Sequence alignment for CL0330

PF09794

Q7QF11_ANOGA/7-482---VLHILVVGFHHKKGCQVEFSYPPL.VAGTEGKGECPSGWKYLPTLALPDGSHNFSSDFVC-FNLP............
Q29HH8_DROPS/14-480---ILHILVVGFHHKLGCQVEFSHPPL.IAGSSGRNECPSGWKYLPTLALPDGSHNFVEDTVF-FNLP............
Q6BP02_DEBHA/131-552---IFAVCLVDFHHVRGPEIQWWRSN....YYPSYPQDNKLFKNLPFQALPDGSHLFEETFSN-FNLVYDFKTGKSYDDG
A5DNM6_PICGU/119-523---IFAVCLVDFHHSRGPEVEFWKS......NYHHNYSPSLFKNLSFQALPDGSHQHEETFSN-FSLVYDFVTGLSYDDG
Q2H333_CHAGB/18-368---IPLVSVVDFHHARGPEVERWFGV....DEGHDPAAEYDWTLLPFMALSDGAHALTEDFSY-FTLLRPA.........
AVL9_PONAB/16-520---VLHIVVVGFHHKKGCQVEFSYPPLIPGDGHDSHTLPEEWKYLPFLALPDGAHNYQEDTVF-FHLP............
Q4P7V8_USTMA/140-510---ILGIAVVDFNHLVGPQIEYTYP.......KELQQDEDLVKSLPFLALPDGSHLSDEDFCY-FHLH............
Q17GP2_AEDAE/7-476---ILHILVVGFHHKKGCQVEFSYPPL.IAGSEGKQECPSGWKYLPTLALPDGSHNFNKDFVC-FNLP............
Q6C028_YARLI/516-899---LFSVCIVGFHHSLGPQIEEWFG.........PEDYSHLWPNLPFQALSDGSHSREEDFSY-FTLLFDENNKSAPGAG
Q54NJ9_DICDI/6-452---IEYIGVIGFHHSLGHRIEFLYP.....DLDEESKKQYNWNLLPFYGIADGVHNSFEDYTF-FIMEEIN.........
A1CPG6_ASPCL/9-384---APIVMVIDFHHARGPEIELCIG.....EDGTDIATENDWSLLPFMALSDGAHASTEEFSY-FTLRKKE.........
Q6FIU1_CANGA/8-406---ILGVCLVDFHHKRGPEVEYWEG.....LDDTGIDSQHLWPNLPFQALPDGSHSFKETFTY-FTLLYDSVNKCSPP.S
Q08D17_XENTR/21-516---VLHIVVVGFHHKKGCQVEFSYPSLMPGEEHDSHILPEEWKYLPFLALPDGAHNFQEDTVF-FHLP............
Q6CKD3_KLULA/6-399---VFGCGLVDFHHTRGPEIEYWYD.....GGTTALNVNNLWEYLPFQALPDGAHSYEQSFTY-FTLLYDEVNKKCCSSV
Q750W9_ASHGO/13-401---VFGVALVDFHHTRGPEVEHWHS.........DELQNCTWNNLPFQALPDGSHSFEETFTY-FTLLYDEGRHRGLN..
Q5KDB3_CRYNJ/119-529---VLGIAVVDFNHLIGPTVEFAFPP...SLQNALSVDENLSKELPFLALPDGAHLSEEDYSY-FHCTFSPSTHNS....
AVL9_YEAST/9-401---IFGICLVDFHHKRGPEIEYWYG......LPEGTQSAELWPNLPFQALPDGSHSFEETFTY-FTLLYDERRQRSPP.N
A3LPG1_PICST/85-492---IFAICVVDFHHSRGPEIQWWKSN...YHPEYTQ...SLFKNLSFQALPDGSHLFEETFSN-FNLVYDFQNSESIDNM
AVL9_SCHPO/10-367---VLCLATIGFHHLRGPEIEHLFP........ESMDFPKEWSILPFLSLPDGAHSSEKDFVY-FTL.............
Q5AIP1_CANAL/191-588---IFAICLVDFHHQRGPEIQWWKSN...YHPDYKQ...GLFKNIPFQALPDGSHLFEETFSN-FNLVYDFDQKQSIDDF
A7TEK5_VANPO/8-400---IVGVGVVDFHHTRGPEVEYWHG......LPEGTDESTLWPNLPFQALPDGSHSFKETFTY-FTLLFNPKTKTCPQ.G
H3CTF9_TETNG/13-493---VLHIVVVGFHHKKGCQVEFSYPPLVPDEGHDSNVLPDEWRYLPFLALPDGAHNYQEDTVY-FHLP............

PF09804

YKE7_YEAST/33-335------IFLSKFDMKKGNIIIWSKS-------IN.GAAIDLSN.IEFKSLPAGIHEQTDDVVN.FVVPKE----------
Q6FLQ0_CANGA/9-288------VFLCQFDMSRGNTLVWSAR-------D...NDPLLKG.IEFKALPSGIHEVSDDVIR.FCIE..----------
A7TLL1_VANPO/24-351------IFLSQFDMKRGNVIVWSKL-------NE.NCNINLQG.TEFKSLPSGVHEVSDDVIN.FILPKE----------
Q75DG5_ASHGO/36-366------MCLTKFDVKKGNTVLWTTS-------L..APEHKLHN.IEFKTLPAGIHESEQDWVN.FVLP..----------
A5DGT1_PICGU/16-298------TFLVQFDTKTGYKLVWSKC-------N...PSLSLSG.IEYKALPSGIHECDSSTVF.IVHK..----------
C5MJC0_CANTT/11-295------VFLAEFDVKSGYKLVWSKS-------V..IPEFDFDG.LDYKAFPSGIHEFNNSTVL.ISHC..----------
A3LNE8_PICST/19-334------MFLVQFEVRTGYEIVWSKS-------V..IDGYDFSG.LDFKVLPSGIHEFDKATVL.VSHL..----------
Q6BJB8_DEBHA/28-311------LFLIHFDVRRGYQLVWSKQ-------AKSRPPIDLGG.LDYKVLPSGIQEHTTSTVF.ISHA..----------
B8M2T3_TALSN/30-332------LFLILFDIKKGYVISWQES-------I...PGIDLEGAVEYKSLPSGLHNVSEDLIY.FV....----------
A2QAY7_ASPNC/31-357------LFVIRFDIKAGYVISWKRT-------V...PGVEVEGAVEYKSLPSGLHNVSEDLVY.FV....----------
A1CNU9_ASPCL/30-339------LFVIRFDIKAGYVISWKRA-------I...PGVEIEGVVEYRSLPSGLHNVSEDLIY.FV....----------
Q5BF30_EMENI/30-339------LFVIHFDVKAGYTVTWKRT-------I...PGVEVEGAVEYKSLPSGLHNVSEDLVY.FV....----------
F2PVM8_TRIEC/26-326------LFLIRFDIRAGYTIAWKKT-------A...SEIVLDNAVEFKSLPSGAHNVKEDLVY.FV....----------
E9CY67_COCPS/13-322------LFLIHFDIKAGYTIVWKES-------L...PDVVLHDVVEFKSLPSGLHNVKEDLVY.FV....----------
C0S3V5_PARBP/84-387------LFLICFDIKAGYAIKWKRS-------N...PDVVLENVVEYKSLPSGLHNVREDLIY.FV....----------
D5G5F9_TUBMM/21-341------LFVIYFDIKAGQTIIWKKF-------A...QGVSLSG.VEFKSLPSGLHNLVEDLVY.FV....----------
E3Q807_COLGM/29-348------LFLIDFDVKAGYTIVWKQA-------A...PGIELEGLVEYKSLPSGLHTVPDDLIY.FV....----------
E9F1A8_METAR/37-350------LFLIDFDVKAGYTITWKRA-------V...PHVELDGQVEYKSLPSGLHTVRHDLIY.FV....----------
C7YNX8_NECH7/29-347------LFLIHFDVKAGYTILWKQS-------A...PGVELEGLVEYKSLPSGLHTVSEDLIY.FV....----------
B2AXI7_PODAN/33-356------LFLIDFDVKAGYTIVWKRA-------V...PGLELEGAVEYKSLPSGLHTVTDDLIY.FV....----------
Q0V1B2_PHANO/27-300------LFLIRFDKKVGYTIAWKRT-------T...TDIELENAVEYKSLPSGLHAQASDLVY.FT....----------
B3RV35_TRIAD/7-273------LFVISFDTKSGNVVEYCVP-------....SGVQLNA.VEFKAMPSGSHTVSEDFVY.FR....----------
LCHN_DANRE/114-382------VFVVTFDTRSGNMIEWCLP-------....HDVNLEG.VEFKSMASGSHRISSDFIY.FR....----------
B7QCC0_IXOSC/54-313------VFVIAFDTRAGNTVEWWTP-------....KELDISG.IEFKAMASGAHRVHTDFIY.FK....----------
F2UE85_SALR5/10-285------VFVVDFDALKGNSLRWQYP-------....NDVELPF.VEFKAMPSGSHSVLEDFPYGFL....----------
YBAG_SCHPO/6-296------IVLATFDAKEGYNVENYYP-------....GDFNVEG.IEYLLFPSGIQELDNCTIF.FR....----------
Q5K7R2_CRYNJ/10-298------VFLTYFDDIKGQSVLYYSS-------L...PDIP.EGTIEHATLPSGLHNLSEDLIC.FR....----------

PF08616

YG76_SCHPO/260-373--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_PICPG/305-418--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
Q4P9F2_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------
E7QKR4_YEASZ/211-334--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------
Q5KLM3_CRYNJ/358-470--------------------------------------------------------------------------------

PF07792

D4AU15_ARTBC/26-120--NFACVFLAKRDETKEKDRKKQRK-----------RR...................-----------------------
MESA_EMENI/79-211--HVEFILVASFHIDRGPIMEHQYP-----------GP..ISSD...........EG-----------------------
A2Q8P4_ASPNC/82-209--HVEYILVASFHIDRGPIMEHQYP-----------AA..ISGD...........ES-----------------------
A1CRY6_ASPCL/85-213--HVEYILVASFHIDRGPIMEHQYP-----------AA..ISGD...........ES-----------------------
B6HSJ1_PENCW/75-202--HVEYILVASFHIDRGPIMEHQYP-----------AA..ISGD...........ES-----------------------
C0SET4_PARBP/168-287--HVEYILVASFHVDRGPIMEHQYP-----------SA..ISGD...........EN-----------------------
F2TNB3_AJEDA/90-216--HVEYILVASFHVDRGPIMEHQYP-----------SA..ISGD...........EH-----------------------
E9DDS1_COCPS/90-219--HVEYILVASFHVDRGPIMEHQYP-----------AA..ISGD...........EH-----------------------
B8MHD8_TALSN/85-217--HVEYILVASFHIDRGPIMEHQYP-----------SA..ISGD...........EG-----------------------
F0XQA1_GROCL/147-315--HVEYILVASFDIDKGPIMEHQYP-----------VA..ITGD...........EH-----------------------
Q7RXB5_NEUCR/122-213--HVEYILVASFDIDRGPVMEHQYP-----------VA..ITGD...........EH-----------------------
B2AXK1_PODAN/123-264--HVEYILVASFDIDRGPIMEHQYP-----------VA..ITGD...........EH-----------------------
Q0V5R0_PHANO/110-243--HVEYILVASFDIDRGSIMEHQYP-----------AA..ISGD...........ET-----------------------
Q6CGA4_YARLI/9-78--HIEYVLAAEFDIDAGPVVKYQYP-----------DT..LPGD...........EQ-----------------------
A0C6F7_PARTE/1-152--MIKALFAAEF.LVKGCVITASYP-----------QT....GD...........SG-----------------------
Q23F93_TETTS/1-94--MIDVIFCSEFDLLKGCVVKAHYP-----------EN..FEYD...........EI-----------------------
D2VRW9_NAEGR/60-215--GIEYIFLAEFDIDKGSIVKVQYP-----------SP..YPYA..........TEY-----------------------
E9BZT8_CAPO3/13-108--LVHHILVSEFDIDKGSGLAHQYP-----------TP..TGAS...........ES-----------------------
D3BKL1_POLPA/154-231--NVEYILLAEFDIDIGSKVKYQYP-----------CP..TGED...........EA-----------------------
F0ZTU4_DICPU/95-230--LVEFILLAEFDILQGSKVNIQYP-----------YPIATGGM...........EL-----------------------
C4Y911_CLAL4/3-80--NISFIVTAEFHVDKGPSLIHQYP-----------NV..LPGS...........EG-----------------------
C4R3J0_PICPG/6-86--SLAYILTAEFDKSKGIVITNQHP-----------CEDDSWLL...........SS-----------------------
A7TRE4_VANPO/73-221--NVHFILSAEFDNKLGPKVKFQYP-----------NS..IPGF.PSSLHGAHSLDS-----------------------
C5DZH0_ZYGRC/8-97--NVDYLLTAEFDNRFGPVVRDQYP-----------SV..IPGFEYEMREGHSQNNA-----------------------
Q75BQ9_ASHGO/49-189--NVEYILAAEFDNKLGPVLKHQFP-----------KN..LPGF.......KSTNSN-----------------------
A0A023ZHY2_YEASX/26-188--NVSYIISAEFDNKLGPILKHQYP-----------KD..IPGFNQFSHEQRNGNTS-----------------------
Q6CPS0_KLULA/28-167--NVQFIIAAEFDNKSGPIIKHQYP-----------KT..IPGF......KTIGSDS-----------------------
C5DJD2_LACTC/29-162--NAQYIISAEFDNKVGPVIKHQHP-----------KP..LAGF......KSSTSRS-----------------------

PF02141

DEN4C_MOUSE/307-491NSNKCICLLSHWPFFEAF.KNFLMF---IYKVSVSGPH............PLPIEKHISHFMQNIPFP------------
DEN5A_HUMAN/202-390YVSKCICLITPMSFMKAC.RSVLEQ---LHQAVTSPQPP...........PLPLESYIYNVLYEVPLP------------
DEN5B_HUMAN/187-375YVSKSICLITPLPFMQAC.KKFLIQ---LYKAVTSQQPP...........PLPLESYIHNILYEVPLP------------
Q0US70_PHANO/395-592WIPRAYGVMGRDASLTPFWKEWLKA---VVVPMTNGAILRVPASSPRIGMWQPLERYVVNLCAEALSP------------
Q0UM90_PHANO/167-348WIPYCLSFLSRYPLYNLL.GDYLRG---MWIHWNKAT..............NLFHAEEVSRILSFPAP------------
Q54JA6_DICDI/110-305KILECLCIISHHAWSSTF.GSMLEI---LETRYRVSI..............DEIHNFLAASLLS.VIP------------
Q55DD7_DICDI/109-294IEPICYCIISRKPFFKLF.DRVFIA---IQEKYEIKSK.............NSIHNLLSA.LIAYPIP------------
DEN2C_HUMAN/586-770RLPEVYCMVSRLGCFNLF.SKILDE---VEKRREMSP..............ALVYPFMRS.VMEAPFP------------
Q5RHZ1_DANRE/778-962RLPEVYCVISRLGCFNLF.SKILDE---VERRRGISA..............ALVYPFMRS.VMESPFP------------
A7RR72_NEMVE/298-481HTNKCICILSHWPFFEAF.KKFLSQ---LYRISVSAQQ.............IPIERYIANMMLDVPFP------------
DEN4B_MOUSE/313-497RSRRAIAVLSRWPAFPAF.RAFLTF---LYRYSVSGPH............RLPLEAHISHFIHNVPFP------------
Q7PWX7_ANOGA/311-495HVNKSICILSRWPFGDTF.EKWLQF---LHQLSILDEKL...........PVPIERYITHLLDEVPFP------------
Q9W3D2_DROME/308-492HMIKAICLLSHHPFGDTF.DKWLKY---LHRMVLYDVNI...........PIPVERYITQLLDEVPFP------------
MTMRD_HUMAN/116-298FAPKSLVLVSRLYYPEIF.RACLGL---IYTVYVDSLN.............VSLESLIANLCAC.LVP------------
Q1LXZ0_DANRE/117-299YAPRSLVLVSRLDHTEVF.RNCLSL---IYTVHVDGLT.............VPMETVIGNLLTC.IIP------------
Q7KSP6_DROME/142-325YAPKCLVLISRLDCAETF.KNCLGT---IYTVYIENLA.............YGLETLIGNILGCIQVP------------
Q177S0_AEDAE/106-289YAPKCLVIVSRLDYIETF.RNCLGT---IYTVYLESLK.............FHLHHLIGSILGCIQVP------------
A7SZQ4_NEMVE/186-373MVSKCISIIMPLPFITAA.MSYLQQ---IYHAAKTADL............PLPLESYIYNLLYEVPLP------------
Q54VP0_DICDI/908-1097YAPKCICVLSHFPFFSSF.RVALNE---IYHRVFHNPS............PIPIERYIFNLVSEIQLP------------
Q2GNY8_CHAGB/440-637WTPRAFGILGRDPAKMGFWKEWLRA---VTVPMTDGAVMRISPSSPKVGRWQPLERYVINLCTEAFSP------------
A7EF60_SCLS1/465-662WIPRAYGILGRDGSMTSFWKEWLKA---VVVPMTDGGILRVPASSPKIGRWQPLERYVVNLCTEALSP------------
Q0CL54_ASPTN/423-620WIPRAYGILGREENMTSFWKEWLKA---VVVPMTDGGVQRIPPSSPRMGVWQPLERYVMNLCTEAFSP------------
DENN_SCHPO/362-562WIPNAYGLLSKHSHLQSFCRDWLRI---VCSSIQAEDLDFIPSSDLNSLKSLNLQSFVKNICCDVPLP------------
DEND3_MOUSE/187-373FVPFAVCVVSRFPYYNSL.KDCLSC---LLTHLKLCKDFE.........VDNHIKDFAAR.LSLIPSP------------
A1Z7Q5_DROME/98-283RTNTAMVLITYLPWHDTF.LKLLPV---LAELRRTDP..............NGFRTFLSE.AYNQGIP------------
Q7Q1I7_ANOGA/88-273KSPTAMVIITYLPWHDTF.MRFLNV---LADIRKNRP..............NEFASFLAE.SYNKGVP------------
B8JLM2_DANRE/225-405.LPEAYCIISNVACFGLF.SKIFDE---VEQRRKISM..............AMIYPFMQS.LREAAFP------------
F1N1V1_BOVIN/150-332.LPRVYCIISCIGCFGLF.SKILDE---VEKRHQISM..............AIIYPFMQG.LREAAFP------------
F1QFB0_DANRE/165-345.LPEAYCIISHVACFGLF.SKIFDE---VEKRRQIST..............AMIYPFMQS.LREAPLP------------
F1RDS6_DANRE/306-489.VKKSICVLSHWPFFSVF.QKFLTF---IYRYSISGPH............VLPLEKHISSFMHNVPFP------------
F6SD79_XENTR/91-270..RSCLCILSCLPWFEHF.YKLLNN---VAEYLAKDQA.............AEIWHLLQT.LYQHPVP------------
F7CWX4_XENTR/145-326..PEVYCIISSLGCFGLF.AKILDE---VEKRREIAT..............ALIYPFMQG.LREATFP------------
H2UHI4_TAKRU/223-407YSNKSICLLSHWPFFQSF.RSFLTF---LYRYSISGPH............ALPIEKHISHFMQTVPFP------------
H3CCM9_TETNG/318-499.LPEVYCIVSRLGCFDLF.SKILDE---VEKRRAISP..............ALVQPFMRG.IMEAPFP------------
H3CZX5_TETNG/307-489.LPEVHCIVSKLGCFNLF.AKILEE---IERRREVSP..............ALVYPFMRS.VMEAPFP------------
H3D3K0_TETNG/203-391YVSKALCLFTPLPFLHAS.RQFLSQ---LHQAVASHSPP...........PLPLESYIHNILYEVPLP------------
H3DM09_TETNG/192-375..AYSFCVISKYPYFTAL.KDCLTC---LSIQLRTCCLSD.........MEETVKEFAAK.LALVPIP------------
U4PB89_CAEEL/329-512..NVSICLISRFPFFNSF.KRFLFF---LHRMSSTPSCS..........HPVPIERYISHLMYEVSFP------------

PF09794

Q7QF11_ANOGA/7-482.......SLTDPEQSV-----YGISCYRQIALEEV....RIRTADLTRSTVQKSVCTLL-------------------SL
Q29HH8_DROPS/14-480.......SLFEPAASI-----YGVSCYRQIRVEKL....KIRTADVTRSTVQKSVCILS-------------------RQ
Q6BP02_DEBHA/131-552EDYNSFDGDPRHLETL-----FGCSCVRQVKTSDLSDEEISRNKDITRSIVQKAVVVIA-------------------KN
A5DNM6_PICGU/119-523DDYDNFQGDPRHLRTL-----FGCSCVRQVKTSDLSDLEMARNKDITRSIVQKAIVVIA-------------------CN
Q2H333_CHAGB/18-368.......TSSAPATSL-----FGISCTRQMDASQL....LNRPAEVTRSTVQKAVVVIA-------------------DS
AVL9_PONAB/16-520.......PRNGNGATV-----FGISCYRQIEAKAL....KVRQADITRETVQKSVCVLS-------------------KL
Q4P7V8_USTMA/140-510.......CSKLSPSTI-----FGISCNRQIAADAL....LKKGAEVTRSTVQKAIVVLA-------------------KQ
Q17GP2_AEDAE/7-476.......SLTDPHESI-----YGISCYRQIPVEKL....KIRTAEMTRSTVQKAVCALL-------------------SI
Q6C028_YARLI/516-899GYSDGRPFNTQTVTTL-----FGIACNRQVGVTDA....LKQDLAVTRSTVQKCVVVIC-------------------RK
Q54NJ9_DICDI/6-452.......PTTSPSKKL-----YGLSYFKQKNKRDLP..KQAITPEDTRSSIQKSVVILS-------------------KF
A1CPG6_ASPCL/9-384.......TATEPATSL-----FGIACSRQIDSNLL....LNRPSDVTRSTVQKAVVVIT-------------------DT
Q6FIU1_CANGA/8-406NSSNELGENSENYTTV-----FAISCSRQIKSDEL....IAKDEDVTRSTVQKAVVVIS-------------------FE
Q08D17_XENTR/21-516.......PRCGDQKTV-----YGVSCYRQIEAKAL....KVRQADVTRETVQKSVCVLS-------------------QL
Q6CKD3_KLULA/6-399GDSLKDGDQSGRYSTF-----FAISCSKQIQSDTL....IKKPKDVIRSTVQKSLVVVC-------------------RK
Q750W9_ASHGO/13-401GIDEVEEDNVDECTTL-----FAISCSRQIKSEEL....LKKGVEVTRSTVQKSLVVIS-------------------RV
Q5KDB3_CRYNJ/119-529.QQHNAETNIPTNQTL-----FGISCNRQLASSEL....HRRPSDVTRSMVQKAVIVIA-------------------SH
AVL9_YEAST/9-401GATDLSDDSINDNTTL-----FAISCSRQIKSDEL....VTKDKDVTRSTVQKAIVVIS-------------------RQ
A3LPG1_PICST/85-492SDLNDYQGDPRHLRTL-----FGCSCVRQVKTSDLSQEERDRNKDITRSIVQKAIVIIV-------------------RK
AVL9_SCHPO/10-367.......PFPNDEGTV-----FGLSCTRQLNASSL....KNIPSDVTRSSVQKAVVVIT-------------------TS
Q5AIP1_CANAL/191-588NDVNNFKGDPRHLKTL-----FGCSCVRQVKTSDLTEEERERNKDITRSIVQKAIVVIT-------------------RK
A7TEK5_VANPO/8-400GATGLTEEERKECTTL-----FAVSCSQQISSEEL....LHKDKEVTRSTVQKAIVVVS-------------------YQ
H3CTF9_TETNG/13-493.......PLGGDKKCV-----YGVSCYRQIEAKAL....KVRQADVTRETVQKSVCVLS-------------------RV

PF09804

YKE7_YEAST/33-335-------LDVCQT.AKTTTYDYGIAYFKQNSFDIIENDNRI..DRSKVQMFSLGVIIDVQNASSD...SKKHFYKEIYHA
Q6FLQ0_CANGA/9-288-------..YEQT.QY.....YGICCYLQNAFEVLDNEGQV..DRSKVKMYSLGVIVDPSQI.........SDDLRGFNY
A7TLL1_VANPO/24-351-------ETSSHD.HY.....YGVAYYRQNGQEIVKKGKQV..DRNEVKMYALGILIDPNLSLKCYPDDEIFSSRHHKYI
Q75DG5_ASHGO/36-366-------.KEDGE.FY.....YGVALFSQNGLRLVEEEQSHGVDRSRVEMYSLAVITDPQFRLDAMAESKYYRWKPNMFI
A5DGT1_PICGU/16-298-------..NDDK.ML.....YGLSQYRSVTEGDNESTETS.VDRSKVKMYSLGILCDPVSK..........SWKPNEYI
C5MJC0_CANTT/11-295-------..FQDK.IY.....YGLSKFYQYIIGDDSSDR......SNVKMYALGVLCDSKPN..........PWKPNEFI
A3LNE8_PICST/19-334-------..HSDK.VY.....YGLGTFRQHIVGQNQPLD.....RSTVKVYSLGIICDPATKE.......SESWKPNEFI
Q6BJB8_DEBHA/28-311-------..CDNT.VY.....YGLGRFRQRIVGADHESSQI..SRDDVKMYSLGILCESTPN.........PMWKSNEFI
B8M2T3_TALSN/30-332-------....HE.EY.....AGICAFINQPAA.ETER........NALMLAVGVLVPL................SFGRL
A2QAY7_ASPNC/31-357-------....HE.QY.....AGISAFVNWPAE.EAER........NAKMFAIGVLVPL................SSGRL
A1CNU9_ASPCL/30-339-------....YE.QY.....AGISAFVNLPAD.EAER........NANMFAVGVLVPL................GSGRL
Q5BF30_EMENI/30-339-------....HD.QY.....AGISAFVNQPAD.ESER........NAKMFSIGVLVPL................SSGRL
F2PVM8_TRIEC/26-326-------....HD.RY.....IGLSAFINQPAG.EAQR........NAIMLSVGILAPL................SHGRL
E9CY67_COCPS/13-322-------....QD.DY.....AGLSAFVNQPAD.ESER........NALMLAVGVLVPL................SQGRL
C0S3V5_PARBP/84-387-------....DD.QH.....AGISAFINHPAA.ESQR........NALMMAVGVLVPL................SYGRL
D5G5F9_TUBMM/21-341-------....QA.PY.....AGISAFINTPAA.EAER........NACMLSVGVLVPL................SYGRL
E3Q807_COLGM/29-348-------....HDGEH.....AGLSAFINTPCDEEEAR........HARMIAVGVLVPL................SYGRL
E9F1A8_METAR/37-350-------.....DGAH.....AGLSAFVNEPCEEEEAR........NARMIAVGVLVPL................SYGRL
C7YNX8_NECH7/29-347-------....HDGGH.....AGLSAFVNMPCDEEEAR........HARMIAVGVLVPL................SYGRL
B2AXI7_PODAN/33-356-------....HDASH.....AGLSAFINTPTDEEETR........HARMIAVGVLVPL................SYGRL
Q0V1B2_PHANO/27-300-------....HE.GY.....AGLSAFARGEAG.SEER........NANFVSVGVLARR.................DGIL
B3RV35_TRIAD/7-273-------...NGQ.DL.....YGLSCFKRIQVDNQEER........GVRMKSVGILCKH....................F
LCHN_DANRE/114-382-------....KG.CY.....FGLACFANMPVESELER........GARMKSVGILSPS....................Y
B7QCC0_IXOSC/54-313-------....RG.NF.....YGLSCFENMKVENEKER........GARMKSIGVLAQS....................Y
F2UE85_SALR5/10-285-------....AE.GM.....YMVSCFKTIK.DAQAAR........GLRACSVGVVCTS....................P
YBAG_SCHPO/6-296-------....FQ.DQ.....LCLSVFSKLQHPSFERS.........AFFTSVGLILSD................DINFG
Q5K7R2_CRYNJ/10-298-------....HH.DL.....PGVGLFRSREKPEGENRG......RGRTMGVVGVVLAEGD...........VADLYSSK

PF08616

YG76_SCHPO/260-373--------------SP----------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------RY----------------------------------------------------------------
A5DM71_PICGU/279-393--------------YN----------------------------------------------------------------
A5DZ96_LODEL/271-385--------------LN----------------------------------------------------------------
A7TRE4_VANPO/376-503--------------NQ----------------------------------------------------------------
A8PX95_MALGO/354-466--------------LH----------------------------------------------------------------
B0D0E4_LACBS/418-530--------------LH----------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------EA----------------------------------------------------------------
C4R3J0_PICPG/305-418--------------FK----------------------------------------------------------------
C5DJD2_LACTC/316-435--------------ND----------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------DT----------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------QT----------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------GT----------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------IH----------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------RY----------------------------------------------------------------
Q4P9F2_USTMA/366-478--------------IH----------------------------------------------------------------
Q55D43_DICDI/566-679--------------DY----------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------HN----------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------VH----------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------NN----------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------KD----------------------------------------------------------------
E7QKR4_YEASZ/211-334--------------.E----------------------------------------------------------------
Q23F93_TETTS/358-465--------------NA----------------------------------------------------------------
Q5KLM3_CRYNJ/358-470--------------.H----------------------------------------------------------------

PF07792

D4AU15_ARTBC/26-120--------------------------------------------------------------------------------
MESA_EMENI/79-211--------------------------------------------------------------------------------
A2Q8P4_ASPNC/82-209--------------------------------------------------------------------------------
A1CRY6_ASPCL/85-213--------------------------------------------------------------------------------
B6HSJ1_PENCW/75-202--------------------------------------------------------------------------------
C0SET4_PARBP/168-287--------------------------------------------------------------------------------
F2TNB3_AJEDA/90-216--------------------------------------------------------------------------------
E9DDS1_COCPS/90-219--------------------------------------------------------------------------------
B8MHD8_TALSN/85-217--------------------------------------------------------------------------------
F0XQA1_GROCL/147-315--------------------------------------------------------------------------------
Q7RXB5_NEUCR/122-213--------------------------------------------------------------------------------
B2AXK1_PODAN/123-264--------------------------------------------------------------------------------
Q0V5R0_PHANO/110-243--------------------------------------------------------------------------------
Q6CGA4_YARLI/9-78--------------------------------------------------------------------------------
A0C6F7_PARTE/1-152--------------------------------------------------------------------------------
Q23F93_TETTS/1-94--------------------------------------------------------------------------------
D2VRW9_NAEGR/60-215--------------------------------------------------------------------------------
E9BZT8_CAPO3/13-108--------------------------------------------------------------------------------
D3BKL1_POLPA/154-231--------------------------------------------------------------------------------
F0ZTU4_DICPU/95-230--------------------------------------------------------------------------------
C4Y911_CLAL4/3-80--------------------------------------------------------------------------------
C4R3J0_PICPG/6-86--------------------------------------------------------------------------------
A7TRE4_VANPO/73-221--------------------------------------------------------------------------------
C5DZH0_ZYGRC/8-97--------------------------------------------------------------------------------
Q75BQ9_ASHGO/49-189--------------------------------------------------------------------------------
A0A023ZHY2_YEASX/26-188--------------------------------------------------------------------------------
Q6CPS0_KLULA/28-167--------------------------------------------------------------------------------
C5DJD2_LACTC/29-162--------------------------------------------------------------------------------

PF02141

DEN4C_MOUSE/307-491------------------------------------------------------------------------------SP
DEN5A_HUMAN/202-390------------------------------------------------------------------------------PP
DEN5B_HUMAN/187-375------------------------------------------------------------------------------PP
Q0US70_PHANO/395-592------------------------------------------------------------------------------IT
Q0UM90_PHANO/167-348------------------------------------------------------------------------------RL
Q54JA6_DICDI/110-305------------------------------------------------------------------------------AP
Q55DD7_DICDI/109-294------------------------------------------------------------------------------KS
DEN2C_HUMAN/586-770------------------------------------------------------------------------------AP
Q5RHZ1_DANRE/778-962------------------------------------------------------------------------------AP
A7RR72_NEMVE/298-481------------------------------------------------------------------------------SP
DEN4B_MOUSE/313-497------------------------------------------------------------------------------SP
Q7PWX7_ANOGA/311-495------------------------------------------------------------------------------SP
Q9W3D2_DROME/308-492------------------------------------------------------------------------------AP
MTMRD_HUMAN/116-298------------------------------------------------------------------------------AA
Q1LXZ0_DANRE/117-299------------------------------------------------------------------------------IA
Q7KSP6_DROME/142-325------------------------------------------------------------------------------PA
Q177S0_AEDAE/106-289------------------------------------------------------------------------------PP
A7SZQ4_NEMVE/186-373------------------------------------------------------------------------------PP
Q54VP0_DICDI/908-1097------------------------------------------------------------------------------RP
Q2GNY8_CHAGB/440-637------------------------------------------------------------------------------LS
A7EF60_SCLS1/465-662------------------------------------------------------------------------------LS
Q0CL54_ASPTN/423-620------------------------------------------------------------------------------NS
DENN_SCHPO/362-562------------------------------------------------------------------------------PK
DEND3_MOUSE/187-373------------------------------------------------------------------------------PP
A1Z7Q5_DROME/98-283------------------------------------------------------------------------------DC
Q7Q1I7_ANOGA/88-273------------------------------------------------------------------------------EP
B8JLM2_DANRE/225-405------------------------------------------------------------------------------AP
F1N1V1_BOVIN/150-332------------------------------------------------------------------------------AP
F1QFB0_DANRE/165-345------------------------------------------------------------------------------SP
F1RDS6_DANRE/306-489------------------------------------------------------------------------------SA
F6SD79_XENTR/91-270------------------------------------------------------------------------------QA
F7CWX4_XENTR/145-326------------------------------------------------------------------------------AP
H2UHI4_TAKRU/223-407------------------------------------------------------------------------------SI
H3CCM9_TETNG/318-499------------------------------------------------------------------------------AP
H3CZX5_TETNG/307-489------------------------------------------------------------------------------AP
H3D3K0_TETNG/203-391------------------------------------------------------------------------------PP
H3DM09_TETNG/192-375------------------------------------------------------------------------------PP
U4PB89_CAEEL/329-512------------------------------------------------------------------------------TP

PF09794

Q7QF11_ANOGA/7-482P.IYGYVEVKLSLIAQAFFEQGD--FSAT--EILVKAY-----EQLNAC.LVSLEPQEI.--------------------
Q29HH8_DROPS/14-480P.IYGYIEVKLALIADAFFDQGD--FSCT--ELLVKAY-----QQLNAC.LLDDESRRP.--------------------
Q6BP02_DEBHA/131-552QPIFQIIKEKLSIISASYFLQNN--FGNT--EILESLY-----DNLNTT.FRVKEKEGVI--------------------
A5DNM6_PICGU/119-523QPIFTKIKEKLSIITHSFLIQER--LDNY--ELLEHLF-----ENLNDS.FKPKVDRRLS--------------------
Q2H333_CHAGB/18-368PQHFGMLRERLSVVTKAWFLQRE--FTDV--EILRRFQ-----ESLADEKARG.LLHDD.--------------------
AVL9_PONAB/16-520P.LYGLLQAKLQLITHAYFEEKD--FSQI--SILKELY-----EHM....NSSLGGASL.--------------------
Q4P7V8_USTMA/140-510P.VFGPIREKLGIVTRAFFAQGD--LANV--DILVDFH-----STLEIG.LQSGGMSED.--------------------
Q17GP2_AEDAE/7-476P.IYGYVEVKLSLIAHAFFEQGD--FSCT--DILVEAF-----EQQNACLYSMDPMVEL.--------------------
Q6C028_YARLI/516-899P.IWGPMKDKLAVVTRAFFMQPT--FDDK--SIIRSLF-----DSLAHT.LTLSKFNSD.--------------------
Q54NJ9_DICDI/6-452P.IFNSFKTQLSSATICYFNQGD--FQNT--DLLVTWF-----HAQNNE.FKERNNEKLV--------------------
A1CPG6_ASPCL/9-384PQTVGQLREKLSVVTSAWFAQRD--FSDT--DILKKFR-----EGLIIS.....WEQNE.--------------------
Q6FIU1_CANGA/8-406P.IFGQIKDKLSIVTNAFFRQKD--FSDR--AIISSLY-----DSLKAT.YMPSDVPSPA--------------------
Q08D17_XENTR/21-516P.LYGLLQAKLQLITHAYFEEKD--FSQI--SILKELY-----EHM....NGSLGGSAI.--------------------
Q6CKD3_KLULA/6-399P.ILGQIKDKLAIITNALFMQRD--FTDK--TIIDTLY-----SNLNSIEYDDHD.....--------------------
Q750W9_ASHGO/13-401P.IFGQIKDKLSIVTNALFLQRD--FSDT--SIIYTLY-----DNLRSM.FNSAASID..--------------------
Q5KDB3_CRYNJ/119-529P.IFGPIRDRLGVVTRAYFAQRD--FAET--KLLEDFY-----TSLETG.LEGKSGEEA.--------------------
AVL9_YEAST/9-401P.IFGQIKDKLSIVTNAFFLQHD--FGDR--KIIQSLY-----ENLKSI.YTPASLVRN.--------------------
A3LPG1_PICST/85-492QPIFTKIREKLSIITKSYFQQDN--FNNV--ELLENLF-----DNLNNT.FK.LIDNELE--------------------
AVL9_SCHPO/10-367P.PFGHIKDNLDIVTNAYFSQGD--FSNL--DVLRDFF-----HVLTRK...........--------------------
Q5AIP1_CANAL/191-588QPIFTKIKDKLSIIAKSYFQQET--FDNF--EILDNLF-----ENLNGQ.FK.LVDNEMH--------------------
A7TEK5_VANPO/8-400P.IFGQIRDKLSIVTNVFFSQKN--FTDR--SIIVSLY-----DNLQSL.FKPMTSTSL.--------------------
H3CTF9_TETNG/13-493P.LYGLLQAKLQLITHAYFEEKD--FSQI--SILKELY-----EHMN....GSLGGSAL.--------------------

PF09804

YKE7_YEAST/33-335YAANRYSSYLESLL.GQWIRQRD..LDKF--DIFEKFF..........................................
Q6FLQ0_CANGA/9-288EVTNQYIPELQSLL.KDWSTNQGSNSNSY--EQLSTYY..........................................
A7TLL1_VANPO/24-351.SCNEYVGDLKKLL.SDWLQNEK..YDDF--STFESFY.....NTNKKTIVKADDGSSGS...................K
Q75DG5_ASHGO/36-366.CANEYKEDLAQLM.EQWLKSK.....SL--EVLEHYFSYNKYQPDLGSPLLMRKWPGSS....................
A5DGT1_PICGU/16-298STGWEHIESLDSTL.YTFLRLQS..WNDY--SVFEELH..........................................
C5MJC0_CANTT/11-295RNGWEYVDSLNEKL.VQFVHSQQ..YDNF--KPIESVL..........................................
A3LNE8_PICST/19-334SNGWEYIEVLDSTL.VHFLQTEQ..YDNF--DIFNQLY......................DRIL............SSEP
Q6BJB8_DEBHA/28-311NNGWEYINKLDDGL.EKFLNGND..YDNF--TIFDEVF..........................................
B8M2T3_TALSN/30-332GKSWRHAAGLKNLA.KQCANNI....SDT--QPLAEYW.....DKHHVRDNEPRLEDTPPDSPAVLR.....RPLKTDRP
A2QAY7_ASPNC/31-357GKSWRHAPKLKELA.ANYAEDM....SNT--QPLTEYW.....DNYEI..RETDASAMPPDSPMESPLS.LRLRAHGDLR
A1CNU9_ASPCL/30-339GKSWRHAPKLKELA.HVYAKDM....SNT--QILSDYW.....ETYEM..RTNGASAIPPDSPLESPL....SLRFRERP
Q5BF30_EMENI/30-339GKSWRHASKLKELA.QRYSESA....FST--NSLSEYW.....ETHEL...SANETSAAPDSPLDSPLS.LRMRAHSDRP
F2PVM8_TRIEC/26-326GRSWKHAAGLKELA.IQLATDP....DDT--QPLASYW.....DKHQL...RDSEGSSPPESPLEYMS....HPKPISVP
E9CY67_COCPS/13-322GKAWRHAASLKELA.RKLANDY....GDT--KPLADYW.....EAFQL...PNYHNESPPDSPLASISG..LKPKQSTPQ
C0S3V5_PARBP/84-387GKAWRHAAKLKELA.RSFADDP....DNM--EPLSAYW.....EMYQF....SDEVNSSSDSPLGSI.....ASLKTPIR
D5G5F9_TUBMM/21-341GRSWRHAENLKELA.KKFAANT....EDH--APLEEYY.....ELNRIHESTEAPESPAESPSSLRYRPSSRYKPPFDSL
E3Q807_COLGM/29-348GRAWRHAEGLKGIA.SKLAEDR....KNT--GLLDEYW.....EKNKA..KGGAEQERPALESPSISF...SAQASQPKT
E9F1A8_METAR/37-350GRAWRHAENLKELA.AILAKDR....SQT--SVLEKYW.....NSHKASENEGQPNDLGPGNLPDS........PTQERR
C7YNX8_NECH7/29-347GRAWRHAEALKEMA.AKLAEDR....KNT--SILEEYW.....TANRE..KQGQGNRRLSGETPVSSP...SLHSQPLGR
B2AXI7_PODAN/33-356GRAWRHAEGLKEMA.SKLVQDR....KQT--QILEEYW.....ERNGA..RETSAPQPLKDEPLASPAL.SFRAVRPPLG
Q0V1B2_PHANO/27-300GRTWGAAGRLESIA.RTIAEDE.....GV--APLEEFW.....EEQTAHARQHDNT........................
B3RV35_TRIAD/7-273ITLHLHMPFLESEV.VKQLNSP....GNY--QRLQEYFTNNIDLNESLIQPYGSNTSVLK....................
LCHN_DANRE/114-382TLLYRYMHFLENQV.RHQLQCP....GQY--SPLEAFY.....EDKKAVLPSGGNGLVTA....................
B7QCC0_IXOSC/54-313SLLHLYKPFLQKQV.RHLLESP....GLY--SDLDQFY.....LKHCSRPTLEASSELSP....................
F2UE85_SALR5/10-285DFLHRHRSFLRDQCQKHLVTDD....DDY--SELKQYF.....EDQKAAEATNDQAAGARVV................EV
YBAG_SCHPO/6-296EAVVKYGETLLYIA.NGL.........SL--ATLKYKFGEDASETYASEKCTSHQLSDSDFFKSLQT......SAVNLEF
Q5K7R2_CRYNJ/10-298SALKEIYDKLENLSQSPFISSVEQDGERE--KVLDEVW.....QKYRADKVKKLEAAMDE....................

PF08616

YG76_SCHPO/260-373--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_PICPG/305-418--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
Q4P9F2_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------
E7QKR4_YEASZ/211-334--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------
Q5KLM3_CRYNJ/358-470--------------------------------------------------------------------------------

PF07792

D4AU15_ARTBC/26-120--------------------------------------------------------------------------------
MESA_EMENI/79-211--------------------------------------------------------------------------------
A2Q8P4_ASPNC/82-209--------------------------------------------------------------------------------
A1CRY6_ASPCL/85-213--------------------------------------------------------------------------------
B6HSJ1_PENCW/75-202--------------------------------------------------------------------------------
C0SET4_PARBP/168-287--------------------------------------------------------------------------------
F2TNB3_AJEDA/90-216--------------------------------------------------------------------------------
E9DDS1_COCPS/90-219--------------------------------------------------------------------------------
B8MHD8_TALSN/85-217--------------------------------------------------------------------------------
F0XQA1_GROCL/147-315--------------------------------------------------------------------------------
Q7RXB5_NEUCR/122-213--------------------------------------------------------------------------------
B2AXK1_PODAN/123-264--------------------------------------------------------------------------------
Q0V5R0_PHANO/110-243--------------------------------------------------------------------------------
Q6CGA4_YARLI/9-78--------------------------------------------------------------------------------
A0C6F7_PARTE/1-152--------------------------------------------------------------------------------
Q23F93_TETTS/1-94--------------------------------------------------------------------------------
D2VRW9_NAEGR/60-215--------------------------------------------------------------------------------
E9BZT8_CAPO3/13-108--------------------------------------------------------------------------------
D3BKL1_POLPA/154-231--------------------------------------------------------------------------------
F0ZTU4_DICPU/95-230--------------------------------------------------------------------------------
C4Y911_CLAL4/3-80--------------------------------------------------------------------------------
C4R3J0_PICPG/6-86--------------------------------------------------------------------------------
A7TRE4_VANPO/73-221--------------------------------------------------------------------------------
C5DZH0_ZYGRC/8-97--------------------------------------------------------------------------------
Q75BQ9_ASHGO/49-189--------------------------------------------------------------------------------
A0A023ZHY2_YEASX/26-188--------------------------------------------------------------------------------
Q6CPS0_KLULA/28-167--------------------------------------------------------------------------------
C5DJD2_LACTC/29-162--------------------------------------------------------------------------------

PF02141

DEN4C_MOUSE/307-491QRPRILIQ...LSVHDAFILSQPV.STPL..PL..SGA------------------------------------------
DEN5A_HUMAN/202-390GRSLKF.....SGVYGPIICQRPS.TNEL..PL..FDF------------------------------------------
DEN5B_HUMAN/187-375GRSLKF.....YGVYEPVICQRPG.PSEL..PL..SDY------------------------------------------
Q0US70_PHANO/395-592SITQVE.....LAVRELRMYARKEALNEI..PG.SRNI------------------------------------------
Q0UM90_PHANO/167-348NDLVRI.....DMKDYALCYQFPSSPTGF......QNF------------------------------------------
Q54JA6_DICDI/110-305GDSFTVYIYDNPFISDKKPTNLPV.SYTLKRPVSTDKS------------------------------------------
Q55DD7_DICDI/109-294STTIELTTTATNSATENWVFPFLKPRTNF......DHI------------------------------------------
DEN2C_HUMAN/586-770GRTITVKSYLPGAGDESIELCRPL.DSRL......EHV------------------------------------------
Q5RHZ1_DANRE/778-962GKTIKVKTFLPGAGNEVIELRRPM.DSRL......EHV------------------------------------------
A7RR72_NEMVE/298-481QRPRILIE...MTRYEPFEISQLY.HSPL..PV..SGA------------------------------------------
DEN4B_MOUSE/313-497QRPRILVQ...MSPYDNLLLCQPV.SSPL..PL..SGA------------------------------------------
Q7PWX7_ANOGA/311-495SILLQLST....LSNNRVLLTLPE.DSPL..PR..SGA------------------------------------------
Q9W3D2_DROME/308-492SIHLQLSS....ESNDRILLTQPE.DSPL..PR..SGA------------------------------------------
MTMRD_HUMAN/116-298GGSQKLFS...LGAGDRQLIQTPL.HDSL..PI..TGT------------------------------------------
Q1LXZ0_DANRE/117-299GGSQRTIT...LGAGDRQVIQTPI.NDSL..PV..SGC------------------------------------------
Q7KSP6_DROME/142-325GGPQVRFS...IGAGDKQSLQPPQ.SSSL..PT..TGS------------------------------------------
Q177S0_AEDAE/106-289GGPQVRFS...IGAGDKQVLQPPI.SPTI..PV..TGS------------------------------------------
A7SZQ4_NEMVE/186-373GRTMRF.....NCVKESITCQRPG.PNEL..PL..FDY------------------------------------------
Q54VP0_DICDI/908-1097GKNPVTFS...LGGLNQCLLKQPD.PCLL..PE..PDI------------------------------------------
Q2GNY8_CHAGB/440-637SLTQVE.....LGVRELRLYARKEAANEI..PG.SRTI------------------------------------------
A7EF60_SCLS1/465-662SKTQIE.....IAVRELRLFARKEAPNEL..PE.SRNT------------------------------------------
Q0CL54_ASPTN/423-620SKTQVE.....LAVRELRLFARKEAANEL..PG.SRNT------------------------------------------
DENN_SCHPO/362-562GLLQLQ.....VNVGPLNLYAFRSPVNEI..PG.WNDV------------------------------------------
DEND3_MOUSE/187-373GPLHLI......FNMKPLQVVFPS.RADPESPI..VDL------------------------------------------
A1Z7Q5_DROME/98-283GGSLKVYY...SAGQSHFTFERPL.QFQL..PSMPENH------------------------------------------
Q7Q1I7_ANOGA/88-273GACLKLHY...DRASQTFLFQRPQ.QFQL..PSIPENH------------------------------------------
B8JLM2_DANRE/225-405GNTVNIKSFIPDRGTEIISLTRPT.DSWL......EHV------------------------------------------
F1N1V1_BOVIN/150-332GKTVTLKSFIPDSGTEFISLTRPL.DSHL......EHV------------------------------------------
F1QFB0_DANRE/165-345GSTVSISSFIPDAGTQIIRLTRPA.DSWL......EHV------------------------------------------
F1RDS6_DANRE/306-489QRPRILVQ...LSPYDNLLLCQPV.SSPL..PL..SGA------------------------------------------
F6SD79_XENTR/91-270NTALSP........EMLSYFIAPD.PTRL..PSVPENR------------------------------------------
F7CWX4_XENTR/145-326GKTVKIKSFIPESGTEIIELTRPL.DCRL......EHI------------------------------------------
H2UHI4_TAKRU/223-407QRPRILVQ...LSPHDSLLLSQPV.SSPL..PL..SGG------------------------------------------
H3CCM9_TETNG/318-499GRTITVKNFLPGSGTEVIELCRPS.DSRL......EHV------------------------------------------
H3CZX5_TETNG/307-489GRTVTVKSFLPGSGNEVITLCRPV.DSRL......EHV------------------------------------------
H3D3K0_TETNG/203-391GRSLRF.....HGVQGPIVCQRPG.PGEL..PM..GEY------------------------------------------
H3DM09_TETNG/192-375GQLHLAFH....LHPLTIVLPSKE.DKDH..PV..VDL------------------------------------------
U4PB89_CAEEL/329-512RRPRVFMQ....LGAENISFDSHD.DSQL..PL..NGA------------------------------------------

PF09794

Q7QF11_ANOGA/7-482---................G.STR........LHFVGV..PLR-----DLLLKWRHKILIL-FKLLLL-QKRVICY----
Q29HH8_DROPS/14-480---..................LRH.........FHVGL..SLR-----EIVLHWRHKTLIL-FKLLLL-QRRVVCF----
Q6BP02_DEBHA/131-552---KDSTSKK.QSSLNEFVERQDE.........FFVNL..NLK-----HTLSKFKTNLLVI-FKALLL-EKKILIY----
A5DNM6_PICGU/119-523---IDQE........ALRIEREDE.........FFVNL..NLK-----ETVTKFRHNFLTL-FKAMLL-EKKILIF----
Q2H333_CHAGB/18-368---.................EDRD.........QYLGL..SLR-----ELVREFRWQTLVL-LKCCLL-QPK....----
AVL9_PONAB/16-520---.................EGSQ.........VYLGL..SPR-----DLVLHFRHKVLIL-FKLILL-EKKVLFY----
Q4P7V8_USTMA/140-510---.................RETV.........MYMGT..SLR-----ELVHKWRFKTLML-VKLLLL-QRRVMFF----
Q17GP2_AEDAE/7-476---..................APAR.......LHFVGL..PLR-----DLVLKWRHKLLIL-YKLLML-QKRIICF----
Q6C028_YARLI/516-899---.................TSSD.........VSIGM..SLC-----ELVSRLKQKLVVV-FKALLL-EKRVLFY----
Q54NJ9_DICDI/6-452---INNSFGYQMNQVLENNNNNNKKLIPINSDFLFGSM..SLK-----KLIMHFGRNSLVF-FKLIML-ERGVVVF----
A1CPG6_ASPCL/9-384---.................ASKD.........QNLGL..SLR-----EMIHEFKYQTLVL-FKALLL-QPKMLFF----
Q6FIU1_CANGA/8-406---N.............FSQRENQ.........LYVGL..CLR-----KILHDFNRNALVL-LKALLL-EKKIVFY----
Q08D17_XENTR/21-516---.................EGSQ.........LYLGL..SPR-----DLVLHFRHKILIL-FKLILL-EKKVLFY----
Q6CKD3_KLULA/6-399---..................ESH.........LYVGL..NLR-----KTVYDLRKEVLVI-LKAILL-EKKVLFY----
Q750W9_ASHGO/13-401---..................ESN.........LFVGL..SLR-----KIIHDFRREFLVI-LKAMLL-ERKIIFY----
Q5KDB3_CRYNJ/119-529---..............................MYMGT..SLR-----ELVHKFRHRTLVL-LKMLML-QKRIMLF----
AVL9_YEAST/9-401---.................AENR.........LYIGL..CLR-----KILHDFKRNALVL-LKAIML-EKKIIVY----
A3LPG1_PICST/85-492---ENTKFTYEFSEQQKSIAKEEE.........NFVNL..NLK-----NTILKFKANFLTI-FKSLLL-DKKILIF----
AVL9_SCHPO/10-367---..................EQD.........VHIALNINLK-----SFLCEWRQNALVL-LKVLLL-GKRILVY----
Q5AIP1_CANAL/191-588---T.............ELEQEEE.........NYVNL..NLK-----STVGKFRSRFLII-FKSLLL-EKKVLIY----
A7TEK5_VANPO/8-400---.................SDSN.........MYVGL..CLR-----KIILDFKKETLVL-FKALFL-EKKIIFY----
H3CTF9_TETNG/13-493---.................EGSQ.........VYLGL..SPR-----DLILHFRHKVLIL-FKLILL-EKKVLFY----

PF09804

YKE7_YEAST/33-335.DENNQGHMAENSVEVFEHSPKER---------RHLVE--YLP-----YWTRKLGPLIFPL-WKASLL-QSRILILVPQG
Q6FLQ0_CANGA/9-288.........HKKISGSLNYEVDYQ---------TSMLN--HLP-----YWLNKLGPLIFPL-FKSCLL-RERILVISAPG
A7TLL1_VANPO/24-351TIRSSELTDDIEDTPVPIANINNK---------LLMLE--HLP-----FWIKKIGPLIFPL-WKSCLL-NEKILILNPLG
Q75DG5_ASHGO/36-366TLTGGSYEDYAQGSKDDAETFKPS---------KSWLY--LLP-----EIIEQLGPSIFTL-WKACLL-RQRILVVNEHG
A5DGT1_PICGU/16-298......SSLTGSQLSPNPISPKTD---------HHLLS--ALP-----DLLDVLGPLVFVL-YKQCLL-RKRIMLFHHDP
C5MJC0_CANTT/11-295..........EGMDGLSPTGPNIN---------NHLLT--KLP-----EMFRTLGPLVFVL-YKQSLL-RKNILIFNQHT
A3LNE8_PICST/19-334HLPVSSSSSRFLSNSSVKLTPNVH---------HHLLT--KLP-----QMFKTVGPFIFAL-YKQSLL-RKRIIFFAKNH
Q6BJB8_DEBHA/28-311......DNLTNTHLKVGKPNININ---------NHLLS--KLP-----LMFQSLGPLVFSL-FKQCLL-RKKVLIFHQNH
B8M2T3_TALSN/30-332ETLQSRSSISDAAGIETTKPFLAP---------YHPAL--SLP-----DFVEKFGPLIFPL-YRASLL-RKRILIV....
A2QAY7_ASPNC/31-357DAVHRTRAFSDAIVLETPRPALTP---------FHPAS--SLP-----NFLDSFGPLLFPL-YRAALL-RKRILFM....
A1CNU9_ASPCL/30-339DSMHRNRTFSDALVLEASRPALTP---------FHPAS--SLP-----EFLDCFGPLIFPL-YRAALL-RKRILLM....
Q5BF30_EMENI/30-339DTLQRNRAISDAMVLETSRPALTP---------FHPAS--SLP-----DFLDAFGPLLFPL-YRAALL-RRRVLFM....
F2PVM8_TRIEC/26-326PAKRRQRALSDATALISSR.TLPS---------YHPAL--TLP-----DFLDTFGPLIFPL-YRAALL-RKRIVFL....
E9CY67_COCPS/13-322GAFHRGRTLSDATALLTSKQLLAP---------YHPAL--CLP-----DFKDTLGPLIFPL-YRAALL-RKRILFL....
C0S3V5_PARBP/84-387EGYTRQRALSDATALMSSKQSLAP---------YHPAS--SLP-----DFMNTFGPLVFQL-YRAALL-RKRILFV....
D5G5F9_TUBMM/21-341NRHSRTRSISDTTALAAPGQALSP---------YHPAL--SLP-----EFVDTFGPLVFPL-YRAALT-RQRILLI....
E3Q807_COLGM/29-348AHHSRNRSASDGASLLPYGHRLSP---------YHPAW--SLT-----ALLDTFGPLIFPI-HRAALL-RKRILIS....
E9F1A8_METAR/37-350.THKRKGSASDGTSLAQAEHRLSP---------FHPAW--SLV-----SLLDKFGPLIFPI-HRAALL-RKRILIS....
C7YNX8_NECH7/29-347KGHNRNRSASDGASLIPTGNTLSP---------YHPAW--SLT-----SLLDKFGPLIFPI-HRAALL-RKRILIS....
B2AXI7_PODAN/33-356RGHARNRSASDGTALIPPGHRLSP---------YHPAW--SLT-----SLLDTFGPLIFPV-HRAALL-RKRILIS....
Q0V1B2_PHANO/27-300KGHSRARAISTVSAVTKDDERLPA---------YHPAL--SML-----KYLDVLGPLVFRL-QQAALL-RKRILFV....
B3RV35_TRIAD/7-273.........VRLLISEYTEYHYSI---------THPAG--CFS-----QFIKFFGVKIFPL-WRLILL-QKKILFY....
LCHN_DANRE/114-382....CPTSALAPIVNRCMHPEMKI---------THPAG--CMS-----QFIRFFGEQIMVL-WKFALL-RKRILIF....
B7QCC0_IXOSC/54-313...........YKTICDGMHSMQI---------THPAG--CFS-----QFLNYFGEKVFLL-WKFALL-KKRILFF....
F2UE85_SALR5/10-285RSPVWNLDRSVVREAEHSNQILVL---------RHEEG--SLS-----ELVRRFGRRIMIL-WKLVLL-QKRVMFL....
YBAG_SCHPO/6-296DSLFEKLQGNKFAILGANSKELSQ---------SYA..--..T-----ILLDHLGPAFYCL-YKFALQ-RKRILLI....
Q5K7R2_CRYNJ/10-298...GKENELDRVHKLITERGRVPS---------AHPIA--FMP-----LLLGLLGPNIVPV-YKAALS-GQRILLY....

PF08616

YG76_SCHPO/260-373----------------------------------------FMN-----TDISADINPINVL.ITALLI-SKKVLFL----
A4I5V0_LEIIN/587-699----------------------------------------SLE-----SLIETLGPSSLHL.LLGILT-EKKILIL----
A5DM71_PICGU/279-393----------------------------------------NEL-----TIYGLQTPPIIVL.INALLT-GKRVIFL----
A5DZ96_LODEL/271-385----------------------------------------NEL-----TIYGLQTPPIILL.INAVLT-GKKILFL----
A7TRE4_VANPO/376-503----------------------------------------KIL-----RFLSKFYPFINKL..TLQNF-SWRLIIN----
A8PX95_MALGO/354-466----------------------------------------PHL-----HSNGVYTHPVTLL.FNALIT-HKRVLFV----
B0D0E4_LACBS/418-530----------------------------------------PHL-----HTNGPQTHPIIIL.FNALVT-GKRIIFL----
C3ZXT1_BRAFL/180-291----------------------------------------DIF-----KCLHPVLPHVQML.WELVLT-TEPIIVM----
C4R3J0_PICPG/305-418----------------------------------------SVL-----PYGVHNTPFIIAL.INALLQ-RKRIIVY----
C5DJD2_LACTC/316-435----------------------------------------HVL-----KFLLKFIPQLDEL..PRSRF-SWRLFVN----
C5DZH0_ZYGRC/269-391----------------------------------------KIS-----KFLLNFIPLLHKR.DANDSF-HFKLVIY----
D2VRW9_NAEGR/366-475----------------------------------------SLC-----RLVTNFKENTMLI.FNAILY-QKRIVFF----
D2W4R6_NAEGR/470-587----------------------------------------SLV-----QLVQYFGLETMLVCWNALLL-DKRIMVI----
Q2URL2_ASPOR/377-488----------------------------------------PHL-----TTSGPYTHPIIIL.VNAMLT-QKRVVFL----
Q4DMT0_TRYCC/444-555----------------------------------------GLE-----QMVEVCGASFWTV.VMAILL-EKRVVVL----
Q4P9F2_USTMA/366-478----------------------------------------PHL-----HTNGPSTHPIIVL.FNALVT-QKRVVFL----
Q55D43_DICDI/566-679----------------------------------------KVI-----GLVQKFGNDVMKI.FNGVLS-QKRIIFL----
Q6BI40_DEBHA/264-378----------------------------------------SEL-----TIYGQQTPPIIIL.INAILV-GKKIIFL----
Q6CGA4_YARLI/272-384----------------------------------------PQL-----TIFGPTTPPVIVL.INALLT-QKRVLFI----
Q6CPS0_KLULA/322-444----------------------------------------SIL-----KLLARLIPLLTEI..PDSTY-SWRLIIN----
Q75BQ9_ASHGO/342-464----------------------------------------HVL-----KFLRQFIPQISLL..DRNDP-SWRLMVN----
E7QKR4_YEASZ/211-334----------------------------------------LVL-----KFLDKFVPYLLKA..GQKVN-AWKLVIN----
Q23F93_TETTS/358-465----------------------------------------SLI-----DLIKRFQDQVMKI.WAAILK-EQRILFV----
Q5KLM3_CRYNJ/358-470----------------------------------------AHL-----HTNGANTHPIILI.LNALLA-NKRVMFL----

PF07792

D4AU15_ARTBC/26-120----------------------------------------...-----.REEKAKKGQRDR-RER...-...........
MESA_EMENI/79-211----------------------------------------M..-----.LAELMLPDQTHV-RSQ...-DWTIFFL....
A2Q8P4_ASPNC/82-209----------------------------------------M..-----.LAELMLPDQTHV-RSQ...-DWTIFFL....
A1CRY6_ASPCL/85-213----------------------------------------M..-----.LAELMLPDQTHV-RSQ...-DWTIFFL....
B6HSJ1_PENCW/75-202----------------------------------------M..-----.LAELMLPDQTHV-RSQ...-DWTMFFL....
C0SET4_PARBP/168-287----------------------------------------M..-----.LAELMLPDQTHV-RSQ...-DWTIFFL....
F2TNB3_AJEDA/90-216----------------------------------------M..-----.LAELMLPDQTHV-RSQ...-DWTIFFL....
E9DDS1_COCPS/90-219----------------------------------------M..-----.LAELMLPDQTHV-RSQ...-DWTMFFL....
B8MHD8_TALSN/85-217----------------------------------------M..-----.LAELMLPDQTHV-RSQ...-DWTIFFL....
F0XQA1_GROCL/147-315----------------------------------------M..-----.LAELMLPDQTHL-RNQ...-DWTMFFL....
Q7RXB5_NEUCR/122-213----------------------------------------M..-----.LAELMLPDQAHA-RNQ...-DWTIFFL....
B2AXK1_PODAN/123-264----------------------------------------M..-----.LAELMLPDQAHV-RNQ...-DWTVFFL....
Q0V5R0_PHANO/110-243----------------------------------------M..-----.LAELMLPDQAHM-RNQ...-DWTIFFL....
Q6CGA4_YARLI/9-78----------------------------------------L..-----.MAELMLPDQSHV-RNQ...-DWTIFFL....
A0C6F7_PARTE/1-152----------------------------------------F.H-----ELASYMIPDGVHK-IKQ...-DKFFFRIGNVR
Q23F93_TETTS/1-94----------------------------------------T..-----.LAAYMLPDGVQK-FDN...-DISVFKY....
D2VRW9_NAEGR/60-215----------------------------------------S..-----.IANLMLPDGSHN-CIE...-DTTVFFL....
E9BZT8_CAPO3/13-108----------------------------------------L..-----.LAELMLPDGVHN-REE...-DWTIFFL....
D3BKL1_POLPA/154-231----------------------------------------L..-----.LAEFMLPDGAHN-RDA...-DWTVFFL....
F0ZTU4_DICPU/95-230----------------------------------------M..-----.LSEWMLPDGAHK-RND...-DWTVFFL....
C4Y911_CLAL4/3-80----------------------------------------L.Q-----YLPELMLPDQIHK-RPE...-DYTLFLL....
C4R3J0_PICPG/6-86----------------------------------------QLQ-----DISNVLMPSQLQH-SMN.RE-SITVFPI....
A7TRE4_VANPO/73-221----------------------------------------T.I-----NLASLMIPNNVEY-TPG.KK-DFTVFML....
C5DZH0_ZYGRC/8-97----------------------------------------V.F-----NLASLMIPNNAEY-NTGDEP-DTTVFML....
Q75BQ9_ASHGO/49-189----------------------------------------L.S-----NLAGLMIPNGIEN-RPG.ES-DFTTFIL....
A0A023ZHY2_YEASX/26-188----------------------------------------VSM-----NLASLMIPSSIER-NPG.KQ-DITVFTL....
Q6CPS0_KLULA/28-167----------------------------------------TCS-----HLASLMIPNSVEN-HPG.KP-DFTVFVL....
C5DJD2_LACTC/29-162----------------------------------------ASV-----NLASLMIPNSAES-RPD.VA-DFTVFIL....

PF02141

DEN4C_MOUSE/307-491----------------------------------------NFS.....SLLMNLGPENCATLLLLVLL.ESKILLH----
DEN5A_HUMAN/202-390----------------------------------------PVK.....EVFELLGVENVFQLFTCALL.EFQILLY----
DEN5B_HUMAN/187-375----------------------------------------PLR.....EAFELLGLENLVQVFTCVLL.EMQILLY----
Q0US70_PHANO/395-592----------------------------------------DIY.....ALFRCLSIPNIVTLFEFVLS.ESRIILL----
Q0UM90_PHANO/167-348----------------------------------------AMW.....PLFTCLSIPNIVGVIEAAVSPTRRIIFT----
Q54JA6_DICDI/110-305----------------------------------------SLHDGTLQPLIETLSSQKLLHLFISLLF.ERRVIIY----
Q55DD7_DICDI/109-294----------------------------------------DYE......LIHKMNPAHIIRLFEFAIT.ESRVILL----
DEN2C_HUMAN/586-770----------------------------------------DFK.....CLFKCLSVCHLIRVCASLLL.ERRVIFV----
Q5RHZ1_DANRE/778-962----------------------------------------DLE.....SLFNCLSVRQVVRVFASLLL.ERRVIFV----
A7RR72_NEMVE/298-481----------------------------------------SYS.....AMLRHLGPDNCLLLFYLILT.EHKILIH----
DEN4B_MOUSE/313-497----------------------------------------SFL.....QLLQNLGPELAITLLLAVLT.EHKLLVH----
Q7PWX7_ANOGA/311-495----------------------------------------GFR.....QLLSNLGPENCLHVLLLVLT.EQKLLIH----
Q9W3D2_DROME/308-492----------------------------------------GFH.....ILLQNLGTDNCLHVLLLALT.EQKILIH----
MTMRD_HUMAN/116-298----------------------------------------SVA.....LLFQQLGIQNVLSLFCAVLT.ENKVLFH----
Q1LXZ0_DANRE/117-299----------------------------------------SVA.....QLFRQLGIVNVLCLFCAALT.EHKILFL----
Q7KSP6_DROME/142-325----------------------------------------GVH.....FLFKQLGIKNVLILLCSVMT.ENKILFL----
Q177S0_AEDAE/106-289----------------------------------------CVS.....LLFHQLGIKNVMLLFCAVMT.EHKILFH----
A7SZQ4_NEMVE/186-373----------------------------------------SLK.....EMFSWLGVENVVELFTCVLL.EHQILLL----
Q54VP0_DICDI/908-1097----------------------------------------SYR.....MLFLSLDIRNVLSLIKCLLL.EEKILII----
Q2GNY8_CHAGB/440-637----------------------------------------DIY.....ALFRCLSLENIVLLLECAMS.EARIIFL----
A7EF60_SCLS1/465-662----------------------------------------DIY.....ALFRALSIPNIVALVEFMLS.ESRIILL----
Q0CL54_ASPTN/423-620----------------------------------------DLY.....ALFRTLSLSNIVILFEYALT.ESRIIFL----
DENN_SCHPO/362-562----------------------------------------DLY.....PLFRALSIPNILVLFEAALM.EAKVIFL----
DEND3_MOUSE/187-373----------------------------------------DLH.....LPLLCFRPEKVLQILTCILT.EQRIVFF----
A1Z7Q5_DROME/98-283----------------------------------------NLN.....LYYNFVEPKEMIAVFAAMLA.ERRIIFT----
Q7Q1I7_ANOGA/88-273----------------------------------------NLN.....QYYNFVEPKFMIGIFAAMLA.ERRIIFV----
B8JLM2_DANRE/225-405----------------------------------------DFR.....TLFRCLSDDEVLEVFASTVL.ERRIIFI----
F1N1V1_BOVIN/150-332----------------------------------------DFR.....SLMRCLSFEQILQIFASAVL.ERRIIFL----
F1QFB0_DANRE/165-345----------------------------------------DFT.....ALFSRLNDEELLLVFTAAVL.ERRIIFI----
F1RDS6_DANRE/306-489----------------------------------------SFV.....KLLQNLGPENTCSLLLAVLT.EHKLLLH----
F6SD79_XENTR/91-270----------------------------------------NLT.....EFLVAVQVDTMLHLYSSLLC.ERRILIT----
F7CWX4_XENTR/145-326----------------------------------------DFK.....TLLQCLNSQIILHIFASVVL.ERRVILV----
H2UHI4_TAKRU/223-407----------------------------------------SLS.....TLLLNLGPKNAATLLVLAVT.EHKILVH----
H3CCM9_TETNG/318-499----------------------------------------DFE.....CLFSSLSLRLLLRVFTSLLL.ERRVIFT----
H3CZX5_TETNG/307-489----------------------------------------DFD.....SLLQCLSVDKLLQVFASILL.ERRVILI----
H3D3K0_TETNG/203-391----------------------------------------PLG.....EAFSLLGVENMVKLLTCTLL.ETQILLY----
H3DM09_TETNG/192-375----------------------------------------DLH.....LPFFCLQPGQLLQVLSCLLQ.EQRIVLF----
U4PB89_CAEEL/329-512----------------------------------------QLI.....DTLKYLGSENLMYLMLLALL.EQKILIH----

PF09794

Q7QF11_ANOGA/7-482G.S-----------------PVHPTCAL------------------ILGIASLHPELISKGFQQVACVKTSRPMSPMPTF
Q29HH8_DROPS/14-480G.S-----------------PVRGMCVL------------------ILGMASLVPRLLEKGFQEVACVRTSRPLSPMPDF
Q6BP02_DEBHA/131-552SNN-----------------NLEMLTQF------------------QNNLISLIPNLINN.LGNSG..............
A5DNM6_PICGU/119-523SNN-----------------NLESLTMF------------------QNNLISLVPNLIHN.LADSS..............
Q2H333_CHAGB/18-368...-----------------........------------------.................DSA..............
AVL9_PONAB/16-520I.S-----------------PVNKLVGA------------------LMTVLSLFPGMIEHGLSDCSQYRPRKSMSEDGGL
Q4P7V8_USTMA/140-510G.Y-----------------PVEQLCNY------------------QYSLVSLLPGLLLN.LQDAG..............
Q17GP2_AEDAE/7-476G.S-----------------PVQPTCAL------------------ILGVVSLHPELLSKGFQEVACVKTSRPMSPMPNF
Q6C028_YARLI/516-899A.S-----------------STELLCTS------------------QFSLVSLIPNLINN.LQDCG..............
Q54NJ9_DICDI/6-452CPQ-----------------PVSPVSEA------------------IMSVLSLHSKSYDL.LFSTN..............
A1CPG6_ASPCL/9-384G.S-----------------RCERLCMI------------------QFSLISLIPGLINS.LQDCA..............
Q6FIU1_CANGA/8-406G.S-----------------NVEALCNL------------------QFGLISLIPNLLSS.LQTSA..............
Q08D17_XENTR/21-516V.S-----------------PVNRLVGA------------------LMTVLSLFPGMIEHGLTDSSQYRPRKSMSEDIEY
Q6CKD3_KLULA/6-399G.N-----------------DVEQLCNI------------------QFAFISLIPCLLSN.IQDCG..............
Q750W9_ASHGO/13-401G.S-----------------NVEELCSL------------------QFGFISLIPNLISN.LQDCG..............
Q5KDB3_CRYNJ/119-529G.Y-----------------PVEKLCTY------------------QYSLVSLIPGLLLN.LRDSG..............
AVL9_YEAST/9-401G.N-----------------DVEALCNL------------------QFGLISLIPDLMSN.LQDSG..............
A3LPG1_PICST/85-492SNS-----------------SLEMLTQF------------------QNNLISLIPNLINN.LDNSG..............
AVL9_SCHPO/10-367D.K-----------------SAERLGNF------------------QYSLLSLIPCMMSH.LQDVS..............
Q5AIP1_CANAL/191-588SNN-----------------NLEALTQF------------------QNNMLSLMPNLINN.LDDSG..............
A7TEK5_VANPO/8-400G.N-----------------NVESLCNL------------------QFGLISLIPNLISN.LQNSG..............
H3CTF9_TETNG/13-493V.S-----------------PVSRLVGA------------------LMTVLSLFPGMIEHGLVDSSSYRPRNSLSEDSSL

PF09804

YKE7_YEAST/33-335ESF...................ELCNSL................AYCVFLISMLPKNLIG-NHVSD--------------
Q6FLQ0_CANGA/9-288NSF...................EYTNSL................LYCLATISRNSKLNMG-NTGSK--------------
A7TLL1_VANPO/24-351GSF...................ELCNSL................VYCISLISLIHKKNMK-AKDEY--------------
Q75DG5_ASHGO/36-366QSF...................ERTNAL................TYCLSVLSLIPLQLER-KLAHA--------------
A5DGT1_PICGU/16-298VIL.................SNYTAGAF................TYLLSLISLISQDTET-IQSNI--------------
C5MJC0_CANTT/11-295KAHDDQDL......LPNGEDHLFSISSY................CYLLSLLSIIPQDIEL-ISKTS--------------
A3LNE8_PICST/19-334RHHLLDKESIENDSDSVENDIYFNHSAF................TYLLSLISVIPHDIET-VSKDE--------------
Q6BJB8_DEBHA/28-311SKI.................DNFSSGAF................TYLLSLLSMIPNDIKI-YSDAL--------------
B8M2T3_TALSN/30-332TEA.................PVQSTCDY................VYALALLSSLPQSLSP-FFDQD--------------
A2QAY7_ASPNC/31-357AEA.................PVHEPCSYGMITIQSLSTNTYSQLVYDLSLLASLPNSLLP-LLPQN--------------
A1CNU9_ASPCL/30-339AEA.................PVHIPCNFD..............AVYDLSLLASLPYSLLP-LLPPA--------------
Q5BF30_EMENI/30-339AEA.................PVQVPCNY................VYDLSLLASLPNSLLP-LLPSD--------------
F2PVM8_TRIEC/26-326GDA.................PVESSCNF................IYNISLLSSLPQNLLS-LLPST--------------
E9CY67_COCPS/13-322GDA.................PVETSCNF................VYDLALLSSLPQTLSP-FLPPT--------------
C0S3V5_PARBP/84-387GEA.................PVEESCNF................VYDLSLLSSLPQSLAP-LLPST--------------
D5G5F9_TUBMM/21-341TGA.................PVELACNF................VYDISILSNIPLSVAD-LLSSE--------------
E3Q807_COLGM/29-348CHA.................PVREICNF................VYNISVLSNIPHTVTE-LLAPT--------------
E9F1A8_METAR/37-350CHA.................PVHEICDF................VYDISILSNIPFSVAD-RLPPS--------------
C7YNX8_NECH7/29-347CHA.................PVHEICDF................VYNISVLSNIPLSVTD-ILPTS--------------
B2AXI7_PODAN/33-356CHA.................PVHEVCNF................VYDISVLSNIPLSVCD-VIDPS--------------
Q0V1B2_PHANO/27-300GGP.................PVRAMCEF................VYILSILSSLSARDSE-LLLPG--------------
B3RV35_TRIAD/7-273SPP.................PVGIACYR................VYCCSLLSSSSISLRE-SQ...--------------
LCHN_DANRE/114-382SPP.................PVGVVCYR................VYCCCCLANVSIPGMG-VSVPE--------------
B7QCC0_IXOSC/54-313SPP.................PIGVVCYR................VYCTSTLVAHVYPDIE-TCL..--------------
F2UE85_SALR5/10-285TSP.................PVDPQCQQ................VYACCALGSHTIASFA-HTQ..--------------
YBAG_SCHPO/6-296SSH.................D.DQLYSI................IDMIVRLSSIKRSSDA-SIPIL--------------
Q5K7R2_CRYNJ/10-298SQP.................PVLPLSAL................AWNIWALSLPPRAALA-NGEAE--------------

PF08616

YG76_SCHPO/260-373TKT----------------SSASVLADF------------------VLSSCALVSG..AT-GLLQG--------------
A4I5V0_LEIIN/587-699SRK----------------GEAADVCEA------------------ALSLGIIGNMLDRD-FMARK--------------
A5DM71_PICGU/279-393SYE----------------NSSGYIIDS------------------ILLALKLITG...G-GILTG--------------
A5DZ96_LODEL/271-385SYE----------------NSAGHIIDH------------------VLLLLKIVTG...G-GILSG--------------
A7TRE4_VANPO/376-503STT----------------FSKDELSHF------------------ILVLSNYVNSCFDC-DATTY--------------
A8PX95_MALGO/354-466AYH----------------SPATVVVEH------------------VLAACALVSG..CG-AVLRG--------------
B0D0E4_LACBS/418-530GHK----------------RPAGEVSSF------------------VLSACALGSG..CG-AVLRG--------------
C3ZXT1_BRAFL/180-291APS----------------PTV..CSET------------------VLALTSMISPLNFC-SDF..--------------
C4R3J0_PICPG/305-418SYS----------------RSCNELLEF------------------IMAYFIIVE....N-FMSTD--------------
C5DJD2_LACTC/316-435STK----------------LPKDTLCQF------------------ILSLSNFIK....H-FDFHY--------------
C5DZH0_ZYGRC/269-391SSQ----------------YKGSGLSQF------------------AIALSNLMGL...T-NGTRS--------------
D2VRW9_NAEGR/366-475SGQ----------------QLAGQVVNT------------------LLSSLVMFPFLHDL-LKKRT--------------
D2W4R6_NAEGR/470-587GSP----------------AKL..VSQI------------------CLTLPLLIYP....-.....--------------
Q2URL2_ASPOR/377-488GHN----------------RPSGEVAEA------------------VLAACALAS....G-GILRG--------------
Q4DMT0_TRYCC/444-555SRQ----------------GLANDVCEA------------------ALSLGLIGNLLDPH-FVTKK--------------
Q4P9F2_USTMA/366-478GYG----------------QPASHVAGF------------------VLAACALGSG..CG-AVLQG--------------
Q55D43_DICDI/566-679GYG----------------CGADEICNY------------------VLAACSMVCPPLKG-TRERC--------------
Q6BI40_DEBHA/264-378SYD----------------NSAGYIINN------------------ILLMLKIITG...G-GILSG--------------
Q6CGA4_YARLI/272-384GYN----------------TPSGDVADH------------------VLAACFLASG...G-GILRG--------------
Q6CPS0_KLULA/322-444STE----------------RSKDELCQF------------------VLALSNLIN....G-FSSEY--------------
Q75BQ9_ASHGO/342-464STT----------------LSKDSLCQF------------------VLALSNFINA...F-DHQHY--------------
E7QKR4_YEASZ/211-334STK----------------LSKEDLCAF------------------ILSLANITATY.AS-DPQSY--------------
Q23F93_TETTS/358-465GYD----------------KSIRECVNF------------------ASSIQLLALP...L-NLSKK--------------
Q5KLM3_CRYNJ/358-470GHG----------------LPANQVARM------------------VLAACALGSG..CG-QVLRG--------------

PF07792

D4AU15_ARTBC/26-120...-----------------.NREHRQQ------------------QQHQQQQQESKQES-KPASK--------------
MESA_EMENI/79-211...-----------------.PLDTGGE------------------GEEDDLAGENNKRK-GKRNR--------------
A2Q8P4_ASPNC/82-209...-----------------.HKDTSAD------------------ADEDDASTGKKKKK-KKSRI--------------
A1CRY6_ASPCL/85-213...-----------------.HKDTSTE------------------EDEDGSAATKKKRR-KRAP.--------------
B6HSJ1_PENCW/75-202...-----------------.HKDTSGD------------------EETDSADGKKKKKR-KSQY.--------------
C0SET4_PARBP/168-287...-----------------.HKDAGSE------------------EEQECGDSSVDQQA-GNSRI--------------
F2TNB3_AJEDA/90-216...-----------------.HKDAGSE------------------EENEYVEPTAGQQT-EYNNI--------------
E9DDS1_COCPS/90-219...-----------------.HRDAGSE------------------DENEYGDDSQGQAE-KAVDE--------------
B8MHD8_TALSN/85-217...-----------------.HKDTESD------------------DEDAERESPKRRRR-RRRKQ--------------
F0XQA1_GROCL/147-315...-----------------.HKDTTPE------------------EEDQERLEKARRRE-KRRRK--------------
Q7RXB5_NEUCR/122-213...-----------------.HKDSSRE------------------EDEADRQAKEERRR-RRKRR--------------
B2AXK1_PODAN/123-264...-----------------.HKDSSQE------------------EDDAERQAKESRRA-RRRRR--------------
Q0V5R0_PHANO/110-243...-----------------.HKDTTAE------------------EEEREERRERRRKR-RRRKE--------------
Q6CGA4_YARLI/9-78...-----------------.HDENGLL------------------KYRPNDKGD.....-.....--------------
A0C6F7_PARTE/1-152FVS-----------------GQVQTYHF------------------DYQWKPLLQSSNQT-LSYS.--------------
Q23F93_TETTS/1-94...-----------------.KLKQVVD------------------QKTHKLVSEINLN.-.....--------------
D2VRW9_NAEGR/60-215...-----------------.RGNNEIN------------------NNHHNENNTSASSL-NNSNS--------------
E9BZT8_CAPO3/13-108...-----------------...NQTAP------------------EHDSAKGSKSMPS.-.....--------------
D3BKL1_POLPA/154-231...-----------------...NRPDP------------------DGILSKNKKAKPKP-KTQGK--------------
F0ZTU4_DICPU/95-230NRP-----------------VPENIKSP------------------EKSKSSSSKSSQSP-QSPSK--------------
C4Y911_CLAL4/3-80...-----------------.YVNSLTG------------------KLQYQYDSKTCDSK-P....--------------
C4R3J0_PICPG/6-86...-----------------.YSTYSDV------------------EFENAILSYDPKP.-.....--------------
A7TRE4_VANPO/73-221...-----------------.YYNTSTK------------------LYQLFKPSNIKTEV-QKNDN--------------
C5DZH0_ZYGRC/8-97...-----------------.YRNRETV------------------KYELFPSKQVDQV.-.....--------------
Q75BQ9_ASHGO/49-189...-----------------.YKDRYAQ------------------TFQLFPNDNAKGSL-KPTAE--------------
A0A023ZHY2_YEASX/26-188...-----------------.YYNKFTQ------------------NYQLFPVPKDPRFS-FNLHH--------------
Q6CPS0_KLULA/28-167...-----------------.YKNQNV.------------------.YQLFPVSKNKTKG-T....--------------
C5DJD2_LACTC/29-162...-----------------.YKDKYTR------------------NYHVFPIADSKLPQ-N....--------------

PF02141

DEN4C_MOUSE/307-491SLR------------------PAVLTGV------------------AEAVVAMIFPFQWQCPYIPL--------------
DEN5A_HUMAN/202-390SQH------------------YQRLMTV------------------AETITALMFPFQWQHVYVPI--------------
DEN5B_HUMAN/187-375SQD------------------YQRLMTV------------------AEGITTLLFPFQWQHVYVPI--------------
Q0US70_PHANO/395-592SSH------------------TAMLHLA------------------SMAIVNLLYPFQWAGVFIPI--------------
Q0UM90_PHANO/167-348SHY------------------PAMLTIA------------------AETVRFCVRVYEWSGLYVPV--------------
Q54JA6_DICDI/110-305SEN------------------INRVSKF------------------INAIVSLLDPFAWQHIFIPI--------------
Q55DD7_DICDI/109-294SKD------------------ISVVSNG------------------ILALSSLLSPLVWQHIFISI--------------
DEN2C_HUMAN/586-770ANS------------------LSTLSKC------------------GHAVVATLYPFTWQHTYIPV--------------
Q5RHZ1_DANRE/778-962ADK------------------LSTLSSC------------------VHAVVALLYPFSWQHTFIPV--------------
A7RR72_NEMVE/298-481SLR------------------PALLTSV------------------AEALTNVLFPFTWQCPYIPL--------------
DEN4B_MOUSE/313-497SLR------------------PDLLTSV------------------CEALVSMIFPLHWQCPYIPL--------------
Q7PWX7_ANOGA/311-495SLR------------------PAILTAV------------------AEAVSSFLFPFKWQCPYIPL--------------
Q9W3D2_DROME/308-492SLR------------------PATLTAV------------------AEAIVSLLFPFKWQCPYIPL--------------
MTMRD_HUMAN/116-298SAS------------------FQRLSDA------------------CRALESLMFPLKYSYPYIPI--------------
Q1LXZ0_DANRE/117-299SSS------------------YQRLTDA------------------CRALLAIMFPLKYSFTYVPI--------------
Q7KSP6_DROME/142-325SKC------------------YWHLTDS------------------CRALVALMYPFRYTHVYIPI--------------
Q177S0_AEDAE/106-289STS------------------YSRLTDS------------------CRALTALMYPFRYSHVYIPI--------------
A7SZQ4_NEMVE/186-373SNS------------------FHRFMLV------------------AEGVVTLIFPFIWQHVYVPI--------------
Q54VP0_DICDI/908-1097SSQ------------------YTLLTYI------------------CEIITTLIHPLVYTHIYVPV--------------
Q2GNY8_CHAGB/440-637SSH------------------TGMLHLA------------------CHALANLLYPLKWASIFIPV--------------
A7EF60_SCLS1/465-662SSH------------------TAMLHLA------------------SKALVSLLYPLKWASIFIPV--------------
Q0CL54_ASPTN/423-620SSH------------------TSMLYLA------------------TRALVDLLFPITWTGVLIPV--------------
DENN_SCHPO/362-562SEN------------------LGMLGYA------------------SQALLHLLYPLTWQGLYIPV--------------
DEND3_MOUSE/187-373SSD------------------WALLTLM------------------AECFVAYLHPLQWQHTFVPI--------------
A1Z7Q5_DROME/98-283SRH------------------LDRLSSC------------------IQAANAFLYPMVWQHIFIPV--------------
Q7Q1I7_ANOGA/88-273SRR------------------LDILSSC------------------VQAANAFLYPMVWQHIFIPV--------------
B8JLM2_DANRE/225-405AEE------------------LGTLSQV------------------IHAVAVLLYPFIWQHTLISI--------------
F1N1V1_BOVIN/150-332AEG------------------LSTLSQC------------------IHATAALLYPFSWAHTYIPV--------------
F1QFB0_DANRE/165-345SEE------------------LSTLSQV------------------LHAVAALLYPFVWQHTFISI--------------
F1RDS6_DANRE/306-489SLR------------------PDVLTSV------------------SEALLSMTFPLRWHCPYIPL--------------
F6SD79_XENTR/91-270SSK------------------LSTLTAC------------------VHASAALLYPMYWQHIYIPT--------------
F7CWX4_XENTR/145-326ARD------------------LSILSEC------------------IHAVVALLYPFAWEHTYIPV--------------
H2UHI4_TAKRU/223-407SLR------------------PAVLTSV------------------TEALVSMIFPFHWPCPYIPL--------------
H3CCM9_TETNG/318-499ADK------------------LSTLSQC------------------CHAIVALLYPFTWQHTYIPV--------------
H3CZX5_TETNG/307-489ADK------------------LSVLSRC------------------CHAVLALLYPFTWQHTFIPV--------------
H3D3K0_TETNG/203-391SQD------------------YQRLMTV------------------SESVTTLLFPFQWQHIYLPI--------------
H3DM09_TETNG/192-375SAD------------------FARLTLV------------------AESFLLFLQPLSWQQPYVPV--------------
U4PB89_CAEEL/329-512SLR------------------PWMLAAV------------------AESVCALMFPFHWQCPYIPQ--------------

PF09794

Q7QF11_ANOGA/7-482STPVEEQHGDAPPCRTTLPAIVTEQEAPHEPIAPCREADELLTDPDGRSIASAKEAALEETTTSSSSSSSPSSGSSMEAA
Q29HH8_DROPS/14-480TDSLQREALALAAAEAEAEAATQD...........................EPKLTPESATAAEGEAEDLALVSSAASAG
Q6BP02_DEBHA/131-552................................................................................
A5DNM6_PICGU/119-523................................................................................
Q2H333_CHAGB/18-368................................................................................
AVL9_PONAB/16-520QESNPCADDFVSASTADVSHTNLGTVR....................KVIAGNHGEDAAMKTEEPLFQVEDSSKGQEPND
Q4P7V8_USTMA/140-510................................................................................
Q17GP2_AEDAE/7-476GTPLDETQKFPSEPTSP........................................VKECISGDTDPQGESSGSASSTA
Q6C028_YARLI/516-899................................................................................
Q54NJ9_DICDI/6-452................................................................................
A1CPG6_ASPCL/9-384................................................................................
Q6FIU1_CANGA/8-406................................................................................
Q08D17_XENTR/21-516PLVTYSDDCTSLAASGLNAKQ................................ENQGPNRNTENSKIDTLLCEHEADTNG
Q6CKD3_KLULA/6-399................................................................................
Q750W9_ASHGO/13-401................................................................................
Q5KDB3_CRYNJ/119-529................................................................................
AVL9_YEAST/9-401................................................................................
A3LPG1_PICST/85-492................................................................................
AVL9_SCHPO/10-367................................................................................
Q5AIP1_CANAL/191-588................................................................................
A7TEK5_VANPO/8-400................................................................................
H3CTF9_TETNG/13-493EESVSGAEEFVSVSVTDL......................................DNAALQGSGRPAAENRSSGNGAEG

PF09804

YKE7_YEAST/33-335--------------------------------------------------------------------------------
Q6FLQ0_CANGA/9-288--------------------------------------------------------------------------------
A7TLL1_VANPO/24-351--------------------------------------------------------------------------------
Q75DG5_ASHGO/36-366--------------------------------------------------------------------------------
A5DGT1_PICGU/16-298--------------------------------------------------------------------------------
C5MJC0_CANTT/11-295--------------------------------------------------------------------------------
A3LNE8_PICST/19-334--------------------------------------------------------------------------------
Q6BJB8_DEBHA/28-311--------------------------------------------------------------------------------
B8M2T3_TALSN/30-332--------------------------------------------------------------------------------
A2QAY7_ASPNC/31-357--------------------------------------------------------------------------------
A1CNU9_ASPCL/30-339--------------------------------------------------------------------------------
Q5BF30_EMENI/30-339--------------------------------------------------------------------------------
F2PVM8_TRIEC/26-326--------------------------------------------------------------------------------
E9CY67_COCPS/13-322--------------------------------------------------------------------------------
C0S3V5_PARBP/84-387--------------------------------------------------------------------------------
D5G5F9_TUBMM/21-341--------------------------------------------------------------------------------
E3Q807_COLGM/29-348--------------------------------------------------------------------------------
E9F1A8_METAR/37-350--------------------------------------------------------------------------------
C7YNX8_NECH7/29-347--------------------------------------------------------------------------------
B2AXI7_PODAN/33-356--------------------------------------------------------------------------------
Q0V1B2_PHANO/27-300--------------------------------------------------------------------------------
B3RV35_TRIAD/7-273--------------------------------------------------------------------------------
LCHN_DANRE/114-382--------------------------------------------------------------------------------
B7QCC0_IXOSC/54-313--------------------------------------------------------------------------------
F2UE85_SALR5/10-285--------------------------------------------------------------------------------
YBAG_SCHPO/6-296--------------------------------------------------------------------------------
Q5K7R2_CRYNJ/10-298--------------------------------------------------------------------------------

PF08616

YG76_SCHPO/260-373--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_PICPG/305-418--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
Q4P9F2_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------
E7QKR4_YEASZ/211-334--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------
Q5KLM3_CRYNJ/358-470--------------------------------------------------------------------------------

PF07792

D4AU15_ARTBC/26-120--------------------------------------------------------------------------------
MESA_EMENI/79-211--------------------------------------------------------------------------------
A2Q8P4_ASPNC/82-209--------------------------------------------------------------------------------
A1CRY6_ASPCL/85-213--------------------------------------------------------------------------------
B6HSJ1_PENCW/75-202--------------------------------------------------------------------------------
C0SET4_PARBP/168-287--------------------------------------------------------------------------------
F2TNB3_AJEDA/90-216--------------------------------------------------------------------------------
E9DDS1_COCPS/90-219--------------------------------------------------------------------------------
B8MHD8_TALSN/85-217--------------------------------------------------------------------------------
F0XQA1_GROCL/147-315--------------------------------------------------------------------------------
Q7RXB5_NEUCR/122-213--------------------------------------------------------------------------------
B2AXK1_PODAN/123-264--------------------------------------------------------------------------------
Q0V5R0_PHANO/110-243--------------------------------------------------------------------------------
Q6CGA4_YARLI/9-78--------------------------------------------------------------------------------
A0C6F7_PARTE/1-152--------------------------------------------------------------------------------
Q23F93_TETTS/1-94--------------------------------------------------------------------------------
D2VRW9_NAEGR/60-215--------------------------------------------------------------------------------
E9BZT8_CAPO3/13-108--------------------------------------------------------------------------------
D3BKL1_POLPA/154-231--------------------------------------------------------------------------------
F0ZTU4_DICPU/95-230--------------------------------------------------------------------------------
C4Y911_CLAL4/3-80--------------------------------------------------------------------------------
C4R3J0_PICPG/6-86--------------------------------------------------------------------------------
A7TRE4_VANPO/73-221--------------------------------------------------------------------------------
C5DZH0_ZYGRC/8-97--------------------------------------------------------------------------------
Q75BQ9_ASHGO/49-189--------------------------------------------------------------------------------
A0A023ZHY2_YEASX/26-188--------------------------------------------------------------------------------
Q6CPS0_KLULA/28-167--------------------------------------------------------------------------------
C5DJD2_LACTC/29-162--------------------------------------------------------------------------------

PF02141

DEN4C_MOUSE/307-491--------------------------------------------------------------------------------
DEN5A_HUMAN/202-390--------------------------------------------------------------------------------
DEN5B_HUMAN/187-375--------------------------------------------------------------------------------
Q0US70_PHANO/395-592--------------------------------------------------------------------------------
Q0UM90_PHANO/167-348--------------------------------------------------------------------------------
Q54JA6_DICDI/110-305--------------------------------------------------------------------------------
Q55DD7_DICDI/109-294--------------------------------------------------------------------------------
DEN2C_HUMAN/586-770--------------------------------------------------------------------------------
Q5RHZ1_DANRE/778-962--------------------------------------------------------------------------------
A7RR72_NEMVE/298-481--------------------------------------------------------------------------------
DEN4B_MOUSE/313-497--------------------------------------------------------------------------------
Q7PWX7_ANOGA/311-495--------------------------------------------------------------------------------
Q9W3D2_DROME/308-492--------------------------------------------------------------------------------
MTMRD_HUMAN/116-298--------------------------------------------------------------------------------
Q1LXZ0_DANRE/117-299--------------------------------------------------------------------------------
Q7KSP6_DROME/142-325--------------------------------------------------------------------------------
Q177S0_AEDAE/106-289--------------------------------------------------------------------------------
A7SZQ4_NEMVE/186-373--------------------------------------------------------------------------------
Q54VP0_DICDI/908-1097--------------------------------------------------------------------------------
Q2GNY8_CHAGB/440-637--------------------------------------------------------------------------------
A7EF60_SCLS1/465-662--------------------------------------------------------------------------------
Q0CL54_ASPTN/423-620--------------------------------------------------------------------------------
DENN_SCHPO/362-562--------------------------------------------------------------------------------
DEND3_MOUSE/187-373--------------------------------------------------------------------------------
A1Z7Q5_DROME/98-283--------------------------------------------------------------------------------
Q7Q1I7_ANOGA/88-273--------------------------------------------------------------------------------
B8JLM2_DANRE/225-405--------------------------------------------------------------------------------
F1N1V1_BOVIN/150-332--------------------------------------------------------------------------------
F1QFB0_DANRE/165-345--------------------------------------------------------------------------------
F1RDS6_DANRE/306-489--------------------------------------------------------------------------------
F6SD79_XENTR/91-270--------------------------------------------------------------------------------
F7CWX4_XENTR/145-326--------------------------------------------------------------------------------
H2UHI4_TAKRU/223-407--------------------------------------------------------------------------------
H3CCM9_TETNG/318-499--------------------------------------------------------------------------------
H3CZX5_TETNG/307-489--------------------------------------------------------------------------------
H3D3K0_TETNG/203-391--------------------------------------------------------------------------------
H3DM09_TETNG/192-375--------------------------------------------------------------------------------
U4PB89_CAEEL/329-512--------------------------------------------------------------------------------

PF09794

Q7QF11_ANOGA/7-482GGGDGAGPNARAAVALLRETSVDTIASNFSSLYAI.............................................
Q29HH8_DROPS/14-480SQCSGDTSPHSTPNSQDLN..FASSSSHRESNGRNSSLTREASVDT..........................LASNLAAL
Q6BP02_DEBHA/131-552.........CPLSDFIETNGPLTKPNSLNTSSRQS.............................................
A5DNM6_PICGU/119-523.........CPLIDYSETNGPLKKPESLNTSSRQS.............................................
Q2H333_CHAGB/18-368.........GPELDNYEKG..LSMPTSLRTSDRNS.............................................
AVL9_PONAB/16-520TNQYLKPPSRPSPDSSESDWETLDPSVLEDPNSKEREQLGSDQTNLFPKDSVPSESL...PITVQPQANTGQVVLIPGLI
Q4P7V8_USTMA/140-510.........DPSLHTRAGR..VEAADSLRSSDRKS.............................................
Q17GP2_AEDAE/7-476QQMQHSQDTDSGSTSTTREITPCSDDAQLGSLEDAAVGRNGTNNARPALAR...............ETSVDTIASNFSSL
Q6C028_YARLI/516-899.........SPLLHSYELG..LTRATSLKTSDRQS.............................................
Q54NJ9_DICDI/6-452.........QSISNDFQIDWTTSTSEEM....................................................
A1CPG6_ASPCL/9-384.........DPSADSYEQT..VKKPTSLKTSDRAS.............................................
Q6FIU1_CANGA/8-406.........SPVLSNSYEN..VTVADSFKSSDRLS.............................................
Q08D17_XENTR/21-516SIEKLKPPSHTSPESVESDWETLDPSILEECISRDEEVIWSTAPEHPDLLPTDTISSGSAPITVQPQSNTGQSVYIPGLI
Q6CKD3_KLULA/6-399.........SPMLDTYSKN..MTMVNSFKSSDRGS.............................................
Q750W9_ASHGO/13-401.........SPLLNKYERQ..LTACDSFKSSDRRS.............................................
Q5KDB3_CRYNJ/119-529.........SPALEQKRSK...VRPTSLRTSDRTS.............................................
AVL9_YEAST/9-401.........SPQLFQDISK..LNVVDSFKSSNRES.............................................
A3LPG1_PICST/85-492.........CPLIDYVETNGPLAKPNSLNTTNRRS.............................................
AVL9_SCHPO/10-367.........SPSAHSLEKS..LHKPASLQTSDKRS.............................................
Q5AIP1_CANAL/191-588.........CPLIDYAETNGPLSKPQSLNTTNRVS.............................................
A7TEK5_VANPO/8-400.........SPMLHKDVSD..IKVVTSFKSSDRAS.............................................
H3CTF9_TETNG/13-493DNHLLKPPARTSPESGDSDWETLDPSVLEEGGTKEAAGDDQRDAAFDPNPETPIT........VQPQAVSGQGGLVQGLV

PF09804

YKE7_YEAST/33-335--------------------------------------------------------------------------------
Q6FLQ0_CANGA/9-288--------------------------------------------------------------------------------
A7TLL1_VANPO/24-351--------------------------------------------------------------------------------
Q75DG5_ASHGO/36-366--------------------------------------------------------------------------------
A5DGT1_PICGU/16-298--------------------------------------------------------------------------------
C5MJC0_CANTT/11-295--------------------------------------------------------------------------------
A3LNE8_PICST/19-334--------------------------------------------------------------------------------
Q6BJB8_DEBHA/28-311--------------------------------------------------------------------------------
B8M2T3_TALSN/30-332--------------------------------------------------------------------------------
A2QAY7_ASPNC/31-357--------------------------------------------------------------------------------
A1CNU9_ASPCL/30-339--------------------------------------------------------------------------------
Q5BF30_EMENI/30-339--------------------------------------------------------------------------------
F2PVM8_TRIEC/26-326--------------------------------------------------------------------------------
E9CY67_COCPS/13-322--------------------------------------------------------------------------------
C0S3V5_PARBP/84-387--------------------------------------------------------------------------------
D5G5F9_TUBMM/21-341--------------------------------------------------------------------------------
E3Q807_COLGM/29-348--------------------------------------------------------------------------------
E9F1A8_METAR/37-350--------------------------------------------------------------------------------
C7YNX8_NECH7/29-347--------------------------------------------------------------------------------
B2AXI7_PODAN/33-356--------------------------------------------------------------------------------
Q0V1B2_PHANO/27-300--------------------------------------------------------------------------------
B3RV35_TRIAD/7-273--------------------------------------------------------------------------------
LCHN_DANRE/114-382--------------------------------------------------------------------------------
B7QCC0_IXOSC/54-313--------------------------------------------------------------------------------
F2UE85_SALR5/10-285--------------------------------------------------------------------------------
YBAG_SCHPO/6-296--------------------------------------------------------------------------------
Q5K7R2_CRYNJ/10-298--------------------------------------------------------------------------------

PF08616

YG76_SCHPO/260-373--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_PICPG/305-418--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
Q4P9F2_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------
E7QKR4_YEASZ/211-334--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------
Q5KLM3_CRYNJ/358-470--------------------------------------------------------------------------------

PF07792

D4AU15_ARTBC/26-120--------------------------------------------------------------------------------
MESA_EMENI/79-211--------------------------------------------------------------------------------
A2Q8P4_ASPNC/82-209--------------------------------------------------------------------------------
A1CRY6_ASPCL/85-213--------------------------------------------------------------------------------
B6HSJ1_PENCW/75-202--------------------------------------------------------------------------------
C0SET4_PARBP/168-287--------------------------------------------------------------------------------
F2TNB3_AJEDA/90-216--------------------------------------------------------------------------------
E9DDS1_COCPS/90-219--------------------------------------------------------------------------------
B8MHD8_TALSN/85-217--------------------------------------------------------------------------------
F0XQA1_GROCL/147-315--------------------------------------------------------------------------------
Q7RXB5_NEUCR/122-213--------------------------------------------------------------------------------
B2AXK1_PODAN/123-264--------------------------------------------------------------------------------
Q0V5R0_PHANO/110-243--------------------------------------------------------------------------------
Q6CGA4_YARLI/9-78--------------------------------------------------------------------------------
A0C6F7_PARTE/1-152--------------------------------------------------------------------------------
Q23F93_TETTS/1-94--------------------------------------------------------------------------------
D2VRW9_NAEGR/60-215--------------------------------------------------------------------------------
E9BZT8_CAPO3/13-108--------------------------------------------------------------------------------
D3BKL1_POLPA/154-231--------------------------------------------------------------------------------
F0ZTU4_DICPU/95-230--------------------------------------------------------------------------------
C4Y911_CLAL4/3-80--------------------------------------------------------------------------------
C4R3J0_PICPG/6-86--------------------------------------------------------------------------------
A7TRE4_VANPO/73-221--------------------------------------------------------------------------------
C5DZH0_ZYGRC/8-97--------------------------------------------------------------------------------
Q75BQ9_ASHGO/49-189--------------------------------------------------------------------------------
A0A023ZHY2_YEASX/26-188--------------------------------------------------------------------------------
Q6CPS0_KLULA/28-167--------------------------------------------------------------------------------
C5DJD2_LACTC/29-162--------------------------------------------------------------------------------

PF02141

DEN4C_MOUSE/307-491--------------------------------------------------------------------------------
DEN5A_HUMAN/202-390--------------------------------------------------------------------------------
DEN5B_HUMAN/187-375--------------------------------------------------------------------------------
Q0US70_PHANO/395-592--------------------------------------------------------------------------------
Q0UM90_PHANO/167-348--------------------------------------------------------------------------------
Q54JA6_DICDI/110-305--------------------------------------------------------------------------------
Q55DD7_DICDI/109-294--------------------------------------------------------------------------------
DEN2C_HUMAN/586-770--------------------------------------------------------------------------------
Q5RHZ1_DANRE/778-962--------------------------------------------------------------------------------
A7RR72_NEMVE/298-481--------------------------------------------------------------------------------
DEN4B_MOUSE/313-497--------------------------------------------------------------------------------
Q7PWX7_ANOGA/311-495--------------------------------------------------------------------------------
Q9W3D2_DROME/308-492--------------------------------------------------------------------------------
MTMRD_HUMAN/116-298--------------------------------------------------------------------------------
Q1LXZ0_DANRE/117-299--------------------------------------------------------------------------------
Q7KSP6_DROME/142-325--------------------------------------------------------------------------------
Q177S0_AEDAE/106-289--------------------------------------------------------------------------------
A7SZQ4_NEMVE/186-373--------------------------------------------------------------------------------
Q54VP0_DICDI/908-1097--------------------------------------------------------------------------------
Q2GNY8_CHAGB/440-637--------------------------------------------------------------------------------
A7EF60_SCLS1/465-662--------------------------------------------------------------------------------
Q0CL54_ASPTN/423-620--------------------------------------------------------------------------------
DENN_SCHPO/362-562--------------------------------------------------------------------------------
DEND3_MOUSE/187-373--------------------------------------------------------------------------------
A1Z7Q5_DROME/98-283--------------------------------------------------------------------------------
Q7Q1I7_ANOGA/88-273--------------------------------------------------------------------------------
B8JLM2_DANRE/225-405--------------------------------------------------------------------------------
F1N1V1_BOVIN/150-332--------------------------------------------------------------------------------
F1QFB0_DANRE/165-345--------------------------------------------------------------------------------
F1RDS6_DANRE/306-489--------------------------------------------------------------------------------
F6SD79_XENTR/91-270--------------------------------------------------------------------------------
F7CWX4_XENTR/145-326--------------------------------------------------------------------------------
H2UHI4_TAKRU/223-407--------------------------------------------------------------------------------
H3CCM9_TETNG/318-499--------------------------------------------------------------------------------
H3CZX5_TETNG/307-489--------------------------------------------------------------------------------
H3D3K0_TETNG/203-391--------------------------------------------------------------------------------
H3DM09_TETNG/192-375--------------------------------------------------------------------------------
U4PB89_CAEEL/329-512--------------------------------------------------------------------------------

PF09794

Q7QF11_ANOGA/7-482...EPSEWGAPLRIFH..................EGVLC----L---PYISLPYMDLL..------....TDPSVKGYMI
Q29HH8_DROPS/14-480CSVNPDEYRAPVSIFA..................SGNLC----L---PYLSLPYMDLL..------....SDPMVLSYVI
Q6BP02_DEBHA/131-552...MLRFFGLPLQVFN.................TKGSFW----N---PYLPLQQLSEL..------....SASETRSYMV
A5DNM6_PICGU/119-523...MLRFFGLPLQIFN.................TKGAFW----N---PYLPLQQLNAL..------....SSPGTKSFMV
Q2H333_CHAGB/18-368...LLSYMGLPLQIFG..................KGSLF----G---PYTPLQQLDVL..------....ADFGTKSYIV
AVL9_PONAB/16-520SGLEEDQYGMPLAIFT..................KGYLC----L---PYMALQQHHLL..------....SDVTVRGFVA
Q4P7V8_USTMA/140-510...LLKFLGMPLDIFG..................PDAFF----Q---PYCPLQQIDLL..------.......KSRSWLV
Q17GP2_AEDAE/7-476CAIKPEEWMAPLKIFH..................EGNLC----L---PYLSLPYMDLL..------....TDPSVKGYII
Q6C028_YARLI/516-899...LLNFMGLPLMVFG..................EGGMF----S---PYIPLQQLGDL..------......ALARYYLV
Q54NJ9_DICDI/6-452...VLNQLGLPIPLFNDGKDNNTTNSDGEKVYGSGGMIL----Q---PYLPLQQISLLLP------PQQGSGKTFNGFLV
A1CPG6_ASPCL/9-384...LLAYMGLPLQIFG..................KGSMF----G---PYTPLQQLDLL..------....ADYGTKSYVV
Q6FIU1_CANGA/8-406...VLKFLGFPLHIFE..................KGGLF----S---PYTPLQQVSEI..------....RSPATKFFMV
Q08D17_XENTR/21-516SGLEEDQYGMPLAIFT..................KGYLC----L---PYMALQQHHLL..------....SDVSVRGFVA
Q6CKD3_KLULA/6-399...VLRFLGFPLQIFT..................KGGFF----S---PYVPLQQMNDL..------....TASVTKWFVA
Q750W9_ASHGO/13-401...VIRFLGFPLQIFA..................SGGLF----S---PYTPLQQLGDL..------....TSPKTKWYVI
Q5KDB3_CRYNJ/119-529...LLRFMGLPLRIFS..................HDAFF----Q---PYMPLQQMDTL..------.......AAKSWLV
AVL9_YEAST/9-401...VLRFLGFPLPIFE..................KGGLF----S---PYTPLQQMNDI..------....RSERTLFFMI
A3LPG1_PICST/85-492...MLRFFGLPLQIFN.................TKNAFW----N---PYLPLQQLDEL..------.......TVESFMV
AVL9_SCHPO/10-367...LLAYTGFPLIIFG..................EGSMF----S---PYTPLQLVHVL..------....EAKSSTSWLA
Q5AIP1_CANAL/191-588...MLRFFGLPLQIFN.................TKNSFW----N---PYLPLQQLDEL..------.......AVNSFMI
A7TEK5_VANPO/8-400...VLTFMGFPLHIFE..................TGGFF----S---PYTPLQQINDI..------....NDEKSKFFVI
H3CTF9_TETNG/13-493SGLEEDQYGLPLPIFT..................KGYLC----L---PYMALQQHHLL..------....SDVTVRGFVA

PF09804

YKE7_YEAST/33-335---.....EYIKPIFT------------------VSTSD----I...PFLESFKKG...................NGYVA
Q6FLQ0_CANGA/9-288---....GSYIPTLFT------------------VGTYD----I...EDLEKHGQE....................GFLA
A7TLL1_VANPO/24-351---....DDFISPLFT------------------IGVND----I...DFLNKVIKESGNS...........DYQMSSFVA
Q75DG5_ASHGO/36-366---....NMPLQTLYT------------------IGIAD----L...DHLTDMVSDALHKSD.......PDGPHLPSFIA
A5DGT1_PICGU/16-298---....VSMSQPIYN------------------VGLHD----LSENDSVLKTP......................HIIT
C5MJC0_CANTT/11-295---...AATYSQPVYH------------------IGLND----L..TGHLMKVK......................GYIG
A3LNE8_PICST/19-334---K..KHSYSQPIYN------------------IGLND----LD.SDDLLKTS......................GYIA
Q6BJB8_DEBHA/28-311---.....TYSQPLYN------------------IGLND----L..ESSLLEFP......................ATIA
B8M2T3_TALSN/30-332---G.APPLRPRPIFN------------------VGIHD----I...PFLST....NSD..............TYSSWIA
A2QAY7_ASPNC/31-357---G.LPSPRPRPLFN------------------VGIHD----I...PHLSSFVGTLVNA............EHDAAWIA
A1CNU9_ASPCL/30-339---G.SPPPRPRPLFN------------------VGIHD----I...PYLSSFVGVSPSS............EPDAAWIA
Q5BF30_EMENI/30-339---R.LLSLRPRALFN------------------VGVYD----I...PYLSSFIRGSADS............EHDSTWIA
F2PVM8_TRIEC/26-326---KDIPSFRPRPLFN------------------IGIHD----M...AQLST....LSS..............TDPCWIA
E9CY67_COCPS/13-322---D.LPAFRPRALFN------------------VGVHD----L...PYLTSLSRKTSPQ...........KKGENCWIA
C0S3V5_PARBP/84-387---A.LPSLRPRPMFS------------------IGIHD----M...PYLLSLPSPSIS.............DPDGCWIA
D5G5F9_TUBMM/21-341---....PSRLRPLFS------------------IGVHD----I...PLLEEEAKRIHPTSQPPH.DRDHLGGEQGSWVA
E3Q807_COLGM/29-348---S..SSQRLRPLFT------------------IGVHD----I...PFLMEDFEASKRRKAGGN..DNFADESGSGWIA
E9F1A8_METAR/37-350---S..PTPRLRPLFT------------------IGVHD----I...PFLMEDFEASKRRQDGT...ADSGGEAGSGWIA
C7YNX8_NECH7/29-347---S..STQRLRPLFS------------------IGVHD----I...PFLMEDFEASKRERSSE...DAVDDEAGSGWIA
B2AXI7_PODAN/33-356---A..PVQRLRPLFT------------------IGVHD----I...SYLMEHQAAMKKRPNQDDQHSDPSEDSTSGWVA
Q0V1B2_PHANO/27-300---A.EALLRLPSLFS------------------VGVHD----I...PSLEAPTTS....................GWTA
B3RV35_TRIAD/7-273---.......TQPQFY------------------VNVAD----I...AELSSTK......................TYVA
LCHN_DANRE/114-382---.......FRPFFY------------------INVAD----I...PALETEL......................SYVA
B7QCC0_IXOSC/54-313---.......CPPNFY------------------INVTD----V...DVLAKQS......................AYVA
F2UE85_SALR5/10-285---.......ARPFLY------------------ANLSD----I...PWMSTHS......................NYIC
YBAG_SCHPO/6-296---....LSDLHPFYS------------------VGLAN----T...STLLDNDLE...................EGWIA
Q5K7R2_CRYNJ/10-298---......ISEYLGN------------------VGLMD----L...DNIKAKKG.....................GWVA

PF08616

YG76_SCHPO/260-373---LTRIT...FPY..------------------IDLSN....V---ESLVKLPG...------------.......YLA
A4I5V0_LEIIN/587-699---V.......FPY..------------------VSVSS....V---NYFMQVPG...------------.......YIV
A5DM71_PICGU/279-393---FFSNYN.IFPM..------------------IDVSK....I---DLLEKCDS...------------.......YLA
A5DZ96_LODEL/271-385---LLTNYN.VFPI..------------------IDVSK....I---DLLEECES...------------.......FIA
A7TRE4_VANPO/376-503---YKQNSILIFPY..------------------MDISM....V---DALRKYLNDKS------------GNISNKFAII
A8PX95_MALGO/354-466---FVASS...IPY..------------------VTLAS....L---DTLRSMRG...------------.......FIA
B0D0E4_LACBS/418-530---FVERS...FPY..------------------ANLNN....R---DEWEAVPA...------------.......YIA
C3ZXT1_BRAFL/180-291---........RPYFT------------------IHDSEFKEYT---TKTQAAPP...------------.......VVL
C4R3J0_PICPG/305-418---SPCTTDHLYPY..------------------VDLSQ....L---EILEKMPF...------------.......YVA
C5DJD2_LACTC/316-435---FENAQVIIFPY..------------------MDISF....L---DALREQLVLQN------------G..RRMFTIV
C5DZH0_ZYGRC/269-391---FSNKPCLTLPF..------------------VDVSI....I---GPLKEYLALQD------------...RGIFLIM
D2VRW9_NAEGR/366-475---........FPY..------------------ASFSN.....---LEFLDVEG...------------.......YIV
D2W4R6_NAEGR/470-587---FQYNVNRVHPY..------------------VPLSEMDDVL---SATSKIPE...------------.......YII
Q2URL2_ASPOR/377-488---FTRHA...FPY..------------------TDLTK....I---DDLLKVPG...------------.......FIA
Q4DMT0_TRYCC/444-555---V.......FPY..------------------TSVNG....L---SHFCSVPG...------------.......YIV
Q4P9F2_USTMA/366-478---FAARA...FPY..------------------TNLLN....L---DDLEKVPG...------------.......YIA
Q55D43_DICDI/566-679---........FPN..------------------INLHHQ.ILI---DKLPPSTG...------------.......VIL
Q6BI40_DEBHA/264-378---LLTNYN.IFPI..------------------LDVSK....I---DCLKKCDS...------------.......YIA
Q6CGA4_YARLI/272-384---FTRYA...FPY..------------------TDLSK....V---DDLLETPG...------------.......FIA
Q6CPS0_KLULA/322-444---FDNSSICIFPY..------------------MEISI....I---DMFRENFTEEF------------T.KGNFFSVV
Q75BQ9_ASHGO/342-464---FQNSSVIIFPY..------------------MDISM....I---DELRNEFSVKK------------T..GNYFSIV
E7QKR4_YEASZ/211-334---FKGNAALIFPY..------------------MDISL....V---DGLRAYVASNS------------D.FVGCFAII
Q23F93_TETTS/358-465---....I...HLY..------------------CHLQD....L---.SFVEKKS...------------.......YIA
Q5KLM3_CRYNJ/358-470---MTECA...FPY..------------------ANLAS....L---DILEEFPG...------------.......YVA

PF07792

D4AU15_ARTBC/26-120---.........................................---......................QAAEEKRENPA
MESA_EMENI/79-211---....VRS....................SSGDEGTSADTN..---..........N......ESEVTEEEESSDEEDG
A2Q8P4_ASPNC/82-209---...........................GDAESGDGDSED..---..................VGGSTEEESSDEEEG
A1CRY6_ASPCL/85-213---...........................ADHDAGDDSQEE..---..........D......TDALTEESSDEDEDDG
B6HSJ1_PENCW/75-202---...........................HGNQAGADIQDE..---.................YLDDISDDPDSSDDEG
C0SET4_PARBP/168-287---...........................RQENEGLNDGGS..---..........E......VSVGDEDEIEDEDEEN
F2TNB3_AJEDA/90-216---...........................SQENEGLNDDSS..---...................EASVVDEDEEDDEN
E9DDS1_COCPS/90-219---AK.........................EDSQDGHDQTED..---..................EEATDDDGDDDDEEA
B8MHD8_TALSN/85-217---....QTE....................IEQESDADSNND..---..........E......DDQSDAAESTDDEEDS
F0XQA1_GROCL/147-315---HGHVATTDNIKTTDGTETNGLSESDADNEEAPEKDKDADDN---DNDDYDDDDDD......DDEDEDSMSTDSEPEG
Q7RXB5_NEUCR/122-213---...........................QDREQGIIHESD..---.................................
B2AXK1_PODAN/123-264---...........................RDRAKGIIHESDDE---DDGGEEDLDDD......DDDWDDDVSTDEEPEG
Q0V5R0_PHANO/110-243---...........................GLDDDDTTAGDE..---......LEGAD......DAEEDDYDTESEDEPD
Q6CGA4_YARLI/9-78---.........................................---.................................
A0C6F7_PARTE/1-152---...........................DDNVLKIRGEKE..---....SEWLDIN......LSNAQIHVISHDFVSI
Q23F93_TETTS/1-94---.........................................---.................................
D2VRW9_NAEGR/60-215---...........................GNNNSSILSNGS..---.NDGGEEAKSSPRNSQEVVEKVDLNTSLESTIL
E9BZT8_CAPO3/13-108---...........................DNKTPAVTSLDA..---.................................
D3BKL1_POLPA/154-231---.........................................---.................................
F0ZTU4_DICPU/95-230---...........................IDTNNNNNNNNN..---.................NNNNNKSATAAPKVEK
C4Y911_CLAL4/3-80---.........................................---.................................
C4R3J0_PICPG/6-86---.........................................---.................................
A7TRE4_VANPO/73-221---...........................DDNDDEENEDGD..---.....GDDDSE......YIDSEIFTDAKDENDN
C5DZH0_ZYGRC/8-97---.........................................---.................................
Q75BQ9_ASHGO/49-189---...........................SHGHLGGSPSSR..---.......LESM......ILEEDENAGSSKTSLS
A0A023ZHY2_YEASX/26-188---...........................REQSDGSVTNSIYY---DAENHQDAKNNRYTIVLEDDELECQEVQNNQNA
Q6CPS0_KLULA/28-167---...........................DLDSSLIIEEED..---....FEEEQEN......GLRSGKIGSIRDDRHL
C5DJD2_LACTC/29-162---...........................DARSPTILEEDE..---.................PQSGLAGEASTNHNAD

PF02141

DEN4C_MOUSE/307-491----------------------------------CPLSL----A---GVL.SAPL---------------------PFIV
DEN5A_HUMAN/202-390----------------------------------LPASL----L---HFL.DAPV---------------------PYLM
DEN5B_HUMAN/187-375----------------------------------LPASL----L---HFL.DAPV---------------------PYLM
Q0US70_PHANO/395-592----------------------------------LPARL----V---QTI.EAPC---------------------PYIV
Q0UM90_PHANO/167-348----------------------------------VHARH----V---KDLVQEPG---------------------PYIL
Q54JA6_DICDI/110-305----------------------------------LPRSL----L---DYC.TAPM---------------------PFII
Q55DD7_DICDI/109-294----------------------------------LPNAL----M---PYV.AAPI---------------------PFLV
DEN2C_HUMAN/586-770----------------------------------LPASM----I---DIV.CSPT---------------------PFLI
Q5RHZ1_DANRE/778-962----------------------------------LPTSM----V---DIV.CCPT---------------------PFLV
A7RR72_NEMVE/298-481----------------------------------CPVAL----N---DVL.CAPC---------------------PFII
DEN4B_MOUSE/313-497----------------------------------CPLVL----A---DVL.SAPV---------------------PFIV
Q7PWX7_ANOGA/311-495----------------------------------CPLGL----A---EVL.HAPL---------------------PYLI
Q9W3D2_DROME/308-492----------------------------------CPLGL----A---EVL.HAPL---------------------PYLI
MTMRD_HUMAN/116-298----------------------------------LPAQL----L---EVL.SSPT---------------------PFII
Q1LXZ0_DANRE/117-299----------------------------------LPGKL----L---EVL.SSPT---------------------PFII
Q7KSP6_DROME/142-325----------------------------------LPAPL----T---EVL.STPT---------------------PFIM
Q177S0_AEDAE/106-289----------------------------------LPASL----V---EVL.STPT---------------------PFIM
A7SZQ4_NEMVE/186-373----------------------------------LPAAL----Q---HFL.DAPV---------------------PFIM
Q54VP0_DICDI/908-1097----------------------------------LPEVL----V---DIAGSTPF---------------------PFIM
Q2GNY8_CHAGB/440-637----------------------------------LPARL----I---SAL.EAPC---------------------PYIV
A7EF60_SCLS1/465-662----------------------------------LPARL----I---SAL.EAPC---------------------PYIV
Q0CL54_ASPTN/423-620----------------------------------LPARL----I---QAL.EAPC---------------------PYIV
DENN_SCHPO/362-562----------------------------------LPRRL----I---SCF.EAPC---------------------SYII
DEND3_MOUSE/187-373----------------------------------LSGQM----L---DFV.MAPT---------------------SFLM
A1Z7Q5_DROME/98-283----------------------------------LPWEF----K---DYL.GAPM---------------------PYLI
Q7Q1I7_ANOGA/88-273----------------------------------LPMQM----K---DIL.AAPM---------------------PFLI
B8JLM2_DANRE/225-405----------------------------------VPEIL----I---DVV.MAPT---------------------PYLL
F1N1V1_BOVIN/150-332----------------------------------VPESL----L---GTV.CCPT---------------------PFMV
F1QFB0_DANRE/165-345----------------------------------VPSVL----I---DVC.EAPT---------------------PYLL
F1RDS6_DANRE/306-489----------------------------------CPLRM----A---DVL.CAPM---------------------PFIV
F6SD79_XENTR/91-270----------------------------------LPPHL----L---DYC.SAPM---------------------PYLI
F7CWX4_XENTR/145-326----------------------------------LPHVL----I---DTV.SCPA---------------------PFIV
H2UHI4_TAKRU/223-407----------------------------------CPLAL----A---DVL.SAPC---------------------PFIV
H3CCM9_TETNG/318-499----------------------------------LPASM----L---DIV.CTPT---------------------PFIV
H3CZX5_TETNG/307-489----------------------------------LPASM----L---DVS.CSPT---------------------PFLI
H3D3K0_TETNG/203-391----------------------------------VSAHL----Y---HLL.DAPV---------------------PFLM
H3DM09_TETNG/192-375----------------------------------LSRSM----L---DFL.MVPT---------------------ALLM
U4PB89_CAEEL/329-512----------------------------------CPLGL----A---GVL.HAPL---------------------PFIA

PF09794

Q7QF11_ANOGA/7-482GASNVLF-----QHKRQL..ADVMI---DVESTLIDVL...DGETKREMQMSTEDLRFVDFVVRHVQTPKEDAE......
Q29HH8_DROPS/14-480GTSNVLF-----QQKRQL..ADVLV---DIEAANLDAH...DPELRRQLVLSTEDLRYMDYIMKHVQTPKEDAE......
Q6BP02_DEBHA/131-552GCSNLLF-----VNQSESLNVDLLI---NLDTNELSYP....KGKPEELHLTSKDKKFVNALISKIKSNEKDEWQNDI..
A5DNM6_PICGU/119-523GSSNLLF-----VNQSMALEVDILI---NLDTNEVSYP....VGRGDDLLLSSKDKIFINSLLENIRKIDEQDN......
Q2H333_CHAGB/18-368GSTNSLL-----LQQKDRY.SDILI---NLDEDTINIT...SPSLKTALQLSTPDRRWIDFITQNVNDTWDDANPSRP..
AVL9_PONAB/16-520GATNILF-----RQQKHL..GDAIV---EVEEALIQIH...DPELRKLLNPTTADLRFADYLVRHVTENRDDVFLDG...
Q4P7V8_USTMA/140-510GTSNSIF-----KQQRDCK.IDVVV---DLEHAHLEFQ...DAKLHQMVNLTPEDRKWMDEVISSVVETWNPADPTRP..
Q17GP2_AEDAE/7-476GASNVLF-----QQKRQL..ADVMI---DVENAVIDVY...DMDLKRQTQLSTEDLRFADFIIRNVQNPKEDAE......
Q6C028_YARLI/516-899GSTNSLL-----LQQKKQH.ADVLV---NMDDNTVEIL...NSSLKSPLSLSSYDKKWIERVVQAVDTSSGNSAATT...
Q54NJ9_DICDI/6-452GTSNSLF-----LKNPPST.VHAIV---DIQNGEIQFK...DESLNRIMELTSSDRRFIDNIYDKVELYNRNNSNNNN..
A1CPG6_ASPCL/9-384GSTNSLL-----LQQKDRY.SDILI---NLDEDTINIS...SPSLRNALILSAADRRWIDLLTQIINDTWDEAHPQRP..
Q6FIU1_CANGA/8-406GTSNKLL-----AEQKTDI.CDIFV---NIDDATVEFL...NKELGSALQLSGQDIKWMDTICNVVKTTWNENDDETP..
Q08D17_XENTR/21-516GATNILF-----RQQKHL..SDAIV---EVEEARIQVH...DPELRKILNPTTADLRFTDHLVKHVMENRDDVFLDG...
Q6CKD3_KLULA/6-399GTSNTLL-----LEQSKTL.CDLLV---NIDDSTVQIMNKKDKDLHQALQLSQSDKKWMDVVIQSVLKSWNQDDYSTL..
Q750W9_ASHGO/13-401GTSNNLL-----LEQKDRL.ADLLV---NVDMKTVETIS.DDKLFAQALQLSHHDRRWMDLLIQNIVNTWNEYDLSTP..
Q5KDB3_CRYNJ/119-529GTTNQIV-----TQQKECR.YDLLV---NIDNNTFTFP...NPKLERVVGLTAADRRWMDDVVQTVEETWGLSEGERPSY
AVL9_YEAST/9-401GSSNTLL-----AEQKEEL.CHIFV---NTDNSTVDIL...DKTLNPVLQLSSHDKKWIESISGIVSDTWNENDDETP..
A3LPG1_PICST/85-492GCSNLLF-----VNQAEKYNIDLLI---NLDTCEISFP....SGKQDELGLSHADKKFINHLINNIENERD.........
AVL9_SCHPO/10-367GTTNTLI-----MLNQNKM.AEVIV---RSDTHQIEFV...DPTIKNLTSLTYTDKSWMEDIISRVESSLEMELP.....
Q5AIP1_CANAL/191-588GCSNLLF-----VNQATSYGIDVLI---NLDTNEVTYP..KNLYATEDLQLSALDKKFIHHLVNCDQPTTKH........
A7TEK5_VANPO/8-400GTSNSLL-----SERKDEL.CQIYV---DTDNFTIEII...DKSLQPLLQLTANDKKWIESMSNVVSESWNENDRETP..
H3CTF9_TETNG/13-493GATNILF-----RQQRHL..SDAII---DVDEASIQIQ...DPELRKVLSLTTADLRFADYLVKHVTENRDDVFLDG...

PF09804

YKE7_YEAST/33-335TTSEEIL-----LYKPEI--YDIVV---KLTSSSTIEE------------------------------------------
Q6FLQ0_CANGA/9-288VTSDEIL-----LYKEEL--FDKAL---ILPSDSLIHE------------------------------------------
A7TLL1_VANPO/24-351CTSDEVL-----AYRPEL--YDIML---KLPPNFMSND------------------------------------------
Q75DG5_ASHGO/36-366CTSDEIL-----AERGEL--FDMVV---KLSNYHGVKV------------------------------------------
A5DGT1_PICGU/16-298VTSDEIL-----MYQ.DV--YDVGV---SLPTDNSGHV------------------------------------------
C5MJC0_CANTT/11-295STNDEIL-----K.DNPV--YDVGV---VIDEKASVFR------------------------------------------
A3LNE8_PICST/19-334STSDDIL-----MFQRDL--YDIGV---ILDDSVTVYN------------------------------------------
Q6BJB8_DEBHA/28-311TTNDDIL-----MYQKNL--YDYAV---FLPNEEYGNS------------------------------------------
B8M2T3_TALSN/30-332CTTDNVL-----ATKTEL--FDILV---TLPTTHSPHI------------------------------------------
A2QAY7_ASPNC/31-357CSTDSVL-----TMKPEL--FDVLV---TLPPAHSKNA------------------------------------------
A1CNU9_ASPCL/30-339CSTDSVL-----SMKSEL--FDVLV---TLPPVHSKNA------------------------------------------
Q5BF30_EMENI/30-339CSTDSVL-----SMKPEL--FDVLV---TLPPSHTKNA------------------------------------------
F2PVM8_TRIEC/26-326CSSDRVL-----GLRPEL--YDVLV---TLPPNYSRQA------------------------------------------
E9CY67_COCPS/13-322CTSDRVL-----GLKPEL--YDVLI---DLPPPYSKDA------------------------------------------
C0S3V5_PARBP/84-387CTTDRVL-----SLKPEI--YDVLV---NLPPAYTKHA------------------------------------------
D5G5F9_TUBMM/21-341CTTDGIL-----YLKNEL--YDVVV---SMPPAHSKNA------------------------------------------
E3Q807_COLGM/29-348CTTDSIL-----AMKDTL--WDMLI---TMPPPYAPNA------------------------------------------
E9F1A8_METAR/37-350CTTDSIL-----AMKDTL--WDMLI---TMPPEHSTNA------------------------------------------
C7YNX8_NECH7/29-347CTTDSIL-----AMKDTL--WDMLI---TIPPDYASNA------------------------------------------
B2AXI7_PODAN/33-356CTTDSIL-----AMKGDL--WDMLI---TLPPVYSSNA------------------------------------------
Q0V1B2_PHANO/27-300CTTDEII-----STKAKL--YDVIV---ELP......T------------------------------------------
B3RV35_TRIAD/7-273CTTEKVF-----ESKKNL--YDAFI---DIRNISSTSP------------------------------------------
LCHN_DANRE/114-382CTTEKIF-----EEKKEL--YDVYI---DNQNVKTHRE------------------------------------------
B7QCC0_IXOSC/54-313CTTEKIF-----ESKQNL--FDLYV---DQQNLEPNSS------------------------------------------
F2UE85_SALR5/10-285CVTETVF-----ELKTSL--FDAFV---FPDDKMLPGA------------------------------------------
YBAG_SCHPO/6-296CTTDTVL-----LSKSSL--YDLAL---YWPDNSFNAN------------------------------------------
Q5K7R2_CRYNJ/10-298TTSDMIF-----KSHTKL--YDIFI---DLSSNPLPPS------------------------------------------

PF08616

YG76_SCHPO/260-373GVMNPAF.....THHADW.-WDVLC---DIDNQTIQVS------------------------------------------
A4I5V0_LEIIN/587-699GTLNPIF.....DNVNPWG-WDLLC---DLDNKSVITA------------------------------------------
A5DM71_PICGU/279-393GTINPFF.....KNNDKL.-WDVLY---DLDANEFHLS------------------------------------------
A5DZ96_LODEL/271-385GTINPFF.....KNNDKL.-WDLLY---DLDANELFLS------------------------------------------
A7TRE4_VANPO/376-503GVANPIF.....KYQQNL.-WDCYY---DLDTETLYDS------------------------------------------
A8PX95_MALGO/354-466GTTHPRI.....EELGC..-WDVLC---DCESGQIIVS------------------------------------------
B0D0E4_LACBS/418-530GVTNPIF.....ESSRQ..-WDLLL---DIGSGNVTVA------------------------------------------
C3ZXT1_BRAFL/180-291GVTNPFF.....AKTLQH.-WPHII---RIGE.MGNIG------------------------------------------
C4R3J0_PICPG/305-418GTANIIF.......QSKPI-WDLFI---NLDDKSILLN------------------------------------------
C5DJD2_LACTC/316-435GVSNPIF.....EYQKDV.-WDFYY---DMDAGSL..Q------------------------------------------
C5DZH0_ZYGRC/269-391GTTNPIF.....KSQDGL.-YDYYY---DLDNELISEA------------------------------------------
D2VRW9_NAEGR/366-475GVCNPMF.....AQREEY.-YDLLV---DIDKMEVKVS------------------------------------------
D2W4R6_NAEGR/470-587GTTNALFETQGKNQRTQW.-WDVCL---SVNSRKVQLA------------------------------------------
Q2URL2_ASPOR/377-488GVTNPTF.....ANHPEW.-WDVLC---DLPTGRIKIS------------------------------------------
Q4DMT0_TRYCC/444-555GTLNPIF.....EMQHTW.-WDVLC---DLDNKCVVLS------------------------------------------
Q4P9F2_USTMA/366-478GVTNPRF.....EDLHA..-WDLLL---NVETGRMQVA------------------------------------------
Q55D43_DICDI/566-679GVSNPVF.....EERSEW.-WDILC---NIGTGKVILN------------------------------------------
Q6BI40_DEBHA/264-378GTINPFF.....KYNHKL.-WDLLY---DLDSNELFLS------------------------------------------
Q6CGA4_YARLI/272-384GAKNPAF.....THHPTW.-YDVVV---DIENFTMDIS------------------------------------------
Q6CPS0_KLULA/322-444GVSNPIF.....QYQVDA.-WDFYY---DLDSDSLLNS------------------------------------------
Q75BQ9_ASHGO/342-464GVSNPIF.....EMQKDV.-WDFYY---DLDSATLLTQ------------------------------------------
E7QKR4_YEASZ/211-334GTANPIF.....RYQLDI.-WDYYY---DVDEGVFYEN------------------------------------------
Q23F93_TETTS/358-465TVSNPLF.....ENRESW.-WDVCC---NIQDGSVKES------------------------------------------
Q5KLM3_CRYNJ/358-470GVTNPRF.....EELPMT.-WDVLC---NLETGKVTVS------------------------------------------

PF07792

D4AU15_ARTBC/26-120KAALPRL-----..........TYL---NVLAVLRL..------------------------------------------
MESA_EMENI/79-211GEGPPLM-----..........YVL---NLVNTKQDNT------------------------------------------
A2Q8P4_ASPNC/82-209GEGPPLM-----..........YVL---NLVNTKQDTS------------------------------------------
A1CRY6_ASPCL/85-213GEGPPLM-----..........YVL---NLVNTKQDNT------------------------------------------
B6HSJ1_PENCW/75-202GEGPPLM-----..........YVL---NLVNTKQDNT------------------------------------------
C0SET4_PARBP/168-287GEGPPLI-----..........YIG---K.........------------------------------------------
F2TNB3_AJEDA/90-216GEGPPLM-----..........YVL---NLVNTKQDTS------------------------------------------
E9DDS1_COCPS/90-219GDGPPLM-----..........YVL---NLVNTKQDNS------------------------------------------
B8MHD8_TALSN/85-217GEGPPLM-----..........YVL---NLVNTKQDNT------------------------------------------
F0XQA1_GROCL/147-315GEGAPLI-----..........YVL---NLVNTKQDKT------------------------------------------
Q7RXB5_NEUCR/122-213.......-----.............---..........------------------------------------------
B2AXK1_PODAN/123-264GEGPPLV-----..........YVL---NLVNTKQDKT------------------------------------------
Q0V5R0_PHANO/110-243PDGPPLV-----..........YVL---NLVNTKLDTT------------------------------------------
Q6CGA4_YARLI/9-78.......-----.............---..........------------------------------------------
A0C6F7_PARTE/1-152TLNPDLI-----YGIKGKFTQDYYL---ACLRNKKDAT------------------------------------------
Q23F93_TETTS/1-94.SSKELV-----..........DLY---KFNNQKDDWE------------------------------------------
D2VRW9_NAEGR/60-215SSDQVIT-----EQSKKEEIFYYVL---NVQKQKKYEG------------------------------------------
E9BZT8_CAPO3/13-108.......-----..........FVY---EFTEATQGW.------------------------------------------
D3BKL1_POLPA/154-231.......-----.............---..........------------------------------------------
F0ZTU4_DICPU/95-230QISSPLM-----A.........YIY---SFSETDEEKG------------------------------------------
C4Y911_CLAL4/3-80.......-----.............---..........------------------------------------------
C4R3J0_PICPG/6-86.......-----.............---..........------------------------------------------
A7TRE4_VANPO/73-221LDDIDTL-----..........YFI---NVVNTVIDKN------------------------------------------
C5DZH0_ZYGRC/8-97.......-----.............---..........------------------------------------------
Q75BQ9_ASHGO/49-189QAREIPL-----..........FFI---NVVHAKIDNA------------------------------------------
A0A023ZHY2_YEASX/26-188IDNEPL.-----..........FFI---NVANTVLDTT------------------------------------------
Q6CPS0_KLULA/28-167EETEPPL-----..........FFL---SVVNTFLDNS------------------------------------------
C5DJD2_LACTC/29-162TKEPPL.-----..........FFL---SVVNALHDKS------------------------------------------

PF02141

DEN4C_MOUSE/307-491GVDSRYFD.....LHDPP--QDVVCI..DLDTN-----------------------------------------------
DEN5A_HUMAN/202-390GLHSNGLDDRSKLELPQE--ANLCFV..DIDNH-----------------------------------------------
DEN5B_HUMAN/187-375GLQSKEGTDRSKLELPQE--ANLCFV..DIDNH-----------------------------------------------
Q0US70_PHANO/395-592GIERRYEP.....TDYPE--DEYVLI..DLDAN-----------------------------------------------
Q0UM90_PHANO/167-348GVTSECRS.....LFTAP--TDALVV..DLDRN-----------------------------------------------
Q54JA6_DICDI/110-305GIHSSLLA...PIRRKPL--NEIVFV..DLDKD-----------------------------------------------
Q55DD7_DICDI/109-294GILESSLK...SFYQQPT--EQVILY..NLDTL-----------------------------------------------
DEN2C_HUMAN/586-770GILSCSLP...QLQDLPI--EEVLIV..DLCAD-----------------------------------------------
Q5RHZ1_DANRE/778-962GILSSSLP...KLKELPV--EEALMV..DLGTD-----------------------------------------------
A7RR72_NEMVE/298-481GIDSRYFD.....QYDPP--DDVTSV..DLDTI-----------------------------------------------
DEN4B_MOUSE/313-497GIHSSYFD.....LHDPP--ADVICV..DLDTN-----------------------------------------------
Q7PWX7_ANOGA/311-495GVDSRFFD.....LYEPP--NDVTCV..DLDTN-----------------------------------------------
Q9W3D2_DROME/308-492GVDSRFFD.....LYEPP--TDVTCI..DLDTN-----------------------------------------------
MTMRD_HUMAN/116-298GVHSVFKT.....DVHEL--LDVIIA..DLDGG-----------------------------------------------
Q1LXZ0_DANRE/117-299GVNSHFRS.....ETQEL--LDVIIA..DLDGG-----------------------------------------------
Q7KSP6_DROME/142-325GIHSSLQT.....EITDL--LDVIVV..DLDGG-----------------------------------------------
Q177S0_AEDAE/106-289GIHSSMQT.....EVTEV--LDVIIA..DLDGG-----------------------------------------------
A7SZQ4_NEMVE/186-373GLYCASEDFKANLQLPSE--ASLCLV..DIDNC-----------------------------------------------
Q54VP0_DICDI/908-1097GIHRSYADR.ILSKEDLL--NELVIV..DLDNN-----------------------------------------------
Q2GNY8_CHAGB/440-637GVERRYEK.....IELPD--DDYVLV..DLDRD-----------------------------------------------
A7EF60_SCLS1/465-662GIERRYDN.....IVLPE--DDYVFV..DLDQD-----------------------------------------------
Q0CL54_ASPTN/423-620GIERRYEK.....VELPS--DDFVLV..DLDAD-----------------------------------------------
DENN_SCHPO/362-562GTLSYFFH....MDDVPL--DNIPLVVCDLDKN-----------------------------------------------
DEND3_MOUSE/187-373GCHLDHFE....EVRKEA--DGLVLI..DIDHG-----------------------------------------------
A1Z7Q5_DROME/98-283GVPEPVLE...TVTSDEL--GEVVIL..NCDTK-----------------------------------------------
Q7Q1I7_ANOGA/88-273GVPEAVYD...TLRREEI--GDVVIL..NCDKR-----------------------------------------------
B8JLM2_DANRE/225-405GVQKRLAH.....LVTDQ--TDLLIV..DLSE.-----------------------------------------------
F1N1V1_BOVIN/150-332GVQMRFRQ...EVLDSPM--EEVLLV..NLCE.-----------------------------------------------
F1QFB0_DANRE/165-345GVQKSMMG.....LITDH--SDVMIV..DLST.-----------------------------------------------
F1RDS6_DANRE/306-489GVHSSYFD.....LYDPP--SDVVCV..DLDTN-----------------------------------------------
F6SD79_XENTR/91-270GVHSSLME...KVNIKSL--EDVVIF..NVDTN-----------------------------------------------
F7CWX4_XENTR/145-326GVQNQFLS...HILDQPM--EEVLLV..DLCK.-----------------------------------------------
H2UHI4_TAKRU/223-407GVDSRYFD.....LYIPP--ADITCV..DLDTN-----------------------------------------------
H3CCM9_TETNG/318-499GLLSSSLP...RLKELPI--EEVLVV..DLG..-----------------------------------------------
H3CZX5_TETNG/307-489GVLAPCLP...QLLELPI--EEVLIV..DLCA.-----------------------------------------------
H3D3K0_TETNG/203-391GIQRRDGAQRSSLHLPHE--ANLCFV..DIDNH-----------------------------------------------
H3DM09_TETNG/192-375GCHVCHFE....EVAAET--DDLILV..NIDD.-----------------------------------------------
U4PB89_CAEEL/329-512GVDSRYFE....LYEDPP--DDVTCF..DLDT.-----------------------------------------------

PF09794

Q7QF11_ANOGA/7-482...............................GSEAWIRDQLYGYMVALLKTS
Q29HH8_DROPS/14-480...............................GSEHWIREQFQGYILALLRTA
Q6BP02_DEBHA/131-552......DNEQFI...................GSDDFVRFEFEDYLLSLLSTT
A5DNM6_PICGU/119-523..........YI...................GSDDYIRYKFEDYLCSLLSTT
Q2H333_CHAGB/18-368......KTMGYV...................GSEEFIRVQFEEYLLSLISSV
AVL9_PONAB/16-520........TGWE...................GGDEWIRAQFAVYIHALLAAT
Q4P7V8_USTMA/140-510......TSMGFH...................GSDDYLRVRFEDYICAMLSST
Q17GP2_AEDAE/7-476...............................GSEVWIREQFYGYMVALLKSS
Q6C028_YARLI/516-899..........FH...................GNEDYVRLQFEDYLMGLLSAV
Q54NJ9_DICDI/6-452......NNNNNNNNNNNNGNNSDNDNAVYKEGCDKWIRDQFENYIVCLLSSI
A1CPG6_ASPCL/9-384......KDHGYM...................GSEEFIRLQFEEYLLALLACM
Q6FIU1_CANGA/8-406......KNSQFE...................GSEDFIRWQFEDYLVGLLSSV
Q08D17_XENTR/21-516........TGWE...................GGDEWIRAQFALYLHSLLSAS
Q6CKD3_KLULA/6-399......RNSQFE...................GSEDYIRWQFEDYLSGLVLTV
Q750W9_ASHGO/13-401......STFQFE...................GSEDFVRWQFEEYLTGLLSSA
Q5KDB3_CRYNJ/119-529VPRHFILFFNLEFTKNYKEGEKADFSFARYRGSDDDLRARFEEYILSALSSI
AVL9_YEAST/9-401......KNSQFE...................GSEDFIRWQFEDYLTGLLSSV
A3LPG1_PICST/85-492........DEFL...................GNDDYIRYQFEDYLNSLISTT
AVL9_SCHPO/10-367.........GFE...................GSDDWIRNQFELYIFGMLATV
Q5AIP1_CANAL/191-588........DDFI...................GSDDYIRSKFEDYLNSLISTM
A7TEK5_VANPO/8-400......KNSQFE...................GSEDFIRWQFEDYLIGLLSSV
H3CTF9_TETNG/13-493........TGWE...................GGDEWIRSQFVVYLHSLLSS.

PF09804

YKE7_YEAST/33-335--------------------------------------------------SP
Q6FLQ0_CANGA/9-288--------------------------------------------------GL
A7TLL1_VANPO/24-351--------------------------------------------------ND
Q75DG5_ASHGO/36-366--------------------------------------------------YA
A5DGT1_PICGU/16-298--------------------------------------------------KI
C5MJC0_CANTT/11-295--------------------------------------------------FP
A3LNE8_PICST/19-334--------------------------------------------------HS
Q6BJB8_DEBHA/28-311--------------------------------------------------YI
B8M2T3_TALSN/30-332--------------------------------------------------SQ
A2QAY7_ASPNC/31-357--------------------------------------------------AE
A1CNU9_ASPCL/30-339--------------------------------------------------AE
Q5BF30_EMENI/30-339--------------------------------------------------AS
F2PVM8_TRIEC/26-326--------------------------------------------------PE
E9CY67_COCPS/13-322--------------------------------------------------PE
C0S3V5_PARBP/84-387--------------------------------------------------PS
D5G5F9_TUBMM/21-341--------------------------------------------------KK
E3Q807_COLGM/29-348--------------------------------------------------KE
E9F1A8_METAR/37-350--------------------------------------------------VD
C7YNX8_NECH7/29-347--------------------------------------------------VE
B2AXI7_PODAN/33-356--------------------------------------------------KE
Q0V1B2_PHANO/27-300--------------------------------------------------QQ
B3RV35_TRIAD/7-273--------------------------------------------------NI
LCHN_DANRE/114-382--------------------------------------------------SL
B7QCC0_IXOSC/54-313--------------------------------------------------MH
F2UE85_SALR5/10-285--------------------------------------------------NV
YBAG_SCHPO/6-296--------------------------------------------------KY
Q5K7R2_CRYNJ/10-298--------------------------------------------------PV

PF08616

YG76_SCHPO/260-373---------------------------------------------------S
A4I5V0_LEIIN/587-699---------------------------------------------------A
A5DM71_PICGU/279-393---------------------------------------------------T
A5DZ96_LODEL/271-385---------------------------------------------------S
A7TRE4_VANPO/376-503---------------------------------------------------I
A8PX95_MALGO/354-466---------------------------------------------------A
B0D0E4_LACBS/418-530---------------------------------------------------K
C3ZXT1_BRAFL/180-291---------------------------------------------------K
C4R3J0_PICPG/305-418---------------------------------------------------F
C5DJD2_LACTC/316-435---------------------------------------------------T
C5DZH0_ZYGRC/269-391---------------------------------------------------A
D2VRW9_NAEGR/366-475---------------------------------------------------Q
D2W4R6_NAEGR/470-587---------------------------------------------------E
Q2URL2_ASPOR/377-488---------------------------------------------------S
Q4DMT0_TRYCC/444-555---------------------------------------------------P
Q4P9F2_USTMA/366-478---------------------------------------------------K
Q55D43_DICDI/566-679---------------------------------------------------P
Q6BI40_DEBHA/264-378---------------------------------------------------S
Q6CGA4_YARLI/272-384---------------------------------------------------P
Q6CPS0_KLULA/322-444---------------------------------------------------K
Q75BQ9_ASHGO/342-464---------------------------------------------------A
E7QKR4_YEASZ/211-334---------------------------------------------------.
Q23F93_TETTS/358-465---------------------------------------------------E
Q5KLM3_CRYNJ/358-470---------------------------------------------------K

PF07792

D4AU15_ARTBC/26-120---------------------------------------------------.
MESA_EMENI/79-211---------------------------------------------------V
A2Q8P4_ASPNC/82-209---------------------------------------------------V
A1CRY6_ASPCL/85-213---------------------------------------------------V
B6HSJ1_PENCW/75-202---------------------------------------------------V
C0SET4_PARBP/168-287---------------------------------------------------.
F2TNB3_AJEDA/90-216---------------------------------------------------V
E9DDS1_COCPS/90-219---------------------------------------------------V
B8MHD8_TALSN/85-217---------------------------------------------------V
F0XQA1_GROCL/147-315---------------------------------------------------Q
Q7RXB5_NEUCR/122-213---------------------------------------------------.
B2AXK1_PODAN/123-264---------------------------------------------------V
Q0V5R0_PHANO/110-243---------------------------------------------------V
Q6CGA4_YARLI/9-78---------------------------------------------------.
A0C6F7_PARTE/1-152---------------------------------------------------I
Q23F93_TETTS/1-94---------------------------------------------------I
D2VRW9_NAEGR/60-215---------------------------------------------------L
E9BZT8_CAPO3/13-108---------------------------------------------------.
D3BKL1_POLPA/154-231---------------------------------------------------.
F0ZTU4_DICPU/95-230---------------------------------------------------W
C4Y911_CLAL4/3-80---------------------------------------------------.
C4R3J0_PICPG/6-86---------------------------------------------------.
A7TRE4_VANPO/73-221---------------------------------------------------N
C5DZH0_ZYGRC/8-97---------------------------------------------------.
Q75BQ9_ASHGO/49-189---------------------------------------------------N
A0A023ZHY2_YEASX/26-188---------------------------------------------------N
Q6CPS0_KLULA/28-167---------------------------------------------------N
C5DJD2_LACTC/29-162---------------------------------------------------N

PF02141

DEN4C_MOUSE/307-491----------------------------------------------------
DEN5A_HUMAN/202-390----------------------------------------------------
DEN5B_HUMAN/187-375----------------------------------------------------
Q0US70_PHANO/395-592----------------------------------------------------
Q0UM90_PHANO/167-348----------------------------------------------------
Q54JA6_DICDI/110-305----------------------------------------------------
Q55DD7_DICDI/109-294----------------------------------------------------
DEN2C_HUMAN/586-770----------------------------------------------------
Q5RHZ1_DANRE/778-962----------------------------------------------------
A7RR72_NEMVE/298-481----------------------------------------------------
DEN4B_MOUSE/313-497----------------------------------------------------
Q7PWX7_ANOGA/311-495----------------------------------------------------
Q9W3D2_DROME/308-492----------------------------------------------------
MTMRD_HUMAN/116-298----------------------------------------------------
Q1LXZ0_DANRE/117-299----------------------------------------------------
Q7KSP6_DROME/142-325----------------------------------------------------
Q177S0_AEDAE/106-289----------------------------------------------------
A7SZQ4_NEMVE/186-373----------------------------------------------------
Q54VP0_DICDI/908-1097----------------------------------------------------
Q2GNY8_CHAGB/440-637----------------------------------------------------
A7EF60_SCLS1/465-662----------------------------------------------------
Q0CL54_ASPTN/423-620----------------------------------------------------
DENN_SCHPO/362-562----------------------------------------------------
DEND3_MOUSE/187-373----------------------------------------------------
A1Z7Q5_DROME/98-283----------------------------------------------------
Q7Q1I7_ANOGA/88-273----------------------------------------------------
B8JLM2_DANRE/225-405----------------------------------------------------
F1N1V1_BOVIN/150-332----------------------------------------------------
F1QFB0_DANRE/165-345----------------------------------------------------
F1RDS6_DANRE/306-489----------------------------------------------------
F6SD79_XENTR/91-270----------------------------------------------------
F7CWX4_XENTR/145-326----------------------------------------------------
H2UHI4_TAKRU/223-407----------------------------------------------------
H3CCM9_TETNG/318-499----------------------------------------------------
H3CZX5_TETNG/307-489----------------------------------------------------
H3D3K0_TETNG/203-391----------------------------------------------------
H3DM09_TETNG/192-375----------------------------------------------------
U4PB89_CAEEL/329-512----------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window