Sequence alignment for CL0328

PF01292

C1DIE6_AZOVD/9-186------------------------------------------------RT..RFPER...........ACHW-VMVICFF
B2UEV9_RALPJ/18-207------------------------------------------------VH..PLWMR...........CTHW-FNALAVM
F2G749_ALTMD/13-185------------------------------------------------IW..DWVVR...........ICHW-GIVAAFI
B2JU39_BURP8/35-202------------------------------------------------GF..SPVTI...........ALHW-LVAVLVL
A8LH36_FRASN/20-219------------------------------------------------VW..DLPVR...........LIHW-LLVLDLV
Q24SV4_DESHY/15-201------------------------------------------------RF..TDGER...........FSHW-VHAVSFL
B0SVS8_CAUSK/3-181------------------------------------------------VM...TRLR...........AYHA-VLAVLVL
Q3KA02_PSEPF/7-177------------------------------------------------HF..NPLAR...........LLHW-LMALMII
A7IEJ2_XANP2/17-189------------------------------------------------RY..GAPLR...........AIHW-LTVLSII
Q5P430_AROAE/8-169------------------------------------------------VW..DRPVR...........IFHW-GLVASLT
Q8KEB1_CHLTE/10-218------------------------------------------------VW..RLPVR...........LYHW-VNAFSIA
A3Y9W1_9GAMM/26-199------------------------------------------------RY..DRVYK...........LLHW-LVAGLIL
A0RPH5_CAMFF/12-218------------------------------------------------EF..SIGLR...........VTHW-IRAICIT
Q2W2V7_MAGSA/500-649------------------------------------------------IR..AGAFR...........LWHR-ANAVLMS
E2XB98_SHIDY/13-220------------------------------------------------VF..EAPVR...........IWHW-LTVLCMA
Q73XF0_MYCPA/5-235------------------------------------------------DY..PVWLR...........VDHW-LNVLFVT
Q3K9Y1_PSEPF/9-180------------------------------------------------RY..STVSI...........LLHW-LMLVLLV
J2ZFR0_SHISO/68-257------------------------------------------------LY..SKAVR...........LWHW-SNALLFV
Q11M26_CHESB/8-183------------------------------------------------SY..GLIAI...........LFHW-TIAILFL
A8EUR4_ARCB4/14-229------------------------------------------------RM..TPIMR...........TIHW-GNAICMV
Q0AAZ8_ALKEH/9-216------------------------------------------------VR..DRWTI...........RLHW-FNALCWA
A3UXK6_VIBSP/7-177------------------------------------------------NY..NPLAR...........AMHW-ISALAIF
Q726G3_DESVH/8-195------------------------------------------------LY..TRFER...........FWHW-AQTLLIL
Q0P8A9_CAMJE/92-274------------------------------------------------AF..TLFER...........LFHF-IAAISWV
Q6MN52_BDEBA/9-210------------------------------------------------YQ..PLSLR...........LWHW-FNALVIL
A1VMH0_POLNA/30-197------------------------------------------------VV..DATTR...........MLHW-LMALSF.
Q24SH5_DESHY/15-204------------------------------------------------RQ..NLVNR...........FVHW-TTALAIF
A4EHB9_9RHOB/9-185------------------------------------------------SY..GSFTK...........LFHW-IIVILFA
A1K9P7_AZOSB/5-173------------------------------------------------RY..DRGAI...........ALHW-LHAILVV
O28892_ARCFU/13-211------------------------------------------------RH..SKFVR...........SCHW-GIVVTGI
Q3SMF3_THIDA/22-205------------------------------------------------VY..DPLLR...........VLHW-SIALGIV
Q0F0S9_9PROT/5-220------------------------------------------------AY..AKPIR...........LLHS-LLALCML
Q1QXP2_CHRSD/8-174------------------------------------------------HY..GSITR...........CLHW-LIAILVI
A8H662_SHEPA/17-235------------------------------------------------VW..DKPVR...........IFHW-VNVILIT
Q2LQE6_SYNAS/8-184------------------------------------------------AT..DSFER...........IVHW-CLAVSCL
Q137Q9_RHOPS/15-183------------------------------------------------EY..GALAV...........TIHW-VIFFAVI
Q0G224_9RHIZ/16-199------------------------------------------------RY..SRGAV...........FLHW-TIAALIL
Q21VQ4_RHOFT/20-197------------------------------------------------RY..DFPSR...........VFHW-VTAVVVT
A6D834_9VIBR/136-317------------------------------------------------RW..SRMDR...........ALHW-SMAFTFL
A5FBE0_FLAJ1/8-190------------------------------------------------QF..TVIHR...........ILHW-SVALLMS
Q0FAP7_9RHOB/5-159------------------------------------------------RH..SITAM...........IFHW-GFVIIFI
A3XC59_9RHOB/9-194------------------------------------------------SY..GSVTK...........SFHW-LTALLLV
A5G519_GEOUR/9-204------------------------------------------------LQ..PTPVR...........IWHW-LNALGIV
A4BH07_9GAMM/8-165------------------------------------------------AS..NWLVR...........LGHL-LFVLSII
A5FTL2_ACICJ/4-178------------------------------------------------AW..RPAQR...........RLHW-WTAGLVA
Q3M4T2_ANAVT/30-199------------------------------------------------YQ..PLLLK...........ILHG-VSGFLAI
Q5QZM1_IDILO/10-182------------------------------------------------VW..DSFIR...........VFHG-LLIVLLG
Q2K795_RHIEC/4-158------------------------------------------------GY..SLAQI...........GLHW-LVALLVP
Q2N9I4_ERYLH/7-222------------------------------------------------KH..AISTR...........IWHW-TNLVCVV
Q2YJ32_BRUA2/13-182------------------------------------------------GY..GLVSR...........GFHW-LMALLFL
A8GZ50_SHEPA/78-266------------------------------------------------RH..DGIAR...........LTHW-TAAFGCL
A5WBJ1_PSYWF/9-194------------------------------------------------NY..GSIAK...........WMHW-IMAFAFI
A5VEG9_SPHWW/24-275------------------------------------------------RH..SLVAR...........LWHW-TTAGTVV
Q3ABV8_CARHZ/7-189------------------------------------------------RH..PLFIR...........VTHW-VNMIAIT
Q3JAE2_NITOC/6-172------------------------------------------------TQ..HLFFI...........TLHW-ILVLLVL
A3PG79_RHOS1/6-157------------------------------------------------GY..TRLQI...........TLHW-AIAGLVL
Q89C01_BRADU/31-198------------------------------------------------RT..DVGTI...........TLHW-ATALAFV
Q1QIT3_NITHX/121-299------------------------------------------------RF..SAFER...........FVHW-MTATCFI
Q1ITC7_KORVE/20-198------------------------------------------------RF..TWTER...........LMHW-YTAVTYI
J9ZA39_LEPFM/17-226------------------------------------------------VW..EIRLR...........LWHW-.TNLLVV
Q1ZU49_PHOAS/13-188------------------------------------------------HYFPNTGLR...........HIHT-SLAALVI
A8G145_SHESH/120-302------------------------------------------------RW..SGLSI...........SVHW-LGAIACI
Q1Z615_PHOPR/4-173------------------------------------------------HY..DILTR...........VLHW-IMATVII
A1RW11_PYRIL/6-212------------------------------------------------VV..SIGYR...........VAHQ-WNLLLFT
Q7NUV6_CHRVO/15-181------------------------------------------------RY..PPLAM...........ALHW-LCAAVML
Q5V2I5_HALMA/8-213------------------------------------------------KF..TRVTT...........LFHS-LLGLDVF
Q7NL56_GLOVI/6-177------------------------------------------------LW..GVFMAATKRAARNWLWVVHW-VMAISFV
Q0BVB5_GRABC/13-193------------------------------------------------VW..DAPLR...........LFHG-ASTLLAA
Q47YK1_COLP3/6-182------------------------------------------------AY..PTYAK...........LIHL-GIAFFGV
A5L4J8_VIBBS/13-176------------------------------------------------NL..TNKVD...........FLHW-GIFSGVM
Q6N8J2_RHOPA/9-176------------------------------------------------QY..GSVAV...........TIHW-LTAVLIV
A0A023E6B3_AERSA/10-170------------------------------------------------HW..DSLVR...........LTHW-GVAAACI
Q87J03_VIBPA/16-183------------------------------------------------AI..SKSMM...........FFHW-VIGLGMI
A1HTF5_9FIRM/5-186------------------------------------------------LH..PLPVR...........IFHW-TMFASVI
Q5NE92_FRATT/30-197------------------------------------------------KY..SLPVR...........VLHS-LLAFLII
Q2BLD7_NEPCE/3-170------------------------------------------------SY..PLAMI...........ILHW-FLAPIIL
Q2IL72_ANADE/263-456------------------------------------------------RH..PAGLR...........ALHW-LNALSWI
A8EX57_ARCB4/6-181------------------------------------------------IW..SLPTR...........VFHS-LFAVFIL
A4YRW2_BRASO/8-180------------------------------------------------SW..GGVAR...........ALHW-VIGPTIL
A5G6W1_GEOUR/7-182------------------------------------------------RF..SAQER...........VLHW-IVTGSFF
Q1YYF5_PHOPR/9-176------------------------------------------------NF..GAVSR...........VIHH-SYLILFF

PF14358

D4L0H2_9FIRM/73-132--------------------------------------------------------------------VLVI-IMLILIM
D0MK75_RHOM4/9-73--------------------------------------------------------------------VVDL-AAFVAFV
W0E6J3_9FIRM/78-136--------------------------------------------------------------------FLNI-LLFIAMI
D2QYK9_PIRSD/9-74--------------------------------------------------------------------FLDL-ALLVVFL
D4H642_DENA2/9-75--------------------------------------------------------------------AVSM-TALFSFI
B3EM27_CHLPB/9-76--------------------------------------------------------------------FISL-GLFVSFL
J7IMY2_DESMD/114-176--------------------------------------------------------------------TAYI-ALPIMAV
W6EIG8_SULMU/8-59--------------------------------------------------------------------VLSA-LLTVVFV
F2KT13_ARCVS/8-72--------------------------------------------------------------------IVTL-SLIATGI
A2BLN5_HYPBU/150-207--------------------------------------------------------------------LWII-AVVVGSA
B3E729_GEOLS/14-80--------------------------------------------------------------------FISL-LTALSFL
R5AVI3_9BACT/6-59--------------------------------------------------------------------NIGL-LLLIAFA
F4GSW9_PUSST/118-178--------------------------------------------------------------------LLFF-ALILLML
F4L3Z1_HALH1/135-204--------------------------------------------------------------------FIYF-LTFIAFV
G2TKP1_BACCO/83-141--------------------------------------------------------------------ALNL-LLLISMC
A1BH85_CHLPD/29-96--------------------------------------------------------------------FISF-GLFISFI
L0KZY5_METHD/9-75--------------------------------------------------------------------SVDV-ILTVIFL
K7RVD2_PROA4/158-222--------------------------------------------------------------------GYTF-VIFILAP
E6W587_DESIS/14-80--------------------------------------------------------------------FVSL-FLTLNAI
B4S7W8_PROA2/12-79--------------------------------------------------------------------FISF-GLVLSFV
F2NIT4_DESAR/9-81--------------------------------------------------------------------LIDA-LMFLCMA
A6LIR5_PARD8/13-85--------------------------------------------------------------------IIDF-VMLMAMA
E6UI69_RUMA7/73-132--------------------------------------------------------------------SVNT-LLLVSIA
I2EY27_EMTOG/6-57--------------------------------------------------------------------LISL-TIAFAFL
Q8TMV4_METAC/9-62--------------------------------------------------------------------VVDL-ALLVQFV
Q2KUA6_BORA1/118-178--------------------------------------------------------------------LLFY-VLILCML
C9RRV1_FIBSS/74-133--------------------------------------------------------------------VVNC-GILLCAF
W0LFH8_9ENTR/72-131--------------------------------------------------------------------TVNL-LLIWVLS
D3RZ50_FERPA/13-74--------------------------------------------------------------------LQHL-LLLTSFV
A9WBK7_CHLAA/77-137--------------------------------------------------------------------LLNA-LLFVAFT
A1B726_PARDP/70-128--------------------------------------------------------------------IVIA-GMAISML
J0RX58_9EURY/9-83--------------------------------------------------------------------IVDL-AMLVAFV
R6EP61_9FIRM/72-131--------------------------------------------------------------------VIVI-LLALTMI
Q3B233_PELLD/10-77--------------------------------------------------------------------FISL-GLVTSFV
Q6APY0_DESPS/4-70--------------------------------------------------------------------IVSL-LLLVSGI
S6CG33_9ACTN/62-122--------------------------------------------------------------------VLNG-VLLVALA
C8WKH1_EGGLE/2-62--------------------------------------------------------------------ALDA-ALLVALS
G0A5D7_METMM/11-75--------------------------------------------------------------------IIDL-IATLLFL
C4XNX5_DESMR/5-71--------------------------------------------------------------------TVTL-VLFFGLF
A7I2S7_CAMHC/7-58--------------------------------------------------------------------FATT-PVIGTFA
C4XNC0_DESMR/13-70--------------------------------------------------------------------FVNL-MLILAGL
A0RPQ5_CAMFF/7-58--------------------------------------------------------------------IGTT-ATIVTFI
W6RUZ5_9CLOT/75-133--------------------------------------------------------------------CLNG-TLFLLAL
C0R274_BRAHW/70-129--------------------------------------------------------------------FINA-MLFICML
R6AFB6_9FIRM/68-125--------------------------------------------------------------------GIDL-LLLFLFL
E8N2M4_ANATU/72-132--------------------------------------------------------------------VVDA-LLLVAMI
B4SDX1_PELPB/4-55--------------------------------------------------------------------WATP-LATGTFV
Q2RX07_RHORT/14-65--------------------------------------------------------------------LLTP-VTAILFL
D6Z5B1_DESAT/6-72--------------------------------------------------------------------VTSL-TALVSFV
B5YIR5_THEYD/10-76--------------------------------------------------------------------FVSL-LTAFSFV
B3EQ00_CHLPB/8-59--------------------------------------------------------------------LATP-LIAAAFL
R6P7P3_9FIRM/71-130--------------------------------------------------------------------IINI-LLLITMI
Q2RIJ9_MOOTA/9-76--------------------------------------------------------------------FLDL-ALFLSAL
I3YFD4_THIV6/9-59--------------------------------------------------------------------WSTP-AVIAAGV
F8E8X8_FLESM/7-73--------------------------------------------------------------------IVSL-VMLLSFI
R6CX21_9CLOT/72-131--------------------------------------------------------------------LCVF-VIFITMT
F0JFF5_DESDE/5-71--------------------------------------------------------------------ITSL-TALLSFL
M4R3B0_BIBTR/72-131--------------------------------------------------------------------TVNF-ATFLLFL
G8QTP5_SPHPG/76-131--------------------------------------------------------------------VLSL-FSCIGII
R7QWY9_9FIRM/8-58--------------------------------------------------------------------IIST-MLFLSVI
F4LLX1_TREBD/74-133--------------------------------------------------------------------VINA-ALLVSCA
R7LCV5_9BACT/72-130--------------------------------------------------------------------AVNA-LLLCVFI
K0NEJ9_DESTT/6-72--------------------------------------------------------------------IISL-TAFLSFF
R7F4I4_9CLOT/70-128--------------------------------------------------------------------ILNL-LLFLAMI
D2RHV9_ARCPA/8-72--------------------------------------------------------------------TIVF-VLIALGL
R6YA34_9FIRM/72-131--------------------------------------------------------------------VVDA-LVLLDML
L0GUL1_9GAMM/12-78--------------------------------------------------------------------AIAF-LVTWSFA
C0QZ66_BRAHW/50-109--------------------------------------------------------------------FINT-MLFICMA
X5DE85_9BACT/10-77--------------------------------------------------------------------FISF-GLTWGIL
B1L3S4_KORCO/10-72--------------------------------------------------------------------IVSI-AQLVLGI
E4TFY8_CALNY/5-71--------------------------------------------------------------------IVSL-TTLWSFI
B9JJR0_AGRRK/72-130--------------------------------------------------------------------VITA-LLLVAML
G7M4T2_9CLOT/72-131--------------------------------------------------------------------AINL-MVFVSMI
R5X0L1_9BACT/9-66--------------------------------------------------------------------ITDA-ALVPLFA
K0C3X7_CYCSP/5-59--------------------------------------------------------------------IVAV-ALFVSFI
R7CCE2_9CLOT/72-131--------------------------------------------------------------------IVDV-VLLIDMF
F2NSL9_TRES6/73-131--------------------------------------------------------------------ATAW-LLFALMI
R6UA77_9CLOT/74-132--------------------------------------------------------------------ILVL-LVLISFV
F5YAS5_TREAZ/76-135--------------------------------------------------------------------VLNT-LLLILFI
W6EBR3_SULMU/7-73--------------------------------------------------------------------FISL-SISFSFL
R5D3A2_9FIRM/72-131--------------------------------------------------------------------ALIG-LIFLCMV
K9VDE1_9CYAN/16-81--------------------------------------------------------------------TIAL-TLLVVWS
E1RA86_SPISS/8-59--------------------------------------------------------------------IINP-ILFLSLL
G0EES3_PYRF1/11-75--------------------------------------------------------------------VSVV-LLAVFGL
R7CST8_9FIRM/68-123--------------------------------------------------------------------AVDG-LLIVSFL
R5I3L3_9PORP/6-78--------------------------------------------------------------------IIDL-FMLTTMA
E8RC78_DESPD/24-75--------------------------------------------------------------------WLTP-FTFGTFI
A5UYY8_ROSS1/82-142--------------------------------------------------------------------ALNV-LLFVLIT
T2KM32_9FLAO/57-117--------------------------------------------------------------------VFNW-ILYIVML
N0AR40_9BACI/76-134--------------------------------------------------------------------LLNI-LLFISMA
M1NG91_DESSD/6-72--------------------------------------------------------------------ITSM-TMFVSFI
A4VFX0_PSEU5/114-174--------------------------------------------------------------------VLFW-VLILSML
B9JP15_AGRRK/72-130--------------------------------------------------------------------LINL-ALLITMM
Q3ATG1_CHLCH/8-59--------------------------------------------------------------------WATP-LAVGTFA
G0L331_ZOBGA/81-141--------------------------------------------------------------------VLNW-TLYFFMI
R7NCG3_9MOLU/2-60--------------------------------------------------------------------VVNF-MLFFIIL
A1BFX6_CHLPD/10-77--------------------------------------------------------------------FISF-GLFIAFF
G4STW3_META2/9-73--------------------------------------------------------------------IIDI-VAFAGFV
I0GHS8_CALEA/20-86--------------------------------------------------------------------IIST-LIFLLFV
G7Z1L5_AZOL4/25-76--------------------------------------------------------------------VVTP-VTIVTFV
E1SVF5_FERBD/125-198--------------------------------------------------------------------VTYL-GLTLVMV
F4C4I1_SPHS2/7-58--------------------------------------------------------------------YITP-FITLVFL
A0LPC1_SYNFM/9-75--------------------------------------------------------------------LLDT-LLFVDLC
Q7CI97_YERPE/72-131--------------------------------------------------------------------TVNI-ILALLFL
E4RQ49_LEAB4/7-58--------------------------------------------------------------------YVTP-FISLIFL
A6LNM0_THEM4/27-84--------------------------------------------------------------------VISL-LLLISFI
V5UHX6_9BURK/124-184--------------------------------------------------------------------LLFY-VMVLCMI
Q8KFP7_CHLTE/12-79--------------------------------------------------------------------FIST-GLLLTFL
W6EDS3_SULMU/5-59--------------------------------------------------------------------VVSL-TLLVSLL
F4HFN7_GALAU/72-131--------------------------------------------------------------------SINF-TTFLLFF
D5DJ74_BACMD/77-135--------------------------------------------------------------------FLNI-MLLITMS
A3CUK5_METMJ/9-76--------------------------------------------------------------------LVDI-GCLITFI
Q7UE94_RHOBA/95-155--------------------------------------------------------------------VLDW-MLFFLFV
E1RE56_METP4/9-80--------------------------------------------------------------------LTDL-LALISLV
R6M5A8_9CLOT/72-131--------------------------------------------------------------------CIDL-LVLISMM
B7GIW2_ANOFW/77-135--------------------------------------------------------------------LLNV-LLLLSMT
B5IFA9_ACIB4/1-67--------------------------------------------------------------------MLST-TLLVDVI
A2SSD8_METLZ/31-96--------------------------------------------------------------------WVDL-AAFIAAV
Q8TUQ6_METAC/9-75--------------------------------------------------------------------LVDL-ALTTLFF
D6DHZ2_CLOSC/72-131--------------------------------------------------------------------CVDL-LLLLAML
B3E2B6_GEOLS/10-61--------------------------------------------------------------------MLSP-LVLTTFL
F8I7H1_SULAT/39-95--------------------------------------------------------------------MLGS-LTASSFV
B4SBP8_PELPB/10-77--------------------------------------------------------------------FTSF-GLFLSFF
Q65T96_MANSM/72-131--------------------------------------------------------------------GLNF-VLFFVFL
Q21KL9_SACD2/6-57--------------------------------------------------------------------IATI-TLSVAFF
D2QJH4_SPILD/6-57--------------------------------------------------------------------LVSL-SVSAVFF
N0BAX1_9EURY/9-75--------------------------------------------------------------------IIDV-LLLTGLI
C8WKW0_EGGLE/72-132--------------------------------------------------------------------ALDL-LIVAAFM
A9AYM2_HERA2/83-143--------------------------------------------------------------------ILNI-GLFIDMT
C0QF61_DESAH/5-71--------------------------------------------------------------------ITSL-TLLIAFS
B9L860_NAUPA/5-71--------------------------------------------------------------------WIDL-LLFYATV
D1B0M4_SULD5/7-73--------------------------------------------------------------------FISL-SLLFSFF
H1YWY9_9EURY/9-71--------------------------------------------------------------------YTDI-AMLASFA
W6RSI1_9RHIZ/73-131--------------------------------------------------------------------LLHF-GLIVNMG
C6BYF4_DESAD/5-71--------------------------------------------------------------------TTSL-TSFFSFI
M1XST7_NATM8/13-77--------------------------------------------------------------------YVNI-VLLISFL
K4LE17_9FIRM/80-137--------------------------------------------------------------------ALNL-AIFISIS
Q2W2B9_MAGSA/11-62--------------------------------------------------------------------YATQ-ATAVLSV
Q15XU8_PSEA6/79-139--------------------------------------------------------------------VWNY-LLYLTML
R5U1B1_9BACE/6-63--------------------------------------------------------------------VIDW-SLVFMFV
A7I9H3_METB6/10-72--------------------------------------------------------------------LIDL-LMGVSFL
R4JZ25_CLOPA/71-128--------------------------------------------------------------------SAGF-ICFFSMI
D9SQY3_CLOC7/76-134--------------------------------------------------------------------ITDL-LLLICVG
A1AR53_PELPD/10-61--------------------------------------------------------------------WISP-ITSVTFL
E4U6D1_OCEP5/21-87--------------------------------------------------------------------WVTL-VLLGAAT
K0NB22_DESTT/5-71--------------------------------------------------------------------ITSL-TLAFSGL
I4D2J4_DESAJ/77-135--------------------------------------------------------------------VINV-LLLLSMA
C9R964_AMMDK/9-90--------------------------------------------------------------------LVDC-LLFLVGL
F8ABZ1_THEID/4-70--------------------------------------------------------------------YVSL-FLFWSLM
B8FH86_DESAA/4-70--------------------------------------------------------------------ITSL-TSLLAFL
H1XS36_9BACT/14-80--------------------------------------------------------------------FVSL-YITWSAL
R5AVH3_9BACE/10-63--------------------------------------------------------------------IIGI-ILVVLFL
R5X3I1_9CLOT/76-130--------------------------------------------------------------------IISF-CLLVTVC
A8F7I9_PSELT/58-115--------------------------------------------------------------------VINF-LLVAVMI
Q8A5L2_BACTN/9-66--------------------------------------------------------------------LTDL-MLVPIFI
K4LFC8_THEPS/9-79--------------------------------------------------------------------WLDC-ALFLTGV
Q3B3K8_PELLD/8-59--------------------------------------------------------------------WATP-IAAGAFL
Q7UGQ3_RHOBA/4-55--------------------------------------------------------------------WVNL-ALLFSFS
W6RUQ3_9CLOT/77-135--------------------------------------------------------------------IVDI-VMIISML
D5V7U4_ARCNC/6-72--------------------------------------------------------------------ITSL-TMMFVMI
L0H0I4_9GAMM/9-59--------------------------------------------------------------------WSTP-AVVAAGI
S6CE05_9ACTN/67-127--------------------------------------------------------------------LLDV-ALVIAVV
F0S3U2_DESTD/5-71--------------------------------------------------------------------YVSL-FLLYTLI
R5W765_9BACE/6-63--------------------------------------------------------------------VIDW-ILIVVFI
A0LNU4_SYNFM/14-72--------------------------------------------------------------------FVML-TAAVSGL
R5LI07_9SPIR/70-129--------------------------------------------------------------------FINT-MLIICML
B0VH29_CLOAI/15-63--------------------------------------------------------------------VVLF-IAVAAII
V4JBA5_9DELT/6-72--------------------------------------------------------------------ITSM-TMLLSLI
S6C133_9ACTN/57-117--------------------------------------------------------------------ALNA-VLLLSLA
B3QVT3_CHLT3/9-64--------------------------------------------------------------------FVTA-TVTMSFV
D4IPJ8_9BACT/10-82--------------------------------------------------------------------LIDA-GLLVGMA
R7CTR1_9FIRM/68-124--------------------------------------------------------------------LIDV-VLIGSFL
Q11BF1_CHESB/72-130--------------------------------------------------------------------ISTS-VLLTAMV
E8T206_THEA1/5-71--------------------------------------------------------------------FVSS-VLFFSLI
I0GQA3_SELRL/62-115--------------------------------------------------------------------WITV-MLLLVWL
Q3A6A8_PELCD/4-70--------------------------------------------------------------------IASL-TAFLSLF

PF03188

ACFR1_ARATH/49-182--------------------------------------------------------------------LHPV-LMLIGFI
A5C961_VITVI/49-182--------------------------------------------------------------------LHPV-LMLIGLV
Q6Z1Y9_ORYSJ/56-192--------------------------------------------------------------------THPV-LMVLGLV
Q9FVY1_ORYSJ/46-178--------------------------------------------------------------------VHPV-LMLIGFI
ACFR2_ARATH/50-183--------------------------------------------------------------------VHPV-MMVIGLI
Q6YW65_ORYSJ/51-184--------------------------------------------------------------------VHPV-LMLIGLV
ACFR4_ARATH/43-175--------------------------------------------------------------------LHPL-LMVIGFI
Q10DW5_ORYSJ/60-193--------------------------------------------------------------------VHPF-VMCWGFI
Q7XH60_ORYSJ/58-190--------------------------------------------------------------------AHPL-FMVIGLV
Q28YW1_DROPS/100-238--------------------------------------------------------------------LHPI-LMIAGFV
A7UTA7_ANOGA/98-236--------------------------------------------------------------------LHPV-LMIGGYI
CYAC3_MOUSE/46-182--------------------------------------------------------------------WHPV-LMVAGMV
CYAC3_DANRE/47-182--------------------------------------------------------------------WHPV-LMVTGML
F7AAH4_CIOIN/56-190--------------------------------------------------------------------LHPL-CMICGMV
A7RY72_NEMVE/55-189--------------------------------------------------------------------YHPV-CMVIGLV
CY561_CAEEL/62-204--------------------------------------------------------------------YHPT-FMIMGMV
CY561_HUMAN/52-186--------------------------------------------------------------------AHPL-CMVIGLI
CYBR1_HUMAN/49-185--------------------------------------------------------------------WHPV-LMVTGFV
F6U164_XENTR/54-190--------------------------------------------------------------------WHPV-LVTSGFI
CYBR1_DANRE/47-183--------------------------------------------------------------------WHPL-LMVIGFI
Q7Q742_ANOGA/55-192--------------------------------------------------------------------WHPL-LMSVGMI
Q9I7U1_DROME/146-282--------------------------------------------------------------------WHPL-FMTIGFI
O16272_CAEEL/98-231--------------------------------------------------------------------LHGF-LMFLGFI
A8X7F4_CAEBR/71-205--------------------------------------------------------------------LHAF-LMVLAFI
Q29JT1_DROPS/48-184--------------------------------------------------------------------LHVW-LVTFGFI
Q9VIT6_DROME/48-184--------------------------------------------------------------------LHAW-LVTFGFV
Q9VIT5_DROME/94-228--------------------------------------------------------------------LHAW-LVTIGFS
Q9VIU6_DROME/47-182--------------------------------------------------------------------MHMF-MTGTGFH
Q17ID4_AEDAE/154-293--------------------------------------------------------------------WHVI-LCVFGFH
A0NFY4_ANOGA/64-202--------------------------------------------------------------------WHVF-LTLIGYH
Q7PZD0_ANOGA/60-198--------------------------------------------------------------------WHPT-FMSIGYL
Q16LW8_AEDAE/141-279--------------------------------------------------------------------WHPT-FMSIGYF
C56D1_MOUSE/54-191--------------------------------------------------------------------WHPV-FMALAFC
F1R6P8_DANRE/63-200--------------------------------------------------------------------WHPV-CMSLGFG
H3BZA9_TETNG/61-199--------------------------------------------------------------------WHPV-FMSVAYC
Q1LXB7_DANRE/47-184--------------------------------------------------------------------WHPF-LMTLSFS
H3DB33_TETNG/49-185--------------------------------------------------------------------WHPF-LMTLAFS
C56D2_BOVIN/47-184--------------------------------------------------------------------WHPV-LMSLAFS
Q5I024_XENTR/47-183--------------------------------------------------------------------WHPF-LMTLAFS

PF01794

FRO8_ARATH/159-281--------------------------------------------------------------------FGLL.AEACLSL
FRO6_ARATH/178-300--------------------------------------------------------------------LGMI.GLLCMVF
Q4WR75_ASPFU/273-390--------------------------------------------------------------------TGIL.SFANVPL
Q4WC00_ASPFU/90-202--------------------------------------------------------------------AGRL.SLINMAV
Q4WRK0_ASPFU/107-219--------------------------------------------------------------------AGEL.ALVNLIF
Q4WF95_ASPFU/130-249--------------------------------------------------------------------FGIV.AVAQLPT
AIM14_DEBHA/94-207--------------------------------------------------------------------FGRM.SYALLPF
Q6BTD9_DEBHA/151-272--------------------------------------------------------------------AGIM.ATALTPF
Q6BXT5_DEBHA/276-393--------------------------------------------------------------------TCIT.AFSLLPS
Q0U921_PHANO/152-271--------------------------------------------------------------------FGQV.GASQLPV
Q0UXV8_PHANO/43-161--------------------------------------------------------------------AAWV.TLTQIPL
A5DEQ5_PICGU/148-261--------------------------------------------------------------------LGRI.ATVCLPT
Q6C644_YARLI/142-255--------------------------------------------------------------------TGFV.IAINFPM
FRE7_YEAST/161-282--------------------------------------------------------------------AGIM.AISLVPF
RBOHJ_ARATH/366-523--------------------------------------------------------------------KGTA.EILKLNM
Q0TVR2_PHANO/35-155--------------------------------------------------------------------TGII.SLANFPL
A3GFP0_PICST/241-358--------------------------------------------------------------------SGLL.LVYSLPV
A5DPY7_PICGU/304-417--------------------------------------------------------------------TSIL.ASEMMPL
A0JNK9_BOVIN/259-407--------------------------------------------------------------------LPIV.AITLLSL
YEDZ_RHORT/50-165--------------------------------------------------------------------LGEW.GLIFLLA
Q217F0_RHOPB/43-167--------------------------------------------------------------------VGWI.GCGLLLV
A0LQW5_ACIC1/61-184--------------------------------------------------------------------TGLL.AGYVVIV
A1TKU8_ACIAC/46-161--------------------------------------------------------------------SGDW.ALRGLWI
A6VUY1_MARMS/1-130--------------------------------------------------------------------MGQY.FPDPGKL
NOX4_PONAB/58-205--------------------------------------------------------------------RASA.SVLNLNC
Q5A445_CANAL/308-425--------------------------------------------------------------------TGIL.SAFLIPL
Q0APN2_MARMM/57-179--------------------------------------------------------------------LGDT.AIRILLV
RBOHC_SOLTU/408-565--------------------------------------------------------------------KGAA.ETIKLNM
Q5FQ04_GLUOX/56-169--------------------------------------------------------------------LGLW.AFRFLLV
Q5E5I2_VIBF1/37-166--------------------------------------------------------------------TGWL.GFAYMGA
Q82R51_STRAW/62-185--------------------------------------------------------------------AGVL.SAYLMSC
Q2H7Y7_CHAGB/153-271--------------------------------------------------------------------NAWV.TVTQVPL
A7TPB1_VANPO/264-381--------------------------------------------------------------------TGIM.SLSLFPV
Q6C0I9_YARLI/142-260--------------------------------------------------------------------CGWV.SISQISL
Q7SFF5_NEUCR/239-364--------------------------------------------------------------------MGFM.FIVNLPL
Q2H477_CHAGB/186-307--------------------------------------------------------------------SGTL.SVVNMVP
DUOX2_PIG/1081-1230--------------------------------------------------------------------RGTA.ASVSFMF
Q6N633_RHOPA/45-180--------------------------------------------------------------------CGVL.ALGLMSV
Q28MM2_JANSC/56-182--------------------------------------------------------------------FGTA.AFFMLSA
Q9L1A8_STRCO/50-176--------------------------------------------------------------------TGLL.AGYLMAL
Q0ACJ0_ALKEH/56-177--------------------------------------------------------------------LAMA.GFALLLA
Q21DI1_SACD2/35-149--------------------------------------------------------------------LGLG.GLRLLLL
Q82L18_STRAW/83-206--------------------------------------------------------------------AGLY.GALLMAF
A0A0D1E108_USTMA/139-260--------------------------------------------------------------------AGMM.ALGLMPF
Q0BQQ1_GRABC/59-172--------------------------------------------------------------------TGRW.TIRFLLV
AIM14_VANPO/88-208--------------------------------------------------------------------LGRL.SYTLIPL
Q6CUH0_KLULA/305-422--------------------------------------------------------------------AGIY.AFAQLPV
A1WD64_ACISJ/52-181--------------------------------------------------------------------SGLW.SIGLMAL
Q6FMR3_CANGA/107-225--------------------------------------------------------------------LGRL.SYVLLSL
Q7PNG0_ANOGA/297-444--------------------------------------------------------------------RACG.QCLNFNC
AIM14_ASHGO/94-211--------------------------------------------------------------------LGRL.SYVLLFL
Q4D1K3_TRYCC/390-520--------------------------------------------------------------------LGQL.AVALLSL
A1C8X0_ASPCL/194-313--------------------------------------------------------------------AAFL.ATIQIPL
NOXB_DICDI/225-375--------------------------------------------------------------------RTAA.RLINLNS
Q47CF6_DECAR/42-170--------------------------------------------------------------------SGIL.ALWWMSA
Q6C208_YARLI/250-367--------------------------------------------------------------------AGIQ.VTVQLPM
Q0RT78_FRAAA/120-243--------------------------------------------------------------------AGLL.AAYLVLV
FRE4_YEAST/273-390--------------------------------------------------------------------SGIL.SFAHLPL
Q47Y20_COLP3/48-162--------------------------------------------------------------------TGIG.AFNLLLV
A7TIJ6_VANPO/133-250--------------------------------------------------------------------CGRI.SVSLLPI
Q0V134_PHANO/180-301--------------------------------------------------------------------TGTL.AALNLIP
Q2IMP5_ANADE/49-169--------------------------------------------------------------------LGFL.GLSIMAM
Q74Z78_ASHGO/248-365--------------------------------------------------------------------ASTI.LIYLVPF
A2I2U7_CHLRE/303-425--------------------------------------------------------------------SGWV.GRLDLLL
Q0RIS3_FRAAA/13-136--------------------------------------------------------------------SGTV.ALLLLTL
Q7MCQ7_VIBVY/47-184--------------------------------------------------------------------SGIL.ALMMFSA
Q6C2K8_YARLI/288-405--------------------------------------------------------------------SGGM.AVTQVPW
YEDZ_PSEAE/42-156--------------------------------------------------------------------LGLG.ALVLLLL
A6LZ17_CLOB8/40-156--------------------------------------------------------------------IAAF.ALVAFAF
Q8YTT0_NOSS1/52-169--------------------------------------------------------------------LGFI.GLAMMAM
A5DUC1_LODEL/275-390--------------------------------------------------------------------TGIT.ATTFMPL
Q6CET8_YARLI/281-396--------------------------------------------------------------------LGIM.AVSQTPL
Q7NFG8_GLOVI/60-173--------------------------------------------------------------------EGHL.ALVGLAL
FRE8_ASHGO/108-221--------------------------------------------------------------------LGRV.AAAFMPA
F2G9K0_ALTMD/54-168--------------------------------------------------------------------TGTW.AIHFLLL
A3LSQ8_PICST/127-243--------------------------------------------------------------------ISKV.AVGSLPT
Q2HEL2_CHAGB/276-393--------------------------------------------------------------------TGNL.AFALFPL
Q5Z0I9_NOCFA/44-161--------------------------------------------------------------------LGFV.GMSMLGA
AIM14_PICST/105-222--------------------------------------------------------------------LGRM.AYCLVPF
Q01ZZ5_SOLUE/82-210--------------------------------------------------------------------AGLC.AIVLLTL
Q2K9I9_RHIEC/52-165--------------------------------------------------------------------LGIW.TIRFLIA
Q5B3H4_EMENI/159-280--------------------------------------------------------------------TGVM.ATVNLIP
A4VRF2_PSEU5/43-178--------------------------------------------------------------------SGVL.GIAAMSV
NOXC_DICDI/622-766--------------------------------------------------------------------RIAA.QLIEFNA
A0K1X7_ARTS2/75-198--------------------------------------------------------------------AGLA.GMDLVLL
A1CUM1_ASPCL/175-298--------------------------------------------------------------------VGVL.AYALTPL
FRP2_SCHPO/114-229--------------------------------------------------------------------LGYL.SCGLFFV
A5WDA3_PSYWF/39-154--------------------------------------------------------------------MGAS.ALACMAS
Q2TYZ6_ASPOR/86-204--------------------------------------------------------------------TSMF.AYACLPW
NOX3_MOUSE/55-218--------------------------------------------------------------------RASA.VCLNFNC
Q6FWS3_CANGA/299-416--------------------------------------------------------------------TGIL.AFAHFPI
Q5KHL8_CRYNJ/202-314--------------------------------------------------------------------LGVM.SFSQLPI
Q2FKR9_METHJ/56-171--------------------------------------------------------------------AGVW.GFISLSL
Q2GQU2_CHAGB/155-272--------------------------------------------------------------------LGVV.AISQWPL
A1CRA6_ASPCL/41-187--------------------------------------------------------------------LGHV.ALSQLPF
A6LWS3_CLOB8/66-186--------------------------------------------------------------------RGLI.SVSFFIL
Q15YY0_PSEA6/59-182--------------------------------------------------------------------LSIS.GMAMMLC
Q604N8_METCA/48-163--------------------------------------------------------------------SGLW.TLRFLLG
Q9EX48_STRCO/90-224--------------------------------------------------------------------SGLLWAWGTVML
Q28KV6_JANSC/39-153--------------------------------------------------------------------LGGI.AFLLMTS
Q5AHQ5_CANAL/95-212--------------------------------------------------------------------YGRM.AYCLIPL
A0A0D1E0K7_USTMA/233-360--------------------------------------------------------------------TGDI.TMGLVPI
Q59WI9_CANAL/253-370--------------------------------------------------------------------AALL.AGFCVPL
Q6CEA2_YARLI/129-243--------------------------------------------------------------------LGRV.SAALYPA
FRO4_ARATH/156-277--------------------------------------------------------------------IGYV.GNICWAF
AIM14_KLULA/97-214--------------------------------------------------------------------LGRL.SYVLVIL
Q0UZN5_PHANO/147-266--------------------------------------------------------------------SGWL.ALACMPF
YEDZ_DEIRA/47-161--------------------------------------------------------------------TGQL.ALIVLTL
A5E743_LODEL/134-251--------------------------------------------------------------------CARI.GIAQIPA
A1AY37_PARDP/49-162--------------------------------------------------------------------LGRT.AIYFLLA
YEDZ_PASMU/44-158--------------------------------------------------------------------LGFS.ALTILLI
A5E459_LODEL/280-397--------------------------------------------------------------------TGIM.VVWCLPV
AIM14_YARLI/82-195--------------------------------------------------------------------FGRL.CYALLPL
A5GKL0_SYNPW/57-207--------------------------------------------------------------------YGSA.AFILLSI
Q7S590_NEUCR/128-246--------------------------------------------------------------------FGII.AVSQYPM
Q5P447_AROAE/42-170--------------------------------------------------------------------SGLL.AIAMMSL
Q4PEM4_USTMA/167-285--------------------------------------------------------------------TGVL.GTAQLPL
A5E3X1_LODEL/124-240--------------------------------------------------------------------IGRV.GVGNLPI
Q5KPP3_CRYNJ/174-292--------------------------------------------------------------------PGFL.ALSQLPL
Y1462_ARCFU/1-125--------------------------------------------------------------------MTVL.SFTLMVN
NOXA_DICDI/58-201--------------------------------------------------------------------RGCA.QLLKLNC
A7RPH5_NEMVE/44-191--------------------------------------------------------------------RGAA.AVLWFSC
A6VQE1_ACTSZ/43-157--------------------------------------------------------------------LGFT.AISILLA
A7ENT9_SCLS1/179-300--------------------------------------------------------------------TGIL.AVINMIP
Q6C3A4_YARLI/310-427--------------------------------------------------------------------TGLV.ALTQIPL
Q6CPC7_KLULA/282-399--------------------------------------------------------------------AGIM.GVHLMVI
Q75D69_ASHGO/278-397--------------------------------------------------------------------SGML.ANCLFVL
Q6CN86_KLULA/282-397--------------------------------------------------------------------TGVM.STIHTPA
Q6CLT2_KLULA/243-363--------------------------------------------------------------------TGGL.AFGLLPL
Q6CET4_YARLI/273-389--------------------------------------------------------------------TGIM.AMTQIPI
FRE1_YEAST/258-375--------------------------------------------------------------------ADLM.AIALFPV
E4X2P3_OIKDI/55-207--------------------------------------------------------------------RGAA.QAINFNL
E7M0W3_YEASV/274-390--------------------------------------------------------------------AGIL.AFAHFPL
E7QHM4_YEASZ/202-316--------------------------------------------------------------------.GIL.AFTQFPL
F6WE71_XENTR/248-394--------------------------------------------------------------------FPIV.SLILLAL
F6YS00_CIOIN/57-202--------------------------------------------------------------------.ASA.ACINLNS
F7BAU5_XENTR/57-219--------------------------------------------------------------------...A.ACLNFNC
H0VSY4_CAVPO/49-211--------------------------------------------------------------------..SA.RCLNFNS
Q4WB75_ASPFU/288-403--------------------------------------------------------------------.GVL.SFANIPL
Q4WCY1_ASPFU/137-255--------------------------------------------------------------------TGFV.AISQLPL
Q4WGG6_ASPFU/187-306--------------------------------------------------------------------.GTL.ATLNLVP
Q5KEC9_CRYNJ/209-325--------------------------------------------------------------------.GYV.AAAHFPL
Q5KEL3_CRYNJ/176-290--------------------------------------------------------------------.AIM.SFYNLPI
Q5KJ95_CRYNJ/122-251--------------------------------------------------------------------.GWI.AQALLPF
YEDZ_XANCP/53-167--------------------------------------------------------------------TGLW.ALRLLLI
Q8XLV2_CLOPE/68-182--------------------------------------------------------------------.GFV.STALFIL
YEDZ_YERPE/48-161--------------------------------------------------------------------.GRM.ALKLLLA
Q9I5Z1_PSEAE/40-165--------------------------------------------------------------------TGVA.SFALMSL

PF10348

Q4WLQ1_ASPFU/53-156------------------------------------------------DESPLSYFA-----------YGK.-HSGTIMA
A5DCA9_PICGU/65-169------------------------------------------------AYNTTTFFT-----------VDAP-HKAALYS
A5DLL3_PICGU/70-174------------------------------------------------AYNTTTFFT-----------VDAP-HKGALYM
Q7S4U9_NEUCR/54-157------------------------------------------------EEYPLTYFA-----------HPD.-HKTAIYA
A3LQA2_PICST/42-147------------------------------------------------QYNTTTYFN-----------VESK-HRGALYG
Q5KLR8_CRYNJ/22-123------------------------------------------------EHHNVTEID-----------TSVP-FDARIYI
YBH6_SCHPO/15-118------------------------------------------------EIDFENYAN-----------H...-MNKFLMA
A7ENZ5_SCLS1/29-130------------------------------------------------SKIQDGDAM-----------SVEP-IDSTLWV
Q6CTZ5_KLULA/79-184------------------------------------------------SYNSTTFFT-----------TDKG-NRGAFWT
Q5KDX6_CRYNJ/161-262------------------------------------------------EFDDSWNLE-----------EVES-HKGLALV
Q7S0V3_NEUCR/59-161------------------------------------------------DQIPEGATI-----------SVEP-LDTTLWL
A0A0D1CF67_USTMA/25-126------------------------------------------------GHHSHGPAD-----------NSIP-IDNILWI
A5DTJ1_LODEL/90-195------------------------------------------------NYNTTTYFT-----------VPSN-HRAALYM
A1C9V0_ASPCL/31-132------------------------------------------------ETVPDGAAV-----------SQEP-IDSTLWV
A6RFH8_AJECN/26-127------------------------------------------------SQLSDGQVI-----------SGDP-IDSILWV
Q6C1B0_YARLI/25-127------------------------------------------------HDIPEGQYT-----------SNES-VGAAMWT
A7F0D8_SCLS1/59-162------------------------------------------------NIAESSYFQ-----------HPE.-LGGLMVA
Q6C5B1_YARLI/116-222------------------------------------------------AYDPTNFFN-----------TETP-GQSLLTW
A7TT31_VANPO/83-190------------------------------------------------SYNTTTYFT-----------TDAG-NKFALKY
Q2GXA8_CHAGB/1-103------------------------------------------------MLNENGRQL-----------VDKV-QDTILWI
Q2HHA0_CHAGB/52-155------------------------------------------------DQYPPTYFA-----------HPD.-NKAAIYG
Q5AP55_CANAL/89-194------------------------------------------------NYNTTTYFT-----------VESA-HRPALYL
Q5B6W6_EMENI/54-157------------------------------------------------DDSPMSYFA-----------YGQ.-YTGWIVA
Q6FMC4_CANGA/68-173------------------------------------------------KYDTTTFFT-----------TDLG-NRSAFKF
Q75EM7_ASHGO/67-172------------------------------------------------QYDTMTYFN-----------APSK-RKRGLWM
E7KKX9_YEASL/58-161------------------------------------------------NYNTTTYFT-----------TQAG-NRSALRY
G4MKH1_MAGO7/63-163------------------------------------------------.KIQEGEAI-----------SMDP-IDTTLWV

PF01578

HEMX_BACSU/66-273------------------------------------------------VLNVTEALY-----------FYAW-VLVTLSL
CCMC_PARDP/3-182------------------------------------------------IWEYANPVK-----------FMRT-SGAILPW
Q8EK42_SHEON/5-184------------------------------------------------LHPYADPER-----------AYKL-SGTLFPW
CCSA_CYACA/70-293------------------------------------------------LSNLYESLL-----------FLSW-VLNIITI
CCMC_MARPO/2-175------------------------------------------------YVPLLRPFF-----------FMCC-SFRYAQI
CCSA_ODOSI/69-306------------------------------------------------LSNLYESLL-----------FLTW-TLLTIYL
Q9KUG2_VIBCH/37-266------------------------------------------------TVFISAAIA-----------LLFH-GWLLSDL
Q9K176_NEIMB/36-266------------------------------------------------ELPVLGA.A-----------LTVH-GAALLMP
NRFE_HAEIN/89-298------------------------------------------------WGGHEGSML-----------FWLF-SLSLWLA
CCSA_CHLVU/70-308------------------------------------------------LSNLYESLI-----------FLAW-CLLLLYI
Q9CLN5_PASMU/37-267------------------------------------------------MPFLTAALL-----------AILL-HFINLIP
CCSA_MAIZE/68-311------------------------------------------------LSNLYESLI-----------FLSW-TLYILHT
CCMF_PSEFL/94-304------------------------------------------------WGAHEGSLL-----------LWAL-ILGGWTF
O66467_AQUAE/59-250------------------------------------------------VGDVYGMIS-----------LVGN-LSVLLFL
O67831_AQUAE/103-307------------------------------------------------WSNLFEALT-----------FWSF-IAGFVYL
O25141_HELPY/695-896------------------------------------------------WSNAYESML-----------YIAW-ASVIAGF
CCSA_PORPU/68-313------------------------------------------------LSNLYESLL-----------FLAW-GLTFVHL
O21278_RECAM/20-197------------------------------------------------YITLIQPSR-----------LMST-TNIILPI
CCMC_ARATH/2-175------------------------------------------------SVSLLQPSF-----------LMSK-TRSYAQI
CCMF_RHOCB/89-298------------------------------------------------WGNHEGSML-----------LWVL-ILAMFGA
CCBS_MARPO/102-404------------------------------------------------WSNHEGSLL-----------LWCW-ILSFYGF
NRFE_ECOLI/72-281------------------------------------------------WGGHEGSLL-----------LWVL-LLSAWSA
CCMF_ECOLI/89-299------------------------------------------------WGAHEGSLL-----------LWVL-LMSGWTF
CCSA_GUITH/70-295------------------------------------------------LSNLYESLM-----------FLTW-GLLFSAI
CCSA_CYAPA/67-316------------------------------------------------ISNLYESLF-----------FLVW-GLNTIWL
CCMC_HAEIN/5-184------------------------------------------------LHPYAKPET-----------QYRI-CGKLSPL
CCMC_ECOLI/5-184------------------------------------------------LHQLAIPPR-----------LYQI-CGWFIPW
O21277_RECAM/89-298------------------------------------------------WSNHEGSML-----------LWCW-ILSIYTY
O28299_ARCFU/5-170------------------------------------------------ASALCFFSG-----------FAML-VYGVYKV
O28091_ARCFU/80-267------------------------------------------------WAGKEGSLL-----------LWVV-LNLMVTS
CCMC_BRADU/3-181------------------------------------------------LIDLANPTR-----------FLAL-TARVLPW
CCMF_BRADU/89-298------------------------------------------------WGNHEGSML-----------LWVS-ILALFGG
Q9P9P5_XYLFA/33-261------------------------------------------------EWRIPALVG-----------LLAH-GGYHFLV
CCSA_GALSU/74-300------------------------------------------------LSNLYESLL-----------FLSW-SLTTIQL
Q9X619_SALTM/58-288------------------------------------------------MAILSAVIA-----------LVCH-AVALESR
C3VYY3_PINTH/67-313------------------------------------------------LSNLYESFM-----------FLSW-SSSVFHI
CCSA_CHLRE/138-347------------------------------------------------LSNLYESLM-----------FLAW-CCTFLYL
CCSA_SYNY3/67-328------------------------------------------------ISNLYESLF-----------FLAW-GITAVHF
Q9HXP7_PSEAE/35-264------------------------------------------------LLLLFGLLA-----------LVAH-AFSLYQQ

PF02628

CTAA_BACPE/6-286--------------------------------------------------------------------KIYSVITSIGVL
ETP1_SCHPO/99-458--------------------------------------------------------------------AFWLLGSSALVL
CTAA_PARDP/37-362--------------------------------------------------------------------RLWLVVLFVMVA
CTAA_SPHWW/18-335--------------------------------------------------------------------ANWLLLVAVLVF
CTAA1_ACICJ/13-334--------------------------------------------------------------------GTWLLVICFMIF
CTAA2_ACICJ/30-356--------------------------------------------------------------------AIWLFVSFALIV
CTAA_GRABC/35-352--------------------------------------------------------------------ATWMFTLCFMIL
Q6FQE7_CANGA/106-462--------------------------------------------------------------------AYWLIGTSGLVF
A1CT55_ASPCL/107-465--------------------------------------------------------------------AYWLLGSAASVF
Q5K7Z7_CRYNJ/87-433--------------------------------------------------------------------PYWLYGCSAVVF
A4SB75_OSTLU/15-353--------------------------------------------------------------------AWWLGGGCAWVF
Q292P6_DROPS/49-381--------------------------------------------------------------------GRWFLGVSGMVF
Q382Y6_TRYB2/45-379--------------------------------------------------------------------AQWLYGSAAVVG
Q4Q7Z4_LEIMA/67-401--------------------------------------------------------------------AHWLYISAACVG
Q607I2_METCA/14-312--------------------------------------------------------------------ARIGIITIAAVY
Q11SZ6_CYTH3/10-312--------------------------------------------------------------------YRIVFVSLVTIY
Q0ABY2_ALKEH/7-324--------------------------------------------------------------------QRLALLLTVWTF
Q5P2E4_AROAE/16-326--------------------------------------------------------------------RRLVLAALALTT
Q3SLW6_THIDA/5-318--------------------------------------------------------------------RNLALLALILTL
Q3J6R5_NITOC/6-323--------------------------------------------------------------------YVFALAASLLAL
Q88RM0_PSEPK/6-317--------------------------------------------------------------------FRLAVFATLLAL
Q2SQU9_HAHCH/23-348--------------------------------------------------------------------RRLVILTSVWAF
Q0VN95_ALCBS/14-332--------------------------------------------------------------------RRFCILAVLLAA
Q7MDC7_VIBVY/12-325--------------------------------------------------------------------RIMVQIALVLTS
A3Q942_SHELP/4-317--------------------------------------------------------------------TSLLKLTLVFTL
Q48AB6_COLP3/12-337--------------------------------------------------------------------RRLVLTSLLLAV
Q15N00_PSEA6/2-315--------------------------------------------------------------------RKLVLAGLILAI
A1SY56_PSYIN/14-353--------------------------------------------------------------------KTLVLLSCLLSV
Q3IJP9_PSEHT/6-319--------------------------------------------------------------------KNWVLVTGLLAL
Q12E38_POLSJ/44-358--------------------------------------------------------------------RVLTLVTLFLTF
A2SKN8_METPP/44-363--------------------------------------------------------------------RALTVLTLFLTF
A4T080_POLSQ/35-356--------------------------------------------------------------------QKLNWVLVFMTF
Q8Y2G5_RALSO/30-341--------------------------------------------------------------------RKLVWITAFLTL
Q2KTW9_BORA1/9-320--------------------------------------------------------------------RKLVFFTWFLTL
Q60CH3_METCA/12-323--------------------------------------------------------------------RKLTFLGLILLF
CTAA_FLAJ1/9-333--------------------------------------------------------------------IIWLLSGCVLLF
CTAA_ORITB/10-346--------------------------------------------------------------------SIWLIVSTLLLL
CTAA_RICPR/7-325--------------------------------------------------------------------TRWLFISCIMVI
CTAA_ANAPZ/7-319--------------------------------------------------------------------ATWLGTCCIMVL
CTAA_NEOSM/4-317--------------------------------------------------------------------RTWLAVCILLIL
CTAA_BRADU/15-335--------------------------------------------------------------------RWWLISVAALIA
CTAA_METS4/27-349--------------------------------------------------------------------RRWLFLMAALVV
CTAA_RHIEC/27-347--------------------------------------------------------------------RLWLGFVLLALF
CTAA_PARL1/21-336--------------------------------------------------------------------AWWLIGVAALVF
CTAA_JANSC/36-361--------------------------------------------------------------------RVFIMILFVMVV
CTAA_HYPNA/15-332--------------------------------------------------------------------RRWLILMALMVY
CTAA_MARMM/13-331--------------------------------------------------------------------STWLLVVAALVC
CTAA_CAUCR/14-334--------------------------------------------------------------------AIWLFIVAAMVF
CTAA_NOVAD/17-340--------------------------------------------------------------------ARWLFVVAFMVV
CTAA_SPHAL/22-339--------------------------------------------------------------------ARWLWAVALLVI
CTAA_BARHE/23-344--------------------------------------------------------------------QVWLYSILLLCL
A0CRQ7_PARTE/61-392--------------------------------------------------------------------GGWLLLCAGGVY
CTAA_MAGSA/22-344--------------------------------------------------------------------AVWLLACCFMVA
A9WIE2_CHLAA/11-294--------------------------------------------------------------------..FAWLNVGYNL
CTAA_LYSSC/8-290--------------------------------------------------------------------KWFAVAATVGML
B7VQY7_VIBTL/4-312--------------------------------------------------------------------.....LTILLTL
CTAA_ANAMF/9-318--------------------------------------------------------------------.VWLGVCCSMTL
F1R355_DANRE/60-387--------------------------------------------------------------------.RWLLGCSGLVL
I0HWX8_RUBGI/43-349--------------------------------------------------------------------..LTTLTLVLAF
CTAA_BRUA2/27-346--------------------------------------------------------------------RYWLYAVFAVLI
CTAA_PELUB/14-326--------------------------------------------------------------------.LWLITLFSLIV
COXX_THET8/12-294--------------------------------------------------------------------..YAWGVLLWNV
Q5ZYG1_LEGPH/18-327--------------------------------------------------------------------...ATLAVFLAF
Q6Z5C5_ORYSJ/128-457--------------------------------------------------------------------.IWLFGCATWVF
CTAA_WOLPM/16-328--------------------------------------------------------------------.IWLFLCSVMVI
CTAA_LISMO/7-287--------------------------------------------------------------------.VWSVLTIICMT
Q9I720_PSEAE/12-320--------------------------------------------------------------------..VAVLATLLAA

PF00033

CYB6_SPIOL/21-210ITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTDAFASVQYIMTEVNFGWLIRSVHRWSASM-MVLMMIL
CYB_ASCSU/10-196VVSLPSSKVLTYGWNFGSMLGMVLGFQILTGTFLAFYYSNDGALAFLSVQYIMYEVNFGWIFRVLHFNGASL-FFIFLYL
CYB_MARPO/20-208LIDYPTPSNISYWWGFGSLAGLCLVIQILTGVFLAMHYTPHVDLAFLSVEHIMRDVKGGWLLRYMHANGASM-FFIVVYL
CYB_TRYBB/9-197RKGLLMSGCLYRIYGVGFSLGFFIALQIICGVCLAWLFFSCFICSNWYFVLFLWDFDLGFVIRSVHICFTSL-LYLLLYI
CYB6_MARPO/21-210ITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFSSVQYIMTEVNFGWLIRSVHRWSASM-MVLMMIL
CYB6_EUGGR/21-210VSSKYVPPHVNIFYCLGGITFTCFIIQVATGFAMTFYYRPTVTEAFLSVKYIMNEVNFGWLIRSIHRWSASM-MVLMMIL
CYB_STELO/18-204FIDLPTPSNISSWWNFGSLLGLCLIMQILTGLFLAMHYTPDTTTAFSSVAHICRDVNYGWFIRYLHANGASM-FFICLYA
CYB_HETFR/19-205LVDLPAPSNISAWWNFGSLLVLCLAVQILTGLFLAMHYTADISLAFSSVIHICRDVNYGWLIRNIHANGASL-FFICIYL

PF13631

D5SPP4_PLAL2/91-258----------------------------------------------------------------------QA-MVVALAL
D7WEJ9_9CORY/110-284----------------------------------------------------------------------LM-FMMAMFA
C7M191_ACIFD/113-287----------------------------------------------------------------------DV-FIAAIVV
A0LTH4_ACIC1/129-303----------------------------------------------------------------------LL-FVAAIIA
Q2JA36_FRASC/139-313----------------------------------------------------------------------LL-FVAAIIV
E3JBI3_FRASU/129-303----------------------------------------------------------------------LL-FVASIIV
C8XCX9_NAKMY/122-296----------------------------------------------------------------------LI-FLFSMML
D1A8W4_THECD/118-295----------------------------------------------------------------------IL-FMVAIMA
C7MZ05_SACVD/123-298----------------------------------------------------------------------LI-FVAAMFV
QCRB_CORDI/110-284----------------------------------------------------------------------LT-FMVSMTV
B1MBC7_MYCA9/109-283----------------------------------------------------------------------LM-FAASIVV
C6W9G5_ACTMD/123-297----------------------------------------------------------------------LL-FMAAIVV
D1A3M6_THECD/119-294----------------------------------------------------------------------VI-FIAAILA
Q9K4I9_STRCO/122-296----------------------------------------------------------------------LV-FLSAIGV
D0LAX2_GORB4/112-287----------------------------------------------------------------------LL-FAASIII
Q01PC6_SOLUE/95-279----------------------------------------------------------------------NF-MIAVVLV
Q9RX79_DEIRA/103-278----------------------------------------------------------------------NI-MVAAAII
A0LFE3_SYNFM/95-264----------------------------------------------------------------------NL-LLVVLGL
A4YE24_METS5/89-278----------------------------------------------------------------------YA-MIILAYV
Q9HIU9_THEAC/81-267----------------------------------------------------------------------YI-MIGLLYI
A4YDG6_METS5/94-292----------------------------------------------------------------------YI-MIILAYI
D2PP93_KRIFD/114-286----------------------------------------------------------------------LI-MMAAITL
D4H0P8_DENA2/82-245----------------------------------------------------------------------HI-FLIVIAV
Q9HIV5_THEAC/107-280----------------------------------------------------------------------YA-MIVLVYA
Q6KZY3_PICTO/98-271----------------------------------------------------------------------YA-MIGLVYF
B3LEZ9_DROMO/89-254----------------------------------------------------------------------SF-FFICIYL
F4B633_ACIHW/89-277----------------------------------------------------------------------YA-MIILAYI
QCRB_MYCTU/120-294----------------------------------------------------------------------.M-FAAAIMV
Q4JWC3_CORJK/115-288----------------------------------------------------------------------.L-FAVSIMV
Q8HC78_ORYLA/88-253----------------------------------------------------------------------SF-FFICIYL
Q97V30_SULSO/93-279----------------------------------------------------------------------YA-MIILAYI
Q97VH0_SULSO/90-287----------------------------------------------------------------------YI-MIILAYI
V9XG29_9NOCA/115-289----------------------------------------------------------------------.M-FAASIVV

PF01292

C1DIE6_AZOVD/9-186LAA--------F...S---------GLSWFF-PT---------------------------LSGLGAVLGTP........
B2UEV9_RALPJ/18-207VLV--------L...S---------GWRIYN-AA---------------------------PFFPFTIPASATLG.....
F2G749_ALTMD/13-185TNY--------F...I---------VE....-..---------------------------.......PG..........
B2JU39_BURP8/35-202AII--------A...L---------EIVLWF-SP---------------------------GTALASV............
A8LH36_FRASN/20-219ALS--------V...T---------GYLIGN-PD---------------------------IHPGGHVYW..........
Q24SV4_DESHY/15-201ILL--------F...T---------GLAVLS-VT---------------------------FRPAMAIVGGI........
B0SVS8_CAUSK/3-181AAY--------F...S---------TEW...-..---------------------------...................
Q3KA02_PSEPF/7-177AML--------F...I---------GAGMVT-SV---------------------------SARHEWL............
A7IEJ2_XANP2/17-189VVF--------G...I---------TYLEGF-FA---------------------------RGTPA..............
Q5P430_AROAE/8-169AAY--------L...T---------SEDAES-P.---------------------------...................
Q8KEB1_CHLTE/10-218VLL--------G...T---------GLYIAY-PV---------------------------LAAPSGEAVFHHG......
A3Y9W1_9GAMM/26-199LML--------LA.KF---------GFASAI-SQ---------------------------EDKITMLIG..........
A0RPH5_CAMFF/12-218ILI--------V...S---------GFYLAY-VF---------------------------VSPAITSEPTNFM......
Q2W2V7_MAGSA/500-649VLA--------V...T---------GLFLHF-AG---------------------------TPAALLR............
E2XB98_SHIDY/13-220VLM--------V...T---------GYFIGK-PL---------------------------PSVSGEATYL.........
Q73XF0_MYCPA/5-235LII--------R...S---------GIEILS-TH---------------------------PKLYWHDDSKPGTEWARFT
Q3K9Y1_PSEPF/9-180LVY--------....A---------SMELRG-LF---------------------------PKGSGG.............
J2ZFR0_SHISO/68-257LLL--------A...S---------GLINHF-AM---------------------------VGATAVKSL..........
Q11M26_CHESB/8-183GQI--------G...L---------GYLTQI-TT---------------------------GDPRLQFDL..........
A8EUR4_ARCB4/14-229VAV--------I...T---------GLYIGH-PY---------------------------YQSFIADPAVD........
Q0AAZ8_ALKEH/9-216LLV--------P...S---------GLGIIT-GD---------------------------SLRLAPAWWPQFLQNL...
A3UXK6_VIBSP/7-177GLF--------G...V---------GLWMVD-LS---------------------------YYSEWYKTA..........
Q726G3_DESVH/8-195VLL--------V...T---------GFEIHG-TY---------------------------RLFGFETA...........
Q0P8A9_CAMJE/92-274ILV--------P...T---------GFVMMF-GE---------------------------VFGGGVFVRV.........
Q6MN52_BDEBA/9-210GLL--------G...T---------AFLRKT-FL---------------------------SWRTNAALIESKMLEAGTS
A1VMH0_POLNA/30-197...--------....T---------GAYLTA-DG---------------------------ERWRLV.............
Q24SH5_DESHY/15-204LLI--------L...T---------GFGQMP-LY---------------------------NRYNVTKLPGAEWL.....
A4EHB9_9RHOB/9-185WQY--------V...S---------GNIMTG-MQ---------------------------RGDVVVGLGQN........
A1K9P7_AZOSB/5-173GLL--------G...W---------GLYMSD-LP---------------------------KGPERSFA...........
O28892_ARCFU/13-211ITA--------L...S---------GMQLSK-LF---------------------------GFTLFDDA...........
Q3SMF3_THIDA/22-205VLI--------A...T---------SQLAEA-FE---------------------------DGPWEDAI...........
Q0F0S9_9PROT/5-220SQI--------A...I---------GELMDV-PE---------------------------VEDKPAVSAIEWIMPAYAH
Q1QXP2_CHRSD/8-174LQL--------T...S---------SFFNIL-WE---------------------------GNVYSQAI...........
A8H662_SHEPA/17-235GLM--------F...I---------GLIMLF-KA---------------------------ELGISGLAAKI........
Q2LQE6_SYNAS/8-184ILC--------F...S---------GLGIMF-HS---------------------------LNFLGEPFGGL........
Q137Q9_RHOPS/15-183ALF--------A...S---------MNYAQE-LD---------------------------KADPLRRTF..........
Q0G224_9RHIZ/16-199VNI--------A...G---------GLMMTS-DI---------------------------LPSAVEFPV..........
Q21VQ4_RHOFT/20-197IAF--------VLGPG---------GFGRLM-RE---------------------------GIDPATRSD..........
A6D834_9VIBR/136-317TLA--------F...S---------GLMLVY-GK---------------------------HFMKPYVPTELW.......
A5FBE0_FLAJ1/8-190ILF--------I...T---------GFLRMY-WM---------------------------SKKTIIDTVETEMQSHNIS
Q0FAP7_9RHOB/5-159YGI--------FKQVD---------DINQLS-DI---------------------------SL.................
A3XC59_9RHOB/9-194SAF--------L...I---------GLIANN-LA---------------------------HEIQSPSFDGSAQTL....
A5G519_GEOUR/9-204TLC--------I...T---------GAQIRF-PE---------------------------YLAIFGSYKT.........
A4BH07_9GAMM/8-165PLL--------L...T---------GLRIAV-AN---------------------------EPALIRFSMLLP.......
A5FTL2_ACICJ/4-178TGF--------A...I---------AWIMVA-VP---------------------------LRDLLVKFL..........
Q3M4T2_ANAVT/30-199AAI--------I...T---------GFLVYN-TF---------------------------DGRFGKLPIPRI.......
Q5QZM1_IDILO/10-182GLW--------WTVEN---------GR....-..---------------------------...................
Q2K795_RHIEC/4-158LQY--------L...T---------GGSIER-TH---------------------------NAVHMGMGPS.........
Q2N9I4_ERYLH/7-222ILF--------M...S---------GLNISN-AH---------------------------PRLYWGEWGFAPEHAWLEL
Q2YJ32_BRUA2/13-182WQF--------A...S---------AILRVF-AK---------------------------DTPI...............
A8GZ50_SHEPA/78-266LLL--------I...T---------GIALGF-LF---------------------------IPRFVVDATAT........
A5WBJ1_PSYWF/9-194GAY--------VAVYF---------RHWFTV-DE---------------------------TPINWTA............
A5VEG9_SPHWW/24-275LLL--------W...S---------GVMIFN-VH---------------------------PRLYWGDSGHKGEAAIMEV
Q3ABV8_CARHZ/7-189SLI--------I...S---------GFYIHN-PL---------------------------KYNFFSTMDA.........
Q3JAE2_NITOC/6-172ALI--------G...L---------GGYLQY-LP---------------------------PTAPKQAFS..........
A3PG79_RHOS1/6-157FNY--------I...F---------GETMER-AY---------------------------DAVRQNVEP..........
Q89C01_BRADU/31-198VSL--------V...T---------GIRIAA-DA---------------------------LRAPFSKWLAPVL......
Q1QIT3_NITHX/121-299ILA--------I...S---------GLNITF-GR---------------------------PLLLPLIGFAAF.......
Q1ITC7_KORVE/20-198YCG--------I...S---------GLAFFS-PH---------------------------LYWMALLLGGA........
J9ZA39_LEPFM/17-226LLL--------F...E---------SYLLFN-WH---------------------------KELGLTHPTTV........
Q1ZU49_PHOAS/13-188LQI--------L...N---------SNLMSM-TH---------------------------AGEIEGGVF..........
A8G145_SHESH/120-302LLM--------L...T---------GLVLAG-GR---------------------------HYFEPSMNASSW.......
Q1Z615_PHOPR/4-173YAM--------C...A---------GYIMHL-VI---------------------------DSSPHI.............
A1RW11_PYRIL/6-212VLA--------I...T---------GGALFA-IE---------------------------VLAPLVYAVGAPLAAAV..
Q7NUV6_CHRVO/15-181WAL--------L...S---------GFALAS-GT---------------------------LPPALAKAVP.........
Q5V2I5_HALMA/8-213LLF--------F...T---------GYAIMF-ND---------------------------ELWWMLTLMGGA.......
Q7NL56_GLOVI/6-177ILF--------A...S---------GMIMTE-LP---------------------------REVAYRPSF..........
Q0BVB5_GRABC/13-193LLA--------LSWVE---------GW....-..---------------------------...................
Q47YK1_COLP3/6-182FAF--------L...T---------GEFAED-GI---------------------------TSNG...............
A5L4J8_VIBBS/13-176LTL--------T...L---------GFISSR-IL---------------------------PFSDKYPT...........
Q6N8J2_RHOPA/9-176IAL--------L...T---------GFRAAA-AE---------------------------DVTTEAAL...........
A0A023E6B3_AERSA/10-170GNL--------WLNEA---------G.....-..---------------------------...................
Q87J03_VIBPA/16-183AVL--------I...S---------GLVMDD-ES---------------------------NNLL...............
A1HTF5_9FIRM/5-186TLL--------F...T---------GLYLHY-PF---------------------------DVVRLP.VSI.........
Q5NE92_FRATT/30-197AQL--------I...L---------GFGYAY-DL---------------------------FDSRWI.............
Q2BLD7_NEPCE/3-170LAL--------F...M---------GNDIAQ-LS---------------------------NDLDLKVDR..........
Q2IL72_ANADE/263-456ALL--------L...S---------GVGLLS-AA---------------------------RFALLGPAAADAIAGA...
A8EX57_ARCB4/6-181LAF--------LTDDD---------KL....-..---------------------------...................
A4YRW2_BRASO/8-180VMI--------A...F---------GWWMNH-IP---------------------------ARPD...............
A5G6W1_GEOUR/7-182TLL--------L...S---------GLGLYS-RL---------------------------FNGYFTLFGGG........
Q1YYF5_PHOPR/9-176SAI--------A...L---------ILYEQT-IP---------------------------AGDVSF.............

PF14358

D4L0H2_9FIRM/73-132GSM--------I---S---------GILLSN-HI---------------------------FK.......----------
D0MK75_RHOM4/9-73LLT--------T---T---------GVLLRY-IL---------------------------PPGSGRFTT----------
W0E6J3_9FIRM/78-136AVI--------V---S---------GFMISK-II---------------------------FP.......----------
D2QYK9_PIRSD/9-74ALM--------F---V---------SVVVRF-VF---------------------------PPLVASSGW----------
D4H642_DENA2/9-75YLT--------F---S---------GVVMYI-T.---------------------------.PPGRIAYW----------
B3EM27_CHLPB/9-76MLI--------V---S---------GIVLYL-A.---------------------------.PPGRVANW----------
J7IMY2_DESMD/114-176VQA--------V---T---------GFILYK-PV---------------------------ELANAAGYF----------
W6EIG8_SULMU/8-59VVS--------I---T---------GVLMY.-..---------------------------.........----------
F2KT13_ARCVS/8-72FQA--------I---S---------GILLFL-S.---------------------------.PKGPQSGH----------
A2BLN5_HYPBU/150-207LLA--------I---T---------GIIMWF-RT---------------------------SFSLETETL----------
B3E729_GEOLS/14-80IMT--------V---S---------GVILFI-T.---------------------------.PQGRVAYW----------
R5AVI3_9BACT/6-59VAL--------T---I---------GVILHL-KS---------------------------HGIIVEPRS----------
F4GSW9_PUSST/118-178GLL--------L---T---------GVVMWR-SY---------------------------FSYLFPIWG----------
F4L3Z1_HALH1/135-204VQV--------I---T---------GFGLYA-AT---------------------------SEWWFPQLF----------
G2TKP1_BACCO/83-141FII--------I---S---------GIIISR-VV---------------------------FP.......----------
A1BH85_CHLPD/29-96ILL--------V---S---------EVILYI-L.---------------------------.PSGKPASR----------
L0KZY5_METHD/9-75IVA--------V---T---------GFVMYF-A.---------------------------IPSGVPRGR----------
K7RVD2_PROA4/158-222FLM--------L---T---------GVAMSP-AI---------------------------RNRFPRLIK----------
E6W587_DESIS/14-80LLT--------I---S---------GLLLYV-I.---------------------------.PEGRVARW----------
B4S7W8_PROA2/12-79MLL--------V---S---------GIVLYI-A.---------------------------.PPGRVANW----------
F2NIT4_DESAR/9-81GIA--------G---I---------GFLMKY-VL---------------------------LPRSAARAL----------
A6LIR5_PARD8/13-85LVS--------I---S---------GFILEI-V.---------------------------IPSRHAVRF----------
E6UI69_RUMA7/73-132LTA--------L---S---------GMSMSG-HA---------------------------VP.......----------
I2EY27_EMTOG/6-57ALS--------I---T---------GILLY.-..---------------------------.........----------
Q8TMV4_METAC/9-62LVG--------Y---S---------GLLLF.-..---------------------------.........----------
Q2KUA6_BORA1/118-178GLV--------L---T---------GIVMWR-AY---------------------------FAIYFPIWA----------
C9RRV1_FIBSS/74-133FLM--------V---S---------GIMLSN-HV---------------------------FA.......----------
W0LFH8_9ENTR/72-131SAI--------I---S---------GMMLSK-HL---------------------------LP.......----------
D3RZ50_FERPA/13-74ILA--------V---T---------GIPLLY-RY---------------------------TEWGMAWIN----------
A9WBK7_CHLAA/77-137VTI--------A---T---------GILISR-EA---------------------------LP.......----------
A1B726_PARDP/70-128ILL--------G---T---------SILISQ-DV---------------------------FA.......----------
J0RX58_9EURY/9-83IVA--------L---S---------SIVLLF-F.---------------------------LPSAGGGWV----------
R6EP61_9FIRM/72-131GFM--------V---S---------GILLSN-YI---------------------------FR.......----------
Q3B233_PELLD/10-77MLL--------V---S---------GTVLFI-A.---------------------------.PPGRVANW----------
Q6APY0_DESPS/4-70MEV--------F---T---------SVVLYI-V.---------------------------.PAGRVAYW----------
S6CG33_9ACTN/62-122FCV--------V---S---------GIMVSG-AL---------------------------LP.......----------
C8WKH1_EGGLE/2-62TVF--------V---S---------GLGMSG-AV---------------------------LQ.......----------
G0A5D7_METMM/11-75GML--------A---T---------GYLLRF-PL---------------------------PPGSNKSHA----------
C4XNX5_DESMR/5-71FVL--------V---S---------GLVMFT-A.---------------------------.PPARVASW----------
A7I2S7_CAMHC/7-58VIA--------I---S---------GILLFL-..---------------------------.........----------
C4XNC0_DESMR/13-70GLP--------V---T---------GIANHY-LG---------------------------FASLTPERH----------
A0RPQ5_CAMFF/7-58VVG--------I---T---------GVLMF.-..---------------------------.........----------
W6RUZ5_9CLOT/75-133IAV--------I---T---------GILISY-TI---------------------------LTNITIANR----------
C0R274_BRAHW/70-129GLV--------V---S---------GILFNR-DL---------------------------VE.......----------
R6AFB6_9FIRM/68-125GVM--------L---T---------GLSFSH-..---------------------------.........----------
E8N2M4_ANATU/72-132AVM--------V---S---------GLMISR-VV---------------------------LP.......----------
B4SDX1_PELPB/4-55ILA--------V---T---------GILMF.-..---------------------------.........----------
Q2RX07_RHORT/14-65VIA--------I---S---------GIMLF.-..---------------------------.........----------
D6Z5B1_DESAT/6-72LLM--------I---T---------SVVLYI-V.---------------------------.PTGRVAHW----------
B5YIR5_THEYD/10-76FAF--------I---S---------GIILYF-T.---------------------------.PQGRIAYW----------
B3EQ00_CHLPB/8-59VSA--------S---T---------GLMMF.-..---------------------------.........----------
R6P7P3_9FIRM/71-130LLM--------I---S---------GIIMSE-YT---------------------------FS.......----------
Q2RIJ9_MOOTA/9-76GLA--------L---S---------GFIPWL-I.---------------------------LPAGRYGRQ----------
I3YFD4_THIV6/9-59FMS--------V---S---------GVLMFF-G.---------------------------.........----------
F8E8X8_FLESM/7-73VVV--------Y---S---------GVFLFI-V.---------------------------.PEGKVAYW----------
R6CX21_9CLOT/72-131GTI--------I---S---------SVLISR-QV---------------------------FS.......----------
F0JFF5_DESDE/5-71VTL--------I---T---------SVILYI-V.---------------------------.PEGRVAYW----------
M4R3B0_BIBTR/72-131TAC--------I---S---------GILLSK-HL---------------------------FA.......----------
G8QTP5_SPHPG/76-131LMA--------I---S---------SVMISK-TL---------------------------F........----------
R7QWY9_9FIRM/8-58AAF--------I---T---------GILLH.-..---------------------------.........----------
F4LLX1_TREBD/74-133LLA--------V---S---------GIMLSN-RV---------------------------FA.......----------
R7LCV5_9BACT/72-130TAA--------A---T---------GAVQSK-FA---------------------------LP.......----------
K0NEJ9_DESTT/6-72VML--------L---T---------SVILYI-V.---------------------------.PQGRVAYW----------
R7F4I4_9CLOT/70-128GMM--------V---S---------GIMISA-DV---------------------------FS.......----------
D2RHV9_ARCPA/8-72FQL--------I---S---------GLILYF-T.---------------------------.PGRHGYRE----------
R6YA34_9FIRM/72-131GLM--------V---S---------GVILSN-HV---------------------------FD.......----------
L0GUL1_9GAMM/12-78VLT--------V---T---------GLVLYV-L.---------------------------.PHGRVAYW----------
C0QZ66_BRAHW/50-109GLM--------I---S---------GILFSQ-RV---------------------------LG.......----------
X5DE85_9BACT/10-77VIL--------V---S---------GVILYV-A.---------------------------.PPGRYAHW----------
B1L3S4_KORCO/10-72LLF--------I---S---------GLVLYF-T.---------------------------.PSGRAHEF----------
E4TFY8_CALNY/5-71GMT--------F---T---------GIILFI-V.---------------------------.PEGRVAYW----------
B9JJR0_AGRRK/72-130VLL--------V---T---------SVLISN-TL---------------------------SP.......----------
G7M4T2_9CLOT/72-131GLM--------I---S---------GIIMSR-YV---------------------------FS.......----------
R5X0L1_9BACT/9-66AVL--------A---T---------GVRLHV-AG---------------------------ETQSHDVWH----------
K0C3X7_CYCSP/5-59AMS--------T---S---------GLLMFV-IE---------------------------KPSFTIQ..----------
R7CCE2_9CLOT/72-131LLM--------F---S---------GISMSR-YV---------------------------FR.......----------
F2NSL9_TRES6/73-131LMA--------F---S---------SVMMSG-AV---------------------------FAFSSINMT----------
R6UA77_9CLOT/74-132GSI--------V---S---------GVIVSR-HL---------------------------FA.......----------
F5YAS5_TREAZ/76-135TAG--------I---S---------GIMMSK-IV---------------------------FK.......----------
W6EBR3_SULMU/7-73IMS--------Y---T---------GIILFL-S.---------------------------.PKGRVANW----------
R5D3A2_9FIRM/72-131GSM--------V---S---------GIVLSR-HV---------------------------FA.......----------
K9VDE1_9CYAN/16-81LAA--------I---T---------GFLLEF-S.---------------------------.PK......----------
E1RA86_SPISS/8-59VQG--------I---S---------GIFMKF-GL---------------------------FYSL.....----------
G0EES3_PYRF1/11-75LTL--------I---S---------GMILAT-AP---------------------------HGPGSGDAT----------
R7CST8_9FIRM/68-123AVL--------L---T---------APFISR-SY---------------------------.........----------
R5I3L3_9PORP/6-78LVS--------I---S---------GFILEF-V.---------------------------IPSRHAVRF----------
E8RC78_DESPD/24-75FTA--------V---T---------GILLF.-..---------------------------.........----------
A5UYY8_ROSS1/82-142IVV--------F---T---------GLMISE-TA---------------------------LP.......----------
T2KM32_9FLAO/57-117LVT--------V---S---------GIVISE-AA---------------------------LP.......----------
N0AR40_9BACI/76-134AVI--------I---T---------GILISK-VV---------------------------TP.......----------
M1NG91_DESSD/6-72LLV--------L---T---------SVILYI-V.---------------------------.PQGRIAYW----------
A4VFX0_PSEU5/114-174VLL--------L---S---------GIVIWR-EY---------------------------FSSFFGIVS----------
B9JP15_AGRRK/72-130TLL--------A---T---------SVIISQ-TV---------------------------FS.......----------
Q3ATG1_CHLCH/8-59IIA--------V---T---------GILLF.-..---------------------------.........----------
G0L331_ZOBGA/81-141VIT--------V---S---------GIVISE-AA---------------------------LP.......----------
R7NCG3_9MOLU/2-60GVL--------I---S---------GILIST-HV---------------------------FV.......----------
A1BFX6_CHLPD/10-77MLL--------I---S---------GVILYI-S.---------------------------.PPGRVANW----------
G4STW3_META2/9-73FLT--------T---T---------GVLLRY-LL---------------------------PPGSGRFAT----------
I0GHS8_CALEA/20-86PVA--------F---S---------GIGLYF-A.---------------------------.PSGREARL----------
G7Z1L5_AZOL4/25-76VST--------V---T---------GIMLL.-..---------------------------.........----------
E1SVF5_FERBD/125-198FMC--------L---S---------GLAMHA-HV---------------------------YHDGFGGAL----------
F4C4I1_SPHS2/7-58VVA--------L---S---------GLLMLF-HL---------------------------FDGY.....----------
A0LPC1_SYNFM/9-75SVA--------A---I---------GLLLAF-V.---------------------------IPSGRVPDT----------
Q7CI97_YERPE/72-131FAI--------I---S---------GLMLSK-HV---------------------------LP.......----------
E4RQ49_LEAB4/7-58VVG--------I---S---------GLLMLF-HW---------------------------FDGY.....----------
A6LNM0_THEM4/27-84LVA--------I---T---------GVVLQQ-SI---------------------------AKGVKLSNP----------
V5UHX6_9BURK/124-184GLL--------L---S---------GIVIWR-AY---------------------------FAFYFPIWA----------
Q8KFP7_CHLTE/12-79VML--------I---S---------GIVLYI-S.---------------------------.PPGRVANW----------
W6EDS3_SULMU/5-59AVG--------S---S---------GILMII-LN---------------------------SFEFQFQ..----------
F4HFN7_GALAU/72-131TAC--------I---S---------GIMLSK-HL---------------------------LA.......----------
D5DJ74_BACMD/77-135FIM--------V---S---------GIFISR-VV---------------------------FP.......----------
A3CUK5_METMJ/9-76PSV--------I---S---------GLVLYL-V.---------------------------LPSGGGRGS----------
Q7UE94_RHOBA/95-155TAT--------F---S---------GVVISE-AA---------------------------LP.......----------
E1RE56_METP4/9-80VMA--------G---T---------GLVLFR-F.---------------------------WPTGSGGAG----------
R6M5A8_9CLOT/72-131SQM--------Y---S---------GVLMSR-YV---------------------------FD.......----------
B7GIW2_ANOFW/77-135GII--------V---T---------GILISK-VV---------------------------FP.......----------
B5IFA9_ACIB4/1-67ILV--------F---T---------GIKLLF-S.---------------------------.PSRKEGIE----------
A2SSD8_METLZ/31-96ATC--------V---T---------GYVLWA-F.---------------------------FPLGSGRGA----------
Q8TUQ6_METAC/9-75GVA--------G---T---------GLFMYF-F.---------------------------IPSGVQRGR----------
D6DHZ2_CLOSC/72-131AQM--------Y---S---------GIVMSR-YV---------------------------FA.......----------
B3E2B6_GEOLS/10-61VVG--------I---S---------GVLLA.-..---------------------------.........----------
F8I7H1_SULAT/39-95VLI--------I---S---------GLILAA-NG---------------------------PDTWSYNGA----------
B4SBP8_PELPB/10-77MIL--------I---S---------GVILYI-G.---------------------------.PSGRGPGA----------
Q65T96_MANSM/72-131TAC--------I---S---------GILLSK-HI---------------------------FA.......----------
Q21KL9_SACD2/6-57VLV--------V---S---------GILLYA-TP---------------------------YNFW.....----------
D2QJH4_SPILD/6-57VLS--------I---T---------GLLIY.-..---------------------------.........----------
N0BAX1_9EURY/9-75IMG--------I---T---------GLGMYL-A.---------------------------.PSGRVARE----------
C8WKW0_EGGLE/72-132TVT--------V---S---------GIMVSG-AV---------------------------LP.......----------
A9AYM2_HERA2/83-143IIM--------F---T---------GIMISK-TV---------------------------VP.......----------
C0QF61_DESAH/5-71LLI--------L---T---------SIILYI-V.---------------------------.PQGRIAFW----------
B9L860_NAUPA/5-71MII--------I---S---------GIVLYI-M.---------------------------.PHGRVAYF----------
D1B0M4_SULD5/7-73IMS--------Y---T---------GIVLFL-A.---------------------------.PKGRVANA----------
H1YWY9_9EURY/9-71ACA--------V---T---------GFIKWP-GL---------------------------LNPVNFVFY----------
W6RSI1_9RHIZ/73-131VLL--------V---T---------SVVISK-SV---------------------------FA.......----------
C6BYF4_DESAD/5-71VLI--------I---T---------SVILYI-V.---------------------------.PQGRVAYW----------
M1XST7_NATM8/13-77AVV--------A---S---------SVVIWV-V.---------------------------LPAGGLHGA----------
K4LE17_9FIRM/80-137IIV--------T---T---------GVLISK-VL---------------------------FPSDTIHGE----------
Q2W2B9_MAGSA/11-62VVG--------I---T---------GVILFF-HL---------------------------.........----------
Q15XU8_PSEA6/79-139LAT--------V---S---------GFLVSV-AL---------------------------LP.......----------
R5U1B1_9BACE/6-63LSA--------F---S---------GIGLHI-AG---------------------------HGNNHGLWH----------
A7I9H3_METB6/10-72VCF--------V---T---------GLLKYQ-DL---------------------------LELTGLNNI----------
R4JZ25_CLOPA/71-128LLC--------I---S---------GIVIK.-..---------------------------.........----------
D9SQY3_CLOC7/76-134VII--------V---T---------GIFISK-VV---------------------------FS.......----------
A1AR53_PELPD/10-61VVG--------V---T---------GILMA.-..---------------------------.........----------
E4U6D1_OCEP5/21-87WLA--------V---S---------GVVLYL-A.---------------------------.PSGRVAKT----------
K0NB22_DESTT/5-71TLL--------V---S---------SIVLYI-G.---------------------------.PPSHVGHF----------
I4D2J4_DESAJ/77-135FTI--------I---S---------GLMISR-IL---------------------------FP.......----------
C9R964_AMMDK/9-90GLA--------F---S---------GFVRWL-V.---------------------------LPGGGGGYG----------
F8ABZ1_THEID/4-70AML--------V---T---------GIVLFI-M.---------------------------.PHGRVAYW----------
B8FH86_DESAA/4-70FTV--------L---T---------SIILYI-V.---------------------------.PQGRVAYW----------
H1XS36_9BACT/14-80ILL--------V---S---------GVILYI-A.---------------------------.PAGRIAKW----------
R5AVH3_9BACE/10-63VTA--------I---T---------GIMLHM-KS---------------------------HGIIFQPRD----------
R5X3I1_9CLOT/76-130AIL--------V---S---------GICIMK-AA---------------------------.........----------
A8F7I9_PSELT/58-115GTT--------I---S---------SIAISQ-..---------------------------.........----------
Q8A5L2_BACTN/9-66LSF--------Y---T---------GVELHI-AG---------------------------QGDNHEIWH----------
K4LFC8_THEPS/9-79GLA--------L---S---------GFVRWS-I.---------------------------SPGSGWGYG----------
Q3B3K8_PELLD/8-59ISG--------V---T---------GVLIF.-..---------------------------.........----------
Q7UGQ3_RHOBA/4-55TLM--------V---T---------GVLVFT-LP---------------------------FSQT.....----------
W6RUQ3_9CLOT/77-135III--------V---T---------GIGISK-YI---------------------------FS.......----------
D5V7U4_ARCNC/6-72IMS--------Y---T---------GIMLFI-S.---------------------------.PPGRIANW----------
L0H0I4_9GAMM/9-59FVA--------V---S---------GVLMLF-G.---------------------------.........----------
S6CE05_9ACTN/67-127VVV--------L---S---------GLMESG-AV---------------------------LL.......----------
F0S3U2_DESTD/5-71AMT--------I---S---------GIVLYV-M.---------------------------.PHGRIAYW----------
R5W765_9BACE/6-63VSA--------I---S---------GIGLHI-AG---------------------------HGNSHEVWH----------
A0LNU4_SYNFM/14-72GLP--------I---T---------GLANHW-HQ---------------------------MESMLSVSR----------
R5LI07_9SPIR/70-129GLM--------I---S---------GIMFSR-KV---------------------------LF.......----------
B0VH29_CLOAI/15-63TYK--------I---S---------ELCNYD-AY---------------------------G........----------
V4JBA5_9DELT/6-72VLI--------I---N---------SIVLYV-V.---------------------------.PEGRVAYW----------
S6C133_9ACTN/57-117ACV--------V---S---------GVMVSG-TV---------------------------LP.......----------
B3QVT3_CHLT3/9-64ILS--------I---T---------GVLMT.-..---------------------------.........----------
D4IPJ8_9BACT/10-82AVS--------I---S---------GFVMNV-I.---------------------------LPSRHAIRH----------
R7CTR1_9FIRM/68-124AVM--------I---T---------APLISY-KL---------------------------.........----------
Q11BF1_CHESB/72-130ALL--------V---T---------SILIST-AL---------------------------SG.......----------
E8T206_THEA1/5-71AML--------I---T---------GTVLFI-M.---------------------------.PHGRVAYW----------
I0GQA3_SELRL/62-115ALA--------V---T---------GVLAAK-QF---------------------------GLELHF...----------
Q3A6A8_PELCD/4-70FVL--------L---T---------SAVLFI-V.---------------------------.PHGRVAYW----------

PF03188

ACFR1_ARATH/49-182ILG--------G---E---------AIISYK-.S---------------------------LP.L...E-----------
A5C961_VITVI/49-182IIG--------G---Q---------AIMSYK-.S---------------------------LP.L...R-----------
Q6Z1Y9_ORYSJ/56-192VLA--------A---E---------AILSYR-.S---------------------------LS.IIVSS-----------
Q9FVY1_ORYSJ/46-178ILG--------S---E---------AIMGYK-.I---------------------------WP.W...G-----------
ACFR2_ARATH/50-183LFN--------G---E---------AMLAYK-.S---------------------------VQ.G...T-----------
Q6YW65_ORYSJ/51-184VLN--------G---E---------AILAYK-.T---------------------------VP.G...T-----------
ACFR4_ARATH/43-175LVS--------G---E---------AILIHR-.W---------------------------LP.G...S-----------
Q10DW5_ORYSJ/60-193LLI--------G---E---------AILAYT-.T---------------------------IP.M...D-----------
Q7XH60_ORYSJ/58-190ICT--------G---E---------AIMAYR-.I---------------------------ML.G...S-----------
Q28YW1_DROPS/100-238TLS--------G---F---------SILIYR-.L---------------------------...CRCVK-----------
A7UTA7_ANOGA/98-236TLS--------G---F---------SILLYR-.I---------------------------...CRCCS-----------
CYAC3_MOUSE/46-182VLY--------G---A---------ASLVYR-.L---------------------------PS.SWVGP-----------
CYAC3_DANRE/47-182VLY--------G---N---------AAVVYR-.I---------------------------PL.TWGHN-----------
F7AAH4_CIOIN/56-190FLY--------G---E---------AALVYR-.V---------------------------...FRQTE-----------
A7RY72_NEMVE/55-189YLY--------S---E---------AMIVYR-.V---------------------------...FRNET-----------
CY561_CAEEL/62-204FLF--------G---E---------ALLVYR-.V---------------------------...FRNER-----------
CY561_HUMAN/52-186FLQ--------G---N---------ALLVYR-.V---------------------------...FRNEA-----------
CYBR1_HUMAN/49-185FIQ--------G---I---------AIIVYR-.L---------------------------PW.TWKCS-----------
F6U164_XENTR/54-190FIQ--------G---I---------AIIVYR-.L---------------------------PW.TWNCS-----------
CYBR1_DANRE/47-183FLQ--------G---I---------AIVVYR-.L---------------------------PW.TWRCS-----------
Q7Q742_ANOGA/55-192FLY--------G---N---------SILIYR-.G---------------------------...FRYAR-----------
Q9I7U1_DROME/146-282YLY--------G---N---------SILIYR-.G---------------------------...FRTTR-----------
O16272_CAEEL/98-231YLQ--------G---E---------ALLSYR-.V---------------------------...YRFTT-----------
A8X7F4_CAEBR/71-205YFQ--------G---E---------ALLAYR-.V---------------------------...YRHDA-----------
Q29JT1_DROPS/48-184FLM--------A---E---------GMMCFY-DG---------------------------SWLTLRYT-----------
Q9VIT6_DROME/48-184FLM--------A---E---------GMMCFY-DG---------------------------SWLTVRYS-----------
Q9VIT5_DROME/94-228FFM--------A---E---------GVMIHY-GG---------------------------NVLTNGYK-----------
Q9VIU6_DROME/47-182VLI--------A---Q---------AMMSHS-KV---------------------------NPLTRWLS-----------
Q17ID4_AEDAE/154-293VLM--------A---E---------SILAFY-SS---------------------------CSWAVALT-----------
A0NFY4_ANOGA/64-202LLM--------A---E---------GIVLLY-SG---------------------------NGWTQKLT-----------
Q7PZD0_ANOGA/60-198ILM--------S---Q---------AVLTMS-GA---------------------------NYFTHRCQ-----------
Q16LW8_AEDAE/141-279ILM--------S---Q---------AVLTLS-GA---------------------------NLLTYRQH-----------
C56D1_MOUSE/54-191LCM--------A---E---------AILLFS-PE---------------------------HSLFFFCS-----------
F1R6P8_DANRE/63-200LCM--------T---E---------GILLFS-AE---------------------------GSPFCFKS-----------
H3BZA9_TETNG/61-199LCM--------T---E---------GILLFS-AE---------------------------VSPFCCKS-----------
Q1LXB7_DANRE/47-184FLM--------T---E---------AILLFN-PH---------------------------SSPVSKLK-----------
H3DB33_TETNG/49-185LFM--------T---E---------AILIFS-PH---------------------------GFPIQKLT-----------
C56D2_BOVIN/47-184FLM--------T---E---------ALLVFS-PE---------------------------SSLLRSLS-----------
Q5I024_XENTR/47-183FLM--------T---E---------AILVFS-PD---------------------------SSLLRSFS-----------

PF01794

FRO8_ARATH/159-281LLF........P---V...LRG...LSMF..-..---------------------------RLLNIEFAA....SV----
FRO6_ARATH/178-300LFL........P---I...SRG...SILL..-..---------------------------RLIDIPFEH....AT----
Q4WR75_ASPFU/273-390LWL........F---A...GRN...NIFI..-..---------------------------WATGWSYST....FN----
Q4WC00_ASPFU/90-202LFA.........---G...SPL...VYLA..-..---------------------------DIIGVSLRA....SR----
Q4WRK0_ASPFU/107-219PLS.........---A...IHL...SNVA..-..---------------------------DLLGISWST....CR----
Q4WF95_ASPFU/130-249HFV........L---AI.KSRY...NPLA..-..---------------------------LLFNTSYER....LL----
AIM14_DEBHA/94-207DIF........L---V...LRP...NSI...-..---------------------------...GLRYLE....LM----
Q6BTD9_DEBHA/151-272VYV........L---S...GKS...NMIT..-..---------------------------FITGISYEK....LN----
Q6BXT5_DEBHA/276-393MYF........M---G...IRN...TPLS..-..---------------------------YVVNWSRRT....FI----
Q0U921_PHANO/152-271HYL........L---A...MRAP.YSPVQ..-..---------------------------WLTRCSHEQ....LK----
Q0UXV8_PHANO/43-161VYL........L---A...ARC...GPFD..-..---------------------------LVTGVSHEQ....IN----
A5DEQ5_PICGU/148-261VLF........L---T...LRP...SPLP..-..---------------------------...NTLYLA....LL----
Q6C644_YARLI/142-255LYI........L---G...AKK...TPLS..-..---------------------------FLVGWSYDQ....LN----
FRE7_YEAST/161-282VFS........L---S...GKI...NVIG..-..---------------------------WLVGLSYEK....IN----
RBOHJ_ARATH/366-523ALILVPVLRRTL---T..FLRS...TFLN..-..---------------------------..HLIPFDD....NI----
Q0TVR2_PHANO/35-155VWL........F---G...MRN...DAMM..-..---------------------------WMTGWGFGT....YN----
A3GFP0_PICST/241-358LVL........F---P...GRN...NFMQ..-..---------------------------WVTGWSQAR....FL----
A5DPY7_PICGU/304-417LIL........F---G...GRN...NFLQ..-..---------------------------WVTRWDYST....FI----
A0JNK9_BOVIN/259-407VYLA.....GLL---A.........AAYQL.-.Y---------------------------YGTKYRRFPPWLETW----
YEDZ_RHORT/50-165SLA........A---T...............-..---------------------------PARLLWGWT....FP----
Q217F0_RHOPB/43-167SLL........L---M..........LREP.-.R---------------------------LARWLGGLE....RM----
A0LQW5_ACIC1/61-184VLA........L---M...ARV...PAVE..-..---------------------------..RGVGADR....LA----
A1TKU8_ACIAC/46-161ALA........V---T...............-..---------------------------PLRMLTGMP....AL----
A6VUY1_MARMS/1-130LMR........L---SGIWASVFVVAVMSM.-.T---------------------------LVGKIKPLK....VI----
NOX4_PONAB/58-205SLILLPMCRTLL---A..YLRG...SQKVP.-.S---------------------------RRTRRLLDK....SR----
Q5A445_CANAL/308-425LIL........F---G...GRN...NFLQ..-..---------------------------WLTGWDFAT....FI----
Q0APN2_MARMM/57-179SLA........I---T...............-..---------------------------PIRDLTRWG....PI----
RBOHC_SOLTU/408-565AIILLPVCRNTI---T..WLRN......KT.-.R---------------------------LGSAVPFDD....NL----
Q5FQ04_GLUOX/56-169CLA........L---A...............-..---------------------------PLRRFTGL.....NL----
Q5E5I2_VIBF1/37-166AIV........L---S...ARF...KWTE..-..---------------------------RLVK.GLDK....AY----
Q82R51_STRAW/62-185TLV........L---A...TRL...MWLE..-..---------------------------QWFG.GLDR....MY----
Q2H7Y7_CHAGB/153-271LYL........L---A...SKC...SIVG..-..---------------------------FLVGTSHER....LN----
A7TPB1_VANPO/264-381IYL........F---G...IRN...NPLI..-..---------------------------EISGISFST....FN----
Q6C0I9_YARLI/142-260IVI........L---A...ARR...NLVS..-..---------------------------ILTGISAQR....LN----
Q7SFF5_NEUCR/239-364LYL........L---S...AKN...QPLR..-..---------------------------LLTGYSYEA....LN----
Q2H477_CHAGB/186-307LII........F---A...GRN...NPLI..-..---------------------------NLLNVSFDT....YN----
DUOX2_PIG/1081-1230SYILLTMCRNLI---T..FLRE...TFL...-..---------------------------.NHYVPFDA....AV----
Q6N633_RHOPA/45-180GVI........L---A...ARP...VWFE..-..---------------------------TPLG.GLDK....FY----
Q28MM2_JANSC/56-182TLC........I---G...............-..---------------------------PLARMDTRF...LPL----
Q9L1A8_STRCO/50-176VVL........Q---M...ARV...PALE..-..---------------------------..RRVGSDR....VA----
Q0ACJ0_ALKEH/56-177EFI........L---S...GRF...RGVT..-..---------------------------..APIGIDV....TL----
Q21DI1_SACD2/35-149SLL........I---T...............-..---------------------------PLVKKFKLG....PL----
Q82L18_STRAW/83-206QLL........L---V...ARL...PWLD..-..---------------------------..RRIGMDR....LT----
A0A0D1E108_USTMA/139-260IYT........L---A...SKV...NFIS..-..---------------------------LLTGVSHER....LQ----
Q0BQQ1_GRABC/59-172SLA........I---T...............-..---------------------------PLREALSWP....RL----
AIM14_VANPO/88-208NLF........L---T...LKP...NWFL..-..---------------------------.PSQCTYTD....FI----
Q6CUH0_KLULA/305-422LFL........F---G...GRN...QILE..-..---------------------------MMTGVKFRS....FV----
A1WD64_ACISJ/52-181AMV........L---A...LRL...PWLE..-..---------------------------RPLG.GMDQ....VY----
Q6FMR3_CANGA/107-225NLF........L---N...LRP...NIFF..-..---------------------------.TDKYVYTD....FI----
Q7PNG0_ANOGA/297-444AFILVLMLRQCI---T..FLRT.......R.-.G---------------------------FTAFLPLDQ....HI----
AIM14_ASHGO/94-211NIF........L---T...LRP...NYIL..-..---------------------------..SDYTYVQ....LL----
Q4D1K3_TRYCC/390-520LMF.......PA---S.........RFSVL.-.H---------------------------SILGTSWES.....L----
A1C8X0_ASPCL/194-313LLS........L---V...GKN...NIVS..-..---------------------------LMTGISYER....LN----
NOXB_DICDI/225-375AVILLPVLRNFL---S..WLRG...TIV...-..---------------------------.NNYIPIDK....HL----
Q47CF6_DECAR/42-170GML........L---A...TRP...VWLE..-..---------------------------QRFG.GLDK....LY----
Q6C208_YARLI/250-367LVL........F---A...LRN...NFLM..-..---------------------------WLTGWSFST....YQ----
Q0RT78_FRAAA/120-243ELM........L---M...ARV...PALE..-..---------------------------..RAIGFDR....LA----
FRE4_YEAST/273-390IVL........F---A...GRN...NFLQ..-..---------------------------LISGLKHTS....FI----
Q47Y20_COLP3/48-162TLT........V---S...............-..---------------------------PIAKKFKLG....YL----
A7TIJ6_VANPO/133-250VLM........L---S...LRP...SPLP..-..---------------------------KKLNLLYLS....LL----
Q0V134_PHANO/180-301TVL........F---A...LRN...NPLI..-..---------------------------TLLQVSYDD....FN----
Q2IMP5_ANADE/49-169QFL........L---T...ARF...QWLA..-..---------------------------..PPFGTDV....VY----
Q74Z78_ASHGO/248-365TFL........F---G...TRN...NVLL..-..---------------------------WLTGWKQST....FY----
A2I2U7_CHLRE/303-425LFF........P---L...PRC...NFLH..-..---------------------------WLLGSDFPT....LV----
Q0RIS3_FRAAA/13-136TVV........L---G.............V.-.V---------------------------ARSGRGLAGLPGFAV----
Q7MCQ7_VIBVY/47-184AMV........L---A...LRL...PTIE..-..---------------------------RWTQ.GIDK....GY----
Q6C2K8_YARLI/288-405IFL........F---A...GRN...NILM..-..---------------------------WMTGWGFDT....FN----
YEDZ_PSEAE/42-156TLA........M---T...............-..---------------------------PLQKLSGWP....GW----
A6LZ17_CLOB8/40-156INF........I---S...TRH...KILD..-..---------------------------GLFG.GLDK....SY----
Q8YTT0_NOSS1/52-169QFA........L---T...ARI...NRIE..-..---------------------------..ASYGVDL....IL----
A5DUC1_LODEL/275-390VFL........F---A...GRN...NFLQ..-..---------------------------WLTRWNFST....FI----
Q6CET8_YARLI/281-396IFL........F---A...GRN...NFLM..-..---------------------------WLTGWSFDT....FN----
Q7NFG8_GLOVI/60-173TLT........A---R...............-..---------------------------PLNRFLP......GL----
FRE8_ASHGO/108-221LFL........L---T...LRP...SPLP..-..---------------------------...YTLYLS....LL----
F2G9K0_ALTMD/54-168TLT........L---S...............-..---------------------------PLAKWLPSP....EP----
A3LSQ8_PICST/127-243IML........A---I...MKN...DLLT..-..---------------------------SISGLQHDR....IT----
Q2HEL2_CHAGB/276-393VLL........F---A...GRN...NVLL..-..---------------------------WLSDWSHST....FV----
Q5Z0I9_NOCFA/44-161QFA........L---V...ARF...RSMA..-..---------------------------..APFGEDA....LV----
AIM14_PICST/105-222TIF........I---S...LRP..PNTVG..-..---------------------------YQSGYYLEK....LN----
Q01ZZ5_SOLUE/82-210NIV........L---GVLVSRNYNPARRWP.-.H---------------------------RKLPASLFR......----
Q2K9I9_RHIEC/52-165TLA........V---S...............-..---------------------------PARELFGW.....NY----
Q5B3H4_EMENI/159-280LVL........L---A...GRN...NPLI..-..---------------------------TLLQVPYDT....YN----
A4VRF2_PSEU5/43-178AVI........L---A...ARP...RRFE..-..---------------------------RFFD.GLDK....TY----
NOXC_DICDI/622-766AIILMTMCKQLF---T..MIRN...TKF...-..---------------------------.KFLFPVDK....YM----
A0K1X7_ARTS2/75-198MLL........L---A...ARI...PLID..-..---------------------------..QSVGHDR....AL----
A1CUM1_ASPCL/175-298AVL........L---A...TRE...SLLS..-..---------------------------LLTGIPYHH.....F----
FRP2_SCHPO/114-229SYF........F---S...LKN...NPFC..-..---------------------------LMLFSSHEK....MN----
A5WDA3_PSYWF/39-154SCI........L---A...SRW...HGVE..-..---------------------------RIFG.GLDR....VY----
Q2TYZ6_ASPOR/86-204VWL........F---A...GRN...NIFI..-..---------------------------WATGWSFST....FN----
NOX3_MOUSE/55-218MLILLPVSRNFI---S..LVRG...TSVCC.-.R---------------------------GPWRRQLDK....NL----
Q6FWS3_CANGA/299-416III........F---S...TRN...NIFE..-..---------------------------SLTGLHYSS....FI----
Q5KHL8_CRYNJ/202-314ILL........L---V...SKN...NPIS..-..---------------------------SLTGITYQK....LN----
Q2FKR9_METHJ/56-171GAL........L---N...LKK.........-..---------------------------GAVKSQFGR....PF----
Q2GQU2_CHAGB/155-272QYL........L---E...LKS..LNPVA..-..---------------------------FLLQSSHEQ....VN----
A1CRA6_ASPCL/41-187QVL.......VS---PARYISTLRPSSPSV.-.I---------------------------SVLTYTPQS....TL----
A6LWS3_CLOB8/66-186VMY.........---.............AG.-.A---------------------------LNQKWTITK....KL----
Q15YY0_PSEA6/59-182QFT........L---L.........NGRVD.-.A---------------------------INSRIGVDN....SM----
Q604N8_METCA/48-163TLA........I---T...............-..---------------------------PLARFPGGH....WL----
Q9EX48_STRCO/90-224GLL........L---S........GPRPAR.-.L---------------------------PVSRQALER......----
Q28KV6_JANSC/39-153SII........L---S...TRL...PILE..-..---------------------------DLFG.GLDR....MY----
Q5AHQ5_CANAL/95-212NIY........L---V...LRP...TNSP..-..---------------------------LLKPGYYLE....NM----
A0A0D1E0K7_USTMA/233-360VLI........L---A...LKQVPFALLST.-.R---------------------------FFGGYAFDR....LS----
Q59WI9_CANAL/253-370LIL........F---A...GRN...NFLQ..-..---------------------------WLTGWSHAR....FL----
Q6CEA2_YARLI/129-243MLF........L---A...LRP...SPLP..-..---------------------------...RTFYLA....LL----
FRO4_ARATH/156-277LFF........P---V...TRA...STIL..-..---------------------------PLVGLTSES....SI----
AIM14_KLULA/97-214NVL........L---T...LRP..ANPIL..-..---------------------------...GYHYLD....LI----
Q0UZN5_PHANO/147-266VFA........T---A...TKT...NWIT..-..---------------------------LCTGVSHER....LQ----
YEDZ_DEIRA/47-161SLA........C---T...............-..---------------------------PARVWLGWT....WA----
A5E743_LODEL/134-251IFL........L---V...TKG...DFIT..-..---------------------------GITGLTYER....TT----
A1AY37_PARDP/49-162TLT........V---T...............-..---------------------------PLLRLTRL.....NL----
YEDZ_PASMU/44-158MFI........L---G...............-..---------------------------KVFYLLKQP....QL----
A5E459_LODEL/280-397LFL........F---A...GRN...NFLQ..-..---------------------------WISGWPYAR....FV----
AIM14_YARLI/82-195IVF........L---A...IRP...SPLP..-..---------------------------...RTFYLK....LL----
A5GKL0_SYNPW/57-207ILC........I---G...............-..---------------------------PLSRLNKRF...HVL----
Q7S590_NEUCR/128-246QYM........L---T...LKS..FNPVS..-..---------------------------WTLKLSHEE....TN----
Q5P447_AROAE/42-170AMV........M---A...TRP...PGVE..-..---------------------------RLLG.GMDR....AY----
Q4PEM4_USTMA/167-285LIL........M---A...SKR...TPLA..-..---------------------------IVSGLGMDR....LM----
A5E3X1_LODEL/124-240LLW........S---V...ARN...DWLT..-..---------------------------RISGFQFDR....LE----
Q5KPP3_CRYNJ/174-292IVL........L---S...LKS...PLPLP.-.I---------------------------FVPSLSYEH....YN----
Y1462_ARCFU/1-125QFY........L---T.........RGFR..-..---------------------------LIEGKGRMS....YI----
NOXA_DICDI/58-201ALILVPVLRNLL---S..FLRG...TFL...-..---------------------------.NNYVPFDK....NI----
A7RPH5_NEMVE/44-191SLMLLPMCRNLL---A..FVRN...TLCKS.-.S---------------------------RRLRRLLDK....HI----
A6VQE1_ACTSZ/43-157VFL........L---R...............-..---------------------------SLIILWQQP....SL----
A7ENT9_SCLS1/179-300LFI........M---A...ARN...NPLI..-..---------------------------NWLNMSFDT....FN----
Q6C3A4_YARLI/310-427LVL........F---G...GRN...NILL..-..---------------------------RYTKWPFNT....FL----
Q6CPC7_KLULA/282-399TFF........L---S...GRN...NIFL..-..---------------------------WWTGWKQST....FY----
Q75D69_ASHGO/278-397TWL........F---A...SRN...SIIL..-..---------------------------AFTGWKQST....ML----
Q6CN86_KLULA/282-397VFL........L---S...GRN...NLLL..-..---------------------------YLTGWPYET....FL----
Q6CLT2_KLULA/243-363TVL........L---A...GRN...NIIS..-..---------------------------SLTGMPYCT....MI----
Q6CET4_YARLI/273-389VFL........F---G...GRN...NFFM..-..---------------------------WLTGWSFDT....FN----
FRE1_YEAST/258-375VYL........F---G...IRN...NPFI..-..---------------------------PITGLSFST....FN----
E4X2P3_OIKDI/55-207SIL.......LF---T..VCRNL.LAFIRSI-FP---------------------------KEFGFLFDN....AI----
E7M0W3_YEASV/274-390IVL........F---G...GKN...STMT..-..---------------------------WLTGIRYTA....FI----
E7QHM4_YEASZ/202-316III........F---T...ARN...SFLE..-..---------------------------FLTGVKFNS....FI----
F6WE71_XENTR/248-394VYL........P---G...IIA...AVLQL.-.Y---------------------------RGTKYSRFPDWLDKW----
F6YS00_CIOIN/57-202SFILFPMCRGLV---T..FMRGL.PR..GV.-.G---------------------------RQVRRLLDR....GR----
F7BAU5_XENTR/57-219LLILLPVCRNLL---S..FLRG...SSACC.-.G---------------------------RSLRRQLDR....NL----
H0VSY4_CAVPO/49-211MLILVPVCRNLL---S..FLRG...TCSFC.-.N---------------------------RTLRKPLDQ....NL----
Q4WB75_ASPFU/288-403LVL........Y---T...GRN...NFLL..-..---------------------------WLTDWSHST....FL----
Q4WCY1_ASPFU/137-255IFL........L---A...GRQ...NIIG..-..---------------------------LFVGLSYER....LN----
Q4WGG6_ASPFU/187-306LVL........F---A...TRN...NPLI..-..---------------------------PLLRISFDS....YN----
Q5KEC9_CRYNJ/209-325CIA........L---G...VRN...NILG..-..---------------------------LLVGKSYER....LK----
Q5KEL3_CRYNJ/176-290LWC........L---A...GRN...DVIL..-..---------------------------WVTGWSFSS....MN----
Q5KJ95_CRYNJ/122-251VFV........M---G...SRI...NPLA..-..---------------------------WITRVEASR....WM----
YEDZ_XANCP/53-167TLA........I---T...............-..---------------------------PLRQLTGQA....VL----
Q8XLV2_CLOPE/68-182VMF........A---G.........AL....-..---------------------------.SKKWGITK....KL----
YEDZ_YERPE/48-161TLL........V---S...............-..---------------------------PLARYSKQP....LL----
Q9I5Z1_PSEAE/40-165IML........L---A...VRP...VWLE..-.K---------------------------PLD..GLDR....MY----

PF10348

Q4WLQ1_ASPFU/53-156HIA--------L-------------MIIAWC-FV---------------------------LPTAVMFSV----------
A5DCA9_PICGU/65-169HVI--------L-------------TAIVTV-VL---------------------------YPVCLVLNN----------
A5DLL3_PICGU/70-174HVG--------L-------------ISVAMV-VV---------------------------YPVCMVMNN----------
Q7S4U9_NEUCR/54-157HIA--------L-------------MVLAWV-FM---------------------------LPVGVMLSI----------
A3LQA2_PICST/42-147HII--------V-------------GLLSII-FV---------------------------YPVAIVFNN----------
Q5KLR8_CRYNJ/22-123HMT--------L-------------QTYLWA-IA---------------------------FPLGMVLGL----------
YBH6_SCHPO/15-118HII--------C-------------MIIAYV-FI---------------------------LPAGIVLAM----------
A7ENZ5_SCLS1/29-130HIL--------L-------------QMLAFG-II---------------------------FPTGMVLGV----------
Q6CTZ5_KLULA/79-184HVI--------T-------------LTIAAV-FI---------------------------YPICIALNN----------
Q5KDX6_CRYNJ/161-262HAF--------L-------------MGLAYF-GV---------------------------LPVALALRA----------
Q7S0V3_NEUCR/59-161HIF--------L-------------QTFVFG-IL---------------------------FPTGMVLGI----------
A0A0D1CF67_USTMA/25-126HIG--------V-------------QTFAWF-FL---------------------------FPLAMVLGM----------
A5DTJ1_LODEL/90-195HIA--------L-------------GLVSII-VV---------------------------YPIALIFNN----------
A1C9V0_ASPCL/31-132HMI--------L-------------MGFAFG-II---------------------------FPLGMVLGI----------
A6RFH8_AJECN/26-127HII--------L-------------MTVAFG-LI---------------------------FPAGMVLGI----------
Q6C1B0_YARLI/25-127YVL--------V-------------TMLAFG-IM---------------------------FPIGLIMGL----------
A7F0D8_SCLS1/59-162HII--------L-------------MTIGWV-FV---------------------------LPLCVMFSI----------
Q6C5B1_YARLI/116-222HIL--------M-------------VATAWI-GV---------------------------YPIAVMLSS----------
A7TT31_VANPO/83-190HIL--------T-------------ITSSLF-FL---------------------------YPICLMLNN----------
Q2GXA8_CHAGB/1-103HIF--------V-------------QMLAFG-IL---------------------------FPLGMVLGI----------
Q2HHA0_CHAGB/52-155HIA--------L-------------MVVGWV-FA---------------------------LPAAVMLSL----------
Q5AP55_CANAL/89-194HIA--------V-------------GLFSVF-VF---------------------------YPISLIFNN----------
Q5B6W6_EMENI/54-157HIA--------L-------------MVVAWC-FV---------------------------LPTAIMLSV----------
Q6FMC4_CANGA/68-173HVA--------T-------------MFILLF-LS---------------------------YPVCLILNS----------
Q75EM7_ASHGO/67-172HAA--------A-------------VAGTAL-VL---------------------------YPASLVLAE----------
E7KKX9_YEASL/58-161HII--------T-------------LLLVAF-VL---------------------------YPVSLALSA----------
G4MKH1_MAGO7/63-163HIF--------I-------------QMLAFG-VL---------------------------FPLGMVLGL----------

PF01578

HEMX_BACSU/66-273VL.TKLLRVDFIVFFT---------NVIGFS-MI...........................AIHTFSPT...........
CCMC_PARDP/3-182VV............AG---------AAACTV-TG...........................LVWGFLT............
Q8EK42_SHEON/5-184FA............IL---------ACLFIT-VG...........................TVWGLLFA...........
CCSA_CYACA/70-293IF......VDKLSIIG---------AIGSSA-VT...........................LIIGYANY...........
CCMC_MARPO/2-175LI............GF---------CWFLTA-MA...........................IYLSIWVA...........
CCSA_ODOSI/69-306YV.EFKTKS...KLVG---------AILIPV-AL...........................LINGFANL...........
Q9KUG2_VIBCH/37-266IL.HS..SGQNLSILN---------VASLIS-FI...........................ISLAMSLAMFKTRLWFLL.
Q9K176_NEIMB/36-266VI.QD..KIIIMGFGY---------SGSLIV-WM...........................MLFIYFAGSFFYPLRGVQ.
NRFE_HAEIN/89-298AF.AFFNRKNDRTFSA---------QSLSLL-GL...........................ICFGFAVFILFYS......
CCSA_CHLVU/70-308YI.EVSTKT...LFLG---------VLTSPA-IL...........................CLVAFTDF...........
Q9CLN5_PASMU/37-267LF.TDLTSGQNFSVIE---------ISSLIS-VM...........................TATIATLAFLFRIHTLWFL
CCSA_MAIZE/68-311IP.KIQNSK...NDLS---------TITTPS-TI...........................LTQGFATS...........
CCMF_PSEFL/94-304AV.SVFSRQLPQVMLA---------RVLAVM-GM...........................ISIGFLLFLIMTS......
O66467_AQUAE/59-250TF.SRKYEFSPFGAFV---------SFFAFL-ST...........................LLL................
O67831_AQUAE/103-307VI....ERKYGFKILG---------AFVIPV-IA...........................AISGFAIY...........
O25141_HELPY/695-896IL............RS---------KLALSA-SS...........................FLAGIALFV..........
CCSA_PORPU/68-313FI.ESKTKS...RLIG---------AVSIPV-AM...........................FVTAFASL...........
O21278_RECAM/20-197LL............FI---------SITLLT-AS...........................LYLGIFIA...........
CCMC_ARATH/2-175LI............GS---------WLFLTA-MA...........................IYLSLGVA...........
CCMF_RHOCB/89-298AA.AAFGGALPERLRA---------RVLAVQ-GT...........................IGVAFLVFVLFTS......
CCBS_MARPO/102-404LF.CYLARPCNVSKQA---------KGAENK-NISFLFSSKGLDQRERAVSLIDEQQIYKGIALFFSIFLLASS......
NRFE_ECOLI/72-281LF.AWHYRQQTDPLFP---------LTLAVL-SL...........................MLAALLLFVVLWS......
CCMF_ECOLI/89-299AV.AIFSQRIPLDIVA---------RVLAIM-GM...........................VSVGFLLFILFTS......
CCSA_GUITH/70-295YL.EYKTNL...YLIG---------AIVSPI-SL...........................FIVSFSTL...........
CCSA_CYAPA/67-316FLYKNNMRI...QLLD---------NSVSLL-LT...........................LLVGFLHF...........
CCMC_HAEIN/5-184FA............FL---------TLVLLG-VG...........................IVWGLAFA...........
CCMC_ECOLI/5-184LA............IA---------SVVVLT-VG...........................WIWGFGFA...........
O21277_RECAM/89-298SL..LFLRKLTIDFFR---------STILIQ-SL...........................INLFFLFFILFTS......
O28299_ARCFU/5-170LS............LA---------PVSSPT-IA..............................................
O28091_ARCFU/80-267LY...INWGVKDRKKA---------KVAAVM-TL...........................FTSYLLLNLLIFS......
CCMC_BRADU/3-181LA............AA---------TVILLA-IG...........................LYQS.ALA...........
CCMF_BRADU/89-298LV.AAFGNNLPLSLRA---------HVLAVQ-AW...........................IASAFYLFILVTS......
Q9P9P5_XYLFA/33-261IL.GN.AGAVDMHFFS---------ALSITF-FV...........................MSGLTILFSTHVGMGTV..
CCSA_GALSU/74-300IL.EFKFKH...KLIG---------AIASPI-ST...........................LTLAFSSF...........
Q9X619_SALTM/58-288IL.PGGDSGQNLSLLN---------VGSLVS-LM...........................ICTVMTIVASRNRGWLLL.
C3VYY3_PINTH/67-313LL.EVRSRD..DRWLG---------AITAPS-AM...........................LTHGFATL...........
CCSA_CHLRE/138-347LY.CTSFTLLVEKMLG---------SLIAPC-SL...........................LMNAFATF...........
CCSA_SYNY3/67-328IA.ERMSQS...RFVG---------AVTSPI-AL...........................GIVAFAAL...........
Q9HXP7_PSEAE/35-264LL.TP..AGLVLDFFN---------AASLIA-AA...........................VILLTLLATLRIPVENLL.

PF02628

CTAA_BACPE/6-286IVL--------L---QGALVTKTGSGEGCGATWP---------------------------LCFGE.VIPTNPA......
ETP1_SCHPO/99-458AIV--------V---VGGITRLTESGLSITE.WK---------------------------PITGV.IPPLTDEQWNQEF
CTAA_PARDP/37-362AMI--------A---LGGATRLTGSGLSITE.WK---------------------------PVTGA.IPPMDAATWQAEF
CTAA_SPHWW/18-335AIV--------V---VGGITRLTESGLSITE.WK---------------------------PVRGI.VPPLNQAEWLAEF
CTAA1_ACICJ/13-334GMV--------V---GGGHARTIGAGFVIQT.WQ---------------------------PFTGI.VPPLTHAAWERAF
CTAA2_ACICJ/30-356EMF--------G---IGAYVQNMNAGLSIMA.WQ---------------------------PVSGV.IPPLTHAAWERMF
CTAA_GRABC/35-352VMV--------M---LGGATRLTGSGLSIME.WA---------------------------PLMGT.LPPTSQTEWERLY
Q6FQE7_CANGA/106-462GIV--------I---LGGLTRLTESGLSITE.WK---------------------------PILGA.LPPLSQKEWEEEF
A1CT55_ASPCL/107-465GIV--------V---FGGLTRLTESGLSITE.WR---------------------------PVTGS.LPPMNAEDWESEF
Q5K7Z7_CRYNJ/87-433GII--------V---IGGLTRLTESGLSIVE.WN---------------------------PITGI.LPPITKEDWDAEW
A4SB75_OSTLU/15-353SMV--------V---LGGMTRLTRSGLSMTD.WK---------------------------.FEYE.HPPLTDEDWAKEF
Q292P6_DROPS/49-381VAV--------G---LGGVTRLTESGLSMVT.WK---------------------------.LTGE.RMPRSLEEWAQEF
Q382Y6_TRYB2/45-379CVV--------V---VGGVTRLTESGLSIVD.WK---------------------------PVTGV.RPPTTQDEWEEEF
Q4Q7Z4_LEIMA/67-401AVV--------W---LGGVTRLTESGLSLVE.WK---------------------------PISGV.RPPLTDEEWDKEF
Q607I2_METCA/14-312FLI--------M---VGGIVRASGAGMGCPD.WP---------------------------TCFGR.LVPPTDESQLPAN
Q11SZ6_CYTH3/10-312LVI--------L---AGGIVRSTGSGMGCPD.WP---------------------------KCFGT.YAPPLEESQLPAD
Q0ABY2_ALKEH/7-324MVV--------V---LGATVRLMDAGLGCPD.WP---------------------------GCYGRLVVPQSEPAISQAN
Q5P2E4_AROAE/16-326LVV--------V---FGAYVRLSDAGLGCPD.WP---------------------------GCYGRLTPHHAATDILETH
Q3SLW6_THIDA/5-318GVV--------S---LGAFVRLSDAGLGCPD.WP---------------------------GCYGKLTPHHAAEAIDAAI
Q3J6R5_NITOC/6-323VVV--------V---VGAYVRLSDAGLSCPD.WP---------------------------GCYQKLLAPTTEQQVDHAN
Q88RM0_PSEPK/6-317LVV--------L---LGAYTRLTHAGLGCPD.WP---------------------------GCYGFISVPKTDVQLAHAE
Q2SQU9_HAHCH/23-348CVI--------L---LGAYTRLVDAGLGCPD.WP---------------------------GCYGFLTVPNEAHEIEIAE
Q0VN95_ALCBS/14-332GVI--------T---LGAWTRLSDAGLGCPD.WP---------------------------GCYGHLDVRKAIEHVANTN
Q7MDC7_VIBVY/12-325VVI--------L---LGAYTRLSDAGLGCPD.WP---------------------------GCYGHLTVPNTAAELSVVE
A3Q942_SHELP/4-317CVI--------L---MGAYTRLSDAGLGCPD.WP---------------------------GCYGMIKVPTQSHELAKAQ
Q48AB6_COLP3/12-337VVI--------G---LGAYTRLTHAGLGCPD.WP---------------------------TCYGLIDVPETSIQIAAAE
Q15N00_PSEA6/2-315TVI--------V---LGAYTRLTDAGLGCPD.WP---------------------------GCYGHYKVPVAQEQINAAE
A1SY56_PSYIN/14-353LVV--------G---LGAYTRLSDAGLGCPD.WP---------------------------GCYGSLTVPAELDASATAK
Q3IJP9_PSEHT/6-319IVV--------A---LGAYTRLSDAGLGCPD.WP---------------------------GCYGFLTVPKHEADIAQAT
Q12E38_POLSJ/44-358DLV--------I---FGAFTRLTDSGLGCPD.WP---------------------------GCYGSASPVGAQMHIEAAQ
A2SKN8_METPP/44-363DLV--------L---FGAFTRLTDSGLGCPD.WP---------------------------GCYGSASPLGARDEIQAAQ
A4T080_POLSQ/35-356DLI--------V---FGAFTRLTDSGLGCPD.WP---------------------------GCYGTSNPFHALSDIAQAE
Q8Y2G5_RALSO/30-341DLI--------M---FGSFTRLTDSGLGCPD.WP---------------------------GCYGTSNPFHARDDIHAAQ
Q2KTW9_BORA1/9-320DLI--------M---FGAFVRLTDSGLGCPD.WP---------------------------GCYGKASPLGALQDIHRAA
Q60CH3_METCA/12-323GAL--------L---IGAFLRIADAGLGCPA.WP---------------------------GCYGA...PVADEQSAAMM
CTAA_FLAJ1/9-333LMV--------V---VGGITRLTNSGLSMTD.WH---------------------------LVTDT.FPPLTDAKWQAAF
CTAA_ORITB/10-346LMI--------V---VGGITRLTNAGLSIVE.WN---------------------------PVSGI.IPPISSEDWNNEF
CTAA_RICPR/7-325LMI--------I---IGGITRLTGAGLSIVE.WS---------------------------PVTGL.LPPFSFESWQVEF
CTAA_ANAPZ/7-319LMV--------F---VGGVTRLTNSGLSITE.WR---------------------------PVTGV.LPPISDADWAKEH
CTAA_NEOSM/4-317SMV--------S---IGGFTRLTESGLSITE.WK---------------------------PVTGV.IPPLSKNAWQKEF
CTAA_BRADU/15-335LMV--------L---VGGATRLTESGLSIVE.WK---------------------------LVTGS.LPPLSAAQWTEAF
CTAA_METS4/27-349AMV--------A---VGGATRLTGSGLSITE.WK---------------------------PVTGA.VPPLSAEAWAEEF
CTAA_RHIEC/27-347CLV--------L---VGGATRLTNSGLSITE.WK---------------------------PIHGV.IPPLSAAEWDEEF
CTAA_PARL1/21-336IMV--------V---VGGLTRLTESGLSITE.WK---------------------------PVTGA.LPPMTEEHWQEEF
CTAA_JANSC/36-361VQI--------A---IGGLTRLTDSGLSITE.WA---------------------------PITGA.IPPLDEAAWEAEL
CTAA_HYPNA/15-332AII--------L---VGGATRLTDSGLSITE.WR---------------------------PVSGA.LPPMSEAAWLVEF
CTAA_MARMM/13-331AMI--------I---IGGTTRLTDSGLSITE.WK---------------------------PISGA.IPPLSQQDWQDEF
CTAA_CAUCR/14-334AMV--------V---VGGATRLTDSGLSITE.WQ---------------------------PIMGA.LPPMSEQAWRESF
CTAA_NOVAD/17-340AIV--------A---VGGITRLTESGVSITE.WK---------------------------PVAGT.LPPITDAQWQAEF
CTAA_SPHAL/22-339IVV--------G---VGGITRLTESGLSITE.WR---------------------------PVSGV.LPPLNEADWVREF
CTAA_BARHE/23-344AIV--------L---VGGATRLTGSGLSITE.WK---------------------------PIHGV.IPPIGVEQWQEEF
A0CRQ7_PARTE/61-392FMV--------L---LGGYTRLTHSGLSMTK.WK---------------------------PIEYA..YPRNQADWEKEF
CTAA_MAGSA/22-344VMV--------L---LGGLTRLTHSGLSMVE.WE---------------------------PIRGI.IPPLNDTDWQLFF
A9WIE2_CHLAA/11-294LVI--------M---WGAFVRATGSGAGCGDHWP---------------------------LCDGQ.VIPRSPD......
CTAA_LYSSC/8-290LIL--------L---GGALVTKTDSGLGCGRNWP---------------------------DCNGS.LIPKEIT......
B7VQY7_VIBTL/4-312TVI--------V---LGAYTRLSDAGLGCPD.WP---------------------------GCYGKITVPSDAQAVNQAN
CTAA_ANAMF/9-318LMV--------V---IGGITRLTHSGLSITE.WQ---------------------------PIVGV.VPPIGDEAWLREK
F1R355_DANRE/60-387GAV--------V---LGGVTRLTESGLSMVD.WH---------------------------LVKEM.KPPQTQAEWEQEF
I0HWX8_RUBGI/43-349DLV--------L---FGSFTRLSDSGLGCPD.WP---------------------------GCYGHASPVGAADHIAAAQ
CTAA_BRUA2/27-346AIV--------M---VGGATRMTGSGLSITE.WK---------------------------PIHGV.IPPLNHAEWVEEF
CTAA_PELUB/14-326LMV--------A---VGGLTRLTDSGLSITA.WE---------------------------LFTGI.LPPMNINEWNFYF
COXX_THET8/12-294LVA--------L---FGAYVRATGSGAGCGAHWP---------------------------TCNGE.VIPRAPQ......
Q5ZYG1_LEGPH/18-327FVV--------M---LGAYTRLTDAGLGCPD.WP---------------------------GCYGRMVLPGADKGLQEAQ
Q6Z5C5_ORYSJ/128-457GLV--------I---LGGVTRLTRSGLSMTD.WK---------------------------.FTGS.LPPMSDEEWLLEF
CTAA_WOLPM/16-328LMV--------G---IGGFTRLSKAGLSITE.WK---------------------------PITGT.LPPLSEQDWLQEK
CTAA_LISMO/7-287VVV--------F---GGALVTKTGSADGCGNSWP---------------------------LCNGQ.LVRLTDVT.....
Q9I720_PSEAE/12-320VVV--------L---LGAYTRLTHAGLGCPD.WP---------------------------GCYGFVHVPLSEAQLAHAE

PF00033

CYB6_SPIOL/21-210HVF------------R---------VYLTGG------------------------------FK-KPRELT----------
CYB_ASCSU/10-196HLF------------K---------GLFF..------------------------------MS-YRLKKV----------
CYB_MARPO/20-208HFF------------R---------GLYYGS------------------------------YA-SPRELV----------
CYB_TRYBB/9-197HIF------------K---------SITLII------------------------------LF-DTHILV----------
CYB6_MARPO/21-210HIF------------R---------VYLTGG------------------------------FK-KPRELT----------
CYB6_EUGGR/21-210HVC------------R---------VYLTGG------------------------------FK-KPRELT----------
CYB_STELO/18-204HMG------------R---------GLYY..------------------------------GS-YMFQET----------
CYB_HETFR/19-205HIA------------R---------GLYY..------------------------------GS-YLLKET----------

PF13631

D5SPP4_PLAL2/91-258QVL------------Q---------IVWDRW------------------------------YL.APRELS----------
D7WEJ9_9CORY/110-284HML------------R---------IFFTGA------------------------------FR.RPREAN----------
C7M191_ACIFD/113-287HLL------------R---------IFFTGA------------------------------YR.KPREIN----------
A0LTH4_ACIC1/129-303HMC------------R---------VFFTGA------------------------------FR.RPRETN----------
Q2JA36_FRASC/139-313HLC------------R---------IFFTGA------------------------------FR.RPREIN----------
E3JBI3_FRASU/129-303HCF------------R---------VFFTGA------------------------------YR.KPREIN----------
C8XCX9_NAKMY/122-296HMM------------R---------VFFTGA------------------------------FR.KPREVN----------
D1A8W4_THECD/118-295HML------------R---------VFFTGA------------------------------YR.KPRELN----------
C7MZ05_SACVD/123-298HMF------------R---------VFFTGA------------------------------FR.RPREAN----------
QCRB_CORDI/110-284HML------------R---------IFFTGA------------------------------FR.RPREAN----------
B1MBC7_MYCA9/109-283HLA------------R---------VFFTGA------------------------------FR.RPREAN----------
C6W9G5_ACTMD/123-297HMF------------R---------IFFTGA------------------------------FR.RPREIN----------
D1A3M6_THECD/119-294HLL------------R---------NFFTGA------------------------------FR.KPRELN----------
Q9K4I9_STRCO/122-296HLL------------R---------VFFTGA------------------------------FR.RPREVN----------
D0LAX2_GORB4/112-287HMM------------R---------IFFTGA------------------------------FR.RPREAN----------
Q01PC6_SOLUE/95-279HMA------------Q---------VFLFGA------------------------------YK.YPRELT----------
Q9RX79_DEIRA/103-278HMM------------R---------IYFTGA------------------------------FK.KPREIN----------
A0LFE3_SYNFM/95-264HLA------------G---------TFLTAA------------------------------YQ.APRQFV----------
A4YE24_METS5/89-278HMF------------R---------NYFVGA------------------------------YK.KPRELL----------
Q9HIU9_THEAC/81-267HLL------------R---------NVFVGA------------------------------YK.RPRRDQ----------
A4YDG6_METS5/94-292HMF------------R---------NFYKGA------------------------------YK.KPRELQ----------
D2PP93_KRIFD/114-286HLL------------R---------LFFTAG------------------------------FR.RPRRLN----------
D4H0P8_DENA2/82-245HLL------------R---------TVLTGV------------------------------YA.GR.KRN----------
Q9HIV5_THEAC/107-280HML------------R---------NYFIGA------------------------------YKGKWRWLQ----------
Q6KZY3_PICTO/98-271HMM------------R---------QYFIGS------------------------------YKGAWRWLQ----------
B3LEZ9_DROMO/89-254HVG------------R---------GIYYGS------------------------------YL.FTP..T----------
F4B633_ACIHW/89-277HMF------------R---------NYFVGA------------------------------YK.KPRELL----------
QCRB_MYCTU/120-294HLA------------R---------IFFTGA------------------------------FR.RPRETN----------
Q4JWC3_CORJK/115-288HMM------------R---------IFFTGA------------------------------FR.KPREAN----------
Q8HC78_ORYLA/88-253HIG------------R---------GLYYGS------------------------------YL.YKET..----------
Q97V30_SULSO/93-279HMF------------R---------NYFAGA------------------------------YK.KPRELL----------
Q97VH0_SULSO/90-287HMF------------R---------NFYKGA------------------------------YK.KPRELQ----------
V9XG29_9NOCA/115-289HLL------------R---------VFFTGA------------------------------FR.RPREAN----------

PF01292

C1DIE6_AZOVD/9-186...................................................QMARI----L....HPF..L-GVVVFLAL
B2UEV9_RALPJ/18-207................................................GWLGGALQ----W....HFA..A-MWLLVVNG
F2G749_ALTMD/13-185......................................................RL----Y....HEI..A-GYAGVSFI
B2JU39_BURP8/35-202......................................................LN----L.........L-GTILFPVS
A8LH36_FRASN/20-219......................................................VT----WTRSIHKV..T-AYVFIALI
Q24SV4_DESHY/15-201...................................................DNARM----I....HRV..A-ALFFAVAV
B0SVS8_CAUSK/3-181......................................................GA----L....HAW..L-GYGVAAVI
Q3KA02_PSEPF/7-177......................................................IN----L....HKP..L-GIAILALV
A7IEJ2_XANP2/17-189......................................................RE----LIWWTHIS..V-GLLLIALV
Q5P430_AROAE/8-169........................................................----.....HQW..A-GYLALALV
Q8KEB1_CHLTE/10-218..................................................IATWRG----V....HFA..V-AFVFIANF
A3Y9W1_9GAMM/26-199........................................................----.....HSS..I-GSILTLFI
A0RPH5_CAMFF/12-218..................................................NAKWRA----V....HQI..V-GFILIGCF
Q2W2V7_MAGSA/500-649......................................................LE----WAFGLHKW..S-GLTLVAAY
E2XB98_SHIDY/13-220....................................................FYMG----YIRLIHFS..A-GMVFTVVL
Q73XF0_MYCPA/5-235RKVMPRDRIYDT....................LDEEEDYHLLISLPGHAQLGMGRH----W....HFFAVI-GWVLVGLS
Q3K9Y1_PSEPF/9-180......................................................RT----LIREVHYM..L-GLTVFVLV
J2ZFR0_SHISO/68-257......................................................VA----V....HEV..C-GFLLLACW
Q11M26_CHESB/8-183......................................................YQ----W....HKS..L-GFLTMVLA
A8EUR4_ARCB4/14-229...................................................KYVMA----WNRWGHFI..A-AIIFDVTA
Q0AAZ8_ALKEH/9-216...............................................FGGNQNLIL----F....HVV..V-GVAWMVGI
A3UXK6_VIBSP/7-177......................................................PD----Y....HRS..V-GILLATVT
Q726G3_DESVH/8-195......................................................FT----V....HNA..C-AWTWFVLY
Q0P8A9_CAMJE/92-274.....................................................CKN----L....HAF..A-TILFIISI
Q6MN52_BDEBA/9-210ITP.....................................ELAKDIAVGIRTPMWD----W....HYV..L-GFTLGGLL
A1VMH0_POLNA/30-197........................................................----.....HVT..L-GYTLAGLL
Q24SH5_DESHY/15-204................................................GDYFITIN----L....HYL..A-AVLLIFVV
A4EHB9_9RHOB/9-185....................................................DYYN----W....HKS..I-GLVALAIA
A1K9P7_AZOSB/5-173......................................................IG----L....HKS..F-GVVALLVV
O28892_ARCFU/13-211......................................................YA----L....HIR..M-SFVFAGLW
Q3SMF3_THIDA/22-205......................................................WN----V....HIL..S-GYVLSAAL
Q0F0S9_9PROT/5-220EGH.....................................HQAVPGAPVEATLGFE----V....HEI..L-GLVIGGLL
Q1QXP2_CHRSD/8-174......................................................VQ----W....HTT..I-GVGILALM
A8H662_SHEPA/17-235....................................................KLKE----V....HIV..I-GYLFVINL
Q2LQE6_SYNAS/8-184...................................................KSLKY----I....HNF..T-ALFFILSL
Q137Q9_RHOPS/15-183......................................................YD----W....HKA..I-GTLVLGLA
Q0G224_9RHIZ/16-199......................................................FQ----F....HKT..I-GLLVLALT
Q21VQ4_RHOFT/20-197......................................................IV----W....HES..L-GILVFALT
A6D834_9VIBR/136-317...................................................GWTVY----LAKQYHNY..M-GPIFFILL
A5FBE0_FLAJ1/8-190LEK.....................................GQIIPIVKSIQKPMWE----W....HEY..A-AYIMFLAF
Q0FAP7_9RHOB/5-159......................................................LK----F....EII..F-AALMLILL
A3XC59_9RHOB/9-194................................................SRAVLLFT----I....HKT..I-GVAAFFTG
A5G519_GEOUR/9-204.....................................................AIL----L....HNT..A-GIVVAVSF
A4BH07_9GAMM/8-165..................................................QGNVHQ----W....HFY..A-AMGFGVAT
A5FTL2_ACICJ/4-178.....................................................LFQ----L....HKT..I-GLTVFALV
Q3M4T2_ANAVT/30-199...................................................GESID----I....HGT..F-AVFFFFVF
Q5QZM1_IDILO/10-182......................................................ME----L....HKD..I-GIALLALL
Q2K795_RHIEC/4-158....................................................YWDT----VQHHLHNY..A-GMAIGLLM
Q2N9I4_ERYLH/7-222PRFP....................................GWITIPDYYSLAEARD----W....HIL..V-AWPFAVIL
Q2YJ32_BRUA2/13-182......................................................YS----FFWSAHFQ..L-GFALLVLA
A8GZ50_SHEPA/78-266...................................................AMMFN----L....HFV..G-ALFFVFGC
A5WBJ1_PSYWF/9-194......................................................LQ----L....HLS..F-GVVVGTLI
A5VEG9_SPHWW/24-275AARDLSRTPLEVIGRAGGYEVDLTGWLGSVLDLGSAGKFFVLIAPSADFQFGATRA----L....HFL..A-AEVLIATW
Q3ABV8_CARHZ/7-189.....................................................ARK----L....HFY..M-MYVVMAGL
Q3JAE2_NITOC/6-172......................................................VN----L....HIS..L-GLTSMILV
A3PG79_RHOS1/6-157......................................................AG----VGHYLHVV..V-GLAVLVLT
Q89C01_BRADU/31-198.................................................PQGEIFS----W....HFL..A-GLAVFFCG
Q1QIT3_NITHX/121-299...................................................SEWSQ----WAKYAHNY..L-SFPFTIGV
Q1ITC7_KORVE/20-198...................................................PSARV----W....HPI..V-GLGFVAGI
J9ZA39_LEPFM/17-226....................................................FFQK----I....HIY..L-GYAFILLF
Q1ZU49_PHOAS/13-188......................................................ST----LFLWVHII..L-GILTVVVT
A8G145_SHESH/120-302...................................................TSLVG----LSSSLHEL..M-AFPFILGY
Q1Z615_PHOPR/4-173......................................................FN----FLSVLNMS..L-ATVGSALF
A1RW11_PYRIL/6-212..............................................GTDAVTAGVQ----LFRIAHRF..L-GHIWGALL
Q7NUV6_CHRVO/15-181.....................................................PLN----V.........A-LTTLLVPF
Q5V2I5_HALMA/8-213...................................................SGVTA----I....HRITGI-GLVALVIF
Q7NL56_GLOVI/6-177......................................................YA----F....HKS..M-GVLILFLL
Q0BVB5_GRABC/13-193......................................................PD----I....HRW..T-AETLLLLL
Q47YK1_COLP3/6-182......................................................YL----L....HSY..L-GLSLASIM
A5L4J8_VIBBS/13-176......................................................IL----I....HQI..L-GSVVLILI
Q6N8J2_RHOPA/9-176......................................................LR----V....HLP..A-AALVLVLT
A0A023E6B3_AERSA/10-170......................................................EE----W....HEW..L-GYAAMALI
Q87J03_VIBPA/16-183......................................................FN----A....HMS..F-GLLVLALS
A1HTF5_9FIRM/5-186.....................................................MRK----V....HLV..F-GFILSVNL
Q5NE92_FRATT/30-197......................................................MT----L....HKS..F-GLVIFFVI
Q2BLD7_NEPCE/3-170......................................................LE----V....HMA..V-GIGVGMLF
Q2IL72_ANADE/263-456...............................................LGGRAALLR----L....HVA..W-GLAWAAVV
A8EX57_ARCB4/6-181......................................................LN----Y....HAV..A-GYAILILL
A4YRW2_BRASO/8-180......................................................RF----FYRSIHAD..I-GYVLLVLL
A5G6W1_GEOUR/7-182...................................................RNAIA----V....HKI..A-GVVFFLSS
Q1YYF5_PHOPR/9-176......................................................VN----L....HSG..I-GVLSLLLL

PF14358

D4L0H2_9FIRM/73-132------------------------------------------------------..----...........-...WIKI.
D0MK75_RHOM4/9-73------------------------------------------------------..----...........-...LWGL.
W0E6J3_9FIRM/78-136------------------------------------------------------..----...........-...GFRA.
D2QYK9_PIRSD/9-74------------------------------------------------------QL----GGM........-........
D4H642_DENA2/9-75------------------------------------------------------AD----WS.........-...IFGM.
B3EM27_CHLPB/9-76------------------------------------------------------TD----WQ.........-...LLGL.
J7IMY2_DESMD/114-176------------------------------------------------------GG----LAA........-........
W6EIG8_SULMU/8-59------------------------------------------------------..----...........-....FKI.
F2KT13_ARCVS/8-72------------------------------------------------------IV----I..........-....FGL.
A2BLN5_HYPBU/150-207------------------------------------------------------..----...........-........
B3E729_GEOLS/14-80------------------------------------------------------LD----WT.........-...FWGI.
R5AVI3_9BACT/6-59------------------------------------------------------A.----...........-........
F4GSW9_PUSST/118-178------------------------------------------------------IR----L..........-........
F4L3Z1_HALH1/135-204------------------------------------------------------AW----VPGVFGGDAP.-........
G2TKP1_BACCO/83-141------------------------------------------------------..----...........-...NINL.
A1BH85_CHLPD/29-96------------------------------------------------------EA----FR.........-...LIGL.
L0KZY5_METHD/9-75------------------------------------------------------YQ----E..........-...YIGI.
K7RVD2_PROA4/158-222------------------------------------------------------LL----GGHQG......-........
E6W587_DESIS/14-80------------------------------------------------------AG----WH.........-...FLGV.
B4S7W8_PROA2/12-79------------------------------------------------------TD----WR.........-...MLGL.
F2NIT4_DESAR/9-81------------------------------------------------------YG----RRVELS.....-...WLGW.
A6LIR5_PARD8/13-85------------------------------------------------------QD----ATPWCSH....-...LLGL.
E6UI69_RUMA7/73-132------------------------------------------------------..----...........-...FM.Y.
I2EY27_EMTOG/6-57------------------------------------------------------..----...........-....IKQ.
Q8TMV4_METAC/9-62------------------------------------------------------..----...........-......ID
Q2KUA6_BORA1/118-178------------------------------------------------------VR----A..........-........
C9RRV1_FIBSS/74-133------------------------------------------------------..----...........-...WLGI.
W0LFH8_9ENTR/72-131------------------------------------------------------..----...........-...DLPI.
D3RZ50_FERPA/13-74------------------------------------------------------AM----GGVEE......-........
A9WBK7_CHLAA/77-137------------------------------------------------------..----...........-...FFGL.
A1B726_PARDP/70-128------------------------------------------------------..----...........-...ALAL.
J0RX58_9EURY/9-83------------------------------------------------------HA----STGVANLKV..-...FLGV.
R6EP61_9FIRM/72-131------------------------------------------------------..----...........-...FVRI.
Q3B233_PELLD/10-77------------------------------------------------------TG----WQ.........-...LLAL.
Q6APY0_DESPS/4-70------------------------------------------------------SG----YR.........-...FLWL.
S6CG33_9ACTN/62-122------------------------------------------------------..----...........-...SLGL.
C8WKH1_EGGLE/2-62------------------------------------------------------..----...........-...AFGL.
G0A5D7_METMM/11-75------------------------------------------------------..----...........-...LWGL.
C4XNX5_DESMR/5-71------------------------------------------------------AD----WG.........-...FLGL.
A7I2S7_CAMHC/7-58------------------------------------------------------..----...........-.....HI.
C4XNC0_DESMR/13-70------------------------------------------------------G.----...........-........
A0RPQ5_CAMFF/7-58------------------------------------------------------..----...........-....FDI.
W6RUZ5_9CLOT/75-133------------------------------------------------------DI----...........-........
C0R274_BRAHW/70-129------------------------------------------------------..----...........-...FLNL.
R6AFB6_9FIRM/68-125------------------------------------------------------..----...........-...TMPIF
E8N2M4_ANATU/72-132------------------------------------------------------..----...........-...VLGL.
B4SDX1_PELPB/4-55------------------------------------------------------..----...........-....FKI.
Q2RX07_RHORT/14-65------------------------------------------------------..----...........-....WHQ.
D6Z5B1_DESAT/6-72------------------------------------------------------AD----WQ.........-...LLWL.
B5YIR5_THEYD/10-76------------------------------------------------------IN----WK.........-...FLGL.
B3EQ00_CHLPB/8-59------------------------------------------------------..----...........-....FHF.
R6P7P3_9FIRM/71-130------------------------------------------------------..----...........-...FLNI.
Q2RIJ9_MOOTA/9-76------------------------------------------------------AF----APGFIF.....-........
I3YFD4_THIV6/9-59------------------------------------------------------..----...........-........
F8E8X8_FLESM/7-73------------------------------------------------------VN----WQ.........-...LIGL.
R6CX21_9CLOT/72-131------------------------------------------------------..----...........-...FLSI.
F0JFF5_DESDE/5-71------------------------------------------------------AD----WH.........-...LLGM.
M4R3B0_BIBTR/72-131------------------------------------------------------..----...........-...EMPF.
G8QTP5_SPHPG/76-131------------------------------------------------------..----...........-........
R7QWY9_9FIRM/8-58------------------------------------------------------..----...........-........
F4LLX1_TREBD/74-133------------------------------------------------------..----...........-...FIGI.
R7LCV5_9BACT/72-130------------------------------------------------------..----...........-...FLGI.
K0NEJ9_DESTT/6-72------------------------------------------------------AD----WR.........-...LWTL.
R7F4I4_9CLOT/70-128------------------------------------------------------..----...........-...FLDI.
D2RHV9_ARCPA/8-72------------------------------------------------------VL----V..........-....YGL.
R6YA34_9FIRM/72-131------------------------------------------------------..----...........-...FLPI.
L0GUL1_9GAMM/12-78------------------------------------------------------TH----WS.........-...LLGL.
C0QZ66_BRAHW/50-109------------------------------------------------------..----...........-...FLNI.
X5DE85_9BACT/10-77------------------------------------------------------VN----WE.........-...LAGL.
B1L3S4_KORCO/10-72------------------------------------------------------II----FM.........-........
E4TFY8_CALNY/5-71------------------------------------------------------AD----LH.........-...IIGL.
B9JJR0_AGRRK/72-130------------------------------------------------------..----...........-.....AM.
G7M4T2_9CLOT/72-131------------------------------------------------------..----...........-...FLPI.
R5X0L1_9BACT/9-66------------------------------------------------------V.----...........-........
K0C3X7_CYCSP/5-59------------------------------------------------------..----...........-........
R7CCE2_9CLOT/72-131------------------------------------------------------..----...........-...FLDI.
F2NSL9_TRES6/73-131------------------------------------------------------SW----...........-........
R6UA77_9CLOT/74-132------------------------------------------------------..----...........-...FLNI.
F5YAS5_TREAZ/76-135------------------------------------------------------..----...........-....LEG.
W6EBR3_SULMU/7-73------------------------------------------------------TN----WE.........-...LLGL.
R5D3A2_9FIRM/72-131------------------------------------------------------..----...........-...FLPR.
K9VDE1_9CYAN/16-81------------------------------------------------------..----GYGTGRLPL..-...FLSL.
E1RA86_SPISS/8-59------------------------------------------------------..----...........-........
G0EES3_PYRF1/11-75------------------------------------------------------..----...........-...ALGI.
R7CST8_9FIRM/68-123------------------------------------------------------..----...........-...SLGF.
R5I3L3_9PORP/6-78------------------------------------------------------QS----ANSWCSH....-...LCGL.
E8RC78_DESPD/24-75------------------------------------------------------..----...........-....FNI.
A5UYY8_ROSS1/82-142------------------------------------------------------..----...........-...WFGI.
T2KM32_9FLAO/57-117------------------------------------------------------..----...........-...AIGI.
N0AR40_9BACI/76-134------------------------------------------------------..----...........-...SLAI.
M1NG91_DESSD/6-72------------------------------------------------------AD----WH.........-...LWGL.
A4VFX0_PSEU5/114-174------------------------------------------------------LR----W..........-........
B9JP15_AGRRK/72-130------------------------------------------------------..----...........-...FLPL.
Q3ATG1_CHLCH/8-59------------------------------------------------------..----...........-....FDI.
G0L331_ZOBGA/81-141------------------------------------------------------..----...........-...VFGI.
R7NCG3_9MOLU/2-60------------------------------------------------------..----...........-...FLNI.
A1BFX6_CHLPD/10-77------------------------------------------------------TD----WR.........-...MIGL.
G4STW3_META2/9-73------------------------------------------------------..----...........-...IWGL.
I0GHS8_CALEA/20-86------------------------------------------------------TN----WT.........-...FLGF.
G7Z1L5_AZOL4/25-76------------------------------------------------------..----...........-....LHW.
E1SVF5_FERBD/125-198------------------------------------------------------YP----FAEWFVGIMGG-MAP.....
F4C4I1_SPHS2/7-58------------------------------------------------------..----...........-........
A0LPC1_SYNFM/9-75------------------------------------------------------SK----F..........-...FMGL.
Q7CI97_YERPE/72-131------------------------------------------------------..----...........-...DLPI.
E4RQ49_LEAB4/7-58------------------------------------------------------..----...........-........
A6LNM0_THEM4/27-84------------------------------------------------------I.----...........-........
V5UHX6_9BURK/124-184------------------------------------------------------IR----L..........-........
Q8KFP7_CHLTE/12-79------------------------------------------------------TD----WN.........-...IFGL.
W6EDS3_SULMU/5-59------------------------------------------------------..----...........-........
F4HFN7_GALAU/72-131------------------------------------------------------..----...........-...EMPF.
D5DJ74_BACMD/77-135------------------------------------------------------..----...........-...NINV.
A3CUK5_METMJ/9-76------------------------------------------------------GW----EL.........-...FLDI.
Q7UE94_RHOBA/95-155------------------------------------------------------..----...........-...ALGI.
E1RE56_METP4/9-80------------------------------------------------------KN----PDYINS.....-...FIGL.
R6M5A8_9CLOT/72-131------------------------------------------------------..----...........-...FLSF.
B7GIW2_ANOFW/77-135------------------------------------------------------..----...........-...HLLG.
B5IFA9_ACIB4/1-67------------------------------------------------------AS----WR.........-...LLGV.
A2SSD8_METLZ/31-96------------------------------------------------------MN----...........-...FLDV.
Q8TUQ6_METAC/9-75------------------------------------------------------YI----V..........-...YMGL.
D6DHZ2_CLOSC/72-131------------------------------------------------------..----...........-...FLPG.
B3E2B6_GEOLS/10-61------------------------------------------------------..----...........-....FHV.
F8I7H1_SULAT/39-95------------------------------------------------------MR----F..........-........
B4SBP8_PELPB/10-77------------------------------------------------------MG----WS.........-...MIGL.
Q65T96_MANSM/72-131------------------------------------------------------..----...........-...EFPF.
Q21KL9_SACD2/6-57------------------------------------------------------..----...........-........
D2QJH4_SPILD/6-57------------------------------------------------------..----...........-....FGQ.
N0BAX1_9EURY/9-75------------------------------------------------------TH----WT.........-...FLGL.
C8WKW0_EGGLE/72-132------------------------------------------------------..----...........-...ALGL.
A9AYM2_HERA2/83-143------------------------------------------------------..----...........-...LLGL.
C0QF61_DESAH/5-71------------------------------------------------------VD----WH.........-...LWGL.
B9L860_NAUPA/5-71------------------------------------------------------TG----WK.........-...FLGV.
D1B0M4_SULD5/7-73------------------------------------------------------TH----WE.........-...LFGL.
H1YWY9_9EURY/9-71------------------------------------------------------GL----TFRE.......-........
W6RSI1_9RHIZ/73-131------------------------------------------------------..----...........-...WLPI.
C6BYF4_DESAD/5-71------------------------------------------------------AD----WS.........-...MLGL.
M1XST7_NATM8/13-77------------------------------------------------------T.----...........-...FLGI.
K4LE17_9FIRM/80-137------------------------------------------------------W.----...........-........
Q2W2B9_MAGSA/11-62------------------------------------------------------..----...........-........
Q15XU8_PSEA6/79-139------------------------------------------------------..----...........-...TLDI.
R5U1B1_9BACE/6-63------------------------------------------------------N.----...........-........
A7I9H3_METB6/10-72------------------------------------------------------VL----PAAQ.......-........
R4JZ25_CLOPA/71-128------------------------------------------------------..----...........-...CLKRI
D9SQY3_CLOC7/76-134------------------------------------------------------..----...........-...GLGL.
A1AR53_PELPD/10-61------------------------------------------------------..----...........-....FHV.
E4U6D1_OCEP5/21-87------------------------------------------------------VD----WR.........-...LLWL.
K0NB22_DESTT/5-71------------------------------------------------------SP----WS.........-...FWGL.
I4D2J4_DESAJ/77-135------------------------------------------------------..----...........-...GLGL.
C9R964_AMMDK/9-90------------------------------------------------------WQ----WGHGGSYGWRL-SQEQVFL.
F8ABZ1_THEID/4-70------------------------------------------------------TG----WT.........-...LLGL.
B8FH86_DESAA/4-70------------------------------------------------------SN----WK.........-...LWGL.
H1XS36_9BACT/14-80------------------------------------------------------TH----IS.........-...LLGL.
R5AVH3_9BACE/10-63------------------------------------------------------I.----...........-........
R5X3I1_9CLOT/76-130------------------------------------------------------..----...........-........
A8F7I9_PSELT/58-115------------------------------------------------------..----...........-...VFDFP
Q8A5L2_BACTN/9-66------------------------------------------------------N.----...........-........
K4LFC8_THEPS/9-79------------------------------------------------------GG----RWSHPEFIFPC-VT......
Q3B3K8_PELLD/8-59------------------------------------------------------..----...........-....FHI.
Q7UGQ3_RHOBA/4-55------------------------------------------------------..----...........-........
W6RUQ3_9CLOT/77-135------------------------------------------------------..----...........-...FLNI.
D5V7U4_ARCNC/6-72------------------------------------------------------AN----WK.........-...LFGL.
L0H0I4_9GAMM/9-59------------------------------------------------------..----...........-........
S6CE05_9ACTN/67-127------------------------------------------------------..----...........-...SFGL.
F0S3U2_DESTD/5-71------------------------------------------------------TG----WR.........-...FLGL.
R5W765_9BACE/6-63------------------------------------------------------N.----...........-........
A0LNU4_SYNFM/14-72------------------------------------------------------HA----...........-........
R5LI07_9SPIR/70-129------------------------------------------------------..----...........-...FLNL.
B0VH29_CLOAI/15-63------------------------------------------------------..----...........-........
V4JBA5_9DELT/6-72------------------------------------------------------AD----WR.........-...FLGL.
S6C133_9ACTN/57-117------------------------------------------------------..----...........-...SMGL.
B3QVT3_CHLT3/9-64------------------------------------------------------..----...........-....FHVF
D4IPJ8_9BACT/10-82------------------------------------------------------AG----ARAHASQ....-...LLGM.
R7CTR1_9FIRM/68-124------------------------------------------------------..----...........-.....SL.
Q11BF1_CHESB/72-130------------------------------------------------------..----...........-.....IF.
E8T206_THEA1/5-71------------------------------------------------------TG----WH.........-...FLGL.
I0GQA3_SELRL/62-115------------------------------------------------------..----...........-........
Q3A6A8_PELCD/4-70------------------------------------------------------AD----WK.........-...LWSL.

PF03188

ACFR1_ARATH/49-182------------------------------------------------------KP----VKKLIHLILHA-IALALGIF
A5C961_VITVI/49-182------------------------------------------------------KE----VKKVIHLVLHA-IALILGII
Q6Z1Y9_ORYSJ/56-192------------------------------------------------------RD----ARKKVHLGLHA-VGLALGGV
Q9FVY1_ORYSJ/46-178------------------------------------------------------HD----TNKMVHLLLHA-IALLLGSV
ACFR2_ARATH/50-183------------------------------------------------------KN----LKKLVHLTLQL-TAFILSLI
Q6YW65_ORYSJ/51-184------------------------------------------------------KK----LKKLVHLALQF-LAMLLSLI
ACFR4_ARATH/43-175------------------------------------------------------RK----TKKAVHLWLQG-MALASAVF
Q10DW5_ORYSJ/60-193------------------------------------------------------HR----TQKMVHMLVHL-VALILAIF
Q7XH60_ORYSJ/58-190------------------------------------------------------RE----VKKAVHLLLHL-VALAFAAV
Q28YW1_DROPS/100-238------------------------------------------------------HI----YVKLIHMFFHA-IAIPCIAL
A7UTA7_ANOGA/98-236------------------------------------------------------HL----IVKLCHTFFHA-CSIPCIVI
CYAC3_MOUSE/46-182------------------------------------------------------RL----PWKVLHAALHL-LAFTCTVV
CYAC3_DANRE/47-182------------------------------------------------------KL----PWKLLHAGLLL-LSFIFSVI
F7AAH4_CIOIN/56-190------------------------------------------------------KL----KAKIIHGSLLL-LAFIAVVV
A7RY72_NEMVE/55-189------------------------------------------------------KY----TVKLVHFALQL-VAFFVAVF
CY561_CAEEL/62-204------------------------------------------------------KK----FSKTLHVILHS-CVLVFMLM
CY561_HUMAN/52-186------------------------------------------------------KR----TTKVLHGLLHI-FALVIALV
CYBR1_HUMAN/49-185------------------------------------------------------KL----LMKSIHAGLNA-VAAILAII
F6U164_XENTR/54-190------------------------------------------------------KL----LMKFIHAGLHL-TALVFTIV
CYBR1_DANRE/47-183------------------------------------------------------KQ----MMKLIHAGLHI-LAFILAVI
Q7Q742_ANOGA/55-192------------------------------------------------------KK----PLKITHATIHG-AAFIFTVV
Q9I7U1_DROME/146-282------------------------------------------------------KK----TLKLTHAGIHM-GAFILTVI
O16272_CAEEL/98-231------------------------------------------------------NR----VSILIHTFLHI-ASIVLAVG
A8X7F4_CAEBR/71-205------------------------------------------------------KM----VSKLLHTALHI-TAIGLAIT
Q29JT1_DROPS/48-184------------------------------------------------------RK----YKTAAHVVLQV-IGGGMGVA
Q9VIT6_DROME/48-184------------------------------------------------------RN----YKTAFHVVLQI-LGGGMGVA
Q9VIT5_DROME/94-228------------------------------------------------------RQ----TKTTIHWVLLT-LGGGCGAA
Q9VIU6_DROME/47-182------------------------------------------------------HR----NKSRFHAILQI-VGGSMVLL
Q17ID4_AEDAE/154-293------------------------------------------------------QP----QRRTTHWIMQV-IGAVCIIV
A0NFY4_ANOGA/64-202------------------------------------------------------HS----HKRTVHWLIEA-VGCSCCVV
Q7PZD0_ANOGA/60-198------------------------------------------------------HR----TKVFLHWLLQA-VAGVLISI
Q16LW8_AEDAE/141-279------------------------------------------------------QK----TRILIHWILQA-LAGILITI
C56D1_MOUSE/54-191------------------------------------------------------RK----TRIRLHWAGQT-MAILCAVL
F1R6P8_DANRE/63-200------------------------------------------------------RK----WKVRLHWFFQA-LLLICGAT
H3BZA9_TETNG/61-199------------------------------------------------------RK----FKVRLHWFCQA-LVLIFGIT
Q1LXB7_DANRE/47-184------------------------------------------------------HK----TKGRLHWILQC-LCVFCATL
H3DB33_TETNG/49-185------------------------------------------------------YR----TKSRCHWILQG-LCVSCAVL
C56D2_BOVIN/47-184------------------------------------------------------RK----GRARCHWVLQL-LALLCALL
Q5I024_XENTR/47-183------------------------------------------------------RR----ARVQVHWVLQL-LCVVCSLL

PF01794

FRO8_ARATH/159-281------------------------------------------------------K.----YHVWFGTGLIF.FSLVHGGS
FRO6_ARATH/178-300------------------------------------------------------R.----YHVWLGHITMA.FFSLHGLC
Q4WR75_ASPFU/273-390------------------------------------------------------I.----FHRHVAWIATL.QAVVHTIL
Q4WC00_ASPFU/90-202------------------------------------------------------R.----IHRATAWMSGM.LLACHVTI
Q4WRK0_ASPFU/107-219------------------------------------------------------K.----IHRATGWMATA.LLAVHVVV
Q4WF95_ASPFU/130-249------------------------------------------------------P.----WHRISGRLIFL.LIVVHATL
AIM14_DEBHA/94-207------------------------------------------------------D.----LHKWMSRVIIA.GAIIHGVG
Q6BTD9_DEBHA/151-272------------------------------------------------------V.----FHQYVGVAALV.LSVIHTIP
Q6BXT5_DEBHA/276-393------------------------------------------------------S.----FHKTIAMAMSF.LAFIHSCS
Q0U921_PHANO/152-271------------------------------------------------------A.----AHQILGRIVFL.LFSLHGIF
Q0UXV8_PHANO/43-161------------------------------------------------------W.----LHRWVGRTILV.SATVHVVV
A5DEQ5_PICGU/148-261------------------------------------------------------P.----IHKWLSRLIVL.QTVLHVIL
Q6C644_YARLI/142-255------------------------------------------------------I.----FHQVVGMCCVY.AAVMHAAV
FRE7_YEAST/161-282------------------------------------------------------I.----YHQWASILCLF.FSWVHVIP
RBOHJ_ARATH/366-523------------------------------------------------------N.----FHKLIAVAIAV.ISLLHTAL
Q0TVR2_PHANO/35-155------------------------------------------------------A.----FHRWVARVATV.QAVVHSLG
A3GFP0_PICST/241-358------------------------------------------------------L.----FHRWMARIMFL.LTLVHVTS
A5DPY7_PICGU/304-417------------------------------------------------------T.----FHRWVSRVIVI.LVLIHTVC
A0JNK9_BOVIN/259-407------------------------------------------------------LQ----CRKQLGLLSFF.FASVHVAY
YEDZ_RHORT/50-165------------------------------------------------------LR----RRRMVGLFAFF.YVCLHLLS
Q217F0_RHOPB/43-167------------------------------------------------------YR----WHHVTGILAYV.ALLLHPLA
A0LQW5_ACIC1/61-184------------------------------------------------------R.----WHAMGGRYLVG.VAAAHTAL
A1TKU8_ACIAC/46-161------------------------------------------------------AR----FRRMIGLFAFF.YALVHLLC
A6VUY1_MARMS/1-130------------------------------------------------------NR----YRRFIGLTAFF.YGLLHFVI
NOX4_PONAB/58-205------------------------------------------------------.T----FHITCGVTICI.FSGVHVAA
Q5A445_CANAL/308-425------------------------------------------------------M.----YHRWISRIDVL.LIIVHAIT
Q0APN2_MARMM/57-179------------------------------------------------------MM----VRRRIGLAAFW.YALLHVLA
RBOHC_SOLTU/408-565------------------------------------------------------.N----FHKVIAVAIAL.GVAIHGLA
Q5FQ04_GLUOX/56-169------------------------------------------------------LR----YRRLTGLLAFF.YASLHLLA
Q5E5I2_VIBF1/37-166------------------------------------------------------G.----LHKKLGISAFI.ALLLHWLV
Q82R51_STRAW/62-185------------------------------------------------------R.----QHKRYAVWSIL.LLTPHLLL
Q2H7Y7_CHAGB/153-271------------------------------------------------------W.----LHRWVGRTMFV.TASVHGWH
A7TPB1_VANPO/264-381------------------------------------------------------Y.----YHKWCAYVCAS.YAFIHAII
Q6C0I9_YARLI/142-260------------------------------------------------------L.----YHRWTARVLFL.CVILHLAH
Q7SFF5_NEUCR/239-364------------------------------------------------------I.----FHRRVGEMMCF.MALVHFVS
Q2H477_CHAGB/186-307------------------------------------------------------L.----LHRWMGRISII.EVIIHFIA
DUOX2_PIG/1081-1230------------------------------------------------------.D----FHRWIAMAALV.LAILHSVG
Q6N633_RHOPA/45-180------------------------------------------------------R.----LHRWLGISALG.FALVHWLL
Q28MM2_JANSC/56-182------------------------------------------------------LY----NRRHFGVLTAA.VAWTHATY
Q9L1A8_STRCO/50-176------------------------------------------------------R.----WHAMTGRYTLC.LVLAHVFL
Q0ACJ0_ALKEH/56-177------------------------------------------------------R.----FHQLMGHTVLV.LLLIHPYL
Q21DI1_SACD2/35-149------------------------------------------------------IK----LRRPLGLWCFT.WVSLHFAA
Q82L18_STRAW/83-206------------------------------------------------------S.----WHRWTGFGILW.TLLAHAVF
A0A0D1E108_USTMA/139-260------------------------------------------------------I.----FHQWLARFMLF.LATVHAIP
Q0BQQ1_GRABC/59-172------------------------------------------------------LI----VRRMIGVGTAC.YALLHLAL
AIM14_VANPO/88-208------------------------------------------------------P.----IHKWLSRFITF.IAILHSIL
Q6CUH0_KLULA/305-422------------------------------------------------------T.----YHKWIGRFMFW.DSMIHSIG
A1WD64_ACISJ/52-181------------------------------------------------------R.----LHKWAGIGAAL.TAILHWGA
Q6FMR3_CANGA/107-225------------------------------------------------------P.----FHKWLSRLIVI.FGLLHGVF
Q7PNG0_ANOGA/297-444------------------------------------------------------.Y----LHKLTGVLVAI.FSLVHTIM
AIM14_ASHGO/94-211------------------------------------------------------P.----MHMWLSRAIST.FGVFHGLA
Q4D1K3_TRYCC/390-520------------------------------------------------------IW----VHKVLGYGMLL.ATVGHMVA
A1C8X0_ASPCL/194-313------------------------------------------------------I.----YHRWVARGCFL.MATLHFAL
NOXB_DICDI/225-375------------------------------------------------------.N----FHKLCAFMLFC.CTIIHCVG
Q47CF6_DECAR/42-170------------------------------------------------------R.----LHKDIGIGAGI.LVFTHWMM
Q6C208_YARLI/250-367------------------------------------------------------C.----FHRAVARVTYL.QIIVHASC
Q0RT78_FRAAA/120-243------------------------------------------------------S.----WHRGLGTNIVL.LIGGHVLL
FRE4_YEAST/273-390------------------------------------------------------V.----FHKWLGRMMFL.DAIIHAAG
Q47Y20_COLP3/48-162------------------------------------------------------LQ----IRRLLGIYTFS.YALMHLFN
A7TIJ6_VANPO/133-250------------------------------------------------------P.----LHKWISRILIF.QATLHSAL
Q0V134_PHANO/180-301------------------------------------------------------L.----FHRWAARITIA.EAVAHTVA
Q2IMP5_ANADE/49-169------------------------------------------------------A.----FHRHVTAVALV.FVAAHPLV
Q74Z78_ASHGO/248-365------------------------------------------------------A.----FHKNMGNILIL.LALTHFVG
A2I2U7_CHLRE/303-425------------------------------------------------------K.----YHRWLGHGTML.INSIHGIV
Q0RIS3_FRAAA/13-136------------------------------------------------------AA----VHRSAGLLAVV.FVTLHVVT
Q7MCQ7_VIBVY/47-184------------------------------------------------------R.----IHKWLGIAGLS.LGVFHWFT
Q6C2K8_YARLI/288-405------------------------------------------------------V.----FHRWIARMCVL.HSLIHTIA
YEDZ_PSEAE/42-156------------------------------------------------------IA----VRRQLGLWCFT.YVLLHLSA
A6LZ17_CLOB8/40-156------------------------------------------------------I.----YHKYLSICALA.LAVIHNIT
Q8YTT0_NOSS1/52-169------------------------------------------------------Q.----FHRYTSIVAFL.FLLAHPII
A5DUC1_LODEL/275-390------------------------------------------------------M.----YHRHTSRIMFM.LIVIHAVC
Q6CET8_YARLI/281-396------------------------------------------------------V.----YHRWIGRGMVA.LAISHGVT
Q7NFG8_GLOVI/60-173------------------------------------------------------LQ----ERRYLGLLTFA.FSVLHTWS
FRE8_ASHGO/108-221------------------------------------------------------P.----MHKWLGRVVVL.QATVHSAL
F2G9K0_ALTMD/54-168------------------------------------------------------IQ----FRRMIGVYAFV.YAFAHLFT
A3LSQ8_PICST/127-243------------------------------------------------------F.----LHLWLGRIMWT.MITIHFIM
Q2HEL2_CHAGB/276-393------------------------------------------------------L.----LHRWVARLFAL.QVLLHSIV
Q5Z0I9_NOCFA/44-161------------------------------------------------------Q.----FHRQISAVALA.FVLAHPVL
AIM14_PICST/105-222------------------------------------------------------..----LHKWISRLIFA.TAIGHGLG
Q01ZZ5_SOLUE/82-210------------------------------------------------------..----IHNWTAYVVLV.LILVHPTL
Q2K9I9_RHIEC/52-165------------------------------------------------------LR----YRRALGLLTFH.YALMHFTV
Q5B3H4_EMENI/159-280------------------------------------------------------L.----IHRWLARIVVC.EALAHTFA
A4VRF2_PSEU5/43-178------------------------------------------------------R.----LHKWLGISALV.IAIFHWGW
NOXC_DICDI/622-766------------------------------------------------------.T----FHKLIGYTLII.ASFLHTIG
A0K1X7_ARTS2/75-198------------------------------------------------------E.----FHRKLGKPSLY.LLLGHGIL
A1CUM1_ASPCL/175-298------------------------------------------------------NF----LHRWLGYVIYA.QSVLHTLG
FRP2_SCHPO/114-229------------------------------------------------------Y.----LHRWLSVYAVL.ISVLHGIL
A5WDA3_PSYWF/39-154------------------------------------------------------E.----AHKWIAIWALV.FAVYHFLF
Q2TYZ6_ASPOR/86-204------------------------------------------------------V.----FHRHLSRLTAI.FAFVHAIS
NOX3_MOUSE/55-218------------------------------------------------------.N----FHKLVAYGIAV.NSVIHIVA
Q6FWS3_CANGA/299-416------------------------------------------------------A.----FHKWLGRFMTL.DAILHSVF
Q5KHL8_CRYNJ/202-314------------------------------------------------------Y.----IHRASSRVCLL.SSWGHAIL
Q2FKR9_METHJ/56-171------------------------------------------------------IR----IHHYFAISGLI.LITIHPVL
Q2GQU2_CHAGB/155-272------------------------------------------------------R.----WHRVMARVTAA.LLSLHAGL
A1CRA6_ASPCL/41-187------------------------------------------------------TS----FHRLFGRLVISPLLLAHAAL
A6LWS3_CLOB8/66-186------------------------------------------------------RS----IRAELAIIGAI.MLLPHGIV
Q15YY0_PSEA6/59-182------------------------------------------------------R.----VHNKAGEYLAI.LFFLHPFL
Q604N8_METCA/48-163------------------------------------------------------IH----LRRTTALLAFF.YACLHVSS
Q9EX48_STRCO/90-224------------------------------------------------------..----LHRTTSLTTMA.LMSAHALM
Q28KV6_JANSC/39-153------------------------------------------------------Q.----VHRVAGVFTAL.FALTH..F
Q5AHQ5_CANAL/95-212------------------------------------------------------N.----LHKWTSRIIVF.CSAIHATG
A0A0D1E0K7_USTMA/233-360------------------------------------------------------F.----LHKWGGRIIWL.FGTAHLVT
Q59WI9_CANAL/253-370------------------------------------------------------L.----FHRWQARVVFI.MILIHVSA
Q6CEA2_YARLI/129-243------------------------------------------------------P.----VHKWLSRIVVL.TTVLHSIF
FRO4_ARATH/156-277------------------------------------------------------K.----YHIWLGHVSNF.CFLVHTVV
AIM14_KLULA/97-214------------------------------------------------------P.----LHKWLSRFVTV.IGIIHGIG
Q0UZN5_PHANO/147-266------------------------------------------------------V.----FHRWISYAFFI.LALLHTFP
YEDZ_DEIRA/47-161------------------------------------------------------AR----IRKALGLLAAF.YAVLHFGI
A5E743_LODEL/134-251------------------------------------------------------F.----LHVWFSFMMFV.VVTFHVGV
A1AY37_PARDP/49-162------------------------------------------------------MR----FRQALGLICFA.YVACHLVA
YEDZ_PASMU/44-158------------------------------------------------------QV----LRRALGLWAWF.YVVLHVYA
A5E459_LODEL/280-397------------------------------------------------------Y.----FHKWMSRIVFI.VSIIHAVG
AIM14_YARLI/82-195------------------------------------------------------P.----LHKWLGRLATL.VGVVHGVL
A5GKL0_SYNPW/57-207------------------------------------------------------LF----NRRHMGVLAFL.LALFHVHG
Q7S590_NEUCR/128-246------------------------------------------------------R.----WHRVLARCTAF.LLSLHTIF
Q5P447_AROAE/42-170------------------------------------------------------R.----LHKWAGILAAG.FASLHWLL
Q4PEM4_USTMA/167-285------------------------------------------------------L.----YHRWISRWFWI.HIFIHTLA
A5E3X1_LODEL/124-240------------------------------------------------------F.----LHKWLSRLMWL.FISVHLSL
Q5KPP3_CRYNJ/174-292------------------------------------------------------F.----LHRWTGRTLFL.SATVHGAM
Y1462_ARCFU/1-125------------------------------------------------------VK----AHRLFGYISVG.FLLFHPLL
NOXA_DICDI/58-201------------------------------------------------------.V----FHKLIAWVICF.ATFGHVMA
A7RPH5_NEMVE/44-191------------------------------------------------------.W----FHKACAITTII.AAVVHTVA
A6VQE1_ACTSZ/43-157------------------------------------------------------AI----LHRPLGSWAIF.YALLHLLS
A7ENT9_SCLS1/179-300------------------------------------------------------L.----LHRWTGRIVTL.QVIAHVAA
Q6C3A4_YARLI/310-427------------------------------------------------------T.----YHRAIAWVTFS.HMVFHSIA
Q6CPC7_KLULA/282-399------------------------------------------------------A.----YHKAVARATVL.VVCVHAIG
Q75D69_ASHGO/278-397------------------------------------------------------T.----YHKAIARTAIA.STLVHTIS
Q6CN86_KLULA/282-397------------------------------------------------------V.----YHKWIARGMWV.HALIHSAC
Q6CLT2_KLULA/243-363------------------------------------------------------F.----YHKWAARLMTI.FGFTHGML
Q6CET4_YARLI/273-389------------------------------------------------------I.----YHRYSSRVMVV.YAIIHSIC
FRE1_YEAST/258-375------------------------------------------------------F.----YHKWSAYVCFM.LAVVHSIV
E4X2P3_OIKDI/55-207------------------------------------------------------Y.----AHKRLSYAIII.WSIAHIGA
E7M0W3_YEASV/274-390------------------------------------------------------T.----YHKWLGRFMLV.DCTIHAIG
E7QHM4_YEASZ/202-316------------------------------------------------------S.----FHKWIGRIMVL.NATIHSLS
F6WE71_XENTR/248-394------------------------------------------------------ML----CRKQLGLVALA.YAFLHAIY
F6YS00_CIOIN/57-202------------------------------------------------------S.----FHILCGYILCL.LAGVHCAA
F7BAU5_XENTR/57-219------------------------------------------------------T.----FHKMVAWMIAL.HTAIHTGA
H0VSY4_CAVPO/49-211------------------------------------------------------T.----FHKLVAYAICI.FTAIHIIA
Q4WB75_ASPFU/288-403------------------------------------------------------L.----LHRWLAFICTL.QACLHSAI
Q4WCY1_ASPFU/137-255------------------------------------------------------W.----FHRWISRTLWL.TATIHMGF
Q4WGG6_ASPFU/187-306------------------------------------------------------L.----LHRWLGRIAAI.ESIIHMAA
Q5KEC9_CRYNJ/209-325------------------------------------------------------I.----WHKVSGRLMFA.ATVWHVVA
Q5KEL3_CRYNJ/176-290------------------------------------------------------I.----FHRWIAIVTAF.QGIAHSAA
Q5KJ95_CRYNJ/122-251------------------------------------------------------I.----WHQYGARVLLF.FSVIHTFI
YEDZ_XANCP/53-167------------------------------------------------------IR----FRRMLGLYAFF.YASVHLTA
Q8XLV2_CLOPE/68-182------------------------------------------------------LR----VRAEMAILASI.LILPHFII
YEDZ_YERPE/48-161------------------------------------------------------LR----CRRLLGLWCFA.WGTLHLLS
Q9I5Z1_PSEAE/40-165------------------------------------------------------R.----LHKWAGILAIV.LGLLHYLL

PF10348

Q4WLQ1_ASPFU/53-156------------------------------------------------------AR----.SRFALPSQFVFLVCNA---
A5DCA9_PICGU/65-169------------------------------------------------------VK----.SSWYLAGLTVNSVVMV---
A5DLL3_PICGU/70-174------------------------------------------------------VQ----.SMWYLAGLTLNSAMVV---
Q7S4U9_NEUCR/54-157------------------------------------------------------AR----.SRYRLLAQFAFLVTNA---
A3LQA2_PICST/42-147------------------------------------------------------LN----MTSWYLSTLVVHTTLVL---
Q5KLR8_CRYNJ/22-123------------------------------------------------------SK----.SKYHVPLQSVNTVLSF---
YBH6_SCHPO/15-118------------------------------------------------------AK----.SKAHIPVQIVYVILTL---
A7ENZ5_SCLS1/29-130------------------------------------------------------GD----.RKWHVPVQILGTVIAV---
Q6CTZ5_KLULA/79-184------------------------------------------------------ID----.SGWYLPLLSIYDMVLL---
Q5KDX6_CRYNJ/161-262------------------------------------------------------AD----.HPAHYLASIASLTIAV---
Q7S0V3_NEUCR/59-161------------------------------------------------------VK----.SRWHVPLQVLATALAL---
A0A0D1CF67_USTMA/25-126------------------------------------------------------VR----.HRLHVPVAITSLALTV---
A5DTJ1_LODEL/90-195------------------------------------------------------LS----MTKTYMAALVIHTGFIL---
A1C9V0_ASPCL/31-132------------------------------------------------------VR----.SRWHVPLQIVGTIIAV---
A6RFH8_AJECN/26-127------------------------------------------------------TR----.SRWHVPVQIVGSVIAF---
Q6C1B0_YARLI/25-127------------------------------------------------------AR----.HRYFIPMQIVAAATAV---
A7F0D8_SCLS1/59-162------------------------------------------------------AR----.SRLSLPTQFVFLASNG---
Q6C5B1_YARLI/116-222------------------------------------------------------AK----.SGLYLPVQTAQVVMVA---
A7TT31_VANPO/83-190------------------------------------------------------IS----.SGWYIPVLTLHFITIL---
Q2GXA8_CHAGB/1-103------------------------------------------------------IK----.SRWHVPLQIFSTALAL---
Q2HHA0_CHAGB/52-155------------------------------------------------------AR----.SRYTLLVQFAFLAINA---
Q5AP55_CANAL/89-194------------------------------------------------------LN----MGKSYMTMLLIHSSCIV---
Q5B6W6_EMENI/54-157------------------------------------------------------AR----.SRMALLSQFIFLVVNA---
Q6FMC4_CANGA/68-173------------------------------------------------------VA----.SSWYLAALTANLALTV---
Q75EM7_ASHGO/67-172------------------------------------------------------SE----.SRWYLVCLAAHCLVLW---
E7KKX9_YEASL/58-161------------------------------------------------------AR----.SRWYLPLLFVNLCICI---
G4MKH1_MAGO7/63-163------------------------------------------------------VK----.SRWHVPVQTIASAIAI---

PF01578

HEMX_BACSU/66-273................EQQSAAFSGQL---------------------------VS----ELLVIHITMAILSYGAFSLS
CCMC_PARDP/3-182...................PEDYKQGA---------------------------TV----KIIFLHVPAALMAINIWLMM
Q8EK42_SHEON/5-184...................PTDYQQGD---------------------------SY----RIIFIHVPAASMSMAAYMGM
CCSA_CYACA/70-293...........ILPPSLRQTSILAPAL---------------------------RS----NWLMMHVSVMIFSYGLLIMG
CCMC_MARPO/2-175...................PSDFQQGE---------------------------NY----RIIYVHVPAAWMSLLIYIAM
CCSA_ODOSI/69-306...........TLSVDMQKSSPLVPAL---------------------------QS----NWLMLHVSMMMLSYGTLIMG
Q9KUG2_VIBCH/37-266.PVAYSFSAINLSAATFLPGTFITHLE---------------------------SD----PKLLLHISLALFSYSTLSIG
Q9K176_NEIMB/36-266.LLLYPCAALMLLSGLVFPGKFSGYEI---------------------------TD----LPFMLHIGTSLLAYGLFGIA
NRFE_HAEIN/89-298......NPFGR.IFPAPAEGRDLNPML---------------------------QD----VGLIFHPPLLYVGYVGFAVN
CCSA_CHLVU/70-308...........SLPTELQQSTPLVPAL---------------------------QS----NWLVMHVTVMIASYAALLLG
Q9CLN5_PASMU/37-267LPIIYSFAIINLVLSTLMPAHFLYHLN---------------------------QD----MGLFIHVGLSLLTYSVCSIV
CCSA_MAIZE/68-311...........GLLTEMHQSTILVPAL---------------------------QS----QWLMMHVSMMLLSYATLLCG
CCMF_PSEFL/94-304......NPFSRMLPQIPADGHDLNPLL---------------------------QD----IGLIVHPPMLYMGYVGFSVA
O66467_AQUAE/59-250...................IPSKELGF---------------------------SN----PLYALHITSAGFSYAFLIFA
O67831_AQUAE/103-307..............KANPEITPLMPAL---------------------------RS----YWLYLHVVTAFTGYAGFTVA
O25141_HELPY/695-896..........AHLGFMDPQIGHLVPVL---------------------------KS----YWLNIHVSVITASYSFLGLC
CCSA_PORPU/68-313...........ALPIEMQKASPLVPAL---------------------------KS----NWLMMHVSIMMISYSILILG
O21278_RECAM/20-197...................DTDVQQGE---------------------------SY----RIIYIHVPSAWICLFIYILL
CCMC_ARATH/2-175...................PLDFQQGG---------------------------NS----RILYVHVPVAWMSIIVYIAT
CCMF_RHOCB/89-298......NPFLR.LEEAPFNGRDMNPLL---------------------------QD----PGLAFHPPFLYLGYVGLSMA
CCBS_MARPO/102-404......NPFVRISFVCTKSLAELNPVL---------------------------QD----PILAIHPPCIYAGYVASAIG
NRFE_ECOLI/72-281......DPFVR.IFPPAIEGRDLNPML---------------------------QH----PGLIFHPPLLYLGYGGLMVA
CCMF_ECOLI/89-299......NPFSRTLPNFPIEGRDLNPLL---------------------------QD----PGLIFHPPLLYMGYVGFSVA
CCSA_GUITH/70-295...........SLPQDMQKAAPLVPAL---------------------------KS----NWLMMHVSVMMLSYSTLIIG
CCSA_CYAPA/67-316...........ILPQEMREISPLVPAL---------------------------KS----NWLMMHVSVMMISYATLMIG
CCMC_HAEIN/5-184...................PADYQQGN---------------------------SF----RIMYVHAPTAIWSMGVYGSM
CCMC_ECOLI/5-184...................PADYQQGN---------------------------SY----RIIYLHVPAAIWSMGIYASM
O21277_RECAM/89-298......NPFLQ.IIDRFLDGKQLNPIL---------------------------QD----IVLSIHPPLVYLGYLGFSIP
O28299_ARCFU/5-170..........................E---------------------------NY----RIIFFHVPAAVTSFVAFAVT
O28091_ARCFU/80-267......NPFTV.LPYTPPDGAGLNPLL---------------------------RT----VEMILHPPVVFLAYSLAALL
CCMC_BRADU/3-181...................PDDYQQGA---------------------------TV----KIMFIHVPNAWLSMFVWGVM
CCMF_BRADU/89-298......NPFLR.IANPPIEGRDLNPVL---------------------------QD----IGLAVHPPMLYLGYVGFSIS
Q9P9P5_XYLFA/33-261..GVVVFPLAGLLLAVYHGYGHSPSPE---------------------------LG----WRVELHACLALLGYATLGIA
CCSA_GALSU/74-300...........FLPKYMQEVSPLIPAL---------------------------KS----NWLLMHVSVILISYAMLLIG
Q9X619_SALTM/58-288.PIVYAFALINLPLATFMPNEYITHLE---------------------------AT----PGMMVHIGLSLFSYATLIIA
C3VYY3_PINTH/67-313...........GLPEEMQRSGMLVPAL---------------------------QS----HWSMMHVSMILFSYATLLCG
CCSA_CHLRE/138-347...........SLPKEMQQASPLVPAL---------------------------QS----NWLMMHVTVMIISYATLIIG
CCSA_SYNY3/67-328...........TLPVDMQQSAPLVPAL---------------------------KS----NWLMMHVSVMMVSYATLMVG
Q9HXP7_PSEAE/35-264.LLLFPLGALTTLLAVLIPHGTVEPIN---------------------------EQ----PGILAHILLSILAYGLLTIA

PF02628

CTAA_BACPE/6-286........................I-----------------------------ET....IIEYSHRI----VSGLVGAM
ETP1_SCHPO/99-458ELYKKSPEFEKLN..SHMTVDEFKN-----------------------------IF....FWEWFHRV----LGRGIGLT
CTAA_PARDP/37-362DKYRQIPQFELVN..SDMDLASFKR-----------------------------IY....WWEWSHRL----LGRLVGLV
CTAA_SPHWW/18-335ENYKRIPQYAAFN..LHMTLEGFKA-----------------------------IY....FWEYMHRL----LARGIGAV
CTAA1_ACICJ/13-334GLYKATAQYQAMQ..PKMTLAQFQS-----------------------------LY....LPMFLDRD----WGRLMAVV
CTAA2_ACICJ/30-356ALYKTIPQYKELN..RGMDLAGFKA-----------------------------IF....WPEWIHRM----WGRLLGFD
CTAA_GRABC/35-352ALYQKIPQYALVN..HGFGLDGFKH-----------------------------IF....WLEWTHRL----WGRLIGLV
Q6FQE7_CANGA/106-462AKYRESPEFMELN..SHINLDEFKF-----------------------------IF....FMEWFHRL----WGRAIGVI
A1CT55_ASPCL/107-465AKYRASPEFQLLN..PNMNLSEFKS-----------------------------IY....YMEWIHRL----WGRFIGLS
Q5K7Z7_CRYNJ/87-433EKYKVSPEGIIMN..ANISRDEFKK-----------------------------IF....YMEWGHRL----AGRALGIG
A4SB75_OSTLU/15-353EKYKQSPEYKKSN..LGMTVEEYKF-----------------------------IY....WMEYGHRM----WGRVLGLY
Q292P6_DROPS/49-381SKYQQYPEYKLQVKNASMTVEEFKF-----------------------------IY....LMEYIHRM----WGRAIGGF
Q382Y6_TRYB2/45-379AKYQNFPEFKQR...NTMTLEEFKF-----------------------------IF....FWEWAHRV----LARSVGIV
Q4Q7Z4_LEIMA/67-401RHYQEFPEFKQK...PNMTLREFQF-----------------------------IF....FWEWAHRV----LARGLGLV
Q607I2_METCA/14-312YHEIYAERGY.......ADTRFNPV-----------------------------KT....WTEYVNRL----VGVSIGLL
Q11SZ6_CYTH3/10-312YKEKYAVQGH........PAVFNVY-----------------------------KT....WTEYVNRL----VGAIAGLI
Q0ABY2_ALKEH/7-324LAFPERP..............VEVA-----------------------------KG....WWEMAHRY----VAGLLGLM
Q5P2E4_AROAE/16-326AADPHGP..............VSLP-----------------------------KA....WKEMIHRY----LAASLGLL
Q3SLW6_THIDA/5-318AAQPDGP..............VTHL-----------------------------KA....WKEMVHRY----FAGTLGML
Q3J6R5_NITOC/6-323RLYPDRP..............VETA-----------------------------KA....WKEMIHRY----LAGILGLL
Q88RM0_PSEPK/6-317LHFPEHP..............VEAA-----------------------------KG....WAEMVHRY----FAGSLAVV
Q2SQU9_HAHCH/23-348ARFPHAP..............VEVH-----------------------------KG....WPEMVHRY----FASALGLL
Q0VN95_ALCBS/14-332ETTPGTL..............REAH-----------------------------KT....VPEMVHRY----FASTLGLV
Q7MDC7_VIBVY/12-325DNFPGML..............VEPN-----------------------------KA....WLEMIHRY----FAGSLGIL
A3Q942_SHELP/4-317DSFPEHT..............VEPE-----------------------------KA....WLEMIHRY----IAGTLGLL
Q48AB6_COLP3/12-337QAFPERP..............VEPA-----------------------------KA....WNEMIHRY----FAGSLGLL
Q15N00_PSEA6/2-315LAFPERP..............LEPQ-----------------------------KA....WNEMIHRY----FASALGLL
A1SY56_PSYIN/14-353HSQPGTMD...........LVFESA-----------------------------KA....WKEMIHRY----FAGTLGLM
Q3IJP9_PSEHT/6-319QSYPDMM..............FETA-----------------------------KA....WKEMIHRY----FAGTLGLL
Q12E38_POLSJ/44-358SAMPTGP..............VTHT-----------------------------KA....WIEMIHRY----LATGVGVL
A2SKN8_METPP/44-363SVLPTGP..............VTHG-----------------------------KA....WVEMVHRY----LATAVGVL
A4T080_POLSQ/35-356HALPDGP..............VTVI-----------------------------KA....WIEMIHRY----LAMTVGTL
Q8Y2G5_RALSO/30-341AAMPSGP..............VTWM-----------------------------KA....WIEMTHRY----FALALGVL
Q2KTW9_BORA1/9-320SDMPFGP..............VTLS-----------------------------KA....WIEMIHRY----VGGLLGLL
Q60CH3_METCA/12-323AAVG....................G-----------------------------KALKWLWLGWVHRY----LGGAFGIL
CTAA_FLAJ1/9-333DEYKKFPEYQKINIHNDFQLSDYKF-----------------------------IY....FWEWFHRF----IGRIIGLV
CTAA_ORITB/10-346NKYTASPEFKLIN..NQITISEFKY-----------------------------IF....FIEYIHRL----LGRITGII
CTAA_RICPR/7-325AKYKAFPEYQSVN..YDITLSQFKF-----------------------------IY....LLEFIHRL----LGRITTLI
CTAA_ANAPZ/7-319EKYAKTPEYLYIN..SGISLSDFKR-----------------------------IY....MTEYVHRL----LGRILGII
CTAA_NEOSM/4-317DKYKNTPEYKVRH..FSISYAEFQF-----------------------------IY....LVEYFHRL----VGRILGLV
CTAA_BRADU/15-335EAYKKIPQYRELN..AGMSLSEFKE-----------------------------IF....WWEWSHRL----LGRFIGVA
CTAA_METS4/27-349AKYRATPQYDILN..RGMSLAEFQV-----------------------------IY....AWEWGHRF----LGRLIGLC
CTAA_RHIEC/27-347RLYQRIPEFQQLN..SSMTVDEFKS-----------------------------IF....WWEWAHRL----IARGIGVI
CTAA_PARL1/21-336DLYRQIPQYQLVN..KGMSLDEFKT-----------------------------IY....WWEWSHRF----LGRLIGLA
CTAA_JANSC/36-361EAYRATTEYQEQN..RGMSLAEFKV-----------------------------IY....WWEWGHRQ----WARFLGVV
CTAA_HYPNA/15-332EKYRATTQYQLTN..AGMALSEFQF-----------------------------IY....WWEWGHRQ----IGRLIGLV
CTAA_MARMM/13-331ALYQQTTEFQVQN..SAMTLDEFEF-----------------------------IF....WWEWGHRQ----LGRLIGLV
CTAA_CAUCR/14-334ELYKQIPQFQLVN..PDMTLEGYKE-----------------------------IF....WWEWAHRL----LGRTVGAV
CTAA_NOVAD/17-340DAYRQTPQFQLVNGPAGMTLATYKF-----------------------------IF....FWEWVHRL----LARTIGLV
CTAA_SPHAL/22-339EKYKQIPEYKEIN..LGMTLAGFKA-----------------------------IF....FWEWLHRI----LGRVVGMA
CTAA_BARHE/23-344LKYQQIAQYKMLN..RDMTLSAFKV-----------------------------IF....WWEWAHRV----LGRLVGLV
A0CRQ7_PARTE/61-392DYYKQFPEYQHT....PIDLEKFKK-----------------------------IF....IVEYLHRV----SGSTLGAL
CTAA_MAGSA/22-344EKYKQTPEYIKVN..AGMSLAEFKG-----------------------------IF....WLEYIHRV----WGRLIGVV
A9WIE2_CHLAA/11-294........................T-----------------------------AQ....LIEFSHRV----TSGIALLL
CTAA_LYSSC/8-290........................P-----------------------------EV....LIEFSHRL----VTGVVSIS
B7VQY7_VIBTL/4-312LQFPERA..............LEAD-----------------------------KA....WIEMIHRY----FAGTLGLL
CTAA_ANAMF/9-318EKYAQTPEYRHRA..ADISLDDFKR-----------------------------IY....IIEYIHRL----FGRALGAV
F1R355_DANRE/60-387AKYQQFPEFKIMN..HDMTLTEFKF-----------------------------IF....YMEWGHRM----WGRLVGLA
I0HWX8_RUBGI/43-349QALPSGP..............VTWS-----------------------------KA....WVEMIHRY----LAMTVSAL
CTAA_BRUA2/27-346EKYQQIPQYQQIN..KGMSLAEFQY-----------------------------IF....WWEWAHRL----LARFVGFL
CTAA_PELUB/14-326TEYKKIPEYKNIN..YGMSLDEFKV-----------------------------IF....YWEYAHRL----LARFVGLF
COXX_THET8/12-294........................V-----------------------------ET....LIEFTHRA----TSGLAFLS
Q5ZYG1_LEGPH/18-327SQYPDLP..............IESK-----------------------------KA....WTEMAHRY----AAGTLALL
Q6Z5C5_ORYSJ/128-457EKYKLSPEYKRVN..KGMSLGDFKF-----------------------------IY....WMEYGHRM----WGRALGFL
CTAA_WOLPM/16-328LKYEATPEYKALN..YGISMEEFRA-----------------------------IY....LIEYVHRL----VARLTGLV
CTAA_LISMO/7-287........................P-----------------------------EK....LIEFMHRM----TTGISSIF
Q9I720_PSEAE/12-320LHFPDAP..............VEAQ-----------------------------KG....WNEMIHRY----FAGALGLL

PF00033

CYB6_SPIOL/21-210------------------------------------------------------------WVTGVVLGVLTASFGVTGYS
CYB_ASCSU/10-196------------------------------------------------------------WVSGIVILLLVMMEAFMGYV
CYB_MARPO/20-208------------------------------------------------------------WCLGVVILLLMIVTAFIGYV
CYB_TRYBB/9-197------------------------------------------------------------WFIGFILFVFIIIIAFIGYV
CYB6_MARPO/21-210------------------------------------------------------------WVTGVILAVLTVSFGVTGYS
CYB6_EUGGR/21-210------------------------------------------------------------WVTGIILAILTVSFGVTGYS
CYB_STELO/18-204------------------------------------------------------------WNIGVLLLLTVMATAFVGYV
CYB_HETFR/19-205------------------------------------------------------------WNIGVILLFLLMATAFVGYV

PF13631

D5SPP4_PLAL2/91-258------------------------------------------------------------FWATIAGGLCILGLSHTGYQ
D7WEJ9_9CORY/110-284------------------------------------------------------------WIIGVVLILLGMIEGFLGYS
C7M191_ACIFD/113-287------------------------------------------------------------WTIGLTLLVLSIINGFIGYS
A0LTH4_ACIC1/129-303------------------------------------------------------------WLIGFTLMTLALLEGFAGYS
Q2JA36_FRASC/139-313------------------------------------------------------------WLIGVSLLLLAIAEGFAGYS
E3JBI3_FRASU/129-303------------------------------------------------------------WLIGVGLLVLGTLEGFAGYS
C8XCX9_NAKMY/122-296------------------------------------------------------------WIIGVLLLILGMAEGFLGYS
D1A8W4_THECD/118-295------------------------------------------------------------WLIGLGLFTLGMVEGMFGYS
C7MZ05_SACVD/123-298------------------------------------------------------------WVIGALLLILGMFEGFFGYS
QCRB_CORDI/110-284------------------------------------------------------------WIIGCVLLFLGMAEGFMGYS
B1MBC7_MYCA9/109-283------------------------------------------------------------WVIGSVLLILAMAEGFTGYS
C6W9G5_ACTMD/123-297------------------------------------------------------------WVIGILLFMLGAIEGFLGYS
D1A3M6_THECD/119-294------------------------------------------------------------WVIGVTLLLLVMLNGLFGYS
Q9K4I9_STRCO/122-296------------------------------------------------------------WLIGLTLFVLALAEGFAGYS
D0LAX2_GORB4/112-287------------------------------------------------------------WIIGCFLLILAMFEGFFGYS
Q01PC6_SOLUE/95-279------------------------------------------------------------WILGVFLLLVTLAMGFTGQV
Q9RX79_DEIRA/103-278------------------------------------------------------------WWIGLLLLIFSALTAVTGYI
A0LFE3_SYNFM/95-264------------------------------------------------------------WISGVLIMLVVPLFIITGDL
A4YE24_METS5/89-278------------------------------------------------------------WILGVLMLVLTLGASFLGYS
Q9HIU9_THEAC/81-267------------------------------------------------------------FLSGILLLLLTLGVGYFGYS
A4YDG6_METS5/94-292------------------------------------------------------------WVTGVLLLALTMGASFFGYS
D2PP93_KRIFD/114-286------------------------------------------------------------WLVVFGLLVVTLGAGLTGTS
D4H0P8_DENA2/82-245------------------------------------------------------------WKLGYIIFFVIVFEAYTGYL
Q9HIV5_THEAC/107-280------------------------------------------------------------WILGVVLFILVYTTAIVGYM
Q6KZY3_PICTO/98-271------------------------------------------------------------WMLGVIMFLLVILTAILGYM
B3LEZ9_DROMO/89-254------------------------------------------------------------WMIGVIILFLVMGTAFMGYV
F4B633_ACIHW/89-277------------------------------------------------------------WILGVFLLVLTMGASFFGYS
QCRB_MYCTU/120-294------------------------------------------------------------WVIGSLLLILAMFEGYFGYS
Q4JWC3_CORJK/115-288------------------------------------------------------------WVIGCVLLLLSVAEGFMGYS
Q8HC78_ORYLA/88-253------------------------------------------------------------WNVGVILLLLVMMTAFVGYV
Q97V30_SULSO/93-279------------------------------------------------------------WIIGVIMLILTLGTAFLGYS
Q97VH0_SULSO/90-287------------------------------------------------------------WITGVILLLLTLGASFFGYS
V9XG29_9NOCA/115-289------------------------------------------------------------WVIGSLLLILAMFEGFFGYS

PF01292

C1DIE6_AZOVD/9-186VYLFVRFV......----------------------------------------------------.........KYNLP
B2UEV9_RALPJ/18-207.LVYLVMNVA....----------------------------------------------------......SGRLARKF
F2G749_ALTMD/13-185.LLRLAWGTLQQQK----------------------------------------------------A.LNKSGEIPYASF
B2JU39_BURP8/35-202.LYRFWAR......----------------------------------------------------..............
A8LH36_FRASN/20-219.LARVGWHIRSPN.----------------------------------------------------...PWSRWTEWIPS
Q24SV4_DESHY/15-201.GMKFFIGDTKHH.----------------------------------------------------....WGWIRSVFTW
B0SVS8_CAUSK/3-181.LLRVVMA......----------------------------------------------------..............
Q3KA02_PSEPF/7-177.IVRILVR......----------------------------------------------------..............
A7IEJ2_XANP2/17-189.AVRIPVR......----------------------------------------------------..............
Q5P430_AROAE/8-169.AFRVVWGFV....----------------------------------------------------.......GSPHARF
Q8KEB1_CHLTE/10-218.LFRMYYALMARDD----------------------------------------------------..QYARFGGFQPWK
A3Y9W1_9GAMM/26-199.MMRLIKR......----------------------------------------------------..............
A0RPH5_CAMFF/12-218.IFKVYLFFFDR..----------------------------------------------------....QSKIERVSVK
Q2W2V7_MAGSA/500-649GAFLGLTA......----------------------------------------------------..............
E2XB98_SHIDY/13-220.LMRIYWAFVGNR.----------------------------------------------------...YSRELFIVPVW
Q73XF0_MYCPA/5-235.YYVLLFAT.....----------------------------------------------------.......GQWHRYW
Q3K9Y1_PSEPF/9-180.WFRLFAR......----------------------------------------------------..............
J2ZFR0_SHISO/68-257LGFVLINAVGDN..----------------------------------------------------.....GHHYRIRRQ
Q11M26_CHESB/8-183.LLRLAWA......----------------------------------------------------..............
A8EUR4_ARCB4/14-229ILIGYLYLFSKF..----------------------------------------------------....DKPYKKVLPT
Q0AAZ8_ALKEH/9-216GLFMLLRWRSVVLP----------------------------------------------------FLRNVLVLTPGALW
A3UXK6_VIBSP/7-177.VLRLLWK......----------------------------------------------------..............
Q726G3_DESVH/8-195.AFIVFWMAT....----------------------------------------------------......TGEWKHYV
Q0P8A9_CAMJE/92-274IPMFLCWI......----------------------------------------------------..........KRML
Q6MN52_BDEBA/9-210.IVRLLVG......----------------------------------------------------.........IFAVK
A1VMH0_POLNA/30-197.VARVLWGLLGPR.----------------------------------------------------....QARLAMLWRK
Q24SH5_DESHY/15-204.FYHIINAFI....----------------------------------------------------.......RKEFDIF
A4EHB9_9RHOB/9-185.VFRLLNR......----------------------------------------------------..............
A1K9P7_AZOSB/5-173.ALRLWWR......----------------------------------------------------..............
O28892_ARCFU/13-211TLFMYFSIAE....----------------------------------------------------......EWKWIKPS
Q3SMF3_THIDA/22-205.AARLLWAL.....----------------------------------------------------........VGPANA
Q0F0S9_9PROT/5-220.LVRIMLALTSLPG----------------------------------------------------..ANWRQLVPWVFA
Q1QXP2_CHRSD/8-174.AMRTLWA......----------------------------------------------------..............
A8H662_SHEPA/17-235.FVRLLWGFI....----------------------------------------------------.......GSGFARL
Q2LQE6_SYNAS/8-184FFSVRMWW......----------------------------------------------------........KEAGIF
Q137Q9_RHOPS/15-183.VLRVLWI......----------------------------------------------------..............
Q0G224_9RHIZ/16-199.VARIIWR......----------------------------------------------------..............
Q21VQ4_RHOFT/20-197.VLRLIWV......----------------------------------------------------..............
A6D834_9VIBR/136-317FAVLFKWW......----------------------------------------------------.........RKSIF
A5FBE0_FLAJ1/8-190.LVRIIYM......----------------------------------------------------..............
Q0FAP7_9RHOB/5-159.IMRYLYM......----------------------------------------------------..............
A3XC59_9RHOB/9-194.LARILWA......----------------------------------------------------..............
A5G519_GEOUR/9-204SLWFFYYKMIAGT.----------------------------------------------------....LLKLYVPNQE
A4BH07_9GAMM/8-165LLYSIGRV......----------------------------------------------------..............
A5FTL2_ACICJ/4-178.VWRLGLR......----------------------------------------------------..............
Q3M4T2_ANAVT/30-199PALALYSF......----------------------------------------------------..............
Q5QZM1_IDILO/10-182.LVRVCWGIF....----------------------------------------------------.......GSENARF
Q2K795_RHIEC/4-158.GMRLVFR......----------------------------------------------------..............
Q2N9I4_ERYLH/7-222LFMWVAML......----------------------------------------------------..............
Q2YJ32_BRUA2/13-182.LLRGVWG......----------------------------------------------------..............
A8GZ50_SHEPA/78-266GLWASNQLVEPR..----------------------------------------------------....RFSTHLPDES
A5WBJ1_PSYWF/9-194.IFRILWR......----------------------------------------------------..............
A5VEG9_SPHWW/24-275.IFYAVYLMASRR.----------------------------------------------------....LGRWVIYPKD
Q3ABV8_CARHZ/7-189.LARVYYAIAT...----------------------------------------------------......KDYQNIWF
Q3JAE2_NITOC/6-172.IFQILLW......----------------------------------------------------..............
A3PG79_RHOS1/6-157.LVRIGAR......----------------------------------------------------..............
Q89C01_BRADU/31-198SAYVAYLA......----------------------------------------------------..............
Q1QIT3_NITHX/121-299ILIFLMWI......----------------------------------------------------............AG
Q1ITC7_KORVE/20-198FWMHHCWA......----------------------------------------------------.........RDLTL
J9ZA39_LEPFM/17-226.LGRLHLLFRGAPV----------------------------------------------------S.RFREIVPEFKGR
Q1ZU49_PHOAS/13-188.LAMISYMLV....----------------------------------------------------......KQSFRQFF
A8G145_SHESH/120-302ILMILMWA......----------------------------------------------------.........PKQIP
Q1Z615_PHOPR/4-173.IVRFVWS......----------------------------------------------------..............
A1RW11_PYRIL/6-212LVYAVNLLLFKK..----------------------------------------------------.....VRIFDAFRK
Q7NUV6_CHRVO/15-181WLLRLLNR......----------------------------------------------------..............
Q5V2I5_HALMA/8-213WITLQLISSTGR..----------------------------------------------------.....SNFSKILPA
Q7NL56_GLOVI/6-177.TARILVM......----------------------------------------------------..............
Q0BVB5_GRABC/13-193.LFRLGWGFAGSE.----------------------------------------------------....TSRFSAFLVA
Q47YK1_COLP3/6-182.LIRVAMGFTKS..----------------------------------------------------.....QALSFKAWS
A5L4J8_VIBBS/13-176NILIARML......----------------------------------------------------..............
Q6N8J2_RHOPA/9-176.VVRVVWW......----------------------------------------------------..............
A0A023E6B3_AERSA/10-170.VLRLLWGLS....----------------------------------------------------.......FAKDHAR
Q87J03_VIBPA/16-183.VPRLVGR......----------------------------------------------------..............
A1HTF5_9FIRM/5-186.LGQIYYYVYT...----------------------------------------------------......GKYTEVLV
Q5NE92_FRATT/30-197PLLAVAKF......----------------------------------------------------..............
Q2BLD7_NEPCE/3-170.VIRLFIK......----------------------------------------------------..............
Q2IL72_ANADE/263-456IPLFLLFKGGLR..----------------------------------------------------.....HVWEDVRVS
A8EX57_ARCB4/6-181.AFRLFWGF.....----------------------------------------------------.......FGPKYSK
A4YRW2_BRASO/8-180.LARMAWR......----------------------------------------------------..............
A5G6W1_GEOUR/7-182LYMYLSHR......----------------------------------------------------.........KEVAT
Q1YYF5_PHOPR/9-176.TIRLIWI......----------------------------------------------------..............

PF14358

D4L0H2_9FIRM/73-132--------------------------------------------------------------------------------
D0MK75_RHOM4/9-73--------------------------------------------------------------------------------
W0E6J3_9FIRM/78-136--------------------------------------------------------------------------------
D2QYK9_PIRSD/9-74--------------------------------------------------------------------------------
D4H642_DENA2/9-75--------------------------------------------------------------------------------
B3EM27_CHLPB/9-76--------------------------------------------------------------------------------
J7IMY2_DESMD/114-176--------------------------------------------------------------------------------
W6EIG8_SULMU/8-59--------------------------------------------------------------------------------
F2KT13_ARCVS/8-72--------------------------------------------------------------------------------
A2BLN5_HYPBU/150-207--------------------------------------------------------------------------------
B3E729_GEOLS/14-80--------------------------------------------------------------------------------
R5AVI3_9BACT/6-59--------------------------------------------------------------------------------
F4GSW9_PUSST/118-178--------------------------------------------------------------------------------
F4L3Z1_HALH1/135-204--------------------------------------------------------------------------------
G2TKP1_BACCO/83-141--------------------------------------------------------------------------------
A1BH85_CHLPD/29-96--------------------------------------------------------------------------------
L0KZY5_METHD/9-75--------------------------------------------------------------------------------
K7RVD2_PROA4/158-222--------------------------------------------------------------------------------
E6W587_DESIS/14-80--------------------------------------------------------------------------------
B4S7W8_PROA2/12-79--------------------------------------------------------------------------------
F2NIT4_DESAR/9-81--------------------------------------------------------------------------------
A6LIR5_PARD8/13-85--------------------------------------------------------------------------------
E6UI69_RUMA7/73-132--------------------------------------------------------------------------------
I2EY27_EMTOG/6-57--------------------------------------------------------------------------------
Q8TMV4_METAC/9-62--------------------------------------------------------------------------------
Q2KUA6_BORA1/118-178--------------------------------------------------------------------------------
C9RRV1_FIBSS/74-133--------------------------------------------------------------------------------
W0LFH8_9ENTR/72-131--------------------------------------------------------------------------------
D3RZ50_FERPA/13-74--------------------------------------------------------------------------------
A9WBK7_CHLAA/77-137--------------------------------------------------------------------------------
A1B726_PARDP/70-128--------------------------------------------------------------------------------
J0RX58_9EURY/9-83--------------------------------------------------------------------------------
R6EP61_9FIRM/72-131--------------------------------------------------------------------------------
Q3B233_PELLD/10-77--------------------------------------------------------------------------------
Q6APY0_DESPS/4-70--------------------------------------------------------------------------------
S6CG33_9ACTN/62-122--------------------------------------------------------------------------------
C8WKH1_EGGLE/2-62--------------------------------------------------------------------------------
G0A5D7_METMM/11-75--------------------------------------------------------------------------------
C4XNX5_DESMR/5-71--------------------------------------------------------------------------------
A7I2S7_CAMHC/7-58--------------------------------------------------------------------------------
C4XNC0_DESMR/13-70--------------------------------------------------------------------------------
A0RPQ5_CAMFF/7-58--------------------------------------------------------------------------------
W6RUZ5_9CLOT/75-133--------------------------------------------------------------------------------
C0R274_BRAHW/70-129--------------------------------------------------------------------------------
R6AFB6_9FIRM/68-125--------------------------------------------------------------------------------
E8N2M4_ANATU/72-132--------------------------------------------------------------------------------
B4SDX1_PELPB/4-55--------------------------------------------------------------------------------
Q2RX07_RHORT/14-65--------------------------------------------------------------------------------
D6Z5B1_DESAT/6-72--------------------------------------------------------------------------------
B5YIR5_THEYD/10-76--------------------------------------------------------------------------------
B3EQ00_CHLPB/8-59--------------------------------------------------------------------------------
R6P7P3_9FIRM/71-130--------------------------------------------------------------------------------
Q2RIJ9_MOOTA/9-76--------------------------------------------------------------------------------
I3YFD4_THIV6/9-59--------------------------------------------------------------------------------
F8E8X8_FLESM/7-73--------------------------------------------------------------------------------
R6CX21_9CLOT/72-131--------------------------------------------------------------------------------
F0JFF5_DESDE/5-71--------------------------------------------------------------------------------
M4R3B0_BIBTR/72-131--------------------------------------------------------------------------------
G8QTP5_SPHPG/76-131--------------------------------------------------------------------------------
R7QWY9_9FIRM/8-58--------------------------------------------------------------------------------
F4LLX1_TREBD/74-133--------------------------------------------------------------------------------
R7LCV5_9BACT/72-130--------------------------------------------------------------------------------
K0NEJ9_DESTT/6-72--------------------------------------------------------------------------------
R7F4I4_9CLOT/70-128--------------------------------------------------------------------------------
D2RHV9_ARCPA/8-72--------------------------------------------------------------------------------
R6YA34_9FIRM/72-131--------------------------------------------------------------------------------
L0GUL1_9GAMM/12-78--------------------------------------------------------------------------------
C0QZ66_BRAHW/50-109--------------------------------------------------------------------------------
X5DE85_9BACT/10-77--------------------------------------------------------------------------------
B1L3S4_KORCO/10-72--------------------------------------------------------------------------------
E4TFY8_CALNY/5-71--------------------------------------------------------------------------------
B9JJR0_AGRRK/72-130--------------------------------------------------------------------------------
G7M4T2_9CLOT/72-131--------------------------------------------------------------------------------
R5X0L1_9BACT/9-66--------------------------------------------------------------------------------
K0C3X7_CYCSP/5-59--------------------------------------------------------------------------------
R7CCE2_9CLOT/72-131--------------------------------------------------------------------------------
F2NSL9_TRES6/73-131--------------------------------------------------------------------------------
R6UA77_9CLOT/74-132--------------------------------------------------------------------------------
F5YAS5_TREAZ/76-135--------------------------------------------------------------------------------
W6EBR3_SULMU/7-73--------------------------------------------------------------------------------
R5D3A2_9FIRM/72-131--------------------------------------------------------------------------------
K9VDE1_9CYAN/16-81--------------------------------------------------------------------------------
E1RA86_SPISS/8-59--------------------------------------------------------------------------------
G0EES3_PYRF1/11-75--------------------------------------------------------------------------------
R7CST8_9FIRM/68-123--------------------------------------------------------------------------------
R5I3L3_9PORP/6-78--------------------------------------------------------------------------------
E8RC78_DESPD/24-75--------------------------------------------------------------------------------
A5UYY8_ROSS1/82-142--------------------------------------------------------------------------------
T2KM32_9FLAO/57-117--------------------------------------------------------------------------------
N0AR40_9BACI/76-134--------------------------------------------------------------------------------
M1NG91_DESSD/6-72--------------------------------------------------------------------------------
A4VFX0_PSEU5/114-174--------------------------------------------------------------------------------
B9JP15_AGRRK/72-130--------------------------------------------------------------------------------
Q3ATG1_CHLCH/8-59--------------------------------------------------------------------------------
G0L331_ZOBGA/81-141--------------------------------------------------------------------------------
R7NCG3_9MOLU/2-60--------------------------------------------------------------------------------
A1BFX6_CHLPD/10-77--------------------------------------------------------------------------------
G4STW3_META2/9-73--------------------------------------------------------------------------------
I0GHS8_CALEA/20-86--------------------------------------------------------------------------------
G7Z1L5_AZOL4/25-76--------------------------------------------------------------------------------
E1SVF5_FERBD/125-198--------------------------------------------------------------------------------
F4C4I1_SPHS2/7-58--------------------------------------------------------------------------------
A0LPC1_SYNFM/9-75--------------------------------------------------------------------------------
Q7CI97_YERPE/72-131--------------------------------------------------------------------------------
E4RQ49_LEAB4/7-58--------------------------------------------------------------------------------
A6LNM0_THEM4/27-84--------------------------------------------------------------------------------
V5UHX6_9BURK/124-184--------------------------------------------------------------------------------
Q8KFP7_CHLTE/12-79--------------------------------------------------------------------------------
W6EDS3_SULMU/5-59--------------------------------------------------------------------------------
F4HFN7_GALAU/72-131--------------------------------------------------------------------------------
D5DJ74_BACMD/77-135--------------------------------------------------------------------------------
A3CUK5_METMJ/9-76--------------------------------------------------------------------------------
Q7UE94_RHOBA/95-155--------------------------------------------------------------------------------
E1RE56_METP4/9-80--------------------------------------------------------------------------------
R6M5A8_9CLOT/72-131--------------------------------------------------------------------------------
B7GIW2_ANOFW/77-135--------------------------------------------------------------------------------
B5IFA9_ACIB4/1-67--------------------------------------------------------------------------------
A2SSD8_METLZ/31-96--------------------------------------------------------------------------------
Q8TUQ6_METAC/9-75--------------------------------------------------------------------------------
D6DHZ2_CLOSC/72-131--------------------------------------------------------------------------------
B3E2B6_GEOLS/10-61--------------------------------------------------------------------------------
F8I7H1_SULAT/39-95--------------------------------------------------------------------------------
B4SBP8_PELPB/10-77--------------------------------------------------------------------------------
Q65T96_MANSM/72-131--------------------------------------------------------------------------------
Q21KL9_SACD2/6-57--------------------------------------------------------------------------------
D2QJH4_SPILD/6-57--------------------------------------------------------------------------------
N0BAX1_9EURY/9-75--------------------------------------------------------------------------------
C8WKW0_EGGLE/72-132--------------------------------------------------------------------------------
A9AYM2_HERA2/83-143--------------------------------------------------------------------------------
C0QF61_DESAH/5-71--------------------------------------------------------------------------------
B9L860_NAUPA/5-71--------------------------------------------------------------------------------
D1B0M4_SULD5/7-73--------------------------------------------------------------------------------
H1YWY9_9EURY/9-71--------------------------------------------------------------------------------
W6RSI1_9RHIZ/73-131--------------------------------------------------------------------------------
C6BYF4_DESAD/5-71--------------------------------------------------------------------------------
M1XST7_NATM8/13-77--------------------------------------------------------------------------------
K4LE17_9FIRM/80-137--------------------------------------------------------------------------------
Q2W2B9_MAGSA/11-62--------------------------------------------------------------------------------
Q15XU8_PSEA6/79-139--------------------------------------------------------------------------------
R5U1B1_9BACE/6-63--------------------------------------------------------------------------------
A7I9H3_METB6/10-72--------------------------------------------------------------------------------
R4JZ25_CLOPA/71-128--------------------------------------------------------------------------------
D9SQY3_CLOC7/76-134--------------------------------------------------------------------------------
A1AR53_PELPD/10-61--------------------------------------------------------------------------------
E4U6D1_OCEP5/21-87--------------------------------------------------------------------------------
K0NB22_DESTT/5-71--------------------------------------------------------------------------------
I4D2J4_DESAJ/77-135--------------------------------------------------------------------------------
C9R964_AMMDK/9-90--------------------------------------------------------------------------------
F8ABZ1_THEID/4-70--------------------------------------------------------------------------------
B8FH86_DESAA/4-70--------------------------------------------------------------------------------
H1XS36_9BACT/14-80--------------------------------------------------------------------------------
R5AVH3_9BACE/10-63--------------------------------------------------------------------------------
R5X3I1_9CLOT/76-130--------------------------------------------------------------------------------
A8F7I9_PSELT/58-115--------------------------------------------------------------------------------
Q8A5L2_BACTN/9-66--------------------------------------------------------------------------------
K4LFC8_THEPS/9-79--------------------------------------------------------------------------------
Q3B3K8_PELLD/8-59--------------------------------------------------------------------------------
Q7UGQ3_RHOBA/4-55--------------------------------------------------------------------------------
W6RUQ3_9CLOT/77-135--------------------------------------------------------------------------------
D5V7U4_ARCNC/6-72--------------------------------------------------------------------------------
L0H0I4_9GAMM/9-59--------------------------------------------------------------------------------
S6CE05_9ACTN/67-127--------------------------------------------------------------------------------
F0S3U2_DESTD/5-71--------------------------------------------------------------------------------
R5W765_9BACE/6-63--------------------------------------------------------------------------------
A0LNU4_SYNFM/14-72--------------------------------------------------------------------------------
R5LI07_9SPIR/70-129--------------------------------------------------------------------------------
B0VH29_CLOAI/15-63--------------------------------------------------------------------------------
V4JBA5_9DELT/6-72--------------------------------------------------------------------------------
S6C133_9ACTN/57-117--------------------------------------------------------------------------------
B3QVT3_CHLT3/9-64--------------------------------------------------------------------------------
D4IPJ8_9BACT/10-82--------------------------------------------------------------------------------
R7CTR1_9FIRM/68-124--------------------------------------------------------------------------------
Q11BF1_CHESB/72-130--------------------------------------------------------------------------------
E8T206_THEA1/5-71--------------------------------------------------------------------------------
I0GQA3_SELRL/62-115--------------------------------------------------------------------------------
Q3A6A8_PELCD/4-70--------------------------------------------------------------------------------

PF03188

ACFR1_ARATH/49-182GICAAFKNHNES..----------------------------------------------------...H...I.PNLYS
A5C961_VITVI/49-182GIYAAFKNHNES..----------------------------------------------------...G...I.ANLYS
Q6Z1Y9_ORYSJ/56-192GIYAVFKYHAEA..----------------------------------------------------...D...I.PNLYS
Q9FVY1_ORYSJ/46-178GIYAAFKFHNES..----------------------------------------------------...G...I.ANLYS
ACFR2_ARATH/50-183GVWAALKFHIDK..----------------------------------------------------...G...I.ENFYS
Q6YW65_ORYSJ/51-184GLWTVWKFHDER..----------------------------------------------------...Q...I.DHLYT
ACFR4_ARATH/43-175GIWT..KFHYQR..----------------------------------------------------...G...VFANFYS
Q10DW5_ORYSJ/60-193GVYAAFKFHDAA..----------------------------------------------------.......VAPDLVS
Q7XH60_ORYSJ/58-190GLYAAFKFHHDL..----------------------------------------------------...R...A.PDIRS
Q28YW1_DROPS/100-238GFLSVFDSHEAL..----------------------------------------------------...Q...K.VNFYS
A7UTA7_ANOGA/98-236GFMAVWDSHNQQ..----------------------------------------------------...Q...I.PNFYS
CYAC3_MOUSE/46-182GLIAVFRFHNHS..----------------------------------------------------...R...I.AHLYS
CYAC3_DANRE/47-182GLCAVFNFHNVH..----------------------------------------------------...H...T.ANLYS
F7AAH4_CIOIN/56-190GLVAVFQFHNHG..----------------------------------------------------...H...I.TNMYS
A7RY72_NEMVE/55-189GLKAAFDFHNKQ..----------------------------------------------------...G...F.PNMYS
CY561_CAEEL/62-204ALKAVFDYHNLHKD----------------------------------------------------PSGNPAPI.VNLVS
CY561_HUMAN/52-186GLVAVFDYHRKK..----------------------------------------------------...G...Y.ADLYS
CYBR1_HUMAN/49-185SVVAVFENHNVN..----------------------------------------------------...N...I.ANMYS
F6U164_XENTR/54-190ALVAVFDFHNAK..----------------------------------------------------...N...I.PNMYS
CYBR1_DANRE/47-183SVVAVFVFHNAK..----------------------------------------------------...N...I.PNMYS
Q7Q742_ANOGA/55-192ALVAVFDSHNLA..----------------------------------------------------...KPNPI.PNMYT
Q9I7U1_DROME/146-282ALKTVFDSHNLA..----------------------------------------------------...NP.PI.PNMYS
O16272_CAEEL/98-231ALFSIILTIKYT..----------------------------------------------------...G...A.SHFSN
A8X7F4_CAEBR/71-205ALCVIIISTNNT..----------------------------------------------------...G...Y.NNFTS
Q29JT1_DROPS/48-184GCLIQLIRDKW...----------------------------------------------------.........TIAVT
Q9VIT6_DROME/48-184GCLIQLIRDDW...----------------------------------------------------.........SISVT
Q9VIT5_DROME/94-228GALIKMIQKG....----------------------------------------------------.........FLLQS
Q9VIU6_DROME/47-182GSLGKFSSKE....----------------------------------------------------.........VHFNT
Q17ID4_AEDAE/154-293GIALEYYWRDRN..----------------------------------------------------..PE...K.RHFST
A0NFY4_ANOGA/64-202GIALEIYFREST..----------------------------------------------------...N...R.RHFSS
Q7PZD0_ANOGA/60-198ASVCIFLNKVRL..----------------------------------------------------...G...K.PHFQT
Q16LW8_AEDAE/141-279AFVCIFLNKVRM..----------------------------------------------------...D...K.KHFQT
C56D1_MOUSE/54-191GLGFIISSKIRS..----------------------------------------------------...E...M.SHLVS
F1R6P8_DANRE/63-200GLGFMVASKNIK..----------------------------------------------------...E...H.QHFKS
H3BZA9_TETNG/61-199GLCFMIASKNLS..----------------------------------------------------...E...H.AHLVT
Q1LXB7_DANRE/47-184GLFAIFYNKSLN..----------------------------------------------------...D...K.PHFTS
H3DB33_TETNG/49-185GVAAIYYNKHLN..----------------------------------------------------...G...K.PHLTS
C56D2_BOVIN/47-184GLGLVILHKEQL..----------------------------------------------------...G...K.AHLAT
Q5I024_XENTR/47-183GLGIIYSNKVLQ..----------------------------------------------------...G...K.PHFST

PF01794

FRO8_ARATH/159-281TLFIWTITHH....----------------------------------------------------..............
FRO6_ARATH/178-300YVVGWII.QGQ...----------------------------------------------------..............
Q4WR75_ASPFU/273-390YTVLFIQ.......----------------------------------------------------..............
Q4WC00_ASPFU/90-202MVIMGWG.......----------------------------------------------------..............
Q4WRK0_ASPFU/107-219AV............----------------------------------------------------..............
Q4WF95_ASPFU/130-249YLNYFIQ.......----------------------------------------------------..............
AIM14_DEBHA/94-207YFIKWIL.......----------------------------------------------------..............
Q6BTD9_DEBHA/151-272FIFQDLAEGG....----------------------------------------------------..............
Q6BXT5_DEBHA/276-393WTAYTIR.......----------------------------------------------------..............
Q0U921_PHANO/152-271YLNFFII.......----------------------------------------------------..............
Q0UXV8_PHANO/43-161MKTSISTT......----------------------------------------------------..............
A5DEQ5_PICGU/148-261YCGFFY........----------------------------------------------------..............
Q6C644_YARLI/142-255FAYYFNP.......----------------------------------------------------..............
FRE7_YEAST/161-282FLRQARHEGG....----------------------------------------------------..............
RBOHJ_ARATH/366-523HMLCNYPRLSSCPY----------------------------------------------------NFYS..........
Q0TVR2_PHANO/35-155YTYMILKDS.....----------------------------------------------------..............
A3GFP0_PICST/241-358KTIGLHQ.......----------------------------------------------------..............
A5DPY7_PICGU/304-417YSLYSRS.......----------------------------------------------------..............
A0JNK9_BOVIN/259-407SLCLPMRRSERYLF----------------------------------------------------LNMAY.........
YEDZ_RHORT/50-165YIGLDQFFD.....----------------------------------------------------..............
Q217F0_RHOPB/43-167LAANGLSTSPA...----------------------------------------------------..............
A0LQW5_ACIC1/61-184IIWGYAVSAHE...----------------------------------------------------..............
A1TKU8_ACIAC/46-161YAWLDMGFD.....----------------------------------------------------..............
A6VUY1_MARMS/1-130YLVLFAGLS.....----------------------------------------------------..............
NOX4_PONAB/58-205HLVNALNFSVN...----------------------------------------------------..............
Q5A445_CANAL/308-425FTVSDKA.......----------------------------------------------------..............
Q0APN2_MARMM/57-179YLGLDLFIEAGTA.----------------------------------------------------..............
RBOHC_SOLTU/408-565HLTCDFPKLLN...----------------------------------------------------..............
Q5FQ04_GLUOX/56-169YVGLDHGFD.....----------------------------------------------------..............
Q5E5I2_VIBF1/37-166IKAAHWAVQLGWLV----------------------------------------------------R.............
Q82R51_STRAW/62-185HFFSGFDGSQ....----------------------------------------------------..............
Q2H7Y7_CHAGB/153-271FYTDWVRA......----------------------------------------------------..............
A7TPB1_VANPO/264-381WTVVSIK.......----------------------------------------------------..............
Q6C0I9_YARLI/142-260FIKTWGVT......----------------------------------------------------..............
Q7SFF5_NEUCR/239-364MVIWQFVLAEDW..----------------------------------------------------..............
Q2H477_CHAGB/186-307WAVVQVSYDG....----------------------------------------------------..............
DUOX2_PIG/1081-1230HVVNVYIFSVSPLS----------------------------------------------------..............
Q6N633_RHOPA/45-180REGPSWITELGLVA----------------------------------------------------LPPK..........
Q28MM2_JANSC/56-182VYGWYFSFTPMDRM----------------------------------------------------..............
Q9L1A8_STRCO/50-176IMWGYAAQAGRGL.----------------------------------------------------..............
Q0ACJ0_ALKEH/56-177YALIPAATQA....----------------------------------------------------..............
Q21DI1_SACD2/35-149WMGLDLALM.....----------------------------------------------------..............
Q82L18_STRAW/83-206ITFGYAQSSSM...----------------------------------------------------..............
A0A0D1E108_USTMA/139-260FIHQPLADHG....----------------------------------------------------..............
Q0BQQ1_GRABC/59-172YGVYENGRL.....----------------------------------------------------..............
AIM14_VANPO/88-208FLSHWSSSSD....----------------------------------------------------..............
Q6CUH0_KLULA/305-422YTYHAFM.......----------------------------------------------------..............
A1WD64_ACISJ/52-181DASSDWIKGLWGRA----------------------------------------------------G.............
Q6FMR3_CANGA/107-225FVIRWAINP.....----------------------------------------------------..............
Q7PNG0_ANOGA/297-444HLFNFT........----------------------------------------------------..............
AIM14_ASHGO/94-211FVIKWQLDN.....----------------------------------------------------..............
Q4D1K3_TRYCC/390-520FYVCYGQAGKL...----------------------------------------------------..............
A1C8X0_ASPCL/194-313LGGVWSQFS.....----------------------------------------------------..............
NOXB_DICDI/225-375HYISFKKINDDVLK----------------------------------------------------..............
Q47CF6_DECAR/42-170EWLPKNLAKLGWIE----------------------------------------------------R.............
Q6C208_YARLI/250-367YHMFDGAKS.....----------------------------------------------------..............
Q0RT78_FRAAA/120-243TVWGYGLSAHE...----------------------------------------------------..............
FRE4_YEAST/273-390FTNYYLY.......----------------------------------------------------..............
Q47Y20_COLP3/48-162FLVFDLQLA.....----------------------------------------------------..............
A7TIJ6_VANPO/133-250YTWWYYE.......----------------------------------------------------..............
Q0V134_PHANO/180-301WLYNTVDVAG....----------------------------------------------------..............
Q2IMP5_ANADE/49-169LLGPELGVGG....----------------------------------------------------..............
Q74Z78_ASHGO/248-365MYEYLRR.......----------------------------------------------------..............
A2I2U7_CHLRE/303-425YMGMWANAGT....----------------------------------------------------..............
Q0RIS3_FRAAA/13-136LLLDPYARLAL...----------------------------------------------------..............
Q7MCQ7_VIBVY/47-184YHLPKWLISLELLE----------------------------------------------------KPVRF.........
Q6C2K8_YARLI/288-405YAMSAHK.......----------------------------------------------------..............
YEDZ_PSEAE/42-156YYVFILGLD.....----------------------------------------------------..............
A6LZ17_CLOB8/40-156ISMGKKIE......----------------------------------------------------..............
Q8YTT0_NOSS1/52-169LFINNPET......----------------------------------------------------..............
A5DUC1_LODEL/275-390FTIAE.........----------------------------------------------------..............
Q6CET8_YARLI/281-396FTVAV.........----------------------------------------------------..............
Q7NFG8_GLOVI/60-173QIEHVLGGSL....----------------------------------------------------..............
FRE8_ASHGO/108-221YTWYFA........----------------------------------------------------..............
F2G9K0_ALTMD/54-168YIFFELQLD.....----------------------------------------------------..............
A3LSQ8_PICST/127-243ACKYWL........----------------------------------------------------..............
Q2HEL2_CHAGB/276-393ALVLYKD.......----------------------------------------------------..............
Q5Z0I9_NOCFA/44-161LQIGGIDI......----------------------------------------------------..............
AIM14_PICST/105-222FLYKWTK.......----------------------------------------------------..............
Q01ZZ5_SOLUE/82-210LLFNATPKFAV...----------------------------------------------------..............
Q2K9I9_RHIEC/52-165YMMLDQAMD.....----------------------------------------------------..............
Q5B3H4_EMENI/159-280WLIPKAQSMG....----------------------------------------------------..............
A4VRF2_PSEU5/43-178GQIPKWLVGFGWLE----------------------------------------------------RPAR..........
NOXC_DICDI/622-766WIV.GMAVATGK..----------------------------------------------------..............
A0K1X7_ARTS2/75-198IAIGYGMAEGL...----------------------------------------------------..............
A1CUM1_ASPCL/175-298WIIIEGRLYQ....----------------------------------------------------..............
FRP2_SCHPO/114-229FMIFS.........----------------------------------------------------..............
A5WDA3_PSYWF/39-154KAKLDSWE......----------------------------------------------------..............
Q2TYZ6_ASPOR/86-204YTVLDTIY......----------------------------------------------------..............
NOX3_MOUSE/55-218HLFNLERYHLGQAK----------------------------------------------------DAEGL.........
Q6FWS3_CANGA/299-416YVIYSLC.......----------------------------------------------------..............
Q5KHL8_CRYNJ/202-314WT............----------------------------------------------------..............
Q2FKR9_METHJ/56-171YAYLALDPG.....----------------------------------------------------..............
Q2GQU2_CHAGB/155-272YLNFFV........----------------------------------------------------..............
A1CRA6_ASPCL/41-187YLSFFIQSTHP...----------------------------------------------------..............
A6LWS3_CLOB8/66-186YFIRFIILKLP...----------------------------------------------------..............
Q15YY0_PSEA6/59-182IGLPRFIVAPS...----------------------------------------------------..............
Q604N8_METCA/48-163YLIFDQLFD.....----------------------------------------------------..............
Q9EX48_STRCO/90-224FAAELVRYEAQLAW----------------------------------------------------AERL..........
Q28KV6_JANSC/39-153FAVPKDLPE.....----------------------------------------------------..............
Q5AHQ5_CANAL/95-212YIYKWVK.......----------------------------------------------------..............
A0A0D1E0K7_USTMA/233-360WCIQLNKDTR....----------------------------------------------------..............
Q59WI9_CANAL/253-370KTSVLIK.......----------------------------------------------------..............
Q6CEA2_YARLI/129-243YAYIYYS.......----------------------------------------------------..............
FRO4_ARATH/156-277FLIYWAMINK....----------------------------------------------------..............
AIM14_KLULA/97-214FIVKWSLDP.....----------------------------------------------------..............
Q0UZN5_PHANO/147-266FIVYHIHWH.....----------------------------------------------------..............
YEDZ_DEIRA/47-161YL.RGQDFS.....----------------------------------------------------..............
A5E743_LODEL/134-251VCYYWAS.......----------------------------------------------------..............
A1AY37_PARDP/49-162WVVFDMAFL.....----------------------------------------------------..............
YEDZ_PASMU/44-158YLALELGYD.....----------------------------------------------------..............
A5E459_LODEL/280-397MTYNGRG.......----------------------------------------------------..............
AIM14_YARLI/82-195YTVHFV........----------------------------------------------------..............
A5GKL0_SYNPW/57-207FRLPAQPFQALGLS----------------------------------------------------VPRIPFQFFGALPW
Q7S590_NEUCR/128-246YYNYFIQ.......----------------------------------------------------..............
Q5P447_AROAE/42-170EMSDDLIEERYGEA----------------------------------------------------G.............
Q4PEM4_USTMA/167-285YTAIYMQV......----------------------------------------------------..............
A5E3X1_LODEL/124-240GTYYWL........----------------------------------------------------..............
Q5KPP3_CRYNJ/174-292WIHQFV........----------------------------------------------------..............
Y1462_ARCFU/1-125EVLPRQFEGSIQ..----------------------------------------------------..............
NOXA_DICDI/58-201HFNNFRLYQDI...----------------------------------------------------..............
A7RPH5_NEMVE/44-191HLINGKRFSEN...----------------------------------------------------..............
A6VQE1_ACTSZ/43-157YLLLELGGD.....----------------------------------------------------..............
A7ENT9_SCLS1/179-300WAASKVHTSG....----------------------------------------------------..............
Q6C3A4_YARLI/310-427FAFLAVY.......----------------------------------------------------..............
Q6CPC7_KLULA/282-399YVIRSSL.......----------------------------------------------------..............
Q75D69_ASHGO/278-397MLVHTLDLG.....----------------------------------------------------..............
Q6CN86_KLULA/282-397WTYLE.........----------------------------------------------------..............
Q6CLT2_KLULA/243-363WSGYCLWKE.....----------------------------------------------------..............
Q6CET4_YARLI/273-389YSYIER........----------------------------------------------------..............
FRE1_YEAST/258-375MTASGVK.......----------------------------------------------------..............
E4X2P3_OIKDI/55-207HYYNFLHNYAALSA----------------------------------------------------S.............
E7M0W3_YEASV/274-390YTYHAYI.......----------------------------------------------------..............
E7QHM4_YEASZ/202-316YSLFAII.......----------------------------------------------------..............
F6WE71_XENTR/248-394TLVMPIRYYVRWWS----------------------------------------------------NNYII.........
F6YS00_CIOIN/57-202HAYNAVYFSKY...----------------------------------------------------..............
F7BAU5_XENTR/57-219HLFNVERLVDARVE----------------------------------------------------ANGTI.........
H0VSY4_CAVPO/49-211HLFNFERYHTSQQA----------------------------------------------------KDGSLA........
Q4WB75_ASPFU/288-403YLQIAVA.......----------------------------------------------------..............
Q4WCY1_ASPFU/137-255WFRNWARY......----------------------------------------------------..............
Q4WGG6_ASPFU/187-306WAVNTVRET.....----------------------------------------------------..............
Q5KEC9_CRYNJ/209-325YVVKWAR.......----------------------------------------------------..............
Q5KEL3_CRYNJ/176-290WTWI..........----------------------------------------------------..............
Q5KJ95_CRYNJ/122-251ILYAPYRQGGI...----------------------------------------------------..............
YEDZ_XANCP/53-167YLWLDLRGF.....----------------------------------------------------..............
Q8XLV2_CLOPE/68-182YTYKFLVRL.....----------------------------------------------------..............
YEDZ_YERPE/48-161YSILELGLSN....----------------------------------------------------..............
Q9I5Z1_PSEAE/40-165ELAGPWL.AGIVGK----------------------------------------------------..............

PF10348

Q4WLQ1_ASPFU/53-156--------------------------------------------------------------------------------
A5DCA9_PICGU/65-169--------------------------------------------------------------------------------
A5DLL3_PICGU/70-174--------------------------------------------------------------------------------
Q7S4U9_NEUCR/54-157--------------------------------------------------------------------------------
A3LQA2_PICST/42-147--------------------------------------------------------------------------------
Q5KLR8_CRYNJ/22-123--------------------------------------------------------------------------------
YBH6_SCHPO/15-118--------------------------------------------------------------------------------
A7ENZ5_SCLS1/29-130--------------------------------------------------------------------------------
Q6CTZ5_KLULA/79-184--------------------------------------------------------------------------------
Q5KDX6_CRYNJ/161-262--------------------------------------------------------------------------------
Q7S0V3_NEUCR/59-161--------------------------------------------------------------------------------
A0A0D1CF67_USTMA/25-126--------------------------------------------------------------------------------
A5DTJ1_LODEL/90-195--------------------------------------------------------------------------------
A1C9V0_ASPCL/31-132--------------------------------------------------------------------------------
A6RFH8_AJECN/26-127--------------------------------------------------------------------------------
Q6C1B0_YARLI/25-127--------------------------------------------------------------------------------
A7F0D8_SCLS1/59-162--------------------------------------------------------------------------------
Q6C5B1_YARLI/116-222--------------------------------------------------------------------------------
A7TT31_VANPO/83-190--------------------------------------------------------------------------------
Q2GXA8_CHAGB/1-103--------------------------------------------------------------------------------
Q2HHA0_CHAGB/52-155--------------------------------------------------------------------------------
Q5AP55_CANAL/89-194--------------------------------------------------------------------------------
Q5B6W6_EMENI/54-157--------------------------------------------------------------------------------
Q6FMC4_CANGA/68-173--------------------------------------------------------------------------------
Q75EM7_ASHGO/67-172--------------------------------------------------------------------------------
E7KKX9_YEASL/58-161--------------------------------------------------------------------------------
G4MKH1_MAGO7/63-163--------------------------------------------------------------------------------

PF01578

HEMX_BACSU/66-273FVFSVLYMFQYHLL..........................................................KKKKWGKW
CCMC_PARDP/3-182LVTSLIWL........................................................................
Q8EK42_SHEON/5-184ATAAFIGL........................................................................
CCSA_CYACA/70-293AFLSLIYVIVNNNLSQKSLNRMFYLP..................................SFYVDFDKNEPRNDIGTATI
CCMC_MARPO/2-175AISSVLFL........................................................................
CCSA_ODOSI/69-306SLLCILFLVISKYQDIDLQILDESSLPL...............................YNIMLDYYEAKLFSPSDEVSE
Q9KUG2_VIBCH/37-266ALYALQLAWLDHKL..........................................................KSKKVFSI
Q9K176_NEIMB/36-266TLLSVLTLLLNRSL..........................................................HRRSFSKL
NRFE_HAEIN/89-298FAMSLSAL........................................................................
CCSA_CHLVU/70-308CFIAIAYLVLSKFFIKTTFVTAPLSSQN..............................TVLRQESFLEEKQKTDIVFEKN
Q9CLN5_PASMU/37-267ALYSIQLVWIDRAL...........................................................KNKKLPF
CCSA_MAIZE/68-311SLLSAALLIIRFRKNFDFFSLKKNVFLKTFF.........................FSEIEYLYAKRSALKNTSFPVFPN
CCMF_PSEFL/94-304FAFAIAAL........................................................................
O66467_AQUAE/59-250GFTSTARLLIERK.............................................................LREKKV
O67831_AQUAE/103-307FGGAVAYLLKEHF.............................................................PENKFV
O25141_HELPY/695-896FVLGILSLVLFI..............................................................LRKQGR
CCSA_PORPU/68-313SLLSILFLIITRGQDINLKGSSVGTGSYTVKS.......................LDSNPSFAFSNPSGIVQEQSNMLIN
O21278_RECAM/20-197TISSIIYL........................................................................
CCMC_ARATH/2-175AINTFLFL........................................................................
CCMF_RHOCB/89-298FSFAVAAL........................................................................
CCBS_MARPO/102-404FCLCLSKIINRQQKSLKNIYIFFFPFLVKPKKGRRPEMAGPHTRTSPYSRVPFGSLAHREQAKSVVRKTNTMYFHFGWTC
NRFE_ECOLI/72-281ASVALASL........................................................................
CCMF_ECOLI/89-299FAFAIASL........................................................................
CCSA_GUITH/70-295SLLAILYLVLIKAQQKKHSLKD...........................................FAFANLEFTFPKSTN
CCSA_CYAPA/67-316SLLSIIYLYFLYRVDKLLNKINAVNLMTSNQNS....................NSLIYNLSFNTLLNSSKSMEYQILLKD
CCMC_HAEIN/5-184AIAAVVAL........................................................................
CCMC_ECOLI/5-184AVAAFIGL........................................................................
O21277_RECAM/89-298FSLTIAYL........................................................................
O28299_ARCFU/5-170LAFSVVFL........................................................................
O28091_ARCFU/80-267YSVIVANS........................................................................
CCMC_BRADU/3-181SIASLGTL........................................................................
CCMF_BRADU/89-298FSFAIAAL........................................................................
Q9P9P5_XYLFA/33-261ALLAMMLWFQERAL..........................................................RQRNVHHW
CCSA_GALSU/74-300SLLSILFLLLSRNNKLNYTKNN..........................................NLTTASNSNDTLILKN
Q9X619_SALTM/58-288ALYALQLAWIDYQL...........................................................KNKKLAF
C3VYY3_PINTH/67-313SLASIALLVIMSGVNRQVIFGAMDNLFSRAIL.......................PNENFYSHEKQKSDLQYTVYFSSTN
CCSA_CHLRE/138-347SLLSILFLILFK..............................................................HKKGTP
CCSA_SYNY3/67-328SLLAIAFLFVTRGQAVELRGSSVGTGGFRQGLVKGNNLNP.......VGNLNPALEGVSGNSGNVAVLEKTTSTPAITLS
Q9HXP7_PSEAE/35-264VFQALLLLLQDYRL..........................................................KHKHPSGL

PF02628

CTAA_BACPE/6-286IIILAIWAW.............KQLKH..MREAK.AL.SFAAVILIIFQGLLGAGAVVFG..................QS
ETP1_SCHPO/99-458ILLPSIYMI.............VTKRA..SPWLS.KR.LIGLTGLVGLQGVIGWWMVKSG....LSEELFS.DGSHPRVS
CTAA_PARDP/37-362WAAGFVFFL.............ATRRI..PTGWT.PR.LLLLGALGGAQGAIGWWMVHSG....LSGE.......MVRVA
CTAA_SPHWW/18-335LAGVMIVAW.............WKRAI..PAGYG.WR.MIGIFALGGLQGAIGWWMVYSG....LSV........RTEVS
CTAA1_ACICJ/13-334FLVPLAVFR.............LRGRI..SNRLT.AW.LLFLFGLGAGEATMGWYMTYEGMTSRIL...........QPS
CTAA2_ACICJ/30-356FGVPLVWFL.............WTGRI..ERRLR.PW.LVTLFVLGGVQGLIGWWMVASGFQPGLT...........EVS
CTAA_GRABC/35-352LLLPLIFLA.............VTRRI..ERSLI.PR.LILIFVLGGLQGAVGWFMVASG....FFPD.......STAVS
Q6FQE7_CANGA/106-462FVMPALYFA.............ATKRT..SSHIN.KR.LLFLSGLLGLQGFVGWWMVKSG....LDKEQLEIRQSKPTVS
A1CT55_ASPCL/107-465FVFPALYFV.............AKKKV..SKPMA.LR.LAGIAGLIGFQGFIGWWMVKSG....LKEDLFA.QGSHPRVS
Q5K7Z7_CRYNJ/87-433FLLPTVYYL.............ARYKL..PRPLP.TK.LLLIGLGIGFQGVLGWWMVKSG....LDEQIIT.DNSVPRVS
A4SB75_OSTLU/15-353FVAPLAYFA.............SKGYV..TSALA.KR.LGVFFVLGAAQGMIGWWMVKSG....LEEQEF..SYDVPRVS
Q292P6_DROPS/49-381FLVPAAYFW.............KKGYF..CPKTK.NS.VLLLGTLIGLQGLMGWYMVKSG....LENRFED.QNDVPRVS
Q382Y6_TRYB2/45-379YGVPLLYFV.............CRGRFRAQPALL.AT.LSGILALGGAQGAMGWYMVRSG....LDPQLLD.ERRKARVS
Q4Q7Z4_LEIMA/67-401FGGPLLYYA.............GRGYFKGNGKFL.AG.LVGILGLGAAQGFMGWYMVTSG....LDNKLLE.ERKKATVS
Q607I2_METCA/14-312IIATLYRSLAF.........WKTD......RTVT.WL.ALTVFLAVGFQGWLGSAVVASN....L..............R
Q11SZ6_CYTH3/10-312IVYQCIYATRF.........LKTT......PKYF.WY.SLLLAVLMASQGLLGAKLVSSY....L..............K
Q0ABY2_ALKEH/7-324ILALAVLAWRRR......QDPWQ.........PV.AL.PVAVVFVVLFQSVLGAWTVTWQ....L..............K
Q5P2E4_AROAE/16-326IIAVAVLAWRKR......DDPAS.........SP.RV.AAALVGLVIFQGLLGKWTVTLL....L..............K
Q3SLW6_THIDA/5-318VLGLAVLAWRRR......RDTRG.........GP.AL.PLLLLGLIVFQALLGMWTVTQL....L..............K
Q3J6R5_NITOC/6-323ILGLAIAAWRNR......SDPTQ.........KV.AL.PLFLLGLVGLQAALGMWTVTLL....V..............Q
Q88RM0_PSEPK/6-317IALLAFQAMRRH......ARDGQ.........PY.RL.PMLLLGVVLAQAAFGMWTVTLK....L..............W
Q2SQU9_HAHCH/23-348IFAIAALSWRD.........ISPDSVPGARRPPR.KL.TLFLCALVILQGLFGMWTVTLK....L..............W
Q0VN95_ALCBS/14-332IIIIAALSFVNR......KREKQ.........PL.KL.PLFLVALVIFQGILGMWTVTMG....L..............Q
Q7MDC7_VIBVY/12-325IFAITLLCLFK.........AKA.........PK.VV.PIVLSLLVVAQALLGMWTVTMK....L..............M
A3Q942_SHELP/4-317VAFILFISFRR.........PDA.........PK.KL.PSFIALLILFQAALGMWTVTMK....L..............M
Q48AB6_COLP3/12-337IAVIAIFSIKLRF.....SKSSK......VRYPI.FL.PLCILCIVTFQAALGMWTVTLK....L..............M
Q15N00_PSEA6/2-315ILIIFVVSIVKR.......AYHR.........PI.KL.PFFLLCLVIFQGMLGMWTVTLN....L..............L
A1SY56_PSYIN/14-353LLAILLWPLFNNLKVLRHQSSINKKKHSPNVLMPFKL.PALLVLLVLFQAFLGMLTVTMQ....L..............Q
Q3IJP9_PSEHT/6-319ILALFVYAFLKR......QSPTT.........PV.KL.PLLLLLLVIFQAALGMWTVTMN....L..............Q
Q12E38_POLSJ/44-358ILTLAIVSWLER......ERAHI.........SP.AW.PTVTLLWVCLQGAFGALTVTMK....L..............F
A2SKN8_METPP/44-363ITVMTLLSWQQW......RRDGRGSSEAPTRVSP.WW.ATVTLLWVCVQGAFGAFTVTLK....L..............Y
A4T080_POLSQ/35-356ILVQVGLAFSKV......KTMGK.........AP.LIGSLGLLMLVCIQGAFGAWTVTLK....L..............Q
Q8Y2G5_RALSO/30-341IITLVVLAWAKR......RELRQ.........SP.WY.ATAVLGLVCLQGAFGAWTVTLK....L..............Q
Q2KTW9_BORA1/9-320IIAIVYMAWRYR......GRLGR.........SP.AL.ATVALVAVCVQGAFGAWTVTHK....L..............M
Q60CH3_METCA/12-323ALVLMAMIG...............WLPAHRGRAA.LL.AAALLLLAAGQAGLGLWGHYAA..................PM
CTAA_FLAJ1/9-333FFVPFVYFL.............AKKKL..DTSTI.KK.CIVLLAMGAFQGFLGWFMVRSG....LID........NPDVS
CTAA_ORITB/10-346IIIPFLIFC.............YLKSL..TKLQY.YR.LLLITCLVVIQGFMGWYMVKSG....LKE........TPYIN
CTAA_RICPR/7-325YIVPLICFY.............FQGVI..KKCKM.LP.YIIALLLFCIQGFMGWYMVESG....LLN........NHSVS
CTAA_ANAPZ/7-319FFVPMLYFA.............VKRQI..KGALA.AR.LGIVALLGALQGAMGWFMVKSG....LVD........VPYVS
CTAA_NEOSM/4-317FFIGLVYFF.............VVGNL..ARESR.LR.LCFALVLGVIQGFVGWYMVKSG....LLD........VPAVS
CTAA_BRADU/15-335YLLPFLFFL.............WRGGL..SRELK.RR.LWLLFALGGLQGAVGWWMVASG....LSE........RVEVS
CTAA_METS4/27-349FFLPLGWFW.............WTGRL..DRRLG.LG.LVGLGVLGGLQGAVGWIMVASG....LQPG.......MVAVA
CTAA_RHIEC/27-347FALPLLYFW.............LTGRI..EKRLR.WP.LVGILALGALQGFIGWWMVSSG....LSV........RTDVS
CTAA_PARL1/21-336FFVPFVFFV.............VTRRV..ERALV.PR.LIFLFVLGGMQGVLGWWMVMSG....LTD........RTEVS
CTAA_JANSC/36-361WAVGFVGLL.............ATKSV..PVGWT.GR.LLLLGVLGGLQGVAGWWMVHSG....LAPG.......MFDVA
CTAA_HYPNA/15-332AVAGFAFFA.............WRRWL..GQGLG.WK.LVGLIALGGLQGAIGWWMVSSG....IGET......ERVSVA
CTAA_MARMM/13-331YFVPFVFFW.............MRGHL..SARLK.SR.LFGLFLLGGAQGAIGWWMVASG....LSD........RLDVS
CTAA_CAUCR/14-334YAIPLIVFL.............IRRDI..PRRLI.WR.CAAMLGLGGLQGLVGWWMVSSG....LSE........RVSVA
CTAA_NOVAD/17-340FAAPLAWFW.............IKRRI..PEGYK.PR.LVALLALGALQGAVGWWMVKSG....IVN........DVKVS
CTAA_SPHAL/22-339LVVPFVWYA.............WRRAI..PAGYG.WR.LFALTALVGLQGAIGWWMVASG....LEY........RTDVS
CTAA_BARHE/23-344ALLGLIWFW.............AIKHI..EKNVL.LQ.LIIVPILIAFQGVVGWWMVASG....IGQS......NLTSVS
A0CRQ7_PARTE/61-392YVLPLAAFT.............AMKWI..KPQYA.KR.LGTIGGLGLLQGLIGWWMVKSG....LDRPKPE.YQQKPRVS
CTAA_MAGSA/22-344FGLPFLWLA.............LSGRI..GRAMV.PR.LAGVFLLGAAQGGMGWFMVKSG....LVD........NPAVS
A9WIE2_CHLAA/11-294TIGLLVWAL.............RLFAA..GHPAR.RA.AIATMIFMIVESLIGAALVLFR....LVAH......DASLTR
CTAA_LYSSC/8-290ILVLTVWTW.............RKLGH..IREVK.LL.GFLAMFFLIAQALIGAAQVLWG..................QG
B7VQY7_VIBTL/4-312IFVVVAWCI.............KK.....NITAA.GL.PLFISATVIFQALLGMWTVTLK....L..............M
CTAA_ANAMF/9-318FCLPIPYFA.............ITKRI..NRAMV.AK.LLMVALLGGMQGAMGWFMVKSG....LVD........TPRVS
F1R355_DANRE/60-387YILPAAYFW.............RRGYF..SRSMK.TR.VLGLCGFVVFQGLLGWYMVKSG....LEEKPE..SYDVPRVS
I0HWX8_RUBGI/43-349VLVLAVASV.............RARRT..LPHGA.GW.ALATLAWVLAQGLLGKYTVTLK....L..............F
CTAA_BRUA2/27-346VAVPLGFFW.............LTGRL..KGGLK.YR.MLGLLALGGLQGAIGWWMVASG....LSE........LTSVS
CTAA_PELUB/14-326TLVPLLFFT.............LYFKK..TLHYS.NK.YYWIFFLVCLQGFIGWYMVSSG....LIE........NNDVS
COXX_THET8/12-294VLALFLWAL.............RAFPK..GHPAR.FG.AGLALFFMVTESLVGASLVLFG....WTAD......NVSRER
Q5ZYG1_LEGPH/18-327IFFIAFQVW.............FKRCQ..DQDLPWHL.PLALFMLVVFQAALGMWTVTLK....L..............L
Q6Z5C5_ORYSJ/128-457FSVPFAYFI.............AKGYV..TRQLG.LR.LSGLFALGAGQGLIGWWMVKSG....LEEPAS..EYVQPRVS
CTAA_WOLPM/16-328FVLPFIYFT.............LRRKI..SKKVV.IK.LFVALLFGALQAFAGWYMVKSG....LVA........KPHVS
CTAA_LISMO/7-287VIVLAICAW.............IYMKN..RRETK.PL.AIIAVLFLIIQALMGMAAVVWG..................QN
Q9I720_PSEAE/12-320ILGLALHAL.............VRRGR..DGQPL.KL.PLLLLAVVIAQAAFGMWTVTLK....L..............W

PF00033

CYB6_SPIOL/21-210LPWDQIGYWA----------------------------------------------------------------------
CYB_ASCSU/10-196LVWAQMSFWA----------------------------------------------------------------------
CYB_MARPO/20-208LPWGQMSFWG----------------------------------------------------------------------
CYB_TRYBB/9-197LPCTMMSYWG----------------------------------------------------------------------
CYB6_MARPO/21-210LPWDQIGYWA----------------------------------------------------------------------
CYB6_EUGGR/21-210LPWDQVGYWA----------------------------------------------------------------------
CYB_STELO/18-204LPWGQMSFWG----------------------------------------------------------------------
CYB_HETFR/19-205LPWGQMSFWG----------------------------------------------------------------------

PF13631

D5SPP4_PLAL2/91-258LPGDQRAHAA----------------------------------------------------------------------
D7WEJ9_9CORY/110-284LPDDLLSGVG----------------------------------------------------------------------
C7M191_ACIFD/113-287LPDDLISGTG----------------------------------------------------------------------
A0LTH4_ACIC1/129-303LPDDLLSGTG----------------------------------------------------------------------
Q2JA36_FRASC/139-313LPDDLLSGTG----------------------------------------------------------------------
E3JBI3_FRASU/129-303LPDDLLSGTG----------------------------------------------------------------------
C8XCX9_NAKMY/122-296LPDDLLSGTG----------------------------------------------------------------------
D1A8W4_THECD/118-295LPDDLLSGTG----------------------------------------------------------------------
C7MZ05_SACVD/123-298LPDDLLSGTG----------------------------------------------------------------------
QCRB_CORDI/110-284LPDDLLSGVG----------------------------------------------------------------------
B1MBC7_MYCA9/109-283LPDDLLSGTG----------------------------------------------------------------------
C6W9G5_ACTMD/123-297LPDDLLSGTG----------------------------------------------------------------------
D1A3M6_THECD/119-294LPDDLLSGTG----------------------------------------------------------------------
Q9K4I9_STRCO/122-296LPDDLLSGTG----------------------------------------------------------------------
D0LAX2_GORB4/112-287LPDDLLSGTG----------------------------------------------------------------------
Q01PC6_SOLUE/95-279MRFDQDAYWG----------------------------------------------------------------------
Q9RX79_DEIRA/103-278LPYDNYAYQT----------------------------------------------------------------------
A0LFE3_SYNFM/95-264LPWDQKGYWT----------------------------------------------------------------------
A4YE24_METS5/89-278LIGDALAVSA----------------------------------------------------------------------
Q9HIU9_THEAC/81-267LSGDVLSADA----------------------------------------------------------------------
A4YDG6_METS5/94-292LVSDVLGVNA----------------------------------------------------------------------
D2PP93_KRIFD/114-286LPDDMASGTS----------------------------------------------------------------------
D4H0P8_DENA2/82-245MPMNQLSYWA----------------------------------------------------------------------
Q9HIV5_THEAC/107-280LTYTYISVAA----------------------------------------------------------------------
Q6KZY3_PICTO/98-271LADTTIAMAA----------------------------------------------------------------------
B3LEZ9_DROMO/89-254LPWGQMSFWG----------------------------------------------------------------------
F4B633_ACIHW/89-277LIGDVLATSA----------------------------------------------------------------------
QCRB_MYCTU/120-294LPDDLLSGLG----------------------------------------------------------------------
Q4JWC3_CORJK/115-288LPDDLLSGVG----------------------------------------------------------------------
Q8HC78_ORYLA/88-253LPWGQMSFWG----------------------------------------------------------------------
Q97V30_SULSO/93-279LIGDALATSA----------------------------------------------------------------------
Q97VH0_SULSO/90-287LVSDVLGVNA----------------------------------------------------------------------
V9XG29_9NOCA/115-289LPDDLLSGTG----------------------------------------------------------------------

PF01292

C1DIE6_AZOVD/9-186EREDLAWFANVKDVLLGKHDKPLLIGKYNAGQKI........----------...........LFW-GIM-----SLISV
B2UEV9_RALPJ/18-207FPVTPAGVRCDMVAALKGRLSHADPRHYNNVQRL........----------...........AYL-LVI-----LDIVL
F2G749_ALTMD/13-185ASVSLSKKAFIEHFHHLQQKKIPTRHGHNPFGWL........----------...........MIF-AVF-----TLFLG
B2JU39_BURP8/35-202.................VTSWHPLPVGTPNPVEVIV......----------........SRSVAT-SLA-----LAMVL
A8LH36_FRASN/20-219TRERLGQIVPSVRFYTFLSREAPPVIGHNPLAGL........----------...........TYT-VLY-----TMFGV
Q24SV4_DESHY/15-201TKADVMHVKAFAVEFFGGHGNYPPQAKFNGGEKI........----------...........NSL-FTI-----FGSIF
B0SVS8_CAUSK/3-181.LTGAPQLGLMRFYPQIQGLKLDNAFTHPAISRI........----------...........LLL-AIA-----VCLVG
Q3KA02_PSEPF/7-177.................LGTRQPPLPADLPGWQVMA......----------........AKASHL-LLY-----ALMLV
A7IEJ2_XANP2/17-189.................IFGPTPPASAQISRPVAIA......----------........SHIVHG-LLY-----LLLIA
Q5P430_AROAE/8-169ADFVPRPATLVDYVGQLARGREPRHLGHNPAAAV........----------...........MIV-FLM-----AMVAT
Q8KEB1_CHLTE/10-218PSWWGKPFKEQMAAYLFLRKGEPDYVGHNPVAAL........----------..........THFL-FIF-----CGSVF
A3Y9W1_9GAMM/26-199...............FIIRSERPTHNMPSWQKKVS.......----------.........SLVHG-ALY-----LCLVM
A0RPH5_CAMFF/12-218DFLSPKIWIAQIKYYLFLGKHPHLHGTYNPLQFI........----------...........AYI-MFY-----IILLV
Q2W2V7_MAGSA/500-649........................LFRRRWRANA........----------...........EGM-VMF-----VLMPA
E2XB98_SHIDY/13-220RKSWWQGVWYEIRWYLFLAKRPSADIGHNPIAQA........----------...........AMF-GYF-----LMSVF
Q73XF0_MYCPA/5-235PYSWSIFPEAFNDIVTYLTFNLPPVLPGEPLDAMQ.......----------........KLTYAG-VVF-----VLAPF
Q3K9Y1_PSEPF/9-180.................SLGPAPKIFPASPPWQTIL......----------........ARLMHW-ALY-----LFMIS
J2ZFR0_SHISO/68-257GWLERAAKQTRFYLFGIMQGEEHPFPATTQSKFNPL......----------.......QQVAYVG-VMC-----GLLPL
Q11M26_CHESB/8-183.................LAAAKPRPVPRTSRLEAIA......----------........ASLTHS-TLI-----AMTIF
A8EUR4_ARCB4/14-229KKNFIEFCEVFFNLMTFNRRKKFSSEHSDSYNIM........----------...........FFT-VFH-----LLLVF
Q0AAZ8_ALKEH/9-216HDLRTMVITMARLFGLMKAAPIPPQGRYNGAQRL........----------...........LGT-MIV-----FASLA
A3UXK6_VIBSP/7-177.................LVTASPKVEGKSYEVAAA.......----------.........KIAHG-FMY-----INLAV
Q726G3_DESVH/8-195PTFLKLMDVVRYYVSGIFKGEPHPVPKSERSKHNPL......----------.......QRLTYLG-IVS-----VLVPF
Q0P8A9_CAMJE/92-274PASYDIRWMMIVGGYLSKIKRPVPAGKFNFGQKS........----------...........WYY-IAV-----FGGFL
Q6MN52_BDEBA/9-210KCPAAHAAQSAWNLSKVPAGQKTHALHYTLVKTG........----------............YA-LFY-----LVTVF
A1VMH0_POLNA/30-197LQGLPGWLKSLPNVKSIATAQPAWRQGQNLMMAL........----------...........AIV-LIL-----GVVVP
Q24SH5_DESHY/15-204PRRGDFKESYLIIKAMITKCKEPPCGKYLAEQRL........----------...........AYF-YIG-----FNVLL
A4EHB9_9RHOB/9-185.................YAGQLPGWAPTLSSGEKKT......----------........IHRLEQ-VLY-----LAMFV
A1K9P7_AZOSB/5-173................LAHPVAPDPRLGALEQRLA.......----------.........GAGHI-ALY-----VLLVA
O28892_ARCFU/13-211RIPYSIKFVLEEAVAWIKGGHVGDPRAYDPRRREYVEKI...----------.....IPSQVLVFW-TYV-----LLTAI
Q3SMF3_THIDA/22-205RWRDLWHPRVWKDALLRLRLPHTHRVGHDALASL........----------...........GYL-FAY-----AVMAL
Q0F0S9_9PROT/5-220DGRKQLASEIRVQVAGWKQAKLAPPEDGEAVARS........----------...........VHG-LIL-----IAGII
Q1QXP2_CHRSD/8-174.................ISQLRHRPEHRGALQKAA.......----------.........IWGHV-LMY-----LVLLL
A8H662_SHEPA/17-235SHILPSISAARDYSQALKSGGNPQYLGHNPLGKL........----------...........AVS-AIF-----VLLIV
Q2LQE6_SYNAS/8-184VFPEDLDWIKSAGGYLWHVDKVPEVGKYNPGQKM........----------...........FFL-VVA-----LGGAA
Q137Q9_RHOPS/15-183.................KIHGAPDLVPSPRFSKVI.......----------........ARISHG-LLY-----LLLLA
Q0G224_9RHIZ/16-199.................AINPPPAHAPTVPLRERLA......----------........ANAVHL-TFY-----ALMLI
Q21VQ4_RHOFT/20-197................AFRPAAPQVQMASWMQLTS.......----------.........KLVHV-ALW-----MLLLA
A6D834_9VIBR/136-317NKTDMQWFMKLGGMVGKHKGSHPSAGFSNGGEKA........----------...........IYW-LLI-----FFGAI
A5FBE0_FLAJ1/8-190.............LVKGIKFPDPLKKSQSVKERMQ.......----------.........GFIYI-IFY-----LFIAV
Q0FAP7_9RHOB/5-159.................SQTQVTSLPEDTSMFQRRA......----------........AKIVHI-SLY-----INLSI
A3XC59_9RHOB/9-194.................LSQPKPGLLHPENKPEALA......----------........AEVVHW-VLY-----GAMVA
A5G519_GEOUR/9-204ELQHGLLRQAIFYFFRYFRGDPSPHHATPDNKFNPM......----------.......QKSAYLA-IMF-----VLMPL
A4BH07_9GAMM/8-165.................RRKRLPRLTHPKKTMQWF.......----------.........NATHY-LAW-----GLLFV
A5FTL2_ACICJ/4-178.................NRHGRPAEADGLSIAERRA......----------........AAAGQA-LLY-----GLLLA
Q3M4T2_ANAVT/30-199...HAGNRKLLQQDSLQNLTQFGRPIWWVSLQRI........----------...........ANT-LML-----IAAVL
Q5QZM1_IDILO/10-182KTFLKSPKAILKHLHNVFKGRYEAENTHSTAGGW........----------...........AVI-IML-----GLLLS
Q2K795_RHIEC/4-158.................LVQPPHGSAPGTWTGRAA.......----------.........TVLHH-AFY-----AAIIA
Q2N9I4_ERYLH/7-222.....VNRHFKRDLTTTRREWKPAAIWEDIKQHAKLKFDAEG----------GKKYNFLQKLSYGI-VLG-----VFLPM
Q2YJ32_BRUA2/13-182.................LMNIHRRPHKDGAIGKLA.......----------.........VLGHL-AIY-----VLMIT
A8GZ50_SHEPA/78-266LWIELKKSVLHYTHMLGMTKTHVEAPKYHHSGRL........----------...........AGL-VIM-----ASSFV
A5WBJ1_PSYWF/9-194.................LNNIQPDEEPGSKLAHLS.......----------........AHLGHF-GLY-----AVMII
A5VEG9_SPHWW/24-275MSPRIIFGQIKSYFTFWRKGRDAEMDYNPIQKMI........----------...........YIA-LFF-----ILIPV
Q3ABV8_CARHZ/7-189RFRDLKNFPALLRYYLFLTDEHPNWGKYNPGQKL........----------...........VYS-GWG-----VLLII
Q3JAE2_NITOC/6-172.................LVLGRPQSSETVSHWQQAI......----------........TRNLYI-LFY-----VCVII
A3PG79_RHOS1/6-157.................FVVGVPEKGTTPGDKVA........----------.........AGLQG-LLY-----LLTLL
Q89C01_BRADU/31-198..RSGLVERNSPKKTRILAMRAPARLKWGAVNII........----------...........LHW-FVY-----ALVIF
Q1QIT3_NITHX/121-299NIPNKVDVEWLKRGGGMVGHDHPPAYRFNAGQKA........----------...........VYW-IVV-----VGGGA
Q1ITC7_KORVE/20-198DEDDRLWLKNVKYYIKNEDEKLPPQGKYDAGQKI........----------...........YYW-VML-----GASIL
J9ZA39_LEPFM/17-226GLFRTLREEIHHHLSPPRDAEGKLLPPADPGHNQLA......----------........RFLYLP-LLT-----VVIPV
Q1ZU49_PHOAS/13-188PYLFGDNAVLFDDLKQLRHGKLPEPREKGLGNIIQ.......----------........GLGIGA-LIL-----IETAA
A8G145_SHESH/120-302ASYDLKWFAVLGGYLNTGKKHHPDAGFANAGEKL........----------...........WFW-VFA-----LFGGL
Q1Z615_PHOPR/4-173................FLRPTISGIKASGSLQNKI.......----------........AHVAHS-LLY-----FLMFT
A1RW11_PYRIL/6-212PLGQQIREAKALAGHYLFGRPLPEDVKTSMERHNVF......----------........VAYMAL-VLI-----ASVVL
Q7NUV6_CHRVO/15-181.................IRFRMPPPASMPARGWKM.......----------........ARRGHL-ALY-----ALGSL
Q5V2I5_HALMA/8-213KDDVDAFIQDIQFVLGRADERHPSARQFAGYKADEVPLL...----------.....SYIGKGVVF-IFS-----IELTL
Q7NL56_GLOVI/6-177.................IRTLGPARSKNWLPVVA........----------...........LHT-ALY-----TFMVV
Q0BVB5_GRABC/13-193PLSGVEKRNTKRHAPTRLMASSPGQATRPDFGHG........----------...........AAG-GWL-----ILVIL
Q47YK1_COLP3/6-182PFSKQQRQYAIEDFRSLLTLKIPKRGPHDGLAGF........----------...........TQA-FGL-----LIFIW
A5L4J8_VIBBS/13-176..................VKPEPEKRKFTFPKLV........----------............QL-VQA-----VTLTF
Q6N8J2_RHOPA/9-176................LGIDDKPEPIDGAPRSQQLI......----------........AGTVHL-LFY-----VVVFG
A0A023E6B3_AERSA/10-170LRALIPSREDFRQQAVELRERAPAAPGHHGSGKL........----------...........AVW-ALW-----LAVLA
Q87J03_VIBPA/16-183.................LIGGMPKPMTERSKFESIA......----------........AAVVMY-SLL-----ALTVV
A1HTF5_9FIRM/5-186SRHDLPHLRSFFRYYLFITEHHPNFGRYNPGQKL........----------...........LFT-AWG-----LAVLT
Q5NE92_FRATT/30-197.................FSIKPPYNPPLPLLQLII.......----------........AKIVHL-GLY-----ISAFS
Q2BLD7_NEPCE/3-170................LASVRQPIPEKGNKLLAKA.......----------........ATWAHI-FIY-----ILVFG
Q2IL72_ANADE/263-456RDDLAWLVRKPLAMAGAWRGPLPPQDKYNAGQKL........----------...........FAV-LVL-----IATAT
A8EX57_ARCB4/6-181FKDFPRGKKNIKEFLNNIFEENQKYIGHNPLASY........----------...........VMI-AML-----IVTFL
A4YRW2_BRASO/8-180.................LFNPTPALPADTPRWLAAV......----------........ARANQW-GLD-----LVTLA
A5G6W1_GEOUR/7-182FDADDRRWIEQRGGYLSREATHFNIGKYNPGQKL........----------...........FAL-FIG-----AATLL
Q1YYF5_PHOPR/9-176.................KKSGKPNALGTPMQKFSA.......----------.........NFSYA-LLV-----GTMIA

PF14358

D4L0H2_9FIRM/73-132--------------------------------------------------------------------------------
D0MK75_RHOM4/9-73--------------------------------------------------------------------------------
W0E6J3_9FIRM/78-136--------------------------------------------------------------------------------
D2QYK9_PIRSD/9-74--------------------------------------------------------------------------------
D4H642_DENA2/9-75--------------------------------------------------------------------------------
B3EM27_CHLPB/9-76--------------------------------------------------------------------------------
J7IMY2_DESMD/114-176--------------------------------------------------------------------------------
W6EIG8_SULMU/8-59--------------------------------------------------------------------------------
F2KT13_ARCVS/8-72--------------------------------------------------------------------------------
A2BLN5_HYPBU/150-207--------------------------------------------------------------------------------
B3E729_GEOLS/14-80--------------------------------------------------------------------------------
R5AVI3_9BACT/6-59--------------------------------------------------------------------------------
F4GSW9_PUSST/118-178--------------------------------------------------------------------------------
F4L3Z1_HALH1/135-204--------------------------------------------------------------------------------
G2TKP1_BACCO/83-141--------------------------------------------------------------------------------
A1BH85_CHLPD/29-96--------------------------------------------------------------------------------
L0KZY5_METHD/9-75--------------------------------------------------------------------------------
K7RVD2_PROA4/158-222--------------------------------------------------------------------------------
E6W587_DESIS/14-80--------------------------------------------------------------------------------
B4S7W8_PROA2/12-79--------------------------------------------------------------------------------
F2NIT4_DESAR/9-81--------------------------------------------------------------------------------
A6LIR5_PARD8/13-85--------------------------------------------------------------------------------
E6UI69_RUMA7/73-132--------------------------------------------------------------------------------
I2EY27_EMTOG/6-57--------------------------------------------------------------------------------
Q8TMV4_METAC/9-62--------------------------------------------------------------------------------
Q2KUA6_BORA1/118-178--------------------------------------------------------------------------------
C9RRV1_FIBSS/74-133--------------------------------------------------------------------------------
W0LFH8_9ENTR/72-131--------------------------------------------------------------------------------
D3RZ50_FERPA/13-74--------------------------------------------------------------------------------
A9WBK7_CHLAA/77-137--------------------------------------------------------------------------------
A1B726_PARDP/70-128--------------------------------------------------------------------------------
J0RX58_9EURY/9-83--------------------------------------------------------------------------------
R6EP61_9FIRM/72-131--------------------------------------------------------------------------------
Q3B233_PELLD/10-77--------------------------------------------------------------------------------
Q6APY0_DESPS/4-70--------------------------------------------------------------------------------
S6CG33_9ACTN/62-122--------------------------------------------------------------------------------
C8WKH1_EGGLE/2-62--------------------------------------------------------------------------------
G0A5D7_METMM/11-75--------------------------------------------------------------------------------
C4XNX5_DESMR/5-71--------------------------------------------------------------------------------
A7I2S7_CAMHC/7-58--------------------------------------------------------------------------------
C4XNC0_DESMR/13-70--------------------------------------------------------------------------------
A0RPQ5_CAMFF/7-58--------------------------------------------------------------------------------
W6RUZ5_9CLOT/75-133--------------------------------------------------------------------------------
C0R274_BRAHW/70-129--------------------------------------------------------------------------------
R6AFB6_9FIRM/68-125--------------------------------------------------------------------------------
E8N2M4_ANATU/72-132--------------------------------------------------------------------------------
B4SDX1_PELPB/4-55--------------------------------------------------------------------------------
Q2RX07_RHORT/14-65--------------------------------------------------------------------------------
D6Z5B1_DESAT/6-72--------------------------------------------------------------------------------
B5YIR5_THEYD/10-76--------------------------------------------------------------------------------
B3EQ00_CHLPB/8-59--------------------------------------------------------------------------------
R6P7P3_9FIRM/71-130--------------------------------------------------------------------------------
Q2RIJ9_MOOTA/9-76--------------------------------------------------------------------------------
I3YFD4_THIV6/9-59--------------------------------------------------------------------------------
F8E8X8_FLESM/7-73--------------------------------------------------------------------------------
R6CX21_9CLOT/72-131--------------------------------------------------------------------------------
F0JFF5_DESDE/5-71--------------------------------------------------------------------------------
M4R3B0_BIBTR/72-131--------------------------------------------------------------------------------
G8QTP5_SPHPG/76-131--------------------------------------------------------------------------------
R7QWY9_9FIRM/8-58--------------------------------------------------------------------------------
F4LLX1_TREBD/74-133--------------------------------------------------------------------------------
R7LCV5_9BACT/72-130--------------------------------------------------------------------------------
K0NEJ9_DESTT/6-72--------------------------------------------------------------------------------
R7F4I4_9CLOT/70-128--------------------------------------------------------------------------------
D2RHV9_ARCPA/8-72--------------------------------------------------------------------------------
R6YA34_9FIRM/72-131--------------------------------------------------------------------------------
L0GUL1_9GAMM/12-78--------------------------------------------------------------------------------
C0QZ66_BRAHW/50-109--------------------------------------------------------------------------------
X5DE85_9BACT/10-77--------------------------------------------------------------------------------
B1L3S4_KORCO/10-72--------------------------------------------------------------------------------
E4TFY8_CALNY/5-71--------------------------------------------------------------------------------
B9JJR0_AGRRK/72-130--------------------------------------------------------------------------------
G7M4T2_9CLOT/72-131--------------------------------------------------------------------------------
R5X0L1_9BACT/9-66--------------------------------------------------------------------------------
K0C3X7_CYCSP/5-59--------------------------------------------------------------------------------
R7CCE2_9CLOT/72-131--------------------------------------------------------------------------------
F2NSL9_TRES6/73-131--------------------------------------------------------------------------------
R6UA77_9CLOT/74-132--------------------------------------------------------------------------------
F5YAS5_TREAZ/76-135--------------------------------------------------------------------------------
W6EBR3_SULMU/7-73--------------------------------------------------------------------------------
R5D3A2_9FIRM/72-131--------------------------------------------------------------------------------
K9VDE1_9CYAN/16-81--------------------------------------------------------------------------------
E1RA86_SPISS/8-59--------------------------------------------------------------------------------
G0EES3_PYRF1/11-75--------------------------------------------------------------------------------
R7CST8_9FIRM/68-123--------------------------------------------------------------------------------
R5I3L3_9PORP/6-78--------------------------------------------------------------------------------
E8RC78_DESPD/24-75--------------------------------------------------------------------------------
A5UYY8_ROSS1/82-142--------------------------------------------------------------------------------
T2KM32_9FLAO/57-117--------------------------------------------------------------------------------
N0AR40_9BACI/76-134--------------------------------------------------------------------------------
M1NG91_DESSD/6-72--------------------------------------------------------------------------------
A4VFX0_PSEU5/114-174--------------------------------------------------------------------------------
B9JP15_AGRRK/72-130--------------------------------------------------------------------------------
Q3ATG1_CHLCH/8-59--------------------------------------------------------------------------------
G0L331_ZOBGA/81-141--------------------------------------------------------------------------------
R7NCG3_9MOLU/2-60--------------------------------------------------------------------------------
A1BFX6_CHLPD/10-77--------------------------------------------------------------------------------
G4STW3_META2/9-73--------------------------------------------------------------------------------
I0GHS8_CALEA/20-86--------------------------------------------------------------------------------
G7Z1L5_AZOL4/25-76--------------------------------------------------------------------------------
E1SVF5_FERBD/125-198--------------------------------------------------------------------------------
F4C4I1_SPHS2/7-58--------------------------------------------------------------------------------
A0LPC1_SYNFM/9-75--------------------------------------------------------------------------------
Q7CI97_YERPE/72-131--------------------------------------------------------------------------------
E4RQ49_LEAB4/7-58--------------------------------------------------------------------------------
A6LNM0_THEM4/27-84--------------------------------------------------------------------------------
V5UHX6_9BURK/124-184--------------------------------------------------------------------------------
Q8KFP7_CHLTE/12-79--------------------------------------------------------------------------------
W6EDS3_SULMU/5-59--------------------------------------------------------------------------------
F4HFN7_GALAU/72-131--------------------------------------------------------------------------------
D5DJ74_BACMD/77-135--------------------------------------------------------------------------------
A3CUK5_METMJ/9-76--------------------------------------------------------------------------------
Q7UE94_RHOBA/95-155--------------------------------------------------------------------------------
E1RE56_METP4/9-80--------------------------------------------------------------------------------
R6M5A8_9CLOT/72-131--------------------------------------------------------------------------------
B7GIW2_ANOFW/77-135--------------------------------------------------------------------------------
B5IFA9_ACIB4/1-67--------------------------------------------------------------------------------
A2SSD8_METLZ/31-96--------------------------------------------------------------------------------
Q8TUQ6_METAC/9-75--------------------------------------------------------------------------------
D6DHZ2_CLOSC/72-131--------------------------------------------------------------------------------
B3E2B6_GEOLS/10-61--------------------------------------------------------------------------------
F8I7H1_SULAT/39-95--------------------------------------------------------------------------------
B4SBP8_PELPB/10-77--------------------------------------------------------------------------------
Q65T96_MANSM/72-131--------------------------------------------------------------------------------
Q21KL9_SACD2/6-57--------------------------------------------------------------------------------
D2QJH4_SPILD/6-57--------------------------------------------------------------------------------
N0BAX1_9EURY/9-75--------------------------------------------------------------------------------
C8WKW0_EGGLE/72-132--------------------------------------------------------------------------------
A9AYM2_HERA2/83-143--------------------------------------------------------------------------------
C0QF61_DESAH/5-71--------------------------------------------------------------------------------
B9L860_NAUPA/5-71--------------------------------------------------------------------------------
D1B0M4_SULD5/7-73--------------------------------------------------------------------------------
H1YWY9_9EURY/9-71--------------------------------------------------------------------------------
W6RSI1_9RHIZ/73-131--------------------------------------------------------------------------------
C6BYF4_DESAD/5-71--------------------------------------------------------------------------------
M1XST7_NATM8/13-77--------------------------------------------------------------------------------
K4LE17_9FIRM/80-137--------------------------------------------------------------------------------
Q2W2B9_MAGSA/11-62--------------------------------------------------------------------------------
Q15XU8_PSEA6/79-139--------------------------------------------------------------------------------
R5U1B1_9BACE/6-63--------------------------------------------------------------------------------
A7I9H3_METB6/10-72--------------------------------------------------------------------------------
R4JZ25_CLOPA/71-128--------------------------------------------------------------------------------
D9SQY3_CLOC7/76-134--------------------------------------------------------------------------------
A1AR53_PELPD/10-61--------------------------------------------------------------------------------
E4U6D1_OCEP5/21-87--------------------------------------------------------------------------------
K0NB22_DESTT/5-71--------------------------------------------------------------------------------
I4D2J4_DESAJ/77-135--------------------------------------------------------------------------------
C9R964_AMMDK/9-90--------------------------------------------------------------------------------
F8ABZ1_THEID/4-70--------------------------------------------------------------------------------
B8FH86_DESAA/4-70--------------------------------------------------------------------------------
H1XS36_9BACT/14-80--------------------------------------------------------------------------------
R5AVH3_9BACE/10-63--------------------------------------------------------------------------------
R5X3I1_9CLOT/76-130--------------------------------------------------------------------------------
A8F7I9_PSELT/58-115--------------------------------------------------------------------------------
Q8A5L2_BACTN/9-66--------------------------------------------------------------------------------
K4LFC8_THEPS/9-79--------------------------------------------------------------------------------
Q3B3K8_PELLD/8-59--------------------------------------------------------------------------------
Q7UGQ3_RHOBA/4-55--------------------------------------------------------------------------------
W6RUQ3_9CLOT/77-135--------------------------------------------------------------------------------
D5V7U4_ARCNC/6-72--------------------------------------------------------------------------------
L0H0I4_9GAMM/9-59--------------------------------------------------------------------------------
S6CE05_9ACTN/67-127--------------------------------------------------------------------------------
F0S3U2_DESTD/5-71--------------------------------------------------------------------------------
R5W765_9BACE/6-63--------------------------------------------------------------------------------
A0LNU4_SYNFM/14-72--------------------------------------------------------------------------------
R5LI07_9SPIR/70-129--------------------------------------------------------------------------------
B0VH29_CLOAI/15-63--------------------------------------------------------------------------------
V4JBA5_9DELT/6-72--------------------------------------------------------------------------------
S6C133_9ACTN/57-117--------------------------------------------------------------------------------
B3QVT3_CHLT3/9-64--------------------------------------------------------------------------------
D4IPJ8_9BACT/10-82--------------------------------------------------------------------------------
R7CTR1_9FIRM/68-124--------------------------------------------------------------------------------
Q11BF1_CHESB/72-130--------------------------------------------------------------------------------
E8T206_THEA1/5-71--------------------------------------------------------------------------------
I0GQA3_SELRL/62-115--------------------------------------------------------------------------------
Q3A6A8_PELCD/4-70--------------------------------------------------------------------------------

PF03188

ACFR1_ARATH/49-182LHSW-----------------------------------------------------------IGI-GVI-----SLYGF
A5C961_VITVI/49-182LHSW-----------------------------------------------------------LGI-VLI-----SLYGI
Q6Z1Y9_ORYSJ/56-192LHSW-----------------------------------------------------------IGI-ATI-----SLYAL
Q9FVY1_ORYSJ/46-178LHSW-----------------------------------------------------------VGL-GTI-----CLYGV
ACFR2_ARATH/50-183LHSW-----------------------------------------------------------LGL-ACL-----FLFAF
Q6YW65_ORYSJ/51-184LHSW-----------------------------------------------------------LGL-SCI-----IFFSL
ACFR4_ARATH/43-175LHSW-----------------------------------------------------------MGL-LSV-----SLFAA
Q10DW5_ORYSJ/60-193LHSW-----------------------------------------------------------LGI-LAV-----ALFGL
Q7XH60_ORYSJ/58-190LHAW-----------------------------------------------------------LGI-TTA-----ALYAF
Q28YW1_DROPS/100-238LHSW-----------------------------------------------------------LGF-VTM-----GMFVL
A7UTA7_ANOGA/98-236LHSW-----------------------------------------------------------LGM-ITM-----GLFAL
CYAC3_MOUSE/46-182LHSW-----------------------------------------------------------LGI-TTV-----VLFAC
CYAC3_DANRE/47-182LHSW-----------------------------------------------------------VGI-CTA-----ALFTA
F7AAH4_CIOIN/56-190LHSW-----------------------------------------------------------CGM-TTV-----ILFCL
A7RY72_NEMVE/55-189LHSW-----------------------------------------------------------LGL-CTV-----LLFTF
CY561_CAEEL/62-204LHSW-----------------------------------------------------------IGL-SVV-----ILYFA
CY561_HUMAN/52-186LHSW-----------------------------------------------------------CGI-LVF-----VLYFV
CYBR1_HUMAN/49-185LHSW-----------------------------------------------------------VGL-IAV-----ICYLL
F6U164_XENTR/54-190LHSW-----------------------------------------------------------IGL-TVV-----ILYAL
CYBR1_DANRE/47-183LHSW-----------------------------------------------------------VGL-AAV-----VLYPS
Q7Q742_ANOGA/55-192LHSW-----------------------------------------------------------VGL-SAV-----ILFSL
Q9I7U1_DROME/146-282LHSW-----------------------------------------------------------LGL-SAV-----IVFSL
O16272_CAEEL/98-231IHSY-----------------------------------------------------------LGV-CLL-----LVYSG
A8X7F4_CAEBR/71-205VHSW-----------------------------------------------------------IGV-CLI-----AVYLV
Q29JT1_DROPS/48-184THAS-----------------------------------------------------------LGF-AAF-----ILCLI
Q9VIT6_DROME/48-184LHAR-----------------------------------------------------------LGF-AAF-----VLCLI
Q9VIT5_DROME/94-228THGR-----------------------------------------------------------LGM-TAF-----VLCIL
Q9VIU6_DROME/47-182WHGR-----------------------------------------------------------VGG-AAS-----FFCAA
Q17ID4_AEDAE/154-293THSI-----------------------------------------------------------LGL-VAL-----ILLVL
A0NFY4_ANOGA/64-202THSI-----------------------------------------------------------VGL-VSL-----AFLAL
Q7PZD0_ANOGA/60-198LHGI-----------------------------------------------------------FGL-VTV-----CLTLV
Q16LW8_AEDAE/141-279THAI-----------------------------------------------------------VGL-ITV-----ILTLA
C56D1_MOUSE/54-191WHSW-----------------------------------------------------------IGA-LTL-----LATGG
F1R6P8_DANRE/63-200WHSY-----------------------------------------------------------LGV-STM-----ATTLL
H3BZA9_TETNG/61-199WHSL-----------------------------------------------------------FGV-GTL-----VATVV
Q1LXB7_DANRE/47-184WHGL-----------------------------------------------------------IGV-VTV-----AVVVF
H3DB33_TETNG/49-185WHGV-----------------------------------------------------------LGA-MTL-----WVVML
C56D2_BOVIN/47-184WHGR-----------------------------------------------------------AGL-LAV-----LWAGL
Q5I024_XENTR/47-183WHGL-----------------------------------------------------------LGV-LTV-----LWTLL

PF01794

FRO8_ARATH/159-281.............I.EEEIWKWQRTGRVYV............----------...........AGL-ISL-----VTGLL
FRO6_ARATH/178-300.............L.LELIFSWNAIGIAIL............----------...........PGV-ISL-----VAGLL
Q4WR75_ASPFU/273-390................SGNAWKKMQKPYLL............----------...........WGT-LAM-----LAMIL
Q4WC00_ASPFU/90-202....................DFNIQKIDNI............----------...........FAI-IGA-----GVLGA
Q4WRK0_ASPFU/107-219...............QDHEFSFPLSEMQNL............----------...........FTI-IGA-----ASLGA
Q4WF95_ASPFU/130-249................TATLQEHLASLKII............----------...........LGI-ASF-----MSLFA
AIM14_DEBHA/94-207................EGSLFTKSVRLWNF............----------...........LGI-VVF-----MLNLI
Q6BTD9_DEBHA/151-272...............AEVLHLNFTSDFAYY............----------...........SGL-PPL-----ILLGL
Q6BXT5_DEBHA/276-393................EGDYAMWAVDAYWQ............----------...........WGM-VSM-----IILGL
Q0U921_PHANO/152-271................SGFLAKRIKDWDVI............----------...........WGI-VSI-----ALFAT
Q0UXV8_PHANO/43-161................DILKSQEEGMAVVR............----------...........YGV-ATY-----AMLIW
A5DEQ5_PICGU/148-261................RNHTWGKAIKPENL............----------...........YGW-AAF-----TGFIM
Q6C644_YARLI/142-255....................MYLITEFWSI............----------...........MGI-LAF-----VAFVV
FRE7_YEAST/161-282...............YERMHQRWKASDMWR............----------...........SGV-PPI-----LFLNL
RBOHJ_ARATH/366-523......DYAGNLLGAKQPTYLGLMLTPVSV............----------...........TGV-LMI-----IFMGI
Q0TVR2_PHANO/35-155...............GWSGFLEYWERHYFW............----------...........NGE-LST-----VAMCA
A3GFP0_PICST/241-358................LHGYSYYMHHSFIR............----------...........WGV-VGA-----VSIGV
A5DPY7_PICGU/304-417....................ILTDFEAYII............----------...........AGG-LAI-----IAGVF
A0JNK9_BOVIN/259-407......QQVHANIENSWNEEEVWRIEMYIS............----------...........FGI-MSL-----GLLSL
YEDZ_RHORT/50-165...............WGAIWADIVKRTYIT............----------...........VGM-AAL-----LLLVP
Q217F0_RHOPB/43-167..............FAWETLSAFDEGWAVW............----------...........SGW-LGL-----LVLML
A0LQW5_ACIC1/61-184.............GLIRQTSDLLLHYPDVL............----------...........MAT-VAL-----GLFVG
A1TKU8_ACIAC/46-161...............VPEIARDIAKRPFIL............----------...........VGM-LAF-----ALLLV
A6VUY1_MARMS/1-130...............WTWISSDLVEKPYIY............----------...........VGV-AAL-----SIMAV
NOX4_PONAB/58-205..............YSEDFVELNAARYRDEDPRKLL......----------....FTTVPGLTGV-CMV-----VVLFL
Q5A445_CANAL/308-425................TGKYNTRMKRDFMI............----------...........WGV-VAT-----ICAGF
Q0APN2_MARMM/57-179............SGALAALWRDVTDRIYIT............----------...........LGM-SAF-----ILLLP
RBOHC_SOLTU/408-565.............ASEEAYEPMIYYFGEQPESYWWF......----------....VRGVEGVTGI-IMV-----VLMAI
Q5FQ04_GLUOX/56-169...............WSVLWVDMTHRYFII............----------...........LGM-SAL-----VLLIP
Q5E5I2_VIBF1/37-166.........PTHAGKERVITGVDWISLAEK............----------...........VGD-ISF-----KVFIL
Q82R51_STRAW/62-185...............YGYAHRTASVGMGHL............----------...........LGA-VSA-----IGLLL
Q2H7Y7_CHAGB/153-271................DAVEYQIKMMPSIK............----------...........YGL-GAW-----GVLLW
A7TPB1_VANPO/264-381................SGWYKSAFSSDYWN............----------...........YGV-AAM-----VFLGI
Q6C0I9_YARLI/142-260................HQIQNQVSTNTFAL............----------...........KGF-GAF-----GILCW
Q7SFF5_NEUCR/239-364.............MLASKTAWAYFTHPLIL............----------...........CGL-GTF-----TSYEL
Q2H477_CHAGB/186-307...............WGGVQQKILGDRFIA............----------...........SGT-VGV-----AAMVI
DUOX2_PIG/1081-1230...........LLACVFPSVFVNDGSKLPQKFYWWF......----------....FQTIPGMTGV-LLL-----VVLAI
Q6N633_RHOPA/45-180......PAHPQEDAALGFDLFRDLKHPAAE............----------...........VGE-WAL-----YALVV
Q28MM2_JANSC/56-182..........EALLTSNTAFDQILGFPIEA............----------...........LGM-FAL-----FILLI
Q9L1A8_STRCO/50-176............GDIVAQTVDSVNQLPDMG............----------...........KAA-IGT-----GLLVV
Q0ACJ0_ALKEH/56-177..............PGVVVPAPSSGLAEGL............----------...........TGV-IAW-----LVLGT
Q21DI1_SACD2/35-149...............WGLIGEELVKRTYIV............----------...........VGF-IAW-----LILLA
Q82L18_STRAW/83-206.............DPVNQLVDLAETVEGVL............----------...........RAV-VAL-----TIIVV
A0A0D1E108_USTMA/139-260...............VTGLREEFFSDSINT............----------...........TGV-IAY-----VCLFV
Q0BQQ1_GRABC/59-172................WLICSEIGSHFYLL............----------...........IGL-VAL-----CGLVV
AIM14_VANPO/88-208...............ENVSIAIKLQNPKNV............----------...........LGL-IML-----IPSLL
Q6CUH0_KLULA/305-422................EDYWKYAKNSATFQ............----------...........SGR-FAM-----WYIGG
A1WD64_ACISJ/52-181..........RPARDAVLPWLTDARGFAKD............----------...........LGE-MAF-----YLLLA
Q6FMR3_CANGA/107-225................KTDLDAKLSNKYNF............----------...........AGI-VIA-----GISII
Q7PNG0_ANOGA/297-444................TIVVYDPVLNANNYTTAEWLFTARPG----------LFGLIGGCANPTGV-VLV-----LILLI
AIM14_ASHGO/94-211................EVSLASKLFNLWNL............----------...........LGF-IVW-----ILLII
Q4D1K3_TRYCC/390-520..............PRGIFSIPMVDKPGHINNF.........----------.......TVPLISL-TTW-----FMIVA
A1C8X0_ASPCL/194-313................GLTALAWDTNKLFR............----------...........SGI-VPY-----VF