Sequence alignment for CL0326

PF04582

Q83931_9REOV/1-326MDGLTQQQRREVVGLILSLTSSVTINPGDLTQIRERLSALESANASLSESVNTALSRLTDLSAALGNMATSV-AEMKVEL
Q9DPB4_9REOV/1-326MAGLTPSQRREVVGLILSLTSSANTNCGDLTPVYDRLLSLESAVASLDGSVGVLSQKVSDLESDLQGVVSSL-GQANSTL
Q9J1B6_9REOV/1-326MAGLNPSQRREVVSLILSLTSNVTISHGDLTPIYERLTNLEASTELLHRSISDISTTVSNISANLQDMTHTL-DDVTANL
Q9DPB5_9REOV/1-326MAGLNPLQRREVVSLILSLTSSTTTNPGDLTAVYERLTNLEASTKSLRQSLSSIVSDLSDVSVDLQDTTRAL-DDAIATL

PF01664

SIGM1_REOVJ/244-462ISGLPARTGSLEASRIDVVAPPLVIQSTGSTRLLRLM--YEAVDFVVTNNVLTLRNRSVTPTFKFPLELNSA-DNSVSIH
SIGM1_REOVD/239-454FDSINSRIGATEQSYVASAVTPLRLNSS..TKVLDML--IDSSTLEIN.SSGQLTVRSTSPNLRYPIADVSG-G..IGMS
SIGM1_REOVL/251-469INELPSRVSTLESAKIDSVLPPLTVREASGVRTLSFG--YDTSDFTIINSVLSLRSRLTLPTYRYPLELDTA-NNRVQVA

PF00541

O56783_ADE17/186-362----------------------LWTTPDT.SPNCRI...DKEKDSKLTLVLTK.CGSQILANVSLIVV.SGK.YQYIDHA
A2I928_ADE03/100-281----------------------LWTGPKP.EANCIIEYGKENPDSKLTLILVK.NGGIVNGYVTLMGA.SDY.VNTLFKN
Q27W86_9ADEN/114-297----------------------LWTGIKP.PPNCQIVENTDTNDGKLTLVLVK.NGGLVNGYVSLVGV.SDT.VNQMFTQ
Q6QP89_9ADEN/266-439----------------------LWTTADP.SPNCKI...YSEKDAKLTLCLTK.CGSQILGTVTVLAVNNGS.LNPITNT
Q9DLD8_ADEB2/391-557----------------------LWTTPDP.SPNASI...KTDLDAKLVLTLSK.AGSTVIGTIGIFAL.KSP.LTPISEN
Q6BEA6_ADE04/248-421----------------------LWTTPDP.SPNCQI...LAENDAKLTLCLTK.CDSQILATVSVLVVRSGN.LNPITGT
Q6I7S0_ADE09/181-357----------------------LWTTPDT.SPNCRI...DQDKDSKLTLVLTK.CGSQILANVSLIVV.AGR.YKIINNN
Q09TX9_9ADEN/188-375----------------------LWTTPDP.SPNCKV...SEEKDSKLTLVLTK.CGSQILASVSLLVV.KGK.FANINNK
Q2Z0J9_9ADEN/122-300----------------------LWTTLDP.SPNCKI...DIEKDSKLTLVLTK.CGSQILANVSLIIV.NGK.FKILNNK
Q2Z0J6_9ADEN/116-300----------------------LWTTPDP.SPNCKV...ETARDSKLTLALTK.CGSQILATVSLLVV.TGK.YAIISDT
FIBP_ADEM1/388-608----------------------LWTGLPI.GNNGTF...HTKQDCKIFLSLTR.LGPMVHGTFML..Q.APQ.YELTTNG
FIBP_ADEB3/803-974----------------------LWTGTGS.NANVTW.RGYTAPGSKLFLSLTRFSTGLVLGNMTIDSN.ASF.GQYINAG
Q6QPC5_9ADEN/260-439----------------------LWTTPDP.SPNCQL...LSDRDAKFTLCLTK.CGSQILGTVAVAAVTVGSALNPINDT
Q6R2L0_ADE01/401-578----------------------LWTTPDP.SPNCQI...HSEKDAKLTLVLTK.CGSQVLATVSALAV.RGS.LAPISGT
O56784_9ADEN/182-355----------------------LWTTPDT.SPNCKM...SEVKDSKLTLILTK.CGSQILGSVSLLAV.KGE.YQNMTAS
Q2Z0I4_9ADEN/122-307----------------------LWTTPDP.SPNCKV...SEAKDSKLTLVLTK.CGSQILASVALLIV.KGK.YQTISES
Q67711_ADE16/163-348----------------------LWTGAKP.SANCVIKEGEDSPDCKLTLVLVK.NGGLINGYITLMGA.SEY.TNTLFKN
Q6QPG1_9ADEN/268-441----------------------LWTTADP.SPNCHI...YSEKDAKLTLCLTK.CGSQILGTVSLIAVDTGS.LNPITGT
A0MK70_9ADEN/197-359----------------------LWTPPTS.NPNCTV...YTESDSLLSLCLTK.CGAHVLGSVSLTGV.AGT.MTNMAET
Q5EY45_ADE07/134-320----------------------LWTGVNPTTANCQIMASSESNDCKLILTLVK.TGALVTAFVYVIGV.SND.FNMLTTH
Q2Z0I8_9ADEN/123-305----------------------LWTTPDP.SPNCKI...EQDKDSKLTLVLTK.CGSQILATMAFQVV.KGT.YENISKN
FIB1_ADE40/373-543----------------------LWTTADP.SPNATF...YESLDAKVWLVLVK.CNGMVNGTISIKAQ.KGT.LLKPTAS
Q2Z0J3_9ADEN/114-294----------------------LWTTPDP.SPNCRV...SEDKDSKLTLILTK.CGSQILASFSLLVV.KGT.YTTVDKN
Q96590_ADE02/401-578----------------------LWTTPDP.SPNCRI...HSDNDCKFTLVLTK.CGSQVLATVAALAV.SGD.LSSMTGT
Q83467_ADEP4/121-287----------------------LWTGPAP.EANVTF.SGENSPSGILRLCLSR.TGGTVIGTLSV....QGS.LTNPSTG
Q76DN6_ADE06/350-524----------------------LWTTPDP.SPNCRI...ASDKDCKLTLALTK.CGSQILGTVSALAV.SGN.MASINGT
Q2Z0J1_9ADEN/116-302----------------------LWTTPDP.SPNCKI...DQDKDSKLTFVLTK.CGSQILANMSLLVV.KGK.FSMINNK
Q0PLX4_ADES7/386-556----------------------LWTTADP.SPNCSV...YQDLDARLWLALVK.SGDMVHGSIALKAL.KGT.LLNPTAS
FIBP_ADE15/182-363----------------------LWTTPDP.SPNCKI...IEDKDSKLTLILTK.CGSQILGSVSLLVV.KGK.FSNINNT
Q2Z0H6_ADE18/113-285----------------------LWTTPDP.LPNCSL...LEDLDTKLTLCLSK.NGAIVHGVVSFVPV.KGA.LLNLQNP
Q2Z0J0_9ADEN/123-298----------------------LWTTPDT.SPNCKI...STEKDSKLTLVLTK.CGSQILASVSLLAV.AGS.YLNMTAS
Q2Z0K4_9ADEN/122-304----------------------LWTTPDP.SPNCKV...IEAKDSKLTLVLTK.CGSQILANMSLLIL.KGT.YEYISNA
Q2Z0J4_9ADEN/122-306----------------------LWTTPDP.SPNCKA...ETEKDSKLTLVLTK.CGSQILATVSIIVL.KGK.YEFVKKE
Q2Z0J8_9ADEN/122-305----------------------LWTTPDP.SPNCTI...DEERDSKLTLVLTK.CGSQILANVSLLVV.KGK.FSNINNN
A7LKA1_ADE31/379-552----------------------LWTTPDP.PPNCTL...RQELDAKLTLCLTK.NESIVNGIVSLIGV.KGD.LLHIQPT
Q2Z0K2_9ADEN/122-300----------------------LWTTLDP.SPNCRI...DVDKDSKLTLVLTK.CGSQILANVSLLVV.KGR.FQNLNYK
Q6VGT5_9ADEN/401-577----------------------LWTTPAP.SPNCRL...NAEKDAKLTLVLTK.CGSQILATVSVLAV.KGS.LAPISGT
FIBP_ADEP3/262-420----------------------LWTGASP.TANVIL.TNTTTPNGTFFLCLTR.VGGLVLGSFAL....KSS.IDLTSMT
Q5C8N5_9ADEN/386-556----------------------LWTTADP.SPNCSI...YTDLDAKMWLSLVK.QGGVVHGSVALKAL.KGT.LLSPTES
Q2Z0K0_9ADEN/121-296----------------------LWTTPDT.SPNCKM...LTKKDSKLTLTLTK.CGSQILGNVSLLAV.SGK.YLNMTKD
A4ZKM1_9ADEN/189-365----------------------LWTTPDT.SPNCKM...STEKDSKLTLTLTK.CGSQVLGNVSLLAV.TGE.YHQMTAT
Q8QVG3_ADEBA/970-1139----------------------LWTTPDP.SPNLNL...EGERTAKLFLSLSY.CNGSVIGTVAIRGL.KEP.VETIENS
FIBP_ADECT/365-537----------------------LWTGPGP.SINGFI...NDTPVIRCFICLTR.DSNLVTVNASFVG..EGG.YRIVSPT
Q695Q9_9ADEN/377-542----------------------LWTTPDP.SPNCNI...EGELDAKFVLALTT.TGTQVVGTCSIYGL.KT..LTNISST
Q0PLX5_ADES7/181-343----------------------LWTFPTK.TPNCTV...FTESDSLLSLCLTK.CGAHVLGSVSLSGV.AGT.MLKMTHT
Q2Z0K5_9ADEN/115-293----------------------LWTTPIH.LPTAQY...QKIKIQN.NLILTK.CGSQILASFSLLVV.KGT.YATVDKN

PF08932

Q71AW2_9CAUD/148-263----------------------ISVNDMT...VSGS---IDVPVQTLTV...E-AGNGLQLQLTKKNNDLVI--------
Q71AV4_9CAUD/148-261----------------------VIINSLV.....NK---KDIPWTDLNR...A-SGVGSTGILQARIINSVI--------
Q1RNE5_9CAUD/148-256----------------------LNTNS.....AKNS---FGA..........L-AGVNLLDNWYVQEMAGGL--------
Q71AW1_9CAUD/148-251----------------------VVINSIS..TTSGV---LDI...........-.GNGVTFSWQKKA.DIVE--------
Q1RNC4_9CAUD/153-268----------------------ISVNDIS...LKGS---LDVPTQKWTL...Q-TSNGLILQFTKKNNDLVI--------
Q1RNB3_9CAUD/181-296----------------------ISANDIS...LRGS---INVPTQMSTI...Q-TGNGLLLQFTKKNDDLVI--------
Q1RNB8_9CAUD/159-279----------------------ITTNTLIVKGVKGQ---RSAQVQTPTVYASI-TGTALEGFLLYRNGNVIT--------
Q1RND4_9CAUD/148-263----------------------ISANNIS...LKGS---IHVPTQMLTV...Q-TAPGLQLQLTKKNDDLVI--------
Q6JDF4_9CAUD/148-251----------------------VVINSIE..TKSGS---LSI...........-.GNGITFSWQKKG.EIVE--------

PF04582

Q83931_9REOV/1-326NSLISDVQALRTSLDSSSSELASLSLLVHDHDSSISDLQKESH-----ALSGDITNLNSSVSAQGLTISSL---------
Q9DPB4_9REOV/1-326TELSKELRQLSSSVDNLMTSLSDLSTTVSGNQAAIAGIQTSVH-----ANTTDISNLKSSVSAISLNITDL---------
Q9J1B6_9REOV/1-326DGLRTTVTALQDSVSILSTNVTDLTNTSSAHAATLSSLQTTVD-----GNSTAISNLKSDVSSNGLAITDL---------
Q9DPB5_9REOV/1-326KGLNTTVAALQNSVASLSSTVNGLTDISSAHSEALSFLRTTID-----GNTVAISNLKGDVSTNGLNIADL---------

PF01664

SIGM1_REOVJ/244-462RNYRIRLGQWSGQLEYHTPSLR---------------WNAPVT-----VNLMRVDDW--------LILSFT---------
SIGM1_REOVD/239-454PNYRFRQSMWIGIVSYSGSGLN---------------WRVQVN-----SDIFIVDDY--------IHICLP---------
SIGM1_REOVL/251-469DRFGMRTGTWTGQLQYQHPQLS---------------WRANVT-----LNLMKVDDW--------LVLSFS---------

PF00541

O56783_ADE17/186-362TNPTL..KSFKIKLLFDNKGV----------------LLP........SSNLDSTYWNF.....................
A2I928_ADE03/100-281KN.....VSINVELYFDATGH----------------ILP........DLSSLKTDLQL.....................
Q27W86_9ADEN/114-297KS.....ATIQLRLYFDSSGN----------------LLT........DESNLKIPLKN.....................
Q6QP89_9ADEN/266-439VS......TALVSLKFDASGV----------------LLS........SSTLDKEYWNF.....................
Q9DLD8_ADEB2/391-557........SINVEIFFDANGE----------------INL........TTSSLKSYWGF.....................
Q6BEA6_ADE04/248-421VS......SAQVFLRFDANGV----------------LLT........EHSTLKKYWGY.....................
Q6I7S0_ADE09/181-357TQPAL..KGFTIKLLFDKNES----------------LWN........SSNLGKSSWNF.....................
Q09TX9_9ADEN/188-375TNPGEDYKKFSVKLLFDANGK----------------LLT........GSSLDGNYWNY.....................
Q2Z0J9_9ADEN/122-300TDPSLP.KSFNIKLLFDQNGV----------------LLE........NSNIEKQYLNF.....................
Q2Z0J6_9ADEN/116-300VNP....KQFSIKLLFNDKGV----------------LLS........DSNLDGTYWNY.....................
FIBP_ADEM1/388-608........MREITFSFNSTGG----------------L..........EQPAPVTYWGALDPPPTAKAAEIENQKRVKKR
FIBP_ADEB3/803-974HE......QIECFILLDNQGN----------------LK.........EGSNLQGTWEV.....................
Q6QPC5_9ADEN/260-439VK......SAIVFLRFDSDGV----------------LMS........NSSMVGDYWNF.....................
Q6R2L0_ADE01/401-578IS......SAHIILRFNEHGV----------------LMN........HSSLDPQYWNF.....................
O56784_9ADEN/182-355TN.....KNVKITLLFDANGV----------------LLE........GSSLDKEYWNF.....................
Q2Z0I4_9ADEN/122-307TIPKDQ.RNFSVKLMFDEKGK----------------LLD........KSSLDKEYWNF.....................
Q67711_ADE16/163-348NQ.....VTIDVNLAFDNTGQ----------------IIT........YLSSLKSNLNF.....................
Q6QPG1_9ADEN/268-441VT......TALVSLKFDANGV----------------LQS........SSTLDSDYWNF.....................
A0MK70_9ADEN/197-359........SLAIEFTFDDTGK----------------LL.........HSPLVNNTFSI.....................
Q5EY45_ADE07/134-320KN.....INFTAELFFDSTGN----------------LLT........SLSSLKTPLNH.....................
Q2Z0I8_9ADEN/123-305TAK....KSFSIKLLFDDNGK----------------LLE........GSSLDKDYWNF.....................
FIB1_ADE40/373-543........FISFVMYFYSDGT----------------WRKNYPVFDNEGILANSATWGY.....................
Q2Z0J3_9ADEN/114-294TTN....KQFSIKLLFDANGK----------------LKS........ESNLSG.YWNY.....................
Q96590_ADE02/401-578VA......SVSIFLRFDQNGV----------------LME........NSSLKKHYWNF.....................
Q83467_ADEP4/121-287Q.......TLGMNLYFDADGN----------------VLS........ESNLVRGSWGM.....................
Q76DN6_ADE06/350-524LS......SVNLVLRFDDNGV----------------LMS........NSSLDKQYWNF.....................
Q2Z0J1_9ADEN/116-302VNGTDDYKKFTIKLLFDEKGV----------------LLK........DSSLDKEYWNY.....................
Q0PLX4_ADES7/386-556........YISIVIYFYSNGV----------------RRTNYPTFDNEGTLANSATWGY.....................
FIBP_ADE15/182-363TNPNEADKQITVKLLFDANGV----------------LKQ........GSTMDSSYWNY.....................
Q2Z0H6_ADE18/113-285T.......SIGLHILFDQHGV----------------LQTGTP.....SAIAPQAYWGY.....................
Q2Z0J0_9ADEN/123-298TQ.....KSIKVSLMFDSKGL----------------LMT........TSSIDKGYWNY.....................
Q2Z0K4_9ADEN/122-304IAN....KSFTIKLLFNDKGV----------------LMD........GSSLDKDYWNY.....................
Q2Z0J4_9ADEN/122-306TDP....KSFDVKLLFDSKGV----------------LLP........TSNLSKEYWNY.....................
Q2Z0J8_9ADEN/122-305TNPTD..KKITVKLLFNEKGV----------------LMD........SSSLKKEYWNY.....................
A7LKA1_ADE31/379-552TT......TVGLHLVFDRQGR----------------LVTTTP.....TALVPQASWGY.....................
Q2Z0K2_9ADEN/122-300TNPNLP.KTFTIKLLFDENGI----------------LKD........SSNLDKNYWNY.....................
Q6VGT5_9ADEN/401-577VQ......SAHLIIRFDENGV----------------LLN........NSFLDPEYWNF.....................
FIBP_ADEP3/262-420KK.........VNFIFDGAGR----------------LQ.........SDSTYKGRFGF.....................
Q5C8N5_9ADEN/386-556........AIVIILHFDNYGV----------------RILNYPTLGTQGTLGNNATWGY.....................
Q2Z0K0_9ADEN/121-296ET......GVKIILLFDRNGV----------------LMQ........ESSLDKEYWNY.....................
A4ZKM1_9ADEN/189-365TK.....KDVKISLLFDENGI----------------LLP........SSSLSKDYWNY.....................
Q8QVG3_ADEBA/970-1139RQ......SFKVILLFNHLGQ----------------LS.........GGNLYTGYFGY.....................
FIBP_ADECT/365-537QS......QFSLIMEFDQFGQ----------------LMST.......GNINSTTTWGE.....................
Q695Q9_9ADEN/377-542........SIAVQLDFDSAGV----------------LLN........SSTMTTSYWGY.....................
Q0PLX5_ADES7/181-343........SVTVQFSFDDSGK----------------LI.........FSPLANNTWGV.....................
Q2Z0K5_9ADEN/115-293TTK....KEFSIKLLFDANGK----------------LKS........ESNLSG.YWNY.....................

PF08932

Q71AW2_9CAUD/148-263-------VRFFGSV...SNIQ---------------------------KGWNMSGTWVD---------------------
Q71AV4_9CAUD/148-261-------YVRGNSI...PVPN---------------------------VAPNFIVPVGT---------------------
Q1RNE5_9CAUD/148-256-------YRLSRII....NVN---------------------------NGVDQP..WGS---------------------
Q71AW1_9CAUD/148-251-------FHWGGRL...TSIN---------------------------SGASFP...VK---------------------
Q1RNC4_9CAUD/153-268-------VQFSGEV...TLTA---------------------------SGKIMGGTWVD---------------------
Q1RNB3_9CAUD/181-296-------VRLLGSV...ANTK---------------------------TGIKMSGPWVD---------------------
Q1RNB8_9CAUD/159-279-------GNFSDITVSGDITT---------------------------AGAIIG..WIT---------------------
Q1RND4_9CAUD/148-263-------VRFLGSV...ANIK---------------------------KGQMMSRTWVD---------------------
Q6JDF4_9CAUD/148-251-------IKWIGRL...TNIN---------------------------SGTTFA...VK---------------------

PF04582

Q83931_9REOV/1-326------------EQRVQAL--EGGSSTSLL---------------------------FADPLKLEAGTVSLELDPYFCSV
Q9DPB4_9REOV/1-326------------ERRVGDI--ESGSGPNLR---------------------------FVSPLSLSQGVVSLVMDPYFCSD
Q9J1B6_9REOV/1-326------------QDRVKSL--ESTASHGLS---------------------------FSPPLSVADGVVSLDMDPYFCSQ
Q9DPB5_9REOV/1-326------------QNRMKSL--ESSTSHGLS---------------------------FSPPLSVADGVVSLDMDPYFCSQ

PF01664

SIGM1_REOVJ/244-462------------RFSTSGI--LASGKFVLN---------------------------FVT--GLSPGWATGSTEPSTT..
SIGM1_REOVD/239-454------------AFDGFSI--ADGGDLSLN---------------------------FVT--GLLPPLLTGDTEPAFHND
SIGM1_REOVL/251-469------------QMTTNSI--MADGKFVIN---------------------------FVS--GLSSGWQTGDTEPSST..

PF00541

O56783_ADE17/186-362............RSDNLTV..SEAYKNAVE...........................FMPNLVAYPKPTT........GS
A2I928_ADE03/100-281............KYKQT......THFSARG...........................FMPSTTAYPFVLP........NA
Q27W86_9ADEN/114-297............KSSTAT...SEAATSSKA...........................FMPSTTAYPFN..........TT
Q6QP89_9ADEN/266-439............RKGDVTP..AEPYTNAIG...........................FMPNIKAYPK...........NT
Q9DLD8_ADEB2/391-557............REGDSYN..PSSNLNPLY...........................LMPNTYAYP............QG
Q6BEA6_ADE04/248-421............RQGDSID..GTPYTNAVG...........................FMPNSTAYPK...........TQ
Q6I7S0_ADE09/181-357............RNENSIM..STAYEKAIG...........................FMPNLVAYPKPTT........GS
Q09TX9_9ADEN/188-375............KNKDSVI..GSPYENAVP...........................FMPNSTAYPKIINNGTANPE.DK
Q2Z0J9_9ADEN/122-300............RSGDSIL..PEPYKNAIG...........................FMPNLLAYAKATTD.......QS
Q2Z0J6_9ADEN/116-300............RSNNNNI..GTPYKEAVG...........................FMPSTTAYPKPTNNTSTDPD.KK
FIBP_ADEM1/388-608AAPDPPVEPPPKRRGDLAVLFAKVAEQAMELAKEQAVQAQPPEHVNTDWADHMNLLRFMPNTLVYP............TA
FIBP_ADEB3/803-974............K........NNPSASKAA...........................FLPSTALYPILNES.......RG
Q6QPC5_9ADEN/260-439............REGQTTQ..SVAYTNAVG...........................FMPNIGAYPK...........TQ
Q6R2L0_ADE01/401-578............RKGDLTN..ATAYTNAVG...........................FMPNLKAYPK...........TQ
O56784_9ADEN/182-355............RNNDSTV..SGKYENAVP...........................FMPNITAY.KPV.........NS
Q2Z0I4_9ADEN/122-307............RSNDSVV..GTAYDNAVP...........................FMPNLKAYPKNTTTSSTNPD.DK
Q67711_ADE16/163-348............KDNQNMA..TGTITSAKG...........................FMPSTTAYPFITY........AT
Q6QPG1_9ADEN/268-441............RQGDVTP..AEAYTNAIG...........................FMPNLKAYPK...........NT
A0MK70_9ADEN/197-359............RQGDSPA..SNPTYNALA...........................FMPNSTLYAR...........GG
Q5EY45_ADE07/134-320............KSGQNMA..TGALTNAKG...........................FMPSTTAYPFN..........VN
Q2Z0I8_9ADEN/123-305............RNDDSIM..PNQYDNAVP...........................FMPNLKAYPNPKTSTVLPST.DK
FIB1_ADE40/373-543............RQGQS.A..NTNVSNAVE...........................FMPSSKRYPN...........EK
Q2Z0J3_9ADEN/114-294............RSDNSVV..STPYDNAVP...........................FMPNTTAYPKIINNTTDPE..NK
Q96590_ADE02/401-578............RNGNSTN..ANPYTNAVG...........................FMPNLLAYPK...........TQ
Q83467_ADEP4/121-287............KDQDTLV...TPIANGQY...........................LMPNLTAYPR...........LI
Q76DN6_ADE06/350-524............RNGDSTN..GQPYTYAVG...........................FMPNLKAYPK...........TQ
Q2Z0J1_9ADEN/116-302............RSNNNNV..GSAYEEAVG...........................FMPSTTAYPKPPTPPTNPTTPLE
Q0PLX4_ADES7/386-556............RQGQS.A..NTNVTNATE...........................FMPSSSRYPV...........NK
FIBP_ADE15/182-363............RSDNSNL..SQPYKKAVG...........................FMPSKTAYPKQTKPTN.....KE
Q2Z0H6_ADE18/113-285............RQGQSIS..PTPVTNALK...........................FMPNSSAYPR...........AN
Q2Z0J0_9ADEN/123-298............RNKNSVV..GTAYENAIP...........................FMPNLVAYPRPNTP.......DS
Q2Z0K4_9ADEN/122-304............KSDDSVM..SKAYENAVP...........................FMPNLKAYPNPTTSTTNPST.DK
Q2Z0J4_9ADEN/122-306............RSYDNNI..GTPYENAVP...........................FMPNLKAYPKPTKTASDKAE.NK
Q2Z0J8_9ADEN/122-305............RNDNSTV..SQAYDNAVP...........................FMPNIKAYPKPTTDTSAKPE.DK
A7LKA1_ADE31/379-552............KQGQSVS..SSAVANALG...........................FMPNVSAYPR...........PN
Q2Z0K2_9ADEN/122-300............RNGNSIL..AEQYKNAVG...........................FMPNLAAYPKSTTT.......QS
Q6VGT5_9ADEN/401-577............RNGDLTE..GTAYTNAVG...........................FMPNLSAYPK...........SH
FIBP_ADEP3/262-420............RSNDSVIEPTAAGLSPAW...........................LMPSTFIYPRNT.........SG
Q5C8N5_9ADEN/386-556............RQGES.A..DTNVLNALA...........................FMPSSKRYPR...........GR
Q2Z0K0_9ADEN/121-296............RNDNNVI..GTPYENAVG...........................FMPNLVAYPKPTSA.......DA
A4ZKM1_9ADEN/189-365............RSDDSIV..SQKYNNAVP...........................FMPNLTAYPKPSAQ.......NA
Q8QVG3_ADEBA/970-1139............RFQNSVL..PNSNIQGTM...........................LMPNSVAYPR............V
FIBP_ADECT/365-537............KPWGNNTVQPRPSHTWKL...........................CMPNREVYS............TP
Q695Q9_9ADEN/377-542............RQNQSIS..PYPITNALS...........................FMPNSTAYPA...........GQ
Q0PLX5_ADES7/181-343............RQSESPL..PNPSFNALT...........................FMPNSTIYSR...........GA
Q2Z0K5_9ADEN/115-293............RSDNSVV..GTAYNNAVP...........................FMPNTTAYPKIIDSTTNPA..DK

PF08932

Q71AW2_9CAUD/148-263------------RPFR..P--------------------------------------AAVQ.SLVGHF.---------..
Q71AV4_9CAUD/148-261------------FPPAFGT--------------------------------------NLPQFDTAGTFY---------..
Q1RNE5_9CAUD/148-256------------LYISAEI--------------------------------------GIP..SLPSGFS---------QS
Q71AW1_9CAUD/148-251------------APFQLIP--------------------------------------DKVK.ELVGHF.---------..
Q1RNC4_9CAUD/153-268------------FPYR..P--------------------------------------SVIQ.SLVGHL.---------..
Q1RNB3_9CAUD/181-296------------KEFR..P--------------------------------------AVVQ.SLVGHF.---------..
Q1RNB8_9CAUD/159-279------------DNDFNPQ--------------------------------------YTQKFSMYTRF.---------..
Q1RND4_9CAUD/148-263------------EPFR..P--------------------------------------AVVQ.SLIGRL.---------..
Q6JDF4_9CAUD/148-251------------APYEVIP--------------------------------------NKTK.ELVGHF.---------..

PF04582

Q83931_9REOV/1-326SRNLTSYSADAQLMQFQWSVKGEDGATNSIDMDVNAHCHGPRTDYLMSTKQSLTITASPATLVFELDRITKLPPDLSRLI
Q9DPB4_9REOV/1-326NQALTSYSTDAQLMQFQWLARGEDGSSSSVDMLVNRHCHGRRTDYMMSTTESFTVTGNSVSLVFNLDYITKPPSDMSRLV
Q9J1B6_9REOV/1-326RVSLTSYSAEAQLMQFRWMARGTNGSSDTIDMTVNAHCHGRRTDYMMSSTGNLTVTSNVVLLTFDLSDITHIPSDLARLV
Q9DPB5_9REOV/1-326RVSLTSYSAEAKLMQFQWMAKGTSGSSDVIDMTVNAHCHGRRTDYMMSSTGGLTVTSNAVSLTFSLDYITNMPSDLSRLI

PF01664

SIGM1_REOVJ/244-462TNPLSTTFAAIQFI---------NGSS---------------------------------------------RVDAFRIL
SIGM1_REOVD/239-454VVTYGAQTVAIGLS---------SGGA---------------------------------------------PQYMSKNL
SIGM1_REOVL/251-469IDPLSTTFAAVQFL---------NNGQ---------------------------------------------RIDAFRIM

PF00541

O56783_ADE17/186-362KKYARDIVYGNIYL---------GGL...AYQ----------------------------------------PVVIKVTF
A2I928_ADE03/100-281GTDNENYIFGQCYY---------KAS.DGALF----------------------------------------PLEVTVTL
Q27W86_9ADEN/114-297TRDSENYIHGICYY---------MTSYDRSLV----------------------------------------PLNISIML
Q6QP89_9ADEN/266-439SAASKSHIVSQVYL---------NGD...EAK----------------------------------------PLMLIITF
Q9DLD8_ADEB2/391-557RKTITQVFPLEVYL---------NGD...TAK----------------------------------------PVPLEVAF
Q6BEA6_ADE04/248-421SSTTKNNIVGQVYM---------NGD...VSK----------------------------------------PMLLTITF
Q6I7S0_ADE09/181-357KKYARDIVYGNIYL---------GGK...PHQ----------------------------------------PATIKTTF
Q09TX9_9ADEN/188-375KSAAKKTIVTNVYL---------GGD...AAK----------------------------------------PVATTISF
Q2Z0J9_9ADEN/122-300KIYARNTIYGNIYL---------DNQ...PYN----------------------------------------PVVIKITF
Q2Z0J6_9ADEN/116-300VSQGKNKIVSNIYL---------GGE...VYQ----------------------------------------PGFIVVKF
FIBP_ADEM1/388-608ATIAANLQFHDTRL---------......SLR----------------------------------------RATLKIRL
FIBP_ADEB3/803-974SLPGKNLVGMQAIL---------GGG.....G----------------------------------------TCTVIATL
Q6QPC5_9ADEN/260-439SKTPKNSIVSQVYL---------TGE...TTM----------------------------------------PMTLTITF
Q6R2L0_ADE01/401-578SRTAKSNIVSQVYL---------NGE...KEK----------------------------------------PMTLTITL
O56784_9ADEN/182-355KSYARSHIFGNVYI---------DAK...PYN----------------------------------------PVVIKISF
Q2Z0I4_9ADEN/122-307ISAGKKNIVSNVYL---------EGR...VYQ----------------------------------------PVALTVKF
Q67711_ADE16/163-348ETLNEDYIYGECYY---------KST.NGTLF----------------------------------------PLKVTVTL
Q6QPG1_9ADEN/268-441SGAAKSHIVGKVYL---------HGD...TGK----------------------------------------PLDLIITF
A0MK70_9ADEN/197-359SGEPRNNYYVQTYL---------RGN...VQR----------------------------------------PITLTVTF
Q5EY45_ADE07/134-320SREKENYIYGTCYY---------TAS.DHTAF----------------------------------------PIDISVML
Q2Z0I8_9ADEN/123-305KSNGKNTIVSNLYL---------EGK...AYQ----------------------------------------PVAVTITF
FIB1_ADE40/373-543GSEVQNMALTYTFL---------QGD...PNM----------------------------------------AISFQSIY
Q2Z0J3_9ADEN/114-294KSSAKNNIDGNVYL---------EGN...AGQ----------------------------------------PVAVAISF
Q96590_ADE02/401-578SQTAKNNIVSQVYL---------HGD...KTK----------------------------------------PMILTITL
Q83467_ADEP4/121-287QTLTSSYIYTQAHL---------DHN....NS----------------------------------------VVDIKIGL
Q76DN6_ADE06/350-524SKTAKSNIVSQVYL---------NGD...KSK----------------------------------------PLHFTITL
Q2Z0J1_9ADEN/116-302KSQAKNKYVSNVYL---------GGQ...AGN----------------------------------------PVATTVSF
Q0PLX4_ADES7/386-556GDNIQNQSFSYTCI---------KGD...FAM----------------------------------------PVPFRVTY
FIBP_ADE15/182-363ISQAKNKIVSNVYL---------GGK...IDQ----------------------------------------PCVIIISF
Q2Z0H6_ADE18/113-285GSEPKSQTFTSTYM---------QGD...IAK----------------------------------------PMTMKVSF
Q2Z0J0_9ADEN/123-298KIYARSKIVGNVYL---------AGL...AYQ----------------------------------------PIVITVSF
Q2Z0K4_9ADEN/122-304KSNGKNAIVSNVYL---------EGR...AYQ----------------------------------------PVAITVTF
Q2Z0J4_9ADEN/122-306VSSAKNKIVSNFYF---------GGQ...TYQ----------------------------------------PGTIIIKF
Q2Z0J8_9ADEN/122-305KSAAKRYIVSNVYI---------GGL...PDK----------------------------------------TVVITIKL
A7LKA1_ADE31/379-552AGEAKSQMLSQTYL---------QGD...TTK----------------------------------------PITMKVVF
Q2Z0K2_9ADEN/122-300KLYARNTIFGNIYL---------DSQ...AYN----------------------------------------PVVIKITF
Q6VGT5_9ADEN/401-577GKTAKSNIVSQVYL---------NGD...KTK----------------------------------------PVTLTITL
FIBP_ADEP3/262-420SSLTSFVYINQTYV---------HVD......----------------------------------------.....IKV
Q5C8N5_9ADEN/386-556GSEVQNQTVGYTCI---------QGD...FSM----------------------------------------PVPYQIQY
Q2Z0K0_9ADEN/121-296KNYSRSKIISNVYL---------KGL...IYQ----------------------------------------PVIIIASF
A4ZKM1_9ADEN/189-365KNYSRTKIISNVYL---------GAL...TYQ----------------------------------------PVIITIAF
Q8QVG3_ADEBA/970-1139KNNVGNYYETTCYL---------AGN...KY.----------------------------------------PVKLRVSL
FIBP_ADECT/365-537AATISRCGLDSIAV---------DGA...PSR----------------------------------------SIDCMLII
Q695Q9_9ADEN/377-542GNQAKSNTYIQTLL---------RGN...TDK----------------------------------------PITLNVTF
Q0PLX5_ADES7/181-343SNEPQNNYYVQTYL---------RGN...VRK----------------------------------------PILLTVTY
Q2Z0K5_9ADEN/115-293KSSAKKIIVGNVYL---------GGN...PGQ----------------------------------------PVAVAISF

PF08932

Q71AW2_9CAUD/148-263......AGRDTSFH-----------------------------------------------------------------I
Q71AV4_9CAUD/148-261.....SHGNLSLSL-----------------------------------------------------------------I
Q1RNE5_9CAUD/148-256YISVSMSNTSNLMW-----------------------------------------------------------------C
Q71AW1_9CAUD/148-251......PTTSNSFH-----------------------------------------------------------------I
Q1RNC4_9CAUD/153-268......AGSGNSFH-----------------------------------------------------------------V
Q1RNB3_9CAUD/181-296......AGKDTSFH-----------------------------------------------------------------I
Q1RNB8_9CAUD/159-279.........GKRLM-----------------------------------------------------------------L
Q1RND4_9CAUD/148-263......VGRGASFH-----------------------------------------------------------------I
Q6JDF4_9CAUD/148-251......ANTGKSFH-----------------------------------------------------------------I

PF04582

Q83931_9REOV/1-326PCHGFQ-----QATFPVDISFQRDGV-------SHSYQVYGTYTSSRVFKITFSPGASGPAVIQFLTVRTGIDT
Q9DPB4_9REOV/1-326PRAGFQ-----AASFPVDVSFTRDTT-------THAYQVYGAFSSPRVFKITFLTGGTGTANLRFLTVRTGIDT
Q9J1B6_9REOV/1-326PSAGFQ-----AASFPVDVSFTRDSA-------THAYQAYGVYSSSRVFTITFPTGGDGTANIRSLTVRTGIDT
Q9DPB5_9REOV/1-326PSVGFQ-----AASFPVDVSFTRDSA-------THSYQVYGAYSSARVFTITFPTGGNGTSNIRFLTVRTGIDT

PF01664

SIGM1_REOVJ/244-462GVAEWN-----AGELEITN-HGGTYT-------AHTNVDWAP------MTIMYPCLG-----------------
SIGM1_REOVD/239-454WVEQWQ-----DGVLRLRV-EGGGSI-------THSNSKWPA------MTVSYPRSF-----------------
SIGM1_REOVL/251-469GVSEWT-----DGELEIKN-YGGTYT-------GHTQVYWAP------WTIMYPCNV-----------------

PF00541

O56783_ADE17/186-362NEEADS.......AYSITFEFVWNKE..YA...R.VEFETTS------FTFSY---------------------
A2I928_ADE03/100-281NKRLPD....SRTSYVMTFLWSLNAG..LAPETTQATLITSP------FTFSY---------------------
Q27W86_9ADEN/114-297NSHTIS....SNVAYAIQFEWNLNAK..ESPESNIATLTTSP------FFFSY---------------------
Q6QP89_9ADEN/266-439NETEDA.....TCTYSITFQWKWDSTK.YT...G.ETLATSS------FTFSY---------------------
Q9DLD8_ADEB2/391-557NTLSST.......GFSLEFTWRNLNA..YT...G.EAFAVSL------GNFTY---------------------
Q6BEA6_ADE04/248-421NGTDDT.....TSAYSISFSYTWTNGS.YI...G.ATFGANS------YTFSY---------------------
Q6I7S0_ADE09/181-357NQETGC.......EYSITFDFSWAKT..YV...N.VEFETTS------FTFSY---------------------
Q09TX9_9ADEN/188-375NKETES.....NCVYSITFDFAWNKT..YK...N.VPFDSSS------LTFSY---------------------
Q2Z0J9_9ADEN/122-300NNEADS.......AYSITFNYSWTKD..YD...N.IPFDSTS------FTLSY---------------------
Q2Z0J6_9ADEN/116-300NQETDA.....NCAYSITFDFGWGKV..YK...DPIPYDTSS------FTFSY---------------------
FIBP_ADEM1/388-608NGSPDS.......AYQLGFMLELVGT.......QSASIVTDT------ISFWY---------------------
FIBP_ADEB3/803-974NGRRSN...NYPAGQSIIFVWQEFNT......IARQPLNHST------LTFSY---------------------
Q6QPC5_9ADEN/260-439NGTDEK.DTTPVSTYSMTFTWQWTGD..YKDK.N.ITFATNS------FSFSY---------------------
Q6R2L0_ADE01/401-578NGTDEN.QTTPASTYSISFSWSWPSNQTYI...G.QTFATNS------YTFSY---------------------
O56784_9ADEN/182-355NQETQN.....NCVYSISFDYTCSKE..YT...G.MQFDVTS------FTFSY---------------------
Q2Z0I4_9ADEN/122-307NSENDC.......AYSITFDFVWSKT..YE...SPVAFDSSS------FTFSY---------------------
Q67711_ADE16/163-348NRRMLA....SGMAYAMNFSWSLNAE..EAPETTEVTLITSP------FFFSY---------------------
Q6QPG1_9ADEN/268-441NETSDE.....SCTYCINFQWQWGADQ.YK...N.ETLAVSS------FTFSY---------------------
A0MK70_9ADEN/197-359NSAATG........YSLSFKWTAVVR.........EKFAAPA------TSFCY---------------------
Q5EY45_ADE07/134-320NQRALN....NETSYCIRVTWSWNTGVAPEVQTSATTLVTSP------FTFYY---------------------
Q2Z0I8_9ADEN/123-305NKETGC.......TYSITFEFGWAKT..YD...VPIPFDSSS------FTFSY---------------------
FIB1_ADE40/373-543NHAIEG........YSLKFTWRVRNN.........ERFDIPC------CSFSY---------------------
Q2Z0J3_9ADEN/114-294NKETTA.......DYSITFDFAWSKA..YE...TPVPFDTSS------MTFSY---------------------
Q96590_ADE02/401-578NGTSESTETSEVSTYSMSFTWSWESGK.YT...T.ETFATNS------YTFSY---------------------
Q83467_ADEP4/121-287NTDLRP.....TAAYGLSFTMTFTNS.......PPTSFGTDL------VQFGY---------------------
Q76DN6_ADE06/350-524NGTDET...NQVSKYSISFSWSWNSGQ.YT...N.DKFATNS------YTFSY---------------------
Q2Z0J1_9ADEN/116-302NKETGC.......TYSITFDFAWNKT..YE...N.VQFDSSF------LTFSY---------------------
Q0PLX4_ADES7/386-556NHALEG........YSLKFTWRVVAN.........QAFDIPC------CSFSY---------------------
FIBP_ADE15/182-363NEEADS.......DYSIVFYFKWYKT..YE...N.VQFDSSS------FNFSY---------------------
Q2Z0H6_ADE18/113-285NAASTV......TGYSLSFTWTGISN..YR...N.QAFSCPS------CSFSY---------------------
Q2Z0J0_9ADEN/123-298NQEKDA.....SCAYSITFEFAWNKD..YV...G..QFDTTS------FTFSY---------------------
Q2Z0K4_9ADEN/122-304NKETGC.......TYSMTFDFGWSKV..YN...DPIPFDTSS------LTFSY---------------------
Q2Z0J4_9ADEN/122-306NEEIDD.....TCAYSITFNFGWGKT..YD...NPFPFDTTS------FTFSY---------------------
Q2Z0J8_9ADEN/122-305NAETES.......AYSMTFEFTWAKT..FE...N.LQFDSSS------FTFSY---------------------
A7LKA1_ADE31/379-552NGNATV......DGYSLTFMWTGVSN..YL...N.QQFSTPS------CSFSY---------------------
Q2Z0K2_9ADEN/122-300NQEADS.......AYSITLNYSWGKD..YE...N.IPFDSTS------FTFSY---------------------
Q6VGT5_9ADEN/401-577NGTQET.GDTTPSAYSMSFSWDWSGHN.YI...N.EIFATSS------YTFSY---------------------
FIBP_ADEP3/262-420NTLSTN.......GYSLEFNFQNMSF........SAPFSTSY------GTFCY---------------------
Q5C8N5_9ADEN/386-556NYGPTG........YSFKFIWRTVSR.........QPFDIPC------CFFSY---------------------
Q2Z0K0_9ADEN/121-296NQETTN.....GCVYSISFDFTCSKD..YT...G.QQFDVTS------FTFSY---------------------
A4ZKM1_9ADEN/189-365NQETEN.....GCAYSITFTFTWQKD..YS...A.QQFDVTS------FTFSY---------------------
Q8QVG3_ADEBA/970-1139NSDSPM....VDWGYSITFEWYEFDN..HI...G.APFLTTY------TSFTY---------------------
FIBP_ADECT/365-537NKPKGV......ATYTLTFRFLNFNR.....LSGGTLFKTDV------LTFTY---------------------
Q695Q9_9ADEN/377-542NNQSTG........YSLKFTWTGLGS..YQ...N.ESFATPT------CTFSY---------------------
Q0PLX5_ADES7/181-343NSVNSG........YSLTFKWDAVAN.........EKFATPT------SSFCY---------------------
Q2Z0K5_9ADEN/115-293NKEILL.......IFN.NIRFAWGKA..YE...TPVPFDTSS------MTFSY---------------------

PF08932

Q71AW2_9CAUD/148-263DINPNG-----------SITWWGANI-------DKTPIATRG------NGSYFI--------------------
Q71AV4_9CAUD/148-261NMSPSG-----------IAV...GNP-------NNTSM..NG------KTISFV--------------------
Q1RNE5_9CAUD/148-256SVTSNN-----------AFRLLTGRS-------TSGAV....------.RSVLV--------------------
Q71AW1_9CAUD/148-251DLEHDG-----------TFRWWGEDK-------ASGSV..RG------TAMYFI--------------------
Q1RNC4_9CAUD/153-268DISPDG-----------SITWWGPYV-------GYDPVTPRG------NASYFI--------------------
Q1RNB3_9CAUD/181-296DIDTNG-----------SITWWGPDI-------GKTPIATRG------NGSYFI--------------------
Q1RNB8_9CAUD/159-279SVDPGG-----------AFRNWGDPI-------AKGDEIYGG------V..FWI--------------------
Q1RND4_9CAUD/148-263DINPDG-----------SITWWGEDI-------GRDSFSSRG------NASYFI--------------------
Q6JDF4_9CAUD/148-251DLEPDG-----------TFRWWGENQ-------ANGSI..RG------TAMYFI--------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window