Sequence alignment for CL0325

PF05221

SAHH_RHOCB/2-462ADYIVKDIKLAEFGRKELDIAET---------EMPGLMACREEFGPS--QPLKGARI--AGSLHMTIQT-----AVLIET
SAHH_YEAST/6-448QNYKIADISLAAFGRKEIELAEH---------EMPGLMAIRKAYGDV--QPLKGARI--AGCLHMTIQT-----AVLIET
SAHH_CATRO/12-484REYKVKDMSQADFGRLEIELAEV---------EMPGLMSCRAEFGPS--QPFKGAKI--TGSLHMTIQT-----AVLIET
SAHH2_DROME/66-491TDFCVKSISKSAFGRREIEIAES---------EMPGIMTLRKRAKDE--KPLKGANI--VGCTHVNAQS-----AVLIET
SAHH_LEIDO/2-436ADYKVKDISLAEWGRKAIELAEN---------EMPGLMELRREYGPS--QPLKGAKI--AGCLHMTVQT-----AVLIET
SAHH_TRIVA/11-485FEYRIADINLHVLGRKELTLAEK---------EMPGLMVLRERYSAS--KPLKGVRI--SGSLHMTVQT-----AVLIET
SAHH_CAEEL/6-436PAYKVADIKLADFGRKEIILAEN---------EMPGLMAMRSKYGPS--QPLKGARI--AGCLHMTIQT-----AVLIET
SAHH_PLAF7/4-478NKSKVKDISLAPFGKMQMEISEN---------EMPGLMRIREEYGKD--QPLKNAKI--TGCLHMTVEC-----ALLIET
SAHH_MOUSE/5-431LPYKVADIGLAAWGRKALDIAEN---------EMPGLMRMREMYSAS--KPLKGARI--AGCLHMTVET-----AVLIET

PF00389

Q9JY94_NEIMB/3-329IAIYG....T...KSYDREHFTRANRHFGF..ELEFFD....FMLDA..KTAKMAEG..AEAVCIFVND.....DGSRPV
O30440_BORPT/4-317IVLFE....NI..HPSARAVFSA.....AGYTDIVAHA...AALPSG..ELREALRG..AEVVGIRSRT.....HLDADL
SERA_ARATH/85-394ILVTE....KL..GEAGVNLLRE.......FGDVDCSY....DLSPE..DLKKKVAE..SDALIVRSGT.....KVTREV
Q9RUU0_DEIRA/18-329APLRV....LI.CDEMNPGNLDH.....EGF.QIDYQG....NLERE..ETLRRLPD..YDALITRSRT.....KVDREL
Q98F95_RHILO/5-315VLVSD....KL..SPTAVQIFKD.......R.GVEVDYLPDLGKDKE..KLLEVIDQ..YDGLAIRSAT.....KVTEKL
Q99R78_STAAM/6-332IMSV.........RDEDMPYIKAWAEKHHV..EVDITK....EALTD..DNVEGVAG..YDGLSLSQQI.....PLSEHV
E9ACF1_LEIMA/115-427ALLLE....GV..NPIAKELLES.....KGC.IVEYIP...NALPRD..TLLEKIRD..VHFLGIRSKT.....QVTQAI
Q9KEA4_BACHD/2-311NVVS.....SARVRPEIQQELLD.........DYPNVHFHFFERM.E..IVGSALEE..ADVLITYGED......VTEEH
O28495_ARCFU/4-322VVSFS....PI.AEPLLKGLIGSVY..SGEV.EVVVIG....EYDER..RILEAVRD..ADIVIGDYTFK...IPITEEM
Q9KLW1_VIBCH/3-321IAILDDYQNVVRGLNAFQCLQGH.........DVTVFN....DSLSDETVLIERLKP..FEALVLIRER....TPITENL
Q9CKF1_PASMU/14-327FLLLE....GV..HQTALEVLQN.....AGYTNIEYHK...KALDDD..ELKEAIKD..AHFVGIRSRT.....FLTEEV
SERA_SHIFL/13-326FLLVE....GV..HQKALESLRA.....AGYTNIEFHK...GALDDE..QLKESIRD..AHFIGLRSRT.....HLTEDV
SERA_ARCFU/3-312VLVAE....PI..SEEAIDYMRK.....NGL.EVEVKT....GMSRE..ELIREVPK..YEAIVVRSQT.....KVDAEV
O58256_PYRHO/5-318VGVL......LKMKREALEELKK.......YADVEIIL....YPSGE..ELKGVIGR..FDGIIVSPTT.....KITREV
Q9X4A4_STAAU/4-319IVVSR....KI..PDKFYQQLSK.......LGDVVMWQKSLVPMPKD..QFVTALRD..ADACFITLSE.....QIDAEI
Q99T17_STAAM/2-311KVVG......LNRMREVETELQQ.........RFSDLDFKFYKKASE..IPESDLAD..LDILVGYDGG......INEAF
CTBP_DROME/30-352VALLDG..RD...CSIEMPILKD.......VATVAFCD....AQSTS..EIHEKVLNEAVGALMWHTII......LTKED
Q9VKI8_DROME/8-324VLVCD....AV..DKSCVELLEQ......HGIKVTYKL....KLPVE..ELCQEVKN..FDAAIVRSDT.....KITAEV
Q97IU7_CLOAB/3-326ILVYN....H...RADETEYFQKFKEKYNV..DLMLTD....KTPTI..ETADFAKG..FDCISIITT......PINAAL
GHRB_ECO57/5-319VILYK....AL..PDDLLQRLQE.........HFTVHQVANLSPQTV.EQNAAIFAE..AEGLLGSNEN......VDAAL
YEAA_SCHPO/9-327ALLV...........GTLKHAHKEWEALGKYAELKTYSDGTREDFLA..KCKTEFQN..VKAICRTYNSKFYMGIFDKEI
LDHD_LEUMC/3-330IFAYG....I...RDDEKPSLEEWKAANPEI.EVDYTQ....ELLTP..ETAKLAEG..SDSAVVYQQL.....DYTRET
Q9KP92_VIBCH/13-326ILLLE....GL..HPSSVEVLQA.....AGYSNIEYHK...GSLEEA..ELIKAIKD..VHFVGIRSRS.....NLTEKV
Q9I1L0_PSEAE/4-318VVLYK....RL..SAPLMERLRE.........RVEVLLVEEPGRDGL.ARLRDALPE..AHGLLGASLR......LDAGL
Q98BH4_RHILO/9-329VVITRKLPDPV..ETRMRELFDA.........RLNVED...RPMTQP..ELVAAVKE..ADVLVPTVTD.....QIDAAL
P74586_SYNY3/3-330IAFFS....S...KAYDRQFFQQANHPHQR..EMVFFD....AQLNL..DTAILAED..CPVICLFVND.....QAPAPV
Y2305_STAAM/4-317VYVAG....AI..PEVGLKLLQE.......HFEVEMYEG.KGLVDKD..TLIKGVKN..ATALISLLST.....NVDKDV
Q59463_HYPME/6-322ILITW....PL..PEAAMARARE......SY.DVIAHGD.DPKITID..EMIETAKS..VDALLITLNE.....KCRKEV
DDH_ZYMMO/3-331VAIFS....S...KNYDHHSIEKENEHYGH..DLVFLN....ERLTK..ETAEKAKD..AEAVCIFVND.....EANAEV
TKRA_BACSU/6-322VFITK....PI..PEEIEAFIGE.....HCRYEVWQED....TLPSD..VLFEKLKE..AEGLLTSGTSG...PSINREL
Q9ZKF4_HELPJ/4-314VAICD....PI..HAKGIQILEA.........QKDIVLHDYSKCPKK..ELLEKLIP..MDALITRSMT.....PITSDF
Q9A244_CAUCR/24-340VIVTRKLPDPV..ETRMCELFDT.........ELNVSD...KPMTAD..ELVDAMSR..ADVLVPTITD.....RIDSRL
SERA_SCHPO/58-378ILLLE....NV..NQSALSNLKD.....EGY.QVEFLK...TSMSED..DLVEKIKG..VHAIGIRSKT.....RLTRRV
GYAR_THELI/5-322VFITR....QI..PENGIKMIEK.......FYEIELWKD.PKAPPRG..VLLEKVRE..VDALVTLVTD.....KVDKEL
Q98LH4_RHILO/9-326VLAFE....RYDPTDASLDWLRERG..VNVIFGNALWEMPFKRFTED..ELIAKAHG..CIALMGASGT.....RITRRV
Q9BLF6_OCTVU/5-323VYITR....RI..PPVGIDLFRE.....KGV.EIDFWDS.DEAIPHQ..ELVKNVKGKGYAGLLCLLTD.....QVDAEV
Q99TE0_STAAM/6-315VLVAD....PI..SKDGIKALLD.....HEQFNVDIQT....GLSEE..ALIKIIPS..YHALIVRSQT.....TVTENI
Q9S2M5_STRCO/3-328ILAFG....V...QADEKPLIERAF.RDHE..DVRCLD....VFLNE..DTAPIAAG..HEIVSTSVNA.....DLGAAV
SERA_METJA/4-312ILVTD....PL..HEDAIKILEE.......VGEVEVAT....GLTKE..ELLEKIKD..ADVLVVRSGT.....KVTRDV
PTXD_PSEST/5-326LVITH...RV...HDEILQLLAP.......HCELMTNQT.DSTLTRE..EILRRCRD..AQAMMAFMPD.....RVDADF
LDHD_STRP1/3-330LKLYN....V...RGEEAVLAKKWADDNGI..EISLTE....SPLTP..ETVKEAEG..FDGIANAQIG.....PLDDAI
Q9LE33_ARATH/9-321VVLLH........RPPSLTFMDE.......ILTREFRTLITDTSSSE..SLPSFFPRHASSARAFVISGR...LPVTDEL
Q9HXB7_PSEAE/5-318VFVFS....RL..APEHLERLQC.........QFNVRVLEPKQGDID.AQYAAALPD..THGMIGVGRP......LGARQ
O67741_AQUAE/4-320VLITD....PI..APEGIELLQK.........DPEVEVYNEPDISYE..ELLEIIKD..FDAIITRSRT.....PVTKEL
SERA_METTH/6-313VLIAD....SI..NEKGISELEE.......VAEVVVNT....TITPE..ELLDAIKD..FDAIVVRSRT.....KVTREV
LDHD_PEDAC/3-329IIAYG....I...RDDEKPYLDEWVTKNHI..EVKAVP....DLLDS..SNIDLAKD..YDGVVAYQQK.....PYTADL
Q9UYH9_PYRAB/5-318IGVL......FKMKSKPLEELKK.......YTDVVLKP....YPSEE..ELKEIIPE..LDGIIIAPVT.....RITKDI
DDH2_SCHPO/3-330VVLFS....S...QSYDRGPFEEANKTFNH..EIIYHN....FSLNK..DTVSLAGK..AQVVCVFVND.....QVDADT
Q9CA90_ARATH/6-313VLMM.........CPMSSYLENE.......L.EKRFNLLRFWTSPEK..SVLLETHRNSIRAVVGNASA.....GADAQL
Q48534_9LACO/4-332IAMYN....V...SPIEVPYIEDWAKKNDV..EIKTTD....QALTS..ATVDLAEG..CSSVSLKPLG.....PVDEEV
LDHD_ECOLI/3-329LAVYS....T...KQYDKKYLQQVNESFGF..ELEFFD....FLLTE..KTAKTANG..CEAVCIFVND.....DGSRPV
SERA_RAT/9-317ILISD....SL..DPCCRKILQD.....GGL.QVVEKQ....NLSKE..ELIAELQD..CEGLIVRSAT.....KVTADV
Q9A6E7_CAUCR/11-318ILLSHEMLMPLQPLLEGAYIVHRLWDYPDRMAFLE.......GPGQS............IRAIVHAGEM.....ALSRDM
Q9HMR0_HALSA/3-311VLVTD....PI..ADAGLDRLRD......AGHEVTTAY....DATGD..ALLDAVSD..AHALIVRSGT.....AVTDAV
Q9WYG2_THEMA/4-311ILIVTRTFGKY..SQEPVEFLRK......EGFEIIRSD....TIDPD......ILKE..VDALIVGTHP......VTAEM
CTBP2_RAT/36-358VALLDG..RD...CTVEMPILKD.......LATVAFCD....AQSTQ..EIHEKVLNEAVGAMMYHTIT......LTRED
Q9PBD8_XYLFA/15-328ILLLE....GV..SHSGIETFRA.....AGYSQIKIHT...TSLPEE..ALQAEIAE..AHIIGIRSRT.....QLNAEV
Q89388_PBCV1/32-362VAIF...........SAGNYVKDFIKPIESICTPVYIE....SSLNE..TTAALANK..CDAINAFVND.....DLSAPV
LDHD_TREPA/3-330CVVFN....L...REEEAPYVEKWKQSHPGV.VVDTYE....EPLTA..KNKELLKG..YEGLVVMQFL.....AMEDEV
Q97MV2_CLOAB/3-317ISVIE....PLGISEEEIRSIAKTI.TDRGH.EIVIYN....EKSTDTNVLKERVKD..SEVIVLANMP......LKAEV
Q97U35_SULSO/2-295KIIS.........TEKVPDECKN.........IISVKD....ENITE.....EDYKN..AEILLTWPGR......VNNDL
Q9A3I9_CAUCR/6-314VLIAD....KL..SPAAVEIFKN......RGLAFDIKT....GLSKD..ELIAVIGD..YDGIAIRSGA.....KLDKDV
Q9RKF9_STRCO/17-329VAITECDHDSFDIERDVVTSAGG.........QLLVTQ....SRDAD..TMVVNCAG..ADAIVVQYAA......ITEQV
Q9RNB7_MICAE/18-330VLLIG....KM.YDEAGQKLLEE......ST.NIEILS....NPTPE..EINEAIQE..VSGVFVRYPN.....NLEASS
LDHD_STAAU/4-330IMFFG....T...RDYEKEMALNWGKKNNV..EVTTSK....ELLSS..ATVDQLKD..YDGVTTMQFG.....KLENDV
Q9LT69_ARATH/49-358ILVTE....KL..GQAGIDLLKK.......YANVDCSY....DLSLE..ELCTKISL..CDALIVRSGT.....KVGRDV
GYAR_AERPE/6-324VFVTR....EV..FPEALELLSK.......YYDVEVWDK.YQPPPYE..TLLSKARE..ADALYTLLTD.....RIDCDL
DDH_HAEIN/3-329IAIYS....T...KSYDRKYIELINAKYNF..DLEFFD....FMLNE..STVRLAEH..CEVVCIFVND.....NGSRKV
O17626_CAEEL/8-316VLIAD....DI..EQECVDILKQ......NGIEVTVKT....KQTKD..ELLVTLPQ..HDAVIVRSAT.....KITAEL
PDXB_PSEAE/3-285ILADE....N...IPVVDAFFAD.........QGSIRRLPGRAIDRA..ALAE......VDVLLVRSVT.....EVSRAA
SERA_YEAST/61-381ILLLE....NV..NQTAITIFEE.....QGY.QVEFYK...SSLPEE..ELIEKIKD..VHAIGIRSKT.....RLTSNV
YGDH_SCHPO/9-332VLAIG....ELKFATNTLKRLSE.....KYHFEFIVPDPHDRSKTIE..KIHEAASKSTFDACFWLFRNAA.ISPFTEEM
Q20595_CAEEL/181-504VALLDG..RD...CSVEMPILKD.......VATVAFCD....AQSTQ..EIHEKVLNEAVAALMYHSIK......LEKED
DHD2_LACPA/3-329IIAYG....A...RVDEIQYFKQWAKDTGN..TLEYHT....EFLDE..NTVEWAKG..FDGINSLQTT.....PYAAGV
Q9KCG9_BACHD/20-325ILVSD....AM..SEQGLSPLLN.........DPRVECVQQNVADAD......DLHE..YDALLVRSAT.....TVTEEL
SERA_MYCLE/6-313VLIAD....KL..AQSTVAALGD.........QVEVRWV..DGPDRT..KLLAAVPE..ADALLVRSAT.....TVDAEV
Q9I530_PSEAE/3-328ILFFS....S...QAYDSESFQASNHRHGF..ELHFQQ....AHLQA..DTAVLAQG..FEVVCAFVND.....DLSRPV
Q9VII9_DROME/10-326VLIS.....HPNVPAPALELLRS.....RGAETIICQS...VPPSRD..EILQKVPG..VDAIYWAHYQ.....PLNAGI
O66939_AQUAE/3-332VLFTS....V...PQEDVPFYQEAL..KDL..SLKIYTTDVSKVPEN..ELKK......AELISVFVYD.....KLTEEL
Q9HVG5_PSEAE/7-321AVFLDHASLDL..GDLDMRPLRA......AFDELQLHA....ASQPQ..EVAARLHD..ARVAISNKVP......IDAQC
GHRB_ENTAG/5-318VLLYK....SL..PDDLRARLDE.........HFTVTAINGLSPETI.AEHGGAGAR..RRHDRLQQHG......GSSAA
Q98CG2_RHILO/11-318AILV.....PADFSDHAVRRIDR......TFKQVSIERADPALVTDE............MRRMVRGIASF...AGISAAM
GRHPR_HUMAN/9-327VFVTR....RI.PAEGRVALARA.....ADC.EVEQWDS.DEPIPAK..ELERGVAG..AHGLLCLLSD.....HVDKRI
Q9KMX4_VIBCH/4-330VIFFS....A...KHYDIASFSKLVDPTQL..SLHFHD....FRLTD..KTAQMAKG..CEVVCAFVND.....ELHASV
Q9K7P7_BACHD/3-318LLFTR....AL..DPEWIEPLKD.......EHDIRMWTEENIPMPRE..LFLKELEE..ADGVFTNLTD.....RFDVEA
Q9I6H5_PSEAE/13-326FLLLE....GV..HQNAVDTLKA.....AGYTNIEYLK...TALSGD..ELKERIAD..AHFIGIRSRT.....QLTEEV
Q9HK29_THEAC/3-309VLVVVPNFLPLDQIRSAVSTITQ.........DVEVRT...........DTDFDRSD..AEILIVTTFT.....PVNGDL
Q9ZH60_LACJH/4-331IFAYA....I...RKDEEPFLNEWKDAHKDI.EVEYTD....KLLAP..ETAKLAKG..ADGVVVYQQL.....DYTPET
Q98GE4_RHILO/8-315ILSTH........PLHPRASAKL.....AGAGQLVIAS....ALDPA..TLTGEAKN..ADIVIVRA.......PLPPAL
DDH1_SCHPO/3-330IAFFS....A...QPYEKEPFEKVNENYKH..EIDYHE....SILNK..KTAVLAEK..APVVCVFVND.....KVDADT
PDXB_VIBCH/3-286ILIDE....N...MPYAQALFSQ.........LGEVILKPGRTLTAD..DLID......VDALMIRSVT.....KVNDAL
DHGY_METEA/5-313VVFLD........RESLDATVREFNFPHEY...KEYES....TWTPE..EIVERLQG..AEIAMINKVP......MRADT
Q97ZK1_SULSO/20-326VLITD....PV..DQYMIRTLQN.....NGL.IVDYKP....EITRE..ELLKIIDQ..YQVLIVRSRT.....KVDKEI
GYAR_PYRAB/6-323VFITR....EI..PEVGIEMLEK.......EFEVEVWED.EREIPRE..ILLEKVKD..VDALVTMLSE.....RIDREV
Q97F10_CLOAB/3-323IVVLDG..YTLNPGDMSWEAFKE.....IGD.LTVYDRTDYTGKEEE..KTIERARD..AEAILTNKTI......ITSKV
Q9Z564_STRCO/7-314VLIAE....EL..SPATVDALGP.........DFEIRHC..NGADRA..ELLPAIAD..VDAILVRSAT.....KVDAEA
LDHD_LACPE/3-330IIAYA....V...RDDERPFFDTWMKENPDV.EVKLVP....ELLTE..DNVDLAKG..FDGADVYQQK.....DYTAEV
SERA_SYNY3/32-339VLVSD....SI..DQVGIDILKQ.......VAQVDVKT....GLSEA..EIIDIVPE..YDAIMLRSAT.....KVTEKI

PF05222

NNTM_BOVIN/60-199------------------------------------------GVPKE--.IFQ...N...EKRV----------ALSPAG
Q7RV12_NEUCR/59-195------------------------------------------GVPRE--.TYP...N...ERRV----------ALTPQN
Q3F038_BACTI/7-137------------------------------------------GVVKE--.IKK...G...EARV----------GMTPEN
Q0VPX1_ALCBS/24-165------------------------------------------GVPKE--.ICP...G...EQRV----------ALTPAN
Q3J1C2_RHOS4/4-139------------------------------------------GAPRE--.IFE...G...EARV----------AMTPDS
Q0EZS3_9PROT/4-136------------------------------------------GIPAE--.IKN...R...EHRV----------ALIPEG
Q0G0B3_9RHIZ/4-136------------------------------------------FIPRE--.QE....G...ETRV----------AASPDT
LYS1_ASHGO/6-141------------------------------------------HLRAE--TKPM.......EARA----------ALTPTT
Q28V87_JANSC/4-137------------------------------------------GCPTE--.IKP...Q...EFRV----------GITPAA
Q24813_ENTHI/568-702------------------------------------------GIPKE--.NVP.......EKMV----------AMVPSV
Q2G7Q1_NOVAD/4-137------------------------------------------GTVRE--.IKN...H...EYRV----------GLTPES
Q6AQV0_DESPS/4-137------------------------------------------GILKE--.IKI...K...EDRV----------CMTPGG
Q82QU1_STRAW/15-145------------------------------------------GVVAE--.SVS...G...ETRV----------AATPAT
Q3B540_PELLD/4-135------------------------------------------GIPLE--.IKT...A...ETRV----------ACTPAG
DHA_OCEIH/4-136------------------------------------------GVPKE--.IKN...N...ENRV----------AMTPAG
Q0S884_RHOSR/4-137------------------------------------------GIPRE--.IKN...H...EYRV----------AISPAG
A0KQF4_AERHH/4-135------------------------------------------GIPRE--.SLA...G...ETRV----------AATPAT
Q9KAF8_BACHD/4-136------------------------------------------GVPKE--.IKN...N...ENRV----------AMTPAS
A6VXM0_MARMS/6-147------------------------------------------GIPKE--.IEE...G...ELRV----------AMTPSI
Q3JE74_NITOC/4-136------------------------------------------GIPRE--.IKT...L...EGRV----------ALVPEA
B1YFJ0_EXIS2/4-136------------------------------------------GVLKE--.IKN...N...ENRV----------ALTPAG
A0YCU2_9GAMM/4-139------------------------------------------GIPRE--.LEA...G...ETRV----------PVIPAS
Q39LR8_BURS3/6-135------------------------------------------GGPLE--.AAH...E...ERRV----------ATVPDV
A5GEE8_GEOUR/4-135------------------------------------------GVPKE--.VKK...E...EYRV----------ALTPAG
A5FP13_FLAJ1/4-137------------------------------------------GVPKE--.IKN...N...ENRV----------ALTPAG
Q98CE6_RHILO/6-139------------------------------------------FIPRE--.LDA...N...EPRV----------AASPDT
Q31MC9_SYNE7/4-136------------------------------------------GVPRE--.LKD...Q...EFRV----------GLSPAS
Q6NYQ7_DANRE/56-195------------------------------------------GVPKE--.IFQ...N...ERRV----------AISPAG
Q1MBQ8_RHIL3/6-139------------------------------------------FVARE--.NTG...E...ETRV----------AASAET
Q5KHJ2_CRYNJ/22-157------------------------------------------WLRCE--KKPF.......EHRS----------ALTPTT
A4TCI0_MYCGI/4-137------------------------------------------GIPTE--.IKN...N...EFRV----------AITPSG
Q8GRT6_GOSHI/8-144------------------------------------------GILSE--SSKK...W...ERRV----------PLTPSH
Q2IDX0_ANADE/4-138------------------------------------------AVLRE--.AAP...G...ERRV----------ALVPEN
Q21L93_SACD2/6-141------------------------------------------GVVRE--.SAL...G...ESRV----------AIAPDV
A0QNT0_MYCS2/5-135------------------------------------------GVPRE--.SAE...G...ERRV----------ALVPKV
Q1GUI4_SPHAL/4-138------------------------------------------AVLKE--.LAA...G...ETRV----------AATPET
DHA_GEOSE/4-137------------------------------------------GIPKE--.IKN...N...ENRV----------AITPAG
Q0AQT6_MARMM/4-137------------------------------------------GVPRE--.IKV...R...EYRV----------GLTPNS
Q1YKG9_MOBAS/4-137------------------------------------------FVPKE--.REA...G...EPRV----------AASPDT
A6UD59_SINMW/6-139------------------------------------------FIAKE--.SDP...N...EGRV----------AGSIDS
Q18031_CAEEL/32-165------------------------------------------AVPKE--.IFP...G...EKRV----------SLSPNG
Q063W8_9SYNE/14-150------------------------------------------LIPVE--.STP...G...ETRI----------AATPDT
Q1V607_VIBAL/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GMIPAS
Q47E46_DECAR/4-137------------------------------------------GVPKE--.IKN...N...EYRV----------GLTPAS
Q39WN5_GEOMG/4-135------------------------------------------GVPRE--.IKT...H...EYRV----------GMTPAG
Q1YRC4_9GAMM/4-137------------------------------------------GVPKE--.IKN...N...EYRV----------GLTPSS
Q3SL22_THIDA/4-136------------------------------------------GIPKE--.IKD...H...EYRV----------ALTPEG
Q6W1Y1_RHISN/6-139------------------------------------------YIARE--.SSP...D...EPRV----------AGSPET
A1RCI4_ARTAT/4-137------------------------------------------GVPKE--.VKN...H...EYRV----------AITPIG
Q67ND6_SYMTH/4-137------------------------------------------GVVRE--.LKA...Y...ENRV----------AMTPAG
Q5SLT7_THET8/5-139------------------------------------------AVPKE--.RAP...G...ERRV----------ALVPEV
A0KEW0_AERHH/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GMTPAG
Q47BC9_DECAR/6-139------------------------------------------AVARE--.STD...G...ESRT----------ALSPET
A1ZZD6_9BACT/38-171------------------------------------------GIPKE--.KSK...S...EKRV----------SLRPEA
Q8DL05_THEEB/4-139------------------------------------------GVVKE--.REV...G...EQRV----------ALIPEV
Q28M63_JANSC/4-139------------------------------------------GTPKE--.IEA...G...EARV----------AMTPDS
Q2RN15_RHORT/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPNS
Q1VSD8_9FLAO/34-167------------------------------------------GLPKE--.TSY...Q...EKRV----------CLTPDA
Q0C3J7_HYPNA/4-137------------------------------------------GVPTE--.IKK...Q...ESRV----------GLTPES
Q2S445_SALRD/35-169------------------------------------------GVPRE--.VGN...E...EQRV----------ALAPSG
A0R9N0_BACAH/4-136------------------------------------------GVPAE--.IKN...N...ENRV----------AMTPAG
Q07J60_RHOP5/4-136------------------------------------------AVAKE--.LDP...A...EPRV----------AASPDT
A1SSF5_PSYIN/4-138------------------------------------------GIPRE--.IQE...N...ENRV----------AATPNT
Q5Z133_NOCFA/18-148------------------------------------------GVVRE--.TNA...G...ERRV----------ALVPKI
Q5WJZ9_BACSK/4-136------------------------------------------GIPKE--.IKS...Y...ENRV----------AITPAG
A2C6Y0_PROM3/14-145------------------------------------------GVPTE--.IKA...D...ELRV----------ALTPDG
A0L9H7_MAGSM/4-145------------------------------------------GIPKE--.IHP...G...ERRV----------AASPDS
Q1Z6I5_PHOPR/6-140------------------------------------------WLRDE--VKQG.......ERRA----------ALTPAG
Q6W1J9_RHISN/4-139------------------------------------------ATPSE--.VFG...G...EARV----------AMTPDS
PNTA_HAEIN/4-137------------------------------------------GVPRE--.LLE...N...ESRV----------AATPKT
Q6AEY9_LEIXX/4-137------------------------------------------TIPRE--.IKN...N...EFRV----------AITPAG
Q6ACH0_LEIXX/6-139------------------------------------------GVLRE--.AEP...G...ERRV----------ALVPEV
Q1YRM2_9GAMM/4-145------------------------------------------GIPAE--.IKT...A...EKRV----------AMSPAN
Q0FNJ6_9RHOB/4-137------------------------------------------GCPRE--.VKA...Q...EYRV----------GLTPNA
Q1VPH7_9FLAO/4-137------------------------------------------GVPIE--.VKN...N...ESRV----------SITPAG
Q1NA78_9SPHN/23-156------------------------------------------GTVKE--.IKN...H...EYRV----------GLTPES
A8GEZ6_SERP5/4-137------------------------------------------GVPRE--.RLA...N...EARV----------AATPKT
Q5LFH6_BACFN/4-137------------------------------------------GVPKE--.IKN...N...ENRV----------GMTPSG
A5FFU7_FLAJ1/32-165------------------------------------------GIPKE--.TSY...Q...ERRI----------CLTPDA
A0K2E1_ARTS2/12-145------------------------------------------GIARE--.HRE...G...ERRV----------AGTPET
A0QNN8_MYCS2/4-137------------------------------------------GIPRE--.SQP...G...ETRV----------AATPQT
Q5YZC0_NOCFA/4-137------------------------------------------GVPGE--.VKA...Q...EFRV----------ALTPAG
P72775_SYNY3/4-136------------------------------------------GVPKE--.IKD...Q...EFRV----------GLTPSS
Q603N5_METCA/4-139------------------------------------------GIPKE--.IFP...G...ERRV----------ATTPEV
Q2N774_ERYLH/4-137------------------------------------------GCPTE--.IKN...H...EYRV----------GLTPES
Q26EF0_FLABB/32-165------------------------------------------GIPKE--.TQH...Q...EKRI----------VLTPDA
Q1J0B1_DEIGD/4-135------------------------------------------GLPKE--.IKV...K...ENRV----------ALTPGG
Q472Z0_CUPPJ/4-137------------------------------------------GVPRE--.IKD...Q...EYRV----------GLTPAS
Q2HFZ2_CHAGB/7-141------------------------------------------HLRSE--TKPL.......EHRS----------ALTPTT
LYS1_YEAST/7-142------------------------------------------HLRAE--TKPL.......EARA----------ALTPTT
Q3UEQ9_MOUSE/27-157------------------------------------------ALRRE--DVNA...W...ERRA----------PLAPKH
Q4SE54_TETNG/23-153------------------------------------------AIRRE--DINP...W...ERRA----------PLAPRH
Q5LPM8_SILPO/4-139------------------------------------------GTPKE--.IFE...G...ENRV----------AMTPDS
A2BS45_PROMS/5-141------------------------------------------LIPSE--.TSS...G...ERRV----------SATPEA
Q65CX6_BACLD/4-136------------------------------------------GIPKE--.IKN...N...ENRV----------AITPAG
Q1QUL9_CHRSD/4-139------------------------------------------GAPKE--.RAQ...G...EARV----------ALTPES
Q05XL4_9SYNE/7-143------------------------------------------LIPVE--.TAT...A...ETRV----------AASPET
Q2J8T8_FRASC/7-142------------------------------------------GVAME--.TAP...G...ERRV----------AMVPQV
A8LYT6_SALAI/4-137------------------------------------------GIPRE--.IKN...H...EYRV----------AITPAG
Q1NHV8_9SPHN/4-138------------------------------------------AIVRE--.QAE...G...ERRV----------AATPET
A4Y0R2_PSEMY/4-136------------------------------------------GVPLE--.THA...G...ETRV----------AATPET
Q11TK3_CYTH3/4-137------------------------------------------GVPKE--.IKN...R...EFRV----------SLTPSG
A0CWD3_PARTE/29-161------------------------------------------GVPKE--.TFP...N...ENRV----------AATPES
Q1MXV6_9GAMM/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPAG
Q2BRI8_9GAMM/4-137------------------------------------------GVPTE--.IKT...R...EYRV----------GLTPSG
Q2SHR3_HAHCH/4-137------------------------------------------GIPKE--.SRP...H...EKRV----------AATPKS
A6VN40_ACTSZ/4-137------------------------------------------GVPRE--.RLN...G...ETRV----------AATPKT
A8ZXI3_DESOH/4-137------------------------------------------GILKE--.IKT...E...EHRV----------AMTPAG
A5FVY5_ACICJ/4-137------------------------------------------GVPRE--.IKN...N...EFRV----------GLTPAS
B2TEW7_BURPP/4-136------------------------------------------GIPRE--.IRE...G...EARV----------AATPET
Q0YPX1_9CHLB/28-159------------------------------------------GIPVE--.RKS...G...ENRV----------ACTPSG
Q8DQ43_STRR6/4-136------------------------------------------GIPKE--.IKN...N...ENCV----------ALTPAG
Q9K827_BACHD/4-136------------------------------------------GVPTE--.VKN...N...ENRV----------AITPAG
Q5CI32_CRYHO/405-540------------------------------------------GVLKE--.DLP...S...EKLV----------AIAPNF
A6U2H6_STAA2/4-136------------------------------------------GIPRE--.IKN...N...ENRV----------GLSPSG
A1EQT6_VIBCL/4-137------------------------------------------GVPRE--.QLA...G...ETRV----------AASPSS
Q0SD61_RHOSR/4-134------------------------------------------GVLKE--.ARA...G...ETRV----------AATPTT
Q11PQ8_CYTH3/7-139------------------------------------------GIIRE--GKVP...S...DRRV----------PLLPAQ
Q2NSW2_SODGM/4-137------------------------------------------GVPKE--.RVA...N...EARV----------AATPKT
Q8DH53_THEEB/4-139------------------------------------------GVPKE--.IKD...Q...EFRV----------GLTPAG
O52942_PHOLP/4-136------------------------------------------GVPKE--.IKN...Q...EFRV----------GLSPSS
Q2W3E7_MAGSA/6-142------------------------------------------GVPRE--.TFP...N...EKRV----------ASVPDV
A0L3P1_MAGSM/4-137------------------------------------------GVVKE--.IRN...Q...ENRV----------ALTPDG
Q0A4X6_ALHEH/6-139------------------------------------------AVPRE--.TRP...G...ERRV----------ALAPAA
O85594_CARST/4-135------------------------------------------GIPKE--.IKN...N...ENRV----------AISPAG
Q6MKC3_BDEBA/4-137------------------------------------------GVPKE--.IKI...S...ENRV----------GLTEAG
Q2LSK0_SYNAS/44-177------------------------------------------GVPKE--.IKD...H...EYRV----------ALTPGS
Q163M5_ROSDO/4-139------------------------------------------GTPKE--.IFE...G...EARV----------AMTPDS
A9CHR5_AGRT5/4-139------------------------------------------GTPKE--.LYE...G...EARV----------GMTPDS
Q74AR0_GEOSL/4-135------------------------------------------GVPRE--.IKV...H...EYRV----------GMTPAG
Q3B571_PELLD/35-169------------------------------------------GIPKE--.RTQ...D...ERRV----------AISPAG
Q9ATP8_ACEAT/79-213------------------------------------------GIPKE--.TKE...G...EKRV----------AATPDS
A4FW08_METM5/4-137------------------------------------------GVPKE--.IKN...N...ENRV----------AITPAG
Q6A5I3_PROAC/4-137------------------------------------------GVPTE--.VKN...S...EFRV----------AVTPAG
Q54P64_DICDI/8-138------------------------------------------GIRRE--DKNR...W...ERRA----------PLAPSH
B4S6Q3_PROA2/35-169------------------------------------------GIPKE--.RLN...D...ERRV----------AISPAG
Q0ALL0_MARMM/4-137------------------------------------------AILKE--.RHA...G...ETRV----------AATPET
Q2VYN4_MAGSA/13-146------------------------------------------GVPKE--.IKS...H...EYRV----------GLTPGS
Q1AS10_RUBXD/6-139------------------------------------------GVPKE--.VKD...K...EGRV----------SLQPDG
Q82M72_STRAW/7-141------------------------------------------WLRHE--SRTT.......ERRT----------PVVPSD
Q7VB57_PROMA/5-141------------------------------------------LIPIE--.VAS...G...ETRV----------AATPET
Q1GL71_SILST/4-137------------------------------------------GCPTE--.IKP...Q...EFRV----------GMTPDA
Q10ZM3_TRIEI/4-136------------------------------------------GIPKE--.IKD...Q...EFRV----------GLTPAS
A0JVY4_ARTS2/5-137------------------------------------------GIVAE--..LG...R...ETRV----------AATPAT
Q15T10_PSEA6/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPAA
A2C801_PROM3/22-158------------------------------------------LIPVE--.SAM...G...ETRV----------AASPDT
Q5FU53_GLUOX/6-140------------------------------------------SVLKE--RDEG...G...ERRV----------ALIPQV
A2E4I0_TRIVA/4-138------------------------------------------GIPKE--.IKD...H...EFRV----------SITPSG
Q0SAT6_RHOSR/4-137------------------------------------------GIPKE--.VKN...H...EYRV----------AATPAG
DHA_BACSU/4-135------------------------------------------GVPKE--.IKN...N...ENRV----------ALTPGG
Q1ZX33_PHOAS/4-137------------------------------------------GVPKE--.IKP...H...EYRV----------GMTPTA
Q2YIM6_BRUA2/6-139------------------------------------------YIPKE--.SDP...N...ETRV----------AGSAET
Q0AGT6_NITEC/4-139------------------------------------------GIPAE--.TRA...G...ETRV----------AATPET
B9M3R5_GEOSF/4-135------------------------------------------GIPGE--.IKQ...H...EYRV----------SLTPAG
Q1ZH92_9GAMM/4-137------------------------------------------GIPKE--.IKN...N...EFRV----------GLTPSS
Q5SLS7_THET8/4-135------------------------------------------GVPKE--.IKT...L...ENRV----------ALTPGG
Q6MUG7_MYCMS/10-140------------------------------------------GLPKE--.IKQ...N...ENRV----------GITPMG
Q21RZ9_RHOFD/27-163------------------------------------------GVPRE--.VFP...G...EKRV----------ATVPEA
Q0K0H4_CUPNH/6-146------------------------------------------GVPRE--.VHP...G...ERRV----------AATPDS
Q47FY5_DECAR/6-139------------------------------------------GVARE--.SAP...G...EHRA----------AIVPEM
A1SJK7_NOCSJ/4-137------------------------------------------GVPKE--.VKN...N...EYRV----------AITPIG
Q7UIW1_RHOBA/5-140------------------------------------------GVPRE--.RWP...G...EARV----------ALVPAS
Q5WXY4_LEGPL/4-137------------------------------------------GVPKE--.IKS...H...ENRV----------GLVPSS
LYS1_SCHPO/7-142------------------------------------------WLRAE--TKPL.......EERS----------ALTPRT
Q064R9_9SYNE/14-145------------------------------------------GIPKE--.IKV...D...EQRV----------ALTPDG
Q0AJH3_NITEC/4-136------------------------------------------GLPKE--.TKE...D...EYRV----------GLTPGS
Q3JEF4_NITOC/4-145------------------------------------------GIPKE--.IHR...G...EKRV----------ATTPDT
A1WCT5_ACISJ/4-136------------------------------------------GVPAE--.TLA...G...ETRV----------AATPET
O25948_HELPY/4-135------------------------------------------GLVKE--.SMD...L...ESRV----------ALVPDD
A1C559_ASPCL/85-224------------------------------------------GVPRE--.TWP...N...ERRV----------AVTPQN
Q55F30_DICDI/135-275------------------------------------------GIPTE--.VYQ...N...EKRV----------SMTPEN
Q2G790_NOVAD/8-140------------------------------------------AVLRE--.RAT...G...ETRV----------SATPET
B0K1G7_THEPX/4-137------------------------------------------GVPKE--.IKT...A...EARV----------AITPAG
Q7NWG7_CHRVO/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPSG
Q1GKH6_SILST/5-139------------------------------------------WVRAE--QRLN.......EDRV----------GLTPAG
Q1GVP3_SPHAL/4-137------------------------------------------GTPKE--.IKN...H...EYRV----------GLTPES
A1K465_AZOSB/6-138------------------------------------------GVPAE--.RIP...G...ERRL----------PVVPDV
A5FAH7_FLAJ1/4-136------------------------------------------GIIKE--RKNP...P...DRRV----------VFSPNE
Q16BE6_ROSDO/4-137------------------------------------------GCPKE--.IKP...Q...EFRV----------GLTPNA
A0NPS2_9RHOB/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPNS
Q1V2K5_PELUQ/4-137------------------------------------------GVPKE--.IKP...Q...EHRI----------GLTPES
Q6KIJ0_MYCMO/4-134------------------------------------------GFPKE--.IKN...N...EFRI----------GVTPNI
Q8EPC2_OCEIH/4-136------------------------------------------GIPKE--.IMN...N...ENRV----------AIAPSG
A8M4N3_SALAI/8-142------------------------------------------WVRHE--TRTT.......ERRA----------PLVPED
Q1ARY0_RUBXD/7-141------------------------------------------GVPRE--.VAE...G...ERRV----------GLVPET
Q6LMW4_PHOPR/33-171------------------------------------------ALVKE--.IESPENPGGLEKRV----------ALVPSD
A0AZX9_BURCH/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPAG
A5G0H4_ACICJ/5-140------------------------------------------AVLKE--.RLP...G...ETRV----------AAVPDS
A5V5I3_SPHWW/4-142------------------------------------------AVLRE--.AAA...G...ESRV----------SATPET
Q7NEB1_GLOVI/4-136------------------------------------------GVPKE--.IKD...Q...EFRV----------GLTPAA
Q60BB4_METCA/4-135------------------------------------------GVPKE--.IKD...L...ENRV----------AVTPQG
A0Z7A7_9GAMM/4-137------------------------------------------GIPKE--.IKN...H...EYRI----------GMTPAG
A1TXK5_MARAV/4-139------------------------------------------GIPRE--.RQD...G...ENRV----------AIIPSG
Q1IIW3_KORVE/4-145------------------------------------------GVPRE--.SYP...G...ERRV----------ALTPAV
Q07600_EIMTE/501-635------------------------------------------GVLRD--.SNG.......SVMV----------PVAPKF
A7HTE3_PARL1/4-137------------------------------------------GVPKE--.IKI...H...EYRV----------GMTPPA
Q3APE7_CHLCH/6-140------------------------------------------GIPKE--.RAQ...D...ERRV----------ALSPAG
Q5P1Y9_AROAE/6-139------------------------------------------GVPAE--.TVP...G...ERRL----------SVVPDV
Q8KEI3_CHLTE/17-148------------------------------------------GIPRE--.IKI...R...ETRV----------ACTPAG
Q2S0H0_SALRD/6-141------------------------------------------GVPRE--.TEP...G...ETRV----------ALVPDV
Q1YVY2_PHOPR/4-137------------------------------------------GVPKE--.IKV...H...EYRV----------GMVPAS
Q1M9L0_RHIL3/4-139------------------------------------------GTPRE--.ICA...D...EARV----------AMTPDS
A8LIC1_DINSH/19-154------------------------------------------GAPKE--.IFP...G...ENRV----------AMTPDS
A0LWI4_ACIC1/4-137------------------------------------------VAVRE--.TAP...Y...ERRV----------AVVPDT
Q8RME8_AMYMD/4-137------------------------------------------AVPRE--.IKK...H...EYRV----------ALTPAG
Q21M61_SACD2/4-145------------------------------------------AIPRE--.RRA...C...EKRV----------AATPET
Q0KA62_CUPNH/4-137------------------------------------------GVPKE--.VKD...N...EYRV----------GLAPAC
A1CKS0_ASPCL/7-145------------------------------------------WLRAE--TKPA.......EARS----------ALTPTT
A1RDP1_ARTAT/4-136------------------------------------------SVPKE--.IKN...N...EFRV----------AITAAG
A0LUF0_ACIC1/4-137------------------------------------------GVPRE--.IKP...Q...EYRV----------ALTPIG
Q4BZ65_CROWT/4-136------------------------------------------GVPKE--.IKD...Q...EFRV----------GLSPNS
Q484K1_COLP3/4-137------------------------------------------GIPKE--.SFL...G...ERRV----------AAAPSS
B1KJ86_SHEWM/4-143------------------------------------------GIPRE--.ILN...Q...ESRV----------AATPAT
Q1N492_9GAMM/4-139------------------------------------------GVPKE--.IYP...G...ETRV----------ALIPTG
Q7UXF1_RHOBA/4-137------------------------------------------GVPSE--.IKT...D...EYRV----------GMLPVG
Q6MB39_PARUW/4-136------------------------------------------GIPKE--.IKN...H...EYRV----------GATPSM
Q2UAA6_ASPOR/84-217------------------------------------------GVPRE--.TYP...N...ERRV----------AITPQN
A0DTI6_PARTE/7-138------------------------------------------GVRAE--DKSY...W...ERRT----------PIPPHD
A1WZC8_HALHL/6-141------------------------------------------AVPKE--.TRP...G...ERRV----------ALVPGV
B2TCQ5_BURPP/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPSS
Q480P6_COLP3/4-137------------------------------------------GVPKE--.IKN...H...EYRI----------GLTPAG
B8FRW7_DESHD/4-137------------------------------------------GIPKE--.IKI...Y...ENRV----------GMPPAG
Q4P6J5_USTMA/9-143------------------------------------------YLRCE--MKPA.......EHRA----------ALTPTT
Q8G5Z4_BIFLO/12-147------------------------------------------GVLNE--.TSE...T...ESRV----------ALTPDI
O44503_CAEEL/33-163------------------------------------------GIRRE--TVNS...W...ERRA----------PLAPTH
A7IGP9_XANP2/4-139------------------------------------------AVPAE--.VDL...G...EPRV----------AATPDT
Q3IZY5_RHOS4/4-137------------------------------------------GCPKE--.IKP...Q...EFRV----------GLTPHA
Q13HL5_BURXL/6-139------------------------------------------AVLTE--.TRA...H...ERRV----------ALVPSV
Q4SJ60_TETNG/61-200------------------------------------------GVPKE--.IFQ...N...ERRV----------AISPAG
Q6AA35_PROAC/43-176------------------------------------------GIPRE--.LLP...G...ENRV----------AATPTT
Q16LL0_AEDAE/57-190------------------------------------------GVPKE--.RWA...N...ERRV----------AVTPAV
B3E8N4_GEOLS/4-135------------------------------------------GVARE--.IKA...H...EYRV----------ALTPQG
B2UC87_RALPJ/4-136------------------------------------------GIPQE--.TRA...D...ETRV----------AATPET
A1VG31_DESVV/4-137------------------------------------------GILKE--.IKA...E...ENRV----------AMTPAG
Q829A4_STRAW/4-137------------------------------------------GIPRE--.VKN...N...EFRV----------AITPAG
Q5R0B7_IDILO/4-137------------------------------------------GVPKE--.IKN...H...EYRI----------GLTPAA
Q1JX18_DESAC/4-137------------------------------------------AVAKE--.IKN...N...EYRV----------AMTAEG
A0FL43_LACPA/28-158------------------------------------------GVVKE--.QKA...G...EGRV----------AVTPEN
Q2Y9W7_NITMU/4-139------------------------------------------GIPAE--.TRG...G...ETRV----------AATPET
A4SFA5_PROVI/35-169------------------------------------------GIPKE--.RAQ...D...ERRV----------ALSPAG
O68519_MYXXA/4-138------------------------------------------GVPKE--.IKT...R...EYRV----------GMVPAG
Q2Y9W3_NITMU/6-138------------------------------------------GLPKE--.TKD...H...ENRV----------GMTPSN
Q2NZT7_XANOM/6-139------------------------------------------LVLKE--.RAD...G...ERRV----------AATPET
B3EKT2_CHLPB/35-169------------------------------------------GIPKE--.RSN...D...ERRV----------ALSPAG
A0ZAH3_NODSP/4-137------------------------------------------GVPRE--.SKD...Q...EFRV----------GLSPSS
Q4SHM6_TETNG/10-149------------------------------------------GVPKE--.TVQ...N...ERRV----------ALSPAG
A4SZU6_POLSQ/4-136------------------------------------------GVPLE--.TRP...G...ETRV----------AATPET
Q0F940_9RHOB/4-139------------------------------------------GTPKE--.IFL...G...ENRV----------AMTPES
Q0U4J1_PHANO/7-146------------------------------------------HARAE--AKPL.......EHRS----------ALTPTT
A1B5J9_PARDP/5-139------------------------------------------WVRTE--SRAN.......ERRV----------GITPAG
Q6F836_ACIAD/4-136------------------------------------------GIPTE--.TIA...G...ENRV----------AATPET
Q0SGE0_RHOSR/15-145------------------------------------------GVVRE--.SND...G...ERRV----------ALVPKV
Q6ANB3_DESPS/4-131------------------------------------------GIPRE--.IKA...Q...EGRV----------ALLPRH
Q2SNB3_HAHCH/4-137------------------------------------------GVPKE--.VKN...H...EYRV----------GLTPAA
Q1Z2Q8_PHOPR/4-143------------------------------------------GVPKE--.IFA...N...ETRV----------AATPKT
A1BEU6_CHLPD/35-169------------------------------------------GIPKE--.RAQ...D...ERRV----------AISPAG
Q2JLS3_SYNJB/4-136------------------------------------------GVPKE--.IKE...Q...EFRV----------GLTPAA
Q5P3E2_AROAE/4-137------------------------------------------GVPRE--.IKV...H...EYRV----------GLTPAS
Q01VE2_SOLUE/4-138------------------------------------------GVLRE--.RGA...F...DRRV----------ALTPPV
B1JFG2_PSEPW/4-136------------------------------------------GVPLE--.TQT...G...ETRV----------AATPET
A0JVR6_ARTS2/4-136------------------------------------------GVPRE--.IKN...N...EFRV----------AITAAG
Q7N4Z3_PHOLL/4-137------------------------------------------GVPKE--.RLA...N...EARV----------AATPNT
Q6NP53_DROME/69-199------------------------------------------AIRRE--DQSV...W...ERRA----------PFGPTH
O04709_MAIZE/19-156------------------------------------------GILAE--TCNM...W...ERRA----------PLTPSH
Q0FRV1_9RHOB/5-139------------------------------------------WVRAE--QRPN.......EERV----------GITPDG
A0AJ28_LISW6/4-136------------------------------------------GVPKE--.IKN...N...ENRV----------AMTPAS
Q0FA42_9RHOB/4-137------------------------------------------GCPAE--.IKN...Q...EYRV----------GITPAT
A8ZX21_DESOH/4-137------------------------------------------GIPRE--.IKK...L...EKRV----------AVTPAG
Q46N60_CUPPJ/4-136------------------------------------------GIPQE--.TRV...G...ETRI----------AATPET
A1ZCQ3_9BACT/4-136------------------------------------------GIIRE--GKVP...V...DKRV----------PLLPEQ
Q021N9_SOLUE/6-147------------------------------------------GFVGE--.GSP...G...ERRV----------AMAPSA
Q3IYW2_RHOS4/5-139------------------------------------------WVRAE--QRPN.......EERV----------GLTPEG
Q3AEB3_CARHZ/4-137------------------------------------------GVPKE--.IKN...N...ENRV----------AITPAG
A1BEX7_CHLPD/4-135------------------------------------------GIPKE--.IKN...R...ESRV----------SCTPSG
Q48BS0_PSE14/4-136------------------------------------------GVPLE--.TQA...G...ETRV----------AATPET
A0PWE2_MYCUA/9-139------------------------------------------GVVAE--.STP...D...ERRV----------ALVPKA
LYS1_CANAX/9-144------------------------------------------HLRAE--TKPL.......EARA----------ALTPST
LYS1_YARLI/8-142------------------------------------------HLRAE--TKPL.......EHRS----------ALTPTT
Q5SIC7_THET8/4-139------------------------------------------GVPRE--.RSG...GEIPERRV----------PLTPQG
B2TAE0_BURPP/4-137------------------------------------------AVPKE--.VKT...Q...EYRV----------GLTPVS
Q1GIS5_SILST/4-139------------------------------------------GTPKE--.IAE...G...ESRV----------AMTPAS
B2JGI7_BURP8/4-136------------------------------------------GVPAE--.TRP...Y...ETRV----------AATPET
Q1AW21_RUBXD/4-137------------------------------------------GVVRE--.VAA...G...ESRV----------ALAPPA
B4SD94_PELPB/35-169------------------------------------------GIPRE--.RLQ...D...ERRV----------AISPPG
Q16C99_ROSDO/5-139------------------------------------------WVRAE--QRDN.......ETRV----------GLTPDG
A7NQG5_ROSCS/4-138------------------------------------------AIPQA--.HAP...D...EHRV----------ALTPAG
A6WFF9_KINRD/4-137------------------------------------------GVPTE--.VKN...R...EYRV----------ALTPAG
A2C3U2_PROM1/5-141------------------------------------------LIPFE--.SAL...G...ETRV----------SATPET
A1B9C0_PARDP/4-139------------------------------------------GALKE--.SFE...G...EARV----------AVTPSS
A3QAN8_SHELP/4-140------------------------------------------GLPKE--.SHA...D...EKRV----------ALIPAN
Q8XRA9_RALSO/4-136------------------------------------------GIPLQ--.TAE...G...ETRV----------ALTPET
A0LMX7_SYNFM/4-137------------------------------------------GCPKE--.IKN...H...EYRV----------GLTPAA
Q47RB8_THEFY/4-137------------------------------------------GVPRE--.IKD...H...EYRV----------AITPAG
PNTAA_RHORU/4-144------------------------------------------AIPKE--.RRP...G...EDRV----------AISPEV
B2JLD8_BURP8/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPSS
Q128A6_POLSJ/4-137------------------------------------------GIPKE--.IKN...H...EYRV----------GLTPSS
Q04WC6_LEPBJ/4-137------------------------------------------GILKE--.AKE.......ETRV----------SVTPDI
Q7P1W1_CHRVO/4-138------------------------------------------VIPAE--.RLA...G...EHRV----------AATPDT
A0PQF0_MYCUA/4-137------------------------------------------GIPTE--.TKD...N...EFRV----------AITPAG
A1IRJ4_NEIMA/4-137------------------------------------------GIPRE--.SLS...G...ETRV----------ACTPAT
Q8KEN6_CHLTE/6-140------------------------------------------AIPKE--.RAQ...D...ERRV----------AISPAG
Q6SH06_9BACT/4-137------------------------------------------GVPRE--.IKN...H...EYRV----------GLPPAG
Q2IJQ2_ANADE/4-137------------------------------------------GCPKE--.IKN...N...ENRV----------GLTPGG
A0NM55_9RHOB/8-143------------------------------------------GTPKE--.TFP...G...ENRV----------AMTPES
Q0G2B1_9RHIZ/4-137------------------------------------------GCPKE--.IKN...H...EYRV----------GLTPAA
A4SWM0_POLSQ/4-137------------------------------------------GVPQE--.VKN...N...EFRV----------GLTPGN
B4SKQ7_STRM5/7-139------------------------------------------GI.KE--.TAP...G...ERRV----------ALTPET
Q1QDC7_PSYCK/5-139------------------------------------------VISAE--.SAS.......ESRV----------ALTPDA
A0ZDC5_NODSP/19-159------------------------------------------AVAKE--.IEV...C...ERRV----------ALNPDT
A1VTW8_POLNA/4-136------------------------------------------GIPAE--.ITA...G...ETRV----------AITPET
A9BR27_DELAS/4-136------------------------------------------GVPAE--.TMA...G...ETRV----------AATPET
Q4BYI1_CROWT/5-144------------------------------------------AVPKE--.SDL...G...ELRV----------ALVPDT
A6VWR5_MARMS/6-139------------------------------------------AILKE--.THP...H...EKRV----------SLVPSL
A4XPH7_PSEMY/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPQS
Q26D16_FLABB/4-137------------------------------------------GIPKE--.IKN...N...ESRV----------SMTPAG
Q1QT97_CHRSD/4-137------------------------------------------AVPKE--.IKN...H...EYRV----------ALTPSV
B0SVI3_CAUSK/5-140------------------------------------------AVTKE--.TRG...G...ETRV----------AATPET
A1HRL4_9FIRM/4-137------------------------------------------GVAKE--.IKN...N...ENRV----------ALTPAG
Q1WRC5_LACS1/4-135------------------------------------------GVPKE--.IKK...Q...EERV----------GATPSA
B0T233_CAUSK/4-137------------------------------------------GVPSE--.IKP...G...EHRV----------GLTPTA
Q28K30_JANSC/4-138------------------------------------------WIRAE--ERAN.......ERRV----------GITPVG
Q1KZW0_9BRAD/4-137------------------------------------------GVPKE--.IKA...H...EYRV----------GLTPGA
B3EDZ5_CHLL2/4-135------------------------------------------GIPKE--.IKK...M...ETRV----------GCTPAG
Q9AIK2_BILWA/4-136------------------------------------------GIPTE--.IKV...Q...EFRV----------GITPAG
A0KWV9_SHESA/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GMVPSS
A0Z8G6_9GAMM/4-139------------------------------------------AIPRE--.THP...G...ENRA----------SVTPET
Q2CCA0_9RHOB/4-137------------------------------------------GVPKE--.IKN...H...EYRV----------GLTPES
A9VUJ6_BACWK/4-136------------------------------------------GVPKE--.IKN...N...ENRV----------ALTPAG
A5V806_SPHWW/4-137------------------------------------------GVPRE--.IKN...H...EYRV----------GLTPAS
Q31MS7_SYNE7/28-167------------------------------------------LIPCE--.PGL...Q...ERRV----------AMLPSQ
Q03RI6_LACBA/4-135------------------------------------------GIPQE--.TKN...N...ENRV----------GITPAG
B7WZ89_COMTE/27-163------------------------------------------GIPRE--.TFP...L...EKRV----------ATVPDV
A4J8G7_DESRM/4-137------------------------------------------GVPKE--.IKN...N...ENRV----------AMTPAG
Q5KUA3_GEOKA/4-136------------------------------------------GVPKE--.IKN...N...ENRV----------AITPAG
Q11IF1_MESSB/4-137------------------------------------------GCPKE--.IKN...H...EYRV----------GLTPGS
Q0IBP4_SYNS3/5-141------------------------------------------LIPIE--.SAA...A...ETRV----------AASPET
A1ZGV6_9BACT/4-137------------------------------------------GVPKE--.IKQ...N...ESRV----------ALTPAG
P73496_SYNY3/23-158------------------------------------------GVPRE--.SFD...Q...ECRV----------AMTPDT
A1V078_BURMS/79-211------------------------------------------GVPAE--.TRA...N...EARV----------AATPET
Q15PN0_PSEA6/5-140------------------------------------------AFPAE--.MKA...G...EKRC----------ALLPVN
Q7VV14_BORPE/4-136------------------------------------------GVPKE--.TRD...G...ETRV----------AATPET
Q12QQ7_SHEDO/4-145------------------------------------------GIPKE--.SLS...G...ETRV----------AATPAT
A7HUT9_PARL1/4-139------------------------------------------AIPKE--.RLD...G...ETRV----------AASPET
Q2CKD5_9RHOB/4-138------------------------------------------WLRAE--ARAT.......ERRT----------PLLPEG
Q03HP9_PEDPA/4-134------------------------------------------AVIKE--.QKE...G...EGRV----------AATPEN
A2BXK8_PROM5/5-141------------------------------------------LIPIE--.TVS...G...ERRV----------SATPGA
A0YVL7_LYNSP/4-136------------------------------------------GIPKE--.TKD...Q...EFRV----------GLSPSS
Q3A7G8_PELCD/26-159------------------------------------------GVPKE--.IKT...R...EYRV----------AMTPAG
Q5DZZ0_VIBF1/4-143------------------------------------------GVPRE--.VFA...G...ETRV----------AATPKT
Q01VQ6_SOLUE/4-137------------------------------------------GVPKE--.IKD...H...ETRV----------GLVPSG
DHA_LYSSH/4-137------------------------------------------GIPKE--.IKN...N...ENRV----------AMTPAG
Q7VA67_PROMA/14-145------------------------------------------GIPKE--.IKS...D...ELRV----------AITPDG
Q10VQ6_TRIEI/4-139------------------------------------------SVAKE--.ILV...N...ECRV----------ALVPDV
A0M2A6_GRAFK/33-166------------------------------------------GIPKE--.TAY...Q...EKRI----------CISPDA
C1DKG5_AZOVD/4-137------------------------------------------GIPRE--.LKN...H...EYRV----------GLTPSS
A8H092_SHEPA/19-156------------------------------------------GLPKE--.SYA...S...ESRV----------AIIPAN
Q0FFN0_9RHOB/5-137------------------------------------------WIRAE--ERPN.......EKRV----------GVTPNG
A1A1C3_BIFAA/12-147------------------------------------------GVLNE--.TSE...H...ESRV----------ALTPDI
Q11SC0_CYTH3/13-146------------------------------------------GIPKE--.LEG...I...ENRV----------CLTPEA
DHA1_STAAM/4-134------------------------------------------AVVKE--.LKQ...G...EGRV----------ACTPEN
A8LLI3_DINSH/4-137------------------------------------------GCPTE--.IKP...Q...EFRV----------GLTPAA
Q3AI65_SYNSC/8-144------------------------------------------LIPVE--.STP...G...ENRV----------AATPDT
Q11EJ3_MESSB/6-139------------------------------------------FVPKE--.ADT...N...EPRV----------AASPDT

PF05221

SAHH_RHOCB/2-462L-KAL-GADVRWASCNIF-STQDHAAAAIA.........AGGTPVFAVKGETLEEYWAYTDKIFQ.FPEG...TCN-MIL
SAHH_YEAST/6-448L-VAL-GAEVTWSSCNIY-STQDHAAAAIA.........ASGVPVFAWKGETEEEYLWCIEQQLFAFKDN..KKLN-LIL
SAHH_CATRO/12-484L-TAL-GAEVRWCSCNIF-STQEHAAAAIA.........RDSAAVFAWKGETLQEYWWCTERALD.WGPD..GGPD-LIV
SAHH2_DROME/66-491L-VQL-GATVRWAACNIY-STQNAVAAALA.........EAGIPIFAWRGETEEEFWWCLDRAI..YSDG..WQPN-LIL
SAHH_LEIDO/2-436L-KAL-GADVRWSSCNIF-STQDNAAAAIA.........KAGVPVFAWKGETDEEYEWCIAQTVKGFSGD..GLPN-MIL
SAHH_TRIVA/11-485L-TAL-GADVRWASCNIF-STQDTAAAAIVVGPTGTPEKPAGIPVFAWKGETLPEYWENTYRALT.WPDG..QGPQ-QVV
SAHH_CAEEL/6-436L-TAL-GAEVQWSSCNIF-STQDHAAAAIA.........QTGVPVYAWKGETDEEYEWCIEQTIV.FKDG..QPLN-MIL
SAHH_PLAF7/4-478L-QKL-GAQIRWCSCNIY-STADYAAAAVS........TLENVTVFAWKNETLEEYWWCVESALT.WGDGDDNGPD-MIV
SAHH_MOUSE/5-431L-VAL-GAEVRWSSCNIF-STQDHAAAAIA.........KAGIPVFAWKGETDEEYLWCIEQTLH.FKDG...PLN-MIL

PF00389

Q9JY94_NEIMB/3-329L.EKLAQIGVKTVALRCA-GFNNVDLKAAE---------ELGLKVV--------------------------RVPA.YSP
O30440_BORPT/4-317L.AAN..PDLRVVGCFCI-GTNQVDLDAAM---------MRGVPVF--------------------------NAPF.SNT
SERA_ARATH/85-394F.EAA.KGRLKVVGRAGV-GIDNVDLQAAT---------EHGCLVV--------------------------NAPT.ANT
Q9RUU0_DEIRA/18-329L.DAA.GPRLKVIGRGGV-GVDNIDLEYAS---------RRGLLVL--------------------------NAPE.SNN
Q98F95_RHILO/5-315I.NAA..TRLKVIGRAGI-GVDNVDIPAAS---------RKGIIVM--------------------------NTPF.GNS
Q99R78_STAAM/6-332Y.KRLNELGIKQIAQRSA-GFDTYDLELAN---------KYNLIVS--------------------------NVPS.YSP
E9ACF1_LEIMA/115-427L.DAA..PKLLGIGCFCI-GTNQVDLDYAT---------TRGVAVF--------------------------NSPF.ANT
Q9KEA4_BACHD/2-311L.QAA..KKLKWIMVISA-GVEQLPFQAIK---------EKGIIVT--------------------------NAKG.IHA
O28495_ARCFU/4-322M.RAM..EKVKLIQQPST-GYNNIDVEAAK---------KLSITVA--------------------------NVGG.VNA
Q9KLW1_VIBCH/3-321L.AHL..PNLKLISQTGK-VSNHIDVALCE---------RYGVTVL--------------------------EGIG.SPV
Q9CKF1_PASMU/14-327L.AHA..QKLIAIGCFCI-GTNQVNLQAAK---------LRGIPVF--------------------------NAPF.SNT
SERA_SHIFL/13-326I.NAA..EKLVAIGCFCI-GTNQVDLDAAA---------KRGIPVF--------------------------NAPF.SNT
SERA_ARCFU/3-312I.QAA..KNLKIIGRAGV-GVDNIDINAAT---------QRGIVVV--------------------------NAPG.GNT
O58256_PYRHO/5-318L.ENA..ERLKVISCHSA-GYDNIDLEEAT---------KRGIYVT--------------------------KVSG.LLS
Q9X4A4_STAAU/4-319L.AQS..PNLKVIANMAV-GYDNIDVESAT---------ANNVVVT--------------------------NTPN.VLT
Q99T17_STAAM/2-311L.QRC..PNLKWIAWFAT-GVNTLPLDYIA---------DHGILLT--------------------------NGKG.VQA
CTBP_DROME/30-352L.EKF..KALRIIVRIGS-GTDNIDVKAAG---------ELGIAVC--------------------------NVPG.YGV
Q9VKI8_DROME/8-324LAAGS..GSLKVVGRAGA-GVDNIDVPAAT---------AQNVVVL--------------------------NTPG.GNS
Q97IU7_CLOAB/3-326I.KKFNDVGVKFISTRTI-GYDHIDIKKAK---------ELRIGVG--------------------------NVT..YSP
GHRB_ECO57/5-319L.EKM..PKLRATSTISV-GYDNFDVDALT---------ARKILLM--------------------------HTPT.VLT
YEAA_SCHPO/9-327I.DNL.PPSVKFICHLGA-GYETVDVAACT---------ARGIQVS--------------------------HVPK.AVD
LDHD_LEUMC/3-330L.TALANVGVTNLSLRNV-GTDNIDFDAAR---------EFNFNIS--------------------------NVPV.YSP
Q9KP92_VIBCH/13-326I.NAA..EKLVAIGCFCI-GTNQVDLNAAA---------KRGIPVF--------------------------NAPF.SNT
Q9I1L0_PSEAE/4-318L.DLA..PRLEAIASVSV-GVDNYDIDYLD---------RRGILLS--------------------------NTPD.VLT
Q98BH4_RHILO/9-329I.AQA.GDNLKLIANFGN-GVDKIDVAAAA---------KKGITVT--------------------------NTPN.VLT
P74586_SYNY3/3-330L.EKLAAQGTKLIALRSA-GYNNVDLKTAA---------DLGLKVV--------------------------HVPS.YSP
Y2305_STAAM/4-317I.DAG..KDLKIIANYGA-GFNNIDIEYAR---------EKSIDVT--------------------------NTPK.AST
Q59463_HYPME/6-322I.DRI.PENIKCISTYSI-GFDHIDLDACK---------ARGIKVG--------------------------NAPH.GVT
DDH_ZYMMO/3-331L.EILAGLGIKLVALRCA-GYNNVDLDAAK---------KLNIKVV--------------------------RVPA.YSP
TKRA_BACSU/6-322L.EHA..PKLKVVSNQSV-GYDNFDIEAMK---------ERGVVGT--------------------------HTPY.TLD
Q9ZKF4_HELPJ/4-314L.KPL..THLKSIVRAGV-GVDNIDLESCS---------QKGIVVM--------------------------NIPT.ANT
Q9A244_CAUCR/24-340L.SRS.GDRLKLIANFGA-GVDNIDVATAN---------ARGIIVT--------------------------NTPG.VLT
SERA_SCHPO/58-378L.EAA..DSLIVIGCFCI-GTNQVDLDFAA---------ERGIAVF--------------------------NSPY.ANS
GYAR_THELI/5-322L.ENA..PKLKIIAQYAV-GYDNIDIEEAT---------KRGIYVT--------------------------NTPG.VLT
Q98LH4_RHILO/9-326M.QAL..PDLRYISKYGI-GVDSIDIDAAT---------EHGILVS--------------------------STPNDFQI
Q9BLF6_OCTVU/5-323F.EAA.GPSLKVVSTLSV-GYEHIDLKACK---------ARNIIAC--------------------------NLSK.IST
Q99TE0_STAAM/6-315I.NAA..DSLKVIARAGV-GVDNININAAT---------LKGILVI--------------------------NAPD.GNT
Q9S2M5_STRCO/3-328L.EILAAGGTRMVAQRST-GFNNVDLDTAD---------RLGMTVA--------------------------RVSY.YSP
SERA_METJA/4-312I.EKA..EKLKVIGRAGV-GVDNIDVEAAT---------EKGIIVV--------------------------NAPD.ASS
PTXD_PSEST/5-326L.QAC..PELRVVGCALK-GFDNFDVDACT---------ARGVWLT--------------------------FVPD.LLT
LDHD_STRP1/3-330Y.PLLKEMGIKQIAQHSA-SVDMYNLDLAT---------ENDIIIT--------------------------NVPS.YSP
Q9LE33_ARATH/9-321L.SHL..PSLQILVCTSV-GIDHIDLAACK---------RRGIVIT--------------------------NAGN.AFS
Q9HXB7_PSEAE/5-318L.EQA..KQLEVISSVSV-GYDNYDLDYLN---------RRGIALT--------------------------NTPD.VLT
O67741_AQUAE/4-320L.ERA..EKLKVVGRAGV-GVDNVDIEEAT---------KRGILVV--------------------------NTPG.ANT
SERA_METTH/6-313I.EAA..PRLKIIARAGV-GVDNVDVKAAT---------DRGIMVI--------------------------NAPE.STS
LDHD_PEDAC/3-329F.DKMHEFGIHAFSLRNV-GLDNVPADALK---------KNDIKIS--------------------------NVPA.YSP
Q9UYH9_PYRAB/5-318L.ERA..ERLKVISCQSA-GYDHVDVEEAT---------KRGIYVT--------------------------KVSG.LLS
DDH2_SCHPO/3-330L.KALAENGVKLVALRCG-GYNNVNLKAAS---------EYKITVV--------------------------HVPS.YSP
Q9CA90_ARATH/6-313I.SDL..PNLEIVSSFSV-GLDKIDLGKCK---------EKGIRVT--------------------------NTPD.VLT
Q48534_9LACO/4-332VYQKLSEYGVKCIGLRIV-GFNTINFDWTK---------KYNLLVT--------------------------NVPV.YSP
LDHD_ECOLI/3-329L.EELKKHGVKYIALRCA-GFNNVDLDAAK---------ELGLKVV--------------------------RVPA.YDP
SERA_RAT/9-317I.NAA..EKLQVVGRAGT-GVDNVDLEAAT---------RKGVLVM--------------------------NTPN.GNS
Q9A6E7_CAUCR/11-318L.AEM..PRLGLIACVSV-GYDGVDVPWCK---------AHGIAVT--------------------------HSTG.LNA
Q9HMR0_HALSA/3-311F.EAA..PDLVIVARAGI-GVDNIDIDAAT---------DHGVMVA--------------------------NAPA.GNV
Q9WYG2_THEMA/4-311V.ENS...SLKIIAKHGV-GVDNIDLEAAT---------KKGIPVT--------------------------ITAG.ANS
CTBP2_RAT/36-358L.EKF..KALRVIVRIGS-GYDNVDIKAAG---------ELGIAVC--------------------------NIPS.AAV
Q9PBD8_XYLFA/15-328L.GHA..KRLMAIGCFCI-GTNQVDLDTAE---------LSGIPVF--------------------------NAPY.SNT
Q89388_PBCV1/32-362L.DILKNCGVSSITLRCA-GFDRLDIEYAK---------ELGFNVY--------------------------RVPA.YSP
LDHD_TREPA/3-330Y.DYMGACKLKVLSTRTA-GFDMYNATLLK---------KHGIRLT--------------------------NVPS.YSP
Q97MV2_CLOAB/3-317I.NSD..SKLKMMSIAFT-GVDHVELSALN---------NKEVVVS--------------------------NASG.YST
Q97U35_SULSO/2-295I.GKM..PNLKVIQTFSA-GVDDLDFSIIP---------SH.VKVF--------------------------SNAG.AYS
Q9A3I9_CAUCR/6-314I.AAA..NKLRVIARAGI-GVDNVDIPAAT---------AKGIVVM--------------------------NTPF.GNS
Q9RKF9_STRCO/17-329M.DRL..PRLKVIGRYGV-GVDSVDVEAAT---------RRGILVC--------------------------NVPD.YGT
Q9RNB7_MICAE/18-330I.RLA..KHLKVISTSGF-GTDSIDIMAAT---------EQGVIVV--------------------------NNPG.MST
LDHD_STAAU/4-330Y.PKLESYGIKQIAQRTA-GFDMYDLDLAK---------KHNIVIS--------------------------NVPS.YSP
Q9LT69_ARATH/49-358F.ESS.RGRLKVVGRAGV-GIDNVDLAAAT---------EYGCLVV--------------------------NAPT.ANT
GYAR_AERPE/6-324L.SQA..PRLRIVAQMAV-GFDNIDVECAT---------RLGIYVT--------------------------NTPG.VLT
DDH_HAEIN/3-329L.EKLAALGVKIVALRCA-GFNNVDLKAAQ---------ELGIQVV--------------------------RVPA.YSP
O17626_CAEEL/8-316LAASA..GKLKLVGRAGT-GVDNIDVPAAS---------ANKILVM--------------------------NTPQ.ANS
PDXB_PSEAE/3-285L.AG...SPVRFVGTCTI-GTDHLDLDYFA---------EAGIAWS--------------------------SAPG.CNA
SERA_YEAST/61-381L.QHA..KNLVCIGCFCI-GTNQVDLDYAT---------SRGIAVF--------------------------NSPF.SNS
YGDH_SCHPO/9-332L.GPL.LPTCKLFVTGAA-GYNNVDVDWAT---------RNGVYVA--------------------------NTPN.GPT
Q20595_CAEEL/181-504L.EKF..KVLKVVFRIGY-GIDNIDVKAAT---------ELGIAVC--------------------------HAPG.DYV
DHD2_LACPA/3-329F.EKMHAYGIKFLTIRNV-GTDNIDMTAMK---------QYGIRLS--------------------------NVPA.YSP
Q9KCG9_BACHD/20-325M.EKM..SSLKIIARAGV-GVDNIDIDAAT---------KHGIVVV--------------------------NAPD.GNT
SERA_MYCLE/6-313L.AAA..PKLKIVARAGV-GLDNVDVDAAT---------ARGVLVV--------------------------NAPT.SNI
Q9I530_PSEAE/3-328L.ERLAAGGTRLVALRSA-GYNHVDLAAAE---------ALGLPVV--------------------------HVPA.YSP
Q9VII9_DROME/10-326L.DAA.GSQLRCVSTMSS-GIDFVDIPEFQ---------KRGIPLG--------------------------HTPG.VVK
O66939_AQUAE/3-332L.SKM..PRLKLIHTRSV-GFDHIDLDYCK---------KKGILVT--------------------------HIPA.YSP
Q9HVG5_PSEAE/7-321I.AAC..PELELILISAT-GTNNIDLAAAR---------ERGIVVA--------------------------NCHG.YGT
GHRB_ENTAG/5-318G.EN...AKLRAASTISV-GYDNFDVEALN---------QRGIVLI--------------------------DTPT.VLT
Q98CG2_RHILO/11-318M.DAL..PNLELIASFGV-GYDSVDVGHAA---------AKNIMVT--------------------------NTPD.VLT
GRHPR_HUMAN/9-327L.DAA.GANLKVISTMSV-GIDHLALDEIK---------KRGIRVG--------------------------YTPD.VLT
Q9KMX4_VIBCH/4-330L.EQLYQGGTRLIAMRCA-GFDKVDLEAAK---------RLGMQVV--------------------------RVPA.YSP
Q9K7P7_BACHD/3-318F.ERA..KRLKVVSTMAV-GYDNIDIKEAT---------KRGVSVG--------------------------HTPG.VLT
Q9I6H5_PSEAE/13-326F.DCA..KKLIAVGCFCI-GTNQVDLNAAR---------ERGIAVF--------------------------NAPY.SNT
Q9HK29_THEAC/3-309L.KKM..PRLRFVQVASI-GYDNVDMNAMK---------KNGIMVS--------------------------NIPT.ASA
Q9ZH60_LACJH/4-331L.QALADAGVTKMSLRNV-GVDNIDMDKAK---------ELGFEIT--------------------------NVPV.YSP
Q98GE4_RHILO/8-315F.EGA..WKLRAAIRHGA-GLDMIPMEAAT---------AAGVLVA--------------------------NVPA.VNA
DDH1_SCHPO/3-330L.KVLAKNGTKLIALRCA-GFNNVDLKAAA---------DNGITVV--------------------------RVPA.YSP
PDXB_VIBCH/3-286L.AKA..NRLKFVGTATA-GMDHVDQALLR---------ERGIFFT--------------------------AAPG.CNK
DHGY_METEA/5-313L.KQL..PDLKLIAVAAT-GTDVVDKAAAK---------AQGITVV--------------------------NIRN.YAF
Q97ZK1_SULSO/20-326I.RYG..VNLKIIARAGI-GLDNIDTEEAS---------KRNIKIV--------------------------YAPG.AST
GYAR_PYRAB/6-323F.ERA..PRLRIVANYAV-GYDNIDVEEAT---------KRGIYVT--------------------------NTPG.VLT
Q97F10_CLOAB/3-323I.EKL..PKLKYIGVLAT-GYNVVDLEFAK---------KKGIVVT--------------------------NIPQ.YST
Q9Z564_STRCO/7-314V.AAA..KKLKVVARAGV-GLDNVDVSAAT---------KAGVMVV--------------------------NAPT.SNI
LDHD_LACPE/3-330L.NKLADEGVKNISLRNV-GVDNLDVPTVK---------ARGLNIS--------------------------NVPA.YSP
SERA_SYNY3/32-339I.QAG..SQLKIIGRAGV-GVDNIDVPAAT---------RQGIVVV--------------------------NSPE.GNT

PF05222

NNTM_BOVIN/60-199V------QAL.....VKQ.G.F..NVVVES---------GAGE...--------------------------ASKF-SDD
Q7RV12_NEUCR/59-195V------AFL.....LKK.G..FGKVLVEK---------GAGA...--------------------------EAEF-HDS
Q3F038_BACTI/7-137V------RKL.....VEE.G.H..QILVEK---------DAGI...--------------------------GSGY-TND
Q0VPX1_ALCBS/24-165V------SAL.....LKKQG.V..EIIIER---------GAGD...--------------------------IAGY-PDS
Q3J1C2_RHOS4/4-139A------LQL.....QKL.G.H..HCVIET---------GAGM...--------------------------KAGF-SDE
Q0EZS3_9PROT/4-136A------RAL.....VED.G.H..QVLVEQ---------GAGA...--------------------------GSGF-SDK
Q0G0B3_9RHIZ/4-136V------KKL.....KGL.G.A..EVVIQS---------GAGE...--------------------------HSKI-TDK
LYS1_ASHGO/6-141V------RTL.....VSH.G.F..KIYVEE---------SA.....--------------------------QSVF-EAA
Q28V87_JANSC/4-137A------REA.....VVH.G.H..RVTMQA---------GAGT...--------------------------GAGF-TDE
Q24813_ENTHI/568-702C------KQL.....RSR.G.Y..GIYVES---------GAGL...--------------------------LSSC-TDE
Q2G7Q1_NOVAD/4-137V------REL.....VAH.G.H..EVWVEA---------GAGN...--------------------------GIGA-SDA
Q6AQV0_DESPS/4-137V------VTM.....VAN.G.H..DVIVEK---------GAGL...--------------------------GSSF-SDA
Q82QU1_STRAW/15-145V------RLL.....LGL.G.Y..EVVVES---------GAGE...--------------------------ASGF-GDQ
Q3B540_PELLD/4-135V------RHL.....VAG.G.H..RVVVQS---------GAGA...--------------------------KSGF-TDD
DHA_OCEIH/4-136V------VHL.....INA.G.H..TVQIEK---------GAGL...--------------------------GSNF-ADA
Q0S884_RHOSR/4-137V------HEL.....NER.G.H..EVVIES---------GAGI...--------------------------GSSF-ADE
A0KQF4_AERHH/4-135V------EQL.....KKL.G.F..EVAIEA---------GAGL...--------------------------LASF-DDA
Q9KAF8_BACHD/4-136V------MSF.....VQA.G.H..QVLIER---------GAGS...--------------------------GSGF-DDI
A6VXM0_MARMS/6-147A------SKV.....KQL.G.F..DIIMES---------GAGV...--------------------------AASY-SDD
Q3JE74_NITOC/4-136T------VEL.....VQQ.G.H..EVFIER---------AAGD...--------------------------PSGY-PDA
B1YFJ0_EXIS2/4-136V------AAL.....MGQ.G.H..TVIVET---------TAGM...--------------------------GSGF-TNE
A0YCU2_9GAMM/4-139V------KRF.....TDQ.G.A..EVHIES---------GMGL...--------------------------SIRI-QDS
Q39LR8_BURS3/6-135V------EKL.....IKL.G.F..SVAVQS---------GAGT...--------------------------GANF-SDD
A5GEE8_GEOUR/4-135T------AEL.....VTS.G.N..EVLVET---------GAGE...--------------------------GSGF-TDD
A5FP13_FLAJ1/4-137V------SEM.....KKH.G.H..TVYVQS---------TAGL...--------------------------GSGF-ADA
Q98CE6_RHILO/6-139V------KRL.....AGL.G.F..DVIVET---------GAGT...--------------------------RSRI-PDE
Q31MC9_SYNE7/4-136V------RAL.....ALQ.G.H..QIWIEQ---------GAGV...--------------------------GSGF-QDE
Q6NYQ7_DANRE/56-195V------EAL.....IKQ.G.F..NVVVES---------GAGE...--------------------------SAKF-SDD
Q1MBQ8_RHIL3/6-139V------KKM.....KSF.G.F..DVVVEA---------GAGA...--------------------------ASRI-PDG
Q5KHJ2_CRYNJ/22-157A------KTL.....LDS.N.F..DVYVEK---------DP.....--------------------------QRIF-DDR
A4TCI0_MYCGI/4-137V------AEL.....VQR.G.H..EVLIQS---------GAGD...--------------------------GSSI-SDA
Q8GRT6_GOSHI/8-144C------ARLLHSGREKT..GI.ARIIVQP---------ST.....--------------------------KRIH-HDS
Q2IDX0_ANADE/4-138V------TRL.....VKQ.G.H..EVRVER---------GAGE...--------------------------AAGF-PDE
Q21L93_SACD2/6-141V------QKL.....NKL.G.V..QVVMQQ---------GAGA...--------------------------SAFL-PDE
A0QNT0_MYCS2/5-135V------EKL.....SAR.G.L..EVVVES---------AAGA...--------------------------GALF-SDA
Q1GUI4_SPHAL/4-138V------KKF.....IGL.G.A..EVAVES---------GAGE...--------------------------QASI-ADA
DHA_GEOSE/4-137V------MTL.....VKA.G.H..EVYVET---------EGGA...--------------------------GSGF-SDS
Q0AQT6_MARMM/4-137V------AEF.....VRH.G.H..EVVVET---------DAGE...--------------------------GIGF-SND
Q1YKG9_MOBAS/4-137V------KKL.....TGL.G.A..TVVVET---------GAGA...--------------------------DSRI-TDA
A6UD59_SINMW/6-139V------KKL.....KSL.G.F..DVVVES---------GAGQ...--------------------------GSRI-PDQ
Q18031_CAEEL/32-165V------ALL.....KKN.G.I..SVLIEE---------NAGV...--------------------------LAGY-SNE
Q063W8_9SYNE/14-150V------KKF.....ISL.G.C..SVSVEC---------GAGV...--------------------------ASGY-LDA
Q1V607_VIBAL/4-137V------REL.....ISH.G.H..QVLVET---------NAGA...--------------------------GIGF-SDD
Q47E46_DECAR/4-137V------REL.....VAH.G.H..RVIVQK---------NAGT...--------------------------AIGL-TDA
Q39WN5_GEOMG/4-135I------AEL.....ARG.G.H..TVLVET---------GAGE...--------------------------GSGF-ADG
Q1YRC4_9GAMM/4-137V------VEL.....VAR.G.H..KVMVEV---------NAGA...--------------------------GIDF-SDE
Q3SL22_THIDA/4-136A------RSL.....VDA.G.H..AVSVES---------HAGA...--------------------------AVGF-GDD
Q6W1Y1_RHISN/6-139V------KKI.....LSF.G.L..EVVVEA---------GAGR...--------------------------CSRI-PDA
A1RCI4_ARTAT/4-137V------HEL.....SAR.G.H..DVFVEA---------GAGA...--------------------------GSSV-TDS
Q67ND6_SYMTH/4-137V------MAM.....VRA.G.H..EVYVEH---------DAGR...--------------------------GSGF-DDS
Q5SLT7_THET8/5-139V------ARL.....VKG.G.A..RVRVER---------GAGE...--------------------------GAYH-PDE
A0KEW0_AERHH/4-137V------QEL.....TAR.G.H..KVLVQQ---------QGGE...--------------------------AIGL-SDA
Q47BC9_DECAR/6-139A------KKF.....AAL.G.A..RLRMEQ---------SSGI...--------------------------QSHF-LDS
A1ZZD6_9BACT/38-171V------EIL.....VRN.G.H..EIRVEA---------GAGL...--------------------------GAKF-TDQ
Q8DL05_THEEB/4-139V------AKL.....VQQ.G.Y..HLWVES---------GAGD...--------------------------MAHF-SDD
Q28M63_JANSC/4-139A------TQL.....QKL.G.Y..ECVIEA---------GAGA...--------------------------QAGF-SDA
Q2RN15_RHORT/4-137V------HEF.....VDH.G.H..AVVVES---------GAGL...--------------------------GIGS-TDA
Q1VSD8_9FLAO/34-167V------NAL.....TAN.G.H..RVLIES---------GAGN...--------------------------QANF-SDR
Q0C3J7_HYPNA/4-137A------GEL.....VRA.G.H..QVNIQA---------GAGI...--------------------------ASGF-ADE
Q2S445_SALRD/35-169T------GAL.....VAN.G.H..EVYVEE---------GAGH...--------------------------EAHF-QND
A0R9N0_BACAH/4-136V------VHL.....IRN.N.H..EVFIQK---------GAGL...--------------------------GSGF-TDA
Q07J60_RHOP5/4-136V------KKF.....KAL.G.A..EVAVEP---------GAGI...--------------------------KSGL-PDS
A1SSF5_PSYIN/4-138V------ELL.....IKQ.G.F..TFLVEK---------NAGI...--------------------------AASF-SDQ
Q5Z133_NOCFA/18-148I------PAL.....LKQ.G.V..EVVVES---------GAGH...--------------------------GALI-PDQ
Q5WJZ9_BACSK/4-136V------DAL.....VGS.G.H..RIVVEA---------AAGI...--------------------------GSGF-TDE
A2C6Y0_PROM3/14-145V------KEL.....VNK.G.L..EVRVQA---------GAGA...--------------------------GAGI-GDE
A0L9H7_MAGSM/4-145I------ERL.....RKL.G.Y..DVQVET---------GAGT...--------------------------EATF-LDD
Q1Z6I5_PHOPR/6-140A------SAL.....IQT.G.A..VVMVEK---------SS.....--------------------------TRIF-ADA
Q6W1J9_RHISN/4-139A------LHL.....QKL.G.Y..ECLIET---------GAGK...--------------------------LAGY-SDD
PNTA_HAEIN/4-137V------QQI.....LKL.G.F..DVIVEH---------DAGF...--------------------------KASF-EDQ
Q6AEY9_LEIXX/4-137V------HDL.....VGA.G.H..EVYVEM---------GAGA...--------------------------GSSI-PDE
Q6ACH0_LEIXX/6-139V------PRL.....CAQ.G.F..DVVVQS---------GAGE...--------------------------CCGF-DDA
Q1YRM2_9GAMM/4-145V------QSL.....TDK.G.V..KVLFQT---------NAGD...--------------------------AAGY-PDG
Q0FNJ6_9RHOB/4-137A------REA.....VSQ.G.H..EVLIQS---------GAGL...--------------------------GAGF-EDD
Q1VPH7_9FLAO/4-137V------FEL.....TKR.K.H..HVYVQT---------QAGL...--------------------------ASGF-EDL
Q1NA78_9SPHN/23-156V------HEL.....TAH.G.H..RVLVET---------RAGD...--------------------------GIGA-GDD
A8GEZ6_SERP5/4-137V------EQL.....LKL.G.F..TVAIES---------GAGK...--------------------------LASF-DDS
Q5LFH6_BACFN/4-137V------AEL.....VKR.G.H..TVYIQH---------TAGE...--------------------------NSGF-QDE
A5FFU7_FLAJ1/32-165V------NSL.....TYE.G.H..RVMIES---------GAGE...--------------------------SSSY-TDK
A0K2E1_ARTS2/12-145V------QQL.....IGL.G.L..EALVES---------RAGA...--------------------------AAGY-SDE
A0QNN8_MYCS2/4-137V------GQI.....LKL.G.Y..SVVVES---------GAGA...--------------------------AASF-SDA
Q5YZC0_NOCFA/4-137A------AEL.....VRH.G.H..EVLVER---------GAGA...--------------------------GSGF-GDE
P72775_SYNY3/4-136V------RAL.....LSQ.G.H..QVFVEE---------GAGV...--------------------------GSGF-PDG
Q603N5_METCA/4-139A------EKI.....MKL.G.F..EVAVES---------GAGD...--------------------------AANF-SDD
Q2N774_ERYLH/4-137A------REL.....AGR.G.H..DVWIES---------GAGL...--------------------------GIGA-TDE
Q26EF0_FLABB/32-165V------AAL.....TAH.G.H..RILMEK---------GAGK...--------------------------GSNF-TDS
Q1J0B1_DEIGD/4-135V------ATL.....IRR.G.H..TVTVER---------GAGV...--------------------------GSGI-HDS
Q472Z0_CUPPJ/4-137V------REL.....VSR.G.H..QVVVQA---------GAGA...--------------------------AIGL-TDH
Q2HFZ2_CHAGB/7-141T------AAL.....IKA.G.Y..TVNVER---------SP.....--------------------------VRIF-DDA
LYS1_YEAST/7-142V------KKL.....IAK.G.F..KIYVED---------SP.....--------------------------QSTF-NIN
Q3UEQ9_MOUSE/27-157I------KGI.....TKL..GY..KVLIQP---------SN.....--------------------------RRAI-HDK
Q4SE54_TETNG/23-153V------KEL.....TNA..KI..KVLVQP---------SN.....--------------------------RRAI-HEK
Q5LPM8_SILPO/4-139A------VQL.....QKL.G.Y..DCAIES---------GAGA...--------------------------AAGF-SDA
A2BS45_PROMS/5-141V------KKL.....NSL.G.C..DVYIES---------SAGK...--------------------------LSGF-SDL
Q65CX6_BACLD/4-136V------VAL.....KKS.G.H..QVLIEQ---------GAGL...--------------------------GSGF-EDA
Q1QUL9_CHRSD/4-139A------QHI.....QKL.G.H..TCVIES---------GAGL...--------------------------AAGF-DDA
Q05XL4_9SYNE/7-143V------KKF.....IGL.G.C..SVAIER---------GAGA...--------------------------SAGF-VDS
Q2J8T8_FRASC/7-142V------GRL.....VGS.G.L..DVLVET---------GAGR...--------------------------GAWF-PDG
A8LYT6_SALAI/4-137V------NEF.....IRA.G.H..QVFVES---------GAGA...--------------------------GSST-SDS
Q1NHV8_9SPHN/4-138V------KKF.....KAL.G.A..DVAIEA---------GAGL...--------------------------TASI-ADA
A4Y0R2_PSEMY/4-136V------KKL.....VGQ.G.H..QVTVQT---------GAGI...--------------------------SASI-PDS
Q11TK3_CYTH3/4-137V------AEL.....VSR.K.H..QVLVQK---------DAGL...--------------------------GSGF-SNE
A0CWD3_PARTE/29-161I------KNL.....VKD.G.H..QVLIES---------GAGL...--------------------------KANF-ADN
Q1MXV6_9GAMM/4-137V------REL.....TSA.G.H..DVVVET---------NAGL...--------------------------AIGL-DNA
Q2BRI8_9GAMM/4-137V------KEL.....CSQ.G.H..DVIIQK---------GAGE...--------------------------KIGF-FDA
Q2SHR3_HAHCH/4-137V------EEL.....IKL.G.F..SVAVEA---------DAGW...--------------------------LSSF-GDG
A6VN40_ACTSZ/4-137V------EQI.....KKL.G.F..DVIVEN---------DAGF...--------------------------KASF-EDN
A8ZXI3_DESOH/4-137V------EMM.....TAR.G.H..EILVET---------RAGA...--------------------------GSGF-DDD
A5FVY5_ACICJ/4-137V------REL.....HAN.G.H..RVLVET---------GAGE...--------------------------GIGM-DDA
B2TEW7_BURPP/4-136V------KKY.....VAQ.G.H..RVIVQS---------GAGV...--------------------------RASL-RDA
Q0YPX1_9CHLB/28-159V------RNL.....VSA.G.H..RVVVEA---------GAGL...--------------------------GSGF-SDD
Q8DQ43_STRR6/4-136V------HSL.....VSR.G.H..RVLIET---------NAGL...--------------------------GSGF-TDA
Q9K827_BACHD/4-136V------MTL.....TQH.G.H..EVIVQK---------GAGE...--------------------------GSGF-TDE
Q5CI32_CRYHO/405-540V------KKL.....RKL.G.F..RVLVES---------GAGT...--------------------------KSQF-DDQ
A6U2H6_STAA2/4-136V------HAL.....VES.G.H..TVLVET---------NAGS...--------------------------GSFF-EDV
A1EQT6_VIBCL/4-137V------EQL.....IKL.G.F..EVCIES---------KAGA...--------------------------LASF-DDA
Q0SD61_RHOSR/4-134V------AAL.....QKL.G.Y..QVVVEP---------GAGE...--------------------------PAGF-TDG
Q11PQ8_CYTH3/7-139C------VEI.....MQQYPHV..EIFVQP---------SD.....--------------------------IRCI-SNK
Q2NSW2_SODGM/4-137V------EQL.....LKL.G.F..SIAMES---------GAGT...--------------------------LASF-EDA
Q8DH53_THEEB/4-139V------QSL.....RER.G.H..EVLIES---------GAGV...--------------------------GSGF-LDE
O52942_PHOLP/4-136V------RTL.....VEA.G.H..TVFIET---------QAGI...--------------------------GAGF-ADQ
Q2W3E7_MAGSA/6-142V------EKL.....IKL.G.F..SVVVET---------GAGA...--------------------------LANF-DDE
A0L3P1_MAGSM/4-137V------ETL.....IQH.G.H..AVWVEQ---------QAGL...--------------------------GSGF-ADH
Q0A4X6_ALHEH/6-139L------RQF.....EKL.G.V..ELLMQK---------GAGL...--------------------------ESGF-DDA
O85594_CARST/4-135V------YSL.....TEG.G.H..EVLVEA---------SAGK...--------------------------TAGF-TDA
Q6MKC3_BDEBA/4-137V------RQY.....VSE.G.H..TVIVEK---------DAGV...--------------------------GSGI-SNE
Q2LSK0_SYNAS/44-177V------GTL.....VRA.G.H..KILVQS---------GAGE...--------------------------GSGF-PDD
Q163M5_ROSDO/4-139A------LQL.....QKL.G.H..TCVVES---------GAGH...--------------------------SAGF-SDA
A9CHR5_AGRT5/4-139A------QAL.....QKL.G.Y..DCVIEA---------GAGK...--------------------------AAGF-SDD
Q74AR0_GEOSL/4-135A------AEL.....TRE.G.H..RVLVEA---------GAGE...--------------------------GSGF-ADD
Q3B571_PELLD/35-169A------QIL.....CEN.G.I..RVMVEA---------GAGR...--------------------------FCNF-TDQ
Q9ATP8_ACEAT/79-213V------KML.....VKE.G.F..KVIIES---------EAGF...--------------------------HASF-SDD
A4FW08_METM5/4-137V------EAF.....VLA.G.H..KVYIEK---------DAGL...--------------------------GSAI-TDE
Q6A5I3_PROAC/4-137V------HAL.....VGR.G.H..EVLVQA---------GAGV...--------------------------GSGI-PDS
Q54P64_DICDI/8-138V------EEL.....VKK..GI..KVIVQP---------ST.....--------------------------LRNY-PNV
B4S6Q3_PROA2/35-169A------RIL.....VEN.G.M..RVMIEH---------DAGK...--------------------------ASNL-SDE
Q0ALL0_MARMM/4-137V------KKF.....VAA.G.H..DVAIEK---------GAGL...--------------------------TAAV-TDE
Q2VYN4_MAGSA/13-146V------REL.....VHH.G.H..QVLVET---------GAGA...--------------------------GIGC-SDT
Q1AS10_RUBXD/6-139V------VEL.....VHH.G.H..EVVVQS---------GAGR...--------------------------ISGF-SDE
Q82M72_STRAW/7-141A------RRL.....VES.G.V..RLTVED---------SP.....--------------------------QRIF-PTE
Q7VB57_PROMA/5-141V------KKL.....RSI.G.F..VVSIEK---------GAGS...--------------------------SAGF-LDE
Q1GL71_SILST/4-137A------REA.....IAH.G.H..QVMIQK---------GAGL...--------------------------GAGF-PDE
Q10ZM3_TRIEI/4-136V------KVC.....TEA.G.N..EVFIET---------EAGW...--------------------------GAGF-SDS
A0JVY4_ARTS2/5-137V------GQL.....LGL.G.Y..EVVVEK---------GAGE...--------------------------SASF-RDE
Q15T10_PSEA6/4-137V------KEF.....VVH.G.H..QVLIED---------NAGT...--------------------------AIGF-TNE
A2C801_PROM3/22-158V------KKF.....LSL.G.S..KVAIER---------GAGL...--------------------------AAGF-VDG
Q5FU53_GLUOX/6-140A------EKL.....TPL.G.I..TFAMET---------GAGV...--------------------------ASSY-PDS
A2E4I0_TRIVA/4-138V------QEF.....VAN.G.H..EVYIEH---------NAGL...--------------------------GSGF-PDE
Q0SAT6_RHOSR/4-137V------HEM.....VAH.G.H..DVFVER---------GAGE...--------------------------GSSI-GDD
DHA_BACSU/4-135V------SQL.....ISN.G.H..RVLVET---------GAGL...--------------------------GSGF-ENE
Q1ZX33_PHOAS/4-137V------KEL.....TAY.G.H..HVYIET---------LAGT...--------------------------GVGF-NDQ
Q2YIM6_BRUA2/6-139V------KKF.....IAL.G.F..DVVVEK---------GAGE...--------------------------KSRI-PDA
Q0AGT6_NITEC/4-139V------KKL.....VAK.GLH..TVLVQA---------GAGI...--------------------------NASI-PDS
B9M3R5_GEOSF/4-135A------ADL.....VRD.G.H..VVLVEI---------GAGT...--------------------------GSGF-DDT
Q1ZH92_9GAMM/4-137V------AEL.....ISH.G.H..HVYVQK---------DAGM...--------------------------GIGF-SDS
Q5SLS7_THET8/4-135V------ESL.....VRR.G.H..TVLVER---------GAGE...--------------------------GSGL-SDA
Q6MUG7_MYCMS/10-140V------VEL.....VRN.N.H..EVLVES---------GAGL...--------------------------GSGF-SDL
Q21RZ9_RHOFD/27-163V------EKL.....IKL.G.F..VVAVES---------GAGD...--------------------------AANC-SDE
Q0K0H4_CUPNH/6-146V------REL.....LKL.G.Y..QVVVET---------GAGQ...--------------------------EASF-SDA
Q47FY5_DECAR/6-139S------KKF.....QAL.G.A..NVVLET---------NAGL...--------------------------ESHF-MDS
A1SJK7_NOCSJ/4-137V------HEL.....TAH.G.H..QVYIER---------GAGE...--------------------------GSSI-HDE
Q7UIW1_RHOBA/5-140V------KKL.....IQV.G.F..SVGIES---------GAGL...--------------------------ASGF-PDE
Q5WXY4_LEGPL/4-137V------REI.....IRA.G.S..DVLVEK---------GAGL...--------------------------GIGI-SDD
LYS1_SCHPO/7-142A------KIL.....ADA.G.F..QITIER---------SS.....--------------------------QRAF-KDK
Q064R9_9SYNE/14-145V------REL.....VTH.G.L..EVKIEA---------GAGA...--------------------------GAGI-GDD
Q0AJH3_NITEC/4-136V------HTL.....TER.G.H..RVLVET---------GAGA...--------------------------GSII-SDQ
Q3JEF4_NITOC/4-145A------ERL.....QKL.G.F..SVALES---------GAGL...--------------------------NANF-SDA
A1WCT5_ACISJ/4-136V------KKL.....VAQ.G.H..TVRVQS---------GAGV...--------------------------CASV-TDA
O25948_HELPY/4-135V------ALI.....VQK.G.V..EVLVQN---------SAGA...--------------------------NSGY-SNE
A1C559_ASPCL/85-224V------TLL.....LKK.G.F.SRVLVER---------GAGG...--------------------------QAQI-LDH
Q55F30_DICDI/135-275V------GVL.....VKK.G.Y..KVLVEE---------GAGK...--------------------------GAKF-SDA
Q2G790_NOVAD/8-140V------KKF.....IAL.G.A..TVAIEE---------GAGI...--------------------------TASI-SDE
B0K1G7_THEPX/4-137V------EAF.....IKN.G.H..EVYIEK---------SAGM...--------------------------GSGI-TDE
Q7NWG7_CHRVO/4-137V------REL.....VAN.G.H..KVLVQT---------HAGL...--------------------------AIGF-TDE
Q1GKH6_SILST/5-139A------KAL.....LEA.G.I..RVTVEE---------SS.....--------------------------SRAI-PLQ
Q1GVP3_SPHAL/4-137A------REL.....VVH.G.H..RVLVET---------GAGE...--------------------------GIGA-HDR
A1K465_AZOSB/6-138V------KKY.....LGL.G.A..RVVIES---------GAGV...--------------------------PAHY-RDE
A5FAH7_FLAJ1/4-136L------TKL.....KQSYHEA..SVEVES---------SD.....--------------------------IRIF-SDE
Q16BE6_ROSDO/4-137A------REA.....VSH.G.H..RVLIET---------NAGA...--------------------------GAGF-EDA
A0NPS2_9RHOB/4-137V------VEM.....VAH.G.H..EVVVET---------NAGV...--------------------------GIGA-SDA
Q1V2K5_PELUQ/4-137V------KTL.....ISE.G.H..EVLVEN---------NGGF...--------------------------EAGF-END
Q6KIJ0_MYCMO/4-134V------SDL.....VKN.K.H..EVLIEK---------NAGL...--------------------------EAGF-SDE
Q8EPC2_OCEIH/4-136V------MSL.....KDA.G.H..EIYVQT---------EAGL...--------------------------GSNF-TDE
A8M4N3_SALAI/8-142A------ARL.....VRQ.G.V..SITVEE---------SP.....--------------------------QRVF-PID
Q1ARY0_RUBXD/7-141V------SRL.....VGE.G.F..EVLVET---------GAGW...--------------------------DYNL-.DE
Q6LMW4_PHOPR/33-171V------GQL.....VQA.G.I..KVYVEC---------GAGD...--------------------------GVGF-SDE
A0AZX9_BURCH/4-137A------REL.....TRH.G.H..RVLVQR---------GAGT...--------------------------AIGL-LDD
A5G0H4_ACICJ/5-140I------KKL.....KAL.G.L..DVVIEA---------GAGE...--------------------------RASV-SDA
A5V5I3_SPHWW/4-142V------KKF.....IAL.G.A..ELGVER---------GAGE...--------------------------GASI-ADG
Q7NEB1_GLOVI/4-136V------RAL.....SDQ.G.H..SVAIEA---------RAGE...--------------------------GSGF-TDR
Q60BB4_METCA/4-135V------AAL.....VNA.G.H..EVLVEV---------AAGL...--------------------------GSGF-ADE
A0Z7A7_9GAMM/4-137V------REL.....VNR.G.H..QVLVET---------EGGV...--------------------------GVGF-DNA
A1TXK5_MARAV/4-139V------STL.....LEA.G.Y..EVVVES---------GAGS...--------------------------AAHF-TDD
Q1IIW3_KORVE/4-145V------PNL.....AKA.G.L..EVVIQA---------GAGA...--------------------------DAGY-PDA
Q07600_EIMTE/501-635V------PKL.....RKL.A.F..RVNVES---------GAGA...--------------------------DAGF-TDE
A7HTE3_PARL1/4-137V------REA.....VHH.G.H..EVLVQK---------GAGF...--------------------------GIGL-FDE
Q3APE7_CHLCH/6-140V------QIL.....GEH.G.I..QVIIES---------NAGM...--------------------------YCNF-TDL
Q5P1Y9_AROAE/6-139V------KKY.....LDL.G.A..QVMVES---------GAGQ...--------------------------PAHY-RDE
Q8KEI3_CHLTE/17-148V------RQL.....VGA.G.H..RVVVER---------GAGE...--------------------------ASGF-SDE
Q2S0H0_SALRD/6-141A------DRL.....LATVDDL..DIRVEE---------GAGQ...--------------------------GAYH-TDA
Q1YVY2_PHOPR/4-137V------NEA.....VSH.G.H..TVYVQT---------LAGS...--------------------------GIGF-SDQ
Q1M9L0_RHIL3/4-139A------AHL.....QKL.G.H..TCLIES---------GAGL...--------------------------LAGF-TDE
A8LIC1_DINSH/19-154A------VQL.....QKL.G.Y..ECVIET---------GAGA...--------------------------AAGF-SDE
A0LWI4_ACIC1/4-137V------TRL.....RSA.G.H..TVAVEQ---------GAGE...--------------------------AAGY-PDE
Q8RME8_AMYMD/4-137V------HEL.....AGR.G.H..DVFVET---------GAGV...--------------------------GSSI-TDE
Q21M61_SACD2/4-145V------KKY.....VGM.G.F..EVLVEK---------DAGT...--------------------------ASRY-MDD
Q0KA62_CUPNH/4-137V------REL.....VSR.G.H..QVMVQA---------GAGA...--------------------------ALGL-SDA
A1CKS0_ASPCL/7-145C------KAL.....MDA.G.Y..DVTVER---------ST.....--------------------------QRIF-DGE
A1RDP1_ARTAT/4-136V------HEF.....KAN.G.H..DVLVET---------GAGV...--------------------------GSGI-SDQ
A0LUF0_ACIC1/4-137V------REL.....TDA.G.H..TVLVEH---------DAGA...--------------------------GSAI-PDV
Q4BZ65_CROWT/4-136V------RVL.....CDR.G.H..QVAVET---------QAGI...--------------------------GSGF-SDQ
Q484K1_COLP3/4-137V------SAL.....IKL.G.F..TVQVQK---------GAGT...--------------------------KASF-TDQ
B1KJ86_SHEWM/4-143V------VQL.....KKL.G.F..SVVVQR---------GAGE...--------------------------AANF-KDE
Q1N492_9GAMM/4-139I------QEL.....LNA.G.F..DVIVEQ---------DAGE...--------------------------GAHF-SDE
Q7UXF1_RHOBA/4-137V------AEL.....TQA.G.H..TVLVQA---------GAGL...--------------------------GSGL-PDH
Q6MB39_PARUW/4-136V------RLL.....VDA.G.H..QVFVQS---------LAGD...--------------------------KIGY-NDE
Q2UAA6_ASPOR/84-217V------ALL.....LRK.G.F.SRVLIER---------GAGE...--------------------------AAEL-LDQ
A0DTI6_PARTE/7-138C------KYI.....MEKHPQI..QMVIQP---------ST.....--------------------------KRIF-TDE
A1WZC8_HALHL/6-141L------KQF.....GKL.G.V..ELLLET---------GAGE...--------------------------GAGF-DDA
B2TCQ5_BURPP/4-137V------REL.....TGR.G.H..RVVVEQ---------GAGA...--------------------------AIGL-NDD
Q480P6_COLP3/4-137V------KEL.....SVN.G.H..EVIVEH---------NGGA...--------------------------SIGF-DNE
B8FRW7_DESHD/4-137V------DAL.....VKA.G.H..TCYLEQ---------SAGL...--------------------------GSGF-TDE
Q4P6J5_USTMA/9-143A------KAL.....IDA.G.F..DITVES---------DP.....--------------------------QRIF-DDK
Q8G5Z4_BIFLO/12-147V------TRL.....KRS.G.V..SSLIEA---------GAGI...--------------------------AADY-TDE
O44503_CAEEL/33-163V------KRL.....TKS..GV..NVLIQP---------SN.....--------------------------RRAY-PIQ
A7IGP9_XANP2/4-139V------KRL.....VAL.G.A..SVAVET---------GAGL...--------------------------KSGI-LDA
Q3IZY5_RHOS4/4-137A------REA.....ASH.G.H..EVLVEA---------GAGA...--------------------------GAGF-SDE
Q13HL5_BURXL/6-139A------QKL.....IKL.G.A..RLHMQP---------GAGA...--------------------------AIHL-DDA
Q4SJ60_TETNG/61-200V------QAL.....VKQ.G.F..NVIVEP---------GAGE...--------------------------PSKF-PDE
Q6AA35_PROAC/43-176V------PAL.....LKL.G.Y..EVVVEA---------GAGE...--------------------------HAAQ-PDR
Q16LL0_AEDAE/57-190T------ATL.....VKK.G.F..KVNVES---------GAGF...--------------------------DAKF-RDA
B3E8N4_GEOLS/4-135V------QQL.....RGD.G.H..QILVEQ---------GAGA...--------------------------GSGF-SDE
B2UC87_RALPJ/4-136V------KKY.....VAL.G.H..QVTVQS---------GAGV...--------------------------AAAQ-PDD
A1VG31_DESVV/4-137V------EVL.....CHH.G.H..TVLVEA---------GAGA...--------------------------GSGF-MDE
Q829A4_STRAW/4-137V------HEL.....VRY.G.H..QVFIEQ---------NAGV...--------------------------GSSI-TDD
Q5R0B7_IDILO/4-137V------REY.....VEN.G.H..DVIIEN---------NGGA...--------------------------AIGF-TNE
Q1JX18_DESAC/4-137V------ARL.....TGL.G.H..HVSVEQ---------NAGA...--------------------------GSGI-SDS
A0FL43_LACPA/28-158V------KKL.....VDA.G.A..TVLVEK---------SAGV...--------------------------GAGF-PDA
Q2Y9W7_NITMU/4-139V------KKF.....TAK.GLH..VVLVQS---------GAGA...--------------------------GASI-ADE
A4SFA5_PROVI/35-169V------QIL.....VEN.G.I..KVVVET---------AAGR...--------------------------FCNF-SDT
O68519_MYXXA/4-138A------AAL.....IAA.G.H..TVLIET---------NAGV...--------------------------GSGI-PDS
Q2Y9W3_NITMU/6-138V------KGL.....TRR.G.H..RVLVQS---------GAGE...--------------------------GSFL-SDD
Q2NZT7_XANOM/6-139V------KKL.....VAR.G.A..SVWIEP---------DAGR...--------------------------ASSM-DNA
B3EKT2_CHLPB/35-169V------KIL.....NEN.G.V..RVLIEK---------HAGL...--------------------------ASNF-SDE
A0ZAH3_NODSP/4-137V------RVL.....QEN.G.H..AIFVET---------KAGS...--------------------------GAGF-TDD
Q4SHM6_TETNG/10-149V------EAL.....VKQ.G.F..RVQVES---------GAGE...--------------------------ESKF-SDQ
A4SZU6_POLSQ/4-136V------KKL.....IGQ.G.H..TVVIQK---------DAGV...--------------------------KASQ-PDS
Q0F940_9RHOB/4-139A------LQM.....QKL.G.Y..ECFIEK---------GAGE...--------------------------AARF-SDK
Q0U4J1_PHANO/7-146A------KKL.....LDA.G.Y..PVLVER---------SPKDPNY--------------------------ARIF-KDE
A1B5J9_PARDP/5-139V------REL.....IAQ.G.F..HVTVEE---------SP.....--------------------------HRIL-PIA
Q6F836_ACIAD/4-136V------KKL.....ISA.G.H..HVVIER---------GAGV...--------------------------KAAY-IDS
Q0SGE0_RHOSR/15-145V------ASL.....IAK.G.V..DVVVES---------GAGL...--------------------------GALI-PDE
Q6ANB3_DESPS/4-131I------KTL.....IEA.G.H..TVYLEK---------DAGL...--------------------------LSAA-SNE
Q2SNB3_HAHCH/4-137V------QEL.....IRN.G.H..KVVVQK---------DAGA...--------------------------AIDF-TDD
Q1Z2Q8_PHOPR/4-143V------EQL.....LKM.G.F..SVAIEQ---------NAGV...--------------------------LASF-GDA
A1BEU6_CHLPD/35-169V------QIL.....TEH.G.I..RVVIEQ---------SAGH...--------------------------FCNF-SDI
Q2JLS3_SYNJB/4-136V------RVL.....TEQ.G.H..QVWVET---------QAGQ...--------------------------GAGF-TDE
Q5P3E2_AROAE/4-137V------REV.....VAH.G.H..EVIVER---------DAGR...--------------------------GIGA-GDD
Q01VE2_SOLUE/4-138V------RRL.....CGA.G.H..TVWIES---------GAGD...--------------------------GAMF-KDP
B1JFG2_PSEPW/4-136I------KKL.....IGQ.G.H..QVTVQR---------GAGL...--------------------------NASI-PDS
A0JVR6_ARTS2/4-136V------HEF.....RTH.G.H..TVLVER---------GAGL...--------------------------GSGI-TDE
Q7N4Z3_PHOLL/4-137V------EHL.....LKL.G.F..NVVVES---------GAGH...--------------------------LASF-EDS
Q6NP53_DROME/69-199V------QKL.....VKQ..NV..KVIVQP---------SN.....--------------------------RRAY-PMQ
O04709_MAIZE/19-156C------ARLLLGGGKNG.PRV.NRIIVQP---------ST.....--------------------------RRIH-HDA
Q0FRV1_9RHOB/5-139A------AAL.....IAQ.G.M..RVTVED---------SA.....--------------------------TRII-PTQ
A0AJ28_LISW6/4-136V------FSY.....VNA.G.H..TVYIEK---------GAGI...--------------------------GSNY-QDA
Q0FA42_9RHOB/4-137A------AEA.....TLR.G.H..KVLIQS---------GAGN...--------------------------GSGF-SDS
A8ZX21_DESOH/4-137V------EAF.....VAK.G.H..KIYVET---------GAGA...--------------------------GLGI-SDE
Q46N60_CUPPJ/4-136V------KKY.....VAQ.G.H..KVTVQS---------GAGL...--------------------------RASL-PDG
A1ZCQ3_9BACT/4-136C------QLL.....QKKYPQL..SFAVQS---------SP.....--------------------------IRCI-ADE
Q021N9_SOLUE/6-147I------SVL.....NKT.G.V..ELLMEP---------GAGV...--------------------------QAGF-PDS
Q3IYW2_RHOS4/5-139A------AAL.....IAR.G.L..RVTVEA---------SR.....--------------------------PRAL-SIE
Q3AEB3_CARHZ/4-137V------EAL.....VAA.G.H..KVVIEN---------NAGL...--------------------------GSGI-TNE
A1BEX7_CHLPD/4-135V------RHL.....VNA.G.H..HVAVEK---------GAGE...--------------------------GSGF-SDD
Q48BS0_PSE14/4-136I------KKL.....ISQ.G.H..RITVQS---------GAGI...--------------------------HASV-PDS
A0PWE2_MYCUA/9-139V------GSL.....VNS.G.V..AVVVES---------GAGE...--------------------------RALL-PDD
LYS1_CANAX/9-144T------KQL.....LDA.G.F..EIYVEE---------SS.....--------------------------QSTF-DIK
LYS1_YARLI/8-142T------RKL.....LDA.G.F..EVFVEK---------SP.....--------------------------LRIF-DDQ
Q5SIC7_THET8/4-139V------REL.....VAS.G.H..RVYVER---------GAGE...--------------------------GAGF-PDE
B2TAE0_BURPP/4-137V------AEL.....VRH.G.H..SVAVEK---------SAGE...--------------------------GSGI-ADS
Q1GIS5_SILST/4-139A------KDL.....QKL.G.F..ECCIEA---------GAGE...--------------------------AAGF-TDA
B2JGI7_BURP8/4-136V------KKY.....VSQ.G.H..RVSVQR---------GAGT...--------------------------AASY-LDD
Q1AW21_RUBXD/4-137V------HEL.....CRA.G.H..RVLVES---------GAGV...--------------------------ASGI-SDA
B4SD94_PELPB/35-169V------QIL.....VEQ.G.I..KVIVEK---------SAGN...--------------------------FCNF-TDL
Q16C99_ROSDO/5-139A------RQL.....IAS.G.I..TLTVEQ---------SP.....--------------------------TRVI-PDA
A7NQG5_ROSCS/4-138V------HSL.....VIA.G.H..TVFVES---------GAGA...--------------------------GAGF-TDA
A6WFF9_KINRD/4-137V------HEL.....VGH.G.H..EVLVQA---------GAGL...--------------------------GSSL-PDA
A2C3U2_PROM1/5-141V------KKF.....LDL.G.C..KVFFEK---------GAGK...--------------------------AAGF-LDD
A1B9C0_PARDP/4-139A------AHL.....RKL.G.H..EVYVEA---------GAGV...--------------------------RAGF-SDT
A3QAN8_SHELP/4-140V------TRL.....IKK.N.L..QILVES---------GAGL...--------------------------AAGF-SDQ
Q8XRA9_RALSO/4-136A------KKL.....KAQ.G.H..VLRVQT---------GAGR...--------------------------RASI-PDP
A0LMX7_SYNFM/4-137V------KAY.....CEA.G.H..EVYMQK---------DAGA...--------------------------GSGI-ADA
Q47RB8_THEFY/4-137V------QEL.....VRH.G.H..DVLIER---------DAGV...--------------------------GSAI-SNA
PNTAA_RHORU/4-144V------KKL.....VGL.G.F..EVIVEQ---------GAGV...--------------------------GASI-TDD
B2JLD8_BURP8/4-137V------REI.....VAH.G.H..EVSVET---------GAGA...--------------------------GIGA-SDD
Q128A6_POLSJ/4-137V------REL.....AAA.G.H..RVIVEH---------NAGS...--------------------------GIGA-SDA
Q04WC6_LEPBJ/4-137V------DTL.....KKI.G.A..VVLVEK---------GAGE...--------------------------QSYY-HDE
Q7P1W1_CHRVO/4-138V------KKL.....VAA.G.H..AVTVEQ---------GAGL...--------------------------AAAL-PDA
A0PQF0_MYCUA/4-137V------AAL.....TKR.G.H..EVLIQV---------GAGE...--------------------------GSAI-SDS
A1IRJ4_NEIMA/4-137V------ALL.....GKL.G.F..ETVVES---------GAGL...--------------------------AASL-DDA
Q8KEN6_CHLTE/6-140V------QIL.....VEQ.G.I..RVVVES---------NAGC...--------------------------FCNF-HDQ
Q6SH06_9BACT/4-137V------IEL.....VRH.G.H..EVMVET---------KAGE...--------------------------GAGF-LDA
Q2IJQ2_ANADE/4-137A------RSL.....VAA.G.H..EVLVES---------GAGE...--------------------------RSGF-TDA
A0NM55_9RHOB/8-143A------KQL.....QKL.G.F..TCLVQS---------GAGT...--------------------------AAGF-SDQ
Q0G2B1_9RHIZ/4-137V------REY.....VAH.G.H..ELIIET---------GAGS...--------------------------GIDA-PDL
A4SWM0_POLSQ/4-137V------SGL.....CKQ.G.H..TVLVQR---------GAGE...--------------------------QIGL-SDE
B4SKQ7_STRM5/7-139A------RKL.....GAL.G.V..SVWYEA---------GAGL...--------------------------AAGF-TDA
Q1QDC7_PSYCK/5-139V------KKL.....RKL.G.F..EVVIQS---------GAGQ...--------------------------ASYY-ADE
A0ZDC5_NODSP/19-159V------ARL.....IKQ.G.L..EVSVEA---------GAGE...--------------------------RSYF-SDS
A1VTW8_POLNA/4-136A------KKL.....KAQ.G.H..TIRIQS---------GAGV...--------------------------AASV-PDD
A9BR27_DELAS/4-136V------KKL.....RAQ.G.H..VLRVQA---------GAGV...--------------------------AASV-PDA
Q4BYI1_CROWT/5-144V------ARF.....IKL.G.F..EVLVQS---------GAGL...--------------------------GAHF-DDS
A6VWR5_MARMS/6-139T------AKL.....IKL.G.A..RLHMQS---------GAGD...--------------------------AAKL-SDS
A4XPH7_PSEMY/4-137V------AEL.....AAL.G.H..EVWVEA---------LAGA...--------------------------AIGF-ADQ
Q26D16_FLABB/4-137V------FEL.....TKN.D.H..EVYIQS---------TAGK...--------------------------GSGF-FDK
Q1QT97_CHRSD/4-137V------REL.....AAR.G.H..TVAVQA---------SAGE...--------------------------GAGF-PDA
B0SVI3_CAUSK/5-140V------KKL.....AAA.G.W..SVTVEA---------GAGI...--------------------------AASY-PDA
A1HRL4_9FIRM/4-137V------QTL.....KAH.G.H..TVLIEA---------SAGV...--------------------------GSGF-ADA
Q1WRC5_LACS1/4-135V------ASL.....VHA.G.H..SVIVEK---------GAGI...--------------------------GFGF-PDE
B0T233_CAUSK/4-137V------REY.....VGH.G.H..SVLVQT---------GAGL...--------------------------GAGY-GDD
Q28K30_JANSC/4-138V------SRL.....LAN.G.L..DITVED---------SP.....--------------------------IRVI-PID
Q1KZW0_9BRAD/4-137V------REY.....VAA.G.H..RVMIET---------NAGA...--------------------------GIGA-TDD
B3EDZ5_CHLL2/4-135V------RYL.....VNG.G.H..RVVVEC---------GAGE...--------------------------ESGF-ADD
Q9AIK2_BILWA/4-136V------HAL.....KEA.G.H..TVLVQK---------GAGL...--------------------------GSMI-TDE
A0KWV9_SHESA/4-137V------REL.....TIK.G.H..EVFVET---------NAGT...--------------------------GIGF-SDQ
A0Z8G6_9GAMM/4-139V------KKL.....VRL.G.A..DLAIET---------GAGA...--------------------------GAGF-SDE
Q2CCA0_9RHOB/4-137V------AEL.....VGR.G.H..EVIVET---------SAGA...--------------------------GIGA-EDE
A9VUJ6_BACWK/4-136V------IPF.....VTA.G.H..KVLVET---------NAGV...--------------------------GSGF-RNV
A5V806_SPHWW/4-137V------ADL.....VAA.G.H..AVIVET---------GAGL...--------------------------GIDF-EDR
Q31MS7_SYNE7/28-167L------ARL.....KQLTG.G..TISVQS---------GAGQ...--------------------------PLGL-SDR
Q03RI6_LACBA/4-135V------VSL.....VHA.G.H..QVIVEH---------HAGE...--------------------------GAGY-PDS
B7WZ89_COMTE/27-163V------EKL.....VKL.G.F..SVAIES---------GAGD...--------------------------AANF-SDE
A4J8G7_DESRM/4-137V------QAM.....VNN.G.H..RVFIEH---------NAGV...--------------------------GSGI-ADE
Q5KUA3_GEOKA/4-136V------LSF.....VQA.G.H..TVLIEK---------EAGV...--------------------------GSGF-NDS
Q11IF1_MESSB/4-137V------REY.....MAH.G.H..DVLVET---------GAGA...--------------------------GIGA-DDN
Q0IBP4_SYNS3/5-141L------KKF.....IAL.G.C..SVAVER---------GAGV...--------------------------SSGF-LDE
A1ZGV6_9BACT/4-137V------TEM.....LNH.N.H..TVYIQT---------QAGE...--------------------------GSGF-SDE
P73496_SYNY3/23-158A------QKL.....QKL.G.F..DLLLET---------GAGA...--------------------------KADF-ADR
A1V078_BURMS/79-211V------RKY.....AAA.G.H..RVTVER---------GAGA...--------------------------GASF-PDD
Q15PN0_PSEA6/5-140V------KAY.....KLL.G.A..DVLIES---------GLGQ...--------------------------HINV-TDN
Q7VV14_BORPE/4-136V------KKY.....IGG.K.H..SVIVER---------GAGV...--------------------------AAHY-PDS
Q12QQ7_SHEDO/4-145I------KQL.....SKL.G.F..DLVVQA---------GAGQ...--------------------------LSSF-DDA
A7HUT9_PARL1/4-139V------KKL.....SAL.G.I..DIVVET---------GAGE...--------------------------HASI-ADA
Q2CKD5_9RHOB/4-138A------ARL.....IAG.G.V..QVSVER---------SA.....--------------------------TRVI-ADA
Q03HP9_PEDPA/4-134V------QKM.....VEA.G.N..EVLVER---------DAGI...--------------------------GAGF-SNE
A2BXK8_PROM5/5-141V------KKL.....KSL.G.C..EVFVES---------SAGE...--------------------------LSGF-NDT
A0YVL7_LYNSP/4-136V------RVC.....TER.G.H..RIFVQT---------AAGV...--------------------------GAGF-TDE
Q3A7G8_PELCD/26-159V------RAL.....TED.G.H..TVLVER---------EAGI...--------------------------GSGL-SDE
Q5DZZ0_VIBF1/4-143V------EQL.....IKL.G.F..TVAVES---------NAGI...--------------------------LASF-DDS
Q01VQ6_SOLUE/4-137V------TAL.....REA.G.H..EVLVET---------HAGE...--------------------------GSSL-PDS
DHA_LYSSH/4-137V------VSL.....THA.G.H.ERLAIET---------GGGI...--------------------------GSSF-TDA
Q7VA67_PROMA/14-145V------KEL.....VTQ.G.L..EVRVQT---------DAGK...--------------------------GLGI-EDQ
Q10VQ6_TRIEI/4-139I------AKL.....VKQ.G.L..EIQVEA---------GAGE...--------------------------KSFF-FDR
A0M2A6_GRAFK/33-166V------AAI.....TAH.G.H..RVMIES---------GAGK...--------------------------WARF-SDK
C1DKG5_AZOVD/4-137V------AEL.....SAL.G.H..EVWVES---------RAGA...--------------------------AIGF-ADP
A8H092_SHEPA/19-156V------TRL.....LKI.N.L..QVLVES---------GAGS...--------------------------NAGF-TDE
Q0FFN0_9RHOB/5-137V------KSL.....LQA.G.F..DVTIER---------DT.....--------------------------TRAI-SIE
A1A1C3_BIFAA/12-147V------TRL.....RKS.G.V..TCLIES---------GAGV...--------------------------ASHY-VDE
Q11SC0_CYTH3/13-146V------ALI.....VNN.G.H..IVQVET---------GAGL...--------------------------NAKF-SDR
DHA1_STAAM/4-134V------RKL.....TDA.G.H..KVIVEK---------NAGI...--------------------------GSGF-SND
A8LLI3_DINSH/4-137A------AEA.....VAH.G.H..AVLVQA---------GAGV...--------------------------GSGF-EDA
Q3AI65_SYNSC/8-144V------KKF.....ISL.G.C..SVAVEH---------GAGT...--------------------------PSGY-LNE
Q11EJ3_MESSB/6-139A------KRL.....SGL.G.F..TVIVER---------GAGL...--------------------------ASRI-TDE

PF05221

SAHH_RHOCB/2-462DDGGDATLYILLGARVEAGETDLIATPTSE.....EEVCLFNQIKKRMVESPGWFTQQRAAIKGVSEETTTGVHRLYDLH
SAHH_YEAST/6-448DDGGDLTTLVHE.........................................KHPEMLEDCFGLSEETTTGVHHLYRMV
SAHH_CATRO/12-484DDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTIIRDGLKSDPTKYTRMKERLVGVSEETTTGVKRLYQMQ
SAHH2_DROME/66-491DDGGDATHLMLK.........................................KYPDYFKAIRGIVEESVTGVHRLYMLS
SAHH_LEIDO/2-436DDGGDLTNLVID.........................................HHPELVPKIFGISEETTTGVKNLYKRL
SAHH_TRIVA/11-485DDGGDATLLISKGFEFETAGAVPEPTEADN....LEYRCVLATLKQVFNQDKNHWHTVAAGMNGVSEETTTGVHRLYQLE
SAHH_CAEEL/6-436DDGGDLTNLVHA.........................................KYPQYLAGIRGLSEETTTGVHNLAKML
SAHH_PLAF7/4-478DDGGDATLLVHKGVEYEKLYEEKNILPDPEKAKNEEERCFLTLLKNSILKNPKKWTNIAKKIIGVSEETTTGVLRLKKMD
SAHH_MOUSE/5-431DDGGDLTNLIHT.........................................KYPQLLSGIRGISEETTTGVHNLYKMM

PF00389

Q9JY94_NEIMB/3-329ESVAEHTVGLML-------------------------------------------------------TLNRRIHKAYQRT
O30440_BORPT/4-317RSVAELVLGETI-------------------------------------------------------LLLRRIPEKNARV
SERA_ARATH/85-394VAAAEHGIALLA-------------------------------------------------------SMARNVAQADASI
Q9RUU0_DEIRA/18-329VSAAELAVMHLM-------------------------------------------------------AAARGLTRSDRKT
Q98F95_RHILO/5-315ITTAEHAVAMIF-------------------------------------------------------ALARQIPEANAST
Q99R78_STAAM/6-332NSIAEFAVNQAI-------------------------------------------------------NVVRHFNQIQTKV
E9ACF1_LEIMA/115-427RSVAELVIGEII-------------------------------------------------------SLSRKMTQRSEEV
Q9KEA4_BACHD/2-311IPMAEYTLSMML-------------------------------------------------------QVARNAKRLISLE
O28495_ARCFU/4-322LSVAEHTVMFAL-------------------------------------------------------ALLRRLIYAHNSV
Q9KLW1_VIBCH/3-321.APAELCWGLIL-------------------------------------------------------AASRHLPSYIEQL
Q9CKF1_PASMU/14-327RSVAELVLGEIL-------------------------------------------------------LLMRNVPQANAEV
SERA_SHIFL/13-326RSVAELVIGELL-------------------------------------------------------LLLRGVPEANAKA
SERA_ARCFU/3-312ISTAEHAIALML-------------------------------------------------------AAARKIPQADRSV
O58256_PYRHO/5-318EAVAEFTVGLII-------------------------------------------------------NLMRKIHYADKFI
Q9X4A4_STAAU/4-319ETTAELGFTLML-------------------------------------------------------AIARRIVEAEKYV
Q99T17_STAAM/2-311KQLSEYILAFIL-------------------------------------------------------DDYKKMKLSYDNQ
CTBP_DROME/30-352EEVADTTMCLIL-------------------------------------------------------NLYRRTYWLANMV
Q9VKI8_DROME/8-324ISACELTCILIG-------------------------------------------------------SLARPVVPAGQSM
Q97IU7_CLOAB/3-326RSVADYTVMMIL-------------------------------------------------------MATRKVKAIMQNS
GHRB_ECO57/5-319ETVADTLMALVL-------------------------------------------------------STARRVVEVAERV
YEAA_SCHPO/9-327DATADVGIFLML-------------------------------------------------------GALRGFNQGIFEL
LDHD_LEUMC/3-330NAIAEHSMLQLS-------------------------------------------------------RLLRRTKALDAKI
Q9KP92_VIBCH/13-326RSVAELVLGEIL-------------------------------------------------------LLLRGIPEKNALA
Q9I1L0_PSEAE/4-318ETTADTGFALIL-------------------------------------------------------ATARRVVELAGWV
Q98BH4_RHILO/9-329EDTADMTMALML-------------------------------------------------------AVPRRLAEGANVL
P74586_SYNY3/3-330HAVAEHTVGLIL-------------------------------------------------------ALNRKLYRAYNRV
Y2305_STAAM/4-317NATADLTIGLVL-------------------------------------------------------AVARRIVEGDQLS
Q59463_HYPME/6-322VATAEIAMLLLL-------------------------------------------------------GSARRAGEGEKMI
DDH_ZYMMO/3-331YSVAEYAVGMLL-------------------------------------------------------TLNRQISRGLKRV
TKRA_BACSU/6-322DTVADLAFSLIL-------------------------------------------------------SSARRVAELDRFV
Q9ZKF4_HELPJ/4-314IAAVELTMAHLI-------------------------------------------------------NAVRSFPCANDQI
Q9A244_CAUCR/24-340EDTADLTMTLIM-------------------------------------------------------AASRRIVEGAEVV
SERA_SCHPO/58-378RSVAELVIGYII-------------------------------------------------------SLARQVGDRSLEL
GYAR_THELI/5-322DATADLAFALLL-------------------------------------------------------AVARRIVEADAFV
Q98LH4_RHILO/9-326FTVSEHAVALML-------------------------------------------------------AVAKQLGTWTPEF
Q9BLF6_OCTVU/5-323DCVSEFAVTLAL-------------------------------------------------------AVSRRIEEGIAAV
Q99TE0_STAAM/6-315ISATEHSLAMLL-------------------------------------------------------SMARNIPQAHQSL
Q9S2M5_STRCO/3-328HSVAEFAWALAM-------------------------------------------------------AVNRRIVRASIRT
SERA_METJA/4-312ISVAELTMGLML-------------------------------------------------------AAARNIPQATASL
PTXD_PSEST/5-326VPTAELAIGLAV-------------------------------------------------------GLGRHLRAADAFV
LDHD_STRP1/3-330ESIAEFTVTIVL-------------------------------------------------------NLIRHVELIRENV
Q9LE33_ARATH/9-321DDVADCAVGLLI-------------------------------------------------------SVLRRIPAADRYV
Q9HXB7_PSEAE/5-318ETTADLGFALLI-------------------------------------------------------SAARRVAELDAWV
O67741_AQUAE/4-320IGATELTMMHML-------------------------------------------------------TIMRNGHKAHESM
SERA_METTH/6-313ITVAEHSIGLML-------------------------------------------------------ALARKIAIADRSV
LDHD_PEDAC/3-329RAIAELSVTQLL-------------------------------------------------------ALLRKIPEFEYKM
Q9UYH9_PYRAB/5-318EAVAEFALGLLI-------------------------------------------------------SLMRKIHYADSFI
DDH2_SCHPO/3-330FAVSEFTVGLLL-------------------------------------------------------SLNRKIHRAYVRV
Q9CA90_ARATH/6-313EDVADLAIGLIL-------------------------------------------------------ALLRRLCECDRYV
Q48534_9LACO/4-332RAIAEMTVTQAM-------------------------------------------------------YLLRKIGEFRYRM
LDHD_ECOLI/3-329EAVAEHAIGMMM-------------------------------------------------------TLNRRIHRAYQRT
SERA_RAT/9-317LSAAELTCGMLM-------------------------------------------------------CLARQIPQATASM
Q9A6E7_CAUCR/11-318ADVADHAVGLVL-------------------------------------------------------AAWRGIVEGDQRL
Q9HMR0_HALSA/3-311RAAAEHTVALAF-------------------------------------------------------AAARSIPQAHARL
Q9WYG2_THEMA/4-311LSVAELTIAFIF-------------------------------------------------------ALSRGLVWAHNKL
CTBP2_RAT/36-358EETADSTVCHIL-------------------------------------------------------NLYRRNTWLYQAL
Q9PBD8_XYLFA/15-328RSVAELIIAEAI-------------------------------------------------------LLLRGIPQKNAEC
Q89388_PBCV1/32-362RSVAELALTHMM-------------------------------------------------------ALSRNIQLVLPRV
LDHD_TREPA/3-330NAIGEYALAAAL-------------------------------------------------------QLTRHAREIETFV
Q97MV2_CLOAB/3-317ESVTELTFGLVF-------------------------------------------------------SVLRNIVPLDKVT
Q97U35_SULSO/2-295LSVAEHAWALIL-------------------------------------------------------ASAKGVGTKKRTI
Q9A3I9_CAUCR/6-314ITTAEHAIAMMF-------------------------------------------------------ALARQIPAADVST
Q9RKF9_STRCO/17-329EAVSDHAIGLAL-------------------------------------------------------SVARGIPRLDRGV
Q9RNB7_MICAE/18-330TAVAEHTLSMIL-------------------------------------------------------ALAKKLPFLDHCV
LDHD_STAAU/4-330ETIAEYSVSIAL-------------------------------------------------------QLVRRFPDIERRV
Q9LT69_ARATH/49-358VAAAEHGIALLT-------------------------------------------------------AMARNIAQADASI
GYAR_AERPE/6-324EATAEFTWALIL-------------------------------------------------------AAARRVVEADHFV
DDH_HAEIN/3-329EAVAEHTIGLMM-------------------------------------------------------TLNRRIHRAYQRT
O17626_CAEEL/8-316RSAAELTCTLIL-------------------------------------------------------SLSRHVPQAAASM
PDXB_PSEAE/3-285RGVVDYVLGCLL-------------------------------------------------------AMAEVRGADLAER
SERA_YEAST/61-381RSVAELVIAEII-------------------------------------------------------SLARQLGDRSIEL
YGDH_SCHPO/9-332EGTANMNLMLFM-------------------------------------------------------CTLRGAREAEQSL
Q20595_CAEEL/181-504EDVADSTLSLIL-------------------------------------------------------DLFRRTYWHAKSY
DHD2_LACPA/3-329AAIAEFALTDTL-------------------------------------------------------YLLRNMGKVQAQL
Q9KCG9_BACHD/20-325ISTAEHTFAMIC-------------------------------------------------------SLLRKIPQANASI
SERA_MYCLE/6-313HSAAEHALALLL-------------------------------------------------------AASRQIAEADASL
Q9I530_PSEAE/3-328HAVAEHAVGLIL-------------------------------------------------------TLNRRLHRAYNRT
Q9VII9_DROME/10-326NAVADLAIGLMI-------------------------------------------------------AAGRHFHAGRTEI
O66939_AQUAE/3-332ESVAEHTFAMIL-------------------------------------------------------TLVKRLKRIEDRV
Q9HVG5_PSEAE/7-321PSVAQHTLALLL-------------------------------------------------------ALATRLPDYQQAV
GHRB_ENTAG/5-318ETVADTMMALVL-------------------------------------------------------SSARRVVEVAERV
Q98CG2_RHILO/11-318EEVADTAIGLLI-------------------------------------------------------NTIRDLPRAENWL
GRHPR_HUMAN/9-327DTTAELAVSLLL-------------------------------------------------------TTCRRLPEAIEEV
Q9KMX4_VIBCH/4-330EAVAEHTVGMML-------------------------------------------------------CLNRRFHKAYQRT
Q9K7P7_BACHD/3-318EATADLTFALLM-------------------------------------------------------ATGRRLRESIDYV
Q9I6H5_PSEAE/13-326RSVAELVLAEAI-------------------------------------------------------LLLRGIPEKNASC
Q9HK29_THEAC/3-309DSVAEHALSMVL-------------------------------------------------------SLIKDQRFLDAEI
Q9ZH60_LACJH/4-331DAIAEHAAIQAA-------------------------------------------------------RVLRQDKRMDEKM
Q98GE4_RHILO/8-315RSVAEHVMFTAL-------------------------------------------------------ALLRQFRRVDRDL
DDH1_SCHPO/3-330YAVAEYTIGLLL-------------------------------------------------------SLNRKIHRAYVRV
PDXB_VIBCH/3-286VGVAEYVFSVLM-------------------------------------------------------VLAQQQGFSVFDK
DHGY_METEA/5-313NTVPEHVVGLMF-------------------------------------------------------ALRRAIVPYANSV
Q97ZK1_SULSO/20-326DSAAELTIGLLI-------------------------------------------------------AAARKLYDSMNMA
GYAR_PYRAB/6-323DATADLAFALLL-------------------------------------------------------ATARHLVKGDKFT
Q97F10_CLOAB/3-323SSVVQMSMALIL-------------------------------------------------------EICGHVGQHNASV
Q9Z564_STRCO/7-314VTAAELACGLIV-------------------------------------------------------ATARNIPQANAAL
LDHD_LACPE/3-330NAIAELSVTQLM-------------------------------------------------------QLLRQTPMFNKKL
SERA_SYNY3/32-339IAAAEHALAMMM-------------------------------------------------------ALARHIPDANKSV

PF05222

NNTM_BOVIN/60-199HYRAA...GAQI-------------------------------------------------------QG.AK..E.....
Q7RV12_NEUCR/59-195AYATA...GATL-------------------------------------------------------VE..SASD.....
Q3F038_BACTI/7-137EYTGA...GANL-------------------------------------------------------VA.QG..E.....
Q0VPX1_ALCBS/24-165AYEAA...GSKL-------------------------------------------------------VD.RD..E.....
Q3J1C2_RHOS4/4-139AYAAA...GVEV-------------------------------------------------------LP.SA.AA.....
Q0EZS3_9PROT/4-136EYTDA...GAMI-------------------------------------------------------VA.SA.AD.....
Q0G0B3_9RHIZ/4-136AFEEA...GAKI-------------------------------------------------------GD.DK........
LYS1_ASHGO/6-141EYAAA...GAEV-------------------------------------------------------VATGSW.R.....
Q28V87_JANSC/4-137DYTAA...GAEI-------------------------------------------------------AA.TA.KD.....
Q24813_ENTHI/568-702DYRSV...GCRI-------------------------------------------------------AE.TT.EE.....
Q2G7Q1_NOVAD/4-137DYEGA...GAII-------------------------------------------------------KA.DA.RT.....
Q6AQV0_DESPS/4-137EYVAA...GATI-------------------------------------------------------ID.AA.AD.....
Q82QU1_STRAW/15-145AYADA...GAGI-------------------------------------------------------GE...........
Q3B540_PELLD/4-135KYRRA...GAMV-------------------------------------------------------SA.SA.DK.....
DHA_OCEIH/4-136EYKEA...GAEL-------------------------------------------------------ID.SA.AS.....
Q0S884_RHOSR/4-137DFKAA...GAQI-------------------------------------------------------LQ.AA.DQ.....
A0KQF4_AERHH/4-135AFEAA...GASV-------------------------------------------------------VP.....S.....
Q9KAF8_BACHD/4-136DYGEA...GATI-------------------------------------------------------EN.DA.AS.....
A6VXM0_MARMS/6-147TYKEV...GVEI-------------------------------------------------------TQ.DT.KK.....
Q3JE74_NITOC/4-136AYQAA...GVTL-------------------------------------------------------LP.DA.RS.....
B1YFJ0_EXIS2/4-136EYTQA...GAQI-------------------------------------------------------IE.TA.AE.....
A0YCU2_9GAMM/4-139DYEQA...GAKI-------------------------------------------------------IS.DR.TA.....
Q39LR8_BURS3/6-135DYRTA...DADV-------------------------------------------------------VP.KA.AD.....
A5GEE8_GEOUR/4-135CYLKS...GGRV-------------------------------------------------------VA.RE..E.....
A5FP13_FLAJ1/4-137EYAEA...GAVV-------------------------------------------------------LP.TI.EE.....
Q98CE6_RHILO/6-139EFAKA...GAVI-------------------------------------------------------SK.AA........
Q31MC9_SYNE7/4-136DYLLA...GAKV-------------------------------------------------------VA.TA.TE.....
Q6NYQ7_DANRE/56-195MYTKA...GATI-------------------------------------------------------RD.VK..D.....
Q1MBQ8_RHIL3/6-139EFEAA...GARI-------------------------------------------------------GS.FA........
Q5KHJ2_CRYNJ/22-157EFEAV...GCKI-------------------------------------------------------VPHNTW.P.....
A4TCI0_MYCGI/4-137DFKRA...GAQL-------------------------------------------------------IT.GA.DE.....
Q8GRT6_GOSHI/8-144LYEDV...GCHI-------------------------------------------------------S......D.....
Q2IDX0_ANADE/4-138AYAAA...GAQV-------------------------------------------------------GD.AG..A.....
Q21L93_SACD2/6-141KYKQD...NVTL-------------------------------------------------------VE.SA.AD.....
A0QNT0_MYCS2/5-135DYERA...GATI-------------------------------------------------------GD...........
Q1GUI4_SPHAL/4-138DYGAA...GASV-------------------------------------------------------.G.SR.AE.....
DHA_GEOSE/4-137EYEKA...GAAD-------------------------------------------------------RC.RTWRD.....
Q0AQT6_MARMM/4-137DYIAA...GASI-------------------------------------------------------MP.DA.AA.....
Q1YKG9_MOBAS/4-137AFEAA...GATI-------------------------------------------------------GS.TA........
A6UD59_SINMW/6-139DYEKA...GARI-------------------------------------------------------GK.AT........
Q18031_CAEEL/32-165EYVRS...GADV-------------------------------------------------------GK.HN..E.....
Q063W8_9SYNE/14-150AYSEQ...GAAL-------------------------------------------------------VA.VGDAS.....
Q1V607_VIBAL/4-137DYIAV...GASI-------------------------------------------------------LP.HA.AD.....
Q47E46_DECAR/4-137LYAGA...GAEL-------------------------------------------------------VD.TA.DE.....
Q39WN5_GEOMG/4-135EYLRV...GARV-------------------------------------------------------CG.RE..E.....
Q1YRC4_9GAMM/4-137EYRAA...GAEM-------------------------------------------------------VA.SA.AD.....
Q3SL22_THIDA/4-136AYRAA...GATV-------------------------------------------------------VP.DA.AG.....
Q6W1Y1_RHISN/6-139EFEKA...GARI-------------------------------------------------------GS.AA........
A1RCI4_ARTAT/4-137EYAAA...GAKI-------------------------------------------------------LD.SA.DD.....
Q67ND6_SYMTH/4-137EYVAA...GARI-------------------------------------------------------LP.SN.ED.....
Q5SLT7_THET8/5-139AYQEA...GAEV-------------------------------------------------------VE.RG..E.....
A0KEW0_AERHH/4-137EYQAA...GAEL-------------------------------------------------------VA.SA.AE.....
Q47BC9_DECAR/6-139DYT.....DIDF-------------------------------------------------------LP.GP.SE.....
A1ZZD6_9BACT/38-171QYSEA...GAEV-------------------------------------------------------CY.SA.KE.....
Q8DL05_THEEB/4-139DYRAA...GAEI-------------------------------------------------------GY.SI.EE.....
Q28M63_JANSC/4-139AYKEA...GVEV-------------------------------------------------------VK.TG.AA.....
Q2RN15_RHORT/4-137DYIKA...GATI-------------------------------------------------------AA.TA.AE.....
Q1VSD8_9FLAO/34-167DYSEA...GGEI-------------------------------------------------------IK.ST.QK.....
Q0C3J7_HYPNA/4-137TYTAI...GAAI-------------------------------------------------------LP.DA.EA.....
Q2S445_SALRD/35-169EYVDA...GAEL-------------------------------------------------------VS.AP.DD.....
A0R9N0_BACAH/4-136QYVEA...GAKI-------------------------------------------------------VD.TA.EE.....
Q07J60_RHOP5/4-136EFTAA...GATV-------------------------------------------------------SA.DA........
A1SSF5_PSYIN/4-138AYQNS...GAEI-------------------------------------------------------GT.DK..N.....
Q5Z133_NOCFA/18-148AYVEA...GAVI-------------------------------------------------------GD...........
Q5WJZ9_BACSK/4-136EYEKA...GAII-------------------------------------------------------EK.NA.KD.....
A2C6Y0_PROM3/14-145AFADA...GAKL-------------------------------------------------------VN.R..EE.....
A0L9H7_MAGSM/4-145AYREA...GAEI-------------------------------------------------------VA.DA.KT.....
Q1Z6I5_PHOPR/6-140EYLAA...GCEL-------------------------------------------------------VEGHSW.V.....
Q6W1J9_RHISN/4-139AYRAA...GVKV-------------------------------------------------------VE.DP.SA.....
PNTA_HAEIN/4-137AFLEA...GAKI-------------------------------------------------------GT.SA..E.....
Q6AEY9_LEIXX/4-137FYAAS...GATL-------------------------------------------------------LP.DA.AA.....
Q6ACH0_LEIXX/6-139TFRAA...GARI-------------------------------------------------------GS.A...D.....
Q1YRM2_9GAMM/4-145LYTEA...GATI-------------------------------------------------------SA.DR.AE.....
Q0FNJ6_9RHOB/4-137DYVAA...GATI-------------------------------------------------------VD.TA.RE.....
Q1VPH7_9FLAO/4-137DYIEA...GAEI-------------------------------------------------------LS.SL.DA.....
Q1NA78_9SPHN/23-156LYVKA...GAEI-------------------------------------------------------IA.TA.AE.....
A8GEZ6_SERP5/4-137AYEAA...GATI-------------------------------------------------------TD.TA..D.....
Q5LFH6_BACFN/4-137AYTAV...GAQI-------------------------------------------------------LP.TM.EE.....
A5FFU7_FLAJ1/32-165EYSDA...GAEI-------------------------------------------------------TK.DT.KR.....
A0K2E1_ARTS2/12-145AYVRA...GARV-------------------------------------------------------VP.VL........
A0QNN8_MYCS2/4-137AYADA...GAQI-------------------------------------------------------GS.AD..A.....
Q5YZC0_NOCFA/4-137AYRAA...GARV-------------------------------------------------------VA.EA.DE.....
P72775_SYNY3/4-136AYAKA...GAEL-------------------------------------------------------VA.TA.KE.....
Q603N5_METCA/4-139AFREA...GVAV-------------------------------------------------------VE.NA.AE.....
Q2N774_ERYLH/4-137EYRAA...GATI-------------------------------------------------------VD.GP.DP.....
Q26EF0_FLABB/32-165QYNEA...GAEL-------------------------------------------------------TS.DR.NK.....
Q1J0B1_DEIGD/4-135EYEAA...GA.V-------------------------------------------------------LG.TA.AE.....
Q472Z0_CUPPJ/4-137SYKLA...GAQL-------------------------------------------------------AG.DA.EE.....
Q2HFZ2_CHAGB/7-141EFEAA...GATL-------------------------------------------------------VPEYSW.V.....
LYS1_YEAST/7-142EYRQA...GAII-------------------------------------------------------VPAGSW.K.....
Q3UEQ9_MOUSE/27-157EYVRA...GGIL-------------------------------------------------------Q......E.....
Q4SE54_TETNG/23-153FYERA...GAIV-------------------------------------------------------Q......E.....
Q5LPM8_SILPO/4-139LYEAA...GVEI-------------------------------------------------------IK.TA.AA.....
A2BS45_PROMS/5-141SYEES...GGTI-------------------------------------------------------IN.NLDQK.....
Q65CX6_BACLD/4-136DYKAA...GADI-------------------------------------------------------LA.EA.KD.....
Q1QUL9_CHRSD/4-139AYRDA...GVEI-------------------------------------------------------VE.GA.DA.....
Q05XL4_9SYNE/7-143AYTEA...GAEL-------------------------------------------------------VS.VADAQ.....
Q2J8T8_FRASC/7-142AYAEA...GATV-------------------------------------------------------VA.RL..D.....
A8LYT6_SALAI/4-137DFAAA...GATI-------------------------------------------------------LT.TA.DQ.....
Q1NHV8_9SPHN/4-138DYAAA...GATV-------------------------------------------------------.A.DR.AA.....
A4Y0R2_PSEMY/4-136AYETA...GATI-------------------------------------------------------GN.DS.AA.....
Q11TK3_CYTH3/4-137QYTHA...GATV-------------------------------------------------------FE.HA.AD.....
A0CWD3_PARTE/29-161VYQEV...GAKV-------------------------------------------------------VD.TN..S.....
Q1MXV6_9GAMM/4-137QYESA...GAKI-------------------------------------------------------LD.SA.EA.....
Q2BRI8_9GAMM/4-137EYQTS...GAEI-------------------------------------------------------VE.TA.GE.....
Q2SHR3_HAHCH/4-137MYEEV...GAKI-------------------------------------------------------VT.RE..E.....
A6VN40_ACTSZ/4-137AFTAA...GTSV-------------------------------------------------------GS.QQ..D.....
A8ZXI3_DESOH/4-137LYRKA...GARI-------------------------------------------------------ID.TA.AD.....
A5FVY5_ACICJ/4-137AYVRA...GAAI-------------------------------------------------------AA.DA.AT.....
B2TEW7_BURPP/4-136AYEAV...GARI-------------------------------------------------------GT.AS.EA.....
Q0YPX1_9CHLB/28-159KYRRA...GAQL-------------------------------------------------------TA.ST.EK.....
Q8DQ43_STRR6/4-136DYQKQ...GAEI-------------------------------------------------------VA.TA.GE.....
Q9K827_BACHD/4-136QFVIA...GAKI-------------------------------------------------------VD.TA.DE.....
Q5CI32_CRYHO/405-540KYENA...SCTI-------------------------------------------------------MA.TR.QD.....
A6U2H6_STAA2/4-136DYKEA...GAEI-------------------------------------------------------VA.EQ.AK.....
A1EQT6_VIBCL/4-137AYTAA...GATI-------------------------------------------------------GS.RE..E.....
Q0SD61_RHOSR/4-134AYAGA...GAEL-------------------------------------------------------RDPLA........
Q11PQ8_CYTH3/7-139EYVSA...GIPI-------------------------------------------------------R......E.....
Q2NSW2_SODGM/4-137AFVAA...GATL-------------------------------------------------------TT.TS..E.....
Q8DH53_THEEB/4-139AYVAA...GAQI-------------------------------------------------------VP.TA.QA.....
O52942_PHOLP/4-136DYVQA...GAQV-------------------------------------------------------VP.SA.KD.....
Q2W3E7_MAGSA/6-142SYVAA...GATI-------------------------------------------------------AK.SA.AE.....
A0L3P1_MAGSM/4-137HYTER...GAQL-------------------------------------------------------CP.TA.AQ.....
Q0A4X6_ALHEH/6-139DYK.....GVTL-------------------------------------------------------VD.SE.EE.....
O85594_CARST/4-135EFEES...GAKI-------------------------------------------------------VN.NA.DD.....
Q6MKC3_BDEBA/4-137QYEKA...GAKI-------------------------------------------------------ID.TK.KE.....
Q2LSK0_SYNAS/44-177EYRSS...GAIL-------------------------------------------------------FP.EA.AD.....
Q163M5_ROSDO/4-139DYEAA...GVEV-------------------------------------------------------VK.TP.AA.....
A9CHR5_AGRT5/4-139AYRAA...GVTV-------------------------------------------------------VD.SA.DA.....
Q74AR0_GEOSL/4-135DFLRS...GARV-------------------------------------------------------VG.RD..N.....
Q3B571_PELLD/35-169DYAEA...GAQI-------------------------------------------------------AE.TP.EE.....
Q9ATP8_ACEAT/79-213MYRDA...GADI-------------------------------------------------------LD.GD..T.....
A4FW08_METM5/4-137EYLAA...GAEI-------------------------------------------------------LK.TA.KE.....
Q6A5I3_PROAC/4-137DFVGA...GARV-------------------------------------------------------VG.DV.ES.....
Q54P64_DICDI/8-138LYEKA...GAII-------------------------------------------------------Q......E.....
B4S6Q3_PROA2/35-169DYSDA...GCTI-------------------------------------------------------TD.SL.EK.....
Q0ALL0_MARMM/4-137AFADA...GAKI-------------------------------------------------------GT.AA..A.....
Q2VYN4_MAGSA/13-146AYRAA...GAEI-------------------------------------------------------AA.DA.AE.....
Q1AS10_RUBXD/6-139EYERA...GARV-------------------------------------------------------VG.SA.RE.....
Q82M72_STRAW/7-141AYEAV...GCEI-------------------------------------------------------AEAGSW.V.....
Q7VB57_PROMA/5-141SYLNV...GAGI-------------------------------------------------------FS.EEDGD.....
Q1GL71_SILST/4-137DYLAA...GAAI-------------------------------------------------------ID.TA.EE.....
Q10ZM3_TRIEI/4-136DYLNA...GGHI-------------------------------------------------------LS.DT.RD.....
A0JVY4_ARTS2/5-137AYEAA...GALI-------------------------------------------------------VG.AD.D......
Q15T10_PSEA6/4-137EFIAA...GAEI-------------------------------------------------------VP.DA.AT.....
A2C801_PROM3/22-158DFNTI...GAEL-------------------------------------------------------VA.PGDSQ.....
Q5FU53_GLUOX/6-140AYK.....DVTF-------------------------------------------------------SP.DR.NA.....
A2E4I0_TRIVA/4-138IYVSV...GAKI-------------------------------------------------------LQ.TA.KE.....
Q0SAT6_RHOSR/4-137AYGAA...GAKI-------------------------------------------------------LD.SA.DA.....
DHA_BACSU/4-135AYESA...GAEI-------------------------------------------------------IA.DP.KQ.....
Q1ZX33_PHOAS/4-137DYIDA...GGFI-------------------------------------------------------SP.TA.EH.....
Q2YIM6_BRUA2/6-139EFAAA...GARI-------------------------------------------------------GT.AV........
Q0AGT6_NITEC/4-139AYQEA...GAVI-------------------------------------------------------VS.GA.SQ.....
B9M3R5_GEOSF/4-135MYLQA...GAEV-------------------------------------------------------CG.RE..D.....
Q1ZH92_9GAMM/4-137DYTNI...GAEI-------------------------------------------------------LD.NA.PD.....
Q5SLS7_THET8/4-135EYARA...GAEL-------------------------------------------------------VG.R..EE.....
Q6MUG7_MYCMS/10-140EYEKA...GAKI-------------------------------------------------------TK.NV.ED.....
Q21RZ9_RHOFD/27-163VYRAA...GAEV-------------------------------------------------------IT.GA.AA.....
Q0K0H4_CUPNH/6-146DYSAA...GAAI-------------------------------------------------------VD.AA..S.....
Q47FY5_DECAR/6-139GFE.....GVKV-------------------------------------------------------AQ.QL.AE.....
A1SJK7_NOCSJ/4-137EYAAA...GAQI-------------------------------------------------------VP.DA.DS.....
Q7UIW1_RHOBA/5-140AYTDV...GAAV-------------------------------------------------------QV.DR.AT.....
Q5WXY4_LEGPL/4-137DYRNA...GAEV-------------------------------------------------------VD.TA.DD.....
LYS1_SCHPO/7-142EFERL...GFPM-------------------------------------------------------VPEGSW.R.....
Q064R9_9SYNE/14-145AFRKA...GAQL-------------------------------------------------------VS.R..DE.....
Q0AJH3_NITEC/4-136DYREA...GAEI-------------------------------------------------------VM.RA.AD.....
Q3JEF4_NITOC/4-145AYREA...GAEI-------------------------------------------------------IE.DT.RS.....
A1WCT5_ACISJ/4-136GFAAV...GAEI-------------------------------------------------------TD.AA.GA.....
O25948_HELPY/4-135AYESV...GAKI-------------------------------------------------------VD..S.KT.....
A1C559_ASPCL/85-224AYEQA...GATL-------------------------------------------------------VD.RG..A.....
Q55F30_DICDI/135-275KYIEA...GAKI-------------------------------------------------------TT.AA..N.....
Q2G790_NOVAD/8-140DYRAV...GAEV-------------------------------------------------------VS.SP........
B0K1G7_THEPX/4-137EYAKV...GAKI-------------------------------------------------------LN.TA.KE.....
Q7NWG7_CHRVO/4-137QYIQA...GASI-------------------------------------------------------AS.NA.EE.....
Q1GKH6_SILST/5-139GYIDA...GCEI-------------------------------------------------------APENAW.P.....
Q1GVP3_SPHAL/4-137YYVEA...GAEI-------------------------------------------------------VQ.SA.DD.....
A1K465_AZOSB/6-138TF..G...DVTL-------------------------------------------------------GA.AA..E.....
A5FAH7_FLAJ1/4-136AYKNM...GITV-------------------------------------------------------T......D.....
Q16BE6_ROSDO/4-137DYTAA...GAQV-------------------------------------------------------LE.TA.AE.....
A0NPS2_9RHOB/4-137DYEAA...GAKI-------------------------------------------------------LA.TA.KE.....
Q1V2K5_PELUQ/4-137QYTSV...GAKI-------------------------------------------------------VD.KA.ED.....
Q6KIJ0_MYCMO/4-134DFIKS...GAKI-------------------------------------------------------ST.QE..E.....
Q8EPC2_OCEIH/4-136QYIQA...GAII-------------------------------------------------------VS.TA.QE.....
A8M4N3_SALAI/8-142QYLRA...GCAW-------------------------------------------------------APSGSW.V.....
Q1ARY0_RUBXD/7-141HYEEA...GARV-------------------------------------------------------VG.SA.GE.....
Q6LMW4_PHOPR/33-171EYLKN...NAIM-------------------------------------------------------QT.AE..Q.....
A0AZX9_BURCH/4-137DYTAA...GASL-------------------------------------------------------GD.GA.EE.....
A5G0H4_ACICJ/5-140ALREA...GAEI-------------------------------------------------------AP.DA.AS.....
A5V5I3_SPHWW/4-142DYEAA...GAKV-------------------------------------------------------.G.DR.TA.....
Q7NEB1_GLOVI/4-136DYLEA...GARI-------------------------------------------------------VE.TA.AE.....
Q60BB4_METCA/4-135EYMAA...GARL-------------------------------------------------------VN.AA..D.....
A0Z7A7_9GAMM/4-137SYGAV...GAQI-------------------------------------------------------VA.SP.ED.....
A1TXK5_MARAV/4-139DYRHA...GAII-------------------------------------------------------AD.DA.DA.....
Q1IIW3_KORVE/4-145LYVEK...GAKV-------------------------------------------------------LP.DR.AS.....
Q07600_EIMTE/501-635EYRRA...GAEV-------------------------------------------------------LS.GP.DA.....
A7HTE3_PARL1/4-137QYVAA...GARI-------------------------------------------------------AD.TA.AE.....
Q3APE7_CHLCH/6-140AYSDA...GASI-------------------------------------------------------AT.SP.EE.....
Q5P1Y9_AROAE/6-139TF..I...DVRF-------------------------------------------------------AA.SA.DE.....
Q8KEI3_CHLTE/17-148KYRLA...GAVL-------------------------------------------------------AS.SA.EE.....
Q2S0H0_SALRD/6-141DYDAA...GCLV-------------------------------------------------------VG....RD.....
Q1YVY2_PHOPR/4-137DYIDA...GAQI-------------------------------------------------------LP.TA.EA.....
Q1M9L0_RHIL3/4-139AYRDA...GVEI-------------------------------------------------------VE.SA.TE.....
A8LIC1_DINSH/19-154AYTAQ...GVTI-------------------------------------------------------AK.TG.AA.....
A0LWI4_ACIC1/4-137VYRDA...GAQI-------------------------------------------------------VQ.R...E.....
Q8RME8_AMYMD/4-137EYVAA...GAKI-------------------------------------------------------LT.TA.DE.....
Q21M61_SACD2/4-145QYVAA...GASI-------------------------------------------------------IG.SM.QE.....
Q0KA62_CUPNH/4-137QYEAA...GAKL-------------------------------------------------------AA.DA.KA.....
A1CKS0_ASPCL/7-145DNILSYLIGAPL-------------------------------------------------------VEEGSWVK.....
A1RDP1_ARTAT/4-136EYALA...GAEI-------------------------------------------------------VE.TA.EE.....
A0LUF0_ACIC1/4-137EYHAT...GGTI-------------------------------------------------------VP.TA.DD.....
Q4BZ65_CROWT/4-136EYEQA...GAKI-------------------------------------------------------VT.SA.AQ.....
Q484K1_COLP3/4-137EFSDA...NAEI-------------------------------------------------------VT.KK.A......
B1KJ86_SHEWM/4-143AYQEA...GADI-------------------------------------------------------VS.LE.E......
Q1N492_9GAMM/4-139EYRTC...GASI-------------------------------------------------------AP.NA.KS.....
Q7UXF1_RHOBA/4-137DYLRA...GAEL-------------------------------------------------------VA.SA.DD.....
Q6MB39_PARUW/4-136MFTRA...GAKI-------------------------------------------------------VQ.SA.EE.....
Q2UAA6_ASPOR/84-217AYEQA...GATL-------------------------------------------------------VD.RA..T.....
A0DTI6_PARTE/7-138QYLEV...GCLV-------------------------------------------------------Q......E.....
A1WZC8_HALHL/6-141DYEAG...GVRI-------------------------------------------------------VQ.SR.DE.....
B2TCQ5_BURPP/4-137LYEWA...GATI-------------------------------------------------------AN.GP.VE.....
Q480P6_COLP3/4-137QYIAA...GAKI-------------------------------------------------------ID.SA.AE.....
B8FRW7_DESHD/4-137EYREA...GAVI-------------------------------------------------------LE.TA.QE.....
Q4P6J5_USTMA/9-143EYTEV...GCKL-------------------------------------------------------APHNTF.H.....
Q8G5Z4_BIFLO/12-147DYEKA...GAKV-------------------------------------------------------TS.RD..E.....
O44503_CAEEL/33-163DYISA...GAIV-------------------------------------------------------R......E.....
A7IGP9_XANP2/4-139DFEAA...GATI-------------------------------------------------------AP.TA.AD.....
Q3IZY5_RHOS4/4-137DYRAA...GARL-------------------------------------------------------VD.TA.EE.....
Q13HL5_BURXL/6-139AFE.....NVAF-------------------------------------------------------IA.DR.TA.....
Q4SJ60_TETNG/61-200HYSQA...GAAI-------------------------------------------------------KD.IK..D.....
Q6AA35_PROAC/43-176AYEEA...GARI-------------------------------------------------------VE.PG.E......
Q16LL0_AEDAE/57-190DYASA...GANI-------------------------------------------------------VD.KS.QA.....
B3E8N4_GEOLS/4-135EYRLA...GGQL-------------------------------------------------------VE.RN..I.....
B2UC87_RALPJ/4-136AYVAA...GAKI-------------------------------------------------------GT.AA.EA.....
A1VG31_DESVV/4-137AYVAA...GATL-------------------------------------------------------IA.TP.AE.....
Q829A4_STRAW/4-137EYVSA...GAQI-------------------------------------------------------LP.TA.DE.....
Q5R0B7_IDILO/4-137QYMEA...GATI-------------------------------------------------------ID.TP.EE.....
Q1JX18_DESAC/4-137DYLNA...GAHI-------------------------------------------------------AF.DR.AE.....
A0FL43_LACPA/28-158DYAAA...GGTI-------------------------------------------------------VS.HA..Q.....
Q2Y9W7_NITMU/4-139EYQAA...GASI-------------------------------------------------------VT.DP.GE.....
A4SFA5_PROVI/35-169DYAEA...GAAI-------------------------------------------------------AE.SP.EE.....
O68519_MYXXA/4-138EYQRV...GAQI-------------------------------------------------------IS.TA.DE.....
Q2Y9W3_NITMU/6-138EYRLA...GATI-------------------------------------------------------VP.RA.ED.....
Q2NZT7_XANOM/6-139VYLQA...GAQP-------------------------------------------------------AG.A...D.....
B3EKT2_CHLPB/35-169EYAEV...GGYL-------------------------------------------------------TD.SP.EA.....
A0ZAH3_NODSP/4-137DYRES...GAEI-------------------------------------------------------VS.TP.EK.....
Q4SHM6_TETNG/10-149QYKNA...GATI-------------------------------------------------------TD.VN..G.....
A4SZU6_POLSQ/4-136AYEAV...GATI-------------------------------------------------------GS.AA.DA.....
Q0F940_9RHOB/4-139DYKNA...GVKV-------------------------------------------------------LN.SA.AS.....
Q0U4J1_PHANO/7-146EFEQA...GATL-------------------------------------------------------IEEGAY.K.....
A1B5J9_PARDP/5-139DYAAA...GAEI-------------------------------------------------------APEGAW.P.....
Q6F836_ACIAD/4-136AYEQV...GATI-------------------------------------------------------TD.....N.....
Q0SGE0_RHOSR/15-145SYKLA...GAAI-------------------------------------------------------AD...........
Q6ANB3_DESPS/4-131DYVTA...GAIL-------------------------------------------------------VD.TA.AE.....
Q2SNB3_HAHCH/4-137QYVAA...GAEI-------------------------------------------------------AA.TA.EQ.....
Q1Z2Q8_PHOPR/4-143AFEAA...GATI-------------------------------------------------------VS.TE..D.....
A1BEU6_CHLPD/35-169DYSEA...GAVI-------------------------------------------------------VA.SP.EE.....
Q2JLS3_SYNJB/4-136DYQKA...GAKL-------------------------------------------------------AV.TP.EE.....
Q5P3E2_AROAE/4-137DYRRA...GARI-------------------------------------------------------ED.DA.AA.....
Q01VE2_SOLUE/4-138EYQRA...GAQV-------------------------------------------------------GY.TP.AE.....
B1JFG2_PSEPW/4-136AYEAV...GASL-------------------------------------------------------GS.AA.DA.....
A0JVR6_ARTS2/4-136EYAIA...GAEI-------------------------------------------------------VT.EA.DD.....
Q7N4Z3_PHOLL/4-137AYQQV...GAEI-------------------------------------------------------TD.RH..N.....
Q6NP53_DROME/69-199AYMQA...GAHI-------------------------------------------------------Q......E.....
O04709_MAIZE/19-156QYEDA...GCEI-------------------------------------------------------S......E.....
Q0FRV1_9RHOB/5-139AYREA...GAEI-------------------------------------------------------ASEGSW.P.....
A0AJ28_LISW6/4-136DFVQA...GAKI-------------------------------------------------------VE.TA.KE.....
Q0FA42_9RHOB/4-137EYTEI...GAII-------------------------------------------------------ID.TA.EE.....
A8ZX21_DESOH/4-137VFQQA...GAAV-------------------------------------------------------LS.TA.DD.....
Q46N60_CUPPJ/4-136TYESA...GAHI-------------------------------------------------------GT.AA.QA.....
A1ZCQ3_9BACT/4-136AYLQA...GLSV-------------------------------------------------------V......D.....
Q021N9_SOLUE/6-147DYVEK...GVRV-------------------------------------------------------AG.GR.EE.....
Q3IYW2_RHOS4/5-139GYAAA...GCAI-------------------------------------------------------APENSW.P.....
Q3AEB3_CARHZ/4-137EYIKA...GAEI-------------------------------------------------------LP.TA.AD.....
A1BEX7_CHLPD/4-135KYRRA...GAMV-------------------------------------------------------EP.SA.EK.....
Q48BS0_PSE14/4-136AYEAA...GAVI-------------------------------------------------------GS.AN.EA.....
A0PWE2_MYCUA/9-139LYTEA...GATI-------------------------------------------------------GD...........
LYS1_CANAX/9-144EYEAV...GAKI-------------------------------------------------------VPEGSW.K.....
LYS1_YARLI/8-142EFVDV...GATL-------------------------------------------------------VEEGSW.V.....
Q5SIC7_THET8/4-139AYEEA...GARL-------------------------------------------------------VG.RE..E.....
B2TAE0_BURPP/4-137DYVKA...GASI-------------------------------------------------------QD.SV.ER.....
Q1GIS5_SILST/4-139AYAEA...GVEV-------------------------------------------------------IK.TA.AG.....
B2JGI7_BURP8/4-136AYAAA...GAEL-------------------------------------------------------VD.AP.AA.....
Q1AW21_RUBXD/4-137DYAAA...GARV-------------------------------------------------------LE.EA.GR.....
B4SD94_PELPB/35-169AYGEA...GATI-------------------------------------------------------AE.SP.EE.....
Q16C99_ROSDO/5-139AYAAT...GCTM-------------------------------------------------------APAHSW.P.....
A7NQG5_ROSCS/4-138SYSAV...GAHI-------------------------------------------------------AYGPE..E.....
A6WFF9_KINRD/4-137DYEAA...GAKV-------------------------------------------------------LT.DV.DE.....
A2C3U2_PROM1/5-141TYMDA...GAEL-------------------------------------------------------VE.RENDE.....
A1B9C0_PARDP/4-139AYEAA...GVTV-------------------------------------------------------EP.NA.AA.....
A3QAN8_SHELP/4-140AYQEA...GAVI-------------------------------------------------------.A.NR.DE.....
Q8XRA9_RALSO/4-136AYEAV...GCEM-------------------------------------------------------TD.AA.GA.....
A0LMX7_SYNFM/4-137EYVSA...GARV-------------------------------------------------------LP.TA.EE.....
Q47RB8_THEFY/4-137EYAAA...GARI-------------------------------------------------------ID.SA.DE.....
PNTAA_RHORU/4-144ALTAA...GATI-------------------------------------------------------AS.TA.AQ.....
B2JLD8_BURP8/4-137AYRTA...GAQI-------------------------------------------------------VP.DP.GA.....
Q128A6_POLSJ/4-137EYEKA...GAGI-------------------------------------------------------VQ.GA.DE.....
Q04WC6_LEPBJ/4-137DYKKA...GANL-------------------------------------------------------VS.RQ..D.....
Q7P1W1_CHRVO/4-138AFLAA...GAGI-------------------------------------------------------AE.QR.QA.....
A0PQF0_MYCUA/4-137DFKAA...GAQL-------------------------------------------------------IS.TA.DQ.....
A1IRJ4_NEIMA/4-137AYQAA...GATV-------------------------------------------------------AD.KA..A.....
Q8KEN6_CHLTE/6-140DYAEA...GAII-------------------------------------------------------VT.SP.EE.....
Q6SH06_9BACT/4-137DYAAA...GGSL-------------------------------------------------------VD.GP.ST.....
Q2IJQ2_ANADE/4-137EYEAV...GARI-------------------------------------------------------AP.VA.RQ.....
A0NM55_9RHOB/8-143AYEEA...GVEI-------------------------------------------------------VK.TA.AT.....
Q0G2B1_9RHIZ/4-137DYETA...GARI-------------------------------------------------------VD.SA.ED.....
A4SWM0_POLSQ/4-137SYRMA...GASL-------------------------------------------------------IN.SS.AE.....
B4SKQ7_STRM5/7-139AYDDA...GARV-------------------------------------------------------FD.A...S.....
Q1QDC7_PSYCK/5-139LYQAA...GADI-------------------------------------------------------AN.SS.ID.....
A0ZDC5_NODSP/19-159AYEAA...GATI-------------------------------------------------------IS.DT.AK.....
A1VTW8_POLNA/4-136AYRAV...GAEI-------------------------------------------------------TD.AA.GA.....
A9BR27_DELAS/4-136LYEAA...GAEI-------------------------------------------------------VD.VA.GA.....
Q4BYI1_CROWT/5-144EYEAA...GATI-------------------------------------------------------IN.GA.KE.....
A6VWR5_MARMS/6-139AYR.....DVIF-------------------------------------------------------MD.DR.HA.....
A4XPH7_PSEMY/4-137DYREA...GAQI-------------------------------------------------------AA.SA.GE.....
Q26D16_FLABB/4-137DYENA...GATI-------------------------------------------------------VN.TI.EE.....
Q1QT97_CHRSD/4-137EYAAA...GARI-------------------------------------------------------EQ.DL.DA.....
B0SVI3_CAUSK/5-140DYEAA...GAKL-------------------------------------------------------AK.TA.KE.....
A1HRL4_9FIRM/4-137EYRQA...GAEI-------------------------------------------------------VG.DK.QA.....
Q1WRC5_LACS1/4-135EYIAA...GAK.-------------------------------------------------------MG.SA.EE.....
B0T233_CAUSK/4-137LYVKA...GATI-------------------------------------------------------AP.DA.DA.....
Q28K30_JANSC/4-138GFRQS...GAQI-------------------------------------------------------AAAGSW.R.....
Q1KZW0_9BRAD/4-137DYRAV...GATI-------------------------------------------------------LA.SA.GE.....
B3EDZ5_CHLL2/4-135KYRRA...GAVM-------------------------------------------------------VE.HA.SD.....
Q9AIK2_BILWA/4-136EYVAA...GAQM-------------------------------------------------------VA.TA.KE.....
A0KWV9_SHESA/4-137DYVDA...GAEI-------------------------------------------------------LA.TA.AE.....
A0Z8G6_9GAMM/4-139AYAAE...GASV-------------------------------------------------------VT.DR.DA.....
Q2CCA0_9RHOB/4-137AYAQA...GAEI-------------------------------------------------------VG.DA.AT.....
A9VUJ6_BACWK/4-136DYVYA...GAEI-------------------------------------------------------VE.SA.AE.....
A5V806_SPHWW/4-137DYRDA...GAAI-------------------------------------------------------VA.DA.AA.....
Q31MS7_SYNE7/28-167DYQEA...GAEV-------------------------------------------------------SD.QE.EQ.....
Q03RI6_LACBA/4-135DYEQA...GA.I-------------------------------------------------------LG.TA.TE.....
B7WZ89_COMTE/27-163AYRAA...GAEV-------------------------------------------------------LP.TA.AA.....
A4J8G7_DESRM/4-137AYIKA...GAQI-------------------------------------------------------LD.TA.KE.....
Q5KUA3_GEOKA/4-136DYARA...GAQI-------------------------------------------------------IE.RA.ED.....
Q11IF1_MESSB/4-137AYRAA...GAEI-------------------------------------------------------AK.SA.ED.....
Q0IBP4_SYNS3/5-141TYASA...GADL-------------------------------------------------------VA.PGEAQ.....
A1ZGV6_9BACT/4-137AYKDA...GAQI-------------------------------------------------------LP.NI.EA.....
P73496_SYNY3/23-158LYESL...GCGI-------------------------------------------------------VD.GR.QT.....
A1V078_BURMS/79-211AYAAA...GAEL-------------------------------------------------------AD.AA.AA.....
Q15PN0_PSEA6/5-140EYVEA...GASV-------------------------------------------------------AT.SR.AE.....
Q7VV14_BORPE/4-136AYEEA...GATL-------------------------------------------------------GT.AE.TA.....
Q12QQ7_SHEDO/4-145AYREA...GAHI-------------------------------------------------------DD.SD..SGKAKE
A7HUT9_PARL1/4-139VYQEA...GAAI-------------------------------------------------------AS.SA.AE.....
Q2CKD5_9RHOB/4-138AYAAV...GCTL-------------------------------------------------------APPGSW.A.....
Q03HP9_PEDPA/4-134EFENA...GGKI-------------------------------------------------------VS.HA..E.....
A2BXK8_PROM5/5-141LYKES...GGQI-------------------------------------------------------VT.ESNAN.....
A0YVL7_LYNSP/4-136DYQNA...GAEV-------------------------------------------------------VS.TA.ED.....
Q3A7G8_PELCD/26-159QYRQA...GARL-------------------------------------------------------VD.AP.DS.....
Q5DZZ0_VIBF1/4-143AFEQA...GATV-------------------------------------------------------VS.TD..D.....
Q01VQ6_SOLUE/4-137DYLEA...GAKI-------------------------------------------------------LS.TA.AE.....
DHA_LYSSH/4-137EYVAA...GAAY-------------------------------------------------------RC.IG.KE.....
Q7VA67_PROMA/14-145DFSNA...GARI-------------------------------------------------------VD.R..DE.....
Q10VQ6_TRIEI/4-139AYEQA...GAKI-------------------------------------------------------IS.DS.NA.....
A0M2A6_GRAFK/33-166DYSEA...GAEI-------------------------------------------------------TK.DT.KK.....
C1DKG5_AZOVD/4-137DYRAA...GAHI-------------------------------------------------------AT.DG.AA.....
A8H092_SHEPA/19-156DYIQA...GASI-------------------------------------------------------.V.SR.DQ.....
Q0FFN0_9RHOB/5-137SY..S...GAQV-------------------------------------------------------AGTGDW.R.....
A1A1C3_BIFAA/12-147DYTKA...GAQV-------------------------------------------------------VS.AD..D.....
Q11SC0_CYTH3/13-146EYSEA...GAKI-------------------------------------------------------VY.SK.KE.....
DHA1_STAAM/4-134MYEKE...GAKI-------------------------------------------------------VT.HE..Q.....
A8LLI3_DINSH/4-137DYIAA...GARI-------------------------------------------------------VD.TA.EE.....
Q3AI65_SYNSC/8-144AYAEQ...GADL-------------------------------------------------------IG.TGDSS.....
Q11EJ3_MESSB/6-139EFEKA...GATL-------------------------------------------------------GG.AA........

PF05221

SAHH_RHOCB/2-462KKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGIRRATDVMMAGKVAVVCGYGDVGKGSAASLRGAGARVKVTEVDPIC
SAHH_YEAST/6-448KEGKLKVPAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGARVLVTEIDPIN
SAHH_CATRO/12-484ANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPIC
SAHH2_DROME/66-491KGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDSLKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPIC
SAHH_LEIDO/2-436SKGNLPMCAINVNDSVTKSKFDNLYGCRESLVDGMKRATDVMIAGKTCCVCGYGDVGKGCAAALRAFGARVVVTEVDPIN
SAHH_TRIVA/11-485KEGKLLFPAINVNDAVTKSKFDNIYGCRHSLIDGINRASDVMIGGKTALVMGYGDVGKGCAQSLRGQGARVIITEVDPIC
SAHH_CAEEL/6-436AKGDLKVPAINVNDSVTKSKFDNLYGIRESLPDGIKRATDVMLAGKVAVVAGYGDVGKGSAASLKAFGSRVIVTEIDPIN
SAHH_PLAF7/4-478KQNELLFTAINVNDAVTKQKYDNVYGCRHSLPDGLMRATDFLISGKIVVICGYGDVGKGCASSMKGLGARVYITEIDPIC
SAHH_MOUSE/5-431SNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPIN

PF00389

Q9JY94_NEIMB/3-329RDANF----------------------------SLEGLTGFNMYGKTAGVIGTGKIGIATMRILKGFGMNLLAYDPFCNP
O30440_BORPT/4-317HLGHW----------------------------DKSAAGAYEARGKTLGIVGYGNIGSQISTLAEAIGMRVVFFDVEAKL
SERA_ARATH/85-394KAGKW----------------------------ERSKYVGVSLVGKTLAVMGFGKVGTEVARRAKGLGMTVISHDPYAPA
Q9RUU0_DEIRA/18-329RAGEW----------------------------DRKFLGLELTDKTLGIVGLGRIGSIVADRAQGLHMNVVAYDPYVPEN
Q98F95_RHILO/5-315HAGKW----------------------------EKNRFMGVEITGKTLGVIGCGNIGSIVATRGVGLKMHVVAFDPFLSD
Q99R78_STAAM/6-332REHDF----------------------------RWEPTILSKSIKDLKVAVIGTGRIGRVVADIFANGYQSDVVAYDPFP
E9ACF1_LEIMA/115-427HRGVW----------------------------NKTHVGCYEVRGKTVGIVGYGHIGSQVGVLAEALGMNVVFYDVLPTL
Q9KEA4_BACHD/2-311QEQTW----------------------------DRRVPMIELNGQTVGVLGAGAIGQEIARLAKAFRMKTIGMNSTGRTV
O28495_ARCFU/4-322LSGRW----------------------------EQDEMANLGVYELHGKTWGIIGMGAQGREVTKRLQGWGVKIIYHDVR
Q9KLW1_VIBCH/3-321HAGHW----------------------------QQNGGLGLGRTLSGHTLGIWGLGKIGQRIAQFGHVFGMPILVWGSEA
Q9CKF1_PASMU/14-327HRGIW----------------------------NKSANGSHEVRGKKLGIIGYGHIGSQLSIIAESLGMRVFFYDIENKL
SERA_SHIFL/13-326HRGVW----------------------------NKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIENKL
SERA_ARCFU/3-312KEGKW----------------------------ERKKFMGIELRGKTAGVIGLGRVGFEVAKRCKALEMNVLAYDPFVSK
O58256_PYRHO/5-318RRGEW----------------------------ESHAKIWTGFKRIESLYGKKVGILGMGAIGKAIARRLIPFGVKLYYW
Q9X4A4_STAAU/4-319EADAW----------------------------QSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRS
Q99T17_STAAM/2-311RQHIY----------------------------DSKITGKRLSGQTVLFLGTGAIATRTAKLAKAFNMNLIGLSKSGQNK
CTBP_DROME/30-352REGKK----------------------------FTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIF
Q9VKI8_DROME/8-324KEGRW----------------------------DRKLYAGTELYGKTLAVLGLGRIGREVAIRMKTWGMRIIGYDPITTE
Q97IU7_CLOAB/3-326YVQDY----------------------------SLEGIQGKELHNLTVGVIGTGKIGRTVIKNLKGFECNIIAYDINENE
GHRB_ECO57/5-319KAGEW----------------------------TASIGPDWYGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNAR
YEAA_SCHPO/9-327HKNNW----------------------------NANCKPSHDPEGKTLGILGLGGIGKTMAKRARAFDMKIVYHNRTPLP
LDHD_LEUMC/3-330AKRDL----------------------------RWAPTTGREMRMQTVGVIGTGHIGRVAINILKGFGAKVIAYDKYPNA
Q9KP92_VIBCH/13-326HRGIW----------------------------KKSADNSYEARGKRLGIIGYGHIGTQLGIIAENLGMHVYFYDIESKL
Q9I1L0_PSEAE/4-318RAGEW----------------------------KKSVGAAQFGTDVHGKTLGIVGMGRIGEALARRGHHGFGMRVLYHSH
Q98BH4_RHILO/9-329TGDKK----------------------------WAGWSPTWMLGRRIWGKRLGIVGMGRIGTAVARRAKAFGLSIHYHNR
P74586_SYNY3/3-330RDDNF----------------------------SLEGLLGFDLHGTTVGVIGTGKIGLAFAQIMNGFGCHLLGYDAFPND
Y2305_STAAM/4-317RTTGF----------------------------DGWAPLFFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPN
Q59463_HYPME/6-322RTRSW----------------------------PGWQPLQLVGQRLDNKTLGIYGFGKIGQALAQRARGFDMNVHYYDIY
DDH_ZYMMO/3-331RENNF----------------------------SLEGLIGLDVHDKTVGIIGVGHIGSVFAHIMTHGFGANVIAYKPHPD
TKRA_BACSU/6-322RAGKW----------------------------GTVEEEALFGIDVHHQTLGIIGMGRIGEQAARRAKFGFDMEVLYHNR
Q9ZKF4_HELPJ/4-314KHQRL----------------------------WKREDWYGTELKNKKLGIIGFGNIGSRVGIRAKAFEMEVLAYDPYIP
Q9A244_CAUCR/24-340KAGGF----------------------------HGWSPTWMMGRRLWGKRLGIIGMGRIGQAVARRAKAFGMQVHYHNRK
SERA_SCHPO/58-378HRGEW----------------------------NKVSSGCWEIRGKTLGIIGYGHIGSQLSVLAEAMGLHVVYYDILPIM
GYAR_THELI/5-322RSGEW----------------------------KKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIY
Q98LH4_RHILO/9-326MRRGG----------------------------WRGLTHGATLRGATVGIVGLGRIGRGVAQRLSGWEARILAYDPFLKE
Q9BLF6_OCTVU/5-323RNGSW----------------------------GLWKPMWILGSSFANRTIGVLGMGRIGYGVARRMKAFCISRLIYHDI
Q99TE0_STAAM/6-315TNKEW----------------------------NRNAFKGTELYHKTLGVIGAGRIGLGVAKRAQSFGMKILAFDPYLTD
Q9S2M5_STRCO/3-328RDFDF----------------------------RLDGLMGRDLHGRTAGVLGTGKIGEAFARIAHGFGMRLLGWDVAENP
SERA_METJA/4-312KRGEW----------------------------DRKRFKGIELYGKTLGVIGLGRIGQQVVKRAKAFGMNIIGYDPYIPK
PTXD_PSEST/5-326RSGEF----------------------------QGWQPQFYGTGLDNATVGILGMGAIGLAMADRLQGWGATLQYHEAKA
LDHD_STRP1/3-330KKQNF----------------------------TWGLPIRGRVLGDMTVAIIGTGRIGLATAKIFKGFGCKVVGYDIYQS
Q9LE33_ARATH/9-321RSGNW----------------------------AKFGDFQLGSKVSGKRVGIVGLGSIGSFVAKRLESFGCVISYNSRSQ
Q9HXB7_PSEAE/5-318KAGNW----------------------------KRTVDAPQFGTDVHGKKLGILGLGRIGAAIARRGRFGFGMQVLYHGN
O67741_AQUAE/4-320LNYKW----------------------------DRKKFMGEELYGRILGIIGLGNIGSQVAIRAKAFGMKVMAYDPYIPR
SERA_METTH/6-313KEGKW----------------------------EKNRFMGIELNGKTLGIIGMGRIGSQVVVRTKAFGMDIMVYDPYISK
LDHD_PEDAC/3-329AHGDY----------------------------RWEPDIGLELNQMTVGVIGTGRIGRAAIDIFKPFGAKVIAYDVFRNP
Q9UYH9_PYRAB/5-318REGKW----------------------------ESHTFVWREFKEVETLYGKEVGIVGMGAIGKAIARRLKPFGCEIYYW
DDH2_SCHPO/3-330REDDF----------------------------NIVGLLGCDIHGKTVGVIGTGKIGSNVAKCFKMGFGCDVLAYDINPD
Q9CA90_ARATH/6-313RSGKW----------------------------KQGEFQLTTKFSGKSVGIIGLGRIGTAIAKRAEAFSCPINYYSRTIK
Q48534_9LACO/4-332DHDHD----------------------------FTWPSNLISNEIYNLTVGLIGVGHIGSGLAEIFSAMGAKVIAYDVAY
LDHD_ECOLI/3-329RDANF----------------------------SLEGLTGFTMYGKTAGVIGTGKIGVAMLRILKGFGMRLLAFDPYPSA
SERA_RAT/9-317KDGKW----------------------------DRKKFMGTELNGKTLGILGLGRIGREVAARMQAFGMKTVGYDPIISP
Q9A6E7_CAUCR/11-318RGGHW----------------------------SHAERMAPRPGLRGRKAGVVGLGHIGEAVAARLKAFDMKVAWWAPRP
Q9HMR0_HALSA/3-311DAGSW----------------------------AKDDYLGTELSGKTLGVVGLGRVGQEVATRLDSLGMDLVAYDPYIGE
Q9WYG2_THEMA/4-311FLERR----------------------------WEGTVGQEVSGKTLGVVGFGSIGREVVKKAVCLGMNVLVYDPYVSKD
CTBP2_RAT/36-358REGTR----------------------------VQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIF
Q9PBD8_XYLFA/15-328HRGGW----------------------------SKSAINSHEARGKVLGIVGYGHIGTQVSVLAEAMGMQVIFYDIESKL
Q89388_PBCV1/32-362KTGNY----------------------------TMEGLVGREITDKTIGIIGTGKIAQEFIKLVKPMAGRIIAYDVYEND
LDHD_TREPA/3-330RKRDF----------------------------RWQKPILSKELRCSRVGILGTGRIGQAAARLFKGVGAQVVGFDPYPN
Q97MV2_CLOAB/3-317REGKT----------------------------KNGFSQSDLSGKTFGVIGTGLIGASVCRIAKAFGCKVIAYSRSKKEE
Q97U35_SULSO/2-295VYDVS----------------------------EKTLLILGGGGIGSEVARIGKTAFRNYVIGISRSFKKPEWFDERHGM
Q9A3I9_CAUCR/6-314QGGKW----------------------------EKNRFMGVELYAKTLGLIGAGNIGGIVADRALGLKMKVVAYDPFLSP
Q9RKF9_STRCO/17-329RAGSF----------------------------DLPAVRPLYQVGQRVFGVVGMGLIGAATARKAAGLGYDVIAYDSAAD
Q9RNB7_MICAE/18-330KKGNY----------------------------LIRNQMQPIQLENKTLGIVGLGRIGTLVAHKCNLALGMRVLAYDPYV
LDHD_STAAU/4-330QAHDF----------------------------TWQAEIMSKPVKNMTVAIIGTGRIGAATAKIYAGFGATITAYDAYPN
Q9LT69_ARATH/49-358KAGKW----------------------------TRNKYVGVSLVGKTLAVLGFGKVGSEVARRARGLGMHVITHDPYAPA
GYAR_AERPE/6-324RWGEW----------------------------WRLRTGWHPMMMLGVELRGKTLGILGMGRIGSRVAEIGKAFGMRIIY
DDH_HAEIN/3-329REANF----------------------------SLEGLIGFNMYGRTVGVIGTGKIGIAVMRILKGFGMNILAYDPFKNP
O17626_CAEEL/8-316KAGKW----------------------------ARKDFMGEEVYGRTLAVLGLGRIGSEVAVRLQAFGMKVIGFDPMVTK
PDXB_PSEAE/3-285TYGVV----------------------------GAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFVSLERLLAEAD
SERA_YEAST/61-381HTGTW----------------------------NKVAARCWEVRGKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIM
YGDH_SCHPO/9-332RLGKW----------------------------RQNLSLTDDPYGKRVGIIGMGAIGKSFAQKILPLGCEIVYHNRNRLE
Q20595_CAEEL/181-504SETRK----------------------------TIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIF
DHD2_LACPA/3-329QAGDY----------------------------EKAGTFIGKELGQQTVGVMGTGHIGQVAIKLFKGFGAKVIAYDPYPM
Q9KCG9_BACHD/20-325KAGEW----------------------------KRKAFQGTELRGKTLGIIGFGRIGSQIAKRAKAFEMTPYVFDPFLTK
SERA_MYCLE/6-313RAHIW----------------------------KRSSFSGTEIFGKTVGVVGLGRIGQLVAARIAAFGAHVIAYDPYVAP
Q9I530_PSEAE/3-328REGDF----------------------------SLHGLTGFDLHGKRVGVIGTGQIGETFARIMAGFGCELLAYDPYPNP
Q9VII9_DROME/10-326ERSQW----------------------------KIEQINWMMGQEIRDSVIGFFGFGGISQAIAKRLQCWDVAKIIYHTR
O66939_AQUAE/3-332KKLNF----------------------------SQDSEILARELNRLTLGVIGTGRIGSRVAMYGLAFGMKVLCYDVVKR
Q9HVG5_PSEAE/7-321RSGRW----------------------------QQSSQFCLLDFPIVELEGKTLGLLGHGELGGAVARLAEAFGMRVLLG
GHRB_ENTAG/5-318KAGEW----------------------------RRSIGPDWFGIDVHHKKMGILGMGRIGLALAQRAHHGFGMPILYNAR
Q98CG2_RHILO/11-318RDGSW----------------------------VRKGNYPLSRLTLRARRVGIFGMGRIGQAIARRLEAFGLPIAYHNRR
GRHPR_HUMAN/9-327KNGGW----------------------------TSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGR
Q9KMX4_VIBCH/4-330RDANF----------------------------SLDGLVGFNFHGKTVGVIGSGKIGVATMRILQGLGMQILCFDPYPNP
Q9K7P7_BACHD/3-318RNDQW----------------------------KSWGPFMLTGQAIYGTTLGIIGMGRIGQAVAKRAKGFNMTLLYHNRS
Q9I6H5_PSEAE/13-326HRGGW----------------------------IKSAANSFEIRGKKLGIVGYGSIGTQLSVLAEALGMQVFFYDTVTKL
Q9HK29_THEAC/3-309RSGRW----------------------------PRITRSSDLMGKTFGIVGMGSIGRALAARLLPFKVAIIYNDTKRMSE
Q9ZH60_LACJH/4-331AKRDL----------------------------RWAPTIGREVRDQVVGVVGTGHIGQVFMKIMEGFGAKVIAYDIFKNP
Q98GE4_RHILO/8-315RAKGW----------------------------LAGREHANANIELAGKTIGIVGLGAVGQAVGHIAAHGFDLKVVATTR
DDH1_SCHPO/3-330REDDF----------------------------NLNGLLGHDLHGKTIGLLGTGRIGGLVAKCLKLGFGCEVLAHDIKPN
PDXB_VIBCH/3-286TVGII----------------------------GAGQVGSYLAKCLSGIGMKVLLNDPPKQAQGDEREFTELETLLKQAD
DHGY_METEA/5-313RRGDW----------------------------NKSKQFCYFDYPIYDIAGSTLGIIGYGALGKSIAKRAEALGMKVLAF
Q97ZK1_SULSO/20-326KGGIF----------------------------KKIEGIELAGKTIGIVGFGRIGTKVAKVCKALDMNVIAYDVINIKEK
GYAR_PYRAB/6-323RSGEW----------------------------KKRGVAWHPKWFLGYDVYGKTIGIIGFGRIGQAIAKRARGFDMRILY
Q97F10_CLOAB/3-323KKGDW----------------------------QNCADFSYLKYPIIELSGKTIGLVGYGSIGKAMQKAAEALGMKVFVY
Q9Z564_STRCO/7-314KNGEW----------------------------KRSKYTGVELAEKTLGVVGLGRIGALVAQRMSAFGMKVVAYDPYVQP
LDHD_LACPE/3-330AKQDF----------------------------RWAPDIAKELNTMTVGVIGTGRIGRAAIDIFKGFGAKVIGYDVYRNA
SERA_SYNY3/32-339KESKW----------------------------ERKQFIGTEVYKKTLGVVGLGKIGSHVAGVAKAMGMKLLAYDPFISQ

PF05222

NNTM_BOVIN/60-199...VL---------------------------------------------------------------------------
Q7RV12_NEUCR/59-195...VW---------------------------------------------------------------------------
Q3F038_BACTI/7-137...AW---------------------------------------------------------------------------
Q0VPX1_ALCBS/24-165...VF---------------------------------------------------------------------------
Q3J1C2_RHOS4/4-139...LF---------------------------------------------------------------------------
Q0EZS3_9PROT/4-136...AW---------------------------------------------------------------------------
Q0G0B3_9RHIZ/4-136...SG---------------------------------------------------------------------------
LYS1_ASHGO/6-141...GA---------------------------------------------------------------------------
Q28V87_JANSC/4-137...VF---------------------------------------------------------------------------
Q24813_ENTHI/568-702...LY---------------------------------------------------------------------------
Q2G7Q1_NOVAD/4-137...VF---------------------------------------------------------------------------
Q6AQV0_DESPS/4-137...VY---------------------------------------------------------------------------
Q82QU1_STRAW/15-145...AW---------------------------------------------------------------------------
Q3B540_PELLD/4-135...VW---------------------------------------------------------------------------
DHA_OCEIH/4-136...VW---------------------------------------------------------------------------
Q0S884_RHOSR/4-137...VW---------------------------------------------------------------------------
A0KQF4_AERHH/4-135...VW---------------------------------------------------------------------------
Q9KAF8_BACHD/4-136...VW---------------------------------------------------------------------------
A6VXM0_MARMS/6-147...LW---------------------------------------------------------------------------
Q3JE74_NITOC/4-136...LY---------------------------------------------------------------------------
B1YFJ0_EXIS2/4-136...VW---------------------------------------------------------------------------
A0YCU2_9GAMM/4-139...LL---------------------------------------------------------------------------
Q39LR8_BURS3/6-135...LW---------------------------------------------------------------------------
A5GEE8_GEOUR/4-135...LF---------------------------------------------------------------------------
A5FP13_FLAJ1/4-137...VY---------------------------------------------------------------------------
Q98CE6_RHILO/6-139...DV---------------------------------------------------------------------------
Q31MC9_SYNE7/4-136...AW---------------------------------------------------------------------------
Q6NYQ7_DANRE/56-195...VF---------------------------------------------------------------------------
Q1MBQ8_RHIL3/6-139...DA---------------------------------------------------------------------------
Q5KHJ2_CRYNJ/22-157...SA---------------------------------------------------------------------------
A4TCI0_MYCGI/4-137...VW---------------------------------------------------------------------------
Q8GRT6_GOSHI/8-144...DL---------------------------------------------------------------------------
Q2IDX0_ANADE/4-138...TL---------------------------------------------------------------------------
Q21L93_SACD2/6-141...VY---------------------------------------------------------------------------
A0QNT0_MYCS2/5-135...PW---------------------------------------------------------------------------
Q1GUI4_SPHAL/4-138...VL---------------------------------------------------------------------------
DHA_GEOSE/4-137...AW---------------------------------------------------------------------------
Q0AQT6_MARMM/4-137...VF---------------------------------------------------------------------------
Q1YKG9_MOBAS/4-137...DA---------------------------------------------------------------------------
A6UD59_SINMW/6-139...DA---------------------------------------------------------------------------
Q18031_CAEEL/32-165...VF---------------------------------------------------------------------------
Q063W8_9SYNE/14-150...TW---------------------------------------------------------------------------
Q1V607_VIBAL/4-137...VF---------------------------------------------------------------------------
Q47E46_DECAR/4-137...VF---------------------------------------------------------------------------
Q39WN5_GEOMG/4-135...VF---------------------------------------------------------------------------
Q1YRC4_9GAMM/4-137...VF---------------------------------------------------------------------------
Q3SL22_THIDA/4-136...VW---------------------------------------------------------------------------
Q6W1Y1_RHISN/6-139...DA---------------------------------------------------------------------------
A1RCI4_ARTAT/4-137...VW---------------------------------------------------------------------------
Q67ND6_SYMTH/4-137...VW---------------------------------------------------------------------------
Q5SLT7_THET8/5-139...LL---------------------------------------------------------------------------
A0KEW0_AERHH/4-137...IF---------------------------------------------------------------------------
Q47BC9_DECAR/6-139...AY---------------------------------------------------------------------------
A1ZZD6_9BACT/38-171...VF---------------------------------------------------------------------------
Q8DL05_THEEB/4-139...VW---------------------------------------------------------------------------
Q28M63_JANSC/4-139...LW---------------------------------------------------------------------------
Q2RN15_RHORT/4-137...VF---------------------------------------------------------------------------
Q1VSD8_9FLAO/34-167...VF---------------------------------------------------------------------------
Q0C3J7_HYPNA/4-137...LF---------------------------------------------------------------------------
Q2S445_SALRD/35-169...LY---------------------------------------------------------------------------
A0R9N0_BACAH/4-136...AW---------------------------------------------------------------------------
Q07J60_RHOP5/4-136....L---------------------------------------------------------------------------
A1SSF5_PSYIN/4-138..LVW---------------------------------------------------------------------------
Q5Z133_NOCFA/18-148...PW---------------------------------------------------------------------------
Q5WJZ9_BACSK/4-136...VW---------------------------------------------------------------------------
A2C6Y0_PROM3/14-145...AW---------------------------------------------------------------------------
A0L9H7_MAGSM/4-145...LW---------------------------------------------------------------------------
Q1Z6I5_PHOPR/6-140...TA---------------------------------------------------------------------------
Q6W1J9_RHISN/4-139...LY---------------------------------------------------------------------------
PNTA_HAEIN/4-137...IW---------------------------------------------------------------------------
Q6AEY9_LEIXX/4-137...TW---------------------------------------------------------------------------
Q6ACH0_LEIXX/6-139...AI---------------------------------------------------------------------------
Q1YRM2_9GAMM/4-145...IF---------------------------------------------------------------------------
Q0FNJ6_9RHOB/4-137...VF---------------------------------------------------------------------------
Q1VPH7_9FLAO/4-137...VY---------------------------------------------------------------------------
Q1NA78_9SPHN/23-156...IF---------------------------------------------------------------------------
A8GEZ6_SERP5/4-137...VW---------------------------------------------------------------------------
Q5LFH6_BACFN/4-137...TY---------------------------------------------------------------------------
A5FFU7_FLAJ1/32-165...VF---------------------------------------------------------------------------
A0K2E1_ARTS2/12-145...EP---------------------------------------------------------------------------
A0QNN8_MYCS2/4-137...VW---------------------------------------------------------------------------
Q5YZC0_NOCFA/4-137...VW---------------------------------------------------------------------------
P72775_SYNY3/4-136...AW---------------------------------------------------------------------------
Q603N5_METCA/4-139...LW---------------------------------------------------------------------------
Q2N774_ERYLH/4-137...IF---------------------------------------------------------------------------
Q26EF0_FLABB/32-165...VF---------------------------------------------------------------------------
Q1J0B1_DEIGD/4-135...AW---------------------------------------------------------------------------
Q472Z0_CUPPJ/4-137...VF---------------------------------------------------------------------------
Q2HFZ2_CHAGB/7-141...DA---------------------------------------------------------------------------
LYS1_YEAST/7-142...TA---------------------------------------------------------------------------
Q3UEQ9_MOUSE/27-157...DI---------------------------------------------------------------------------
Q4SE54_TETNG/23-153...DI---------------------------------------------------------------------------
Q5LPM8_SILPO/4-139...LW---------------------------------------------------------------------------
A2BS45_PROMS/5-141...IW---------------------------------------------------------------------------
Q65CX6_BACLD/4-136...VW---------------------------------------------------------------------------
Q1QUL9_CHRSD/4-139...LW---------------------------------------------------------------------------
Q05XL4_9SYNE/7-143...AW---------------------------------------------------------------------------
Q2J8T8_FRASC/7-142...LF---------------------------------------------------------------------------
A8LYT6_SALAI/4-137...VW---------------------------------------------------------------------------
Q1NHV8_9SPHN/4-138...TV---------------------------------------------------------------------------
A4Y0R2_PSEMY/4-136...L.---------------------------------------------------------------------------
Q11TK3_CYTH3/4-137...VY---------------------------------------------------------------------------
A0CWD3_PARTE/29-161...VY---------------------------------------------------------------------------
Q1MXV6_9GAMM/4-137...VF---------------------------------------------------------------------------
Q2BRI8_9GAMM/4-137...LW---------------------------------------------------------------------------
Q2SHR3_HAHCH/4-137...AW---------------------------------------------------------------------------
A6VN40_ACTSZ/4-137...VW---------------------------------------------------------------------------
A8ZXI3_DESOH/4-137...VF---------------------------------------------------------------------------
A5FVY5_ACICJ/4-137...VF---------------------------------------------------------------------------
B2TEW7_BURPP/4-136...M.---------------------------------------------------------------------------
Q0YPX1_9CHLB/28-159...VW---------------------------------------------------------------------------
Q8DQ43_STRR6/4-136...AW---------------------------------------------------------------------------
Q9K827_BACHD/4-136...VW---------------------------------------------------------------------------
Q5CI32_CRYHO/405-540...VV---------------------------------------------------------------------------
A6U2H6_STAA2/4-136...VW---------------------------------------------------------------------------
A1EQT6_VIBCL/4-137...IW---------------------------------------------------------------------------
Q0SD61_RHOSR/4-134.....---------------------------------------------------------------------------
Q11PQ8_CYTH3/7-139...DL---------------------------------------------------------------------------
Q2NSW2_SODGM/4-137...VW---------------------------------------------------------------------------
Q8DH53_THEEB/4-139...AW---------------------------------------------------------------------------
O52942_PHOLP/4-136...AW---------------------------------------------------------------------------
Q2W3E7_MAGSA/6-142...LW---------------------------------------------------------------------------
A0L3P1_MAGSM/4-137...VW---------------------------------------------------------------------------
Q0A4X6_ALHEH/6-139...LL---------------------------------------------------------------------------
O85594_CARST/4-135...VW---------------------------------------------------------------------------
Q6MKC3_BDEBA/4-137...VY---------------------------------------------------------------------------
Q2LSK0_SYNAS/44-177...IW---------------------------------------------------------------------------
Q163M5_ROSDO/4-139...LW---------------------------------------------------------------------------
A9CHR5_AGRT5/4-139...LF---------------------------------------------------------------------------
Q74AR0_GEOSL/4-135...LF---------------------------------------------------------------------------
Q3B571_PELLD/35-169...LY---------------------------------------------------------------------------
Q9ATP8_ACEAT/79-213...VL---------------------------------------------------------------------------
A4FW08_METM5/4-137...VF---------------------------------------------------------------------------
Q6A5I3_PROAC/4-137...VW---------------------------------------------------------------------------
Q54P64_DICDI/8-138...DL---------------------------------------------------------------------------
B4S6Q3_PROA2/35-169...LY---------------------------------------------------------------------------
Q0ALL0_MARMM/4-137...TL---------------------------------------------------------------------------
Q2VYN4_MAGSA/13-146...VF---------------------------------------------------------------------------
Q1AS10_RUBXD/6-139...VF---------------------------------------------------------------------------
Q82M72_STRAW/7-141...SA---------------------------------------------------------------------------
Q7VB57_PROMA/5-141...SL---------------------------------------------------------------------------
Q1GL71_SILST/4-137...IF---------------------------------------------------------------------------
Q10ZM3_TRIEI/4-136...VW---------------------------------------------------------------------------
A0JVY4_ARTS2/5-137...AW---------------------------------------------------------------------------
Q15T10_PSEA6/4-137...VF---------------------------------------------------------------------------
A2C801_PROM3/22-158...AW---------------------------------------------------------------------------
Q5FU53_GLUOX/6-140...LV---------------------------------------------------------------------------
A2E4I0_TRIVA/4-138...VY---------------------------------------------------------------------------
Q0SAT6_RHOSR/4-137...VW---------------------------------------------------------------------------
DHA_BACSU/4-135...VW---------------------------------------------------------------------------
Q1ZX33_PHOAS/4-137...VF---------------------------------------------------------------------------
Q2YIM6_BRUA2/6-139...DA---------------------------------------------------------------------------
Q0AGT6_NITEC/4-139...LY---------------------------------------------------------------------------
B9M3R5_GEOSF/4-135...LF---------------------------------------------------------------------------
Q1ZH92_9GAMM/4-137...IF---------------------------------------------------------------------------
Q5SLS7_THET8/4-135...AW---------------------------------------------------------------------------
Q6MUG7_MYCMS/10-140...VW---------------------------------------------------------------------------
Q21RZ9_RHOFD/27-163...LW---------------------------------------------------------------------------
Q0K0H4_CUPNH/6-146...LW---------------------------------------------------------------------------
Q47FY5_DECAR/6-139...VY---------------------------------------------------------------------------
A1SJK7_NOCSJ/4-137...TW---------------------------------------------------------------------------
Q7UIW1_RHOBA/5-140...VL---------------------------------------------------------------------------
Q5WXY4_LEGPL/4-137...VF---------------------------------------------------------------------------
LYS1_SCHPO/7-142...HA---------------------------------------------------------------------------
Q064R9_9SYNE/14-145...AW---------------------------------------------------------------------------
Q0AJH3_NITEC/4-136...AW---------------------------------------------------------------------------
Q3JEF4_NITOC/4-145...LW---------------------------------------------------------------------------
A1WCT5_ACISJ/4-136...W.---------------------------------------------------------------------------
O25948_HELPY/4-135...AW---------------------------------------------------------------------------
A1C559_ASPCL/85-224...LW---------------------------------------------------------------------------
Q55F30_DICDI/135-275...LF---------------------------------------------------------------------------
Q2G790_NOVAD/8-140....A---------------------------------------------------------------------------
B0K1G7_THEPX/4-137...VF---------------------------------------------------------------------------
Q7NWG7_CHRVO/4-137...VF---------------------------------------------------------------------------
Q1GKH6_SILST/5-139...DA---------------------------------------------------------------------------
Q1GVP3_SPHAL/4-137...IF---------------------------------------------------------------------------
A1K465_AZOSB/6-138...VF---------------------------------------------------------------------------
A5FAH7_FLAJ1/4-136...DI---------------------------------------------------------------------------
Q16BE6_ROSDO/4-137...IF---------------------------------------------------------------------------
A0NPS2_9RHOB/4-137...VF---------------------------------------------------------------------------
Q1V2K5_PELUQ/4-137...IF---------------------------------------------------------------------------
Q6KIJ0_MYCMO/4-134...VW---------------------------------------------------------------------------
Q8EPC2_OCEIH/4-136...AW---------------------------------------------------------------------------
A8M4N3_SALAI/8-142...EA---------------------------------------------------------------------------
Q1ARY0_RUBXD/7-141...VY---------------------------------------------------------------------------
Q6LMW4_PHOPR/33-171...IY---------------------------------------------------------------------------
A0AZX9_BURCH/4-137...IF---------------------------------------------------------------------------
A5G0H4_ACICJ/5-140...AL---------------------------------------------------------------------------
A5V5I3_SPHWW/4-142...TL---------------------------------------------------------------------------
Q7NEB1_GLOVI/4-136...VY---------------------------------------------------------------------------
Q60BB4_METCA/4-135...AW---------------------------------------------------------------------------
A0Z7A7_9GAMM/4-137...IL---------------------------------------------------------------------------
A1TXK5_MARAV/4-139...LY---------------------------------------------------------------------------
Q1IIW3_KORVE/4-145...VF---------------------------------------------------------------------------
Q07600_EIMTE/501-635...VI---------------------------------------------------------------------------
A7HTE3_PARL1/4-137...IF---------------------------------------------------------------------------
Q3APE7_CHLCH/6-140...LY---------------------------------------------------------------------------
Q5P1Y9_AROAE/6-139...VC---------------------------------------------------------------------------
Q8KEI3_CHLTE/17-148...VW---------------------------------------------------------------------------
Q2S0H0_SALRD/6-141...AT---------------------------------------------------------------------------
Q1YVY2_PHOPR/4-137...VF---------------------------------------------------------------------------
Q1M9L0_RHIL3/4-139...LF---------------------------------------------------------------------------
A8LIC1_DINSH/19-154...LF---------------------------------------------------------------------------
A0LWI4_ACIC1/4-137...AL---------------------------------------------------------------------------
Q8RME8_AMYMD/4-137...TW---------------------------------------------------------------------------
Q21M61_SACD2/4-145...LY---------------------------------------------------------------------------
Q0KA62_CUPNH/4-137...VY---------------------------------------------------------------------------
A1CKS0_ASPCL/7-145...DA---------------------------------------------------------------------------
A1RDP1_ARTAT/4-136...VW---------------------------------------------------------------------------
A0LUF0_ACIC1/4-137...VW---------------------------------------------------------------------------
Q4BZ65_CROWT/4-136...AW---------------------------------------------------------------------------
Q484K1_COLP3/4-137...CW---------------------------------------------------------------------------
B1KJ86_SHEWM/4-143...AF---------------------------------------------------------------------------
Q1N492_9GAMM/4-139...LY---------------------------------------------------------------------------
Q7UXF1_RHOBA/4-137...IF---------------------------------------------------------------------------
Q6MB39_PARUW/4-136...VY---------------------------------------------------------------------------
Q2UAA6_ASPOR/84-217...VW---------------------------------------------------------------------------
A0DTI6_PARTE/7-138...DL---------------------------------------------------------------------------
A1WZC8_HALHL/6-141...LL---------------------------------------------------------------------------
B2TCQ5_BURPP/4-137...VF---------------------------------------------------------------------------
Q480P6_COLP3/4-137...IF---------------------------------------------------------------------------
B8FRW7_DESHD/4-137...VY---------------------------------------------------------------------------
Q4P6J5_USTMA/9-143...SL---------------------------------------------------------------------------
Q8G5Z4_BIFLO/12-147...VL---------------------------------------------------------------------------
O44503_CAEEL/33-163...DL---------------------------------------------------------------------------
A7IGP9_XANP2/4-139...AL---------------------------------------------------------------------------
Q3IZY5_RHOS4/4-137...LF---------------------------------------------------------------------------
Q13HL5_BURXL/6-139...LV---------------------------------------------------------------------------
Q4SJ60_TETNG/61-200...VF---------------------------------------------------------------------------
Q6AA35_PROAC/43-176...AW---------------------------------------------------------------------------
Q16LL0_AEDAE/57-190...F.---------------------------------------------------------------------------
B3E8N4_GEOLS/4-135...LF---------------------------------------------------------------------------
B2UC87_RALPJ/4-136...L.---------------------------------------------------------------------------
A1VG31_DESVV/4-137...IY---------------------------------------------------------------------------
Q829A4_STRAW/4-137...VW---------------------------------------------------------------------------
Q5R0B7_IDILO/4-137...IF---------------------------------------------------------------------------
Q1JX18_DESAC/4-137...LF---------------------------------------------------------------------------
A0FL43_LACPA/28-158...SW---------------------------------------------------------------------------
Q2Y9W7_NITMU/4-139...LY---------------------------------------------------------------------------
A4SFA5_PROVI/35-169...LF---------------------------------------------------------------------------
O68519_MYXXA/4-138...VW---------------------------------------------------------------------------
Q2Y9W3_NITMU/6-138...AW---------------------------------------------------------------------------
Q2NZT7_XANOM/6-139...AV---------------------------------------------------------------------------
B3EKT2_CHLPB/35-169...LY---------------------------------------------------------------------------
A0ZAH3_NODSP/4-137...TW---------------------------------------------------------------------------
Q4SHM6_TETNG/10-149...AF---------------------------------------------------------------------------
A4SZU6_POLSQ/4-136...F.---------------------------------------------------------------------------
Q0F940_9RHOB/4-139...LY---------------------------------------------------------------------------
Q0U4J1_PHANO/7-146...TA---------------------------------------------------------------------------
A1B5J9_PARDP/5-139...GA---------------------------------------------------------------------------
Q6F836_ACIAD/4-136...AY---------------------------------------------------------------------------
Q0SGE0_RHOSR/15-145...PW---------------------------------------------------------------------------
Q6ANB3_DESPS/4-131...LF---------------------------------------------------------------------------
Q2SNB3_HAHCH/4-137...VF---------------------------------------------------------------------------
Q1Z2Q8_PHOPR/4-143...VW---------------------------------------------------------------------------
A1BEU6_CHLPD/35-169...LF---------------------------------------------------------------------------
Q2JLS3_SYNJB/4-136...IY---------------------------------------------------------------------------
Q5P3E2_AROAE/4-137...LY---------------------------------------------------------------------------
Q01VE2_SOLUE/4-138...IV---------------------------------------------------------------------------
B1JFG2_PSEPW/4-136...Y.---------------------------------------------------------------------------
A0JVR6_ARTS2/4-136...VW---------------------------------------------------------------------------
Q7N4Z3_PHOLL/4-137...IW---------------------------------------------------------------------------
Q6NP53_DROME/69-199...DI---------------------------------------------------------------------------
O04709_MAIZE/19-156...DL---------------------------------------------------------------------------
Q0FRV1_9RHOB/5-139...EA---------------------------------------------------------------------------
A0AJ28_LISW6/4-136...AW---------------------------------------------------------------------------
Q0FA42_9RHOB/4-137...LF---------------------------------------------------------------------------
A8ZX21_DESOH/4-137...VW---------------------------------------------------------------------------
Q46N60_CUPPJ/4-136...F.---------------------------------------------------------------------------
A1ZCQ3_9BACT/4-136...DI---------------------------------------------------------------------------
Q021N9_SOLUE/6-147...VF---------------------------------------------------------------------------
Q3IYW2_RHOS4/5-139...TA---------------------------------------------------------------------------
Q3AEB3_CARHZ/4-137...VF---------------------------------------------------------------------------
A1BEX7_CHLPD/4-135...VW---------------------------------------------------------------------------
Q48BS0_PSE14/4-136...F.---------------------------------------------------------------------------
A0PWE2_MYCUA/9-139...AW---------------------------------------------------------------------------
LYS1_CANAX/9-144...TA---------------------------------------------------------------------------
LYS1_YARLI/8-142...SA---------------------------------------------------------------------------
Q5SIC7_THET8/4-139...AF---------------------------------------------------------------------------
B2TAE0_BURPP/4-137...LW---------------------------------------------------------------------------
Q1GIS5_SILST/4-139...LW---------------------------------------------------------------------------
B2JGI7_BURP8/4-136...F.---------------------------------------------------------------------------
Q1AW21_RUBXD/4-137...VY---------------------------------------------------------------------------
B4SD94_PELPB/35-169...LY---------------------------------------------------------------------------
Q16C99_ROSDO/5-139...DA---------------------------------------------------------------------------
A7NQG5_ROSCS/4-138...IY---------------------------------------------------------------------------
A6WFF9_KINRD/4-137...VW---------------------------------------------------------------------------
A2C3U2_PROM1/5-141...VK---------------------------------------------------------------------------
A1B9C0_PARDP/4-139...LI---------------------------------------------------------------------------
A3QAN8_SHELP/4-140...VL---------------------------------------------------------------------------
Q8XRA9_RALSO/4-136...L.---------------------------------------------------------------------------
A0LMX7_SYNFM/4-137...VW---------------------------------------------------------------------------
Q47RB8_THEFY/4-137...VW---------------------------------------------------------------------------
PNTAA_RHORU/4-144...AL---------------------------------------------------------------------------
B2JLD8_BURP8/4-137...VF---------------------------------------------------------------------------
Q128A6_POLSJ/4-137...VF---------------------------------------------------------------------------
Q04WC6_LEPBJ/4-137...II---------------------------------------------------------------------------
Q7P1W1_CHRVO/4-138...ML---------------------------------------------------------------------------
A0PQF0_MYCUA/4-137...VW---------------------------------------------------------------------------
A1IRJ4_NEIMA/4-137...VW---------------------------------------------------------------------------
Q8KEN6_CHLTE/6-140...LY---------------------------------------------------------------------------
Q6SH06_9BACT/4-137...IF---------------------------------------------------------------------------
Q2IJQ2_ANADE/4-137...VF---------------------------------------------------------------------------
A0NM55_9RHOB/8-143...LW---------------------------------------------------------------------------
Q0G2B1_9RHIZ/4-137...VF---------------------------------------------------------------------------
A4SWM0_POLSQ/4-137...VF---------------------------------------------------------------------------
B4SKQ7_STRM5/7-139...RW---------------------------------------------------------------------------
Q1QDC7_PSYCK/5-139...VV---------------------------------------------------------------------------
A0ZDC5_NODSP/19-159...LW---------------------------------------------------------------------------
A1VTW8_POLNA/4-136...Y.---------------------------------------------------------------------------
A9BR27_DELAS/4-136...L.---------------------------------------------------------------------------
Q4BYI1_CROWT/5-144...LW---------------------------------------------------------------------------
A6VWR5_MARMS/6-139...LV---------------------------------------------------------------------------
A4XPH7_PSEMY/4-137...VF---------------------------------------------------------------------------
Q26D16_FLABB/4-137...VY---------------------------------------------------------------------------
Q1QT97_CHRSD/4-137...LW---------------------------------------------------------------------------
B0SVI3_CAUSK/5-140...AL---------------------------------------------------------------------------
A1HRL4_9FIRM/4-137...LF---------------------------------------------------------------------------
Q1WRC5_LACS1/4-135...AW---------------------------------------------------------------------------
B0T233_CAUSK/4-137...VF---------------------------------------------------------------------------
Q28K30_JANSC/4-138...SA---------------------------------------------------------------------------
Q1KZW0_9BRAD/4-137...VF---------------------------------------------------------------------------
B3EDZ5_CHLL2/4-135...VW---------------------------------------------------------------------------
Q9AIK2_BILWA/4-136...CW---------------------------------------------------------------------------
A0KWV9_SHESA/4-137...VF---------------------------------------------------------------------------
A0Z8G6_9GAMM/4-139...LL---------------------------------------------------------------------------
Q2CCA0_9RHOB/4-137...VF---------------------------------------------------------------------------
A9VUJ6_BACWK/4-136...VW---------------------------------------------------------------------------
A5V806_SPHWW/4-137...VF---------------------------------------------------------------------------
Q31MS7_SYNE7/28-167...LW---------------------------------------------------------------------------
Q03RI6_LACBA/4-135...AW---------------------------------------------------------------------------
B7WZ89_COMTE/27-163...LW---------------------------------------------------------------------------
A4J8G7_DESRM/4-137...VF---------------------------------------------------------------------------
Q5KUA3_GEOKA/4-136...VW---------------------------------------------------------------------------
Q11IF1_MESSB/4-137...VF---------------------------------------------------------------------------
Q0IBP4_SYNS3/5-141...AW---------------------------------------------------------------------------
A1ZGV6_9BACT/4-137...IY---------------------------------------------------------------------------
P73496_SYNY3/23-158...LF---------------------------------------------------------------------------
A1V078_BURMS/79-211...F.---------------------------------------------------------------------------
Q15PN0_PSEA6/5-140...LL---------------------------------------------------------------------------
Q7VV14_BORPE/4-136...L.---------------------------------------------------------------------------
Q12QQ7_SHEDO/4-145GNTVW---------------------------------------------------------------------------
A7HUT9_PARL1/4-139...AL---------------------------------------------------------------------------
Q2CKD5_9RHOB/4-138...SA---------------------------------------------------------------------------
Q03HP9_PEDPA/4-134...AW---------------------------------------------------------------------------
A2BXK8_PROM5/5-141...IW---------------------------------------------------------------------------
A0YVL7_LYNSP/4-136...VW---------------------------------------------------------------------------
Q3A7G8_PELCD/26-159...VY---------------------------------------------------------------------------
Q5DZZ0_VIBF1/4-143...VW---------------------------------------------------------------------------
Q01VQ6_SOLUE/4-137...VW---------------------------------------------------------------------------
DHA_LYSSH/4-137...AW---------------------------------------------------------------------------
Q7VA67_PROMA/14-145...AW---------------------------------------------------------------------------
Q10VQ6_TRIEI/4-139...LW---------------------------------------------------------------------------
A0M2A6_GRAFK/33-166...IF---------------------------------------------------------------------------
C1DKG5_AZOVD/4-137...LY---------------------------------------------------------------------------
A8H092_SHEPA/19-156...LF---------------------------------------------------------------------------
Q0FFN0_9RHOB/5-137...SA---------------------------------------------------------------------------
A1A1C3_BIFAA/12-147...VI---------------------------------------------------------------------------
Q11SC0_CYTH3/13-146...VF---------------------------------------------------------------------------
DHA1_STAAM/4-134...AW---------------------------------------------------------------------------
A8LLI3_DINSH/4-137...VF---------------------------------------------------------------------------
Q3AI65_SYNSC/8-144...AW---------------------------------------------------------------------------
Q11EJ3_MESSB/6-139...DA---------------------------------------------------------------------------

PF05221

SAHH_RHOCB/2-462ALQAAMDGFEVVVLEDVVADAD....IFITTTGNKDVIRIEHMREMKDMAIVGNIGHFDNEIQVAALKNHKWTNIKDQVD
SAHH_YEAST/6-448ALQAAMEGYQVVTMEDASHIGQV..FVTTTGCRDIINGEHFINMPEDAIVCNIGHFDIEIDVAWLKANAKECINIKPQVD
SAHH_CATRO/12-484ALQATMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDR
SAHH2_DROME/66-491ALQAAMDGFRVVRLNEVIRTVD...VVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQV
SAHH_LEIDO/2-436ALQASMEGYQVALVEDVMADAHI..FVTTTGNDDIITSEHFPHMRDDAIVCNIGHFDTEIQVGWLEANAKEHVEIKPQVD
SAHH_TRIVA/11-485ALQAVMEGYQVRRIEEVVKDVDI.FVTCTGNCDIISVDMMAQMKDKAIVGNIGHFDNEIDTDGLMKYPGIKHIPIKPEYD
SAHH_CAEEL/6-436ALQAAMEGYEVTTLEEAAPKANI..IVTTTGCKDIVTGKHFELLPNDAIVCNVGHFDCEIDVKWLNTNATKKDTIKPQVD
SAHH_PLAF7/4-478AIQAVMEGFNVVTLDEIVDKGDF.FITCTGNVDVIKLEHLLKMKNNAVVGNIGHFDDEIQVNELFNYKGIHIENVKPQVD
SAHH_MOUSE/5-431ALQAAMEGYEVTTMDEACKEGNI..FVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVD

PF00389

Q9JY94_NEIMB/3-329EAEKIGGKYVDLDELYARSDIIT......LHCPATPENHYML-----------------------------NEAAFDKMK
O30440_BORPT/4-317PLGNARAAGSLAELLEQAD................VVTLHVP-----------------------------GGKSTQNIV
SERA_ARATH/85-394DRARALGVDLVSFDQAIS..................TADFVS-----------------------------LHMPLTPAT
Q9RUU0_DEIRA/18-329KFERLGVQRAASLDELLG..................QVDALT-----------------------------VHTPLTDET
Q98F95_RHILO/5-315KRAEELGVEKVELDELF...................ARADFI-----------------------------TLHTPLTDK
Q99R78_STAAM/6-332NAKIATYVDYKDTIEEAVEGADIV....TLHVPATKYNHYLF-----------------------------NAELFKHFK
E9ACF1_LEIMA/115-427AIGNATKFTHINDLLTFSD................FVTIHVP-----------------------------ETDVTKGMI
Q9KEA4_BACHD/2-311SSFDQIVPPASVDTLLK...................NSDFVV-----------------------------SVLPFTKRT
O28495_ARCFU/4-322RAEDIEEYGVEFRDFDALL...............READIVSL-----------------------------HVPLTEETR
Q9KLW1_VIBCH/3-321SRQKALELGYQAAADKAEF..............FAKADVLSL-----------------------------HLRLNDATR
Q9CKF1_PASMU/14-327PLGNAQQLRTLEELLSSCD................VVSLHVP-----------------------------ENASTKNLI
SERA_SHIFL/13-326PLGNATQVQHLSDLLNMSD................VVSLHVP-----------------------------ENPSTKNMM
SERA_ARCFU/3-312ERAEQIGVKLVDFDTLLA..................SSDVIT-----------------------------VHVPRTKET
O58256_PYRHO/5-318SRHRKVNVEKELKARYMDID.............ELLEKSDIV-----------------------------ILALPLTRD
Q9X4A4_STAAU/4-319RHKDAEADFNATYVSFETL...............LAESDFII-----------------------------CTAPLTKET
Q99T17_STAAM/2-311DEFDEIYTIESLESTLP...................NADIII-----------------------------NALPETQET
CTBP_DROME/30-352YDPYLPDGIDKSLGLTRVYTLQ.........DLLFQSDCVSL-----------------------------HCTLNEHNH
Q9VKI8_DROME/8-324AEAKAAGIEKMTLEEIWPL................ADYITVH-----------------------------TPLIPATRN
Q97IU7_CLOAB/3-326EVKAHAKYVKLEELLMSSDVITV.......HVPGAEDNYHLI-----------------------------NKNSISKMK
GHRB_ECO57/5-319RHHKEAEERFNARYCDLDT..............LLQESDFVC-----------------------------LILPLTDET
YEAA_SCHPO/9-327EEEAEGAEFVSFDDLLA....................KSDVL-----------------------------SLNLPLNAH
LDHD_LEUMC/3-330ELQAEGLYVDTLDELYAQADAIS......LYVPGVPENHHLI-----------------------------NADAIAKMK
Q9KP92_VIBCH/13-326SLGNATQVHTLSELLNKCD................VISLHVP-----------------------------ETAGTKNMM
Q9I1L0_PSEAE/4-318SPKPHVEERYAASYRPLDA..............LLEESDFVC-----------------------------LTLPLTAAT
Q98BH4_RHILO/9-329HRVLPAVEDGLEATYWESLDQ..........MLARMDIISVN-----------------------------CPSTPATFH
P74586_SYNY3/3-330KFTAIGQALYVSLNELLAHSDIIS.....LHCPLLPETHYLI-----------------------------NTNTIAQMK
Y2305_STAAM/4-317RKEEKEREIGAKYVDLDTL................LKNADFI-----------------------------TINAAYNPK
Q59463_HYPME/6-322RAKPEVEAKYNATYHDSLD..............SLLKVSQFF-----------------------------SINAPSTPE
DDH_ZYMMO/3-331PELAKKVGFRFTSLDEVIETSDII....SLHCPLTPENHHMI-----------------------------NEETLARAK
TKRA_BACSU/6-322HRKQETEDSIGVKYAELDT..............LLEQSDFIL-----------------------------LITPLTDET
Q9ZKF4_HELPJ/4-314SSKATDLGVIYTKNFEDI..................LQCDMI-----------------------------TIHTPKNKE
Q9A244_CAUCR/24-340PVSPRIAEELGCTYWESLD..............QMLARMDFV-----------------------------SVNCPHTPA
SERA_SCHPO/58-378PLGSAKQLSSLPELLHRADFVS........LHVPASPETKNM-----------------------------ISSKEFAAM
GYAR_THELI/5-322YSRTRKPEAEEEIGAEYVDF............ETLLKESDFI-----------------------------SLHVPLTKE
Q98LH4_RHILO/9-326APPGIELVDFPTLVEQ.....................SDFLT-----------------------------LHATPSPDN
Q9BLF6_OCTVU/5-323KESSFAQELGAEFVDLETL...............LKDSDVIC-----------------------------ICCNLTPAT
Q99TE0_STAAM/6-315EKAKSLSITKATVDEIA...................QHSDFV-----------------------------TLHTPLTPK
Q9S2M5_STRCO/3-328ACAELGMRYVAKDELLARSDLIT......LHVPLMAETRHLI-----------------------------DATALKAMR
SERA_METJA/4-312EVAESMGVELVDDINELC..................KRADFI-----------------------------TLHVPLTPK
PTXD_PSEST/5-326LDTQTEQRLGLRQVACSELFAS........SDFILLALPLNA-----------------------------DTQHLVNAE
LDHD_STRP1/3-330DAAKAVLDYKESVEEAIKDADLVS.....LHMPPTAENTHLF-----------------------------NSDLFKSFK
Q9LE33_ARATH/9-321KQSSPYRYYSDILSLAE....................NNDVL-----------------------------VLCCSLTDE
Q9HXB7_PSEAE/5-318NRKPELEQELGARFLGFDE...............LLGEADFV-----------------------------CVVVPLGAQ
O67741_AQUAE/4-320EKAEKLGVKLVDNLHDMLRE............IDVLTIHAPL-----------------------------THETKNMID
SERA_METTH/6-313EAAEEMGVTVTDLETLL...................RESDIV-----------------------------TIHVPLTPE
LDHD_PEDAC/3-329ALEKEGMYVDTLEELYQQANVIT......LHVPALKDNYHML-----------------------------DEKAFGQMQ
Q9UYH9_PYRAB/5-318SRHRKEDIEREVNAKYLDLD.............ELLEEVDIV-----------------------------ILALPLTKE
DDH2_SCHPO/3-330KKLENYGVQFVEQNEVLKKADFLC.....LHCPLTPSTTHIV-----------------------------NSDSLALMK
Q9CA90_ARATH/6-313PDVAYKYYPTVVDLAQ.....................NSDIL-----------------------------VVACPLTEQ
Q48534_9LACO/4-332NPEFEPFLTYTDFDTVLKEADIVS.....LHTPLFPSTENMI-----------------------------GEKQLKEMK
LDHD_ECOLI/3-329AALELGVEYVDLPTLFSESDVIS......LHCPLTPENYHLL-----------------------------NEAAFEQMK
SERA_RAT/9-317EVAASFGVQQLPLEEIW...................PLCDFI-----------------------------TVHTPLLPS
Q9A6E7_CAUCR/11-318KETDYPRADSLMALAR.....................DSDVL-----------------------------IVCARPDDS
Q9HMR0_HALSA/3-311DRAAQLGAELVDIETCV...................ARADFL-----------------------------TIHVPLTDE
Q9WYG2_THEMA/4-311SVRLLEATPVDDLEQLLK..................ESDFVS-----------------------------LHVPLNEST
CTBP2_RAT/36-358YDPYLQDGIERSLGVQRVYTLQ.........DLLYQSDCVSL-----------------------------HCNLNEHNH
Q9PBD8_XYLFA/15-328SLGNARPAASLDELLGIAD................VVTLHVP-----------------------------ETAATKNML
Q89388_PBCV1/32-362IVKEMGVEYMSLPDVIKESDVLSLHCPLMKSTFHMINEDTLK-----------------------------TMKKTAVII
LDHD_TREPA/3-330DAAKEWLTYVSMDELLSTSDVIS......LHMPATKDSHHLI-----------------------------NAKTIAQMK
Q97MV2_CLOAB/3-317LEVIGVNYVTLDELLAK...................SDVISV-----------------------------HVPQTQETI
Q97U35_SULSO/2-295TMLREKIGEADIIV.........................DTL-----------------------------PLNKQTRGL
Q9A3I9_CAUCR/6-314ERAVEMGVEKVELDELL...................ARADVI-----------------------------TLHTPLTDK
Q9RKF9_STRCO/17-329PDAQTFRGFRSVGLHELL.................ERAQVVS-----------------------------VHTPLTEQT
Q9RNB7_MICAE/18-330PASKAETVGATLLKDLDVL...............LAESDFVS-----------------------------LHTELTSET
LDHD_STAAU/4-330KDLDFLTYKDSVKEAIKDADIIS......LHVPANKESYHLF-----------------------------DKAMFDHVK
Q9LT69_ARATH/49-358DRARAIGVELVSFEVAIS..................TADFIS-----------------------------LHLPLTAAT
GYAR_AERPE/6-324HSRSRKREIEKELGAEYRSLE...........DLLRESDILS-----------------------------IHLPLTDET
DDH_HAEIN/3-329VVEELGGQYVELDELYAKSHVIT......LHCPATPENYHLL-----------------------------NCEAFAKMK
O17626_CAEEL/8-316EQAEAKNIELLSLEQIW...................PQADYI-----------------------------TVHVPLIKQ
PDXB_PSEAE/3-285VISLHTPL..................................-----------------------------...NRDGEH
SERA_YEAST/61-381ALGTARQVSTLDELLNKSDFVT........LHVPATPETEKM-----------------------------LSAPQFAAM
YGDH_SCHPO/9-332AEEEKRLGASFVSFDELL..................SSSDVI-----------------------------SINCPLTPA
Q20595_CAEEL/181-504YDPFVREGHDKALGFERVYTMD........EFMSRSDCISLH-----------------------------CNLGDETRG
DHD2_LACPA/3-329KGDHPDFDYVSLEDLFKQSDVID......LHVPGIEQNTHII-----------------------------NEAAFNLMK
Q9KCG9_BACHD/20-325ARAEKLGVTVASLDDVL...................QVADII-----------------------------TVHTPLTKE
SERA_MYCLE/6-313ARAAQLGIELMSFDDLL...................ARADFI-----------------------------SVHLPKTPE
Q9I530_PSEAE/3-328RIQALGGRYLALDALLAESDIVS......LHCPLTADTRHLI-----------------------------DAQRLATMK
Q9VII9_DROME/10-326TRKENDGDFKAEHVSFEQL...............LQESDFLV-----------------------------VAAPLTNET
O66939_AQUAE/3-332EDLKEKGCVYTSLDELLKESDVISL...HVPYTKETHHMINE-----------------------------ERISLMKDG
Q9HVG5_PSEAE/7-321QLPGRPARADRLPLGELLP...............RVDALTLH-----------------------------CPLTEDTRG
GHRB_ENTAG/5-318KHHEEAESRFNAQYCDLDT..............LLRESDFLC-----------------------------ISLPLTEQT
Q98CG2_RHILO/11-318RVEGLAYQYHPTLRGLA...................EAVDTL-----------------------------ISVAPGGAS
GRHPR_HUMAN/9-327QPRPEEAAEFQAEFVSTPE..............LAAQSDFIV-----------------------------VACSLTPAT
Q9KMX4_VIBCH/4-330DAIALGARYVELSELFAQSDVIT......LHCPMSKENYHLL-----------------------------NESAFDQMK
Q9K7P7_BACHD/3-318RNEQAEKELGATYCSLDHL...............LARSDYVV-----------------------------LLAPSTDET
Q9I6H5_PSEAE/13-326PLGNAVQIGSLHELLGMSD................IVSLHVP-----------------------------ELPSTQWMI
Q9HK29_THEAC/3-309AEEEEYGATFVSLDRLL...................SDSDVI-----------------------------SVHVPLNET
Q9ZH60_LACJH/4-331ELEKKGYYVDSLDDLYKQADVIS......LHVPDVPANVHMI-----------------------------NDESIAKMK
Q98GE4_RHILO/8-315SMQPAPEKVGFLSIDALV.................EQSDIIV-----------------------------LCCPLTPET
DDH1_SCHPO/3-330KELEKFGIQFVEQQEVLAKADFLC.....LHCPLTPDTEHLV-----------------------------DEKLLASMK
PDXB_VIBCH/3-286VITLHTPI..................................-----------------------------...TRGGEW
DHGY_METEA/5-313DVFPQDGLVDLETILTQS..................DVITLH-----------------------------VPLTPDTKN
Q97ZK1_SULSO/20-326ANIVGVRVAESLEELLKN..................SDVITF-----------------------------HVTVGKDAK
GYAR_PYRAB/6-323YSRTRKPEVEKELNAEFKPL............DELLRESDFV-----------------------------VLAVPLNKE
Q97F10_CLOAB/3-323TPHPDKKYENESMKFVSLDT.............LFKEADVIS-----------------------------LHCPLKDDN
Q9Z564_STRCO/7-314ARAAQMGVKVLSLDELL...................EVSDFI-----------------------------TVHLPKTPE
LDHD_LACPE/3-330ELEKEGMYVDTLDELYAQADVIT......LHVPALKDNYHML-----------------------------NADAFSKMK
SERA_SYNY3/32-339ERADQIGCTLVDLDLLF...................SEADFI-----------------------------TLHIPKTPE

PF05222

NNTM_BOVIN/60-199------------------------------------A.SDLV-----------------------------VKVRAP..M
Q7RV12_NEUCR/59-195------------------------------------NNAD