Sequence alignment for CL0326

PF04582

Q83931_9REOV/1-326-MDGLTQQQRREVVGLILSLTSSVTINPGDLTQIRERLSALESANASLSESVNTALSRLTDLS--AALGNMATSVAEMKV
Q9DPB4_9REOV/1-326-MAGLTPSQRREVVGLILSLTSSANTNCGDLTPVYDRLLSLESAVASLDGSVGVLSQKVSDLE--SDLQGVVSSLGQANS
A7J362_9REOV/1-326-MAGLNPSQRREVVSLILSLTSNVTISHGDLTPIYERLTNLEASTELLHRSISDISTTVSNIS--ANLQDMTHTLDDVTA
Q9DPB5_9REOV/1-326-MAGLNPLQRREVVSLILSLTSSTTTNPGDLTAVYERLTNLEASTKSLRQSLSSIVSDLSDVS--VDLQDTTRALDDAIA

PF01664

SIGM1_REOVJ/244-462-ISGLPARTGSLEASRIDVVAPPLVIQSTGSTRLLRLM--YEAVDFVVTNNVLTLRNRSVTPT--FKFPLELNSADNSVS
SIGM1_REOVD/239-454-FDSINSRIGATEQSYVASAVTPLRLNSS..TKVLDML--IDSSTLEIN.SSGQLTVRSTSPN--LRYPIADVSGG..IG
SIGM1_REOVL/251-469-INELPSRVSTLESAKIDSVLPPLTVREASGVRTLSFG--YDTSDFTIINSVLSLRSRLTLPT--YRYPLELDTANNRVQ

PF00541

SPIKE_ADE02/401-578LWTTPDPSPNCRIHSDNDCKFTLVLTKCG--SQVLATV-----AALAVSGDLSSMTGTVASVSIFLRFDQNGVLMENSSL
Q71BV8_AD01A/401-578LWTTPDPSPNCQIHSEKDAKLTLVLTKCG--SQVLATV-----SALAVRGSLAPISGTISSAHIILRFNEHGVLMNHSSL

PF04582

Q83931_9REOV/1-326ELNSLISDVQALRTSLDSSSSELASLSLLVHDHDSSISDLQKESHALSGDITNLNSSVSAQGLTISSLEQRVQALEGGSS
Q9DPB4_9REOV/1-326TLTELSKELRQLSSSVDNLMTSLSDLSTTVSGNQAAIAGIQTSVHANTTDISNLKSSVSAISLNITDLERRVGDIESGSG
A7J362_9REOV/1-326NLDGLRTTVTALQDSVSILSTNVTDLTNTSSAHAATLSSLQTTVDGNSTAISNLKSDVSSNGLAITDLQDRVKSLESTAS
Q9DPB5_9REOV/1-326TLKGLNTTVAALQNSVASLSSTVNGLTDISSAHSEALSFLRTTIDGNTVAISNLKGDVSTNGLNIADLQNRMKSLESSTS

PF01664

SIGM1_REOVJ/244-462IHRNYRIRLGQWSGQLEYHTPSLR---------------WNAPVTVNLMRVDDW--------LILSFTRFSTSGILASGK
SIGM1_REOVD/239-454MSPNYRFRQSMWIGIVSYSGSGLN---------------WRVQVNSDIFIVDDY--------IHICLPAFDGFSIADGGD
SIGM1_REOVL/251-469VADRFGMRTGTWTGQLQYQHPQLS---------------WRANVTLNLMKVDDW--------LVLSFSQMTTNSIMADGK

PF00541

SPIKE_ADE02/401-578KKHYWNFRNGNSTNANPYTNA--------------------------VGFMPNL----------LAYPKTQSQTAKNN--
Q71BV8_AD01A/401-578DPQYWNFRKGDLTNATAYTNA--------------------------VGFMPNL----------KAYPKTQSRTAKSN--

PF04582

Q83931_9REOV/1-326TSLLFADPLKLEAGTVSLELDPYFCSVSRNLTSYSADAQLMQFQWSVKGEDGATNSIDMDVNAHCHGPRTDYLMSTKQSL
Q9DPB4_9REOV/1-326PNLRFVSPLSLSQGVVSLVMDPYFCSDNQALTSYSTDAQLMQFQWLARGEDGSSSSVDMLVNRHCHGRRTDYMMSTTESF
A7J362_9REOV/1-326HGLSFSPPLSVADGVVSLDMDPYFCSQRVSLTSYSAEAQLMQFRWMARGTNGSSDTIDMTVNAHCHGRRTDYMMSSTGNL
Q9DPB5_9REOV/1-326HGLSFSPPLSVADGVVSLDMDPYFCSQRVSLTSYSAEAKLMQFQWMAKGTSGSSDVIDMTVNAHCHGRRTDYMMSSTGGL

PF01664

SIGM1_REOVJ/244-462FVLNFVT--GLSPGWATGSTEPSTT..TNPLSTTFAAIQFI---------NGSS--------------------------
SIGM1_REOVD/239-454LSLNFVT--GLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLS---------SGGA--------------------------
SIGM1_REOVL/251-469FVINFVS--GLSSGWQTGDTEPSST..IDPLSTTFAAVQFL---------NNGQ--------------------------

PF00541

SPIKE_ADE02/401-578---------IVSQVYLHGDKTKPMI-LTITLNGTSESTETS---------------------------------------
Q71BV8_AD01A/401-578---------IVSQVYLNGEKEKPMT-LTITLNGTDENQTT.---------------------------------------

PF04582

Q83931_9REOV/1-326TITASPATLVFELDRITKLPPDLSRLIPCHGFQQATFPVDISFQRDGVSHSYQVYGTYTSSRVFKITFSPGASGPAVIQF
Q9DPB4_9REOV/1-326TVTGNSVSLVFNLDYITKPPSDMSRLVPRAGFQAASFPVDVSFTRDTTTHAYQVYGAFSSPRVFKITFLTGGTGTANLRF
A7J362_9REOV/1-326TVTSNVVLLTFDLSDITHIPSDLARLVPSAGFQAASFPVDVSFTRDSATHAYQAYGVYSSSRVFTITFPTGGDGTANIRS
Q9DPB5_9REOV/1-326TVTSNAVSLTFSLDYITNMPSDLSRLIPSVGFQAASFPVDVSFTRDSATHSYQVYGAYSSARVFTITFPTGGNGTSNIRF

PF01664

SIGM1_REOVJ/244-462-------------------RVDAFRILGVAEWNAGELEITN-HGGTYTAHTNVDWAP------MTIMYPCLG--------
SIGM1_REOVD/239-454-------------------PQYMSKNLWVEQWQDGVLRLRV-EGGGSITHSNSKWPA------MTVSYPRSF--------
SIGM1_REOVL/251-469-------------------RIDAFRIMGVSEWTDGELEIKN-YGGTYTGHTQVYWAP------WTIMYPCNV--------

PF00541

SPIKE_ADE02/401-578-------------------EVSTYSMSFTWSWESG..KYTT---ETFATNS------------YTFSY------------
Q71BV8_AD01A/401-578-------------------PASTYSISFSWSWPSNQTYIG.---QTFATNS------------YTFSY------------

PF04582

Q83931_9REOV/1-326LTVRTGIDT
Q9DPB4_9REOV/1-326LTVRTGIDT
A7J362_9REOV/1-326LTVRTGIDT
Q9DPB5_9REOV/1-326LTVRTGIDT

PF01664

SIGM1_REOVJ/244-462---------
SIGM1_REOVD/239-454---------
SIGM1_REOVL/251-469---------

PF00541

SPIKE_ADE02/401-578---------
Q71BV8_AD01A/401-578---------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window