLQALGAQVRWASCNIF.
U1MPL7_ASCSU/7-436SYKVADITLAD..FGRMEITLAEEEMPGLMAMRAKYGPQKPLKGARIAGCLHMTIQTAVLIETLVELGAEVQWSSCNIF.
F6XCK4_CIOIN/7-437AYKVADMSLAE..FGRKEIEIAENEMPGLMSLRKMYGESKPLKGARIAGCLHMTIQTAVLIETLQALGAKVQWSSCNIF.
Q5FRZ9_GLUOX/12-437DYKVRDITLAD..WGRKEISIAEGEMPGLMALREEYKDSQPLKGARIAGCLHMTIQTAVLIETLIALGATVRWSSCNIF.
K7YQ52_9PROT/6-430DYKVADISLAE..WGKREIAIAETEMSGLMAIQEEYISYKPLKGAQIIGCLHMTIQTAVLIKTLIALGAEVRWSSCNIF.
J9YYB1_9PROT/2-425DYKVKDISQHA..FGRQEIEIAETEMPGLMAIREQYGDSKPLAGANIMGCLHMTIQTAVLIETLVALGAKCRWSSCNIY.
F2I015_PELSM/10-434DYKIKDIGLAD..FGDREISLAETEMPGLMALRKEYSAQQPLKGANILGCLHMTIQTAVLIDTLVALGASVRWSSCNIF.
E0TE34_PARBH/4-465DYEIADIGLAD..FGNKEIKIAEHEMPGLMQTRAEFGGSQPLKGARIAGSLHMTIQTAVLIQTLEALGATVRWASCNIY.
I1C1Z9_RHIO9/6-432PYKVADISLAA..FGLKEIEIAENEMPGLMEIARKYGPSQPLKGARIAGCLHMTIQTAILIRTLIALGAQVTWSSCNIF.
E9CHK0_CAPO3/6-431NYKVADISLAE..WGRKEIELAQNEMPGLMYLREKYGAAQPLKGARISGCLHMTIQTAVLIETLTALGAQVMWSSCNIF.
S9X649_SCHCR/5-432NYKVADISLAA..FGRKELEIAENEMPGLMAIREKHAQSQPLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIY.
D5BTB0_PUNMI/4-463DYIITDISLAD..WGRKELSIAETEMPGLMALRDEFGAAKPLKGARVAGCLHMTIQTGVLIETLVALGADVRWSSCNIY.
Q4Q124_LEIMA/3-436DYKVKDISLAE..WGRKAIELAENEMPGLMELRREYGPSQPLKGAKIAGCLHMTVQTAVLIETLKALGAELRWSSCNIF.
Q2NB41_ERYLH/6-468DYVIKDIALAK..YGRDEMAIAETEMPGLMALRDEYGESQPLKGARITGSLHMTIQTAVLIETLVALGADVRWATCNIF.
T1K9L8_TETUR/5-432AYKVADINLAN..FGREEITLAENEMPGLMSLRQKYGPSKPLKGARIAGCLHMTIQTAVLIETLIDLGAEVQWSSCNIY.
B3RVD8_TRIAD/6-432KYKVADISLAD..FGRKEIEIAQNEMPGLMKMRRKYGESKPLKGARIAGCLHMTIQTAVLMETLIELGAEVQWSSCNIF.
H3EHZ4_PRIPA/5-433TYKVADISQAE..FGRKEITLAENEMPGLMAMRAKYGPSKPLAGARIAGCLHMTIQTAVLIETLQELGASVQWSSCNIF.
R4XBF9_TAPDE/4-432PYKVADLNLAA..YGRKEIEISEVEMPGLMMTREKYGKEQPLKGARIAGCLHMTVQTAVLIETLTFLGAEVTWSSCNIF.
M7NIB1_PNEMU/6-434PYKVADISLAN..WGRKEIELAENEMPGLLSCRKKYGNSKPLKGARIAGCLHMTIQTAVLIETLVELGAEVTWSSCNIF.
S5R4D1_9PROT/14-476DFVIADINLSQ..WGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETLKCLGAEVRWSSCNIY.
K0C550_ALCDB/10-461DYKVADISLAQ..WGRSEIEIAETEMPALMAIRAKYRAEQPLKGARIIGCIHMTIQTAVLIETLKELGAEVRWSSCNIF.
SAHH_PSEMY/12-468DYKVADISLAD..WGRKELIIAESEMPALMGLRRKYAASQPLKGAKILGCIHMTIQTGVLIETLTALGAEVRWSSCNIF.
SAHH_PSEU5/12-467DFKVADISLAA..WGRREIIIAESEMPALMGLRRKYAAEQPLKGAKILGCIHMTIQTAVLIETLIALGAEVRWSSCNIF.
C5BTQ5_TERTT/11-461DYKVADIKLAE..WGRKEIDIAEGEMPALMALREKYRAEQPLAGAKIMGCIHMTIQTAVLIETLVELGAEVRWSSCNIF.
B1XI71_SYNP2/9-457DYKVADINLAS..WGRKEIAIAEGEMPALMTIRKKYSASKPLAGAKIIGCIHMTIQTAVLIETLVELGAEVRWSSCNIF.
E1VQZ0_9GAMM/8-458DYKVADISLAE..WGRKEIEIAESEMPALMSLRKQYSAQKPLAGARILGCIHMTIQTAVLIETLVELGAEVRWTSCNIF.
A1U548_MARAV/13-463DYKVRDITLAD..WGRKEIKIAEGEMPALMKLREKYKAEQPLKGANIMGCIHMTIQTAVLIETLVELGANVRWSSCNIF.
Q5R045_IDILO/8-458DYKVADISLAE..WGRKEIAIAESEMPALMTIRRKYADSKPLAGARIIGCIHMTIQTAVLIETLLELGAEVRWSSCNIF.
SAHH_ACIAD/17-466DYKVADISLAD..YGRKEIKLAEAEMPALIGLRKRYAAEKPLAGAKILGCIHMTIQTAVLIETLVELGAEVRWTSCNIF.
Q4FT37_PSYA2/19-473DYKVADISLAD..YGRREITLAEAEMPALMGLRRRYEADQPLKGAKIAGCIHMTIQTAVLIETLVALGAEVRWTSCNIF.
W4VUN6_ATTCE/58-483DFCVRNINQQA..FGRREIEIAEQEMPGIMALRKRAGDDKPLKNAKIVGCTHINAQTAVLIETLVELGAQVRWAACNIY.
SAHH2_DROME/67-491DFCVKSISKSA..FGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGATVRWAACNIY.
A1AX10_RUTMC/19-464DYKVADMALAD..YGRKEIELAEAEMPALMTLRKKYQSTQPLKDAKILGCIHMTIQTAVLMETLINLGAQVRWSSCNIF.
F6SNC6_CIOIN/38-463DFCIRNIKHAD..FGRREIEIAEQEMPALMDLRKRAQGDKPLNGAKVVGCTHISAQSAVLIETLSQLGAKVRWCCCNIY.
Q7QE71_ANOGA/31-458DFCVRNIKQHS..FGRHEIEIAEQEMPGIMALRKQALDDKPLKGANIVGCTHVNAQTAVLIETLICLGANVRWAACNIY.
A7SRK8_NEMVE/53-478DFCVKNIKLAD..FGRREIEIAEQEMPGLMLLRKRNCTDKPLEGAKIVACTHVTAQAAVLIETLMALGAQIRWCACNIY.
E4XGP7_OIKDI/72-497DFCVRNIKYSQ..IGRREIEIAEQEMPALMSLRKRAAGDKPLNGARIVGCTHVTAQAAVLVETLIELGAQVRWCACNIF.
I3KBV8_ORENI/75-500DFCIKNISQAD..FGRKEIEMAGREMPALMNLRKRAGGEKPLAGAKVVGCTHITAQTAVLIETLVALGAQCRWAACNIF.
K7DYH7_DANRE/71-496DFCIKNIKLAD..FGRRQIELAEDEMTALMALRKAAQGEKPLAGAKIVGCTHVTAQTAVLFETLSGLGAQCRWAACNIY.
H2KNW6_CLOSI/142-567DFCVQKIRRAS..FGLREIEIAEQEMPALVNLRKRAKDDQPLKGAQILGCTHVTAHTAVLLETLVVLGAQVRWCACNIY.
H3D3K6_TETNG/64-489DFCVKNIKQAH..LGRREIEIAEQDMAALMFLRTRAGAEKPLAGAKVMGCTHITAQTAVLIETLSVLGAQCRWAACNIF.
B3RUN3_TRIAD/31-456DFCVKNIKSAE..FGRREIEIAEQEMPGIMILRVKYAENKPLQSARIIGCTHITAQTAVLIETLITAGASVRWAACNIY.
W5K360_ASTMX/86-511DFCIRSIRQAA..FGRREIEMAEQEMPALVMLRKATQGEKPLAGAKIVGCTHITAHTAVLIETLSLLGAQCRWTACNIY.
H0W4G1_CAVPO/66-492DFCVKNIKQAE..FGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMSWLGVLGVECRVFLCFLYI

PF00389

Q9JY94_NEIMB/3-329------IAIYG--....T...KSYDREHFTRANRHFGF..ELEFFD.....FMLDA..KTAKMAEG..AEAVCIFVND..
SERA_ARATH/85-394------ILVTE--....KL..GEAGVNLLRE.......FGDVDCSY.....DLSPE..DLKKKVAE..SDALIVRSGT..
Q9RUU0_DEIRA/18-329------APLRV--....LI.CDEMNPGNLDH.....EGF.QIDYQG.....NLERE..ETLRRLPD..YDALITRSRT..
Q98F95_RHILO/5-315------VLVSD--....KL..SPTAVQIFKD.......R.GVEVDYLP.DLGKDKE..KLLEVIDQ..YDGLAIRSAT..
E9ACF1_LEIMA/115-427------ALLLE--....GV..NPIAKELLES.....KGC.IVEYIP....NALPRD..TLLEKIRD..VHFLGIRSKT..
Q9KEA4_BACHD/2-311------NVVS.--....SARVRPEIQQELLD.........DYPNVHFH.FFERM.E..IVGSALEE..ADVLITYGED..
O28495_ARCFU/4-322------VVSFS--....PI.AEPLLKGLIGSV..YSGEV.EVVVIG.....EYDER..RILEAVRD..ADIVIGDYTFK.
Q9KLW1_VIBCH/3-321------IAILD--DYQNVVRGLNAFQCLQGH.........DVTVFN.....DSLSDETVLIERLKP..FEALVLIRER..
Q9CKF1_PASMU/14-327------FLLLE--....GV..HQTALEVLQN.....AGYTNIEYHK....KALDDD..ELKEAIKD..AHFVGIRSRT..
SERA_ARCFU/3-312------VLVAE--....PI..SEEAIDYMRK.....NGL.EVEVKT.....GMSRE..ELIREVPK..YEAIVVRSQT..
CTBP_DROME/30-352------VALLD--G..RD...CSIEMPILKD.......VATVAFCD.....AQSTS..EIHEKVLNEAVGALMWHTII..
Q9VKI8_DROME/8-324------VLVCD--....AV..DKSCVELLEQ......HGIKVTYKL.....KLPVE..ELCQEVKN..FDAAIVRSDT..
Q97IU7_CLOAB/3-326------ILVYN--....H...RADETEYFQKFKEKYNV..DLMLTD.....KTPTI..ETADFAKG..FDCISIITT...
YEAA_SCHPO/9-327------ALLV.--..........GTLKHAHKEWEALGKYAELKTYSDG.TREDFLA..KCKTEFQN..VKAICRTYNSKF
Q9KP92_VIBCH/13-326------ILLLE--....GL..HPSSVEVLQA.....AGYSNIEYHK....GSLEEA..ELIKAIKD..VHFVGIRSRS..
Q9I1L0_PSEAE/4-318------VVLYK--....RL..SAPLMERLRE.........RVEVLLVE.EPGRDGL.ARLRDALPE..AHGLLGASLR..
Q98BH4_RHILO/9-329------VVITR--KLPDPV..ETRMRELFDA.........RLNVED....RPMTQP..ELVAAVKE..ADVLVPTVTD..
P74586_SYNY3/3-330------IAFFS--....S...KAYDRQFFQQANHPHQR..EMVFFD.....AQLNL..DTAILAED..CPVICLFVND..
DDH_ZYMMO/3-331------VAIFS--....S...KNYDHHSIEKENEHYGH..DLVFLN.....ERLTK..ETAEKAKD..AEAVCIFVND..
TKRA_BACSU/6-322------VFITK--....PI..PEEIEAFIGE.....HCRYEVWQED.....TLPSD..VLFEKLKE..AEGLLTSGTSG.
Q9A244_CAUCR/24-340------VIVTR--KLPDPV..ETRMCELFDT.........ELNVSD....KPMTAD..ELVDAMSR..ADVLVPTITD..
SERA_SCHPO/58-378------ILLLE--....NV..NQSALSNLKD.....EGY.QVEFLK....TSMSED..DLVEKIKG..VHAIGIRSKT..
GYAR_THELN/5-322------VFITR--....QI..PENGIKMIEK.......FYEIELWKD..PKAPPRG..VLLEKVRE..VDALVTLVTD..
Q98LH4_RHILO/9-326------VLAFE--....RYDPTDASLDWLRER..GVNVIFGNALWEMP.FKRFTED..ELIAKAHG..CIALMGASGT..
Q9S2M5_STRCO/3-328------ILAFG--....V...QADEKPLIERAF.RDHE..DVRCLD.....VFLNE..DTAPIAAG..HEIVSTSVNA..
SERA_METJA/4-312------ILVTD--....PL..HEDAIKILEE.......VGEVEVAT.....GLTKE..ELLEKIKD..ADVLVVRSGT..
LDHD_STRP1/3-330------LKLYN--....V...RGEEAVLAKKWADDNGI..EISLTE.....SPLTP..ETVKEAEG..FDGIANAQIG..
HPR3_ARATH/9-321------VVLLH--........RPPSLTFMDE.......ILTREFRTLI.TDTSSSE..SLPSFFPRHASSARAFVISGR.
Q9HXB7_PSEAE/5-318------VFVFS--....RL..APEHLERLQC.........QFNVRVLE.PKQGDID.AQYAAALPD..THGMIGVGRP..
O67741_AQUAE/4-320------VLITD--....PI..APEGIELLQK.........DPEVEVYN.EPDISYE..ELLEIIKD..FDAIITRSRT..
SERA_METTH/6-313------VLIAD--....SI..NEKGISELEE.......VAEVVVNT.....TITPE..ELLDAIKD..FDAIVVRSRT..
DDH2_SCHPO/3-330------VVLFS--....S...QSYDRGPFEEANKTFNH..EIIYHN.....FSLNK..DTVSLAGK..AQVVCVFVND..
HPR2_ARATH/6-313------VLMM.--........CPMSSYLENE.......L.EKRFNLLR.FWTSPEK..SVLLETHRNSIRAVVGNASA..
LDHD_ECOLI/3-329------LAVYS--....T...KQYDKKYLQQVNESFGF..ELEFFD.....FLLTE..KTAKTANG..CEAVCIFVND..
SERA_RAT/9-317------ILISD--....SL..DPCCRKILQD.....GGL.QVVEKQ.....NLSKE..ELIAELQD..CEGLIVRSAT..
Q9A6E7_CAUCR/11-318------ILLSH--EMLMPLQPLLEGAYIVHRLWDYPDRMAFLE........GPGQS............IRAIVHAGEM..
Q9HMR0_HALSA/3-311------VLVTD--....PI..ADAGLDRLRD......AGHEVTTAY.....DATGD..ALLDAVSD..AHALIVRSGT..
Q9WYG2_THEMA/4-311------ILIVT--RTFGKY..SQEPVEFLRK......EGFEIIRSD.....TIDPD......ILKE..VDALIVGTHP..
CTBP2_RAT/36-358------VALLD--G..RD...CTVEMPILKD.......LATVAFCD.....AQSTQ..EIHEKVLNEAVGAMMYHTIT..
Q9PBD8_XYLFA/15-328------ILLLE--....GV..SHSGIETFRA.....AGYSQIKIHT....TSLPEE..ALQAEIAE..AHIIGIRSRT..
Q89388_PBCV1/32-362------VAIF.--..........SAGNYVKDFIKPIESICTPVYIE.....SSLNE..TTAALANK..CDAINAFVND..
LDHD_TREPA/3-330------CVVFN--....L...REEEAPYVEKWKQSHPGV.VVDTYE.....EPLTA..KNKELLKG..YEGLVVMQFL..
Q97MV2_CLOAB/3-317------ISVIE--....PLGISEEEIRSIAKTI.TDRGH.EIVIYN.....EKSTDTNVLKERVKD..SEVIVLANMP..
Q97U35_SULSO/2-295------KIIS.--........TEKVPDECKN.........IISVKD.....ENITE.....EDYKN..AEILLTWPGR..
Q9A3I9_CAUCR/6-314------VLIAD--....KL..SPAAVEIFKN......RGLAFDIKT.....GLSKD..ELIAVIGD..YDGIAIRSGA..
Q9RKF9_STRCO/17-329------VAITE--CDHDSFDIERDVVTSAGG.........QLLVTQ.....SRDAD..TMVVNCAG..ADAIVVQYAA..
Q9LT69_ARATH/49-358------ILVTE--....KL..GQAGIDLLKK.......YANVDCSY.....DLSLE..ELCTKISL..CDALIVRSGT..
GYAR_AERPE/6-324------VFVTR--....EV..FPEALELLSK.......YYDVEVWDK..YQPPPYE..TLLSKARE..ADALYTLLTD..
DDH_HAEIN/3-329------IAIYS--....T...KSYDRKYIELINAKYNF..DLEFFD.....FMLNE..STVRLAEH..CEVVCIFVND..
O17626_CAEEL/8-316------VLIAD--....DI..EQECVDILKQ......NGIEVTVKT.....KQTKD..ELLVTLPQ..HDAVIVRSAT..
PDXB_PSEAE/3-285------ILADE--....N...IPVVDAFFAD.........QGSIRRLP.GRAIDRA..ALAE......VDVLLVRSVT..
SERA_YEAST/61-381------ILLLE--....NV..NQTAITIFEE.....QGY.QVEFYK....SSLPEE..ELIEKIKD..VHAIGIRSKT..
YGDH_SCHPO/9-332------VLAIG--....ELKFATNTLKRLSE.....KYHFEFIVPDPH.DRSKTIE..KIHEAASKSTFDACFWLFRNAA
CTBP1_CAEEL/181-504------VALLD--G..RD...CSVEMPILKD.......VATVAFCD.....AQSTQ..EIHEKVLNEAVAALMYHSIK..
Q9KCG9_BACHD/20-325------ILVSD--....AM..SEQGLSPLLN.........DPRVECVQ.QNVADAD......DLHE..YDALLVRSAT..
SERA_MYCLE/6-313------VLIAD--....KL..AQSTVAALGD.........QVEVRWV...DGPDRT..KLLAAVPE..ADALLVRSAT..
Q9I530_PSEAE/3-328------ILFFS--....S...QAYDSESFQASNHRHGF..ELHFQQ.....AHLQA..DTAVLAQG..FEVVCAFVND..
Q9VII9_DROME/10-326------VLIS.--....HPNVPAPALELLRS.....RGAETIICQS....VPPSRD..EILQKVPG..VDAIYWAHYQ..
O66939_AQUAE/3-332------VLFTS--....V...PQEDVPFYQEA..LKDL..SLKIYTTD.VSKVPEN..ELKK......AELISVFVYD..
Q9HVG5_PSEAE/7-321------AVFLD--HASLDL..GDLDMRPLRA......AFDELQLHA.....ASQPQ..EVAARLHD..ARVAISNKVP..
Q98CG2_RHILO/11-318------AILV.--....PADFSDHAVRRIDR......TFKQVSIERAD.PALVTDE............MRRMVRGIASF.
GRHPR_HUMAN/9-327------VFVTR--....RI.PAEGRVALARA.....ADC.EVEQWDS..DEPIPAK..ELERGVAG..AHGLLCLLSD..
Q9KMX4_VIBCH/4-330------VIFFS--....A...KHYDIASFSKLVDPTQL..SLHFHD.....FRLTD..KTAQMAKG..CEVVCAFVND..
Q9K7P7_BACHD/3-318------LLFTR--....AL..DPEWIEPLKD.......EHDIRMWTEE.NIPMPRE..LFLKELEE..ADGVFTNLTD..
Q9I6H5_PSEAE/13-326------FLLLE--....GV..HQNAVDTLKA.....AGYTNIEYLK....TALSGD..ELKERIAD..AHFIGIRSRT..
Q9HK29_THEAC/3-309------VLVVV--PNFLPLDQIRSAVSTITQ.........DVEVRT............DTDFDRSD..AEILIVTTFT..
Q98GE4_RHILO/8-315------ILSTH--........PLHPRASAKL.....AGAGQLVIAS.....ALDPA..TLTGEAKN..ADIVIVRA....
DDH1_SCHPO/3-330------IAFFS--....A...QPYEKEPFEKVNENYKH..EIDYHE.....SILNK..KTAVLAEK..APVVCVFVND..
PDXB_VIBCH/3-286------ILIDE--....N...MPYAQALFSQ.........LGEVILKP.GRTLTAD..DLID......VDALMIRSVT..
DHGY_METEA/5-313------VVFLD--........RESLDATVREFNFPHEY...KEYES.....TWTPE..EIVERLQG..AEIAMINKVP..
Q97ZK1_SULSO/20-326------VLITD--....PV..DQYMIRTLQN.....NGL.IVDYKP.....EITRE..ELLKIIDQ..YQVLIVRSRT..
Q97F10_CLOAB/3-323------IVVLD--G..YTLNPGDMSWEAFKE.....IGD.LTVYDRTD.YTGKEEE..KTIERARD..AEAILTNKTI..
Q9Z564_STRCO/7-314------VLIAE--....EL..SPATVDALGP.........DFEIRHC...NGADRA..ELLPAIAD..VDAILVRSAT..
SERA_SYNY3/32-339------VLVSD--....SI..DQVGIDILKQ.......VAQVDVKT.....GLSEA..EIIDIVPE..YDAIMLRSAT..
A6TI50_KLEP7/6-326------.VITH--....RV..HDEILQLLAP......HC.ELVTNQT..DSTLTRE..EILRRCRD..AQAMMAFMPD..
B0JPW3_MICAN/19-330------.LLIG--....KM.YDEAGQKLLEE......ST.NTEILS.....NPTLD..KINEAIQE..VSGVFVRYPN..
G1UB05_LACJO/8-330------.....--....AI..RKDEEPFLNEWKDAHKDI.EVEYTD.....KLLAP..ETAKLAKG..ADGVVVYQQL..
N0B2T1_9RHIZ/6-319------ILITW--....PL..PEAAMARARA......SY.DVIAHGD..NPRITID..ELLETAKS..VDALLITLNE..
O25158_HELPY/4-314------VAICD--....PI..HAKGIQILEA.......QKDIVLHDY...SKCPKK..ELLEKLTP..MDALITRSMT..
SERA_ECOLI/14-326------.LLVE--....GV..HQKALESLRA.....AGYTNIEFHK....GALDDE..QLKESIRD..AHFIGLRSRT..
GHRB_ECOLI/5-319------VILYK--....AL..PDDLLQRLQE.........HFTVHQVANLSPQTVE..QNAAIFAE..AEGLLGSNEN..
Q03CR3_LACC3/8-328------.....--....A...RVDEIQYFKQW..AKDTGNTLEYHT.....EFLDE..NTVEWAKG..FDGINSLQIT..
Q03VC9_LEUMM/6-329------...Y.--....GI..RDDEKPSLEEWKAANPEI.EVDYTQ.....ELLTP..ETAKLAEG..SDSAVVYQQL..
Q1GAA2_LACDA/5-332------.AMYN--.....V..SPIEVPYIEDWA.KKNDV.EIKTTD.....QALTS..ATVDLAEG..CSSVSLKPLG..
Q2FV62_STAA8/9-332------.....--.....V..RDEDMPYIKAW..AEKHHVEVDITK.....EALTD..DNVEGVAG..YDGLSLSQQI..
Y2577_STAA8/5-317------.YVAG--....AI..PEVGLKLLQE.......HFEVEMYEG..KGLVDKD..TLIKGVKN..ATALISLLST..
Q2FXK1_STAA8/6-315------VLVAD--....PI..SKDGIKALLD....HEQF.NVDIQT.....GLSEE..ALIKIIPS..YHALIVRSQT..
Q7W0H7_BORPE/11-324------IVLFE--....NI..HPSARAVFSA.....AGYTDIVAHA....AALPSG..ELREALRG..AEVVGIRSRT..
LDHD_LACPL/6-329------...Y.--....AV..RDDERPFFDTWMKENPDV.EVKLVP.....ELLTE..DNVDLAKG..FDGADVYQQK..

PF05222

Q3A7G8_PELCD/4-137--------------------------------------------------------------------------------
NNTM_BOVIN/60-199--------------------------------------------------------------------------------
Q0VPX1_ALCBS/24-165--------------------------------------------------------------------------------
Q3J1C2_RHOS4/4-139--------------------------------------------------------------------------------
LYS1_ASHGO/6-141--------------------------------------------------------------------------------
Q28V87_JANSC/4-137--------------------------------------------------------------------------------
Q2G7Q1_NOVAD/4-137--------------------------------------------------------------------------------
Q6AQV0_DESPS/4-137--------------------------------------------------------------------------------
Q82QU1_STRAW/15-145--------------------------------------------------------------------------------
Q3B540_PELLD/4-135--------------------------------------------------------------------------------
DHA_OCEIH/4-136--------------------------------------------------------------------------------
Q0S884_RHOSR/4-137--------------------------------------------------------------------------------
A0KQF4_AERHH/4-135--------------------------------------------------------------------------------
Q9KAF8_BACHD/4-136--------------------------------------------------------------------------------
A6VXM0_MARMS/6-147--------------------------------------------------------------------------------
Q3JE74_NITOC/4-136--------------------------------------------------------------------------------
B1YFJ0_EXIS2/4-136--------------------------------------------------------------------------------
A5GEE8_GEOUR/4-135--------------------------------------------------------------------------------
A5FP13_FLAJ1/4-137--------------------------------------------------------------------------------
Q98CE6_RHILO/6-139--------------------------------------------------------------------------------
Q31MC9_SYNE7/4-136--------------------------------------------------------------------------------
Q6NYQ7_DANRE/56-195--------------------------------------------------------------------------------
Q5KHJ2_CRYNJ/22-157--------------------------------------------------------------------------------
Q2IDX0_ANADE/4-138--------------------------------------------------------------------------------
Q21L93_SACD2/6-141--------------------------------------------------------------------------------
A0QNT0_MYCS2/5-135--------------------------------------------------------------------------------
Q1GUI4_SPHAL/4-138--------------------------------------------------------------------------------
Q0AQT6_MARMM/4-137--------------------------------------------------------------------------------
Q18031_CAEEL/32-165--------------------------------------------------------------------------------
Q47E46_DECAR/4-137--------------------------------------------------------------------------------
Q39WN5_GEOMG/4-135--------------------------------------------------------------------------------
Q3SL22_THIDA/4-136--------------------------------------------------------------------------------
Q6W1Y1_RHISN/6-139--------------------------------------------------------------------------------
Q67ND6_SYMTH/4-137--------------------------------------------------------------------------------
Q5SLT7_THET8/5-139--------------------------------------------------------------------------------
A0KEW0_AERHH/4-137--------------------------------------------------------------------------------
Q47BC9_DECAR/6-139--------------------------------------------------------------------------------
Q8DL05_THEEB/4-139--------------------------------------------------------------------------------
Q28M63_JANSC/4-139--------------------------------------------------------------------------------
Q2RN15_RHORT/4-137--------------------------------------------------------------------------------
Q0C3J7_HYPNA/4-137--------------------------------------------------------------------------------
Q2S445_SALRD/35-169--------------------------------------------------------------------------------
A1SSF5_PSYIN/4-138--------------------------------------------------------------------------------
Q5Z133_NOCFA/18-148--------------------------------------------------------------------------------
Q5WJZ9_BACSK/4-136--------------------------------------------------------------------------------
A0L9H7_MAGSM/4-145--------------------------------------------------------------------------------
Q6W1J9_RHISN/4-139--------------------------------------------------------------------------------
PNTA_HAEIN/4-137--------------------------------------------------------------------------------
Q6AEY9_LEIXX/4-137--------------------------------------------------------------------------------
Q6ACH0_LEIXX/6-139--------------------------------------------------------------------------------
A8GEZ6_SERP5/4-137--------------------------------------------------------------------------------
Q5LFH6_BACFN/4-137--------------------------------------------------------------------------------
A5FFU7_FLAJ1/32-165--------------------------------------------------------------------------------
A0K2E1_ARTS2/12-145--------------------------------------------------------------------------------
A0QNN8_MYCS2/4-137--------------------------------------------------------------------------------
Q5YZC0_NOCFA/4-137--------------------------------------------------------------------------------
P72775_SYNY3/4-136--------------------------------------------------------------------------------
Q603N5_METCA/4-139--------------------------------------------------------------------------------
Q2N774_ERYLH/4-137--------------------------------------------------------------------------------
Q1J0B1_DEIGD/4-135--------------------------------------------------------------------------------
Q2HFZ2_CHAGB/7-141--------------------------------------------------------------------------------
LYS1_YEAST/7-142--------------------------------------------------------------------------------
Q5LPM8_RUEPO/4-139--------------------------------------------------------------------------------
Q65CX6_BACLD/4-136--------------------------------------------------------------------------------
Q1QUL9_CHRSD/4-139--------------------------------------------------------------------------------
Q2J8T8_FRASC/7-142--------------------------------------------------------------------------------
A4Y0R2_PSEMY/4-136--------------------------------------------------------------------------------
Q11TK3_CYTH3/4-137--------------------------------------------------------------------------------
A0CWD3_PARTE/29-161--------------------------------------------------------------------------------
Q2SHR3_HAHCH/4-137--------------------------------------------------------------------------------
A6VN40_ACTSZ/4-137--------------------------------------------------------------------------------
A8ZXI3_DESOH/4-137--------------------------------------------------------------------------------
A5FVY5_ACICJ/4-137--------------------------------------------------------------------------------
Q8DQ43_STRR6/4-136--------------------------------------------------------------------------------
Q9K827_BACHD/4-136--------------------------------------------------------------------------------
Q5CI32_CRYHO/405-540--------------------------------------------------------------------------------
Q0SD61_RHOSR/4-134--------------------------------------------------------------------------------
Q11PQ8_CYTH3/7-139--------------------------------------------------------------------------------
Q2NSW2_SODGM/4-137--------------------------------------------------------------------------------
Q8DH53_THEEB/4-139--------------------------------------------------------------------------------
Q2W3E7_MAGSA/6-142--------------------------------------------------------------------------------
A0L3P1_MAGSM/4-137--------------------------------------------------------------------------------
Q0A4X6_ALKEH/6-139--------------------------------------------------------------------------------
Q6MKC3_BDEBA/4-137--------------------------------------------------------------------------------
Q2LSK0_SYNAS/44-177--------------------------------------------------------------------------------
Q163M5_ROSDO/4-139--------------------------------------------------------------------------------
A9CHR5_AGRT5/4-139--------------------------------------------------------------------------------
Q74AR0_GEOSL/4-135--------------------------------------------------------------------------------
Q3B571_PELLD/35-169--------------------------------------------------------------------------------
Q6A5I3_PROAC/4-137--------------------------------------------------------------------------------
Q54P64_DICDI/8-138--------------------------------------------------------------------------------
B4S6Q3_PROA2/35-169--------------------------------------------------------------------------------
Q0ALL0_MARMM/4-137--------------------------------------------------------------------------------
Q2VYN4_MAGSA/13-146--------------------------------------------------------------------------------
Q1AS10_RUBXD/6-139--------------------------------------------------------------------------------
Q82M72_STRAW/7-141--------------------------------------------------------------------------------
Q7VB57_PROMA/5-141--------------------------------------------------------------------------------
Q1GL71_RUEST/4-137--------------------------------------------------------------------------------
Q10ZM3_TRIEI/4-136--------------------------------------------------------------------------------
A0JVY4_ARTS2/5-137--------------------------------------------------------------------------------
Q15T10_PSEA6/4-137--------------------------------------------------------------------------------
Q5FU53_GLUOX/6-140--------------------------------------------------------------------------------
A2E4I0_TRIVA/4-138--------------------------------------------------------------------------------
Q0SAT6_RHOSR/4-137--------------------------------------------------------------------------------
DHA_BACSU/4-135--------------------------------------------------------------------------------
Q2YIM6_BRUA2/6-139--------------------------------------------------------------------------------
B9M3R5_GEODF/4-135--------------------------------------------------------------------------------
Q5SLS7_THET8/4-135--------------------------------------------------------------------------------
Q6MUG7_MYCMS/10-140--------------------------------------------------------------------------------
Q21RZ9_ALBFT/27-163--------------------------------------------------------------------------------
Q0K0H4_CUPNH/6-146--------------------------------------------------------------------------------
Q47FY5_DECAR/6-139--------------------------------------------------------------------------------
A1SJK7_NOCSJ/4-137--------------------------------------------------------------------------------
Q7UIW1_RHOBA/5-140--------------------------------------------------------------------------------
LYS1_SCHPO/7-142--------------------------------------------------------------------------------
Q3JEF4_NITOC/4-145--------------------------------------------------------------------------------
A1WCT5_ACISJ/4-136--------------------------------------------------------------------------------
O25948_HELPY/4-135--------------------------------------------------------------------------------
A1C559_ASPCL/85-224--------------------------------------------------------------------------------
Q55F30_DICDI/135-275--------------------------------------------------------------------------------
Q2G790_NOVAD/8-140--------------------------------------------------------------------------------
Q7NWG7_CHRVO/4-137--------------------------------------------------------------------------------
Q1GKH6_RUEST/5-139--------------------------------------------------------------------------------
Q1GVP3_SPHAL/4-137--------------------------------------------------------------------------------
A1K465_AZOSB/6-138--------------------------------------------------------------------------------
A5FAH7_FLAJ1/4-136--------------------------------------------------------------------------------
Q6KIJ0_MYCMO/4-134--------------------------------------------------------------------------------
Q8EPC2_OCEIH/4-136--------------------------------------------------------------------------------
Q1ARY0_RUBXD/7-141--------------------------------------------------------------------------------
Q6LMW4_PHOPR/33-171--------------------------------------------------------------------------------
A5G0H4_ACICJ/5-140--------------------------------------------------------------------------------
A5V5I3_SPHWW/4-142--------------------------------------------------------------------------------
Q7NEB1_GLOVI/4-136--------------------------------------------------------------------------------
Q60BB4_METCA/4-135--------------------------------------------------------------------------------
A1TXK5_MARAV/4-139--------------------------------------------------------------------------------
Q1IIW3_KORVE/4-145--------------------------------------------------------------------------------
A7HTE3_PARL1/4-137--------------------------------------------------------------------------------
Q3APE7_CHLCH/6-140--------------------------------------------------------------------------------
Q5P1Y9_AROAE/6-139--------------------------------------------------------------------------------
Q8KEI3_CHLTE/17-148--------------------------------------------------------------------------------
Q2S0H0_SALRD/6-141--------------------------------------------------------------------------------
A8LIC1_DINSH/19-154--------------------------------------------------------------------------------
A0LWI4_ACIC1/4-137--------------------------------------------------------------------------------
Q21M61_SACD2/4-145--------------------------------------------------------------------------------
Q0KA62_CUPNH/4-137--------------------------------------------------------------------------------
A1CKS0_ASPCL/7-145--------------------------------------------------------------------------------
A0LUF0_ACIC1/4-137--------------------------------------------------------------------------------
Q484K1_COLP3/4-137--------------------------------------------------------------------------------
Q7UXF1_RHOBA/4-137--------------------------------------------------------------------------------
Q6MB39_PARUW/4-136--------------------------------------------------------------------------------
Q2UAA6_ASPOR/84-217--------------------------------------------------------------------------------
A0DTI6_PARTE/7-138--------------------------------------------------------------------------------
A1WZC8_HALHL/6-141--------------------------------------------------------------------------------
Q480P6_COLP3/4-137--------------------------------------------------------------------------------
Q4P6J5_USTMA/9-143--------------------------------------------------------------------------------
Q8G5Z4_BIFLO/12-147--------------------------------------------------------------------------------
O44503_CAEEL/33-163--------------------------------------------------------------------------------
A7IGP9_XANP2/4-139--------------------------------------------------------------------------------
Q3IZY5_RHOS4/4-137--------------------------------------------------------------------------------
Q13HL5_BURXL/6-139--------------------------------------------------------------------------------
Q6AA35_PROAC/43-176--------------------------------------------------------------------------------
Q16LL0_AEDAE/57-190--------------------------------------------------------------------------------
B3E8N4_GEOLS/4-135--------------------------------------------------------------------------------
B2UC87_RALPJ/4-136--------------------------------------------------------------------------------
Q829A4_STRAW/4-137--------------------------------------------------------------------------------
Q5R0B7_IDILO/4-137--------------------------------------------------------------------------------
Q2Y9W7_NITMU/4-139--------------------------------------------------------------------------------
Q2Y9W3_NITMU/6-138--------------------------------------------------------------------------------
B3EKT2_CHLPB/35-169--------------------------------------------------------------------------------
A0ZAH3_NODSP/4-137--------------------------------------------------------------------------------
A4SZU6_POLSQ/4-136--------------------------------------------------------------------------------
Q0U4J1_PHANO/7-146--------------------------------------------------------------------------------
A1B5J9_PARDP/5-139--------------------------------------------------------------------------------
Q6F836_ACIAD/4-136--------------------------------------------------------------------------------
Q0SGE0_RHOSR/15-145--------------------------------------------------------------------------------
Q6ANB3_DESPS/4-131--------------------------------------------------------------------------------
Q2SNB3_HAHCH/4-137--------------------------------------------------------------------------------
A1BEU6_CHLPD/35-169--------------------------------------------------------------------------------
Q2JLS3_SYNJB/4-136--------------------------------------------------------------------------------
Q01VE2_SOLUE/4-138--------------------------------------------------------------------------------
A0JVR6_ARTS2/4-136--------------------------------------------------------------------------------
Q7N4Z3_PHOLL/4-137--------------------------------------------------------------------------------
O04709_MAIZE/19-156--------------------------------------------------------------------------------
A8ZX21_DESOH/4-137--------------------------------------------------------------------------------
Q021N9_SOLUE/6-147--------------------------------------------------------------------------------
Q3IYW2_RHOS4/5-139--------------------------------------------------------------------------------
Q3AEB3_CARHZ/4-137--------------------------------------------------------------------------------
A1BEX7_CHLPD/4-135--------------------------------------------------------------------------------
LYS1_YARLI/8-142--------------------------------------------------------------------------------
Q5SIC7_THET8/4-139--------------------------------------------------------------------------------
Q1GIS5_RUEST/4-139--------------------------------------------------------------------------------
B2JGI7_BURP8/4-136--------------------------------------------------------------------------------
Q1AW21_RUBXD/4-137--------------------------------------------------------------------------------
B4SD94_PELPB/35-169--------------------------------------------------------------------------------
Q16C99_ROSDO/5-139--------------------------------------------------------------------------------
A6WFF9_KINRD/4-137--------------------------------------------------------------------------------
A1B9C0_PARDP/4-139--------------------------------------------------------------------------------
A3QAN8_SHELP/4-140--------------------------------------------------------------------------------
Q8XRA9_RALSO/4-136--------------------------------------------------------------------------------
A0LMX7_SYNFM/4-137--------------------------------------------------------------------------------
Q47RB8_THEFY/4-137--------------------------------------------------------------------------------
B2JLD8_BURP8/4-137--------------------------------------------------------------------------------
Q128A6_POLSJ/4-137--------------------------------------------------------------------------------
Q7P1W1_CHRVO/4-138--------------------------------------------------------------------------------
Q8KEN6_CHLTE/6-140--------------------------------------------------------------------------------
Q2IJQ2_ANADE/4-137--------------------------------------------------------------------------------
A4SWM0_POLSQ/4-137--------------------------------------------------------------------------------
A0ZDC5_NODSP/19-159--------------------------------------------------------------------------------
A1VTW8_POLNA/4-136--------------------------------------------------------------------------------
A9BR27_DELAS/4-136--------------------------------------------------------------------------------
A6VWR5_MARMS/6-139--------------------------------------------------------------------------------
A4XPH7_PSEMY/4-137--------------------------------------------------------------------------------
Q1QT97_CHRSD/4-137--------------------------------------------------------------------------------
B0SVI3_CAUSK/5-140--------------------------------------------------------------------------------
Q1WRC5_LACS1/4-135--------------------------------------------------------------------------------
B0T233_CAUSK/4-137--------------------------------------------------------------------------------
Q28K30_JANSC/4-138--------------------------------------------------------------------------------
A5V806_SPHWW/4-137--------------------------------------------------------------------------------
Q31MS7_SYNE7/28-167--------------------------------------------------------------------------------
Q03RI6_LACBA/4-135--------------------------------------------------------------------------------
A4J8G7_DESRM/4-137--------------------------------------------------------------------------------
Q5KUA3_GEOKA/4-136--------------------------------------------------------------------------------
Q11IF1_CHESB/4-137--------------------------------------------------------------------------------
P73496_SYNY3/23-158--------------------------------------------------------------------------------
Q15PN0_PSEA6/5-140--------------------------------------------------------------------------------
Q7VV14_BORPE/4-136--------------------------------------------------------------------------------
Q12QQ7_SHEDO/4-145--------------------------------------------------------------------------------
A7HUT9_PARL1/4-139--------------------------------------------------------------------------------
Q03HP9_PEDPA/4-134--------------------------------------------------------------------------------
Q5DZZ0_VIBF1/4-143--------------------------------------------------------------------------------
Q01VQ6_SOLUE/4-137--------------------------------------------------------------------------------
Q7VA67_PROMA/14-145--------------------------------------------------------------------------------
Q10VQ6_TRIEI/4-139--------------------------------------------------------------------------------
A0M2A6_GRAFK/33-166--------------------------------------------------------------------------------
C1DKG5_AZOVD/4-137--------------------------------------------------------------------------------
A1A1C3_BIFAA/12-147--------------------------------------------------------------------------------
Q11SC0_CYTH3/13-146--------------------------------------------------------------------------------
A8LLI3_DINSH/4-137--------------------------------------------------------------------------------
Q11EJ3_CHESB/6-139--------------------------------------------------------------------------------
A4X685_SALTO/4-137--------------------------------------------------------------------------------
B1WS00_CYAA5/5-144--------------------------------------------------------------------------------
B2FPZ7_STRMK/9-139--------------------------------------------------------------------------------
B2HKV6_MYCMM/4-137--------------------------------------------------------------------------------
B2HLU5_MYCMM/9-139--------------------------------------------------------------------------------
B4EIC9_BURCJ/4-137--------------------------------------------------------------------------------
B4HYA5_DROSE/26-155--------------------------------------------------------------------------------
B9RR16_RICCO/8-144--------------------------------------------------------------------------------
D0IWI5_COMT2/2-128--------------------------------------------------------------------------------
D4ZJ19_SHEVD/4-142--------------------------------------------------------------------------------
F7QES8_9BRAD/5-136--------------------------------------------------------------------------------
G0FKF9_AMYMS/4-137--------------------------------------------------------------------------------
H3CUQ7_TETNG/61-200--------------------------------------------------------------------------------
H3CVX4_TETNG/53-186--------------------------------------------------------------------------------
H3CYI7_TETNG/31-160--------------------------------------------------------------------------------
H7C6H0_BRADU/4-137--------------------------------------------------------------------------------
K4PU16_SHEON/4-137--------------------------------------------------------------------------------
Q036E3_LACC3/4-134--------------------------------------------------------------------------------
Q1D4V2_MYXXD/4-138--------------------------------------------------------------------------------
Q24858_ENTHI/568-702--------------------------------------------------------------------------------
Q24YW8_DESHY/4-137--------------------------------------------------------------------------------
DHA2_STAA8/4-136--------------------------------------------------------------------------------
DHA1_STAA8/5-134--------------------------------------------------------------------------------
Q2K468_RHIEC/46-178--------------------------------------------------------------------------------
PNTAA_RHORT/4-144--------------------------------------------------------------------------------
Q46JT2_PROMT/6-141--------------------------------------------------------------------------------
Q4FMG2_PELUB/4-137--------------------------------------------------------------------------------
Q4FU92_PSYA2/10-139--------------------------------------------------------------------------------
Q59P14_CANAL/10-144--------------------------------------------------------------------------------
Q5F6S7_NEIG1/4-136--------------------------------------------------------------------------------
Q5ZX09_LEGPH/4-137--------------------------------------------------------------------------------
Q63QY7_BURPS/4-136--------------------------------------------------------------------------------
Q6LIA6_PHOPR/6-139--------------------------------------------------------------------------------
Q6LIV6_PHOPR/4-143--------------------------------------------------------------------------------
Q6LQ29_PHOPR/6-139--------------------------------------------------------------------------------
DHA_METMP/4-137--------------------------------------------------------------------------------
Q72EK7_DESVH/4-137--------------------------------------------------------------------------------
Q7RV12_NEUCR/120-256--------------------------------------------------------------------------------
Q7V5T2_PROMM/14-145--------------------------------------------------------------------------------
Q81VA6_BACAN/4-136--------------------------------------------------------------------------------
Q87QP6_VIBPA/4-137--------------------------------------------------------------------------------
Q8Y6V2_LISMO/4-136--------------------------------------------------------------------------------
Q92LZ7_RHIME/7-139--------------------------------------------------------------------------------
AASS_MOUSE/28-157--------------------------------------------------------------------------------
Q9KM26_VIBCH/4-137--------------------------------------------------------------------------------
X2GRC3_9BACI/4-136--------------------------------------------------------------------------------

PF05221

E6S782_INTC7/4-477STQDEAAAAV-VVGPH...GTPEDP--QGVPVFAWKGETLEEYWWCTEQALT.........WP.....GDG.......GP
A0JU72_ARTS2/4-491STQDEAAAAV-VVGN....GTVEDP--QGVPVFAWKGETLEEYWWTAEQILT.........WPGADSNPDL.......GP
D6Y6B5_THEBD/2-474STQDHAAAAV-VVGPN...GTPDNP--QGVPVFAWKGETLEEYWWCIEQIFR.........WP.....DGS.......GP
D1BWJ6_XYLCX/10-497STQDEAAAAI-AVGPH...GTPEDP--QGIPVFAWKGESLEEYWDCTEQILL.........WPA....ADGGFR....GP
F6FRM5_ISOV2/23-520STQDEAAAAV-VVGPH...GTPEDP--RGVPVFAWKGETLEEYWDCTEQILV.........WPG....EESETR....GP
E4NC13_KITSK/8-481STQDHAAAAI-AVGPN...GTPEDP--QGVPVFAWKGETLEEYWWCTEQALS.........WP.....DGQ.......TP
D7B5R0_NOCDD/4-477STQDHAAAAV-VVGPD...GTAEDP--KGVPVFAWKGETLEEYWWCTEQALT.........WP.....GAE.......GP
R4LG47_9ACTO/12-485STQDEAAAAV-VVGTE...GTAEAP--QGVSVFAWKGETLEEYWWCTEQLFD.........FG.....DGR.......GP
A4X3J2_SALTO/22-495STQDHAAAAV-VVGPE...GSPEAL--AGVPVFAWKGESLEEYWWCTEQALT.........WP.....GDE.......GP
C5C1M6_BEUC1/15-511STQDEAAAAV-VVGRPETGGTPDDP--RGTPVFAWKGESLAEYWECTEAILA.........WPS....ASDGTG....GP
F4CRV7_PSEUX/22-502STQDHAAAAT-VVGPT...GTPEAP--AGVPVFAWKGETLEEYWWCTEQLFA.........FRD....ENGAVV....GP
K0KB99_SACES/13-486STQDHAAAAV-VVGPH...GTPEEP--QGVPVFAWKGETLEEYWWTAESMLT.........WP.....DGG.......GP
A0LS32_ACIC1/2-475STQDHAAAAV-VVGPD...GTPDQP--RGVPVFAWKGETIEEYWWCTEQALR.........WP.....DGD.......GP
F6EFW8_AMYSD/14-489STQDHAAAAI-VVGPY...GTPEDP--QGVPVYAWKGETLEEYWWCTEKALT.........WP.....DEA.......GP
C7MUK9_SACVD/12-484STQDEAAAAV-VVGRN...GTPDKP--EGVPVFAWKGETLEEYWWCTDQIFR.........FD......GE.......GP
A4FNJ5_SACEN/13-486STDDSAAAAV-VVGPH...GTPDEP--RGVPVFAWKGETLEEYWWCTERMLT.........WP.....GEA.......GP
F5XQ99_MICPN/10-486STQDHAAAAV-VVGPD...GTPERP--AGVPVFAWKGETIEDYWWCSERILV.........WP.....DGE.......FA
SAHH_MYCMM/17-491STQDHAAAAV-VVGPH...GTPEEP--KGVPVFAWKGESLEEYWWCAEQMLT.........WP.....DSD.......KP
R4T8V2_AMYOR/12-490STQDEAAAAV-VVGPN...GTVENP--SGSSVFAWKGETLAEYWWCTDQLFD.........FG.....DGR.......VP
J9SDU9_9ACTO/17-488STQDHAAAAI-VVGPN...GTPEEP--KGVPVFAWKGETLEEYWWAAEEMLT.........W.......PG.......EP
F4H4D2_CELFA/46-530STQDEAAAAV-VVGPD...GTHARP--AGPAVFAWKGETLEEYWECTRQALL.........WP.....DGG.......GP
C7QZI2_JONDD/10-493STQDEAAAAI-AVGPT...GTPDNP--SGVPVFAWKGETLSEYWDCTEQIMT.........WRD....DHGHLT....GP
A1SGL1_NOCSJ/2-475STQDHAAAAI-AVGPN...GTADDP--QGVPVFAWKGETLEEYWWCTQQILD.........WP.....GGT.......MP
A6WER2_KINRD/4-486STQDQAAAAV-VVGS....GTVEEP--AGVPVFAWKGETLEEYWALADRIFD.........WGT...DAEGHRI....GP
I4F357_MODMB/14-493STQDHAAAAI-VVGE....GTAEEP--TGVPVFAWKGETLPEYWWCTQRLFE.........FTD....DDGDVI....GP
C8XJI5_NAKMY/22-497STQDHAAAAV-VVGKY...GTVEEP--KGTPVFAWKGETLPEYWWCTEQMLR.........WP.....DGQ.......GP
I6X351_PROPF/4-475STQDHAAAAV-VVGPD...GTPEDP--RGVPVFAWKGETLQEYWWCTRQILD.........WP.....GET.......NP
M5A353_9ACTN/11-489STQDHAAAAV-VVGPN...GTVDEP--AGVPVYAWKGETLEEYWWCTDQMMT.........WPDA..ADGTTYD....GP
W0RH07_9BACT/19-492STQDHAAAAV-AVGPN...GTPENP--QGTPVFAWKGETLEEYWWCTEQALM.........WP.....DGS.......GP
SAHH_COREF/6-477STQDEAAAAI-VVGD....GTPEDP--QGVPVFAWKGETLDEYWWCINQIFS.........WE.....GEL........P
E2SDU6_9ACTO/5-482STQDHAAAAV-VVGRD...GTAADP--KGTPVFAWKGETLAEYWDEAEKVFA.........FTD....DQGAAC....GP
X5E7G5_9CORY/23-501STQDEAAAAV-VVGA....GTPENP--QGVPVFAWKGETLDEYWWCLEQIFD.........WG.....DTR........P
G0HF72_CORVD/28-503STQDEAAASV-VVGS....GTPETP--TGVPVFAWKGETLDEYWWCLEQVFD.........WG.....DDK........P
A7H6N3_ANADF/19-492STQDHAAAAV-VVGRG...GTPDAP--RGVPVFAWKGETLEEYWDCTERALD.........FG.....GGK.......GP
D9SB20_FIBSS/15-498STQDNAAAAV-VVGKN...GSVSNP--QGVPVFAWKGESLEEYWENTARALV.........WP.....DGK.......TA
L0GYM4_9GAMM/6-467STQDHAAAAI-A...........AA--.GTPVFAWKGETLEEYWWCTEQAL..........S.......WPDGA....GP
B9S9Y6_RICCO/13-484STQDHAAAAI-A...........RD--.SAAVFAWKGETLQEYWWCTERALD.........WG.....PGG.......GP
S6BUQ9_9GAMM/6-466STQDHAAAAI-A...........AT--.GIPVYAWKGETLEEYWWCTEQVL..........N.......WPDGK....GP
K0C944_CYCSP/5-466STQDHAAAAI-A...........DL--.NIPVFAWKGETIEEYWWCTEQMM..........T.......WPEGQ....EA
E6WQA4_PSEUU/13-480STQDHAAAAI-A...........AT--.GTPVFAWKGETLEEYWDCTLDALT.........FT......LPDGTL..TGP
H3G8U2_PHYRM/6-480STQDHAAAAI-A...........RD--GAAAVFAWKGETLEEYWECTLNAIT.........WPSD.DGKGD.......GP
A8IXE0_CHLRE/12-482STQDHAAAAI-A...........RD--.SAAVFAWKGETLEEYWWCTEQALT.........WA.....GCD.......GP
X5DXZ4_9BACT/10-471STQDHAAAAI-A...........KA--.GVPVFAWKGETLEEYWWCTREAMS.........F........PDGK....GP
R7L6X2_9BACT/8-471STQDHAAAAI-A...........KA--.GIPVFAWKGESLEEYWECTYKALT.........W........NDGK....GP
B4S716_PROA2/10-471STQDHAAAAI-A...........AA--.GVPVFAWKGETLEEYWWCTRQALA.........F........DGGK....GP
I4BAF3_TURPD/15-478STQDHAAAAI-A...........KA--.GIPVFAWKGETLEEYWWCTEQALT.........W........PDGS....GP
F0VM57_NEOCL/4-476STQDHAAAAI-V...........KS--NSASVFAWKGETLEEYWWCTVMALT.........WP.....DAA.......GP
D5EQ42_CORAD/10-478STQDHAAAYV-A...........KH--LEVPVFAWKGETLEDYWWCTEQALT.........W........PDGS....GP
C7LQI3_DESBD/10-472STQDHAAAAV-V...........AE--GLAKVFAWKGETLEDYWWCTEMALT.........W........PDGT....GP
F3YYZ8_DESAF/11-474STQDDAAAAI-A...........AA--GTAAVFAWKGENLEEYWWCTEQALT.........W........PDGG....GP
D4H862_DENA2/6-469STQDHAAAAI-A...........AT--.GVPVFAWKGESLEEYWWCTEQALR.........F........PDGK....GP
F8E7L7_FLESM/7-469STQDHAAAAI-A...........EA--.GIPVFAWKGETLEEYWWCTEQALS.........F........E.DG....GP
C8X588_DESRD/10-472STQDHAAAAI-A...........EA--GTAKVFAWKGETLEEYWWCTEQALT.........W........PDGS....GP
G8NVU2_GRAMM/12-476STQDHAAAAI-A...........AA--.GVPVFAWKGETLEEYWWCTDQALR.........H........EGGL....GP
E4TFL4_CALNY/3-466STQDHAAAAI-A...........KA--.GVPVFAWKGETLEEYWWCIEQALT.........F........PGGK....GP
SAHH_DESAD/9-471STQDHAAAAI-A...........AN--GTAKVFAWKGETLEEYWWCTEQALT.........W........PDGS....GP
G0GAZ7_SPITZ/7-470STQDHAAAAV-A...........KA--.GIPVYAWKGETLEEYWECTLNALT.........F........PDGG....GP
B0VFI4_CLOAI/2-465STQDNAAAAI-A...........KR--.GIPVFAWKGETLNDYWWCTLQALS.........W........E..E....GP
SAHH_DESAG/15-478STQDHAAAAI-A...........DS--GMAKVFAWKGETLEEYWWCTEMALT.........W........PDGS....GP
H8L337_FRAAD/12-476STQDDVAAAL-A...........AD--.GLPVFAWKGESLEEYWDCTLDMLT.........H........PGEL....GP
A0BCF6_PARTE/5-476STQDHAAAAI-A...........QA--KSAAVFAWKGETLLEYWECTVRALD.........WG.....NGQ.......GP
M4NS42_9GAMM/11-478STQDHAAAAI-A...........AT--.GTPVFAWKGETLEEYWDCTLDALS.........F........PDGKGGFLGP
T2GAN7_DESGI/2-464STQDHAAAAV-A...........KA--GISKVFAWKGETLEDYWWCTEMALT.........W........PDGS....GP
D7G8Q4_ECTSI/5-478STQDHAAAAI-A...........RD--ESAAVFAWKGESLEEYWECTLSALT.........WPEA.DDKGT.......GP
SAHH_PELCD/9-474STQDHAAAAI-A...........AT--.GVPVFAYKGETLEEYWEYTFKALA.........Y........E..E....GP
D0LJJ9_HALO1/23-511STQDHAAAAV-AVGPT...GTVATP--AGIPVFAWKGETLPEYWWCTFQALC.........W........PDGS....GP
F0XY15_AURAN/5-479STQDHAAAAI-A...........RD--ESAAVFAWKGETLEEYWECTMNAIT.........WTSP.DAKGD.......GP
C5K5D1_PERM5/3-480STQDHAAAAI-A...........KA--GSANVYAWKGETLEEYWWCTEQALT.........WP.....HAD.......GP
SAHH_METCA/12-471STQDHAAAAI-A...........AD--.GIPVFAYKGESLDDYWEYTHRIL..........E.......WPGDV....GP
B7FT14_PHATC/5-480STQDHAAAAI-A...........RD--ESAAVFAWKGESLEEYWECTLNAIT.........WPED.DGKGC.......GP
W0IVC4_9BACT/19-482STQDHAAAAI-A...........AT--.GVPVFAWKGETLEEYWDLTWRALS.........F........PGGQ....GP
D7E778_METEZ/5-466STQDEAAAAI-A...........AE--.GIPVFAWKGETVDEYWWCTKQALT.........W........SDGK....GP
C4LU18_ENTHI/5-465STQDHAAAAI-V...........QA--.GVPVFAWKGETVQEYWECTLKALK.........FG.....ENQ.......GP
B2UR10_AKKM8/7-470STQDHAAAAI-A...........KS--.GTPVFAWKGETLREYWDCTWKAMN.........F........PDGL....GP
D5MJ17_9BACT/14-479STQDHAAAAI-A...........VA--.GVPVFAWKGETLEEYWDCTFRALV.........H........PGKHGEVLGP
E1QFH0_DESB2/14-475STQDHAAAAI-A...........AA--.GVPVFAWKGETLEEYWWCTMQALT.........W........PDGQ....GP
D6Z0B0_DESAT/10-434STQDQAAAAM-V...........AA--.GIPTFAWKGENEEEFWWCIEQTI..........T.......GPDGW....RP
F4GUC2_PUSST/14-474STQDHAAAAI-A...........AG--.GTPVFAIKGETLEDYWNYTHQIF..........E.......WPNGQ....HA
SAHH_LEPIN/11-435STQDHAAAAI-A...........KA--.GIPVFAWKGETEEEYWWCIEQTIF.........F........G..D...KGP
B4RBP7_PHEZH/3-462STQDHAAAAI-A...........VK--.GTPVFAIKGETLIEYWEYAHRIF..........E.......WADGG....YP
C1EH64_MICSR/17-486STQDHAAAAV-A...........RD--.SAAVFAWKGETLEEYWWCTDKMLD.........W.......GS.......EP
D5BW57_NITHN/12-436STQDHAAAAI-A...........AK--.GIPVFAWKGETEEEYWWCVDQTI..........H.......GPNGW....QP
E1WZA8_BACMS/5-430STQDHAAAAM-A...........AA--.GIPVFAWKGLTEEEFDWCIEKTL..........K.......WADGS....AL
V6F3C0_9PROT/3-464STQDHAAAAI-A...........EA--.GIPVFAVKGESLEEYWDYTHRIF..........E.......WADGG....CP
Q2L174_BORA1/11-472STQDHAAAAI-A...........AT--.GTPVFAVKGETLEEYWQYTHKIF..........E.......WPQDR....HA
A9GFA1_SORC5/8-437STQDHAAAAI-A...........AA--.GIPVFAWKGETLEEYDWCIEQQLYA......FKG........G..K....GP
D2W1E4_NAEGR/11-472STQDDAAAAI-A...........AA--.NIPVFAWKGETLVEYWECTWKALK.........F.......GP..N...MGP
B1ZZ56_OPITP/11-473STQDHAAAAI-A...........KA--.GVPVFAWKGETLEEYWDMTLNAIS.........F........PGGK....GP
W0BHF8_9GAMM/12-436STQDHAAAAM-A...........AV--.GVPVFAWKGETEEEYWWCVEQTL..........Q.......GPDGW....TP
S6AB36_9PROT/9-467STQDQAAAAI-A...........AT--.GVPVFAYKGESLEEYWEYTHNIF..........E.......WP.GE....SA
G7Z7L3_AZOL4/7-431STQDQAAAAI-A...........AA--.GIPVFAWKGETEEEFWWCIEQTL..........R.......GPDGW....TP
G4R9F7_PELHB/6-465STQDHAAAAI-A...........EA--.GIPVFAHKGETLAEYWDFADRIL..........D.......WGNGE....VA
E6W439_DESIS/5-431STQDHAAAAI-A...........AG--.NIPVFAWKGETEEEYWWCVHQTIQ.........G........PDGW....LP
A0LCX4_MAGSM/15-440STQDHAAAAI-A...........AA--.GVPVFAWKGETEEEYVWCVEQTI..........K.......GPDGW....VP
V5S8R2_9RHIZ/6-467STQDHAAAAI-A...........AA--.GIPVFAFKGETLKEYWAFTHKLF..........E.......WGDGG....TP
C7R7A8_KANKD/3-464STQDHAAAAI-A...........DQ--.GIPVFAYKGETLDEYWEYTHHIM..........E.......WHDGG....SP
W8L8P3_HALHR/11-470STQDHAAAAI-A...........AG--.GTPVFAYKGETLEEYWEYCHKIF..........E.......WSDGG....TP
SAHH_RHOCB/3-462STQDHAAAAI-A...........AG--.GTPVFAVKGETLEEYWAYTDKIF..........Q.......FPEGT.....C
I1XLP2_METNJ/11-435STQDHAAAAI-A...........DQ--.GIPVFAWKGETEEEAVWCIRQTI..........M.......GTDGW....RP
SAHH_RHILO/6-465STQDHAAAAI-A...........EA--.GIPVFAVKGESLEQYWDYTDRIF..........Q.......WADGG....LS
E3I6Z6_RHOVT/4-465STQDHAAAAI-A...........AR--.GTPVFAIKGETLDEYWDYVDRIL..........E.......WPNGE....TA
H6L1E3_SAPGL/8-437STQDQAAAAI-A...........AA--.GVPVFAWKGMTEEEYDWCLEQTLR........SF........KDGE....PL
D5BCE6_ZUNPS/5-432STQDQAAAAI-A...........EA--.GIPVYAWKGMTEEEFDWCIEQTL..........FF......GEDRK....PL
E8UEX5_TAYEM/4-465STQDHAAAAI-A...........ES--.GIPVFAVKGESLEEYWSYTHEIF..........N.......WSEDQ....GF
F8GKE5_NITSI/14-476STQDHAASAI-A...........AK--.NIPVFAYKGESLEDYWEYAHQIF..........EWTI..AGQPSGA......
Q0A6D2_ALKEH/11-469STQDHAAAAI-A...........AQ--.GIPVFAYKGETLDEYWDYCHRIF..........E.......FEGEP.....A
SAHH_MARMM/9-468STQDHAAAAI-A...........ET--.GVPVFATKGETLEEYWDYADAIF..........H.......WPDGE....TA
SAHH_HALHL/5-429STQDQAAAAV-A...........AN--.GTPVFAWKGETEEEYWWCIEQTI..........N.......GPDGW....KP
G4SUH2_META2/5-429STQDHAAAAI-A...........AK--.GIPVFAWKGETEEEAEWCIVQTI..........E.......GPNGW....RP
SAHH_BURXL/13-472STQDHAAAAI-A...........KA--.GTPVFAFKGESLDEYWEFSHRIF..........E.......WPNGE....FA
W5XC25_9BACT/19-478STQDHAAAAI-A...........AT--.SVPVFAYKGESLDDYWEYTHRIM..........E.......WADGG....TP
SAHH_HYPNA/9-468STQDHAAAAI-A...........DA--.GTAVFAYKGETLEEYWDYTDRMF..........Q.......WPDGE....GP
M4S945_9SPHN/11-468STQDHAAAAI-A...........AQ--.GIPVFAVKGETLEEYWDYVIRIF..........D.......WG.DT....TA
SAHH_SYNPW/16-475STQDHAAAAM-A...........AR--.DIPVFAVKGETLEEYWEYTHRIL..........E.......WGDGG....SP
A7HPA7_PARL1/11-471STQDHAAAAI-A...........AR--.GIPVFAIKGESLEDYWEYTHRIF..........E.......WSDGG....AP
SAHH_RALME/10-471STQDHAAAAI-A...........AS--.GTPVFAFKGESLKEYWDFTHRIF..........D.......WADGG....TP
Q09BK3_STIAD/11-470STQDHAAAAI-A...........AS--.GTPVFAYKGETLEEYWDYTHRIF..........E.......WADGG....AP
I4AIU9_FLELS/9-439STQDQAAAAI-A...........AT--.GVPVFAWKGLTEEEFDWCIEQTL..........FFG....EGENRK....PL
SAHH_BARHE/5-464STQDHAAAAI-A...........AT--.GTPVFAVKGETLEEYWTYIDAIF..........Q.......WPDGN....PS
F2IVA0_POLGS/3-461STQDQAAAAI-A...........KA--.GIPVFAVKGETLEEYWDYADRIF..........D.......FPDGA......
SAHH_DICDI/5-430STQDQAAAAI-A...........AT--.GVPVYAWKGETEEEYNWCVEQTIV.........F........QDGQ....PL
Q4P829_USTMA/3-430STQDHAAAAI-A...........AT--.GVPVFAWKGETEEEYDWCLEQTLT.........A.......HPEGP......
B3QUB9_CHLT3/8-434STQDHAAAAI-A...........AA--.GVPVYAWKGMNEEEFFWCIEQTI..........F.......FEDDQ....PL
SAHH_ACISJ/10-475STQDHAAAAI-A...........AT--.GTPVFAIKGETLVDYWDYTHRIF..........DFG...PKGSEGE....GP
SAHH_COXBU/13-437STQDHAAAAL-A...........QK--.GIPIFAWKGETEEEYWRCIASTL..........E.......GPKGW....TP
U9U9F5_RHIID/3-430STQDQAAAAI-A...........AT--.GVPVFAWKGETEEEYTWCIEQTLF.........A.......FKDGK....PL
SAHH_PLAF7/5-478STADYAAAAV-S...........TL--ENVTVFAWKNETLEEYWWCVESALT.........WGD...GDDN.......GP
R7KIX3_9BURK/4-463STQDHAAAAI-A...........AE--.GIPVFAVKGETVNDYWEYTHKIM..........E.......WDDGG....YS
E4TS79_MARTH/6-432STQDQAAAAI-A...........AA--.GIPVYAWKGMTEEEFNWCIEQTL..........FF......GEDKK....PL
F2IAQ7_FLUTR/9-436STQDHAAAAI-A...........AA--.GIPVYAWKGMNEEEFDWCIEQTI..........FA.....FEG.GE....PL
SAHH_METPP/12-476STQDHAAAAL-V...........AA--.GTPVFAYKGETLTDYWDYTHRIF..........DFG...AKGTDGE....GP
U1MPL7_ASCSU/7-436STQDHAAAAI-A...........KA--.GIPVYAWKGETDEEYEWCIEQTLV.........F........KDGK....PL
F6XCK4_CIOIN/7-437STQDHAAAAI-A...........AT--.GTAVYAWKGETDEEYIWCVDQTIV.........F........PNNE....PL
Q5FRZ9_GLUOX/12-437STQDHAAAAI-A...........AA--.GIPVFAWKGLTEDEFNWCIEQTI..........H.......GPDGW....TP
K7YQ52_9PROT/6-430STQDHAAAAI-A...........AS--.DIPVFAWKGETEEEYEWCIRQTI..........E.......GPNSW....HA
J9YYB1_9PROT/2-425STQDHAAAAI-A...........QS--.GTPVFAWKGMSEEEFWWCIDQTI..........E........ADGW....EP
F2I015_PELSM/10-434STQDHAAAAI-A...........KK--.GIPVFAWKGETEEEYWWCVKQTI..........E.......GNKDW....KP
E0TE34_PARBH/4-465STQDHAAAAI-A...........AN--.GTPVFAKKGETLEEYWAYADRLW..........E.......WPDGE....IA
I1C1Z9_RHIO9/6-432STQDHAAAAI-A...........AS--.GVPVYAWKGETDEEFVWCIEQTLF.........F........PDGQ....PL
E9CHK0_CAPO3/6-431STQDNAAAAI-A...........AA--.GIPVFAWKGETDEEYLWCIEQTLI.........F........PDGQ....PL
S9X649_SCHCR/5-432STQDHAAAAI-A...........AT--.GVPVFAWKGETEEEYIWCIEQQLK.........S.......FPSGQ....PL
D5BTB0_PUNMI/4-463STQDQAAAAI-A...........KA--.GVPVFAKKGETLAEYWEYVDRTF..........Q.......WSNGE....TA
Q4Q124_LEIMA/3-436STQDNAAAAI-A...........KT--.GVPVFAWKGETDEEYEWCIAQTVK.........GF......SGDGL.....P
Q2NB41_ERYLH/6-468STQDHAAAAI-A...........EQ--.GIPVFAVKGESLADYWDYVGRIF..........DWST..SEDA.DQ....TA
T1K9L8_TETUR/5-432STQDHAAAAM-A...........KR--.GVAVYAWKGETEEEYLWCIEQTIF.........W........PDGK....PL
B3RVD8_TRIAD/6-432STQDHAAAAM-A...........AK--.GIPVYAWKGETDDEYIWCIEQTLV.........F........ANGE....PL
H3EHZ4_PRIPA/5-433STQDHAAAAI-A...........AA--.GIPVYAWKGETEEEYEWCIEQTLV.........W........PDGK....PL
R4XBF9_TAPDE/4-432STQDHAAAAI-A...........AA--.GVPVFAWKGETEEEYLWCIEQQLK.........S.......FKDGK....SL
M7NIB1_PNEMU/6-434STQDHAAAAI-A...........AS--.GISVFAWKGETEEEYLWCIETQLT.........S.......FKNGK....HL
S5R4D1_9PROT/14-476STQDHAAAAI-A............S--KGIPVFAFKGESISDYWEFNHRIFD.........WPGNSNTEQA.........
K0C550_ALCDB/10-461STQDHAAAAI-A...........AS--.GVPVFAWKGETEEEYMWCIEQTCRDGD...GNLW................DA
SAHH_PSEMY/12-468STQDQAAAAI-A...........AA--.GIPVFAWKGETEEEYEWCIEQTILKD....GKPW................DA
SAHH_PSEU5/12-467STQDQAAAAI-A...........AA--.GIPVFAWKGETEEEYEWCIEQTILKD....GQPW................DA
C5BTQ5_TERTT/11-461STQDHAAAAI-A...........AA--.GIPVFAWKGETEEEFWWCIEQTIVKD....GKPW................DA
B1XI71_SYNP2/9-457STQDHAAAAI-A...........EA--.GVPVFAWKGETEEEYMWCIEQTCRTPD...GELW................DA
E1VQZ0_9GAMM/8-458STQDHAAAAI-A...........AA--.GIPVFAWKGETEQEYWWCIEQQILKN....GEPW................NA
A1U548_MARAV/13-463STQDQAAAAI-A...........AQ--.GIPVFAWKGETDEEYEWCLHKTVGAD....VDGW................EP
Q5R045_IDILO/8-458STQDHAAAAM-A...........AA--.GVPVFAWKGETEEEYDWCLKQTCHKD....GELW................DA
SAHH_ACIAD/17-466STQDHAAAAI-A...........AS--.GVPVFAWKGETEEEYNWCLEQQINVN....GKPW................DA
Q4FT37_PSYA2/19-473STQDHAAAAI-A...........AA--.GISVYAWKGETEEEYEWCLRQQVHVGGEESGQLW................DT
W4VUN6_ATTCE/58-483STQNEVAAAL-A...........YA--.GYPVFAWRGETEEDFWWCIDKCVAA......ENW................QP
SAHH2_DROME/67-491STQNAVAAAL-A...........EA--.GIPIFAWRGETEEEFWWCLDRAIYS......DGW................QP
A1AX10_RUTMC/19-464STQDHAASAM-V...........AA--.NIPTFAWKGETEEEFLWCIEQTILEN....GKPW................AA
F6SNC6_CIOIN/38-463STQNEVAAAL-A...........EA--.GYSIFAWKGQEEEDFWWCIEKCITA......DGW................HP
Q7QE71_ANOGA/31-458STQNEVAAAL-A...........ES--.GVPIFAWRGEIEEDFWWCIDKCVHA......ENW................QP
A7SRK8_NEMVE/53-478STQNEVAAAM-A...........ES--.GLSIFAWKGESEEDFWWCIEKCITS......NGW................QP
E4XGP7_OIKDI/72-497STQNEVAAAL-A...........EA--.GIPIFAWKGEGEEEFWWCIEKCVAN......TSW................EP
I3KBV8_ORENI/75-500STQNAVAAAL-V...........KA--.GISVFAWRGESEDEFWWCIDHCVGT......ETW................QP
K7DYH7_DANRE/71-496STQNEVAAAL-A...........ER--.DFPVFAWKGESEDDFWWCIDRCVNV......EGW................EP
H2KNW6_CLOSI/142-567STQNEVAAAL-A...........EK--.GYAIYAWKGESEEDFWWCIDQCIKH......DSW................LP
H3D3K6_TETNG/64-489STQNAVAAAL-A...........EA--.GTAVFAWRGQTEDDFWWCIEKCVGA......EIW................QP
B3RUN3_TRIAD/31-456STQNEVAAAL-A...........EE--.GIPVFGWKGMSEDDFWWCIEKASNH......QNW................QA
W5K360_ASTMX/86-511SIQNEVSAAL-A...........EG--.GVPVFAWKGESEEDYFWCIDKCVNA......EGW................EP
H0W4G1_CAVPO/66-492SVCHEVAGLC-G...........TS--.HVSLRALHEKSMQGNTWVYTKTNDI......TGT................YL

PF00389

Q9JY94_NEIMB/3-329...DGSRPVL.E-----------KLAQIGVKTVALRCAGFN---------------------------------------
SERA_ARATH/85-394...KVTREVF.E-----------AA.KGRLKVVGRAGVGID---------------------------------------
Q9RUU0_DEIRA/18-329...KVDRELL.D-----------AA.GPRLKVIGRGGVGVD---------------------------------------
Q98F95_RHILO/5-315...KVTEKLI.N-----------AA..TRLKVIGRAGIGVD---------------------------------------
E9ACF1_LEIMA/115-427...QVTQAIL.D-----------AA..PKLLGIGCFCIGTN---------------------------------------
Q9KEA4_BACHD/2-311....VTEEHL.Q-----------AA..KKLKWIMVISAGVE---------------------------------------
O28495_ARCFU/4-322..IPITEEMM.R-----------AM..EKVKLIQQPSTGYN---------------------------------------
Q9KLW1_VIBCH/3-321..TPITENLL.A-----------HL..PNLKLISQTGKVSN---------------------------------------
Q9CKF1_PASMU/14-327...FLTEEVL.A-----------HA..QKLIAIGCFCIGTN---------------------------------------
SERA_ARCFU/3-312...KVDAEVI.Q-----------AA..KNLKIIGRAGVGVD---------------------------------------
CTBP_DROME/30-352....LTKEDL.E-----------KF..KALRIIVRIGSGTD---------------------------------------
Q9VKI8_DROME/8-324...KITAEVLAA-----------GS..GSLKVVGRAGAGVD---------------------------------------
Q97IU7_CLOAB/3-326...PINAALI.K-----------KFNDVGVKFISTRTIGYD---------------------------------------
YEAA_SCHPO/9-327YMGIFDKEII.D-----------NL.PPSVKFICHLGAGYE---------------------------------------
Q9KP92_VIBCH/13-326...NLTEKVI.N-----------AA..EKLVAIGCFCIGTN---------------------------------------
Q9I1L0_PSEAE/4-318....LDAGLL.D-----------LA..PRLEAIASVSVGVD---------------------------------------
Q98BH4_RHILO/9-329...QIDAALI.A-----------QA.GDNLKLIANFGNGVD---------------------------------------
P74586_SYNY3/3-330...QAPAPVL.E-----------KLAAQGTKLIALRSAGYN---------------------------------------
DDH_ZYMMO/3-331...EANAEVL.E-----------ILAGLGIKLVALRCAGYN---------------------------------------
TKRA_BACSU/6-322..PSINRELL.E-----------HA..PKLKVVSNQSVGYD---------------------------------------
Q9A244_CAUCR/24-340...RIDSRLL.S-----------RS.GDRLKLIANFGAGVD---------------------------------------
SERA_SCHPO/58-378...RLTRRVL.E-----------AA..DSLIVIGCFCIGTN---------------------------------------
GYAR_THELN/5-322...KVDKELL.E-----------NA..PKLKIIAQYAVGYD---------------------------------------
Q98LH4_RHILO/9-326...RITRRVM.Q-----------AL..PDLRYISKYGIGVD---------------------------------------
Q9S2M5_STRCO/3-328...DLGAAVL.E-----------ILAAGGTRMVAQRSTGFN---------------------------------------
SERA_METJA/4-312...KVTRDVI.E-----------KA..EKLKVIGRAGVGVD---------------------------------------
LDHD_STRP1/3-330...PLDDAIY.P-----------LLKEMGIKQIAQHSASVD---------------------------------------
HPR3_ARATH/9-321..LPVTDELL.S-----------HL..PSLQILVCTSVGID---------------------------------------
Q9HXB7_PSEAE/5-318....LGARQL.E-----------QA..KQLEVISSVSVGYD---------------------------------------
O67741_AQUAE/4-320...PVTKELL.E-----------RA..EKLKVVGRAGVGVD---------------------------------------
SERA_METTH/6-313...KVTREVI.E-----------AA..PRLKIIARAGVGVD---------------------------------------
DDH2_SCHPO/3-330...QVDADTL.K-----------ALAENGVKLVALRCGGYN---------------------------------------
HPR2_ARATH/6-313...GADAQLI.S-----------DL..PNLEIVSSFSVGLD---------------------------------------
LDHD_ECOLI/3-329...DGSRPVL.E-----------ELKKHGVKYIALRCAGFN---------------------------------------
SERA_RAT/9-317...KVTADVI.N-----------AA..EKLQVVGRAGTGVD---------------------------------------
Q9A6E7_CAUCR/11-318...ALSRDML.A-----------EM..PRLGLIACVSVGYD---------------------------------------
Q9HMR0_HALSA/3-311...AVTDAVF.E-----------AA..PDLVIVARAGIGVD---------------------------------------
Q9WYG2_THEMA/4-311....VTAEMV.E-----------NS...SLKIIAKHGVGVD---------------------------------------
CTBP2_RAT/36-358....LTREDL.E-----------KF..KALRVIVRIGSGYD---------------------------------------
Q9PBD8_XYLFA/15-328...QLNAEVL.G-----------HA..KRLMAIGCFCIGTN---------------------------------------
Q89388_PBCV1/32-362...DLSAPVL.D-----------ILKNCGVSSITLRCAGFD---------------------------------------
LDHD_TREPA/3-330...AMEDEVY.D-----------YMGACKLKVLSTRTAGFD---------------------------------------
Q97MV2_CLOAB/3-317....LKAEVI.N-----------SD..SKLKMMSIAFTGVD---------------------------------------
Q97U35_SULSO/2-295....VNNDLI.G-----------KM..PNLKVIQTFSAGVD---------------------------------------
Q9A3I9_CAUCR/6-314...KLDKDVI.A-----------AA..NKLRVIARAGIGVD---------------------------------------
Q9RKF9_STRCO/17-329....ITEQVM.D-----------RL..PRLKVIGRYGVGVD---------------------------------------
Q9LT69_ARATH/49-358...KVGRDVF.E-----------SS.RGRLKVVGRAGVGID---------------------------------------
GYAR_AERPE/6-324...RIDCDLL.S-----------QA..PRLRIVAQMAVGFD---------------------------------------
DDH_HAEIN/3-329...NGSRKVL.E-----------KLAALGVKIVALRCAGFN---------------------------------------
O17626_CAEEL/8-316...KITAELLAA-----------SA..GKLKLVGRAGTGVD---------------------------------------
PDXB_PSEAE/3-285...EVSRAAL.A-----------G...SPVRFVGTCTIGTD---------------------------------------
SERA_YEAST/61-381...RLTSNVL.Q-----------HA..KNLVCIGCFCIGTN---------------------------------------
YGDH_SCHPO/9-332.ISPFTEEML.G-----------PL.LPTCKLFVTGAAGYN---------------------------------------
CTBP1_CAEEL/181-504....LEKEDL.E-----------KF..KVLKVVFRIGYGID---------------------------------------
Q9KCG9_BACHD/20-325...TVTEELM.E-----------KM..SSLKIIARAGVGVD---------------------------------------
SERA_MYCLE/6-313...TVDAEVL.A-----------AA..PKLKIVARAGVGLD---------------------------------------
Q9I530_PSEAE/3-328...DLSRPVL.E-----------RLAAGGTRLVALRSAGYN---------------------------------------
Q9VII9_DROME/10-326...PLNAGIL.D-----------AA.GSQLRCVSTMSSGID---------------------------------------
O66939_AQUAE/3-332...KLTEELL.S-----------KM..PRLKLIHTRSVGFD---------------------------------------
Q9HVG5_PSEAE/7-321....IDAQCI.A-----------AC..PELELILISATGTN---------------------------------------
Q98CG2_RHILO/11-318..AGISAAMM.D-----------AL..PNLELIASFGVGYD---------------------------------------
GRHPR_HUMAN/9-327...HVDKRIL.D-----------AA.GANLKVISTMSVGID---------------------------------------
Q9KMX4_VIBCH/4-330...ELHASVL.E-----------QLYQGGTRLIAMRCAGFD---------------------------------------
Q9K7P7_BACHD/3-318...RFDVEAF.E-----------RA..KRLKVVSTMAVGYD---------------------------------------
Q9I6H5_PSEAE/13-326...QLTEEVF.D-----------CA..KKLIAVGCFCIGTN---------------------------------------
Q9HK29_THEAC/3-309...PVNGDLL.K-----------KM..PRLRFVQVASIGYD---------------------------------------
Q98GE4_RHILO/8-315...PLPPALF.E-----------GA..WKLRAAIRHGAGLD---------------------------------------
DDH1_SCHPO/3-330...KVDADTL.K-----------VLAKNGTKLIALRCAGFN---------------------------------------
PDXB_VIBCH/3-286...KVNDALL.A-----------KA..NRLKFVGTATAGMD---------------------------------------
DHGY_METEA/5-313....MRADTL.K-----------QL..PDLKLIAVAATGTD---------------------------------------
Q97ZK1_SULSO/20-326...KVDKEII.R-----------YG..VNLKIIARAGIGLD---------------------------------------
Q97F10_CLOAB/3-323....ITSKVI.E-----------KL..PKLKYIGVLATGYN---------------------------------------
Q9Z564_STRCO/7-314...KVDAEAV.A-----------AA..KKLKVVARAGVGLD---------------------------------------
SERA_SYNY3/32-339...KVTEKII.Q-----------AG..SQLKIIGRAGVGVD---------------------------------------
A6TI50_KLEP7/6-326...RVDADFL.Q-----------AC..PELRVVGCALKGFD---------------------------------------
B0JPW3_MICAN/19-330...KLEASSI.R-----------LA..KQLKVISTSGFGTD---------------------------------------
G1UB05_LACJO/8-330...DYTPETL.Q-----------ALADAGVTKMSLRNVGVD---------------------------------------
N0B2T1_9RHIZ/6-319...KCRKDVI.D-----------RM.PDNIKCISTYSIGFD---------------------------------------
O25158_HELPY/4-314...PITSDFL.K-----------PL..THLKSIVRAGVGVD---------------------------------------
SERA_ECOLI/14-326...HLTEDVI.N-----------AA..EKLVAIGCFCIGTN---------------------------------------
GHRB_ECOLI/5-319....VNAALL.E-----------KM..PKLRATSTISVGYD---------------------------------------
Q03CR3_LACC3/8-328...PYAAGVF.E-----------KMHAYGIKFLTIRNVGTD---------------------------------------
Q03VC9_LEUMM/6-329...DYTRETL.T-----------ALANVGVTNLSLRNVGTD---------------------------------------
Q1GAA2_LACDA/5-332...PVDEEVVYQ-----------KLSEYGVKCIGLRIVGFN---------------------------------------
Q2FV62_STAA8/9-332...PLSEHVY.K-----------RLNELGIKQIAQRSAGFD---------------------------------------
Y2577_STAA8/5-317...NVDKDVI.D-----------AG..KDLKIIANYGAGFN---------------------------------------
Q2FXK1_STAA8/6-315...TVTENII.N-----------AA..DSLKVIARAGVGVD---------------------------------------
Q7W0H7_BORPE/11-324...HLDADLL.A-----------AN..PDLRVVGCFCIGTN---------------------------------------
LDHD_LACPL/6-329...DYTAEVL.N-----------KLADEGVKNISLRNVGVD---------------------------------------

PF05222

Q3A7G8_PELCD/4-137---GVPKE.I-K--------------------------------------------------------------------
NNTM_BOVIN/60-199---GVPKE.I-F--------------------------------------------------------------------
Q0VPX1_ALCBS/24-165---GVPKE.I-C--------------------------------------------------------------------
Q3J1C2_RHOS4/4-139---GAPRE.I-F--------------------------------------------------------------------
LYS1_ASHGO/6-141---HLRAETK-P--------------------------------------------------------------------
Q28V87_JANSC/4-137---GCPTE.I-K--------------------------------------------------------------------
Q2G7Q1_NOVAD/4-137---GTVRE.I-K--------------------------------------------------------------------
Q6AQV0_DESPS/4-137---GILKE.I-K--------------------------------------------------------------------
Q82QU1_STRAW/15-145---GVVAE.S-V--------------------------------------------------------------------
Q3B540_PELLD/4-135---GIPLE.I-K--------------------------------------------------------------------
DHA_OCEIH/4-136---GVPKE.I-K--------------------------------------------------------------------
Q0S884_RHOSR/4-137---GIPRE.I-K--------------------------------------------------------------------
A0KQF4_AERHH/4-135---GIPRE.S-L--------------------------------------------------------------------
Q9KAF8_BACHD/4-136---GVPKE.I-K--------------------------------------------------------------------
A6VXM0_MARMS/6-147---GIPKE.I-E--------------------------------------------------------------------
Q3JE74_NITOC/4-136---GIPRE.I-K--------------------------------------------------------------------
B1YFJ0_EXIS2/4-136---GVLKE.I-K--------------------------------------------------------------------
A5GEE8_GEOUR/4-135---GVPKE.V-K--------------------------------------------------------------------
A5FP13_FLAJ1/4-137---GVPKE.I-K--------------------------------------------------------------------
Q98CE6_RHILO/6-139---FIPRE.L-D--------------------------------------------------------------------
Q31MC9_SYNE7/4-136---GVPRE.L-K--------------------------------------------------------------------
Q6NYQ7_DANRE/56-195---GVPKE.I-F--------------------------------------------------------------------
Q5KHJ2_CRYNJ/22-157---WLRCEKK-P--------------------------------------------------------------------
Q2IDX0_ANADE/4-138---AVLRE.A-A--------------------------------------------------------------------
Q21L93_SACD2/6-141---GVVRE.S-A--------------------------------------------------------------------
A0QNT0_MYCS2/5-135---GVPRE.S-A--------------------------------------------------------------------
Q1GUI4_SPHAL/4-138---AVLKE.L-A--------------------------------------------------------------------
Q0AQT6_MARMM/4-137---GVPRE.I-K--------------------------------------------------------------------
Q18031_CAEEL/32-165---AVPKE.I-F--------------------------------------------------------------------
Q47E46_DECAR/4-137---GVPKE.I-K--------------------------------------------------------------------
Q39WN5_GEOMG/4-135---GVPRE.I-K--------------------------------------------------------------------
Q3SL22_THIDA/4-136---GIPKE.I-K--------------------------------------------------------------------
Q6W1Y1_RHISN/6-139---YIARE.S-S--------------------------------------------------------------------
Q67ND6_SYMTH/4-137---GVVRE.L-K--------------------------------------------------------------------
Q5SLT7_THET8/5-139---AVPKE.R-A--------------------------------------------------------------------
A0KEW0_AERHH/4-137---GVPKE.I-K--------------------------------------------------------------------
Q47BC9_DECAR/6-139---AVARE.S-T--------------------------------------------------------------------
Q8DL05_THEEB/4-139---GVVKE.R-E--------------------------------------------------------------------
Q28M63_JANSC/4-139---GTPKE.I-E--------------------------------------------------------------------
Q2RN15_RHORT/4-137---GVPKE.I-K--------------------------------------------------------------------
Q0C3J7_HYPNA/4-137---GVPTE.I-K--------------------------------------------------------------------
Q2S445_SALRD/35-169---GVPRE.V-G--------------------------------------------------------------------
A1SSF5_PSYIN/4-138---GIPRE.I-Q--------------------------------------------------------------------
Q5Z133_NOCFA/18-148---GVVRE.T-N--------------------------------------------------------------------
Q5WJZ9_BACSK/4-136---GIPKE.I-K--------------------------------------------------------------------
A0L9H7_MAGSM/4-145---GIPKE.I-H--------------------------------------------------------------------
Q6W1J9_RHISN/4-139---ATPSE.V-F--------------------------------------------------------------------
PNTA_HAEIN/4-137---GVPRE.L-L--------------------------------------------------------------------
Q6AEY9_LEIXX/4-137---TIPRE.I-K--------------------------------------------------------------------
Q6ACH0_LEIXX/6-139---GVLRE.A-E--------------------------------------------------------------------
A8GEZ6_SERP5/4-137---GVPRE.R-L--------------------------------------------------------------------
Q5LFH6_BACFN/4-137---GVPKE.I-K--------------------------------------------------------------------
A5FFU7_FLAJ1/32-165---GIPKE.T-S--------------------------------------------------------------------
A0K2E1_ARTS2/12-145---GIARE.H-R--------------------------------------------------------------------
A0QNN8_MYCS2/4-137---GIPRE.S-Q--------------------------------------------------------------------
Q5YZC0_NOCFA/4-137---GVPGE.V-K--------------------------------------------------------------------
P72775_SYNY3/4-136---GVPKE.I-K--------------------------------------------------------------------
Q603N5_METCA/4-139---GIPKE.I-F--------------------------------------------------------------------
Q2N774_ERYLH/4-137---GCPTE.I-K--------------------------------------------------------------------
Q1J0B1_DEIGD/4-135---GLPKE.I-K--------------------------------------------------------------------
Q2HFZ2_CHAGB/7-141---HLRSETK-P--------------------------------------------------------------------
LYS1_YEAST/7-142---HLRAETK-P--------------------------------------------------------------------
Q5LPM8_RUEPO/4-139---GTPKE.I-F--------------------------------------------------------------------
Q65CX6_BACLD/4-136---GIPKE.I-K--------------------------------------------------------------------
Q1QUL9_CHRSD/4-139---GAPKE.R-A--------------------------------------------------------------------
Q2J8T8_FRASC/7-142---GVAME.T-A--------------------------------------------------------------------
A4Y0R2_PSEMY/4-136---GVPLE.T-H--------------------------------------------------------------------
Q11TK3_CYTH3/4-137---GVPKE.I-K--------------------------------------------------------------------
A0CWD3_PARTE/29-161---GVPKE.T-F--------------------------------------------------------------------
Q2SHR3_HAHCH/4-137---GIPKE.S-R--------------------------------------------------------------------
A6VN40_ACTSZ/4-137---GVPRE.R-L--------------------------------------------------------------------
A8ZXI3_DESOH/4-137---GILKE.I-K--------------------------------------------------------------------
A5FVY5_ACICJ/4-137---GVPRE.I-K--------------------------------------------------------------------
Q8DQ43_STRR6/4-136---GIPKE.I-K--------------------------------------------------------------------
Q9K827_BACHD/4-136---GVPTE.V-K--------------------------------------------------------------------
Q5CI32_CRYHO/405-540---GVLKE.D-L--------------------------------------------------------------------
Q0SD61_RHOSR/4-134---GVLKE.A-R--------------------------------------------------------------------
Q11PQ8_CYTH3/7-139---GIIREGK-V--------------------------------------------------------------------
Q2NSW2_SODGM/4-137---GVPKE.R-V--------------------------------------------------------------------
Q8DH53_THEEB/4-139---GVPKE.I-K--------------------------------------------------------------------
Q2W3E7_MAGSA/6-142---GVPRE.T-F--------------------------------------------------------------------
A0L3P1_MAGSM/4-137---GVVKE.I-R--------------------------------------------------------------------
Q0A4X6_ALKEH/6-139---AVPRE.T-R--------------------------------------------------------------------
Q6MKC3_BDEBA/4-137---GVPKE.I-K--------------------------------------------------------------------
Q2LSK0_SYNAS/44-177---GVPKE.I-K--------------------------------------------------------------------
Q163M5_ROSDO/4-139---GTPKE.I-F--------------------------------------------------------------------
A9CHR5_AGRT5/4-139---GTPKE.L-Y--------------------------------------------------------------------
Q74AR0_GEOSL/4-135---GVPRE.I-K--------------------------------------------------------------------
Q3B571_PELLD/35-169---GIPKE.R-T--------------------------------------------------------------------
Q6A5I3_PROAC/4-137---GVPTE.V-K--------------------------------------------------------------------
Q54P64_DICDI/8-138---GIRREDK-N--------------------------------------------------------------------
B4S6Q3_PROA2/35-169---GIPKE.R-L--------------------------------------------------------------------
Q0ALL0_MARMM/4-137---AILKE.R-H--------------------------------------------------------------------
Q2VYN4_MAGSA/13-146---GVPKE.I-K--------------------------------------------------------------------
Q1AS10_RUBXD/6-139---GVPKE.V-K--------------------------------------------------------------------
Q82M72_STRAW/7-141---WLRHESR-T--------------------------------------------------------------------
Q7VB57_PROMA/5-141---LIPIE.V-A--------------------------------------------------------------------
Q1GL71_RUEST/4-137---GCPTE.I-K--------------------------------------------------------------------
Q10ZM3_TRIEI/4-136---GIPKE.I-K--------------------------------------------------------------------
A0JVY4_ARTS2/5-137---GIVAE..-L--------------------------------------------------------------------
Q15T10_PSEA6/4-137---GVPKE.I-K--------------------------------------------------------------------
Q5FU53_GLUOX/6-140---SVLKERD-E--------------------------------------------------------------------
A2E4I0_TRIVA/4-138---GIPKE.I-K--------------------------------------------------------------------
Q0SAT6_RHOSR/4-137---GIPKE.V-K--------------------------------------------------------------------
DHA_BACSU/4-135---GVPKE.I-K--------------------------------------------------------------------
Q2YIM6_BRUA2/6-139---YIPKE.S-D--------------------------------------------------------------------
B9M3R5_GEODF/4-135---GIPGE.I-K--------------------------------------------------------------------
Q5SLS7_THET8/4-135---GVPKE.I-K--------------------------------------------------------------------
Q6MUG7_MYCMS/10-140---GLPKE.I-K--------------------------------------------------------------------
Q21RZ9_ALBFT/27-163---GVPRE.V-F--------------------------------------------------------------------
Q0K0H4_CUPNH/6-146---GVPRE.V-H--------------------------------------------------------------------
Q47FY5_DECAR/6-139---GVARE.S-A--------------------------------------------------------------------
A1SJK7_NOCSJ/4-137---GVPKE.V-K--------------------------------------------------------------------
Q7UIW1_RHOBA/5-140---GVPRE.R-W--------------------------------------------------------------------
LYS1_SCHPO/7-142---WLRAETK-P--------------------------------------------------------------------
Q3JEF4_NITOC/4-145---GIPKE.I-H--------------------------------------------------------------------
A1WCT5_ACISJ/4-136---GVPAE.T-L--------------------------------------------------------------------
O25948_HELPY/4-135---GLVKE.S-M--------------------------------------------------------------------
A1C559_ASPCL/85-224---GVPRE.T-W--------------------------------------------------------------------
Q55F30_DICDI/135-275---GIPTE.V-Y--------------------------------------------------------------------
Q2G790_NOVAD/8-140---AVLRE.R-A--------------------------------------------------------------------
Q7NWG7_CHRVO/4-137---GVPKE.I-K--------------------------------------------------------------------
Q1GKH6_RUEST/5-139---WVRAEQR-L--------------------------------------------------------------------
Q1GVP3_SPHAL/4-137---GTPKE.I-K--------------------------------------------------------------------
A1K465_AZOSB/6-138---GVPAE.R-I--------------------------------------------------------------------
A5FAH7_FLAJ1/4-136---GIIKERK-N--------------------------------------------------------------------
Q6KIJ0_MYCMO/4-134---GFPKE.I-K--------------------------------------------------------------------
Q8EPC2_OCEIH/4-136---GIPKE.I-M--------------------------------------------------------------------
Q1ARY0_RUBXD/7-141---GVPRE.V-A--------------------------------------------------------------------
Q6LMW4_PHOPR/33-171---ALVKE.I-E--------------------------------------------------------------------
A5G0H4_ACICJ/5-140---AVLKE.R-L--------------------------------------------------------------------
A5V5I3_SPHWW/4-142---AVLRE.A-A--------------------------------------------------------------------
Q7NEB1_GLOVI/4-136---GVPKE.I-K--------------------------------------------------------------------
Q60BB4_METCA/4-135---GVPKE.I-K--------------------------------------------------------------------
A1TXK5_MARAV/4-139---GIPRE.R-Q--------------------------------------------------------------------
Q1IIW3_KORVE/4-145---GVPRE.S-Y--------------------------------------------------------------------
A7HTE3_PARL1/4-137---GVPKE.I-K--------------------------------------------------------------------
Q3APE7_CHLCH/6-140---GIPKE.R-A--------------------------------------------------------------------
Q5P1Y9_AROAE/6-139---GVPAE.T-V--------------------------------------------------------------------
Q8KEI3_CHLTE/17-148---GIPRE.I-K--------------------------------------------------------------------
Q2S0H0_SALRD/6-141---GVPRE.T-E--------------------------------------------------------------------
A8LIC1_DINSH/19-154---GAPKE.I-F--------------------------------------------------------------------
A0LWI4_ACIC1/4-137---VAVRE.T-A--------------------------------------------------------------------
Q21M61_SACD2/4-145---AIPRE.R-R--------------------------------------------------------------------
Q0KA62_CUPNH/4-137---GVPKE.V-K--------------------------------------------------------------------
A1CKS0_ASPCL/7-145---WLRAETK-P--------------------------------------------------------------------
A0LUF0_ACIC1/4-137---GVPRE.I-K--------------------------------------------------------------------
Q484K1_COLP3/4-137---GIPKE.S-F--------------------------------------------------------------------
Q7UXF1_RHOBA/4-137---GVPSE.I-K--------------------------------------------------------------------
Q6MB39_PARUW/4-136---GIPKE.I-K--------------------------------------------------------------------
Q2UAA6_ASPOR/84-217---GVPRE.T-Y--------------------------------------------------------------------
A0DTI6_PARTE/7-138---GVRAEDK-S--------------------------------------------------------------------
A1WZC8_HALHL/6-141---AVPKE.T-R--------------------------------------------------------------------
Q480P6_COLP3/4-137---GVPKE.I-K--------------------------------------------------------------------
Q4P6J5_USTMA/9-143---YLRCEMK-P--------------------------------------------------------------------
Q8G5Z4_BIFLO/12-147---GVLNE.T-S--------------------------------------------------------------------
O44503_CAEEL/33-163---GIRRETV-N--------------------------------------------------------------------
A7IGP9_XANP2/4-139---AVPAE.V-D--------------------------------------------------------------------
Q3IZY5_RHOS4/4-137---GCPKE.I-K--------------------------------------------------------------------
Q13HL5_BURXL/6-139---AVLTE.T-R--------------------------------------------------------------------
Q6AA35_PROAC/43-176---GIPRE.L-L--------------------------------------------------------------------
Q16LL0_AEDAE/57-190---GVPKE.R-W--------------------------------------------------------------------
B3E8N4_GEOLS/4-135---GVARE.I-K--------------------------------------------------------------------
B2UC87_RALPJ/4-136---GIPQE.T-R--------------------------------------------------------------------
Q829A4_STRAW/4-137---GIPRE.V-K--------------------------------------------------------------------
Q5R0B7_IDILO/4-137---GVPKE.I-K--------------------------------------------------------------------
Q2Y9W7_NITMU/4-139---GIPAE.T-R--------------------------------------------------------------------
Q2Y9W3_NITMU/6-138---GLPKE.T-K--------------------------------------------------------------------
B3EKT2_CHLPB/35-169---GIPKE.R-S--------------------------------------------------------------------
A0ZAH3_NODSP/4-137---GVPRE.S-K--------------------------------------------------------------------
A4SZU6_POLSQ/4-136---GVPLE.T-R--------------------------------------------------------------------
Q0U4J1_PHANO/7-146---HARAEAK-P--------------------------------------------------------------------
A1B5J9_PARDP/5-139---WVRTESR-A--------------------------------------------------------------------
Q6F836_ACIAD/4-136---GIPTE.T-I--------------------------------------------------------------------
Q0SGE0_RHOSR/15-145---GVVRE.S-N--------------------------------------------------------------------
Q6ANB3_DESPS/4-131---GIPRE.I-K--------------------------------------------------------------------
Q2SNB3_HAHCH/4-137---GVPKE.V-K--------------------------------------------------------------------
A1BEU6_CHLPD/35-169---GIPKE.R-A--------------------------------------------------------------------
Q2JLS3_SYNJB/4-136---GVPKE.I-K--------------------------------------------------------------------
Q01VE2_SOLUE/4-138---GVLRE.R-G--------------------------------------------------------------------
A0JVR6_ARTS2/4-136---GVPRE.I-K--------------------------------------------------------------------
Q7N4Z3_PHOLL/4-137---GVPKE.R-L--------------------------------------------------------------------
O04709_MAIZE/19-156---GILAETC-N--------------------------------------------------------------------
A8ZX21_DESOH/4-137---GIPRE.I-K--------------------------------------------------------------------
Q021N9_SOLUE/6-147---GFVGE.G-S--------------------------------------------------------------------
Q3IYW2_RHOS4/5-139---WVRAEQR-P--------------------------------------------------------------------
Q3AEB3_CARHZ/4-137---GVPKE.I-K--------------------------------------------------------------------
A1BEX7_CHLPD/4-135---GIPKE.I-K--------------------------------------------------------------------
LYS1_YARLI/8-142---HLRAETK-P--------------------------------------------------------------------
Q5SIC7_THET8/4-139---GVPRE.R-S--------------------------------------------------------------------
Q1GIS5_RUEST/4-139---GTPKE.I-A--------------------------------------------------------------------
B2JGI7_BURP8/4-136---GVPAE.T-R--------------------------------------------------------------------
Q1AW21_RUBXD/4-137---GVVRE.V-A--------------------------------------------------------------------
B4SD94_PELPB/35-169---GIPRE.R-L--------------------------------------------------------------------
Q16C99_ROSDO/5-139---WVRAEQR-D--------------------------------------------------------------------
A6WFF9_KINRD/4-137---GVPTE.V-K--------------------------------------------------------------------
A1B9C0_PARDP/4-139---GALKE.S-F--------------------------------------------------------------------
A3QAN8_SHELP/4-140---GLPKE.S-H--------------------------------------------------------------------
Q8XRA9_RALSO/4-136---GIPLQ.T-A--------------------------------------------------------------------
A0LMX7_SYNFM/4-137---GCPKE.I-K--------------------------------------------------------------------
Q47RB8_THEFY/4-137---GVPRE.I-K--------------------------------------------------------------------
B2JLD8_BURP8/4-137---GVPKE.I-K--------------------------------------------------------------------
Q128A6_POLSJ/4-137---GIPKE.I-K--------------------------------------------------------------------
Q7P1W1_CHRVO/4-138---VIPAE.R-L--------------------------------------------------------------------
Q8KEN6_CHLTE/6-140---AIPKE.R-A--------------------------------------------------------------------
Q2IJQ2_ANADE/4-137---GCPKE.I-K--------------------------------------------------------------------
A4SWM0_POLSQ/4-137---GVPQE.V-K--------------------------------------------------------------------
A0ZDC5_NODSP/19-159---AVAKE.I-E--------------------------------------------------------------------
A1VTW8_POLNA/4-136---GIPAE.I-T--------------------------------------------------------------------
A9BR27_DELAS/4-136---GVPAE.T-M--------------------------------------------------------------------
A6VWR5_MARMS/6-139---AILKE.T-H--------------------------------------------------------------------
A4XPH7_PSEMY/4-137---GVPKE.I-K--------------------------------------------------------------------
Q1QT97_CHRSD/4-137---AVPKE.I-K--------------------------------------------------------------------
B0SVI3_CAUSK/5-140---AVTKE.T-R--------------------------------------------------------------------
Q1WRC5_LACS1/4-135---GVPKE.I-K--------------------------------------------------------------------
B0T233_CAUSK/4-137---GVPSE.I-K--------------------------------------------------------------------
Q28K30_JANSC/4-138---WIRAEER-A--------------------------------------------------------------------
A5V806_SPHWW/4-137---GVPRE.I-K--------------------------------------------------------------------
Q31MS7_SYNE7/28-167---LIPCE.P-G--------------------------------------------------------------------
Q03RI6_LACBA/4-135---GIPQE.T-K--------------------------------------------------------------------
A4J8G7_DESRM/4-137---GVPKE.I-K--------------------------------------------------------------------
Q5KUA3_GEOKA/4-136---GVPKE.I-K--------------------------------------------------------------------
Q11IF1_CHESB/4-137---GCPKE.I-K--------------------------------------------------------------------
P73496_SYNY3/23-158---GVPRE.S-F--------------------------------------------------------------------
Q15PN0_PSEA6/5-140---AFPAE.M-K--------------------------------------------------------------------
Q7VV14_BORPE/4-136---GVPKE.T-R--------------------------------------------------------------------
Q12QQ7_SHEDO/4-145---GIPKE.S-L--------------------------------------------------------------------
A7HUT9_PARL1/4-139---AIPKE.R-L--------------------------------------------------------------------
Q03HP9_PEDPA/4-134---AVIKE.Q-K--------------------------------------------------------------------
Q5DZZ0_VIBF1/4-143---GVPRE.V-F--------------------------------------------------------------------
Q01VQ6_SOLUE/4-137---GVPKE.I-K--------------------------------------------------------------------
Q7VA67_PROMA/14-145---GIPKE.I-K--------------------------------------------------------------------
Q10VQ6_TRIEI/4-139---SVAKE.I-L--------------------------------------------------------------------
A0M2A6_GRAFK/33-166---GIPKE.T-A--------------------------------------------------------------------
C1DKG5_AZOVD/4-137---GIPRE.L-K--------------------------------------------------------------------
A1A1C3_BIFAA/12-147---GVLNE.T-S--------------------------------------------------------------------
Q11SC0_CYTH3/13-146---GIPKE.L-E--------------------------------------------------------------------
A8LLI3_DINSH/4-137---GCPTE.I-K--------------------------------------------------------------------
Q11EJ3_CHESB/6-139---FVPKE.A-D--------------------------------------------------------------------
A4X685_SALTO/4-137---GIPRE.I-K--------------------------------------------------------------------
B1WS00_CYAA5/5-144---AVPKE.S-D--------------------------------------------------------------------
B2FPZ7_STRMK/9-139---...KE.T-A--------------------------------------------------------------------
B2HKV6_MYCMM/4-137---GIPTE.T-K--------------------------------------------------------------------
B2HLU5_MYCMM/9-139---GVVAE.S-T--------------------------------------------------------------------
B4EIC9_BURCJ/4-137---GVPKE.I-K--------------------------------------------------------------------
B4HYA5_DROSE/26-155---.IRREDQ-S--------------------------------------------------------------------
B9RR16_RICCO/8-144---GILSESV-N--------------------------------------------------------------------
D0IWI5_COMT2/2-128---.......-.--------------------------------------------------------------------
D4ZJ19_SHEVD/4-142---GIPRE.I-L--------------------------------------------------------------------
F7QES8_9BRAD/5-136---.VARE.I-D--------------------------------------------------------------------
G0FKF9_AMYMS/4-137---AVPRE.I-K--------------------------------------------------------------------
H3CUQ7_TETNG/61-200---GVPKE.I-F--------------------------------------------------------------------
H3CVX4_TETNG/53-186---GVPKE.T-V--------------------------------------------------------------------
H3CYI7_TETNG/31-160---.IRREDI-N--------------------------------------------------------------------
H7C6H0_BRADU/4-137---GVPKE.I-K--------------------------------------------------------------------
K4PU16_SHEON/4-137---GVPKE.I-K--------------------------------------------------------------------
Q036E3_LACC3/4-134---GVVKE.Q-K--------------------------------------------------------------------
Q1D4V2_MYXXD/4-138---GVPKE.I-K--------------------------------------------------------------------
Q24858_ENTHI/568-702---GIPKE.N-V--------------------------------------------------------------------
Q24YW8_DESHY/4-137---GIPKE.I-K--------------------------------------------------------------------
DHA2_STAA8/4-136---GIPRE.I-K--------------------------------------------------------------------
DHA1_STAA8/5-134---.VVKE.L-K--------------------------------------------------------------------
Q2K468_RHIEC/46-178---.VAKE.V-T--------------------------------------------------------------------
PNTAA_RHORT/4-144---AIPKE.R-R--------------------------------------------------------------------
Q46JT2_PROMT/6-141---.IPFE.S-A--------------------------------------------------------------------
Q4FMG2_PELUB/4-137---GVPKE.I-K--------------------------------------------------------------------
Q4FU92_PSYA2/10-139---.......-S--------------------------------------------------------------------
Q59P14_CANAL/10-144---.LRAE.T-K--------------------------------------------------------------------
Q5F6S7_NEIG1/4-136---GIPRE.S-L--------------------------------------------------------------------
Q5ZX09_LEGPH/4-137---GVPKE.I-K--------------------------------------------------------------------
Q63QY7_BURPS/4-136---GVPAE.T-R--------------------------------------------------------------------
Q6LIA6_PHOPR/6-139---WLRDE.V-K--------------------------------------------------------------------
Q6LIV6_PHOPR/4-143---GVPKE.I-F--------------------------------------------------------------------
Q6LQ29_PHOPR/6-139---GVPKE.I-K--------------------------------------------------------------------
DHA_METMP/4-137---GVPKE.I-K--------------------------------------------------------------------
Q72EK7_DESVH/4-137---GILKE.I-K--------------------------------------------------------------------
Q7RV12_NEUCR/120-256---GVPRE.T-Y--------------------------------------------------------------------
Q7V5T2_PROMM/14-145---GVPTE.I-K--------------------------------------------------------------------
Q81VA6_BACAN/4-136---GVPAE.I-K--------------------------------------------------------------------
Q87QP6_VIBPA/4-137---GVPKE.I-K--------------------------------------------------------------------
Q8Y6V2_LISMO/4-136---GVPKE.I-K--------------------------------------------------------------------
Q92LZ7_RHIME/7-139---.IAKE.S-D--------------------------------------------------------------------
AASS_MOUSE/28-157---.LRREDV-N--------------------------------------------------------------------
Q9KM26_VIBCH/4-137---GVPRE.Q-L--------------------------------------------------------------------
X2GRC3_9BACI/4-136---GIPKE.I-K--------------------------------------------------------------------

PF05221

E6S782_INTC7/4-477.NMILDDGGDATMLVHKGVE....WEAAGQVPV..TTDED......SEEFGVFKELVRRSLEA.DGQKWTTIAAG...IK
A0JU72_ARTS2/4-491.NMILDDGGDATMLVHKGVE....FEALGSVPA...AAED.....ESDEGRVFLDVLRASLAA.DPQKWTRIGSR...LL
D6Y6B5_THEBD/2-474.NMILDDGGDATLFVHKAVE....FERAGAVPQ..PSEDD......SEEWKIVLDTLRRCVGK.D.IRWSELARQ...IK
D1BWJ6_XYLCX/10-497.NMILDDGGDATMLVHLGLQ....YERAGVVPP..NTLQGEP..DHTHEMNVVRDVLRRALDA.DPLRWTEVASG...IL
F6FRM5_ISOV2/23-520.NLILDDGGDATMLVHLGLQ....YERAGVVPP..DTLPGEP..DHTHEMNVVRGVLRRALEA.DPLRWTTIAQG...IG
E4NC13_KITSK/8-481.NMILDDGGDATLLIHKGVE....FEKAGAAPS..PDTAD......NDEYRIILELLNRTLVE.SPQKWTEVAAT...IK
D7B5R0_NOCDD/4-477.NMILDDGGDATMLVHKGAE....YEKAGAVPD..PDSAD......SEEMGVVLRLLSASLER.DNTKWTRIAER...IQ
R4LG47_9ACTO/12-485.NMILDDGGDATLLVHKGVE....FEAAGAVPA..TTAED......NHEYSIILDTLRRSLAS.DNQRFTKIAAE...IR
A4X3J2_SALTO/22-495.NMILDDGGDATLLVHKGVE....FERAGAVPA..ADASD......SEEFTMVLDLLRRSLER.DGGKWTRLASG...IR
C5C1M6_BEUC1/15-511.TLILDDGGDATMLVHSGVR....YEAAGAVPS..DPRPGEP..GYSEEHLVVLDVLRRSLAA.DPQRWTRIASA...IG
F4CRV7_PSEUX/22-502.NMILDDGGDATLLVHKGVE....FEKTGVVPT...VDDEDL..TVSDEYRIILDTLRRSLAA.DGQYWTRVASD...IR
K0KB99_SACES/13-486.NMILDDGGDATLLVHKGAE....YEKAGVVPP...ADEN.....DSEEWQLVLETLRKSLAA.DNGKWTKIAEG...IR
A0LS32_ACIC1/2-475.NMLLDDGGDATLLVHKGVD....MEKTGVVPD..PDDAD......SPDLAAISRLLRRSYAE.DPRRWTTIAGG...IR
F6EFW8_AMYSD/14-489ANMILDDGGDATMLVLRGAQ....FEAAGTVPP...IDPDQ....HSAEYQVFLGLLQRSLEA.DGKKWTRIADS...VQ
C7MUK9_SACVD/12-484.NMILDDGGDASMLVHKGVE....FEAAGAVPE..PSEED......SEEYRIVLDRLRKSLAE.DSQRFTRIAAN...IR
A4FNJ5_SACEN/13-486.NMILDDGGDATLLVHKGVQ....YERAGVVPN..PADDD......PDEFKVILQTLRASLAA.DTTKWTRAAER...IR
F5XQ99_MICPN/10-486.NMILDDGGDATLLVHKGVE....YIKAGAVPE..PAESD......PEELRVLLALLRRSIAE.G.CDWTEIANA...IK
SAHH_MYCMM/17-491ANMILDDGGDATMLVLRGMQ....YEKAGVVPP...AEED.....DSAEWKVFLGLLRSRFET.DKGKWTKIAES...VK
R4T8V2_AMYOR/12-490.NMVLDDGGDATLLIHKGVE....FEAAGAVPQ..ATEED......GEEYGLVLETLRESLGR.DTGRFTRIAKE...VR
J9SDU9_9ACTO/17-488ANMILDDGGDATMLVLRGAE....FEKAGVVPP...AEDD.....HPAEYKVFLELLRKRFET.DKGKWTAISES...VQ
F4H4D2_CELFA/46-530.DLLLDDGGDATMLVHEGAR....AEAAGAVPED.PPPGDP...TRSEELLVVRRLLRRSLGQ.DPQRWSRVAAG...VV
C7QZI2_JONDD/10-493.NMILDDGGDATLLVHLGVQ....YEKDGSVPE..PLFPGDA..GYNAEKEEIHRVLRASVDK.SGNHWTELANN...IL
A1SGL1_NOCSJ/2-475.NMILDDGGDATLLVHLGVQ....AEKTGQAPD..PASAT......SNEQRIIFEALGEVLAK.NPNHWTPIANS...IK
A6WER2_KINRD/4-486.NMILDDGGDATMLVLEGKR....FEAAGAVPA..TTAED......SEEYAVVLELLRKSLAE.DPQRWTRIAEG...IR
I4F357_MODMB/14-493.NMLLDDGGDATLLVHLGTR....FEADGVVPD..TTDAD......SEEYGVILDVLRSSLGE.DPQRWTRIGQG...IK
C8XJI5_NAKMY/22-497.NMILDDGGDATLLVHKGVA....YEKTGVIPS...INEDDP..EYSEEYAVILDFLRASLAA.DPQYWTRTAPS...II
I6X351_PROPF/4-475.NLILDDGGDATLFVHEGVA....AQRAGAVPA..DDPAD......PEEALVVKAALREALGQ...LDFEALAAG...IL
M5A353_9ACTN/11-489.NMILDDGGDATMLLHKGVE....FEKAGEVPD..PTEAS......SAEFAIVLGLLQRTLKS.DPGKWTRMASH...IK
W0RH07_9BACT/19-492.NLLLDDGGDATLLVHKGAE....YEKAGAIPAF.DAEND......PEEWGVILELLRAEAQK.NPGRWTKVIAG...IR
SAHH_COREF/6-477.NMILDDGGDATMAVIRGRE....YEKAGVVPQ..PEAND......SDEYIAFLGMLREVLAE.EPDKWTRLADS...IK
E2SDU6_9ACTO/5-482.NVLLDDGGDITMLLHLGVE....YEKTGVVPP..QDSTD......NEEFKEVLRVLARSVAE.KPQYWTTLAKD...IR
X5E7G5_9CORY/23-501.NMILDDGGDATMAVITGSE....FEGNGIVPE..PSAED......SDEYQAFLGMLGRVYSQ.DDTRWTEAGKA...VK
G0HF72_CORVD/28-503.NMILDDGGDATNAVIEGTI....FEGNGLVPE..PSTED......SDEYQAFLRMLARAYGK.DATRWTEAGKA...IK
A7H6N3_ANADF/19-492.TQIVDDGGDATLLIHKGFE....FEKAGKVPR..AASAD......SEEYAVVLRLLGRELKK.DPRRWTRVAED...CA
D9SB20_FIBSS/15-498.DLIVDDGGDATMLVTCGAE....FEDAGKVPEF.NPETD......SEEWGVFLATCRKIFEK.DPKQWTRAREA...LK
L0GYM4_9GAMM/6-467.NMILDDGGDATLLVHKGVEY...EKAGGVPEP...TSSD......NEEWTAVLRLLGRTFAR.NSQHWHQIAAN...IK
B9S9Y6_RICCO/13-484.DLIVDDGGDATLLIHEGVKAEEIYEKTGQVPD..PTSTD......NAEFQIVLTIIRDGLKT.DPKKYHKMKER...LV
S6BUQ9_9GAMM/6-466.NMILDDGGDATLLVHKGAEF...AE.TGVPEP...KEGD......AEEWRVILDTLRRSLAE.DPQRYKRMAEG...IR
K0C944_CYCSP/5-466.NMILDDGGDATLLLHKGVEF...EKAGAVPDA...KEGD......NEEWIAILDVLRRNLPV.APTRWQNMASS...IK
E6WQA4_PSEUU/13-480.ELVVDDGGDVTLLIHKGYEL...EQGDESWVN...SPSG......SHEEQVIKDLLKRVAVE.RPGYWTRVVAD...WK
H3G8U2_PHYRM/6-480.DLIVDDGGDMTLLIHEGFKAEKAFAENGGVPD..ASSTD......NAEMKCVLNIIARTLKS.DPKKWTKIAQR...CK
A8IXE0_CHLRE/12-482.DLLVDDGGDATLLIHEGLKAEEQYAKDGTLPN..PDSTD......NAEFKIVLGLIRDSIQK.DATKWTRMSKK...VM
X5DXZ4_9BACT/10-471.QLIVDDGGDATLLIHKGYAA...EK.DASVLD...VDAS......SEEEGVILELLKTTLKE.DNQKWHRTVAE...WK
R7L6X2_9BACT/8-471.QLIVDDGGDATLLIHKGYEL...EE.GDKWVY...GKSE......SREEEVIKNLLKKIYKQ.DKSHWHKVVKD...VA
B4S716_PROA2/10-471.NMIVDDGGDATLMIILGYKI...EN.NPALLD...VTPG......NAEEKALYGQLKEVFES.DNQHWHKVAAE...IK
I4BAF3_TURPD/15-478.DLIVDDGGDATMLIHDGTKA...EK.DPKFVD...QPTD......NKEYKIVLNLIRESLKK.SKDKWTKIGKA...VR
F0VM57_NEOCL/4-476.DLLVDDGGDATLLIHEGVKAEKEFARSGALPD..PASTD......NAEMKVVFKLLADGIQK.EPQKWTRLAAN...LK
D5EQ42_CORAD/10-478.QLIVDDGGDATLLIHKGYEL...EN.GSDWVN...TDSS......STEEQVIKNLLKKIHND.KPNHWHGVVKE...WK
C7LQI3_DESBD/10-472.DLIVDDGGDATLLVHEGVKV...EK.DQSLLA...RTTD......NKEFRCVLDRLILSAKT.DPQKWTRIAAR...IR
F3YYZ8_DESAF/11-474.DLIVDDGGDATLFVHQGVKI...EQ.DPSLLD...KKYD......NKEFRIVIERLKASYQA.DKTKWTRIAKK...IK
D4H862_DENA2/6-469.QLIVDDGGDATMMIHTGVAA...EK.DPSILD...KKAD......STEESVFLAQLKKIFAE.APTRWQETVKE...LK
F8E7L7_FLESM/7-469.NLIVDDGGDATLMVHLGYQS...EQ.DPSLLD...KTPD......GEDEKELLARLKLISQR.DNSFWEKLVKN...LK
C8X588_DESRD/10-472.DLIVDDGGDATLFVHQGAKM...EK.DPALLE...QKTD......NKEFQCVLDRLVDSYNR.DPQKWTRIAAN...IR
G8NVU2_GRAMM/12-476.QLVVDDGGDVTLLIHKGYEL...EDGDRSFVD...GKAG......SVEEEVIQKLLKSVLAE.DSQRWHNVAKE...WR
E4TFL4_CALNY/3-466.NLIVDDGGDATLMVHLGYKA...EK.DPSSIE...YNTD......SEDERELLKRLKTILTT.NPQKWQNTLKE...LY
SAHH_DESAD/9-471.DLIVDDGGDATLLIHHGVKA...EK.DASILD...EKTD......NKEFQCVLDRLKLSVAE.TPGKWTAIAEK...VR
G0GAZ7_SPITZ/7-470.DLVVDDGGDATLMIHKGYEL...EE.GSRWVD...EPSQ......SEDERALKALLRRVYKE.DPHHWHKVVER...WK
B0VFI4_CLOAI/2-465.DLIVDDGGDATLMVHEGYRLEEQYKQTGKLPE...VDAE......NAEMRIVQELLINQLTI.DPYKWHRAVKC...LR
SAHH_DESAG/15-478.DLIVDDGGDATMLIHKGVEA...EK.NPALLE...KSYD......NKEFQIVMNRIALSMKN.DPGKWTRVAAK...VR
H8L337_FRAAD/12-476.ELIVDDGGDATLLIHKGVEL...ENGDRSWVD...APGA......SHEEQVIKNLLKRVATE.RPGFWTKVAAD...WK
A0BCF6_PARTE/5-476.TLIVDDGGDMTMMLLEGVKWEKKYEANGELPEPARAE........SEDEQAFLTVLRREIQQ.TPNKFRNYVAQ...VK
M4NS42_9GAMM/11-478.QLVVDDGGDVTLLIHKGYE....LENGSKWVD...EKAS......SHEEQVIKNLLKRVHAE.RPGYWHTVVRD...WK
T2GAN7_DESGI/2-464.DLIVDDGGDATLLIHHGVKC...EK.DPSLLD...KPVD......NKEFAIVMARLKAAYAQ.NSGRWQAVAAK...IK
D7G8Q4_ECTSI/5-478.DIIVDDGGDMTLLIHEGFKAENAYEKDGTLPDP.ESAGD......NAEFRIVLTIIKRELPK.TPRKWHELAAR...CV
SAHH_PELCD/9-474.QLIVDDGGDATLLIHRGVERERAYARTGKVPE...ISHD......NKELSIVDALLNRQLLV.DAEYWQRMATG...LL
D0LJJ9_HALO1/23-511.NLILDDGGDATLLVHLGAE....CEHKGSIPEVSSTP........VEEERVILSLLHAVRAERGDNFWRPLAAK...IR
F0XY15_AURAN/5-479.DLIVDDGGDMTLLVHEGFKAENAYAKDGTLPD..PSSTD......NAEFKIVLTIIKRTLPT.QPDKWHKVAAR...MK
C5K5D1_PERM5/3-480.DLIVDDGGDATLLIHEGVKAEKAYKESKVIPN..PDAEG......NAEFKCVLTILKQGIERGELDKWTKMASK...IV
SAHH_METCA/12-471.NMILDDGGDATLLVTLGARA...EKDA.SLLA...NPTC......EEEEVLFAAIRKRLAAK.P.GWYSRIQAG...IK
B7FT14_PHATC/5-480.DLIVDDGGDMTLLIHEGKKAEDQFLKDGTVPD..PSSTD......NAEFKIVLTIIKRLLEGGETDKWNKIASR...CK
W0IVC4_9BACT/19-482.QLVVDDGGDVTLLLHKGYE....LEHGSDWIH...TPSA......SHEEQVIKNLLGRIHAS.DTGIFTRIASA...WR
D7E778_METEZ/5-466.HLIVDDGGDATLMMHRGYEA...ED.NPSILD...EPTE......NKDLMAQNKILKDSQAE.DPQFWHKAVAE...WK
C4LU18_ENTHI/5-465.QIIVDDGGDATLMIHTGYH....AE..........EHPEILDVKGTEEVNALHNVLKKQLKE.NPRFWHNILPE...IR
B2UR10_AKKM8/7-470.QLIVDDGGDATLLIHRGYEM...EE.GSDWVD...TPSE......SEEEEVVKALLKKIAAA.TPGIFHRWLPE...LK
D5MJ17_9BACT/14-479.QLIVDDGGDATLLIHWGVKA...EK.DASFLD...RTPE......SEEEGCILNLLRKTLKS.HPGLWTRISKE...WK
E1QFH0_DESB2/14-475.NLVVDDGGDATLLIHKGYYA...EK.NPALLD...EPTD......DKELKCVIDVLRRMQAQ.NPRHWHGVVAD...WK
D6Z0B0_DESAT/10-434.NMILDDGGDLTQIMHE..................................................KYPELMKD...VK
F4GUC2_PUSST/14-474.NMILDDGGDATTLLHLGAKA...ENDI.SVLD...KPGS......EEERVLFASIKAQLARD.A.KWYSTRLAQ...VR
SAHH_LEPIN/11-435.NMILDDGGDLTAYIHE..................................................KYPKLLSE...IR
B4RBP7_PHEZH/3-462.NMILDDGGDATLLCVLGPKA...EADP.SILN...NPQN......EEEEALYTVMKRYLKEK.P.GFYSAIRAA...IK
C1EH64_MICSR/17-486LDIIVDDGGDATLLIHEGYKAEIEFEKSGAKPD..PSTTD......NAEMKLVLKTIAENLDK.DPKRWHKIVST...CV
D5BW57_NITHN/12-436.NMLLDDGGDLTAVMHE..................................................RYPEILEG...VR
E1WZA8_BACMS/5-430.NMILDDGGDLTNMVHD..................................................KFPELIEG...IK
V6F3C0_9PROT/3-464.NMILDDGGDATLLIHLGMRA...EK.DLSVLA...NPTC......EEEEVLFASIKKKLETD.P.TFYTRNGVA...IR
Q2L174_BORA1/11-472.NMILDDGGDATLLLHLGTKA...ESDP.SVLA...NPGS......EEERVLFAAIKETLARD.P.KWYSTRLSQ...IK
A9GFA1_SORC5/8-437.NMILDDGGDLTIVAHE..................................................KHPELFTGADPIR
D2W1E4_NAEGR/11-472.QLIVDDGGDMTLLVHRGYQ....AEKDASILE...SDGG......VEELRIVNDLLKRILKE.EPGFFHAIVPH...IK
B1ZZ56_OPITP/11-473.QLVVDDGGDVTLLIHKGCEL...EE.GSDWAN...TASA......SHEEQVIKDLLKRVHAQ.DPLFWTKMAKE...WR
W0BHF8_9GAMM/12-436.NMLLDDGGDLTQIIHN..................................................KYTHLLEG...IK
S6AB36_9PROT/9-467.NMILDDGGDATLLLHLGTRA...ESDI.SVIA...KPTC......EEERVLFAAIKAKLTTS.P.GWYSARIKH...IK
G7Z7L3_AZOL4/7-431.NMILDDGGDVTQIMHD..................................................KYPEMLDG...VR
G4R9F7_PELHB/6-465.NMILDDGGDATMLVLIGARA...ETDP.SVLA...NPSN......EEEEELFKVIKRRLEKE.P.GFYSKCRAA...IK
E6W439_DESIS/5-431.NLLLDDGGDLTEVVHR..................................................DYPQLCQE...IK
A0LCX4_MAGSM/15-440.NMILDDGGDLTEILHR.................................................PEYVEIMKG...VR
V5S8R2_9RHIZ/6-467.NMILDDGGDATLYIHLGVRA...EGGDTAFLD...KAGS......EEEEVLFALIRKTLSEK.PKGWFGTVAKA...IK
C7R7A8_KANKD/3-464.NMILDDGGDATTLLILGTRA...EKDI.SVLD...NPKS......EEEVALFKAIKVKLSED.S.DFYSRTLAN...IQ
W8L8P3_HALHR/11-470.NMILDDGGDATLLIHLGARA...EKDL.SLVD...NPTN......DEERVLFAQIKERVKSQ.P.GWYSKVLKN...IQ
SAHH_RHOCB/3-462.NMILDDGGDATLYILLGARV...EAGETDLIA...TPTS......EEEVCLFNQIKKRMVES.P.GWFTQQRAA...IK
I1XLP2_METNJ/11-435.NMILDDGGDLTTMMHQ..................................................DYPELLAD...VK
SAHH_RHILO/6-465.NMILDDGGDATMYILIGARA...EAGE.DVLS...NPQS......EEEEYFYAQVKKRLKAS.P.GFFTKQKAA...IR
E3I6Z6_RHOVT/4-465.NMILDDGGDATLIVLLGAEA...ETNP.AVLE...NPHS......EEEASLFKTIKARLAKT.P.GWYSKVKAN...IK
H6L1E3_SAPGL/8-437.NMILDDGGDLTNVVLD..................................................KYPEMAKG...VF
D5BCE6_ZUNPS/5-432.NMILDDGGDLTNMVLD..................................................KYPELAKD...VK
E8UEX5_TAYEM/4-465ANMILDDGGDATLLLHLGTRA...EGEP.ECIA...NPTS......EEERVLYAAIKAKLQED.P.NWYSKRIKH...IK
F8GKE5_NITSI/14-476.NMILDDGGDATLLLILGTKA...EKNP.TVIA...NPTN......EEETVLFASIRNKLSSQ.P.NWYSSNLAR...IR
Q0A6D2_ALKEH/11-469.NMILDDGGDATLLLNLGAKA...EQDA.SVLD...NPGS......DEEKALFVAIRNRLESQ.P.GWYSERLAA...IQ
SAHH_MARMM/9-468.NMILDDGGDATMYLILGEKA...ENDP.SVLN...HPKS......EEETFLFAQIKKRIAAT.P.GWFAKAKAA...IQ
SAHH_HALHL/5-429.NMLLDDGGDLTAVIHE..................................................QYPDMMKD...IY
G4SUH2_META2/5-429.NMILDDGGDLTLMMHQ..................................................QYPELMAD...VK
SAHH_BURXL/13-472.NMILDDGGDATLLLILGSKA...EKDR.SVIS...KPTN......EEEVALYKSIERHLDAD.P.TWYSTRLAH...IK
W5XC25_9BACT/19-478.NLILDDGGDATLLVLLGSRA...EEDA.SVIS...NPTN......EEEVALYASIKKRLAEK.P.GYYARLKEA...IK
SAHH_HYPNA/9-468.NLILDDGGDATMYLILGEKA...ESDP.SFLE...KPTS......EEEKYFFAQIKKRLTAS.P.GWFKKTKAG...VR
M4S945_9SPHN/11-468.NMILDDGGDATMFALWGARV...EAGE.A.LF...TPSN......EEEEIFVATLKRFLAER.P.GYLTETVKA...IK
SAHH_SYNPW/16-475.NMILDDGGDATGLVMLGSKA...EQDI.TVLD...NPGN......EEETFLFASIKKKLAQD.P.TFYSRTKAQ...IQ
A7HPA7_PARL1/11-471.NMILDDGGDATLLIHLGKRA...EEGDVAFLE...TPGN......EEEEILFAAIKRRLKHK.P.GFYSQIAKS...VR
SAHH_RALME/10-471.NMILDDGGDATLLLHLGARA...EKDA.SLIA...KPTS......EEETFLFAAIKEKLAKD.S.TWYSRNLAA...IR
Q09BK3_STIAD/11-470.NMILDDGGDATLLVHLGSQA...EKDP.SVLT...NPGS......EEEKVLFASIKKRLETK.P.GWYSKVAQS...IL
I4AIU9_FLELS/9-439.NMILDDGGDLTNMVLD..................................................RYPELVAG...IG
SAHH_BARHE/5-464.NLILDDGADATNYILMGSRA...ETNK.DILS...HPKT......EEEELFFKQIQRRMEAT.P.GFFTRQRAA...IK
F2IVA0_POLGS/3-461.NMILDDGGDATLYILLGARV...EAGETDLIA...NPKS......EEEECLFAQIKKRMAKN.P.GWFTRQRGL...IK
SAHH_DICDI/5-430.NMILDDGGDLTNLVHE..................................................KYPQFLAG...IK
Q4P829_USTMA/3-430.NMILDDGGDLTWLVHD..................................................KHPQLLEQ...IK
B3QUB9_CHLT3/8-434.NMILDDGGDLTEMVFE..................................................KFPELVPG...IK
SAHH_ACISJ/10-475.NMILDDGGDATLLMHLGKRA...EKDA.SVLA...HPGS......EEERILFAAIKAKLAED.S.TWYSRKSAQ...II
SAHH_COXBU/13-437.NLLLDDGGDLTAHTLQ..................................................KHPELCQN...IR
U9U9F5_RHIID/3-430.NMILDDGGDLTSLVHN..................................................KHPELLKD...IK
SAHH_PLAF7/5-478.DMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPEKAK........NEEERCFLTLLKNSILK.NPKKWTNIAKK...II
R7KIX3_9BURK/4-463.NMILDDGGDATLLLHLGAQA...EENH.SVIE...HPKS......DEEKALFAAIDRHLKED.P.QWYSKRIVH...IK
E4TS79_MARTH/6-432.NMILDDGGDLTNMVLD..................................................NYPELADG...IN
F2IAQ7_FLUTR/9-436.NMILDDGGDLTNMVFD..................................................RFPELTAG...IR
SAHH_METPP/12-476.NMILDDGGDATLLMHLGQKA...EKDP.SVIS...KPTS......EEETCLFAAIKAKLAQD.P.TWYTRKSAQ...II
U1MPL7_ASCSU/7-436.NMILDDGGDLTNLIHQ..................................................KHPEYLPG...IY
F6XCK4_CIOIN/7-437.NMILDDGGDLTNLVHE..................................................KYPQFLPG...IK
Q5FRZ9_GLUOX/12-437.NMILDDGGDLTIMMHD..................................................KYPEMLKD...VR
K7YQ52_9PROT/6-430.NMLLDDGGDLTKIMHE..................................................KYPELLNN...IR
J9YYB1_9PROT/2-425.NMILDDGGDLTLRMHE..................................................KYPELLKN...IK
F2I015_PELSM/10-434.NMILDDGGDLTDLMHK..................................................EYSHLLKD...VK
E0TE34_PARBH/4-465.NMILDDGGDATMLILLGSEA...ETDP.SVLD...NPGN......EEERIVFETIKRRLARD.P.GFYSRVKAS...IK
I1C1Z9_RHIO9/6-432.NMILDDGGDLTNIVHQ..................................................KYPHLLPG...IK
E9CHK0_CAPO3/6-431.NMILDDGGDLTNVVHD..................................................KYPQYLAG...IR
S9X649_SCHCR/5-432.NMILDDGGDLTALVHE..................................................RHPELLVD...IR
D5BTB0_PUNMI/4-463.NMILDDGGDATMYILLGARA...EAGE.TVLA...HPAS......EEEEYLKAQLETRLAAS.P.GWFTKQRDA...IK
Q4Q124_LEIMA/3-436.NMILDDGGDLTNLVID..................................................RYPELVPK...IF
Q2NB41_ERYLH/6-468.NLILDDGGDATMFALWGARI...EAGE.E.MP...EPAN......AEEIEMQRALKAFVKDK.P.GYLTRSVKN...IV
T1K9L8_TETUR/5-432.NMILDDGGDLTNHIHE..................................................KYPQLLSG...IK
B3RVD8_TRIAD/6-432.NMILDDGGDLTNLVHQ..................................................KYPQFIPG...IR
H3EHZ4_PRIPA/5-433.NMILDDGGDLTNIVHA..................................................KYPQYLAD...IR
R4XBF9_TAPDE/4-432.NMILDDGGDLTALVHE..................................................KYPEMLND...CR
M7NIB1_PNEMU/6-434.NMILDDGGDLTSLVHN..................................................KYPEYLEN...CK
S5R4D1_9PROT/14-476.NMILDDGGDATFLLHLGAQ....AE..........NNISILSNPCSEEEVCLFKSIKNKLKI.DSKWYSSRLKQ...IK
K0C550_ALCDB/10-461.NMILDDGGDLTAYIHD..................................................TYPEMLDN...IH
SAHH_PSEMY/12-468.NMVLDDGGDLTEILHK..................................................KYPQMLER...IH
SAHH_PSEU5/12-467.NMVLDDGGDLTQILHD..................................................KYPQVLER...VH
C5BTQ5_TERTT/11-461.NMILDDGGDLTQVVHD..................................................KYHAMLDN...IH
B1XI71_SYNP2/9-457.NMILDDGGDLTGYIHT..................................................TYPEMLSR...IH
E1VQZ0_9GAMM/8-458.NMVLDDGGDLTEVLHD..................................................KYPQMLDA...IH
A1U548_MARAV/13-463.NMILDDGGDLTELLHK..................................................EYPQVIAK...CH
Q5R045_IDILO/8-458.NMILDDGGDLTLMIHD..................................................EFPQMLEK...VH
SAHH_ACIAD/17-466.NMILDDGGDLTALVHE..................................................KYPTLLDH...IH
Q4FT37_PSYA2/19-473.NLILDDGGDLTALIHN..................................................DYAELLDN...IH
W4VUN6_ATTCE/58-483.NMILDDGGDATHLMLK..................................................KYNAMFKM...IQ
SAHH2_DROME/67-491.NLILDDGGDATHLMLK..................................................KYPDYFKA...IR
A1AX10_RUTMC/19-464.NMVLDDGGDLTQTLHE..................................................KYPEMLDN...IH
F6SNC6_CIOIN/38-463.NMILDDGGDLTHSIIK..................................................KYQTIFRG...MK
Q7QE71_ANOGA/31-458.NMILDDGGDATHLMLK..................................................KYPVMFKM...IK
A7SRK8_NEMVE/53-478.NMVLDDGGDATHLMYK..................................................KFNGTFNT...LK
E4XGP7_OIKDI/72-497.NLILDDGGDATHFMLR..................................................HHPNLFKK...II
I3KBV8_ORENI/75-500.NMILDDGGDLTDWIYK..................................................KYPELFKN...LK
K7DYH7_DANRE/71-496.NMILDDGGDMTHWIYK..................................................KYPHIFKK...VK
H2KNW6_CLOSI/142-567.NVVLDDGGDLTHRLHK..................................................EYPDLLSG...VR
H3D3K6_TETNG/64-489.NMVLDDGGDLTHWIHE..................................................KHPSLFQT...LK
B3RUN3_TRIAD/31-456.NLILDNGGDATHYMKR..................................................KYIDKFRC...LK
W5K360_ASTMX/86-511.NLILDDGGDLTHWIYR..................................................KYPQLFEN...IK
H0W4G1_CAVPO/66-492.LQILDDGGDLTHWIYK..................................................KYPNMFKK...IK

PF00389

Q9JY94_NEIMB/3-329-NVDLKAAEELGLKVVR-------------------------------------------------------------VP
SERA_ARATH/85-394-NVDLQAATEHGCLVVN-------------------------------------------------------------AP
Q9RUU0_DEIRA/18-329-NIDLEYASRRGLLVLN-------------------------------------------------------------AP
Q98F95_RHILO/5-315-NVDIPAASRKGIIVMN-------------------------------------------------------------TP
E9ACF1_LEIMA/115-427-QVDLDYATTRGVAVFN-------------------------------------------------------------SP
Q9KEA4_BACHD/2-311-QLPFQAIKEKGIIVTN-------------------------------------------------------------AK
O28495_ARCFU/4-322-NIDVEAAKKLSITVAN-------------------------------------------------------------VG
Q9KLW1_VIBCH/3-321-HIDVALCERYGVTVLE-------------------------------------------------------------GI
Q9CKF1_PASMU/14-327-QVNLQAAKLRGIPVFN-------------------------------------------------------------AP
SERA_ARCFU/3-312-NIDINAATQRGIVVVN-------------------------------------------------------------AP
CTBP_DROME/30-352-NIDVKAAGELGIAVCN-------------------------------------------------------------VP
Q9VKI8_DROME/8-324-NIDVPAATAQNVVVLN-------------------------------------------------------------TP
Q97IU7_CLOAB/3-326-HIDIKKAKELRIGVGN-------------------------------------------------------------VT
YEAA_SCHPO/9-327-TVDVAACTARGIQVSH-------------------------------------------------------------VP
Q9KP92_VIBCH/13-326-QVDLNAAAKRGIPVFN-------------------------------------------------------------AP
Q9I1L0_PSEAE/4-318-NYDIDYLDRRGILLSN-------------------------------------------------------------TP
Q98BH4_RHILO/9-329-KIDVAAAAKKGITVTN-------------------------------------------------------------TP
P74586_SYNY3/3-330-NVDLKTAADLGLKVVH-------------------------------------------------------------VP
DDH_ZYMMO/3-331-NVDLDAAKKLNIKVVR-------------------------------------------------------------VP
TKRA_BACSU/6-322-NFDIEAMKERGVVGTH-------------------------------------------------------------TP
Q9A244_CAUCR/24-340-NIDVATANARGIIVTN-------------------------------------------------------------TP
SERA_SCHPO/58-378-QVDLDFAAERGIAVFN-------------------------------------------------------------SP
GYAR_THELN/5-322-NIDIEEATKRGIYVTN-------------------------------------------------------------TP
Q98LH4_RHILO/9-326-SIDIDAATEHGILVSS-------------------------------------------------------------TP
Q9S2M5_STRCO/3-328-NVDLDTADRLGMTVAR-------------------------------------------------------------VS
SERA_METJA/4-312-NIDVEAATEKGIIVVN-------------------------------------------------------------AP
LDHD_STRP1/3-330-MYNLDLATENDIIITN-------------------------------------------------------------VP
HPR3_ARATH/9-321-HIDLAACKRRGIVITN-------------------------------------------------------------AG
Q9HXB7_PSEAE/5-318-NYDLDYLNRRGIALTN-------------------------------------------------------------TP
O67741_AQUAE/4-320-NVDIEEATKRGILVVN-------------------------------------------------------------TP
SERA_METTH/6-313-NVDVKAATDRGIMVIN-------------------------------------------------------------AP
DDH2_SCHPO/3-330-NVNLKAASEYKITVVH-------------------------------------------------------------VP
HPR2_ARATH/6-313-KIDLGKCKEKGIRVTN-------------------------------------------------------------TP
LDHD_ECOLI/3-329-NVDLDAAKELGLKVVR-------------------------------------------------------------VP
SERA_RAT/9-317-NVDLEAATRKGVLVMN-------------------------------------------------------------TP
Q9A6E7_CAUCR/11-318-GVDVPWCKAHGIAVTH-------------------------------------------------------------ST
Q9HMR0_HALSA/3-311-NIDIDAATDHGVMVAN-------------------------------------------------------------AP
Q9WYG2_THEMA/4-311-NIDLEAATKKGIPVTI-------------------------------------------------------------TA
CTBP2_RAT/36-358-NVDIKAAGELGIAVCN-------------------------------------------------------------IP
Q9PBD8_XYLFA/15-328-QVDLDTAELSGIPVFN-------------------------------------------------------------AP
Q89388_PBCV1/32-362-RLDIEYAKELGFNVYR-------------------------------------------------------------VP
LDHD_TREPA/3-330-MYNATLLKKHGIRLTN-------------------------------------------------------------VP
Q97MV2_CLOAB/3-317-HVELSALNNKEVVVSN-------------------------------------------------------------AS
Q97U35_SULSO/2-295-DLDFSIIPSH.VKVFS-------------------------------------------------------------NA
Q9A3I9_CAUCR/6-314-NVDIPAATAKGIVVMN-------------------------------------------------------------TP
Q9RKF9_STRCO/17-329-SVDVEAATRRGILVCN-------------------------------------------------------------VP
Q9LT69_ARATH/49-358-NVDLAAATEYGCLVVN-------------------------------------------------------------AP
GYAR_AERPE/6-324-NIDVECATRLGIYVTN-------------------------------------------------------------TP
DDH_HAEIN/3-329-NVDLKAAQELGIQVVR-------------------------------------------------------------VP
O17626_CAEEL/8-316-NIDVPAASANKILVMN-------------------------------------------------------------TP
PDXB_PSEAE/3-285-HLDLDYFAEAGIAWSS-------------------------------------------------------------AP
SERA_YEAST/61-381-QVDLDYATSRGIAVFN-------------------------------------------------------------SP
YGDH_SCHPO/9-332-NVDVDWATRNGVYVAN-------------------------------------------------------------TP
CTBP1_CAEEL/181-504-NIDVKAATELGIAVCH-------------------------------------------------------------AP
Q9KCG9_BACHD/20-325-NIDIDAATKHGIVVVN-------------------------------------------------------------AP
SERA_MYCLE/6-313-NVDVDAATARGVLVVN-------------------------------------------------------------AP
Q9I530_PSEAE/3-328-HVDLAAAEALGLPVVH-------------------------------------------------------------VP
Q9VII9_DROME/10-326-FVDIPEFQKRGIPLGH-------------------------------------------------------------TP
O66939_AQUAE/3-332-HIDLDYCKKKGILVTH-------------------------------------------------------------IP
Q9HVG5_PSEAE/7-321-NIDLAAARERGIVVAN-------------------------------------------------------------CH
Q98CG2_RHILO/11-318-SVDVGHAAAKNIMVTN-------------------------------------------------------------TP
GRHPR_HUMAN/9-327-HLALDEIKKRGIRVGY-------------------------------------------------------------TP
Q9KMX4_VIBCH/4-330-KVDLEAAKRLGMQVVR-------------------------------------------------------------VP
Q9K7P7_BACHD/3-318-NIDIKEATKRGVSVGH-------------------------------------------------------------TP
Q9I6H5_PSEAE/13-326-QVDLNAARERGIAVFN-------------------------------------------------------------AP
Q9HK29_THEAC/3-309-NVDMNAMKKNGIMVSN-------------------------------------------------------------IP
Q98GE4_RHILO/8-315-MIPMEAATAAGVLVAN-------------------------------------------------------------VP
DDH1_SCHPO/3-330-NVDLKAAADNGITVVR-------------------------------------------------------------VP
PDXB_VIBCH/3-286-HVDQALLRERGIFFTA-------------------------------------------------------------AP
DHGY_METEA/5-313-VVDKAAAKAQGITVVN-------------------------------------------------------------IR
Q97ZK1_SULSO/20-326-NIDTEEASKRNIKIVY-------------------------------------------------------------AP
Q97F10_CLOAB/3-323-VVDLEFAKKKGIVVTN-------------------------------------------------------------IP
Q9Z564_STRCO/7-314-NVDVSAATKAGVMVVN-------------------------------------------------------------AP
SERA_SYNY3/32-339-NIDVPAATRQGIVVVN-------------------------------------------------------------SP
A6TI50_KLEP7/6-326-NFDVDACTARGVWLTF-------------------------------------------------------------VP
B0JPW3_MICAN/19-330-SIDIMAATEQGVIVVN-------------------------------------------------------------NP
G1UB05_LACJO/8-330-NIDMDKAKELGFEITN-------------------------------------------------------------VP
N0B2T1_9RHIZ/6-319-HIDLDACKARGIKVGN-------------------------------------------------------------AP
O25158_HELPY/4-314-NIDLESCSQKGIVVMN-------------------------------------------------------------IP
SERA_ECOLI/14-326-QVDLDAAAKRGIPVFN-------------------------------------------------------------AP
GHRB_ECOLI/5-319-NFDVDALTARKILLMH-------------------------------------------------------------TP
Q03CR3_LACC3/8-328-NIDMTAMKQYGIRLSN-------------------------------------------------------------VP
Q03VC9_LEUMM/6-329-NIDFDAAREFNFNISN-------------------------------------------------------------VP
Q1GAA2_LACDA/5-332-TINFDWTKKYNLLVTN-------------------------------------------------------------VP
Q2FV62_STAA8/9-332-TYDLELANKYNFIVSN-------------------------------------------------------------VP
Y2577_STAA8/5-317-NIDIEYAREKSIDVTN-------------------------------------------------------------TP
Q2FXK1_STAA8/6-315-NINIDAATLKGILVIN-------------------------------------------------------------AP
Q7W0H7_BORPE/11-324-QVDLDAAMMRGVPVFN-------------------------------------------------------------AP
LDHD_LACPL/6-329-NLDVPTVKARGLNISN-------------------------------------------------------------VP

PF05222

Q3A7G8_PELCD/4-137-T...R...EYRVAM---------------------------------------------------------------TP
NNTM_BOVIN/60-199-Q...N...EKRVAL---------------------------------------------------------------SP
Q0VPX1_ALCBS/24-165-P...G...EQRVAL---------------------------------------------------------------TP
Q3J1C2_RHOS4/4-139-E...G...EARVAM---------------------------------------------------------------TP
LYS1_ASHGO/6-141-M.......EARAAL---------------------------------------------------------------TP
Q28V87_JANSC/4-137-P...Q...EFRVGI---------------------------------------------------------------TP
Q2G7Q1_NOVAD/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q6AQV0_DESPS/4-137-I...K...EDRVCM---------------------------------------------------------------TP
Q82QU1_STRAW/15-145-S...G...ETRVAA---------------------------------------------------------------TP
Q3B540_PELLD/4-135-T...A...ETRVAC---------------------------------------------------------------TP
DHA_OCEIH/4-136-N...N...ENRVAM---------------------------------------------------------------TP
Q0S884_RHOSR/4-137-N...H...EYRVAI---------------------------------------------------------------SP
A0KQF4_AERHH/4-135-A...G...ETRVAA---------------------------------------------------------------TP
Q9KAF8_BACHD/4-136-N...N...ENRVAM---------------------------------------------------------------TP
A6VXM0_MARMS/6-147-E...G...ELRVAM---------------------------------------------------------------TP
Q3JE74_NITOC/4-136-T...L...EGRVAL---------------------------------------------------------------VP
B1YFJ0_EXIS2/4-136-N...N...ENRVAL---------------------------------------------------------------TP
A5GEE8_GEOUR/4-135-K...E...EYRVAL---------------------------------------------------------------TP
A5FP13_FLAJ1/4-137-N...N...ENRVAL---------------------------------------------------------------TP
Q98CE6_RHILO/6-139-A...N...EPRVAA---------------------------------------------------------------SP
Q31MC9_SYNE7/4-136-D...Q...EFRVGL---------------------------------------------------------------SP
Q6NYQ7_DANRE/56-195-Q...N...ERRVAI---------------------------------------------------------------SP
Q5KHJ2_CRYNJ/22-157-F.......EHRSAL---------------------------------------------------------------TP
Q2IDX0_ANADE/4-138-P...G...ERRVAL---------------------------------------------------------------VP
Q21L93_SACD2/6-141-L...G...ESRVAI---------------------------------------------------------------AP
A0QNT0_MYCS2/5-135-E...G...ERRVAL---------------------------------------------------------------VP
Q1GUI4_SPHAL/4-138-A...G...ETRVAA---------------------------------------------------------------TP
Q0AQT6_MARMM/4-137-V...R...EYRVGL---------------------------------------------------------------TP
Q18031_CAEEL/32-165-P...G...EKRVSL---------------------------------------------------------------SP
Q47E46_DECAR/4-137-N...N...EYRVGL---------------------------------------------------------------TP
Q39WN5_GEOMG/4-135-T...H...EYRVGM---------------------------------------------------------------TP
Q3SL22_THIDA/4-136-D...H...EYRVAL---------------------------------------------------------------TP
Q6W1Y1_RHISN/6-139-P...D...EPRVAG---------------------------------------------------------------SP
Q67ND6_SYMTH/4-137-A...Y...ENRVAM---------------------------------------------------------------TP
Q5SLT7_THET8/5-139-P...G...ERRVAL---------------------------------------------------------------VP
A0KEW0_AERHH/4-137-N...H...EYRVGM---------------------------------------------------------------TP
Q47BC9_DECAR/6-139-D...G...ESRTAL---------------------------------------------------------------SP
Q8DL05_THEEB/4-139-V...G...EQRVAL---------------------------------------------------------------IP
Q28M63_JANSC/4-139-A...G...EARVAM---------------------------------------------------------------TP
Q2RN15_RHORT/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q0C3J7_HYPNA/4-137-K...Q...ESRVGL---------------------------------------------------------------TP
Q2S445_SALRD/35-169-N...E...EQRVAL---------------------------------------------------------------AP
A1SSF5_PSYIN/4-138-E...N...ENRVAA---------------------------------------------------------------TP
Q5Z133_NOCFA/18-148-A...G...ERRVAL---------------------------------------------------------------VP
Q5WJZ9_BACSK/4-136-S...Y...ENRVAI---------------------------------------------------------------TP
A0L9H7_MAGSM/4-145-P...G...ERRVAA---------------------------------------------------------------SP
Q6W1J9_RHISN/4-139-G...G...EARVAM---------------------------------------------------------------TP
PNTA_HAEIN/4-137-E...N...ESRVAA---------------------------------------------------------------TP
Q6AEY9_LEIXX/4-137-N...N...EFRVAI---------------------------------------------------------------TP
Q6ACH0_LEIXX/6-139-P...G...ERRVAL---------------------------------------------------------------VP
A8GEZ6_SERP5/4-137-A...N...EARVAA---------------------------------------------------------------TP
Q5LFH6_BACFN/4-137-N...N...ENRVGM---------------------------------------------------------------TP
A5FFU7_FLAJ1/32-165-Y...Q...ERRICL---------------------------------------------------------------TP
A0K2E1_ARTS2/12-145-E...G...ERRVAG---------------------------------------------------------------TP
A0QNN8_MYCS2/4-137-P...G...ETRVAA---------------------------------------------------------------TP
Q5YZC0_NOCFA/4-137-A...Q...EFRVAL---------------------------------------------------------------TP
P72775_SYNY3/4-136-D...Q...EFRVGL---------------------------------------------------------------TP
Q603N5_METCA/4-139-P...G...ERRVAT---------------------------------------------------------------TP
Q2N774_ERYLH/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q1J0B1_DEIGD/4-135-V...K...ENRVAL---------------------------------------------------------------TP
Q2HFZ2_CHAGB/7-141-L.......EHRSAL---------------------------------------------------------------TP
LYS1_YEAST/7-142-L.......EARAAL---------------------------------------------------------------TP
Q5LPM8_RUEPO/4-139-E...G...ENRVAM---------------------------------------------------------------TP
Q65CX6_BACLD/4-136-N...N...ENRVAI---------------------------------------------------------------TP
Q1QUL9_CHRSD/4-139-Q...G...EARVAL---------------------------------------------------------------TP
Q2J8T8_FRASC/7-142-P...G...ERRVAM---------------------------------------------------------------VP
A4Y0R2_PSEMY/4-136-A...G...ETRVAA---------------------------------------------------------------TP
Q11TK3_CYTH3/4-137-N...R...EFRVSL---------------------------------------------------------------TP
A0CWD3_PARTE/29-161-P...N...ENRVAA---------------------------------------------------------------TP
Q2SHR3_HAHCH/4-137-P...H...EKRVAA---------------------------------------------------------------TP
A6VN40_ACTSZ/4-137-N...G...ETRVAA---------------------------------------------------------------TP
A8ZXI3_DESOH/4-137-T...E...EHRVAM---------------------------------------------------------------TP
A5FVY5_ACICJ/4-137-N...N...EFRVGL---------------------------------------------------------------TP
Q8DQ43_STRR6/4-136-N...N...ENCVAL---------------------------------------------------------------TP
Q9K827_BACHD/4-136-N...N...ENRVAI---------------------------------------------------------------TP
Q5CI32_CRYHO/405-540-P...S...EKLVAI---------------------------------------------------------------AP
Q0SD61_RHOSR/4-134-A...G...ETRVAA---------------------------------------------------------------TP
Q11PQ8_CYTH3/7-139-P...S...DRRVPL---------------------------------------------------------------LP
Q2NSW2_SODGM/4-137-A...N...EARVAA---------------------------------------------------------------TP
Q8DH53_THEEB/4-139-D...Q...EFRVGL---------------------------------------------------------------TP
Q2W3E7_MAGSA/6-142-P...N...EKRVAS---------------------------------------------------------------VP
A0L3P1_MAGSM/4-137-N...Q...ENRVAL---------------------------------------------------------------TP
Q0A4X6_ALKEH/6-139-P...G...ERRVAL---------------------------------------------------------------AP
Q6MKC3_BDEBA/4-137-I...S...ENRVGL---------------------------------------------------------------TE
Q2LSK0_SYNAS/44-177-D...H...EYRVAL---------------------------------------------------------------TP
Q163M5_ROSDO/4-139-E...G...EARVAM---------------------------------------------------------------TP
A9CHR5_AGRT5/4-139-E...G...EARVGM---------------------------------------------------------------TP
Q74AR0_GEOSL/4-135-V...H...EYRVGM---------------------------------------------------------------TP
Q3B571_PELLD/35-169-Q...D...ERRVAI---------------------------------------------------------------SP
Q6A5I3_PROAC/4-137-N...S...EFRVAV---------------------------------------------------------------TP
Q54P64_DICDI/8-138-R...W...ERRAPL---------------------------------------------------------------AP
B4S6Q3_PROA2/35-169-N...D...ERRVAI---------------------------------------------------------------SP
Q0ALL0_MARMM/4-137-A...G...ETRVAA---------------------------------------------------------------TP
Q2VYN4_MAGSA/13-146-S...H...EYRVGL---------------------------------------------------------------TP
Q1AS10_RUBXD/6-139-D...K...EGRVSL---------------------------------------------------------------QP
Q82M72_STRAW/7-141-T.......ERRTPV---------------------------------------------------------------VP
Q7VB57_PROMA/5-141-S...G...ETRVAA---------------------------------------------------------------TP
Q1GL71_RUEST/4-137-P...Q...EFRVGM---------------------------------------------------------------TP
Q10ZM3_TRIEI/4-136-D...Q...EFRVGL---------------------------------------------------------------TP
A0JVY4_ARTS2/5-137-G...R...ETRVAA---------------------------------------------------------------TP
Q15T10_PSEA6/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q5FU53_GLUOX/6-140-G...G...ERRVAL---------------------------------------------------------------IP
A2E4I0_TRIVA/4-138-D...H...EFRVSI---------------------------------------------------------------TP
Q0SAT6_RHOSR/4-137-N...H...EYRVAA---------------------------------------------------------------TP
DHA_BACSU/4-135-N...N...ENRVAL---------------------------------------------------------------TP
Q2YIM6_BRUA2/6-139-P...N...ETRVAG---------------------------------------------------------------SA
B9M3R5_GEODF/4-135-Q...H...EYRVSL---------------------------------------------------------------TP
Q5SLS7_THET8/4-135-T...L...ENRVAL---------------------------------------------------------------TP
Q6MUG7_MYCMS/10-140-Q...N...ENRVGI---------------------------------------------------------------TP
Q21RZ9_ALBFT/27-163-P...G...EKRVAT---------------------------------------------------------------VP
Q0K0H4_CUPNH/6-146-P...G...ERRVAA---------------------------------------------------------------TP
Q47FY5_DECAR/6-139-P...G...EHRAAI---------------------------------------------------------------VP
A1SJK7_NOCSJ/4-137-N...N...EYRVAI---------------------------------------------------------------TP
Q7UIW1_RHOBA/5-140-P...G...EARVAL---------------------------------------------------------------VP
LYS1_SCHPO/7-142-L.......EERSAL---------------------------------------------------------------TP
Q3JEF4_NITOC/4-145-R...G...EKRVAT---------------------------------------------------------------TP
A1WCT5_ACISJ/4-136-A...G...ETRVAA---------------------------------------------------------------TP
O25948_HELPY/4-135-D...L...ESRVAL---------------------------------------------------------------VP
A1C559_ASPCL/85-224-P...N...ERRVAV---------------------------------------------------------------TP
Q55F30_DICDI/135-275-Q...N...EKRVSM---------------------------------------------------------------TP
Q2G790_NOVAD/8-140-T...G...ETRVSA---------------------------------------------------------------TP
Q7NWG7_CHRVO/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q1GKH6_RUEST/5-139-N.......EDRVGL---------------------------------------------------------------TP
Q1GVP3_SPHAL/4-137-N...H...EYRVGL---------------------------------------------------------------TP
A1K465_AZOSB/6-138-P...G...ERRLPV---------------------------------------------------------------VP
A5FAH7_FLAJ1/4-136-P...P...DRRVVF---------------------------------------------------------------SP
Q6KIJ0_MYCMO/4-134-N...N...EFRIGV---------------------------------------------------------------TP
Q8EPC2_OCEIH/4-136-N...N...ENRVAI---------------------------------------------------------------AP
Q1ARY0_RUBXD/7-141-E...G...ERRVGL---------------------------------------------------------------VP
Q6LMW4_PHOPR/33-171-SPENPGGLEKRVAL---------------------------------------------------------------VP
A5G0H4_ACICJ/5-140-P...G...ETRVAA---------------------------------------------------------------VP
A5V5I3_SPHWW/4-142-A...G...ESRVSA---------------------------------------------------------------TP
Q7NEB1_GLOVI/4-136-D...Q...EFRVGL---------------------------------------------------------------TP
Q60BB4_METCA/4-135-D...L...ENRVAV---------------------------------------------------------------TP
A1TXK5_MARAV/4-139-D...G...ENRVAI---------------------------------------------------------------IP
Q1IIW3_KORVE/4-145-P...G...ERRVAL---------------------------------------------------------------TP
A7HTE3_PARL1/4-137-I...H...EYRVGM---------------------------------------------------------------TP
Q3APE7_CHLCH/6-140-Q...D...ERRVAL---------------------------------------------------------------SP
Q5P1Y9_AROAE/6-139-P...G...ERRLSV---------------------------------------------------------------VP
Q8KEI3_CHLTE/17-148-I...R...ETRVAC---------------------------------------------------------------TP
Q2S0H0_SALRD/6-141-P...G...ETRVAL---------------------------------------------------------------VP
A8LIC1_DINSH/19-154-P...G...ENRVAM---------------------------------------------------------------TP
A0LWI4_ACIC1/4-137-P...Y...ERRVAV---------------------------------------------------------------VP
Q21M61_SACD2/4-145-A...C...EKRVAA---------------------------------------------------------------TP
Q0KA62_CUPNH/4-137-D...N...EYRVGL---------------------------------------------------------------AP
A1CKS0_ASPCL/7-145-A.......EARSAL---------------------------------------------------------------TP
A0LUF0_ACIC1/4-137-P...Q...EYRVAL---------------------------------------------------------------TP
Q484K1_COLP3/4-137-L...G...ERRVAA---------------------------------------------------------------AP
Q7UXF1_RHOBA/4-137-T...D...EYRVGM---------------------------------------------------------------LP
Q6MB39_PARUW/4-136-N...H...EYRVGA---------------------------------------------------------------TP
Q2UAA6_ASPOR/84-217-P...N...ERRVAI---------------------------------------------------------------TP
A0DTI6_PARTE/7-138-Y...W...ERRTPI---------------------------------------------------------------PP
A1WZC8_HALHL/6-141-P...G...ERRVAL---------------------------------------------------------------VP
Q480P6_COLP3/4-137-N...H...EYRIGL---------------------------------------------------------------TP
Q4P6J5_USTMA/9-143-A.......EHRAAL---------------------------------------------------------------TP
Q8G5Z4_BIFLO/12-147-E...T...ESRVAL---------------------------------------------------------------TP
O44503_CAEEL/33-163-S...W...ERRAPL---------------------------------------------------------------AP
A7IGP9_XANP2/4-139-L...G...EPRVAA---------------------------------------------------------------TP
Q3IZY5_RHOS4/4-137-P...Q...EFRVGL---------------------------------------------------------------TP
Q13HL5_BURXL/6-139-A...H...ERRVAL---------------------------------------------------------------VP
Q6AA35_PROAC/43-176-P...G...ENRVAA---------------------------------------------------------------TP
Q16LL0_AEDAE/57-190-A...N...ERRVAV---------------------------------------------------------------TP
B3E8N4_GEOLS/4-135-A...H...EYRVAL---------------------------------------------------------------TP
B2UC87_RALPJ/4-136-A...D...ETRVAA---------------------------------------------------------------TP
Q829A4_STRAW/4-137-N...N...EFRVAI---------------------------------------------------------------TP
Q5R0B7_IDILO/4-137-N...H...EYRIGL---------------------------------------------------------------TP
Q2Y9W7_NITMU/4-139-G...G...ETRVAA---------------------------------------------------------------TP
Q2Y9W3_NITMU/6-138-D...H...ENRVGM---------------------------------------------------------------TP
B3EKT2_CHLPB/35-169-N...D...ERRVAL---------------------------------------------------------------SP
A0ZAH3_NODSP/4-137-D...Q...EFRVGL---------------------------------------------------------------SP
A4SZU6_POLSQ/4-136-P...G...ETRVAA---------------------------------------------------------------TP
Q0U4J1_PHANO/7-146-L.......EHRSAL---------------------------------------------------------------TP
A1B5J9_PARDP/5-139-N.......ERRVGI---------------------------------------------------------------TP
Q6F836_ACIAD/4-136-A...G...ENRVAA---------------------------------------------------------------TP
Q0SGE0_RHOSR/15-145-D...G...ERRVAL---------------------------------------------------------------VP
Q6ANB3_DESPS/4-131-A...Q...EGRVAL---------------------------------------------------------------LP
Q2SNB3_HAHCH/4-137-N...H...EYRVGL---------------------------------------------------------------TP
A1BEU6_CHLPD/35-169-Q...D...ERRVAI---------------------------------------------------------------SP
Q2JLS3_SYNJB/4-136-E...Q...EFRVGL---------------------------------------------------------------TP
Q01VE2_SOLUE/4-138-A...F...DRRVAL---------------------------------------------------------------TP
A0JVR6_ARTS2/4-136-N...N...EFRVAI---------------------------------------------------------------TA
Q7N4Z3_PHOLL/4-137-A...N...EARVAA---------------------------------------------------------------TP
O04709_MAIZE/19-156-M...W...ERRAPL---------------------------------------------------------------TP
A8ZX21_DESOH/4-137-K...L...EKRVAV---------------------------------------------------------------TP
Q021N9_SOLUE/6-147-P...G...ERRVAM---------------------------------------------------------------AP
Q3IYW2_RHOS4/5-139-N.......EERVGL---------------------------------------------------------------TP
Q3AEB3_CARHZ/4-137-N...N...ENRVAI---------------------------------------------------------------TP
A1BEX7_CHLPD/4-135-N...R...ESRVSC---------------------------------------------------------------TP
LYS1_YARLI/8-142-L.......EHRSAL---------------------------------------------------------------TP
Q5SIC7_THET8/4-139-G...GEIPERRVPL---------------------------------------------------------------TP
Q1GIS5_RUEST/4-139-E...G...ESRVAM---------------------------------------------------------------TP
B2JGI7_BURP8/4-136-P...Y...ETRVAA---------------------------------------------------------------TP
Q1AW21_RUBXD/4-137-A...G...ESRVAL---------------------------------------------------------------AP
B4SD94_PELPB/35-169-Q...D...ERRVAI---------------------------------------------------------------SP
Q16C99_ROSDO/5-139-N.......ETRVGL---------------------------------------------------------------TP
A6WFF9_KINRD/4-137-N...R...EYRVAL---------------------------------------------------------------TP
A1B9C0_PARDP/4-139-E...G...EARVAV---------------------------------------------------------------TP
A3QAN8_SHELP/4-140-A...D...EKRVAL---------------------------------------------------------------IP
Q8XRA9_RALSO/4-136-E...G...ETRVAL---------------------------------------------------------------TP
A0LMX7_SYNFM/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q47RB8_THEFY/4-137-D...H...EYRVAI---------------------------------------------------------------TP
B2JLD8_BURP8/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q128A6_POLSJ/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q7P1W1_CHRVO/4-138-A...G...EHRVAA---------------------------------------------------------------TP
Q8KEN6_CHLTE/6-140-Q...D...ERRVAI---------------------------------------------------------------SP
Q2IJQ2_ANADE/4-137-N...N...ENRVGL---------------------------------------------------------------TP
A4SWM0_POLSQ/4-137-N...N...EFRVGL---------------------------------------------------------------TP
A0ZDC5_NODSP/19-159-V...C...ERRVAL---------------------------------------------------------------NP
A1VTW8_POLNA/4-136-A...G...ETRVAI---------------------------------------------------------------TP
A9BR27_DELAS/4-136-A...G...ETRVAA---------------------------------------------------------------TP
A6VWR5_MARMS/6-139-P...H...EKRVSL---------------------------------------------------------------VP
A4XPH7_PSEMY/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q1QT97_CHRSD/4-137-N...H...EYRVAL---------------------------------------------------------------TP
B0SVI3_CAUSK/5-140-G...G...ETRVAA---------------------------------------------------------------TP
Q1WRC5_LACS1/4-135-K...Q...EERVGA---------------------------------------------------------------TP
B0T233_CAUSK/4-137-P...G...EHRVGL---------------------------------------------------------------TP
Q28K30_JANSC/4-138-N.......ERRVGI---------------------------------------------------------------TP
A5V806_SPHWW/4-137-N...H...EYRVGL---------------------------------------------------------------TP
Q31MS7_SYNE7/28-167-L...Q...ERRVAM---------------------------------------------------------------LP
Q03RI6_LACBA/4-135-N...N...ENRVGI---------------------------------------------------------------TP
A4J8G7_DESRM/4-137-N...N...ENRVAM---------------------------------------------------------------TP
Q5KUA3_GEOKA/4-136-N...N...ENRVAI---------------------------------------------------------------TP
Q11IF1_CHESB/4-137-N...H...EYRVGL---------------------------------------------------------------TP
P73496_SYNY3/23-158-D...Q...ECRVAM---------------------------------------------------------------TP
Q15PN0_PSEA6/5-140-A...G...EKRCAL---------------------------------------------------------------LP
Q7VV14_BORPE/4-136-D...G...ETRVAA---------------------------------------------------------------TP
Q12QQ7_SHEDO/4-145-S...G...ETRVAA---------------------------------------------------------------TP
A7HUT9_PARL1/4-139-D...G...ETRVAA---------------------------------------------------------------SP
Q03HP9_PEDPA/4-134-E...G...EGRVAA---------------------------------------------------------------TP
Q5DZZ0_VIBF1/4-143-A...G...ETRVAA---------------------------------------------------------------TP
Q01VQ6_SOLUE/4-137-D...H...ETRVGL---------------------------------------------------------------VP
Q7VA67_PROMA/14-145-S...D...ELRVAI---------------------------------------------------------------TP
Q10VQ6_TRIEI/4-139-V...N...ECRVAL---------------------------------------------------------------VP
A0M2A6_GRAFK/33-166-Y...Q...EKRICI---------------------------------------------------------------SP
C1DKG5_AZOVD/4-137-N...H...EYRVGL---------------------------------------------------------------TP
A1A1C3_BIFAA/12-147-E...H...ESRVAL---------------------------------------------------------------TP
Q11SC0_CYTH3/13-146-G...I...ENRVCL---------------------------------------------------------------TP
A8LLI3_DINSH/4-137-P...Q...EFRVGL---------------------------------------------------------------TP
Q11EJ3_CHESB/6-139-T...N...EPRVAA---------------------------------------------------------------SP
A4X685_SALTO/4-137-N...H...EYRVAI---------------------------------------------------------------TP
B1WS00_CYAA5/5-144-L...G...ELRVAL---------------------------------------------------------------VP
B2FPZ7_STRMK/9-139-P...G...ERRVAL---------------------------------------------------------------TP
B2HKV6_MYCMM/4-137-D...N...EFRVAI---------------------------------------------------------------TP
B2HLU5_MYCMM/9-139-P...D...ERRVAL---------------------------------------------------------------VP
B4EIC9_BURCJ/4-137-N...H...EYRVGL---------------------------------------------------------------TP
B4HYA5_DROSE/26-155-V...W...ERRAPF---------------------------------------------------------------GP
B9RR16_RICCO/8-144-K...W...ERRVPL---------------------------------------------------------------TP
D0IWI5_COMT2/2-128-........EKRVAT---------------------------------------------------------------VP
D4ZJ19_SHEVD/4-142-A...Q...ESRVAA---------------------------------------------------------------TP
F7QES8_9BRAD/5-136-P...S...EPRVAA---------------------------------------------------------------SP
G0FKF9_AMYMS/4-137-K...H...EYRVAL---------------------------------------------------------------TP
H3CUQ7_TETNG/61-200-Q...N...ERRVAI---------------------------------------------------------------SP
H3CVX4_TETNG/53-186-Q...N...ERRVAL---------------------------------------------------------------SP
H3CYI7_TETNG/31-160-P...W...ERRAPL---------------------------------------------------------------AP
H7C6H0_BRADU/4-137-A...H...EYRVGL---------------------------------------------------------------TP
K4PU16_SHEON/4-137-N...H...EYRVGM---------------------------------------------------------------VP
Q036E3_LACC3/4-134-A...G...EGRVAV---------------------------------------------------------------TP
Q1D4V2_MYXXD/4-138-T...R...EYRVGM---------------------------------------------------------------VP
Q24858_ENTHI/568-702-P.......EKMVAM---------------------------------------------------------------VP
Q24YW8_DESHY/4-137-I...Y...ENRVGM---------------------------------------------------------------PP
DHA2_STAA8/4-136-N...N...ENRVGL---------------------------------------------------------------SP
DHA1_STAA8/5-134-Q...G...EGRVAC---------------------------------------------------------------TP
Q2K468_RHIEC/46-178-D...G...ETRVAA---------------------------------------------------------------SA
PNTAA_RHORT/4-144-P...G...EDRVAI---------------------------------------------------------------SP
Q46JT2_PROMT/6-141-L...G...ETRVSA---------------------------------------------------------------TP
Q4FMG2_PELUB/4-137-P...Q...EHRIGL---------------------------------------------------------------TP
Q4FU92_PSYA2/10-139-A...S...ECRVAL---------------------------------------------------------------TP
Q59P14_CANAL/10-144-P...L...EARAAL---------------------------------------------------------------TP
Q5F6S7_NEIG1/4-136-S...G...ETRVAC---------------------------------------------------------------TP
Q5ZX09_LEGPH/4-137-S...H...ENRVGL---------------------------------------------------------------VP
Q63QY7_BURPS/4-136-A...N...EARVAA---------------------------------------------------------------TP
Q6LIA6_PHOPR/6-139-Q...G...ERRAAL---------------------------------------------------------------TP
Q6LIV6_PHOPR/4-143-A...N...ETRVAA---------------------------------------------------------------TP
Q6LQ29_PHOPR/6-139-V...H...EYRVGM---------------------------------------------------------------VP
DHA_METMP/4-137-N...N...ENRVAI---------------------------------------------------------------TP
Q72EK7_DESVH/4-137-A...E...ENRVAM---------------------------------------------------------------TP
Q7RV12_NEUCR/120-256-P...N...ERRVAL---------------------------------------------------------------TP
Q7V5T2_PROMM/14-145-A...D...ELRVAL---------------------------------------------------------------TP
Q81VA6_BACAN/4-136-N...N...ENRVAM---------------------------------------------------------------TP
Q87QP6_VIBPA/4-137-N...H...EYRVGM---------------------------------------------------------------IP
Q8Y6V2_LISMO/4-136-N...N...ENRVAM---------------------------------------------------------------TP
Q92LZ7_RHIME/7-139-P...N...EGRVAG---------------------------------------------------------------SV
AASS_MOUSE/28-157-A...W...ERRAPL---------------------------------------------------------------AP
Q9KM26_VIBCH/4-137-A...G...ETRVAA---------------------------------------------------------------SP
X2GRC3_9BACI/4-136-N...N...ENRVAM---------------------------------------------------------------TP

PF05221

E6S782_INTC7/4-477G-VTEETTTGVHRLYQLAEAGGLLFPAINVNDS-----VTK-SKFDNKYGCRHSLIDGLNRATDVLIGGKMAVVCGYGD-
A0JU72_ARTS2/4-491G-VTEETTTGVHRLYRLAEQGKLLFPAINVNDS-----VTK-SKFDNKYGIRHSLPDGINRATDVLMGGKIAVVCGYGD-
D6Y6B5_THEBD/2-474G-VTEETTTGVHRLYELEKSGRLLFPAINVNDS-----VTK-SKFDNKYGCRHSVIDGLNRATDVLIGGKVAVVCGYGD-
D1BWJ6_XYLCX/10-497G-VTEETTTGVHRLYHLAEAGELLFPAINVNDS-----VTK-SKFDNKYGIRHSLPDGINRATDILIGGKVAFVAGYGD-
F6FRM5_ISOV2/23-520G-VTEETTTGVHRLYHLAESGELLFPAINVNDS-----VTK-SKFDNKYGIRHSLPDGINRATDILIGGKVAFVAGYGD-
E4NC13_KITSK/8-481G-VTEETTTGVHRLYEMHRDGKLLFPAINVNDS-----VTK-SKFDNKYGCRHSLIDGINRATDVLIGGKVAVVCGYGD-
D7B5R0_NOCDD/4-477G-VTEETTTGVLRLYEMRREGTLAFPAINVNDS-----VTK-SKFDNKYGIRHSLPDGIMRATDVLIGGKVAVVCGYGD-
R4LG47_9ACTO/12-485G-VTEETTTGVARLYKFAKTGDLLFPAINVNDS-----VTK-SKFDNKYGIRHSLVDGLNRATDVMIGGKLAVVCGYGD-
A4X3J2_SALTO/22-495G-VTEETTTGVHRLYEMHRAGSLLFPAINVNDA-----VTK-SKFDNRYGCRHSLVDGINRATDVLIGGKVAVVVGYGD-
C5C1M6_BEUC1/15-511G-VSEETTTGVHRLYQLAAAKELLFPAINVNDS-----VTK-SKFDNRYGIRHSLPDGLNRATDVLIGGKVAFVAGYGD-
F4CRV7_PSEUX/22-502G-VTEETTTGVHRLYQLAEQELLLFPAINVNDS-----VTK-SKFDNKYGIRHSLIDGLNRGTDVLIGGKVAVVAGYGD-
K0KB99_SACES/13-486G-VTEETTTGVMRLYQLAAAGNLLFPAINVNDA-----VTK-SKFDNRYGIRHSLIDGINRGTDVLMGGKVAVICGYGD-
A0LS32_ACIC1/2-475G-VTEETTTGVHRLHQMAAAGTLLFPAINVNDS-----VTK-SKFDNKYGCRHSLIDGINRATDVLIGGKLAVVCGYGD-
F6EFW8_AMYSD/14-489G-VTEETTTGVHRLYQFAAAGELVFPAINVNDS-----VTK-SKFDNKYGTRHSLLDGINRGTDVLIGGKYAVVCGYGD-
C7MUK9_SACVD/12-484G-VTEETTTGVLRLYEYAKSGELLFPAINVNDS-----VTK-SKFDNKYGCRHSLIDGINRATDVLIGGKVAVVCGYGD-
A4FNJ5_SACEN/13-486G-VTEETTTGVNRLYQLAAQGELLFPAINVNDS-----VTK-SKFDNKYGIRHSLIDGINRATDVLVGGKVAVVCGYGD-
F5XQ99_MICPN/10-486G-VTEETTTGVHRLYEMFRRGALLFPAINVNDS-----VTK-SKFDNKYGCRHSLIDGLNRATDVLIGGKVAVVCGYGD-
SAHH_MYCMM/17-491G-VTEETTTGVLRLYQFAAAGDLAFPAINVNDS-----VTK-SKFDNKYGTRHSLIDGINRGTDALIGGKKVLICGYGD-
R4T8V2_AMYOR/12-490G-VTEETTNGVKRLYKLAKEGELLFPAMNVNDS-----VTK-SKFDNKYGIRHSLIDGLNRGTDVMIAGKVAVVCGYGD-
J9SDU9_9ACTO/17-488G-VTEETTTGVLRLYQFAAAGDLAFPAINVNDS-----VTK-SKFDNKYGTRHSLIDGINRGTDVLIGGKKVLICGYGD-
F4H4D2_CELFA/46-530G-VSEETTTGVHRLYRLAAAGELLFPAINVNDA-----VTK-SKFDNRYGIRHSLPDGLDRATDVLIGGKVAFVAGYGD-
C7QZI2_JONDD/10-493G-VTEETTTGVHRLYALAEKEELLFPAINVNDS-----VTK-SKFDNKYGIRHSLPDGINRATDILIGGKVAFVAGYGD-
A1SGL1_NOCSJ/2-475G-VTEETTTGVHRLYEMMREGSLLFPAINVNDS-----VTK-SKFDNKYGCRHSLIDGINRATDVLIGGKVAVVCGYGD-
A6WER2_KINRD/4-486G-VTEETTTGVLRLAEYFRNGVLPFPAINVNDS-----VTK-SKFDNKYGTRHSLIDGINRGTDVLIGGKTAVVFGYGD-
I4F357_MODMB/14-493G-VTEETTTGVLRLYELARDGRLLFPAINVNDS-----VTK-SKFDNLYGVRHSLIDGINRGTDVMIGGKVAVVCGYGD-
C8XJI5_NAKMY/22-497G-VTEETTTGVNRLYQLAAAGELLFPAINVNDS-----VTK-SKFDNKYGIRHSLIDGINRGTDVLIGGKVALVAGYGD-
I6X351_PROPF/4-475G-VTEETTTGVHRLYEMHRNGTLLFGAINVNDS-----VTK-SKFDNRYGCRHSLVDGINRATDVLIGGKVAVVCGYGD-
M5A353_9ACTN/11-489G-VTEETTTGVHRLYKMMEEGELIFPAINVNDS-----VTK-SKFDNLYGCRHSLVDSISRATDVMIGGKTALVLGYGD-
W0RH07_9BACT/19-492G-VSEETTTGVHRLYEMMNAGTLAFAAINVNDS-----VTK-SKFDNLYGCRHSIVDGINRATDVMMAGKVAVVFGYGD-
SAHH_COREF/6-477G-VTEETTTGVHRLYHFAEEGVLPFPAMNVNDA-----VTK-SKFDNKYGTRHSLIDGINRATDMLMGGKNVLVCGYGD-
E2SDU6_9ACTO/5-482G-VSEETTTGVLRLYDRFKEGSLLFPAINVNDS-----VTK-SKFDNKYGCRHSLIDGLNRATDVMIGGKVAVVCGYGD-
X5E7G5_9CORY/23-501G-VTEETTTGVHRLYHFAEQGTLPFPAMNVNDA-----VTK-SKFDNRYGTRHSLLDGINRATDMLVGGKSVLVCGYGD-
G0HF72_CORVD/28-503G-VTEETTTGVHRLYHFAEQGTLPFPAMNVNDA-----VTK-SKFDNRYGTRHSVIDGINRGTDMLIGGKAALVAGYGD-
A7H6N3_ANADF/19-492G-VTEETTTGVHRLYEMQKAGTLLFPAINVNDS-----VTK-SKFDNLYGCRHSLVDGLNRATDVMLAGKLCVVCGYGD-
D9SB20_FIBSS/15-498G-VSEETTTGVHRLYQMAQAKRLKFPAINVNDS-----VTK-SKFDNLYGCRHSLIDGINRATDVMMAGKIAVVCGYGD-
L0GYM4_9GAMM/6-467G-VTEETTTGVHRLYEMAKNGTLLFPAMNVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKIAMVCGYGD-
B9S9Y6_RICCO/13-484G-VSEETTTGVKRLYQMQANGTLLFPAINVNDS-----VTK-SKFDNLYGCRHSLPDGLMRATDVMIAGKVSVVCGYGD-
S6BUQ9_9GAMM/6-466G-VTEETTTGVHRLYQMMEEGKLLFPAMNVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKIAVVCGYGD-
K0C944_CYCSP/5-466G-VTEETTTGVHRLYQMQESGELLFPAMNVNDS-----VTK-SKFDNLYGCRESLLDGIKRATDVMIAGKIAVVIGYGD-
E6WQA4_PSEUU/13-480G-VSEETTTGVHRLYQLAEAGKLLVPAINVNDS-----VTK-SKFDNLYGCRESLADGLKRAMDVMLAGKVAVVCGYGD-
H3G8U2_PHYRM/6-480G-VSEETTTGVHRLYQMEKNGSLLFPAINVNDS-----VTK-SKFDNLYGCRHSLPDGIMRATDVMLAGKRVVICGFGD-
A8IXE0_CHLRE/12-482G-VSEETTTGVKRLYEMQANGSLLFPAINVNDS-----VTK-SKFDNVYGCRHSLPDGIMRATDVMIAGKTAFIAGYGD-
X5DXZ4_9BACT/10-471G-VSEETTTGVHRLYHMAEKGELLVPAINVNDS-----VTK-SKFDNLYGCRESLADGIKRATDVMIAGKVVVVAGYGD-
R7L6X2_9BACT/8-471G-VSEETTTGVHRLYQRMNEGKLLFPAFNVNDS-----VTK-SKFDNVYGCRESLVDGIKRATDVMVAGKVALVCGYGD-
B4S716_PROA2/10-471G-VSEETTTGVHRLYQMMEKGELLFPAINVNDS-----VTK-SKFDNLYGCRESLADGIKRATDVMLAGKIVVVLGYGD-
I4BAF3_TURPD/15-478G-VSEETTTGVKRLYSMLEKGELLFPAINVNDS-----VTK-SKFDNLYGCRESLADGIKRATDTMIAGKVAFIAGYGD-
F0VM57_NEOCL/4-476G-VSEETTTGVHRLLLMAKKKELLFPAINVNDC-----VTK-SKFDNVYGCRHSLPDGIMRATDVMLGGKRVVICGFGD-
D5EQ42_CORAD/10-478G-VSEETTTGVHRLYEMHNAGKLLVPAINVNDS-----VTK-SKFDNLYGCRESLLDGIKRATDVMVAGKVGVVCGYGD-
C7LQI3_DESBD/10-472G-VSEETTTGVHRLYQMAKNGELLFPAFNVNDS-----VTK-SKFDNLYGCRESLADGIKRATDIMVAGKVVLVCGYGD-
F3YYZ8_DESAF/11-474G-VSEETTTGVHRLYQMHKKGELLFPAINVNDS-----VTK-SKFDNLYGCRESLIDGIKRATDIMIAGKVCLVCGYGD-
D4H862_DENA2/6-469G-VSEETTTGVHRLYHMMEKGELLIPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKVAVVCGYGD-
F8E7L7_FLESM/7-469G-VSEETTTGVHRLYQMRQTGELLIPAINVNDS-----VTK-SKFDNLYGCRESLIDGIKRATDVMIAGKTAVICGYGD-
C8X588_DESRD/10-472G-VSEETTTGVHRLYQMAESGELLFPAFNVNDS-----VTK-SKFDNLYGCRESLADGIKRATDVMIAGKIVVVCGYGD-
G8NVU2_GRAMM/12-476G-VSEETTTGVHRLYKMMEQGKLLVPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMVAGKVAVVCGYGD-
E4TFL4_CALNY/3-466G-VSEETTTGVHRLYQMKERGELLIPAINVNDS-----VTK-SKFDNIYGCRESLLDGIKRAMDVMIAGKVAVVCGYGE-
SAHH_DESAD/9-471G-VSEETTTGVHRLYQMQEAGELLFPAINVNDS-----VTK-SKFDNLYGCRESLADGIKRATDVMIAGKVVVVVGYGD-
G0GAZ7_SPITZ/7-470G-VSEETTTGVHRLYMLQEQGRLLVPAINVNDS-----VTK-SKFDNIYGCRESLIDGIKRATDVMIAGKVAVVCGYGD-
B0VFI4_CLOAI/2-465G-VSEETTTGVHRLYQKRDEGTLLFPAINVNDS-----VTK-SKFDNLYGCRESLADGIKRGTDIMVAGKIVMICGYGD-
SAHH_DESAG/15-478G-VSEETTTGVHRLYHMEKDGSLLFPAINVNDS-----VTK-SKFDNLYGCRESLADGIKRATDVMIAGKTVVVLGYGD-
H8L337_FRAAD/12-476G-VSEETTTGVHRLYQLAEAGKLLVPAINVNDS-----VTK-SKFDNLYGCRESLADGIKRATDLMVAGKVAVVCGYGD-
A0BCF6_PARTE/5-476G-VSEETTTGVHRLKQIAAKGELLFPAINVNDS-----VTK-SKFDNIYGCRHSVIDGIFRATDVMLSGKKALVCGYGD-
M4NS42_9GAMM/11-478G-VSEETTTGVHRLYQLAEAKSLLVPAINVNDS-----VTK-SKFDNLYGCRESLADGLKRAMDVMLAGKVAVVCGYGD-
T2GAN7_DESGI/2-464G-VSEETTTGVHRLYQMQKAGELLFPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMMAGKCCVVVGYGD-
D7G8Q4_ECTSI/5-478G-VSEETTTGVHRLYMMEKDESLLFPAINVNDS-----VTK-SKFDNLYGCKHSLPDGLCRATDVMIAGKSAVVCGYGD-
SAHH_PELCD/9-474G-VSEETTTGVHRLYHMARNGELLFPAFNVNDS-----VTK-SKFDNLYGCRESLIDGIKRATDVMIAGKKCVVLGYGD-
D0LJJ9_HALO1/23-511G-VSEETTTGVHRLYDRVKAGTLLFPGINVNDS-----VTK-SKFDNVYGCRHSLVDAIMRATDVLISGKRALVCGFGD-
F0XY15_AURAN/5-479G-VSEETTTGVHRLYTMSKDGELLFPAINVNDS-----VTK-SKFDNLYGCKHSVIDGICRATDVMMAGKRAVICGYGD-
C5K5D1_PERM5/3-480G-VSEETTTGVHRLNSMAASGALLFPAINVNDC-----VTK-SKFDNVYGCRHSLPDGIMRATDVMIGGKTVFVAGYGD-
SAHH_METCA/12-471G-VTEETTTGVHRLYEMQAKGRLPFPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKIAVVLGYGD-
B7FT14_PHATC/5-480G-VSEETTTGVHRLYTMEKTGTLLFTAINVNDS-----VTK-SKFDNLYGCKHSLPDGLMRATDVMLAGKKAVIAGYGD-
W0IVC4_9BACT/19-482G-VSEETTTGVHRLYQLHQQGKLLVPAINVNDS-----VTK-SKFDNLYGCRESLADGLKRATDVMIAGKVAVVCGYGD-
D7E778_METEZ/5-466G-VSEETTTGVHRLYHWEKDGELLVPAINVNDS-----VTK-SKFDNIYGCRESLVDAIKRGTDVMVAGKVAVVCGYGD-
C4LU18_ENTHI/5-465G-CSEETTTGVLRLKQMVKEKKLLFPAVNVNDS-----VTK-SKFDNIYGCRHSLIDGINRATDVMIGGKVACVCGYGD-
B2UR10_AKKM8/7-470G-VSEETTTGVHRLYQMQAAGRLLIPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMVAGKVAVVCGYGD-
D5MJ17_9BACT/14-479G-VSEETTTGVHRLYQMMDKGELLVPAINVNDS-----VTK-SKFDNLYGCRESLADGIKRATDVMIAGKVVVVAGYGD-
E1QFH0_DESB2/14-475G-VSEETTTGVHRLYHMAEQNQLLVPAINVNDS-----VTK-SKFDNIYGCRESLVDGIKRATDVMVAGKQALVCGYGD-
D6Z0B0_DESAT/10-434G-ISEETTTGVHRLYEMTKEGSLLAPAINVNDS-----VTK-SKFDNLYGCRESLLDGIKRATDVMIAGKICVVAGYGD-
F4GUC2_PUSST/14-474G-VTEETTTGVHRLYQMSKKGELAFPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMVAGKIAVVCGFGD-
SAHH_LEPIN/11-435G-ISEETTTGVKSLYKLLKKGELKVPAFNVNDS-----VTK-SKFDNLYGCRESLADGIKRATDVMLAGKVALVCGFGD-
B4RBP7_PHEZH/3-462G-VSEETTTGVHRLYQMAERGELPFPAINVNDS-----VTK-SKFDNLYGCRESLVDAIRRGTDVMLAGKTAVVMGYGD-
C1EH64_MICSR/17-486G-VSEETTTGVKRLYEMQKAGELLFPAINVNDS-----VTK-CKFDNLYGCRHSLPDGIMRATDVMIASKTCFVAGFGD-
D5BW57_NITHN/12-436G-LSEETTTGVHRLYEMMEQGTLKVPAFNVNDS-----VTK-SKFDNLYGCRESLLDGIKRATDVMIAGKTTVILGYGD-
E1WZA8_BACMS/5-430G-LSEETTTGVHRLYERVEKGTLKMPAININDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKVCVVAGYGD-
V6F3C0_9PROT/3-464G-VTEETTTGVHRLYEMEKKGTLLWPAINVNDS-----VTK-SKFDNKYGCRESLVDGIRRATDVMLAGKVAVVAGFGD-
Q2L174_BORA1/11-472G-VTEETTTGVHRLYQMSQKGELAFAAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMVAGKIAVVAGYGD-
A9GFA1_SORC5/8-437G-LSEETTTGVHRLYEMHRAGKLKVPAINVNDS-----VTK-SKFDNLYGCRESLGDGIKRATDVMFAGKVAVVCGYGD-
D2W1E4_NAEGR/11-472G-VSEETTTGVHRLYAMQKQGTLLFPAINVNDS-----VTK-SKFDNIYGCRHSLLDGLNRATDVMLAGKECVVCGFGD-
B1ZZ56_OPITP/11-473G-VSEETTTGVHRLYQMLEKGKLRVPAINVNDS-----VTK-SKFDNLYGCRESLADGLKRATDVMIAGKVACVCGYGD-
W0BHF8_9GAMM/12-436G-VSEETTTGVARLYEMAKKAQLKIPAINVNDS-----VTK-SKFDNLYGCRESLLDGIKRATDVMIAGKVVLILGYGD-
S6AB36_9PROT/9-467G-VTEETTTGVHRLYQMAEEGRLKFPAINVNDS-----VTK-SKFDNLYGCRESLLDGIKRATDVMIAGKICVVLGYGD-
G7Z7L3_AZOL4/7-431G-LSEETTTGVHRLYEMMKKGTLKVPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMVAGKVAVVAGYGD-
G4R9F7_PELHB/6-465G-VSEETTTGVMRLYQLQEKGDLPFPAINVNDS-----VTK-SKFDNKYGCRESLVDAIRRGTDVMMAGKVAIVCGYGD-
E6W439_DESIS/5-431G-VSEETTTGVHRLYQMMGRNELKFPAINVNDS-----VTK-SKFDNLYGCRESLADGIKRATDVMVAGKIVVICGYGD-
A0LCX4_MAGSM/15-440G-ISEETTTGVLRLYEMAQKGKLECPAFNVNDS-----VTK-SKFDNLYGCRESLMDGIKRATDVMIAGKIGVVCGYGD-
V5S8R2_9RHIZ/6-467G-VSEETTTGVHRLYEMQKEGKLLFPAINVNDS-----VTK-SKFDNLYGCRESLVDGIRRGTDVMMAGKVAMVAGFGD-
C7R7A8_KANKD/3-464G-VTEETTTGVARLYQMKKRGELPFPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKIAIVCGYGD-
W8L8P3_HALHR/11-470G-VTEETTTGVHRLYQMAKEGSLPFPAINVNDS-----VTK-SKFDNLYGCRESTVDAIKRATDVMIAGKTAVVCGYGD-
SAHH_RHOCB/3-462G-VSEETTTGVHRLYDLHKKGLLPFPAINVNDS-----VTK-SKFDNKYGCKESLVDGIRRATDVMMAGKVAVVCGYGD-
I1XLP2_METNJ/11-435G-LSEETTTGVHRLYEMMKAGALKVPAINVNDS-----VTK-SKFDNLYGCRESLLDGIKRATDVMVAGKICVVLGYGD-
SAHH_RHILO/6-465G-VTEETTTGVNRLYQLQKKGLLPFPAINVNDS-----VTK-SKFDNKYGCKESLVDGIRRGTDTMMAGKVAVVCGYGD-
E3I6Z6_RHOVT/4-465G-VSEETTTGVLRLYQMEKKGTLAFPAINVNDS-----VTK-SKFDNRYGCRESLVDGIRRATDVMMAGKVAVVCGYGD-
H6L1E3_SAPGL/8-437G-ISEETTTGVHRLYERVKKGTLPMPAINVNDS-----VTK-SKFDNKYGCRESAVDAIRRATDIMLAGKVAVVGGYGD-
D5BCE6_ZUNPS/5-432G-LSEETTTGVHRLYERMKNGTLPMPAINVNDS-----VTK-SKFDNKFGCRESAVDAIRRATDVMLAGKRVVVCGYGD-
E8UEX5_TAYEM/4-465G-VTEETTTGVHRLYQMSARGELQFPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKTAVVVGFGD-
F8GKE5_NITSI/14-476G-VTEETTTGVHRLYEMHKNGELPFPAFNVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKIALVCGYGD-
Q0A6D2_ALKEH/11-469G-VTEETTTGVNRLVRMANEGTLPFPAINVNDS-----VTK-SKFDNLYGCRESLLDGIKRATDVMIAGKICVVAGYGD-
SAHH_MARMM/9-468G-VSEETTTGVMRLYQMQKRGELPFPAINVNDS-----VTK-SKFDNRYGCRESLVDAIRRGTDVMMAGKKALVFGYGD-
SAHH_HALHL/5-429G-VSEETTTGVHRLYEMSRKGELGMPAFNVNDS-----VTK-SKFDNLYGCRESLVDSIKRATDVMIAGKVAVVAGFGD-
G4SUH2_META2/5-429G-LSEETTTGVLRLTEMVAKGKLMVPAFNVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKIAVVCGYGD-
SAHH_BURXL/13-472G-VTEETTTGVHRLYQMEKEGRLPFPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKIAVVAGYGD-
W5XC25_9BACT/19-478G-VSEETTTGVKRLYQLQKEGRLPFPAFNVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKIAVVCGYGD-
SAHH_HYPNA/9-468G-VSEETTTGVNRLYQLEKRGELPFPAINVNDS-----VTK-SKFDNKYGCKESLVDAIRRGTDVMMAGKKAFVAGYGD-
M4S945_9SPHN/11-468G-VSEETTTGVHRLYELAKKGKLPFPAINVNDS-----VTK-SKFDNLYGCKESLVDAIRRATDVMLAGKVACVAGFGD-
SAHH_SYNPW/16-475G-VTEETTTGVARLYKMQKSGELPFPAINVNDS-----VTK-SKFDNLYGCRESLVDSIKRATDVMVAGKQALVMGYGD-
A7HPA7_PARL1/11-471G-VTEETTTGVHRLYEMQKKGTLLWPAINVNDS-----VTK-SKFDNLYGCRESLVDGIRRATDVMMSGKVGVVAGFGD-
SAHH_RALME/10-471G-VTEETTTGVHRLYQMAQKGELKFPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKIAVVAGYGD-
Q09BK3_STIAD/11-470G-VTEETTTGVHRLYQMAKEGRLKFPAINVNDS-----VTK-SKFDNVYGCRESLVDGIKRATDVMIAGKVAVVAGYGE-
I4AIU9_FLELS/9-439G-ISEETTTGVHRLYERLKNGTLPLPCINVNDS-----VTK-SKFDNKYGCRESCVDAIRRATDVMMAGKVAVVGGYGD-
SAHH_BARHE/5-464G-ISEETTTGVHRLHQLQKEGLLPFPAININDS-----VTK-SKFDNKYGCRESLVDGIRRATDVMIAGKTAIVCGYGD-
F2IVA0_POLGS/3-461G-VSEETTTGVMRLYEMQKKGQLPFPAINVNDS-----VTK-SKFDNRYGCRESLVDGIRRGTDVMMSGKVAVVCGYGD-
SAHH_DICDI/5-430G-ISEETTTGVHNLYKMFKEGKLKVPAINVNDS-----VTK-SKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGD-
Q4P829_USTMA/3-430G-VSEETTTGVHILYSAMKKGTLKLPAINVNDS-----VTK-SKFDNYYGCRESLVDGIKRATDVMLGGKVAIVAGFGD-
B3QUB9_CHLT3/8-434G-ISEETTTGVLRLYEREKNGTLGIPSINVNDS-----VTK-SKFDNKYGCRESCVDAIRRATDVMIAGKVAVVAGFGD-
SAHH_ACISJ/10-475G-VTEETTTGVHRLKEMSAKGTLLFRAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKVAVVAGYGD-
SAHH_COXBU/13-437G-VSEETTTGVHRLYRMLKEGSLKFPAINVNDS-----VTK-SKFDNLYGCRESLIDSIKRATDVMIAGKRVVVCGYGD-
U9U9F5_RHIID/3-430G-VSEETTTGVHHLYQMLKEGKLKVPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVQIAGKVAVVAGYGD-
SAHH_PLAF7/5-478G-VSEETTTGVLRLKKMDKQNELLFTAINVNDA-----VTK-QKYDNVYGCRHSLPDGLMRATDFLISGKIVVICGYGD-
R7KIX3_9BURK/4-463G-VSEETTTGVHRLYQMAAKGTLRFPAMNVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKVAVVVGYGD-
E4TS79_MARTH/6-432G-LSEETTTGVHRLYERMKKGTLPMPAINVNDS-----VTK-SKFDNKYGCKESLVDAIRRATDVMMAGKVAVVGGYGD-
F2IAQ7_FLUTR/9-436G-LSEETTTGVHRLHERKKNGTLVMPAINVNDS-----VTK-SKFDNKYGCKESLVDSIRRATDVMMAGKVAVVCGYGD-
SAHH_METPP/12-476G-VTEETTTGVHRLNEMSAKGTLLFRAINVNDS-----VTK-SKFDNLYGCRESLVDSIKRATDVMIAGKVACVAGYGD-
U1MPL7_ASCSU/7-436G-LSEETTTGVHNLAKMLKAGTLKVAAINVNDS-----VTK-SKFDNLYGIRESLPDGIKRATDVMIAGKVAVVCGFGD-
F6XCK4_CIOIN/7-437G-LSEETTTGVHNLYKMMEAGTLKCPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMLAGKVALVAGYGD-
Q5FRZ9_GLUOX/12-437G-ISEETTTGVHRLWEMSKKGTLKVPAINVNDS-----VTK-SKFDNLYGCRESLVDAIRRGTDVMMAGKVAVVAGYGD-
K7YQ52_9PROT/6-430G-VSEETTTGVHRLYEMVKKGTLMIPAINVNDS-----VTK-SKFDNLYGCRESLADGIRRATDVMFAGKVACVAGYGD-
J9YYB1_9PROT/2-425G-LSEETTTGVLRLEQMVEKGTLQVPAINVNDS-----VTK-SKFDNLYGCKESLVDGIRRGTDVMMAGKVAVVAGFGD-
F2I015_PELSM/10-434G-VSEETTTGVLALNKMAEDKKLLIPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMMSGKVAIVAGFGD-
E0TE34_PARBH/4-465G-VTEETTTGVLRLYQREKKGTLPFPAINVNDS-----VTK-SKFDNKYGCKESLVDAIRRGTDVMMAGKKALVAGYGD-
I1C1Z9_RHIO9/6-432G-LSEETTTGVHNLYKMFKNGELKLPAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKVSVVAGYGD-
E9CHK0_CAPO3/6-431G-ISEETTTGVKNLYKMFKQGKLKIPSFNVNDS-----VTK-SKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGFGD-
S9X649_SCHCR/5-432G-VSEETTTGVHNLYKMFHENKLKVPAINVNDS-----VTK-SKFDNLFGCKESLVDGIKRATDVMIAGKVGVVAGFGD-
D5BTB0_PUNMI/4-463G-VSEETTTGVLRLYQLAEAGGLPFPAINVNDS-----VTK-SKFDNLYGCRESLVDAIRRATDVMLAGKVAVVAGFGD-
Q4Q124_LEIMA/3-436G-ISEETTTGVKNLYKRLSKGNLPISAINVNDS-----VTK-SKFDNLYGCRESLVDGIKRATDVMIAGKTCCVCGYGD-
Q2NB41_ERYLH/6-468G-VSEETTTGVHRLYHIAKGGKLPFPAINVNDS-----VTK-SKFDNLYGCRESLVDAIRRATDVMLSGKVACVAGFGD-
T1K9L8_TETUR/5-432G-ISEETTTGVHNLNRMLKKGLLKCPAFNVNDS-----VTK-SKFDNLYGCRESLSDGIKRATDVMIAGKTCVVAGFGD-
B3RVD8_TRIAD/6-432G-LTEETTTGVHNLYKMAKHGNLLMPAVNINDS-----VTK-SKFDNLYGCRESLIDGIKRATDVMIAGKTCAVFGFGD-
H3EHZ4_PRIPA/5-433G-LSEETTTGVHNLAKMLAKGDLKVPAINVNDS-----VTK-SKFDNLYGIRESLPDGIKRATDVMLAGKVAVVAGYGD-
R4XBF9_TAPDE/4-432G-VSEETTTGVHHLYKMMRDGKLKVPAINVNDS-----VTK-SKFDNLFGCKESLIDGIKRATDVMIGGKVAVVAGYGD-
M7NIB1_PNEMU/6-434G-ISEETTTGVHQLYRMFKEGRLKVPAINVNDS-----VTK-SKFDNYMGCRESLIDGIKRATDIMIAGKVAIVAGFGD-
S5R4D1_9PROT/14-476G-VTEETTTGVYRLRRMFKEGKLSFPAINVNDS-----VTK-SKFDNLYGCRESLIDGIKRATDVMIAGKIAVIIGYGD-
K0C550_ALCDB/10-461G-ITEETTTGVHRLYDMLKKGTLKVPAVNVNDS-----VTK-SKNDNKYGCRHSLNDAIKRGTDHLLSGKKALVVGYGD-
SAHH_PSEMY/12-468G-ITEETTTGVHRLLDMLKAGTLKVPAINVNDA-----VTK-SKNDNKYGCRHSLNDAIKRGTDHLLSGKQALVIGYGD-
SAHH_PSEU5/12-467G-ITEETTTGVHRLLDMLKGGTLKVPAINVNDS-----VTK-SKNDNKYGCRHSLNDAIKRATDHLLSGKQALVIGYGD-
C5BTQ5_TERTT/11-461G-ISEETTTGVHRLMEMLEEGSLKVPAINVNDA-----VTK-SKNDNKYGCRHSLNDAIKRGTDHLLSGKKALVVGYGD-
B1XI71_SYNP2/9-457G-VTEETTTGVHRLYEMLEKGKLKIPAINVNDS-----VTK-AKNDNKYGCRHSLNDAIKRATDHLLAGKKALVIGYGD-
E1VQZ0_9GAMM/8-458G-ISEETTTGVHRLEDMLKKGKLKVPAINVNDS-----VTK-SKNDNKYGCRHSLNDAIKRATDHLLAGKKALVIGYGD-
A1U548_MARAV/13-463G-VTEETTTGVHRLQEMLRDGTLKIPAINVNDS-----VTK-SKNDNKYGCRHSLNDAIKRATDHLLSGKKALVIGYGD-
Q5R045_IDILO/8-458G-ITEETTTGVHRLLDMLEKGTLKVPAINVNDA-----VTK-SKNDNKYGCRHSLNDAIKRSTDHLLSGKKALVVGYGD-
SAHH_ACIAD/17-466G-ITEETTTGVQRLLEMWKDGSLKVPAINVNDS-----VTK-SKNDNKYGCRHSLNDAIKRATDMLLSGRRALVIGYGD-
Q4FT37_PSYA2/19-473G-ISEETTTGVHRLVEMLNKGTLKVPAINVNDA-----VTK-SKNDNKYGCRHSLNDAIKRATDMFLAGRRALVIGYGD-
W4VUN6_ATTCE/58-483G-IVEESVTGVHRLYQLSKAGKLSVPAMNVNDS-----VTK-TKFDNLYSCRESIIDSLKRSTDIMFGGKQVVICGYGE-
SAHH2_DROME/67-491G-IVEESVTGVHRLYMLSKGGKLTVPAINVNDS-----VTK-NKFDTFYTCRDSILDSLKRTTDIMFGGKQVVICGYGD-
A1AX10_RUTMC/19-464G-ISEETTTGIHRLLKMMEKGSLKVPAINVNNS-----VTK-SKNDNKYGCRHSLNDAIKRGTDMLMSGKKALIIGYGD-
F6SNC6_CIOIN/38-463G-IVEESVTGVHRLYQLAKTGKLSIPAMNVNDS-----VTK-QKFDNLYSCRESVLDGLKRTTDIMFGGKQVVVCGYGE-
Q7QE71_ANOGA/31-458G-IVDESVTGVHRLYQLSKTSKLTVPAMNVKDA-----ITK-TKFDSLYSCKESVIDSLKRATDIMIGGKQIVLCGYGE-
A7SRK8_NEMVE/53-478G-IVEESVTGVHRLYQLSKQGKLTVPAMNVNDS-----VTK-TKFDNLYCCRESILDSLKRTTDVMFGGKQVLVCGYGE-
E4XGP7_OIKDI/72-497G-IVEESVTGVHRLYQLSKTGKLVVPAMNVNDS-----VTK-QKFDNLYSCRESILDGLKRTTDIMFGGKQILICGYGE-
I3KBV8_ORENI/75-500G-VVEESITGVYRLYQLSKAGRLSVPAMNVNDS-----VTK-QKFDNLYFCKESVLEGLKRTTDIMFGGKQVVVCGYGE-
K7DYH7_DANRE/71-496G-IVEESITGIHRLHHLSKAGKLCVPAINVNDS-----VTK-QKFDNLYCCRESILDSLKKTADIMFGGKQVVVCGYGE-
H2KNW6_CLOSI/142-567G-IVEESVTGVHRLYQYVKAGTLRVPAMNVSDS-----INK-SKFDNYYLCKESVVDALKRTTDMMISGKTVLVCGYGE-
H3D3K6_TETNG/64-489G-IVEESLTGIHRLYQLSKAGKLCLPAFNVNDC-----VTK-QKFDSLYCCKESVLSGLKRTTDVMFGGKQVLVCGYGE-
B3RUN3_TRIAD/31-456G-IVEESVTGVHRLYQMTKNNCLPIPAMNINDS-----VVK-GKFDNLYCCREAVIDSLKKTTDIMFGGKQVLICGYGE-
W5K360_ASTMX/86-511G-IVEESVSGVHRLYQLYKAGKLCSPAINVNES-----VIK-QKFDNFYCCKESVLDGLKRTTDVTLSGKQVVVCGYGE-
H0W4G1_CAVPO/66-492G-IVEESVTGVHRLYQLSKAGKLCVPAMNVNDS-----VTK-QKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGE-

PF00389

Q9JY94_NEIMB/3-329A.YSPESVAEHTVGLMLTLNRRIH----KAYQR-----TRD-ANFSL------------EGLTGFNMYGKTAGVIGTGK-
SERA_ARATH/85-394T.ANTVAAAEHGIALLASMARNVA----QADAS-----IKA-GKWER------------SKYVGVSLVGKTLAVMGFGK-
Q9RUU0_DEIRA/18-329E.SNNVSAAELAVMHLMAAARGLT----RSDRK-----TRA-GEWDR------------KFLGLELTDKTLGIVGLGRI-
Q98F95_RHILO/5-315F.GNSITTAEHAVAMIFALARQIP----EANAS-----THA-GKWEK------------NRFMGVEITGKTLGVIGCGN-
E9ACF1_LEIMA/115-427F.ANTRSVAELVIGEIISLSRKMT----QRSEE-----VHR-GVWNK------------THVGCYEVRGKTVGIVGYGH-
Q9KEA4_BACHD/2-311G.IHAIPMAEYTLSMMLQVARNAK----RLISL-----EQE-QTWDR------------RVPMIELNGQTVGVLGAGAI-
O28495_ARCFU/4-322G.VNALSVAEHTVMFALALLRRLI----YAHNS-----VLS-GRWEQ------------DEMANLGVYELHGKTWGIIG-
Q9KLW1_VIBCH/3-321G.SPV.APAELCWGLILAASRHLP----SYIEQ-----LHA-GHWQQ------------NGGLGLGRTLSGHTLGIWGL-
Q9CKF1_PASMU/14-327F.SNTRSVAELVLGEILLLMRNVP----QANAE-----VHR-GIWNK------------SANGSHEVRGKKLGIIGYGH-
SERA_ARCFU/3-312G.GNTISTAEHAIALMLAAARKIP----QADRS-----VKE-GKWER------------KKFMGIELRGKTAGVIGLGR-
CTBP_DROME/30-352G.YGVEEVADTTMCLILNLYRRTY----WLANM-----VRE-GKKFT------------GPEQVREAAHGCARIRGDTL-
Q9VKI8_DROME/8-324G.GNSISACELTCILIGSLARPVV----PAGQS-----MKE-GRWDR------------KLYAGTELYGKTLAVLGLGR-
Q97IU7_CLOAB/3-326..YSPRSVADYTVMMILMATRKVK----AIMQN-----SYV-QDYSL------------EGIQGKELHNLTVGVIGTGK-
YEAA_SCHPO/9-327K.AVDDATADVGIFLMLGALRGFN----QGIFE-----LHK-NNWNA------------NCKPSHDPEGKTLGILGLGG-
Q9KP92_VIBCH/13-326F.SNTRSVAELVLGEILLLLRGIP----EKNAL-----AHR-GIWKK------------SADNSYEARGKRLGIIGYGH-
Q9I1L0_PSEAE/4-318D.VLTETTADTGFALILATARRVV----ELAGW-----VRA-GEWKK------------SVGAAQFGTDVHGKTLGIVG-
Q98BH4_RHILO/9-329N.VLTEDTADMTMALMLAVPRRLA----EGANV-----LTG-DKKWA------------GWSPTWMLGRRIWGKRLGIV-
P74586_SYNY3/3-330S.YSPHAVAEHTVGLILALNRKLY----RAYNR-----VRD-DNFSL------------EGLLGFDLHGTTVGVIGTGK-
DDH_ZYMMO/3-331A.YSPYSVAEYAVGMLLTLNRQIS----RGLKR-----VRE-NNFSL------------EGLIGLDVHDKTVGIIGVGH-
TKRA_BACSU/6-322Y.TLDDTVADLAFSLILSSARRVA----ELDRF-----VRA-GKWGT------------VEEEALFGIDVHHQTLGIIG-
Q9A244_CAUCR/24-340G.VLTEDTADLTMTLIMAASRRIV----EGAEV-----VKA-GGFHG------------WSPTWMMGRRLWGKRLGIIG-
SERA_SCHPO/58-378Y.ANSRSVAELVIGYIISLARQVG----DRSLE-----LHR-GEWNK------------VSSGCWEIRGKTLGIIGYGH-
GYAR_THELN/5-322G.VLTDATADLAFALLLAVARRIV----EADAF-----VRS-GEWKK------------SEVGWHPLMFLGYGLKGKTL-
Q98LH4_RHILO/9-326NDFQIFTVSEHAVALMLAVAKQLG----TWTPE-----FMR-RGGWR------------GLTHGATLRGATVGIVGLGR-
Q9S2M5_STRCO/3-328Y.YSPHSVAEFAWALAMAVNRRIV----RASIR-----TRD-FDFRL------------DGLMGRDLHGRTAGVLGTGK-
SERA_METJA/4-312D.ASSISVAELTMGLMLAAARNIP----QATAS-----LKR-GEWDR------------KRFKGIELYGKTLGVIGLGR-
LDHD_STRP1/3-330S.YSPESIAEFTVTIVLNLIRHVE----LIREN-----VKK-QNFTW------------GLPIRGRVLGDMTVAIIGTG-
HPR3_ARATH/9-321N.AFSDDVADCAVGLLISVLRRIP----AADRY-----VRS-GNWAK------------FGDFQLGSKVSGKRVGIVGL-
Q9HXB7_PSEAE/5-318D.VLTETTADLGFALLISAARRVA----ELDAW-----VKA-GNWKR------------TVDAPQFGTDVHGKKLGILG-
O67741_AQUAE/4-320G.ANTIGATELTMMHMLTIMRNGH----KAHES-----MLN-YKWDR------------KKFMGEELYGRILGIIGLGN-
SERA_METTH/6-313E.STSITVAEHSIGLMLALARKIA----IADRS-----VKE-GKWEK------------NRFMGIELNGKTLGIIGMGR-
DDH2_SCHPO/3-330S.YSPFAVSEFTVGLLLSLNRKIH----RAYVR-----VRE-DDFNI------------VGLLGCDIHGKTVGVIGTGK-
HPR2_ARATH/6-313D.VLTEDVADLAIGLILALLRRLC----ECDRY-----VRS-GKWKQ------------GEFQLTTKFSGKSVGIIGLG-
LDHD_ECOLI/3-329A.YDPEAVAEHAIGMMMTLNRRIH----RAYQR-----TRD-ANFSL------------EGLTGFTMYGKTAGVIGTGK-
SERA_RAT/9-317N.GNSLSAAELTCGMLMCLARQIP----QATAS-----MKD-GKWDR------------KKFMGTELNGKTLGILGLGR-
Q9A6E7_CAUCR/11-318G.LNAADVADHAVGLVLAAWRGIV----EGDQR-----LRG-GHWSH------------AERMAPRPGLRGRKAGVVGL-
Q9HMR0_HALSA/3-311A.GNVRAAAEHTVALAFAAARSIP----QAHAR-----LDA-GSWAK------------DDYLGTELSGKTLGVVGLGR-
Q9WYG2_THEMA/4-311G.ANSLSVAELTIAFIFALSRGLV----WAHNK-----LFL-ERRWE------------GTVGQEVSGKTLGVVGFGSI-
CTBP2_RAT/36-358S.AAVEETADSTVCHILNLYRRNT----WLYQA-----LRE-GTRVQ------------SVEQIREVASGAARIRGETL-
Q9PBD8_XYLFA/15-328Y.SNTRSVAELIIAEAILLLRGIP----QKNAE-----CHR-GGWSK------------SAINSHEARGKVLGIVGYGH-
Q89388_PBCV1/32-362A.YSPRSVAELALTHMMALSRNIQ----LVLPR-----VKT-GNYTM------------EGLVGREITDKTIGIIGTGK-
LDHD_TREPA/3-330S.YSPNAIGEYALAAALQLTRHAR----EIETF-----VRK-RDFRW------------QKPILSKELRCSRVGILGTG-
Q97MV2_CLOAB/3-317G.YSTESVTELTFGLVFSVLRNIV----PLDKV-----TRE-GKTKN------------GFSQSDLSGKTFGVIGTGLI-
Q97U35_SULSO/2-295G.AYSLSVAEHAWALILASAKGVG----TKKRT-----IVY-DVSEK------------TLLILGGGGIGSEVARIGKT-
Q9A3I9_CAUCR/6-314F.GNSITTAEHAIAMMFALARQIP----AADVS-----TQG-GKWEK------------NRFMGVELYAKTLGLIGAGN-
Q9RKF9_STRCO/17-329D.YGTEAVSDHAIGLALSVARGIP----RLDRG-----VRA-GSFDL------------PAVRPLYQVGQRVFGVVGMG-
Q9LT69_ARATH/49-358T.ANTVAAAEHGIALLTAMARNIA----QADAS-----IKA-GKWTR------------NKYVGVSLVGKTLAVLGFGK-
GYAR_AERPE/6-324G.VLTEATAEFTWALILAAARRVV----EADHF-----VRW-GEWWR------------LRTGWHPMMMLGVELRGKTL-
DDH_HAEIN/3-329A.YSPEAVAEHTIGLMMTLNRRIH----RAYQR-----TRE-ANFSL------------EGLIGFNMYGRTVGVIGTGK-
O17626_CAEEL/8-316Q.ANSRSAAELTCTLILSLSRHVP----QAAAS-----MKA-GKWAR------------KDFMGEEVYGRTLAVLGLGR-
PDXB_PSEAE/3-285G.CNARGVVDYVLGCLLAMAEVRG----ADLAE-----RTY-GVVGA------------GQVGGRLVEVLRGLGWKVLV-
SERA_YEAST/61-381F.SNSRSVAELVIAEIISLARQLG----DRSIE-----LHT-GTWNK------------VAARCWEVRGKTLGIIGYGH-
YGDH_SCHPO/9-332N.GPTEGTANMNLMLFMCTLRGAR----EAEQS-----LRL-GKWRQ------------NLSLTDDPYGKRVGIIGMGA-
CTBP1_CAEEL/181-504G.DYVEDVADSTLSLILDLFRRTY----WHAKS-----YSE-TRKTI------------GADQVRENAVGSKKVRGSVL-
Q9KCG9_BACHD/20-325D.GNTISTAEHTFAMICSLLRKIP----QANAS-----IKA-GEWKR------------KAFQGTELRGKTLGIIGFGR-
SERA_MYCLE/6-313T.SNIHSAAEHALALLLAASRQIA----EADAS-----LRA-HIWKR------------SSFSGTEIFGKTVGVVGLGR-
Q9I530_PSEAE/3-328A.YSPHAVAEHAVGLILTLNRRLH----RAYNR-----TRE-GDFSL------------HGLTGFDLHGKRVGVIGTGQ-
Q9VII9_DROME/10-326G.VVKNAVADLAIGLMIAAGRHFH----AGRTE-----IER-SQWKI------------EQINWMMGQEIRDSVIGFFG-
O66939_AQUAE/3-332A.YSPESVAEHTFAMILTLVKRLK----RIEDR-----VKK-LNFSQ------------DSEILARELNRLTLGVIGTG-
Q9HVG5_PSEAE/7-321G.YGTPSVAQHTLALLLALATRLP----DYQQA-----VRS-GRWQQ------------SSQFCLLDFPIVELEGKTLG-
Q98CG2_RHILO/11-318D.VLTEEVADTAIGLLINTIRDLP----RAENW-----LRD-GSWVR------------KGNYPLSRLTLRARRVGIFG-
GRHPR_HUMAN/9-327D.VLTDTTAELAVSLLLTTCRRLP----EAIEE-----VKN-GGWTS------------WKPLWLCGYGLTQSTVGIIG-
Q9KMX4_VIBCH/4-330A.YSPEAVAEHTVGMMLCLNRRFH----KAYQR-----TRD-ANFSL------------DGLVGFNFHGKTVGVIGSGK-
Q9K7P7_BACHD/3-318G.VLTEATADLTFALLMATGRRLR----ESIDY-----VRN-DQWKS------------WGPFMLTGQAIYGTTLGIIG-
Q9I6H5_PSEAE/13-326Y.SNTRSVAELVLAEAILLLRGIP----EKNAS-----CHR-GGWIK------------SAANSFEIRGKKLGIVGYGS-
Q9HK29_THEAC/3-309T.ASADSVAEHALSMVLSLIKDQR----FLDAE-----IRS-GRWPR------------ITRSSDLMGKTFGIVGMGSI-
Q98GE4_RHILO/8-315A.VNARSVAEHVMFTALALLRQFR----RVDRD-----LRA-KGWLA------------GREHANANIELAGKTIGIVG-
DDH1_SCHPO/3-330A.YSPYAVAEYTIGLLLSLNRKIH----RAYVR-----VRE-DDFNL------------NGLLGHDLHGKTIGLLGTGR-
PDXB_VIBCH/3-286G.CNKVGVAEYVFSVLMVLAQQQG----FSVFD-----KTV-GIIGA------------GQVGSYLAKCLSGIGMKVLL-
DHGY_METEA/5-313N.YAFNTVPEHVVGLMFALRRAIV----PYANS-----VRR-GDWNK------------SKQFCYFDYPIYDIAGSTLG-
Q97ZK1_SULSO/20-326G.ASTDSAAELTIGLLIAAARKLY----DSMNM-----AKG-GIFKK------------IEGIELAGKTIGIVGFGRIG-
Q97F10_CLOAB/3-323Q.YSTSSVVQMSMALILEICGHVG----QHNAS-----VKK-GDWQN------------CADFSYLKYPIIELSGKTIG-
Q9Z564_STRCO/7-314T.SNIVTAAELACGLIVATARNIP----QANAA-----LKN-GEWKR------------SKYTGVELAEKTLGVVGLGR-
SERA_SYNY3/32-339E.GNTIAAAEHALAMMMALARHIP----DANKS-----VKE-SKWER------------KQFIGTEVYKKTLGVVGLGK-
A6TI50_KLEP7/6-326D.LLTVPTAELAIGLAVGLGRHLR----AADAF-----VRS-GEFQG------------WQPQFYGTGLDNATVGILGM-
B0JPW3_MICAN/19-330G.MSTTAVAEHTLSMILALAKKLP----FLDHC-----VKK-GNYLI------------RNQMQPIQLENKTLGIVGLG-
G1UB05_LACJO/8-330V.YSPDAIAEHAAIQAARVLRQDK----RMDEK-----MAK-RDLRW------------APTIGREVRDQVVGVVGTGH-
N0B2T1_9RHIZ/6-319H.GVTVATAEIAMLLLLGSARRAS----EGEKM-----IRT-RSWPG------------WQPLQLVGQRLDGKKLGIYG-
O25158_HELPY/4-314T.ANTIAAVELTMAHLINAVRSFP----CANDQ-----IKH-QRLWK------------REDWYGTELKNKKLGIIGFG-
SERA_ECOLI/14-326F.SNTRSVAELVIGELLLLLRGVP----EANAK-----AHR-GVWNK------------LAAGSFEARGKKLGIIGYGH-
GHRB_ECOLI/5-319T.VLTETVADTLMALVLSTARRVV----EVAER-----VKA-GEWTA------------SIGPDWYGTDVHHKTLGIVG-
Q03CR3_LACC3/8-328A.YSPAAIAEFALTDTLYLLRNMG----KVQAQ-----LQA-GDYEK------------AGTFIGKELGQQTVGVMGTG-
Q03VC9_LEUMM/6-329V.YSPNAIAEHSMIQLSRLLRRTK----ALDAK-----IAK-HDLRW------------APTIGREMRMQTVGVIGTGH-
Q1GAA2_LACDA/5-332V.YSPRAIAEMTVTQAMYLLRKIG----EFRYR-----MDH-DHDFT------------WPSNLISNEIYNLTVGLIGV-
Q2FV62_STAA8/9-332S.YSPNSIAEFAVNQAINVVRHFN----QIQTK-----VRE-HDFRW------------EPTILSKSIKDLKVAVIGTG-
Y2577_STAA8/5-317K.ASTNATADLTIGLVLAVARRIV----EGDQL-----SRT-TGFDG------------WAPLFFRGREVSGKTIGIIG-
Q2FXK1_STAA8/6-315D.GNTISATEHTLAMLLSMARNIP----QAHQS-----LTN-KEWNR------------NAFKGTELYHKTLGVIGAGR-
Q7W0H7_BORPE/11-324F.SNTRSVAELVLGEAILLLRRIP----EKNAR-----VHL-GHWDK------------SAAGAYEARGKTLGIVGYGN-
LDHD_LACPL/6-329A.YSPNAIAELSVTQLMQLLRQTP----LFNKK-----LAK-QDFRW------------APDIAKELNTMTVGVIGTGR-

PF05222

Q3A7G8_PELCD/4-137A---------------------------GVRAL.....TED.G.H.T-----------------------VLVEREAGI.
NNTM_BOVIN/60-199A---------------------------GVQAL.....VKQ.G.F.N-----------------------VVVESGAGE.
Q0VPX1_ALCBS/24-165A---------------------------NVSAL.....LKKQG.V.E-----------------------IIIERGAGD.
Q3J1C2_RHOS4/4-139D---------------------------SALQL.....QKL.G.H.H-----------------------CVIETGAGM.
LYS1_ASHGO/6-141T---------------------------TVRTL.....VSH.G.F.K-----------------------IYVEESA...
Q28V87_JANSC/4-137A---------------------------AAREA.....VVH.G.H.R-----------------------VTMQAGAGT.
Q2G7Q1_NOVAD/4-137E---------------------------SVREL.....VAH.G.H.E-----------------------VWVEAGAGN.
Q6AQV0_DESPS/4-137G---------------------------GVVTM.....VAN.G.H.D-----------------------VIVEKGAGL.
Q82QU1_STRAW/15-145A---------------------------TVRLL.....LGL.G.Y.E-----------------------VVVESGAGE.
Q3B540_PELLD/4-135A---------------------------GVRHL.....VAG.G.H.R-----------------------VVVQSGAGA.
DHA_OCEIH/4-136A---------------------------GVVHL.....INA.G.H.T-----------------------VQIEKGAGL.
Q0S884_RHOSR/4-137A---------------------------GVHEL.....NER.G.H.E-----------------------VVIESGAGI.
A0KQF4_AERHH/4-135A---------------------------TVEQL.....KKL.G.F.E-----------------------VAIEAGAGL.
Q9KAF8_BACHD/4-136A---------------------------SVMSF.....VQA.G.H.Q-----------------------VLIERGAGS.
A6VXM0_MARMS/6-147S---------------------------IASKV.....KQL.G.F.D-----------------------IIMESGAGV.
Q3JE74_NITOC/4-136E---------------------------ATVEL.....VQQ.G.H.E-----------------------VFIERAAGD.
B1YFJ0_EXIS2/4-136A---------------------------GVAAL.....MGQ.G.H.T-----------------------VIVETTAGM.
A5GEE8_GEOUR/4-135A---------------------------GTAEL.....VTS.G.N.E-----------------------VLVETGAGE.
A5FP13_FLAJ1/4-137A---------------------------GVSEM.....KKH.G.H.T-----------------------VYVQSTAGL.
Q98CE6_RHILO/6-139D---------------------------TVKRL.....AGL.G.F.D-----------------------VIVETGAGT.
Q31MC9_SYNE7/4-136A---------------------------SVRAL.....ALQ.G.H.Q-----------------------IWIEQGAGV.
Q6NYQ7_DANRE/56-195A---------------------------GVEAL.....IKQ.G.F.N-----------------------VVVESGAGE.
Q5KHJ2_CRYNJ/22-157T---------------------------TAKTL.....LDS.N.F.D-----------------------VYVEKDP...
Q2IDX0_ANADE/4-138E---------------------------NVTRL.....VKQ.G.H.E-----------------------VRVERGAGE.
Q21L93_SACD2/6-141D---------------------------VVQKL.....NKL.G.V.Q-----------------------VVMQQGAGA.
A0QNT0_MYCS2/5-135K---------------------------VVEKL.....SAR.G.L.E-----------------------VVVESAAGA.
Q1GUI4_SPHAL/4-138E---------------------------TVKKF.....IGL.G.A.E-----------------------VAVESGAGE.
Q0AQT6_MARMM/4-137N---------------------------SVAEF.....VRH.G.H.E-----------------------VVVETDAGE.
Q18031_CAEEL/32-165N---------------------------GVALL.....KKN.G.I.S-----------------------VLIEENAGV.
Q47E46_DECAR/4-137A---------------------------SVREL.....VAH.G.H.R-----------------------VIVQKNAGT.
Q39WN5_GEOMG/4-135A---------------------------GIAEL.....ARG.G.H.T-----------------------VLVETGAGE.
Q3SL22_THIDA/4-136E---------------------------GARSL.....VDA.G.H.A-----------------------VSVESHAGA.
Q6W1Y1_RHISN/6-139E---------------------------TVKKI.....LSF.G.L.E-----------------------VVVEAGAGR.
Q67ND6_SYMTH/4-137A---------------------------GVMAM.....VRA.G.H.E-----------------------VYVEHDAGR.
Q5SLT7_THET8/5-139E---------------------------VVARL.....VKG.G.A.R-----------------------VRVERGAGE.
A0KEW0_AERHH/4-137A---------------------------GVQEL.....TAR.G.H.K-----------------------VLVQQQGGE.
Q47BC9_DECAR/6-139E---------------------------TAKKF.....AAL.G.A.R-----------------------LRMEQSSGI.
Q8DL05_THEEB/4-139E---------------------------VVAKL.....VQQ.G.Y.H-----------------------LWVESGAGD.
Q28M63_JANSC/4-139D---------------------------SATQL.....QKL.G.Y.E-----------------------CVIEAGAGA.
Q2RN15_RHORT/4-137N---------------------------SVHEF.....VDH.G.H.A-----------------------VVVESGAGL.
Q0C3J7_HYPNA/4-137E---------------------------SAGEL.....VRA.G.H.Q-----------------------VNIQAGAGI.
Q2S445_SALRD/35-169S---------------------------GTGAL.....VAN.G.H.E-----------------------VYVEEGAGH.
A1SSF5_PSYIN/4-138N---------------------------TVELL.....IKQ.G.F.T-----------------------FLVEKNAGI.
Q5Z133_NOCFA/18-148K---------------------------IIPAL.....LKQ.G.V.E-----------------------VVVESGAGH.
Q5WJZ9_BACSK/4-136A---------------------------GVDAL.....VGS.G.H.R-----------------------IVVEAAAGI.
A0L9H7_MAGSM/4-145D---------------------------SIERL.....RKL.G.Y.D-----------------------VQVETGAGT.
Q6W1J9_RHISN/4-139D---------------------------SALHL.....QKL.G.Y.E-----------------------CLIETGAGK.
PNTA_HAEIN/4-137K---------------------------TVQQI.....LKL.G.F.D-----------------------VIVEHDAGF.
Q6AEY9_LEIXX/4-137A---------------------------GVHDL.....VGA.G.H.E-----------------------VYVEMGAGA.
Q6ACH0_LEIXX/6-139E---------------------------VVPRL.....CAQ.G.F.D-----------------------VVVQSGAGE.
A8GEZ6_SERP5/4-137K---------------------------TVEQL.....LKL.G.F.T-----------------------VAIESGAGK.
Q5LFH6_BACFN/4-137S---------------------------GVAEL.....VKR.G.H.T-----------------------VYIQHTAGE.
A5FFU7_FLAJ1/32-165D---------------------------AVNSL.....TYE.G.H.R-----------------------VMIESGAGE.
A0K2E1_ARTS2/12-145E---------------------------TVQQL.....IGL.G.L.E-----------------------ALVESRAGA.
A0QNN8_MYCS2/4-137Q---------------------------TVGQI.....LKL.G.Y.S-----------------------VVVESGAGA.
Q5YZC0_NOCFA/4-137A---------------------------GAAEL.....VRH.G.H.E-----------------------VLVERGAGA.
P72775_SYNY3/4-136S---------------------------SVRAL.....LSQ.G.H.Q-----------------------VFVEEGAGV.
Q603N5_METCA/4-139E---------------------------VAEKI.....MKL.G.F.E-----------------------VAVESGAGD.
Q2N774_ERYLH/4-137E---------------------------SAREL.....AGR.G.H.D-----------------------VWIESGAGL.
Q1J0B1_DEIGD/4-135G---------------------------GVATL.....IRR.G.H.T-----------------------VTVERGAGV.
Q2HFZ2_CHAGB/7-141T---------------------------TTAAL.....IKA.G.Y.T-----------------------VNVERSP...
LYS1_YEAST/7-142T---------------------------TVKKL.....IAK.G.F.K-----------------------IYVEDSP...
Q5LPM8_RUEPO/4-139D---------------------------SAVQL.....QKL.G.Y.D-----------------------CAIESGAGA.
Q65CX6_BACLD/4-136A---------------------------GVVAL.....KKS.G.H.Q-----------------------VLIEQGAGL.
Q1QUL9_CHRSD/4-139E---------------------------SAQHI.....QKL.G.H.T-----------------------CVIESGAGL.
Q2J8T8_FRASC/7-142Q---------------------------VVGRL.....VGS.G.L.D-----------------------VLVETGAGR.
A4Y0R2_PSEMY/4-136E---------------------------TVKKL.....VGQ.G.H.Q-----------------------VTVQTGAGI.
Q11TK3_CYTH3/4-137S---------------------------GVAEL.....VSR.K.H.Q-----------------------VLVQKDAGL.
A0CWD3_PARTE/29-161E---------------------------SIKNL.....VKD.G.H.Q-----------------------VLIESGAGL.
Q2SHR3_HAHCH/4-137K---------------------------SVEEL.....IKL.G.F.S-----------------------VAVEADAGW.
A6VN40_ACTSZ/4-137K---------------------------TVEQI.....KKL.G.F.D-----------------------VIVENDAGF.
A8ZXI3_DESOH/4-137A---------------------------GVEMM.....TAR.G.H.E-----------------------ILVETRAGA.
A5FVY5_ACICJ/4-137A---------------------------SVREL.....HAN.G.H.R-----------------------VLVETGAGE.
Q8DQ43_STRR6/4-136A---------------------------GVHSL.....VSR.G.H.R-----------------------VLIETNAGL.
Q9K827_BACHD/4-136A---------------------------GVMTL.....TQH.G.H.E-----------------------VIVQKGAGE.
Q5CI32_CRYHO/405-540N---------------------------FVKKL.....RKL.G.F.R-----------------------VLVESGAGT.
Q0SD61_RHOSR/4-134T---------------------------TVAAL.....QKL.G.Y.Q-----------------------VVVEPGAGE.
Q11PQ8_CYTH3/7-139A---------------------------QCVEI.....MQQYPHV.E-----------------------IFVQPSD...
Q2NSW2_SODGM/4-137K---------------------------TVEQL.....LKL.G.F.S-----------------------IAMESGAGT.
Q8DH53_THEEB/4-139A---------------------------GVQSL.....RER.G.H.E-----------------------VLIESGAGV.
Q2W3E7_MAGSA/6-142D---------------------------VVEKL.....IKL.G.F.S-----------------------VVVETGAGA.
A0L3P1_MAGSM/4-137D---------------------------GVETL.....IQH.G.H.A-----------------------VWVEQQAGL.
Q0A4X6_ALKEH/6-139A---------------------------ALRQF.....EKL.G.V.E-----------------------LLMQKGAGL.
Q6MKC3_BDEBA/4-137A---------------------------GVRQY.....VSE.G.H.T-----------------------VIVEKDAGV.
Q2LSK0_SYNAS/44-177G---------------------------SVGTL.....VRA.G.H.K-----------------------ILVQSGAGE.
Q163M5_ROSDO/4-139D---------------------------SALQL.....QKL.G.H.T-----------------------CVVESGAGH.
A9CHR5_AGRT5/4-139D---------------------------SAQAL.....QKL.G.Y.D-----------------------CVIEAGAGK.
Q74AR0_GEOSL/4-135A---------------------------GAAEL.....TRE.G.H.R-----------------------VLVEAGAGE.
Q3B571_PELLD/35-169A---------------------------GAQIL.....CEN.G.I.R-----------------------VMVEAGAGR.
Q6A5I3_PROAC/4-137A---------------------------GVHAL.....VGR.G.H.E-----------------------VLVQAGAGV.
Q54P64_DICDI/8-138S---------------------------HVEEL.....VKK..GI.K-----------------------VIVQPST...
B4S6Q3_PROA2/35-169A---------------------------GARIL.....VEN.G.M.R-----------------------VMIEHDAGK.
Q0ALL0_MARMM/4-137E---------------------------TVKKF.....VAA.G.H.D-----------------------VAIEKGAGL.
Q2VYN4_MAGSA/13-146G---------------------------SVREL.....VHH.G.H.Q-----------------------VLVETGAGA.
Q1AS10_RUBXD/6-139D---------------------------GVVEL.....VHH.G.H.E-----------------------VVVQSGAGR.
Q82M72_STRAW/7-141S---------------------------DARRL.....VES.G.V.R-----------------------LTVEDSP...
Q7VB57_PROMA/5-141E---------------------------TVKKL.....RSI.G.F.V-----------------------VSIEKGAGS.
Q1GL71_RUEST/4-137D---------------------------AAREA.....IAH.G.H.Q-----------------------VMIQKGAGL.
Q10ZM3_TRIEI/4-136A---------------------------SVKVC.....TEA.G.N.E-----------------------VFIETEAGW.
A0JVY4_ARTS2/5-137A---------------------------TVGQL.....LGL.G.Y.E-----------------------VVVEKGAGE.
Q15T10_PSEA6/4-137A---------------------------AVKEF.....VVH.G.H.Q-----------------------VLIEDNAGT.
Q5FU53_GLUOX/6-140Q---------------------------VAEKL.....TPL.G.I.T-----------------------FAMETGAGV.
A2E4I0_TRIVA/4-138S---------------------------GVQEF.....VAN.G.H.E-----------------------VYIEHNAGL.
Q0SAT6_RHOSR/4-137A---------------------------GVHEM.....VAH.G.H.D-----------------------VFVERGAGE.
DHA_BACSU/4-135G---------------------------GVSQL.....ISN.G.H.R-----------------------VLVETGAGL.
Q2YIM6_BRUA2/6-139E---------------------------TVKKF.....IAL.G.F.D-----------------------VVVEKGAGE.
B9M3R5_GEODF/4-135A---------------------------GAADL.....VRD.G.H.V-----------------------VLVEIGAGT.
Q5SLS7_THET8/4-135G---------------------------GVESL.....VRR.G.H.T-----------------------VLVERGAGE.
Q6MUG7_MYCMS/10-140M---------------------------GVVEL.....VRN.N.H.E-----------------------VLVESGAGL.
Q21RZ9_ALBFT/27-163E---------------------------AVEKL.....IKL.G.F.V-----------------------VAVESGAGD.
Q0K0H4_CUPNH/6-146D---------------------------SVREL.....LKL.G.Y.Q-----------------------VVVETGAGQ.
Q47FY5_DECAR/6-139E---------------------------MSKKF.....QAL.G.A.N-----------------------VVLETNAGL.
A1SJK7_NOCSJ/4-137I---------------------------GVHEL.....TAH.G.H.Q-----------------------VYIERGAGE.
Q7UIW1_RHOBA/5-140A---------------------------SVKKL.....IQV.G.F.S-----------------------VGIESGAGL.
LYS1_SCHPO/7-142R---------------------------TAKIL.....ADA.G.F.Q-----------------------ITIERSS...
Q3JEF4_NITOC/4-145D---------------------------TAERL.....QKL.G.F.S-----------------------VALESGAGL.
A1WCT5_ACISJ/4-136E---------------------------TVKKL.....VAQ.G.H.T-----------------------VRVQSGAGV.
O25948_HELPY/4-135D---------------------------DVALI.....VQK.G.V.E-----------------------VLVQNSAGA.
A1C559_ASPCL/85-224Q---------------------------NVTLL.....LKK.G.FSR-----------------------VLVERGAGG.
Q55F30_DICDI/135-275E---------------------------NVGVL.....VKK.G.Y.K-----------------------VLVEEGAGK.
Q2G790_NOVAD/8-140E---------------------------TVKKF.....IAL.G.A.T-----------------------VAIEEGAGI.
Q7NWG7_CHRVO/4-137S---------------------------GVREL.....VAN.G.H.K-----------------------VLVQTHAGL.
Q1GKH6_RUEST/5-139A---------------------------GAKAL.....LEA.G.I.R-----------------------VTVEESS...
Q1GVP3_SPHAL/4-137E---------------------------SAREL.....VVH.G.H.R-----------------------VLVETGAGE.
A1K465_AZOSB/6-138D---------------------------VVKKY.....LGL.G.A.R-----------------------VVIESGAGV.
A5FAH7_FLAJ1/4-136N---------------------------ELTKL.....KQSYHEA.S-----------------------VEVESSD...
Q6KIJ0_MYCMO/4-134N---------------------------IVSDL.....VKN.K.H.E-----------------------VLIEKNAGL.
Q8EPC2_OCEIH/4-136S---------------------------GVMSL.....KDA.G.H.E-----------------------IYVQTEAGL.
Q1ARY0_RUBXD/7-141E---------------------------TVSRL.....VGE.G.F.E-----------------------VLVETGAGW.
Q6LMW4_PHOPR/33-171S---------------------------DVGQL.....VQA.G.I.K-----------------------VYVECGAGD.
A5G0H4_ACICJ/5-140D---------------------------SIKKL.....KAL.G.L.D-----------------------VVIEAGAGE.
A5V5I3_SPHWW/4-142E---------------------------TVKKF.....IAL.G.A.E-----------------------LGVERGAGE.
Q7NEB1_GLOVI/4-136A---------------------------AVRAL.....SDQ.G.H.S-----------------------VAIEARAGE.
Q60BB4_METCA/4-135Q---------------------------GVAAL.....VNA.G.H.E-----------------------VLVEVAAGL.
A1TXK5_MARAV/4-139S---------------------------GVSTL.....LEA.G.Y.E-----------------------VVVESGAGS.
Q1IIW3_KORVE/4-145A---------------------------VVPNL.....AKA.G.L.E-----------------------VVIQAGAGA.
A7HTE3_PARL1/4-137P---------------------------AVREA.....VHH.G.H.E-----------------------VLVQKGAGF.
Q3APE7_CHLCH/6-140A---------------------------GVQIL.....GEH.G.I.Q-----------------------VIIESNAGM.
Q5P1Y9_AROAE/6-139D---------------------------VVKKY.....LDL.G.A.Q-----------------------VMVESGAGQ.
Q8KEI3_CHLTE/17-148A---------------------------GVRQL.....VGA.G.H.R-----------------------VVVERGAGE.
Q2S0H0_SALRD/6-141D---------------------------VADRL.....LATVDDL.D-----------------------IRVEEGAGQ.
A8LIC1_DINSH/19-154D---------------------------SAVQL.....QKL.G.Y.E-----------------------CVIETGAGA.
A0LWI4_ACIC1/4-137D---------------------------TVTRL.....RSA.G.H.T-----------------------VAVEQGAGE.
Q21M61_SACD2/4-145E---------------------------TVKKY.....VGM.G.F.E-----------------------VLVEKDAGT.
Q0KA62_CUPNH/4-137A---------------------------CVREL.....VSR.G.H.Q-----------------------VMVQAGAGA.
A1CKS0_ASPCL/7-145T---------------------------TCKAL.....MDA.G.Y.D-----------------------VTVERST...
A0LUF0_ACIC1/4-137I---------------------------GVREL.....TDA.G.H.T-----------------------VLVEHDAGA.
Q484K1_COLP3/4-137S---------------------------SVSAL.....IKL.G.F.T-----------------------VQVQKGAGT.
Q7UXF1_RHOBA/4-137V---------------------------GVAEL.....TQA.G.H.T-----------------------VLVQAGAGL.
Q6MB39_PARUW/4-136S---------------------------MVRLL.....VDA.G.H.Q-----------------------VFVQSLAGD.
Q2UAA6_ASPOR/84-217Q---------------------------NVALL.....LRK.G.FSR-----------------------VLIERGAGE.
A0DTI6_PARTE/7-138H---------------------------DCKYI.....MEKHPQI.Q-----------------------MVIQPST...
A1WZC8_HALHL/6-141G---------------------------VLKQF.....GKL.G.V.E-----------------------LLLETGAGE.
Q480P6_COLP3/4-137A---------------------------GVKEL.....SVN.G.H.E-----------------------VIVEHNGGA.
Q4P6J5_USTMA/9-143T---------------------------TAKAL.....IDA.G.F.D-----------------------ITVESDP...
Q8G5Z4_BIFLO/12-147D---------------------------IVTRL.....KRS.G.V.S-----------------------SLIEAGAGI.
O44503_CAEEL/33-163T---------------------------HVKRL.....TKS..GV.N-----------------------VLIQPSN...
A7IGP9_XANP2/4-139D---------------------------TVKRL.....VAL.G.A.S-----------------------VAVETGAGL.
Q3IZY5_RHOS4/4-137H---------------------------AAREA.....ASH.G.H.E-----------------------VLVEAGAGA.
Q13HL5_BURXL/6-139S---------------------------VAQKL.....IKL.G.A.R-----------------------LHMQPGAGA.
Q6AA35_PROAC/43-176T---------------------------TVPAL.....LKL.G.Y.E-----------------------VVVEAGAGE.
Q16LL0_AEDAE/57-190A---------------------------VTATL.....VKK.G.F.K-----------------------VNVESGAGF.
B3E8N4_GEOLS/4-135Q---------------------------GVQQL.....RGD.G.H.Q-----------------------ILVEQGAGA.
B2UC87_RALPJ/4-136E---------------------------TVKKY.....VAL.G.H.Q-----------------------VTVQSGAGV.
Q829A4_STRAW/4-137A---------------------------GVHEL.....VRY.G.H.Q-----------------------VFIEQNAGV.
Q5R0B7_IDILO/4-137A---------------------------AVREY.....VEN.G.H.D-----------------------VIIENNGGA.
Q2Y9W7_NITMU/4-139E---------------------------TVKKF.....TAK.GLH.V-----------------------VLVQSGAGA.
Q2Y9W3_NITMU/6-138S---------------------------NVKGL.....TRR.G.H.R-----------------------VLVQSGAGE.
B3EKT2_CHLPB/35-169A---------------------------GVKIL.....NEN.G.V.R-----------------------VLIEKHAGL.
A0ZAH3_NODSP/4-137S---------------------------SVRVL.....QEN.G.H.A-----------------------IFVETKAGS.
A4SZU6_POLSQ/4-136E---------------------------TVKKL.....IGQ.G.H.T-----------------------VVIQKDAGV.
Q0U4J1_PHANO/7-146T---------------------------TAKKL.....LDA.G.Y.P-----------------------VLVERSPKDP
A1B5J9_PARDP/5-139A---------------------------GVREL.....IAQ.G.F.H-----------------------VTVEESP...
Q6F836_ACIAD/4-136E---------------------------TVKKL.....ISA.G.H.H-----------------------VVIERGAGV.
Q0SGE0_RHOSR/15-145K---------------------------VVASL.....IAK.G.V.D-----------------------VVVESGAGL.
Q6ANB3_DESPS/4-131R---------------------------HIKTL.....IEA.G.H.T-----------------------VYLEKDAGL.
Q2SNB3_HAHCH/4-137A---------------------------AVQEL.....IRN.G.H.K-----------------------VVVQKDAGA.
A1BEU6_CHLPD/35-169A---------------------------GVQIL.....TEH.G.I.R-----------------------VVIEQSAGH.
Q2JLS3_SYNJB/4-136A---------------------------AVRVL.....TEQ.G.H.Q-----------------------VWVETQAGQ.
Q01VE2_SOLUE/4-138P---------------------------VVRRL.....CGA.G.H.T-----------------------VWIESGAGD.
A0JVR6_ARTS2/4-136A---------------------------GVHEF.....RTH.G.H.T-----------------------VLVERGAGL.
Q7N4Z3_PHOLL/4-137N---------------------------TVEHL.....LKL.G.F.N-----------------------VVVESGAGH.
O04709_MAIZE/19-156S---------------------------HCARLLLGGGKNG.PRVNR-----------------------IIVQPST...
A8ZX21_DESOH/4-137A---------------------------GVEAF.....VAK.G.H.K-----------------------IYVETGAGA.
Q021N9_SOLUE/6-147S---------------------------AISVL.....NKT.G.V.E-----------------------LLMEPGAGV.
Q3IYW2_RHOS4/5-139E---------------------------GAAAL.....IAR.G.L.R-----------------------VTVEASR...
Q3AEB3_CARHZ/4-137A---------------------------GVEAL.....VAA.G.H.K-----------------------VVIENNAGL.
A1BEX7_CHLPD/4-135S---------------------------GVRHL.....VNA.G.H.H-----------------------VAVEKGAGE.
LYS1_YARLI/8-142T---------------------------TTRKL.....LDA.G.F.E-----------------------VFVEKSP...
Q5SIC7_THET8/4-139Q---------------------------GVREL.....VAS.G.H.R-----------------------VYVERGAGE.
Q1GIS5_RUEST/4-139A---------------------------SAKDL.....QKL.G.F.E-----------------------CCIEAGAGE.
B2JGI7_BURP8/4-136E---------------------------TVKKY.....VSQ.G.H.R-----------------------VSVQRGAGT.
Q1AW21_RUBXD/4-137P---------------------------AVHEL.....CRA.G.H.R-----------------------VLVESGAGV.
B4SD94_PELPB/35-169P---------------------------GVQIL.....VEQ.G.I.K-----------------------VIVEKSAGN.
Q16C99_ROSDO/5-139D---------------------------GARQL.....IAS.G.I.T-----------------------LTVEQSP...
A6WFF9_KINRD/4-137A---------------------------GVHEL.....VGH.G.H.E-----------------------VLVQAGAGL.
A1B9C0_PARDP/4-139S---------------------------SAAHL.....RKL.G.H.E-----------------------VYVEAGAGV.
A3QAN8_SHELP/4-140A---------------------------NVTRL.....IKK.N.L.Q-----------------------ILVESGAGL.
Q8XRA9_RALSO/4-136E---------------------------TAKKL.....KAQ.G.H.V-----------------------LRVQTGAGR.
A0LMX7_SYNFM/4-137A---------------------------AVKAY.....CEA.G.H.E-----------------------VYMQKDAGA.
Q47RB8_THEFY/4-137A---------------------------GVQEL.....VRH.G.H.D-----------------------VLIERDAGV.
B2JLD8_BURP8/4-137S---------------------------SVREI.....VAH.G.H.E-----------------------VSVETGAGA.
Q128A6_POLSJ/4-137S---------------------------SVREL.....AAA.G.H.R-----------------------VIVEHNAGS.
Q7P1W1_CHRVO/4-138D---------------------------TVKKL.....VAA.G.H.A-----------------------VTVEQGAGL.
Q8KEN6_CHLTE/6-140A---------------------------GVQIL.....VEQ.G.I.R-----------------------VVVESNAGC.
Q2IJQ2_ANADE/4-137G---------------------------GARSL.....VAA.G.H.E-----------------------VLVESGAGE.
A4SWM0_POLSQ/4-137G---------------------------NVSGL.....CKQ.G.H.T-----------------------VLVQRGAGE.
A0ZDC5_NODSP/19-159D---------------------------TVARL.....IKQ.G.L.E-----------------------VSVEAGAGE.
A1VTW8_POLNA/4-136E---------------------------TAKKL.....KAQ.G.H.T-----------------------IRIQSGAGV.
A9BR27_DELAS/4-136E---------------------------TVKKL.....RAQ.G.H.V-----------------------LRVQAGAGV.
A6VWR5_MARMS/6-139S---------------------------LTAKL.....IKL.G.A.R-----------------------LHMQSGAGD.
A4XPH7_PSEMY/4-137Q---------------------------SVAEL.....AAL.G.H.E-----------------------VWVEALAGA.
Q1QT97_CHRSD/4-137S---------------------------VVREL.....AAR.G.H.T-----------------------VAVQASAGE.
B0SVI3_CAUSK/5-140E---------------------------TVKKL.....AAA.G.W.S-----------------------VTVEAGAGI.
Q1WRC5_LACS1/4-135S---------------------------AVASL.....VHA.G.H.S-----------------------VIVEKGAGI.
B0T233_CAUSK/4-137T---------------------------AVREY.....VGH.G.H.S-----------------------VLVQTGAGL.
Q28K30_JANSC/4-138V---------------------------GVSRL.....LAN.G.L.D-----------------------ITVEDSP...
A5V806_SPHWW/4-137A---------------------------SVADL.....VAA.G.H.A-----------------------VIVETGAGL.
Q31MS7_SYNE7/28-167S---------------------------QLARL.....KQLTG.G.T-----------------------ISVQSGAGQ.
Q03RI6_LACBA/4-135A---------------------------GVVSL.....VHA.G.H.Q-----------------------VIVEHHAGE.
A4J8G7_DESRM/4-137A---------------------------GVQAM.....VNN.G.H.R-----------------------VFIEHNAGV.
Q5KUA3_GEOKA/4-136A---------------------------GVLSF.....VQA.G.H.T-----------------------VLIEKEAGV.
Q11IF1_CHESB/4-137G---------------------------SVREY.....MAH.G.H.D-----------------------VLVETGAGA.
P73496_SYNY3/23-158D---------------------------TAQKL.....QKL.G.F.D-----------------------LLLETGAGA.
Q15PN0_PSEA6/5-140V---------------------------NVKAY.....KLL.G.A.D-----------------------VLIESGLGQ.
Q7VV14_BORPE/4-136E---------------------------TVKKY.....IGG.K.H.S-----------------------VIVERGAGV.
Q12QQ7_SHEDO/4-145A---------------------------TIKQL.....SKL.G.F.D-----------------------LVVQAGAGQ.
A7HUT9_PARL1/4-139E---------------------------TVKKL.....SAL.G.I.D-----------------------IVVETGAGE.
Q03HP9_PEDPA/4-134E---------------------------NVQKM.....VEA.G.N.E-----------------------VLVERDAGI.
Q5DZZ0_VIBF1/4-143K---------------------------TVEQL.....IKL.G.F.T-----------------------VAVESNAGI.
Q01VQ6_SOLUE/4-137S---------------------------GVTAL.....REA.G.H.E-----------------------VLVETHAGE.
Q7VA67_PROMA/14-145D---------------------------GVKEL.....VTQ.G.L.E-----------------------VRVQTDAGK.
Q10VQ6_TRIEI/4-139D---------------------------VIAKL.....VKQ.G.L.E-----------------------IQVEAGAGE.
A0M2A6_GRAFK/33-166D---------------------------AVAAI.....TAH.G.H.R-----------------------VMIESGAGK.
C1DKG5_AZOVD/4-137S---------------------------SVAEL.....SAL.G.H.E-----------------------VWVESRAGA.
A1A1C3_BIFAA/12-147D---------------------------IVTRL.....RKS.G.V.T-----------------------CLIESGAGV.
Q11SC0_CYTH3/13-146E---------------------------AVALI.....VNN.G.H.I-----------------------VQVETGAGL.
A8LLI3_DINSH/4-137A---------------------------AAAEA.....VAH.G.H.A-----------------------VLVQAGAGV.
Q11EJ3_CHESB/6-139D---------------------------TAKRL.....SGL.G.F.T-----------------------VIVERGAGL.
A4X685_SALTO/4-137A---------------------------GVNEF.....VRA.G.H.Q-----------------------VFVESGAGV.
B1WS00_CYAA5/5-144D---------------------------IVARF.....IKL.G.F.E-----------------------VLVQSGAGL.
B2FPZ7_STRMK/9-139E---------------------------TARKL.....GAL.G.I.T-----------------------VWYEAGAGL.
B2HKV6_MYCMM/4-137A---------------------------GVAAL.....TKR.G.H.E-----------------------VLIQAGAGE.
B2HLU5_MYCMM/9-139K---------------------------AVGSL.....VNS.G.V.A-----------------------VVVESGAGE.
B4EIC9_BURCJ/4-137A---------------------------GAREL.....TRH.G.H.R-----------------------VLVQRGAGT.
B4HYA5_DROSE/26-155T---------------------------HVQKL.....VKQ.N.V.K-----------------------VIVQPSN...
B9RR16_RICCO/8-144S---------------------------HCARLLHSGRDRT.G.VAR-----------------------IIVQPST...
D0IWI5_COMT2/2-128D---------------------------VVEKL.....IKL.G.F.S-----------------------VAIESGAGD.
D4ZJ19_SHEVD/4-142A---------------------------TVIQL.....KKL.G.F.S-----------------------VVVQSGAGE.
F7QES8_9BRAD/5-136D---------------------------TVKKF.....KAL.G.A.E-----------------------VAIEPGAGI.
G0FKF9_AMYMS/4-137A---------------------------GVHEL.....AGR.G.H.D-----------------------VFVETGAGV.
H3CUQ7_TETNG/61-200A---------------------------GVQAL.....VKQ.G.F.N-----------------------VIVEPGAGE.
H3CVX4_TETNG/53-186A---------------------------GVEAL.....VKQ.G.F.R-----------------------VQVESGAGE.
H3CYI7_TETNG/31-160R---------------------------HVKEL.....TNA.K.I.K-----------------------VLVQPSN...
H7C6H0_BRADU/4-137G---------------------------AAREY.....VAA.G.H.R-----------------------VMIETNAGA.
K4PU16_SHEON/4-137S---------------------------SVREL.....TIK.G.H.E-----------------------VFVETNAGT.
Q036E3_LACC3/4-134E---------------------------NVKKL.....VDV.G.A.T-----------------------VLVEKSAGV.
Q1D4V2_MYXXD/4-138A---------------------------GAAAL.....IAA.G.H.T-----------------------VLIETNAGV.
Q24858_ENTHI/568-702S---------------------------VCKQL.....RSR.G.Y.G-----------------------IYVESGAGL.
Q24YW8_DESHY/4-137A---------------------------GVDAL.....VKA.G.H.T-----------------------CYLEQSAGL.
DHA2_STAA8/4-136S---------------------------GVHAL.....VES.G.H.T-----------------------VLVETNAGS.
DHA1_STAA8/5-134E---------------------------NVRKL.....TDA.G.H.K-----------------------VIVEKNAGI.
Q2K468_RHIEC/46-178E---------------------------TVKKL.....KGF.G.F.D-----------------------VIVEAGAGA.
PNTAA_RHORT/4-144E---------------------------VVKKL.....VGL.G.F.E-----------------------VIVEQGAGV.
Q46JT2_PROMT/6-141E---------------------------TVKKF.....LDL.G.C.K-----------------------VFFEKGAGK.
Q4FMG2_PELUB/4-137D---------------------------SVKTL.....ISE.G.H.E-----------------------VLVENNGGY.
Q4FU92_PSYA2/10-139D---------------------------AVKKL.....RKL.G.F.E-----------------------VVIQSGAGQ.
Q59P14_CANAL/10-144S---------------------------TTKQL.....LDA.G.F.E-----------------------IYVEESS...
Q5F6S7_NEIG1/4-136A---------------------------TVALL.....GKL.G.F.E-----------------------TVVESGAGL.
Q5ZX09_LEGPH/4-137S---------------------------SVREI.....IRA.G.S.D-----------------------VLVEKGAGL.
Q63QY7_BURPS/4-136E---------------------------TVRKY.....AAA.G.H.R-----------------------VTVERGAGA.
Q6LIA6_PHOPR/6-139A---------------------------GASAL.....ILT.G.A.V-----------------------VMVEKSS...
Q6LIV6_PHOPR/4-143K---------------------------TVEQL.....LNM.G.F.S-----------------------VAIEQNAGV.
Q6LQ29_PHOPR/6-139A---------------------------SVNEA.....VSH.G.H.T-----------------------VYVQTLAGS.
DHA_METMP/4-137A---------------------------GVEAF.....VLA.G.H.K-----------------------VYIEKGAGL.
Q72EK7_DESVH/4-137A---------------------------GVEVL.....CHH.G.H.T-----------------------VLVEAGAGA.
Q7RV12_NEUCR/120-256Q---------------------------NVAFL.....LKK.G.FGK-----------------------VLVEKGAGA.
Q7V5T2_PROMM/14-145D---------------------------GVKEL.....VTK.G.L.E-----------------------VRVQAGAGA.
Q81VA6_BACAN/4-136A---------------------------GVVHL.....IRN.N.H.E-----------------------VFIQKGAGL.
Q87QP6_VIBPA/4-137A---------------------------SVREL.....ISH.G.H.Q-----------------------VLVETNAGA.
Q8Y6V2_LISMO/4-136A---------------------------SVFSY.....VNA.G.H.T-----------------------VYVEKDAGI.
Q92LZ7_RHIME/7-139E---------------------------SVKKL.....KSL.G.F.D-----------------------VVVEAGAGL.
AASS_MOUSE/28-157K---------------------------HIKGI.....TKL.G.Y.K-----------------------VLIQPSN...
Q9KM26_VIBCH/4-137S---------------------------SVEQL.....IKL.G.F.E-----------------------VCIESKAGA.
X2GRC3_9BACI/4-136A---------------------------GVVSL.....THA.G.H.E-----------------------VYIETGAGI.

PF05221

E6S782_INTC7/4-477--VGKGCAQSLAGQ---GARVVVTEVDPICALQAAMEGFQVLR.............LED..VVG..QADIFITTTGCYDV
A0JU72_ARTS2/4-491--VGKGAAEAFRGQ---GSRVIVTEIDPICALQAAMDGYQVAK.............LES..VLS..EGHIFITTTGNKDV
D6Y6B5_THEBD/2-474--VGKGCAQALRGQ---GARVIVTEIDPICALQAAMDGFQVTT.............VED..VVE..TADIFITATGCCGV
D1BWJ6_XYLCX/10-497--VGKGAAEAFRGQ---GARVIVSEVDPICALQAAMDGFQVAR.............IED..VLD..VADFFITTTGNKDV
F6FRM5_ISOV2/23-520--VGKGAAEAFRGQ---GARVIVSEVDPICALQAAMDGFQVAR.............IED..VLG..EADFFITTTGNKDV
E4NC13_KITSK/8-481--VGKGCAESLRGQ---GARVIVTEIDPICALQAAMDGYQVAT.............LDD..VVE..SADIFVTTTGNKDI
D7B5R0_NOCDD/4-477--VGKGAAEALRGQ---GARVVVTEIDPINALQAAMDGYQVTL.............LED..VLE..TGDIFITTTGNFNV
R4LG47_9ACTO/12-485--VGKGSAETLRGQ---GARVVVTEVDPICALQAAMDGMQVVR.............IED..VVA..EADIFITTTGGTDI
A4X3J2_SALTO/22-495--VGKGCAESLRGQ---GARVVVAEIDPICALQAAMDGYQVAT.............LED..VVE..TADIFITATGCFDV
C5C1M6_BEUC1/15-511--VGKGAAESLRGQ---GARVVVAEVDPICALQAAMDGFQVVR.............LED..VVG..EADFFITTTGNFDV
F4CRV7_PSEUX/22-502--VGKGSAEALAGQ---GARVIVSEVDPICALQALLEGYQVAR.............LED..VIG..QADIVITTTGNKDI
K0KB99_SACES/13-486--VGKGAAESLRGQ---GARIIVTEIDPICALQAAMDGYDVQV.............LED..VLG..RADIIITTTGNKDV
A0LS32_ACIC1/2-475--VGKGCAQALRGQ---GARVVVTEIDPICALQAAMDGYQVTT.............LDD..VVT..QADIVITATGCVNV
F6EFW8_AMYSD/14-489--VGKGSAEALRGQ---GARVTVTEVDPINALQAMMDGFHVAT.............VDE..VIS..AADIVITATGNMNV
C7MUK9_SACVD/12-484--VGKGCADALRGQ---GARVIVTEIDPICALQAAMDGYEVTV.............LED..VVD..KADIFVTATGNFNI
A4FNJ5_SACEN/13-486--VGKGSAESLRGQ---RARVIITEVDPINALQALLDGYEVAR.............LDS..VIG..QADIVITATGNKDI
F5XQ99_MICPN/10-486--VGKGCADSLRGQ---GARVLITEVDPICALQAAMDGYQVVT.............LDE..ALP..VADIYVTATGCLDV
SAHH_MYCMM/17-491--VGKGCAEAMKGQ---GARVSVTEIDPINALQAMMEGFDVVT.............VED..AIG..DADIVVTSTGNKDI
R4T8V2_AMYOR/12-490--VGKGAVESLRGQ---GARVVVTEIDPICALQAAMEGLDVVE.............LDD..VVE..RGDIFITTTGNFDI
J9SDU9_9ACTO/17-488--VGKGCAESLAGQ---GARVQVTEIDPINALQALMDGFDVVT.............VED..AIG..NADIVITSTGNLGV
F4H4D2_CELFA/46-530--VGKGAAEALRGQ---GARVLVSEVDPICALQAAMDGFQVVR.............LDD..VVG..EVDFVVTATGDRGV
C7QZI2_JONDD/10-493--VGKGAAEAFRGQ---GARVIVSEVDPICALQAAMDGFQVAQ.............LED..VVD..QADFFITTTGNFNV
A1SGL1_NOCSJ/2-475--VGKGCAESLRGQ---GARVIVTEIDPICALQASMDGYQVTT.............LED..ALP..IADIIITATGNKDV
A6WER2_KINRD/4-486--VGKGCAESLRGQ---GARVVVTEIDPINALQAAMDGYQVVR.............LED..VVE..TADIFITATGNKDV
I4F357_MODMB/14-493--VGKGSADSLRGQ---GARVIVTEIDPINALQAAMHGYEVTT.............LDE..VIG..KADIIITATGNKDI
C8XJI5_NAKMY/22-497--VGKGAAESLRGQ---GARVVVAEIDPICALQALMDGFEVST.............VDK..AVE..RADLIITTTGNKDI
I6X351_PROPF/4-475--VGKGCAESLRGQ---GARVIVTEVDPICALQAAMDGFQVSR.............LES..VVG..IGDIFVTATGCRDV
M5A353_9ACTN/11-489--VGKGCVQSLQGQ---GARVIVTEIDPINALQAAMEGLQVLP.............LED..CID..EVDIFVTATGNFNL
W0RH07_9BACT/19-492--VGKGCAQALKGQ---GARVVITEIDPICALQAAMEGYQVLT.............IDD..VIE..TADIFITATGNKNI
SAHH_COREF/6-477--VGKGCAEAFDGQ---GARVRVTEADPINALQALMDGYSVVT.............VDE..AIA..DADIVITATGNKDI
E2SDU6_9ACTO/5-482--VGKGSAESLRGQ---GARVIVTEIDPICALQAVMDGYEVKR.............LES..VID..TADIFITTTGNFDI
X5E7G5_9CORY/23-501--VGKGVAEAFKGQ---GARVKVTEADPINALQALMDGYSVVT.............VDN..AIG..EADIVITSTGNLGI
G0HF72_CORVD/28-503--VGKGVAEALKGQ---GARVKVTEADPINALQALMDGFPVVT.............VDD..AIG..EADIVITSTGNLGI
A7H6N3_ANADF/19-492--VGKGCAQALRGQ---GARVVVTEIDPINALQASMEGYQVVR.............VED..VVK..EADVFVTATGNLDV
D9SB20_FIBSS/15-498--VGKGCAQSLRGQ---GARVIITEIDPICALQAAMEGYEVKT.............LDE..VVS..YADIFVTTTGNTGI
L0GYM4_9GAMM/6-467--VGKGCAQSLRGL---GATVWVSEIDPICALQAAMEGFKVVT.............MEE..AAP..IADIFVTSTGNKDI
B9S9Y6_RICCO/13-484--VGKGCAAALKQA---GSRVIVTEIDPICALQALMEGYQVLP.............LED..VVS..EADIFVTTTGNKDI
S6BUQ9_9GAMM/6-466--VGKGSAQSLRGL---GATVWVTEIDPICALQAAMEGYRVVI.............MEE..AAP..LADIFVTTTGNKDI
K0C944_CYCSP/5-466--VGKGCAQAFKGM---GASVWVTEVDPICALQAAMEGYRVVR.............MDD..VAD..QGDIFVTTTGNLGV
E6WQA4_PSEUU/13-480--VGKGSAHSLRAY---GARVIVTEIDPICALQAAMEGFEVAT.............VED..TLG..QADIYVTTTGNRDI
H3G8U2_PHYRM/6-480--VGKGCAQAMKAA---GSVVYVTEVDPICALQACMDGFQVVR.............LES..IVS..EADIFITTTGNKDI
A8IXE0_CHLRE/12-482--VGKGCASAMKAA---GARTIVSEIDPICALQAAMEGYQVQP.............LED..CLE..TADIFITTTGNKDI
X5DXZ4_9BACT/10-471--VGKGCAHSMRSY---GARVIVTEIDPICALQAAMEGFEVKT.............MED..ALA..EGNIYVTTTGNCDV
R7L6X2_9BACT/8-471--VGKGCVQALKGL---GATILVSEIDPICALQAAMEGYRVVT.............VED..ALP..IADIYVTTTGNCDI
B4S716_PROA2/10-471--VGKGCAHSMRTY---GSRVIVTEIDPICALQASMEGFEVTT.............MEE..AVK..EGNIFVTTTGNKDV
I4BAF3_TURPD/15-478--VGKGSAQSMRNF---GARVIVSEIDPICALQAAMEGYQVAP.............IED..ALE..SADIYVTTTGNKDI
F0VM57_NEOCL/4-476--VGKGCAAAMKGA---GARVVVTEVDPICALQAAMEGYSVVT.............LES..QLA..VGDIFISATGNKDI
D5EQ42_CORAD/10-478--VGKGCAAALKGM---GAQVVVTEVDPICALQAAMEGYRVLT.............VED..TLG..WGDIYVTTTGNFGI
C7LQI3_DESBD/10-472--VGKGCAQSMRGF---GARVLITEVDPICALQAAMEGYEVTT.............MAK..GCL..EADIFVTATGNYHV
F3YYZ8_DESAF/11-474--VGKGCCQALRGM---GARVLVTEIDPICALQATMEGYQVTT.............VED..ALP..VADIFVTSTGNYKV
D4H862_DENA2/6-469--VGKGCAESLRGL---GAIVIVTE<