Sequence alignment for CL0330

PF09794

Q7QF11_ANOGA/7-482-VLHILVVGFHHKKGC.................QVEFSYPPL.VAGTEGKGECPSGWKY-LPTLALPDGSHNFSSDFVC-
Q29HH8_DROPS/14-480-ILHILVVGFHHKLGC.................QVEFSHPPL.IAGSSGRNECPSGWKY-LPTLALPDGSHNFVEDTVF-
Q6BP02_DEBHA/131-552-IFAVCLVDFHHVRGP.................EIQWWRSN....YYPSYPQDNKLFKN-LPFQALPDGSHLFEETFSN-
A5DNM6_PICGU/119-523-IFAVCLVDFHHSRGP.................EVEFWKS......NYHHNYSPSLFKN-LSFQALPDGSHQHEETFSN-
Q2H333_CHAGB/18-368-IPLVSVVDFHHARGP.................EVERWFGV....DEGHDPAAEYDWTL-LPFMALSDGAHALTEDFSY-
AVL9_PONAB/16-520-VLHIVVVGFHHKKGC.................QVEFSYPPLIPGDGHDSHTLPEEWKY-LPFLALPDGAHNYQEDTVF-
Q4P7V8_USTMA/140-510-ILGIAVVDFNHLVGP.................QIEYTYP.......KELQQDEDLVKS-LPFLALPDGSHLSDEDFCY-
Q17GP2_AEDAE/7-476-ILHILVVGFHHKKGC.................QVEFSYPPL.IAGSEGKQECPSGWKY-LPTLALPDGSHNFNKDFVC-
Q6C028_YARLI/516-899-LFSVCIVGFHHSLGP.................QIEEWFG.........PEDYSHLWPN-LPFQALSDGSHSREEDFSY-
Q54NJ9_DICDI/6-452-IEYIGVIGFHHSLGH.................RIEFLYP.....DLDEESKKQYNWNL-LPFYGIADGVHNSFEDYTF-
A1CPG6_ASPCL/9-384-APIVMVIDFHHARGP.................EIELCIG.....EDGTDIATENDWSL-LPFMALSDGAHASTEEFSY-
Q4SKV3_TETNG/13-521-VLHIVVVGFHHKKGCQHQKEHSPSADAVSSDWQVEFSYPPLVPDEGHDSNVLPDEWRY-LPFLALPDGAHNYQEDTVY-
Q6FIU1_CANGA/8-406-ILGVCLVDFHHKRGP.................EVEYWEG.....LDDTGIDSQHLWPN-LPFQALPDGSHSFKETFTY-
Q08D17_XENTR/21-516-VLHIVVVGFHHKKGC.................QVEFSYPSLMPGEEHDSHILPEEWKY-LPFLALPDGAHNFQEDTVF-
Q6CKD3_KLULA/6-399-VFGCGLVDFHHTRGP.................EIEYWYD.....GGTTALNVNNLWEY-LPFQALPDGAHSYEQSFTY-
Q750W9_ASHGO/13-401-VFGVALVDFHHTRGP.................EVEHWHS.........DELQNCTWNN-LPFQALPDGSHSFEETFTY-
Q5KDB3_CRYNJ/119-529-VLGIAVVDFNHLIGP.................TVEFAFPP...SLQNALSVDENLSKE-LPFLALPDGAHLSEEDYSY-
A6RFN4_AJECN/8-299-EPIILVIDFHHARGP.................EVEHCFC.....KQGADVLAKNDWSL-LPFMALSDGAHASTEDFSY-
AVL9_YEAST/9-401-IFGICLVDFHHKRGP.................EIEYWYG......LPEGTQSAELWPN-LPFQALPDGSHSFEETFTY-
A3LPG1_PICST/85-492-IFAICVVDFHHSRGP.................EIQWWKSN...YHPEYTQ...SLFKN-LSFQALPDGSHLFEETFSN-
AVL9_SCHPO/10-367-VLCLATIGFHHLRGP.................EIEHLFP........ESMDFPKEWSI-LPFLSLPDGAHSSEKDFVY-
Q5AIP1_CANAL/191-588-IFAICLVDFHHQRGP.................EIQWWKSN...YHPDYKQ...GLFKN-IPFQALPDGSHLFEETFSN-
A7TEK5_VANPO/8-400-IVGVGVVDFHHTRGP.................EVEYWHG......LPEGTDESTLWPN-LPFQALPDGSHSFKETFTY-

PF09804

Q6C716_YARLI/3-239----LFYATFDVKLGH-----------------SILKG..--------....FGEGLGG.VEYKAIPSSFQQ..DDVVY.
YKE7_YEAST/33-335----IFLSKFDMKKGN-----------------IIIWSKS--------ING.AAIDLSN.IEFKSLPAGIHEQTDDVVN.
Q6FLQ0_CANGA/9-288----VFLCQFDMSRGN-----------------TLVWSAR--------D...NDPLLKG.IEFKALPSGIHEVSDDVIR.
A7TLL1_VANPO/24-351----IFLSQFDMKRGN-----------------VIVWSKL--------NEN.CNINLQG.TEFKSLPSGVHEVSDDVIN.
Q75DG5_ASHGO/36-366----MCLTKFDVKKGN-----------------TVLWTTS--------LA..PEHKLHN.IEFKTLPAGIHESEQDWVN.
Q6CP43_KLULA/3-242----IFVHEFDVLKGN-----------------TLVWTNG--------....DAKTLEG.LEYTVLPSGIHLRNTDTVY.
A5DGT1_PICGU/16-298----TFLVQFDTKTGY-----------------KLVWSKC--------N...PSLSLSG.IEYKALPSGIHECDSSTVF.
Q5A7K9_CANAL/8-279----LFIAEFDVRSGY-----------------KLVHQEA--------KI..AGFDFDG.LEYKVLPSGIQEFGTSTVL.
B9WCZ6_CANDC/8-285----VFLAEFDIRSGY-----------------KLVWSKA--------EV..PGFEFDG.LEYKVLPSGIHEYGESTVL.
C5MJC0_CANTT/11-295----VFLAEFDVKSGY-----------------KLVWSKS--------VI..PEFDFDG.LDYKAFPSGIHEFNNSTVL.
A3LNE8_PICST/19-334----MFLVQFEVRTGY-----------------EIVWSKS--------VI..DGYDFSG.LDFKVLPSGIHEFDKATVL.
Q6BJB8_DEBHA/28-311----LFLIHFDVRRGY-----------------QLVWSKQ--------AKSRPPIDLGG.LDYKVLPSGIQEHTTSTVF.
B8M2T3_TALSN/30-332----LFLILFDIKKGY-----------------VISWQES--------I...PGIDLEGAVEYKSLPSGLHNVSEDLIY.
A2QAY7_ASPNC/31-357----LFVIRFDIKAGY-----------------VISWKRT--------V...PGVEVEGAVEYKSLPSGLHNVSEDLVY.
A1CNU9_ASPCL/30-339----LFVIRFDIKAGY-----------------VISWKRA--------I...PGVEIEGVVEYRSLPSGLHNVSEDLIY.
Q2UQJ8_ASPOR/30-340----LFVIRFDIKAGY-----------------VVSWKRT--------V...PGAEVEGIVEYKSLPSGLHNVSEDLVY.
Q5BF30_EMENI/30-339----LFVIHFDVKAGY-----------------TVTWKRT--------I...PGVEVEGAVEYKSLPSGLHNVSEDLVY.
F2PVM8_TRIEC/26-326----LFLIRFDIRAGY-----------------TIAWKKT--------A...SEIVLDNAVEFKSLPSGAHNVKEDLVY.
E9CY67_COCPS/13-322----LFLIHFDIKAGY-----------------TIVWKES--------L...PDVVLHDVVEFKSLPSGLHNVKEDLVY.
C0S3V5_PARBP/84-387----LFLICFDIKAGY-----------------AIKWKRS--------N...PDVVLENVVEYKSLPSGLHNVREDLIY.
C0NKX7_AJECG/29-332----IFLICFDVKAGY-----------------TVKWKRA--------I...PEVVLENVVEYKSLPSGLHNVREDLVY.
D5G5F9_TUBMM/21-341----LFVIYFDIKAGQ-----------------TIIWKKF--------A...QGVSLSG.VEFKSLPSGLHNLVEDLVY.
E3Q807_COLGM/29-348----LFLIDFDVKAGY-----------------TIVWKQA--------A...PGIELEGLVEYKSLPSGLHTVPDDLIY.
E9F1A8_METAR/37-350----LFLIDFDVKAGY-----------------TITWKRA--------V...PHVELDGQVEYKSLPSGLHTVRHDLIY.
C7YNX8_NECH7/29-347----LFLIHFDVKAGY-----------------TILWKQS--------A...PGVELEGLVEYKSLPSGLHTVSEDLIY.
B2AXI7_PODAN/33-356----LFLIDFDVKAGY-----------------TIVWKRA--------V...PGLELEGAVEYKSLPSGLHTVTDDLIY.
A6RUI2_BOTFB/28-351----LFMIYFDIKAGY-----------------TIGWKRS--------L...PGIELDGVVEYRSLPSGLHTVEEDLIY.
Q0V1B2_PHANO/27-300----LFLIRFDKKVGY-----------------TIAWKRT--------T...TDIELENAVEYKSLPSGLHAQASDLVY.
B3RV35_TRIAD/7-273----LFVISFDTKSGN-----------------VVEYCVP--------....SGVQLNA.VEFKAMPSGSHTVSEDFVY.
LCHN_XENLA/61-326----VFVVTFDPRSGN-----------------IVEWCRP--------....HDIDLEG.VEFKSMASGSHRVQSDFIY.
LCHN_DANRE/114-382----VFVVTFDTRSGN-----------------MIEWCLP--------....HDVNLEG.VEFKSMASGSHRISSDFIY.
B7QCC0_IXOSC/54-313----VFVIAFDTRAGN-----------------TVEWWTP--------....KELDISG.IEFKAMASGAHRVHTDFIY.
F2UE85_SALS5/10-285----VFVVDFDALKGN-----------------SLRWQYP--------....NDVELPF.VEFKAMPSGSHSVLEDFPYG
YBAG_SCHPO/6-296----IVLATFDAKEGY-----------------NVENYYP--------....GDFNVEG.IEYLLFPSGIQELDNCTIF.
B6K728_SCHJY/9-263----AFCASFDHRTGY-----------------TLDAVYP--------....AEVQLNG.VEYKAFPSKLQELHEDIFS.
Q5K7R2_CRYNJ/10-298----VFLTYFDDIKGQ-----------------SVLYYSS--------L...PDIP.EGTIEHATLPSGLHNLSEDLIC.

PF08616

A0C6F7_PARTE/251-368--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A6ZNX6_YEAS7/345-470--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_PICPG/305-418--------------------------------------------------------------------------------
C4Y911_CLAL4/255-369--------------------------------------------------------------------------------
C4YQL5_CANAW/259-373--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
YG76_SCHPO/259-372--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
Q4P9F2_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q55YB7_CRYNB/357-470--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------

PF07792

MESA_EMENI/79-241HVEFILVASFHIDRGP-----------------IMEHQYP-------------GPI.SS..............DEGMLA-
E7KUE5_YEASL/26-218NVSYIISAEFDNKLGP-----------------ILKHQYP-------------KDI.PGFNQFSHEQRNGNTSVSMNLA-
B2AXK1_PODAN/123-294HVEYILVASFDIDRGP-----------------IMEHQYP-------------VAI.TG..............DEHMLA-
E9DDS1_COCPS/90-249HVEYILVASFHVDRGP-----------------IMEHQYP-------------AAI.SG..............DEHMLA-
F2TNB3_AJEDA/90-246HVEYILVASFHVDRGP-----------------IMEHQYP-------------SAI.SG..............DEHMLA-
Q0V5R0_PHANO/110-273HVEYILVASFDIDRGS-----------------IMEHQYP-------------AAI.SG..............DETMLA-
C4Y911_CLAL4/3-80NISFIVTAEFHVDKGP-----------------SLIHQYP-------------NVL.PG...........SE.GLQYLP-
Q75BQ9_ASHGO/49-219NVEYILAAEFDNKLGP-----------------VLKHQFP-------------KNL.PGFK........STNSNLSNLA-
A7TRE4_VANPO/73-251NVHFILSAEFDNKLGP-----------------KVKFQYP-------------NSI.PGFPSSL.HGAHSLDSTI.NLA-
C5DZH0_ZYGRC/8-97NVDYLLTAEFDNRFGP-----------------VVRDQYP-------------SVI.PGFEYEM.REGHSQNNAVFNLA-
Q5KLM3_CRYNJ/72-162SSAVDPLLSHESEASL-----------------QTRTST.-------------....................DSDGKA-
A2Q8P4_ASPNC/82-239HVEYILVASFHIDRGP-----------------IMEHQYP-------------AAI.SG..............DESMLA-
A1CRY6_ASPCL/85-243HVEYILVASFHIDRGP-----------------IMEHQYP-------------AAI.SG..............DESMLA-
F0XQA1_GROCL/147-345HVEYILVASFDIDKGP-----------------IMEHQYP-------------VAI.TG..............DEHMLA-
E9BZT8_CAPO3/13-108LVHHILVSEFDIDKGS-----------------GLAHQYP-------------TP..TG...........A..SESLLA-
Q6CGA4_YARLI/9-78HIEYVLAAEFDIDAGP-----------------VVKYQYP-------------DTL.PG..............DEQLMA-
C0SET4_PARBP/168-287HVEYILVASFHVDRGP-----------------IMEHQYP-------------SAI.SG..............DENMLA-
Q7RXB5_NEUCR/122-235HVEYILVASFDIDRGP-----------------VMEHQYP-------------VAI.TG..............DEHMLA-
Q6CPS0_KLULA/28-197NVQFIIAAEFDNKSGP-----------------IIKHQYP-------------KTI.PGFKT......IGSDSTCSHLA-
A6RVU6_BOTFB/70-232HVEYILVASFDIDKGP-----------------IMEHQYP-------------VAI.TG..............DEHMLA-
C4R3J0_PICPG/6-86SLAYILTAEFDKSKGI-----------------VITNQHP-------------C.....EDD.....SWLLSSQLQDIS-
B8MHD8_TALSN/85-247HVEYILVASFHIDRGP-----------------IMEHQYP-------------SAI.SG..............DEGMLA-
A0C6F7_PARTE/1-175MIKALFAAEF.LVKGC-----------------VITASYP-------------Q.....T..........GDSGFHELA-
D8QBP3_SCHCM/66-137NTIQPVLALDDAD...-----------------.......-------------..........................-
Q23F93_TETTS/1-96MIDVIFCSEFDLLKGC-----------------VVKAHYP-------------E.....N..........FEYDEITLA-
D2VRW9_NAEGR/60-245GIEYIFLAEFDIDKGS-----------------IVKVQYP-------------SPY.PY...........A..TEYSIA-
D3BKL1_POLPA/154-247NVEYILLAEFDIDIGS-----------------KVKYQYP-------------CP..TG...........E..DEALLA-
F0ZTU4_DICPU/95-230LVEFILLAEFDILQGS-----------------KVNIQYP-------------YPIATG...........G..MELMLS-
B6HSJ1_PENCW/75-232HVEYILVASFHIDRGP-----------------IMEHQYP-------------AAI.SG..............DESMLA-
D4AU15_ARTBC/26-120NFACVFLAKRDETKEK-----------------DRKKQRK-------------R.....RREE...KAKKGQRDRRERN-
C5DJD2_LACTC/29-192NAQYIISAEFDNKVGP-----------------VIKHQHP-------------KPL.AGFKS......STSRSASVNLA-

PF02141

DEN5A_HUMAN/202-390YVSKCICLITPMSFMK-------------------AC.RSVLEQLHQAVTSPQPP...........PLPLESYIYNVLY-
DEN5B_HUMAN/187-375YVSKSICLITPLPFMQ-------------------AC.KKFLIQLYKAVTSQQPP...........PLPLESYIHNILY-
Q0US70_PHANO/395-592WIPRAYGVMGRDASLT-------------------PFWKEWLKAVVVPMTNGAILRVPASSPRIGMWQPLERYVVNLCA-
Q0UM90_PHANO/167-348WIPYCLSFLSRYPLYN-------------------LL.GDYLRGMWIHWNKAT..............NLFHAEEVSRIL-
Q54JA6_DICDI/110-305KILECLCIISHHAWSS-------------------TF.GSMLEILETRYRVSI..............DEIHNFLAASLL-
Q55DD7_DICDI/109-294IEPICYCIISRKPFFK-------------------LF.DRVFIAIQEKYEIKSK.............NSIHNLLSA.LI-
Q08BI6_DANRE/181-363RLPEAYCIISNVACFG-------------------LF.SKIFDEVEQRRKISM..............AMIYPFMQS.LR-
Q5U3I4_DANRE/164-346RLPEAYCIISHVACFG-------------------LF.SKIFDEVEKRRQIST..............AMIYPFMQS.LR-
Q0VCJ3_BOVIN/149-333RLPRVYCIISCIGCFG-------------------LF.SKILDEVEKRHQISM..............AIIYPFMQG.LR-
Q6DF82_XENLA/149-333RSPEVYCIISSLGCFG-------------------LF.SKILDEVEKRRAIST..............ALVYPFMQG.LR-
DEN2C_HUMAN/586-770RLPEVYCMVSRLGCFN-------------------LF.SKILDEVEKRREMSP..............ALVYPFMRS.VM-
Q4T8M0_TETNG/323-507RLPEVYCIVSRLGCFD-------------------LF.SKILDEVEKRRAISP..............ALVQPFMRG.IM-
Q5RHZ1_DANRE/778-962RLPEVYCVISRLGCFN-------------------LF.SKILDEVERRRGISA..............ALVYPFMRS.VM-
Q4SCC1_TETNG/127-311RLPEVHCIVSKLGCFN-------------------LF.AKILEEIERRREVSP..............ALVYPFMRS.VM-
A7RR72_NEMVE/298-481HTNKCICILSHWPFFE-------------------AF.KKFLSQLYRISVSAQQ.............IPIERYIANMML-
Q3U2K9_MOUSE/307-491NSNKCICLLSHWPFFE-------------------AF.KNFLMFIYKVSVSGPH............PLPIEKHISHFMQ-
DEN4B_MOUSE/313-497RSRRAIAVLSRWPAFP-------------------AF.RAFLTFLYRYSVSGPH............RLPLEAHISHFIH-
A0PJS2_DANRE/305-489QVKKSICVLSHWPFFS-------------------VF.QKFLTFIYRYSISGPH............VLPLEKHISSFMH-
Q4SLY3_TETNG/383-567YSNKSICLLSHWPFFQ-------------------SF.RSFLTFLYRYSISGPH............ALPIEKHISHFMQ-
Q7PWX7_ANOGA/311-495HVNKSICILSRWPFGD-------------------TF.EKWLQFLHQLSILDEKL...........PVPIERYITHLLD-
Q9W3D2_DROME/308-492HMIKAICLLSHHPFGD-------------------TF.DKWLKYLHRMVLYDVNI...........PIPVERYITQLLD-
Q9TXV4_CAEEL/347-533YKNVSICLISRFPFFN-------------------SF.KRFLFFLHRMSSTPSCS..........HPVPIERYISHLMY-
MTMRD_HUMAN/116-298FAPKSLVLVSRLYYPE-------------------IF.RACLGLIYTVYVDSLN.............VSLESLIANLCA-
Q4SZD9_TETNG/73-244FAPKSLILVSRLDYPE-------------------IF.RGCLGLVYTVYIENLT.............FPLEGLVANLFT-
A6PVH0_HUMAN/128-310FAPKTLVLVSRLDHTE-------------------VF.RNSLGLIYAIHVEGLN.............VCLENVIGNLLT-
Q1LXZ0_DANRE/117-299YAPRSLVLVSRLDHTE-------------------VF.RNCLSLIYTVHVDGLT.............VPMETVIGNLLT-
Q7KSP6_DROME/142-325YAPKCLVLISRLDCAE-------------------TF.KNCLGTIYTVYIENLA.............YGLETLIGNILG-
Q177S0_AEDAE/106-289YAPKCLVIVSRLDYIE-------------------TF.RNCLGTIYTVYLESLK.............FHLHHLIGSILG-
Q4S7I6_TETNG/216-404YVSKALCLFTPLPFLH-------------------AS.RQFLSQLHQAVASHSPP...........PLPLESYIHNILY-
A7SZQ4_NEMVE/186-373MVSKCISIIMPLPFIT-------------------AA.MSYLQQIYHAAKTADL............PLPLESYIYNLLY-
Q54VP0_DICDI/908-1097YAPKCICVLSHFPFFS-------------------SF.RVALNEIYHRVFHNPS............PIPIERYIFNLVS-
Q2GNY8_CHAGB/440-637WTPRAFGILGRDPAKM-------------------GFWKEWLRAVTVPMTDGAVMRISPSSPKVGRWQPLERYVINLCT-
A7EF60_SCLS1/465-662WIPRAYGILGRDGSMT-------------------SFWKEWLKAVVVPMTDGGILRVPASSPKIGRWQPLERYVVNLCT-
Q0CL54_ASPTN/423-620WIPRAYGILGREENMT-------------------SFWKEWLKAVVVPMTDGGVQRIPPSSPRMGVWQPLERYVMNLCT-
DENN_SCHPO/362-562WIPNAYGLLSKHSHLQ-------------------SFCRDWLRIVCSSIQAEDLDFIPSSDLNSLKSLNLQSFVKNICC-
Q4RI35_TETNG/140-326FSAYSFCVISKYPYFT-------------------AL.KDCLTCLSIQLRTCCLSD.........MEETVKEFAAK.LA-
DEND3_MOUSE/187-373FVPFAVCVVSRFPYYN-------------------SL.KDCLSCLLTHLKLCKDFE.........VDNHIKDFAAR.LS-
A1Z7Q5_DROME/98-283RTNTAMVLITYLPWHD-------------------TF.LKLLPVLAELRRTDP..............NGFRTFLSE.AY-
Q7Q1I7_ANOGA/88-273KSPTAMVIITYLPWHD-------------------TF.MRFLNVLADIRKNRP..............NEFASFLAE.SY-
Q6DCI3_XENLA/89-270ASRSCLCILSCLPWFE-------------------HF.YKLLNNIAEYLAKDQS.............VEICDLLQT.VY-

PF09794

Q7QF11_ANOGA/7-482FNLP...................SLTDPEQSV-----YGISCYRQIALEEV....RIR--TADLTRSTVQKSVCTLLSL-
Q29HH8_DROPS/14-480FNLP...................SLFEPAASI-----YGVSCYRQIRVEKL....KIR--TADVTRSTVQKSVCILSRQ-
Q6BP02_DEBHA/131-552FNLVYDFKTGKSYDDGEDYNSFDGDPRHLETL-----FGCSCVRQVKTSDLSDEEISR--NKDITRSIVQKAVVVIAKN-
A5DNM6_PICGU/119-523FSLVYDFVTGLSYDDGDDYDNFQGDPRHLRTL-----FGCSCVRQVKTSDLSDLEMAR--NKDITRSIVQKAIVVIACN-
Q2H333_CHAGB/18-368FTLLRPA................TSSAPATSL-----FGISCTRQMDASQL....LNR--PAEVTRSTVQKAVVVIADS-
AVL9_PONAB/16-520FHLP...................PRNGNGATV-----FGISCYRQIEAKAL....KVR--QADITRETVQKSVCVLSKL-
Q4P7V8_USTMA/140-510FHLH...................CSKLSPSTI-----FGISCNRQIAADAL....LKK--GAEVTRSTVQKAIVVLAKQ-
Q17GP2_AEDAE/7-476FNLP...................SLTDPHESI-----YGISCYRQIPVEKL....KIR--TAEMTRSTVQKAVCALLSI-
Q6C028_YARLI/516-899FTLLFDENNKSAPGAGGYSDGRPFNTQTVTTL-----FGIACNRQVGVTDA....LKQ--DLAVTRSTVQKCVVVICRK-
Q54NJ9_DICDI/6-452FIMEEIN................PTTSPSKKL-----YGLSYFKQKNKRDLP..KQAI--TPEDTRSSIQKSVVILSKF-
A1CPG6_ASPCL/9-384FTLRKKE................TATEPATSL-----FGIACSRQIDSNLL....LNR--PSDVTRSTVQKAVVVITDT-
Q4SKV3_TETNG/13-521FHLP...................PLGGDKKCV-----YGVSCYRQIEAKAL....KVR--QADVTRETVQKSVCVLSRV-
Q6FIU1_CANGA/8-406FTLLYDSVNKCSPP.SNSSNELGENSENYTTV-----FAISCSRQIKSDEL....IAK--DEDVTRSTVQKAVVVISFE-
Q08D17_XENTR/21-516FHLP...................PRCGDQKTV-----YGVSCYRQIEAKAL....KVR--QADVTRETVQKSVCVLSQL-
Q6CKD3_KLULA/6-399FTLLYDEVNKKCCSSVGDSLKDGDQSGRYSTF-----FAISCSKQIQSDTL....IKK--PKDVIRSTVQKSLVVVCRK-
Q750W9_ASHGO/13-401FTLLYDEGRHRGLN..GIDEVEEDNVDECTTL-----FAISCSRQIKSEEL....LKK--GVEVTRSTVQKSLVVISRV-
Q5KDB3_CRYNJ/119-529FHCTFSPSTHNS.....QQHNAETNIPTNQTL-----FGISCNRQLASSEL....HRR--PSDVTRSMVQKAVIVIASH-
A6RFN4_AJECN/8-299FTLQQSA................LDSEPATSL-----FGISCTRQIDSASL....INR--PPEVTRSTVQKAVVAVIDE-
AVL9_YEAST/9-401FTLLYDERRQRSPP.NGATDLSDDSINDNTTL-----FAISCSRQIKSDEL....VTK--DKDVTRSTVQKAIVVISRQ-
A3LPG1_PICST/85-492FNLVYDFQNSESIDNMSDLNDYQGDPRHLRTL-----FGCSCVRQVKTSDLSQEERDR--NKDITRSIVQKAIVIIVRK-
AVL9_SCHPO/10-367FTL....................PFPNDEGTV-----FGLSCTRQLNASSL....KNI--PSDVTRSSVQKAVVVITTS-
Q5AIP1_CANAL/191-588FNLVYDFDQKQSIDDFNDVNNFKGDPRHLKTL-----FGCSCVRQVKTSDLTEEERER--NKDITRSIVQKAIVVITRK-
A7TEK5_VANPO/8-400FTLLFNPKTKTCPQ.GGATGLTEEERKECTTL-----FAVSCSQQISSEEL....LHK--DKEVTRSTVQKAIVVVSYQ-

PF09804

Q6C716_YARLI/3-239LS....-----------------....HN.GQ.....PGVAVVVDRNIGNN----EGE.......RRNTVFALGVLVDE.
YKE7_YEAST/33-335FVVPKE-----------------LDVCQT.AKTTTYDYGIAYFKQNSFDII----END..NRIDRSKVQMFSLGVIIDV.
Q6FLQ0_CANGA/9-288FC....-----------------IEYEQT.QY.....YGICCYLQNAFEVL----DNE..GQVDRSKVKMYSLGVIVDP.
A7TLL1_VANPO/24-351FILPKE-----------------ETSSHD.HY.....YGVAYYRQNGQEIV----KKG..KQVDRNEVKMYALGILIDPN
Q75DG5_ASHGO/36-366FVLPKE-----------------...DGE.FY.....YGVALFSQNGLRLV----EEEQSHGVDRSRVEMYSLAVITDPQ
Q6CP43_KLULA/3-242FK....-----------------....LD.GK.....PGLAVFKQNTMELE----ASQ..HHIDRSKVRMFSFGTIFDH.
A5DGT1_PICGU/16-298IV....-----------------HKNDDK.ML.....YGLSQYRSVTEGDN----EST.ETSVDRSKVKMYSLGILCDP.
Q5A7K9_CANAL/8-279FS....-----------------HWFQGK.VY.....YGLSKYYQYIIGDD----SRD......RNNVKMFAMGVLCEP.
B9WCZ6_CANDC/8-285LS....-----------------HWHEGR.VY.....YGMSRYYQYVIGND----STD......RSNVKMFALGILCDP.
C5MJC0_CANTT/11-295IS....-----------------HCFQDK.IY.....YGLSKFYQYIIGDD----SSD......RSNVKMYALGVLCDS.
A3LNE8_PICST/19-334VS....-----------------HLHSDK.VY.....YGLGTFRQHIVGQN----QPL.....DRSTVKVYSLGIICDP.
Q6BJB8_DEBHA/28-311IS....-----------------HACDNT.VY.....YGLGRFRQRIVGAD----HES..SQISRDDVKMYSLGILCES.
B8M2T3_TALSN/30-332FV....-----------------....HE.EY.....AGICAFINQPAA.E----TER........NALMLAVGVLVPL.
A2QAY7_ASPNC/31-357FV....-----------------....HE.QY.....AGISAFVNWPAE.E----AER........NAKMFAIGVLVPL.
A1CNU9_ASPCL/30-339FV....-----------------....YE.QY.....AGISAFVNLPAD.E----AER........NANMFAVGVLVPL.
Q2UQJ8_ASPOR/30-340FV....-----------------....HE.QY.....AGISAFINQPAE.E----AVR........NAKMFSVGVLVPL.
Q5BF30_EMENI/30-339FV....-----------------....HD.QY.....AGISAFVNQPAD.E----SER........NAKMFSIGVLVPL.
F2PVM8_TRIEC/26-326FV....-----------------....HD.RY.....IGLSAFINQPAG.E----AQR........NAIMLSVGILAPL.
E9CY67_COCPS/13-322FV....-----------------....QD.DY.....AGLSAFVNQPAD.E----SER........NALMLAVGVLVPL.
C0S3V5_PARBP/84-387FV....-----------------....DD.QH.....AGISAFINHPAA.E----SQR........NALMMAVGVLVPL.
C0NKX7_AJECG/29-332FV....-----------------....HQ.QY.....AGISAFINHPAA.E----SER........NALMIAVGVLVPL.
D5G5F9_TUBMM/21-341FV....-----------------....QA.PY.....AGISAFINTPAA.E----AER........NACMLSVGVLVPL.
E3Q807_COLGM/29-348FV....-----------------....HDGEH.....AGLSAFINTPCDEE----EAR........HARMIAVGVLVPL.
E9F1A8_METAR/37-350FV....-----------------.....DGAH.....AGLSAFVNEPCEEE----EAR........NARMIAVGVLVPL.
C7YNX8_NECH7/29-347FV....-----------------....HDGGH.....AGLSAFVNMPCDEE----EAR........HARMIAVGVLVPL.
B2AXI7_PODAN/33-356FV....-----------------....HDASH.....AGLSAFINTPTDEE----ETR........HARMIAVGVLVPL.
A6RUI2_BOTFB/28-351FT....-----------------....HD.NY.....AGLSAFVNAPAD.K----SSR........NARMIAVGIMVPL.
Q0V1B2_PHANO/27-300FT....-----------------....HE.GY.....AGLSAFARGEAG.S----EER........NANFVSVGVLARR.
B3RV35_TRIAD/7-273FR....-----------------...NGQ.DL.....YGLSCFKRIQVDNQ----EER........GVRMKSVGILCKH.
LCHN_XENLA/61-326FR....-----------------....KG.GF.....FGLACFANMPVESE----LER........GARMKSVGVLSPS.
LCHN_DANRE/114-382FR....-----------------....KG.CY.....FGLACFANMPVESE----LER........GARMKSVGILSPS.
B7QCC0_IXOSC/54-313FK....-----------------....RG.NF.....YGLSCFENMKVENE----KER........GARMKSIGVLAQS.
F2UE85_SALS5/10-285FL....-----------------....AE.GM.....YMVSCFKTIK.DAQ----AAR........GLRACSVGVVCTS.
YBAG_SCHPO/6-296FR....-----------------....FQ.DQ.....LCLSVFSKLQHPSF----ERS.........AFFTSVGLILSD.
B6K728_SCHJY/9-263FR....-----------------...LED.EK.....LCICAYKRVMDDNL----ERG.........ARFLSLGLICES.
Q5K7R2_CRYNJ/10-298FR....-----------------....HH.DL.....PGVGLFRSREKPEG----ENR......GRGRTMGVVGVVLAE.

PF08616

A0C6F7_PARTE/251-368------------------------------NA------------------------------------------------
A4I5V0_LEIIN/587-699------------------------------RY------------------------------------------------
A5DM71_PICGU/279-393------------------------------YN------------------------------------------------
A5DZ96_LODEL/271-385------------------------------LN------------------------------------------------
A6ZNX6_YEAS7/345-470------------------------------NE------------------------------------------------
A7TRE4_VANPO/376-503------------------------------NQ------------------------------------------------
A8PX95_MALGO/354-466------------------------------LH------------------------------------------------
B0D0E4_LACBS/418-530------------------------------LH------------------------------------------------
C3ZXT1_BRAFL/180-291------------------------------EA------------------------------------------------
C4R3J0_PICPG/305-418------------------------------FK------------------------------------------------
C4Y911_CLAL4/255-369------------------------------HN------------------------------------------------
C4YQL5_CANAW/259-373------------------------------LN------------------------------------------------
C5DJD2_LACTC/316-435------------------------------ND------------------------------------------------
C5DZH0_ZYGRC/269-391------------------------------DT------------------------------------------------
D2VRW9_NAEGR/366-475------------------------------QT------------------------------------------------
D2W4R6_NAEGR/470-587------------------------------GT------------------------------------------------
YG76_SCHPO/259-372------------------------------SP------------------------------------------------
Q23F93_TETTS/358-465------------------------------NA------------------------------------------------
Q2URL2_ASPOR/377-488------------------------------IH------------------------------------------------
Q4DMT0_TRYCC/444-555------------------------------RY------------------------------------------------
Q4P9F2_USTMA/366-478------------------------------IH------------------------------------------------
Q55D43_DICDI/566-679------------------------------DY------------------------------------------------
Q55YB7_CRYNB/357-470------------------------------FH------------------------------------------------
Q6BI40_DEBHA/264-378------------------------------HN------------------------------------------------
Q6CGA4_YARLI/272-384------------------------------VH------------------------------------------------
Q6CPS0_KLULA/322-444------------------------------NN------------------------------------------------
Q75BQ9_ASHGO/342-464------------------------------KD------------------------------------------------

PF07792

MESA_EMENI/79-241------------------------------EL------------------------------------------------
E7KUE5_YEASL/26-218------------------------------SL------------------------------------------------
B2AXK1_PODAN/123-294------------------------------EL------------------------------------------------
E9DDS1_COCPS/90-249------------------------------EL------------------------------------------------
F2TNB3_AJEDA/90-246------------------------------EL------------------------------------------------
Q0V5R0_PHANO/110-273------------------------------EL------------------------------------------------
C4Y911_CLAL4/3-80------------------------------EL------------------------------------------------
Q75BQ9_ASHGO/49-219------------------------------GL------------------------------------------------
A7TRE4_VANPO/73-251------------------------------SL------------------------------------------------
C5DZH0_ZYGRC/8-97------------------------------SL------------------------------------------------
Q5KLM3_CRYNJ/72-162------------------------------ST------------------------------------------------
A2Q8P4_ASPNC/82-239------------------------------EL------------------------------------------------
A1CRY6_ASPCL/85-243------------------------------EL------------------------------------------------
F0XQA1_GROCL/147-345------------------------------EL------------------------------------------------
E9BZT8_CAPO3/13-108------------------------------EL------------------------------------------------
Q6CGA4_YARLI/9-78------------------------------EL------------------------------------------------
C0SET4_PARBP/168-287------------------------------EL------------------------------------------------
Q7RXB5_NEUCR/122-235------------------------------EL------------------------------------------------
Q6CPS0_KLULA/28-197------------------------------SL------------------------------------------------
A6RVU6_BOTFB/70-232------------------------------EL------------------------------------------------
C4R3J0_PICPG/6-86------------------------------NV------------------------------------------------
B8MHD8_TALSN/85-247------------------------------EL------------------------------------------------
A0C6F7_PARTE/1-175------------------------------SY------------------------------------------------
D8QBP3_SCHCM/66-137------------------------------..------------------------------------------------
Q23F93_TETTS/1-96------------------------------AY------------------------------------------------
D2VRW9_NAEGR/60-245------------------------------NL------------------------------------------------
D3BKL1_POLPA/154-247------------------------------EF------------------------------------------------
F0ZTU4_DICPU/95-230------------------------------EW------------------------------------------------
B6HSJ1_PENCW/75-232------------------------------EL------------------------------------------------
D4AU15_ARTBC/26-120------------------------------RE------------------------------------------------
C5DJD2_LACTC/29-192------------------------------SL------------------------------------------------

PF02141

DEN5A_HUMAN/202-390------------------------------EV------------------------------------------------
DEN5B_HUMAN/187-375------------------------------EV------------------------------------------------
Q0US70_PHANO/395-592------------------------------EA------------------------------------------------
Q0UM90_PHANO/167-348------------------------------SF------------------------------------------------
Q54JA6_DICDI/110-305------------------------------S.------------------------------------------------
Q55DD7_DICDI/109-294------------------------------AY------------------------------------------------
Q08BI6_DANRE/181-363------------------------------EA------------------------------------------------
Q5U3I4_DANRE/164-346------------------------------EA------------------------------------------------
Q0VCJ3_BOVIN/149-333------------------------------EA------------------------------------------------
Q6DF82_XENLA/149-333------------------------------EA------------------------------------------------
DEN2C_HUMAN/586-770------------------------------EA------------------------------------------------
Q4T8M0_TETNG/323-507------------------------------EA------------------------------------------------
Q5RHZ1_DANRE/778-962------------------------------ES------------------------------------------------
Q4SCC1_TETNG/127-311------------------------------EA------------------------------------------------
A7RR72_NEMVE/298-481------------------------------DV------------------------------------------------
Q3U2K9_MOUSE/307-491------------------------------NI------------------------------------------------
DEN4B_MOUSE/313-497------------------------------NV------------------------------------------------
A0PJS2_DANRE/305-489------------------------------NV------------------------------------------------
Q4SLY3_TETNG/383-567------------------------------TV------------------------------------------------
Q7PWX7_ANOGA/311-495------------------------------EV------------------------------------------------
Q9W3D2_DROME/308-492------------------------------EV------------------------------------------------
Q9TXV4_CAEEL/347-533------------------------------EV------------------------------------------------
MTMRD_HUMAN/116-298------------------------------C.------------------------------------------------
Q4SZD9_TETNG/73-244------------------------------F.------------------------------------------------
A6PVH0_HUMAN/128-310------------------------------C.------------------------------------------------
Q1LXZ0_DANRE/117-299------------------------------C.------------------------------------------------
Q7KSP6_DROME/142-325------------------------------CI------------------------------------------------
Q177S0_AEDAE/106-289------------------------------CI------------------------------------------------
Q4S7I6_TETNG/216-404------------------------------EV------------------------------------------------
A7SZQ4_NEMVE/186-373------------------------------EV------------------------------------------------
Q54VP0_DICDI/908-1097------------------------------EI------------------------------------------------
Q2GNY8_CHAGB/440-637------------------------------EA------------------------------------------------
A7EF60_SCLS1/465-662------------------------------EA------------------------------------------------
Q0CL54_ASPTN/423-620------------------------------EA------------------------------------------------
DENN_SCHPO/362-562------------------------------DV------------------------------------------------
Q4RI35_TETNG/140-326------------------------------LV------------------------------------------------
DEND3_MOUSE/187-373------------------------------LI------------------------------------------------
A1Z7Q5_DROME/98-283------------------------------NQ------------------------------------------------
Q7Q1I7_ANOGA/88-273------------------------------NK------------------------------------------------
Q6DCI3_XENLA/89-270------------------------------HH------------------------------------------------

PF09794

Q7QF11_ANOGA/7-482--------------------P.IYGYVEVKLSLIAQAFFEQG--DFSAT--EILVKAY----------------------
Q29HH8_DROPS/14-480--------------------P.IYGYIEVKLALIADAFFDQG--DFSCT--ELLVKAY----------------------
Q6BP02_DEBHA/131-552--------------------QPIFQIIKEKLSIISASYFLQN--NFGNT--EILESLY----------------------
A5DNM6_PICGU/119-523--------------------QPIFTKIKEKLSIITHSFLIQE--RLDNY--ELLEHLF----------------------
Q2H333_CHAGB/18-368--------------------PQHFGMLRERLSVVTKAWFLQR--EFTDV--EILRRFQ----------------------
AVL9_PONAB/16-520--------------------P.LYGLLQAKLQLITHAYFEEK--DFSQI--SILKELY----------------------
Q4P7V8_USTMA/140-510--------------------P.VFGPIREKLGIVTRAFFAQG--DLANV--DILVDFH----------------------
Q17GP2_AEDAE/7-476--------------------P.IYGYVEVKLSLIAHAFFEQG--DFSCT--DILVEAF----------------------
Q6C028_YARLI/516-899--------------------P.IWGPMKDKLAVVTRAFFMQP--TFDDK--SIIRSLF----------------------
Q54NJ9_DICDI/6-452--------------------P.IFNSFKTQLSSATICYFNQG--DFQNT--DLLVTWF----------------------
A1CPG6_ASPCL/9-384--------------------PQTVGQLREKLSVVTSAWFAQR--DFSDT--DILKKFR----------------------
Q4SKV3_TETNG/13-521--------------------P.LYGLLQAKLQLITHAYFEEK--DFSQI--SILKELY----------------------
Q6FIU1_CANGA/8-406--------------------P.IFGQIKDKLSIVTNAFFRQK--DFSDR--AIISSLY----------------------
Q08D17_XENTR/21-516--------------------P.LYGLLQAKLQLITHAYFEEK--DFSQI--SILKELY----------------------
Q6CKD3_KLULA/6-399--------------------P.ILGQIKDKLAIITNALFMQR--DFTDK--TIIDTLY----------------------
Q750W9_ASHGO/13-401--------------------P.IFGQIKDKLSIVTNALFLQR--DFSDT--SIIYTLY----------------------
Q5KDB3_CRYNJ/119-529--------------------P.IFGPIRDRLGVVTRAYFAQR--DFAET--KLLEDFY----------------------
A6RFN4_AJECN/8-299--------------------PRHFGQLRQKLSIVTSAWFAQR--DFSDT--DILKIFQ----------------------
AVL9_YEAST/9-401--------------------P.IFGQIKDKLSIVTNAFFLQH--DFGDR--KIIQSLY----------------------
A3LPG1_PICST/85-492--------------------QPIFTKIREKLSIITKSYFQQD--NFNNV--ELLENLF----------------------
AVL9_SCHPO/10-367--------------------P.PFGHIKDNLDIVTNAYFSQG--DFSNL--DVLRDFF----------------------
Q5AIP1_CANAL/191-588--------------------QPIFTKIKDKLSIIAKSYFQQE--TFDNF--EILDNLF----------------------
A7TEK5_VANPO/8-400--------------------P.IFGQIRDKLSIVTNVFFSQK--NFTDR--SIIVSLY----------------------

PF09804

Q6C716_YARLI/3-239......................PWNYLNILDTTM.KALEKGD.....EV--KVLNGLW......................
YKE7_YEAST/33-335..QNASSDSKKHFYKEIYHAYAANRYSSYLESLL.GQWIRQR..DLDKF--DIFEKFF......................
Q6FLQ0_CANGA/9-288........SQISDDLRGFNYEVTNQYIPELQSLL.KDWSTNQGSNSNSY--EQLSTYY......................
A7TLL1_VANPO/24-351LSLKCYPDDEIFSSRHHKYI.SCNEYVGDLKKLL.SDWLQNE..KYDDF--STFESFY.....NTNKKTIVKADDGSSGS
Q75DG5_ASHGO/36-366FRLDAMAESKYYRWKPNMFI.CANEYKEDLAQLM.EQWLKSK.....SL--EVLEHYFSYNKYQPDLGSPLLMRKWPGSS
Q6CP43_KLULA/3-242................PMDYEQLSLYEGGMKDAL.ERWWKDQ.....DY--SVLEEWD......................
A5DGT1_PICGU/16-298.........VSKSWKPNEYISTGWEHIESLDSTL.YTFLRLQ..SWNDY--SVFEELH......................
Q5A7K9_CANAL/8-279.........KPSVWKPNEFIDNGWEYADAIHQKL.VSFVHSG..EYVGL--K............................
B9WCZ6_CANDC/8-285.........GSSVWKPNEFIRNGWEYVEEVHQKL.VKFVHSR..EYTDF--AKLQ.........................
C5MJC0_CANTT/11-295.........KPNPWKPNEFIRNGWEYVDSLNEKL.VQFVHSQ..QYDNF--KPIESVL......................
A3LNE8_PICST/19-334......ATKESESWKPNEFISNGWEYIEVLDSTL.VHFLQTE..QYDNF--DIFNQLY......................
Q6BJB8_DEBHA/28-311........TPNPMWKSNEFINNGWEYINKLDDGL.EKFLNGN..DYDNF--TIFDEVF......................
B8M2T3_TALSN/30-332...............SFGRLGKSWRHAAGLKNLA.KQCANNI....SDT--QPLAEYW.....DKHHVRDNEPRLEDTPP
A2QAY7_ASPNC/31-357...............SSGRLGKSWRHAPKLKELA.ANYAEDM....SNT--QPLTEYW.....DNYEI..RETDASAMPP
A1CNU9_ASPCL/30-339...............GSGRLGKSWRHAPKLKELA.HVYAKDM....SNT--QILSDYW.....ETYEM..RTNGASAIPP
Q2UQJ8_ASPOR/30-340...............SSGRLGKSWRHAPKLRELA.QIYALDM....SHT--EPLLKYW.....EIYEI..RDSDLSGVPP
Q5BF30_EMENI/30-339...............SSGRLGKSWRHASKLKELA.QRYSESA....FST--NSLSEYW.....ETHEL...SANETSAAP
F2PVM8_TRIEC/26-326...............SHGRLGRSWKHAAGLKELA.IQLATDP....DDT--QPLASYW.....DKHQL...RDSEGSSPP
E9CY67_COCPS/13-322...............SQGRLGKAWRHAASLKELA.RKLANDY....GDT--KPLADYW.....EAFQL...PNYHNESPP
C0S3V5_PARBP/84-387...............SYGRLGKAWRHAAKLKELA.RSFADDP....DNM--EPLSAYW.....EMYQF....SDEVNSSS
C0NKX7_AJECG/29-332...............SYGRLGKAWRHTAKLKELA.RSLADDS....DNT--EPLSAYW.....ETHQL....SEDTVSPP
D5G5F9_TUBMM/21-341...............SYGRLGRSWRHAENLKELA.KKFAANT....EDH--APLEEYY.....ELNRIHESTEAPESPAE
E3Q807_COLGM/29-348...............SYGRLGRAWRHAEGLKGIA.SKLAEDR....KNT--GLLDEYW.....EKNKA..KGGAEQERPA
E9F1A8_METAR/37-350...............SYGRLGRAWRHAENLKELA.AILAKDR....SQT--SVLEKYW.....NSHKASENEGQPNDLGP
C7YNX8_NECH7/29-347...............SYGRLGRAWRHAEALKEMA.AKLAEDR....KNT--SILEEYW.....TANRE..KQGQGNRRLS
B2AXI7_PODAN/33-356...............SYGRLGRAWRHAEGLKEMA.SKLVQDR....KQT--QILEEYW.....ERNGA..RETSAPQPLK
A6RUI2_BOTFB/28-351...............SYGRLGRSWKHAESLKDLA.SELILDE....SKT--ERLEGFW.....ESHKGNDLGKSRETDSL
Q0V1B2_PHANO/27-300................DGILGRTWGAAGRLESIA.RTIAEDE.....GV--APLEEFW.....EEQTAHARQHDNT....
B3RV35_TRIAD/7-273...................FITLHLHMPFLESEV.VKQLNSP....GNY--QRLQEYFTNNIDLNESLIQPYGSNTSVLK
LCHN_XENLA/61-326...................YTLLYRYMHFLENQV.RHQLEIP....GHY--TPLEAFY.....EDKKGVLPVGPQTCQPA
LCHN_DANRE/114-382...................YTLLYRYMHFLENQV.RHQLQCP....GQY--SPLEAFY.....EDKKAVLPSGGNGLVTA
B7QCC0_IXOSC/54-313...................YSLLHLYKPFLQKQV.RHLLESP....GLY--SDLDQFY.....LKHCSRPTLEASSELSP
F2UE85_SALS5/10-285...................PDFLHRHRSFLRDQCQKHLVTDD....DDY--SELKQYF.....EDQKAAEATNDQAAGAR
YBAG_SCHPO/6-296...............DINFGEAVVKYGETLLYIA.NGL.........SL--ATLKYKFGEDASETYASEKCTSHQLSDSD
B6K728_SCHJY/9-263...............KTTYKQLVLQFEDLLTNTI.NTISRSP...TKQT--ETLLKYF......................
Q5K7R2_CRYNJ/10-298..........GDVADLYSSKSALKEIYDKLENLSQSPFISSVEQDGERE--KVLDEVW.....QKYRADKVKKLEAAMDE

PF08616

A0C6F7_PARTE/251-368--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A6ZNX6_YEAS7/345-470--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_PICPG/305-418--------------------------------------------------------------------------------
C4Y911_CLAL4/255-369--------------------------------------------------------------------------------
C4YQL5_CANAW/259-373--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
YG76_SCHPO/259-372--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
Q4P9F2_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q55YB7_CRYNB/357-470--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------

PF07792

MESA_EMENI/79-241--------------------------------------------------------------------------------
E7KUE5_YEASL/26-218--------------------------------------------------------------------------------
B2AXK1_PODAN/123-294--------------------------------------------------------------------------------
E9DDS1_COCPS/90-249--------------------------------------------------------------------------------
F2TNB3_AJEDA/90-246--------------------------------------------------------------------------------
Q0V5R0_PHANO/110-273--------------------------------------------------------------------------------
C4Y911_CLAL4/3-80--------------------------------------------------------------------------------
Q75BQ9_ASHGO/49-219--------------------------------------------------------------------------------
A7TRE4_VANPO/73-251--------------------------------------------------------------------------------
C5DZH0_ZYGRC/8-97--------------------------------------------------------------------------------
Q5KLM3_CRYNJ/72-162--------------------------------------------------------------------------------
A2Q8P4_ASPNC/82-239--------------------------------------------------------------------------------
A1CRY6_ASPCL/85-243--------------------------------------------------------------------------------
F0XQA1_GROCL/147-345--------------------------------------------------------------------------------
E9BZT8_CAPO3/13-108--------------------------------------------------------------------------------
Q6CGA4_YARLI/9-78--------------------------------------------------------------------------------
C0SET4_PARBP/168-287--------------------------------------------------------------------------------
Q7RXB5_NEUCR/122-235--------------------------------------------------------------------------------
Q6CPS0_KLULA/28-197--------------------------------------------------------------------------------
A6RVU6_BOTFB/70-232--------------------------------------------------------------------------------
C4R3J0_PICPG/6-86--------------------------------------------------------------------------------
B8MHD8_TALSN/85-247--------------------------------------------------------------------------------
A0C6F7_PARTE/1-175--------------------------------------------------------------------------------
D8QBP3_SCHCM/66-137--------------------------------------------------------------------------------
Q23F93_TETTS/1-96--------------------------------------------------------------------------------
D2VRW9_NAEGR/60-245--------------------------------------------------------------------------------
D3BKL1_POLPA/154-247--------------------------------------------------------------------------------
F0ZTU4_DICPU/95-230--------------------------------------------------------------------------------
B6HSJ1_PENCW/75-232--------------------------------------------------------------------------------
D4AU15_ARTBC/26-120--------------------------------------------------------------------------------
C5DJD2_LACTC/29-192--------------------------------------------------------------------------------

PF02141

DEN5A_HUMAN/202-390---------------PLPPPGRSLKF.....SGVYGPIICQRPS.TNEL..PL..FDF----------------------
DEN5B_HUMAN/187-375---------------PLPPPGRSLKF.....YGVYEPVICQRPG.PSEL..PL..SDY----------------------
Q0US70_PHANO/395-592---------------LSPITSITQVE.....LAVRELRMYARKEALNEI..PG.SRNI----------------------
Q0UM90_PHANO/167-348---------------PAPRLNDLVRI.....DMKDYALCYQFPSSPTGF......QNF----------------------
Q54JA6_DICDI/110-305---------------VIPAPGDSFTVYIYDNPFISDKKPTNLPV.SYTLKRPVSTDKS----------------------
Q55DD7_DICDI/109-294---------------PIPKSSTTIELTTTATNSATENWVFPFLKPRTNF......DHI----------------------
Q08BI6_DANRE/181-363---------------AFPAPGNTVNIKSFIPDRGTEIISLTRPT.DSWL......EHV----------------------
Q5U3I4_DANRE/164-346---------------PLPSPGSTVSISSFIPDAGTQIIRLTRPA.DSWL......EHV----------------------
Q0VCJ3_BOVIN/149-333---------------AFPAPGKTVTLKSFIPDSGTEFISLTRPL.DSHL......EHV----------------------
Q6DF82_XENLA/149-333---------------TFPAPGKTVKIKSFIPESGTEMIELTRPL.DCRL......EHI----------------------
DEN2C_HUMAN/586-770---------------PFPAPGRTITVKSYLPGAGDESIELCRPL.DSRL......EHV----------------------
Q4T8M0_TETNG/323-507---------------PFPAPGRTITVKNFLPGSGTEVIELCRPS.DSRL......EHV----------------------
Q5RHZ1_DANRE/778-962---------------PFPAPGKTIKVKTFLPGAGNEVIELRRPM.DSRL......EHV----------------------
Q4SCC1_TETNG/127-311---------------PFPAPGRTVTVKSFLPGSGNEVITLCRPV.DSRL......EHV----------------------
A7RR72_NEMVE/298-481---------------PFPSPQRPRILIE...MTRYEPFEISQLY.HSPL..PV..SGA----------------------
Q3U2K9_MOUSE/307-491---------------PFPSPQRPRILIQ...LSVHDAFILSQPV.STPL..PL..SGA----------------------
DEN4B_MOUSE/313-497---------------PFPSPQRPRILVQ...MSPYDNLLLCQPV.SSPL..PL..SGA----------------------
A0PJS2_DANRE/305-489---------------PFPSAQRPRILVQ...LSPYDNLLLCQPV.SSPL..PL..SGA----------------------
Q4SLY3_TETNG/383-567---------------PFPSIQRPRILVQ...LSPHDSLLLSQPV.SSPL..PL..SGG----------------------
Q7PWX7_ANOGA/311-495---------------PFPSPSILLQLST....LSNNRVLLTLPE.DSPL..PR..SGA----------------------
Q9W3D2_DROME/308-492---------------PFPAPSIHLQLSS....ESNDRILLTQPE.DSPL..PR..SGA----------------------
Q9TXV4_CAEEL/347-533---------------SFPTPRRPRVFMQ...LGAEN.ISFDSHD.DSQL..PL..NGA----------------------
MTMRD_HUMAN/116-298---------------LVPAAGGSQKLFS...LGAGDRQLIQTPL.HDSL..PI..TGT----------------------
Q4SZD9_TETNG/73-244---------------QVPVVGGAQDMPK...LSS......HVPT.NIS...PI..SSS----------------------
A6PVH0_HUMAN/128-310---------------TVPLAGGSQRTIS...LGAGDRQVIQTPL.ADSL..PV..SRC----------------------
Q1LXZ0_DANRE/117-299---------------IIPIAGGSQRTIT...LGAGDRQVIQTPI.NDSL..PV..SGC----------------------
Q7KSP6_DROME/142-325---------------QVPPAGGPQVRFS...IGAGDKQSLQPPQ.SSSL..PT..TGS----------------------
Q177S0_AEDAE/106-289---------------QVPPPGGPQVRFS...IGAGDKQVLQPPI.SPTI..PV..TGS----------------------
Q4S7I6_TETNG/216-404---------------PLPPPGRSLRF.....HGVQGPIVCQRPG.PGEL..PM..GEY----------------------
A7SZQ4_NEMVE/186-373---------------PLPPPGRTMRF.....NCVKESITCQRPG.PNEL..PL..FDY----------------------
Q54VP0_DICDI/908-1097---------------QLPRPGKNPVTFS...LGGLNQCLLKQPD.PCLL..PE..PDI----------------------
Q2GNY8_CHAGB/440-637---------------FSPLSSLTQVE.....LGVRELRLYARKEAANEI..PG.SRTI----------------------
A7EF60_SCLS1/465-662---------------LSPLSSKTQIE.....IAVRELRLFARKEAPNEL..PE.SRNT----------------------
Q0CL54_ASPTN/423-620---------------FSPNSSKTQVE.....LAVRELRLFARKEAANEL..PG.SRNT----------------------
DENN_SCHPO/362-562---------------PLPPKGLLQLQ.....VNVGPLNLYAFRSPVNEI..PG.WNDV----------------------
Q4RI35_TETNG/140-326---------------PIPPPGQLHLA......FHLHPLTIVLPS.KEDKDHPV..VDL----------------------
DEND3_MOUSE/187-373---------------PSPPPGPLHLI......FNMKPLQVVFPS.RADPESPI..VDL----------------------
A1Z7Q5_DROME/98-283---------------GIPDCGGSLKVYY...SAGQSHFTFERPL.QFQL..PSMPENH----------------------
Q7Q1I7_ANOGA/88-273---------------GVPEPGACLKLHY...DRASQTFLFQRPQ.QFQL..PSIPENH----------------------
Q6DCI3_XENLA/89-270---------------PVPQENTALSLEM........LSYFIAPD.PTRL..PSVPENR----------------------

PF09794

Q7QF11_ANOGA/7-482------------------------EQLNAC.LVSLEPQEI........G.............STR........LHFVGV.
Q29HH8_DROPS/14-480------------------------QQLNAC.LLDDESRRP......................LRH.........FHVGL.
Q6BP02_DEBHA/131-552------------------------DNLNTT.FRVKEKEGVIKDSTSKKQSSLN....EFVERQDE.........FFVNL.
A5DNM6_PICGU/119-523------------------------ENLNDS.FKPKVDRRLSI...DQE.ALR.......IEREDE.........FFVNL.
Q2H333_CHAGB/18-368------------------------ESLADEKARG.LLHDD.....................EDRD.........QYLGL.
AVL9_PONAB/16-520------------------------EHM....NSSLGGASL.....................EGSQ.........VYLGL.
Q4P7V8_USTMA/140-510------------------------STLEIG.LQSGGMSED.....................RETV.........MYMGT.
Q17GP2_AEDAE/7-476------------------------EQQNACLYSMDPMVEL......................APAR.......LHFVGL.
Q6C028_YARLI/516-899------------------------DSLAHT.LTLSKFNSD.....................TSSD.........VSIGM.
Q54NJ9_DICDI/6-452------------------------HAQNNE.FKERNNEKLVIN..NSF.GYQMNQVLENNNNNNKKLIPINSDFLFGSM.
A1CPG6_ASPCL/9-384------------------------EGLIIS.....WEQNE.....................ASKD.........QNLGL.
Q4SKV3_TETNG/13-521------------------------EHM....NGSLGGSAL.....................EGSQ.........VYLGL.
Q6FIU1_CANGA/8-406------------------------DSLKAT.YMPSDVPSP.........ANF.......SQRENQ.........LYVGL.
Q08D17_XENTR/21-516------------------------EHM....NGSLGGSAI.....................EGSQ.........LYLGL.
Q6CKD3_KLULA/6-399------------------------SNLNSIEYDDHD..........................ESH.........LYVGL.
Q750W9_ASHGO/13-401------------------------DNLRSM.FNSAASID.......................ESN.........LFVGL.
Q5KDB3_CRYNJ/119-529------------------------TSLETG.LEGKSGEEA..................................MYMGT.
A6RFN4_AJECN/8-299------------------------ESLAES.....LDNDE.....................GQQD.........GIL...
AVL9_YEAST/9-401------------------------ENLKSI.YTPASLVRN.....................AENR.........LYIGL.
A3LPG1_PICST/85-492------------------------DNLNNT.FK.LIDNELEEN..TKF.TYEFSEQQKSIAKEEE.........NFVNL.
AVL9_SCHPO/10-367------------------------HVLTRK................................EQD.........VHIALN
Q5AIP1_CANAL/191-588------------------------ENLNGQ.FK.LVDNEM.........HTE.......LEQEEE.........NYVNL.
A7TEK5_VANPO/8-400------------------------DNLQSL.FKPMTSTSL.....................SDSN.........MYVGL.

PF09804

Q6C716_YARLI/3-239...............................SLLTKGPKP---------------------MAPE---------RHPIY-
YKE7_YEAST/33-335.....................DENNQGHMAENSVEVFEHS---------------------PKER---------RHLVE-
Q6FLQ0_CANGA/9-288.............................HKKISGSLNYE---------------------VDYQ---------TSMLN-
A7TLL1_VANPO/24-351...................KTIRSSELTDDIEDTPVPIAN---------------------INNK---------LLMLE-
Q75DG5_ASHGO/36-366....................TLTGGSYEDYAQGSKDDAET---------------------FKPS---------KSWLY-
Q6CP43_KLULA/3-242......................................EK---------------------QNGD---------DTSNF-
A5DGT1_PICGU/16-298..........................SSLTGSQLSPNPIS---------------------PKTD---------HHLLS-
Q5A7K9_CANAL/8-279..................................GIPKVV---------------------PNVD---------NHLLT-
B9WCZ6_CANDC/8-285..................................DIPKVT---------------------PNIN---------NHLLT-
C5MJC0_CANTT/11-295..............................EGMDGLSPTG---------------------PNIN---------NHLLT-
A3LNE8_PICST/19-334............DRILSSEPHLPVSSSSSRFLSNSSVKLT---------------------PNVH---------HHLLT-
Q6BJB8_DEBHA/28-311..........................DNLTNTHLKVGKPN---------------------ININ---------NHLLS-
B8M2T3_TALSN/30-332.DSPAVLRRPLKT....DRPETLQSRSSISDAAGIETTKP---------------------FLAP---------YHPAL-
A2QAY7_ASPNC/31-357.DSPMESPLSLRLRAHGDLRDAVHRTRAFSDAIVLETPRP---------------------ALTP---------FHPAS-
A1CNU9_ASPCL/30-339.DSPLESPLSLRFR...ERPDSMHRNRTFSDALVLEASRP---------------------ALTP---------FHPAS-
Q2UQJ8_ASPOR/30-340.DSPLESPLSLRLRAHGERPDHSLRNRTFSDAIVLETPRP---------------------ALTP---------FHPAS-
Q5BF30_EMENI/30-339.DSPLDSPLSLRMRAHSDRPDTLQRNRAISDAMVLETSRP---------------------ALTP---------FHPAS-
F2PVM8_TRIEC/26-326.ESPLEYMSHPKP...ISVPPAKRRQRALSDATALISSR.---------------------TLPS---------YHPAL-
E9CY67_COCPS/13-322.DSPLASISGLKP.KQSTPQGAFHRGRTLSDATALLTSKQ---------------------LLAP---------YHPAL-
C0S3V5_PARBP/84-387.DSPLGSIASLKT....PIREGYTRQRALSDATALMSSKQ---------------------SLAP---------YHPAS-
C0NKX7_AJECG/29-332.DSPSGAIASLKT....PVRDVYARHRALSDATALLTSKQ---------------------SLAP---------YHPAL-
D5G5F9_TUBMM/21-341SPSSLRYRPSSRYKPPFDSLNRHSRTRSISDTTALAAPGQ---------------------ALSP---------YHPAL-
E3Q807_COLGM/29-348LESPSISFSAQAS...QPKTAHHSRNRSASDGASLLPYGH---------------------RLSP---------YHPAW-
E9F1A8_METAR/37-350.GNLPDSPTQERR........THKRKGSASDGTSLAQAEH---------------------RLSP---------FHPAW-
C7YNX8_NECH7/29-347GETPVSSPSLHSQ...PLGRKGHNRNRSASDGASLIPTGN---------------------TLSP---------YHPAW-
B2AXI7_PODAN/33-356.DEPLASPALSFRAVRPPLGRGHARNRSASDGTALIPPGH---------------------RLSP---------YHPAW-
A6RUI2_BOTFB/28-351LDSPSSARYKARN..TPPKARGHNRDRSASDGTALIPPGH---------------------TLSV---------YHPAW-
Q0V1B2_PHANO/27-300....................KGHSRARAISTVSAVTKDDE---------------------RLPA---------YHPAL-
B3RV35_TRIAD/7-273.............................VRLLISEYTEY---------------------HYSI---------THPAG-
LCHN_XENLA/61-326...........................LHWLPPVHKHLYP---------------------EMKI---------THPAG-
LCHN_DANRE/114-382........................CPTSALAPIVNRCMHP---------------------EMKI---------THPAG-
B7QCC0_IXOSC/54-313...............................YKTICDGMH---------------------SMQI---------THPAG-
F2UE85_SALS5/10-285................VVEVRSPVWNLDRSVVREAEHSNQ---------------------ILVL---------RHEEG-
YBAG_SCHPO/6-296FFKSLQTSAVNLE......FDSLFEKLQGNKFAILGANSK---------------------ELSQ---------SYA..-
B6K728_SCHJY/9-263................................LNECNSTE---------------------VVMS---------NTSLN-
Q5K7R2_CRYNJ/10-298.......................GKENELDRVHKLITERG---------------------RVPS---------AHPIA-

PF08616

A0C6F7_PARTE/251-368--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A6ZNX6_YEAS7/345-470--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_PICPG/305-418--------------------------------------------------------------------------------
C4Y911_CLAL4/255-369--------------------------------------------------------------------------------
C4YQL5_CANAW/259-373--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
YG76_SCHPO/259-372--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
Q4P9F2_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q55YB7_CRYNB/357-470--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------

PF07792

MESA_EMENI/79-241--------------------------------------------------------------------------------
E7KUE5_YEASL/26-218--------------------------------------------------------------------------------
B2AXK1_PODAN/123-294--------------------------------------------------------------------------------
E9DDS1_COCPS/90-249--------------------------------------------------------------------------------
F2TNB3_AJEDA/90-246--------------------------------------------------------------------------------
Q0V5R0_PHANO/110-273--------------------------------------------------------------------------------
C4Y911_CLAL4/3-80--------------------------------------------------------------------------------
Q75BQ9_ASHGO/49-219--------------------------------------------------------------------------------
A7TRE4_VANPO/73-251--------------------------------------------------------------------------------
C5DZH0_ZYGRC/8-97--------------------------------------------------------------------------------
Q5KLM3_CRYNJ/72-162--------------------------------------------------------------------------------
A2Q8P4_ASPNC/82-239--------------------------------------------------------------------------------
A1CRY6_ASPCL/85-243--------------------------------------------------------------------------------
F0XQA1_GROCL/147-345--------------------------------------------------------------------------------
E9BZT8_CAPO3/13-108--------------------------------------------------------------------------------
Q6CGA4_YARLI/9-78--------------------------------------------------------------------------------
C0SET4_PARBP/168-287--------------------------------------------------------------------------------
Q7RXB5_NEUCR/122-235--------------------------------------------------------------------------------
Q6CPS0_KLULA/28-197--------------------------------------------------------------------------------
A6RVU6_BOTFB/70-232--------------------------------------------------------------------------------
C4R3J0_PICPG/6-86--------------------------------------------------------------------------------
B8MHD8_TALSN/85-247--------------------------------------------------------------------------------
A0C6F7_PARTE/1-175--------------------------------------------------------------------------------
D8QBP3_SCHCM/66-137--------------------------------------------------------------------------------
Q23F93_TETTS/1-96--------------------------------------------------------------------------------
D2VRW9_NAEGR/60-245--------------------------------------------------------------------------------
D3BKL1_POLPA/154-247--------------------------------------------------------------------------------
F0ZTU4_DICPU/95-230--------------------------------------------------------------------------------
B6HSJ1_PENCW/75-232--------------------------------------------------------------------------------
D4AU15_ARTBC/26-120--------------------------------------------------------------------------------
C5DJD2_LACTC/29-192--------------------------------------------------------------------------------

PF02141

DEN5A_HUMAN/202-390--------------------------------------------------------------------------------
DEN5B_HUMAN/187-375--------------------------------------------------------------------------------
Q0US70_PHANO/395-592--------------------------------------------------------------------------------
Q0UM90_PHANO/167-348--------------------------------------------------------------------------------
Q54JA6_DICDI/110-305--------------------------------------------------------------------------------
Q55DD7_DICDI/109-294--------------------------------------------------------------------------------
Q08BI6_DANRE/181-363--------------------------------------------------------------------------------
Q5U3I4_DANRE/164-346--------------------------------------------------------------------------------
Q0VCJ3_BOVIN/149-333--------------------------------------------------------------------------------
Q6DF82_XENLA/149-333--------------------------------------------------------------------------------
DEN2C_HUMAN/586-770--------------------------------------------------------------------------------
Q4T8M0_TETNG/323-507--------------------------------------------------------------------------------
Q5RHZ1_DANRE/778-962--------------------------------------------------------------------------------
Q4SCC1_TETNG/127-311--------------------------------------------------------------------------------
A7RR72_NEMVE/298-481--------------------------------------------------------------------------------
Q3U2K9_MOUSE/307-491--------------------------------------------------------------------------------
DEN4B_MOUSE/313-497--------------------------------------------------------------------------------
A0PJS2_DANRE/305-489--------------------------------------------------------------------------------
Q4SLY3_TETNG/383-567--------------------------------------------------------------------------------
Q7PWX7_ANOGA/311-495--------------------------------------------------------------------------------
Q9W3D2_DROME/308-492--------------------------------------------------------------------------------
Q9TXV4_CAEEL/347-533--------------------------------------------------------------------------------
MTMRD_HUMAN/116-298--------------------------------------------------------------------------------
Q4SZD9_TETNG/73-244--------------------------------------------------------------------------------
A6PVH0_HUMAN/128-310--------------------------------------------------------------------------------
Q1LXZ0_DANRE/117-299--------------------------------------------------------------------------------
Q7KSP6_DROME/142-325--------------------------------------------------------------------------------
Q177S0_AEDAE/106-289--------------------------------------------------------------------------------
Q4S7I6_TETNG/216-404--------------------------------------------------------------------------------
A7SZQ4_NEMVE/186-373--------------------------------------------------------------------------------
Q54VP0_DICDI/908-1097--------------------------------------------------------------------------------
Q2GNY8_CHAGB/440-637--------------------------------------------------------------------------------
A7EF60_SCLS1/465-662--------------------------------------------------------------------------------
Q0CL54_ASPTN/423-620--------------------------------------------------------------------------------
DENN_SCHPO/362-562--------------------------------------------------------------------------------
Q4RI35_TETNG/140-326--------------------------------------------------------------------------------
DEND3_MOUSE/187-373--------------------------------------------------------------------------------
A1Z7Q5_DROME/98-283--------------------------------------------------------------------------------
Q7Q1I7_ANOGA/88-273--------------------------------------------------------------------------------
Q6DCI3_XENLA/89-270--------------------------------------------------------------------------------

PF09794

Q7QF11_ANOGA/7-482.PLR-----DLLLKW------RHKILIL-FKLLLL-QKRVICY----G.S-----------------PVHP---------
Q29HH8_DROPS/14-480.SLR-----EIVLHW------RHKTLIL-FKLLLL-QRRVVCF----G.S-----------------PVRG---------
Q6BP02_DEBHA/131-552.NLK-----HTLSKF------KTNLLVI-FKALLL-EKKILIY----SNN-----------------NLEM---------
A5DNM6_PICGU/119-523.NLK-----ETVTKF------RHNFLTL-FKAMLL-EKKILIF----SNN-----------------NLES---------
Q2H333_CHAGB/18-368.SLR-----ELVREF------RWQTLVL-LKCCLL-QPK....----...-----------------....---------
AVL9_PONAB/16-520.SPR-----DLVLHF------RHKVLIL-FKLILL-EKKVLFY----I.S-----------------PVNK---------
Q4P7V8_USTMA/140-510.SLR-----ELVHKW------RFKTLML-VKLLLL-QRRVMFF----G.Y-----------------PVEQ---------
Q17GP2_AEDAE/7-476.PLR-----DLVLKW------RHKLLIL-YKLLML-QKRIICF----G.S-----------------PVQP---------
Q6C028_YARLI/516-899.SLC-----ELVSRL------KQKLVVV-FKALLL-EKRVLFY----A.S-----------------STEL---------
Q54NJ9_DICDI/6-452.SLK-----KLIMHF------GRNSLVF-FKLIML-ERGVVVF----CPQ-----------------PVSP---------
A1CPG6_ASPCL/9-384.SLR-----EMIHEF------KYQTLVL-FKALLL-QPKMLFF----G.S-----------------RCER---------
Q4SKV3_TETNG/13-521.SPR-----DLILHF------RHKVLIL-FKLILL-EKKVLFY----V.S-----------------PVSR---------
Q6FIU1_CANGA/8-406.CLR-----KILHDF------NRNALVL-LKALLL-EKKIVFY----G.S-----------------NVEA---------
Q08D17_XENTR/21-516.SPR-----DLVLHF------RHKILIL-FKLILL-EKKVLFY----V.S-----------------PVNR---------
Q6CKD3_KLULA/6-399.NLR-----KTVYDL------RKEVLVI-LKAILL-EKKVLFY----G.N-----------------DVEQ---------
Q750W9_ASHGO/13-401.SLR-----KIIHDF------RREFLVI-LKAMLL-ERKIIFY----G.S-----------------NVEE---------
Q5KDB3_CRYNJ/119-529.SLR-----ELVHKF------RHRTLVL-LKMLML-QKRIMLF----G.Y-----------------PVEK---------
A6RFN4_AJECN/8-299....-----......------.......-......-.......----...-----------------....---------
AVL9_YEAST/9-401.CLR-----KILHDF------KRNALVL-LKAIML-EKKIIVY----G.N-----------------DVEA---------
A3LPG1_PICST/85-492.NLK-----NTILKF------KANFLTI-FKSLLL-DKKILIF----SNS-----------------SLEM---------
AVL9_SCHPO/10-367INLK-----SFLCEW------RQNALVL-LKVLLL-GKRILVY----D.K-----------------SAER---------
Q5AIP1_CANAL/191-588.NLK-----STVGKF------RSRFLII-FKSLLL-EKKVLIY----SNN-----------------NLEA---------
A7TEK5_VANPO/8-400.CLR-----KIILDF------KKETLVL-FKALFL-EKKIIFY----G.N-----------------NVES---------

PF09804

Q6C716_YARLI/3-239-ALV-----PLLTMI------GPEFFEI-HRQTLL-RNRLLIVLDHDTGI.................TLEQ---------
YKE7_YEAST/33-335-YLP-----YWTRKL------GPLIFPL-WKASLL-QSRILILVPQGESF...................EL---------
Q6FLQ0_CANGA/9-288-HLP-----YWLNKL------GPLIFPL-FKSCLL-RERILVISAPGNSF...................EY---------
A7TLL1_VANPO/24-351-HLP-----FWIKKI------GPLIFPL-WKSCLL-NEKILILNPLGGSF...................EL---------
Q75DG5_ASHGO/36-366-LLP-----EIIEQL------GPSIFTL-WKACLL-RQRILVVNEHGQSF...................ER---------
Q6CP43_KLULA/3-242-DFN-----GTCLTI------GPIVLQL-WRCALL-QERILILN...KGV.................EVKK---------
A5DGT1_PICGU/16-298-ALP-----DLLDVL------GPLVFVL-YKQCLL-RKRIMLFHHDPVIL.................SNYT---------
Q5A7K9_CANAL/8-279-NLP-----EMFRSL------GPLVFVL-YKQSLL-RKRILIFNQHHKSY......DDQDILPSGVDNLYN---------
B9WCZ6_CANDC/8-285-NLP-----EMFRTL------GPLVFVL-YKQSLL-RKRILLFNQRSRSH......DDQDILPNGVDNLYN---------
C5MJC0_CANTT/11-295-KLP-----EMFRTL------GPLVFVL-YKQSLL-RKNILIFNQHTKAH......DDQDLLPNGEDHLFS---------
A3LNE8_PICST/19-334-KLP-----QMFKTV------GPFIFAL-YKQSLL-RKRIIFFAKNHRHHLLDKESIENDSDSVENDIYFN---------
Q6BJB8_DEBHA/28-311-KLP-----LMFQSL------GPLVFSL-FKQCLL-RKKVLIFHQNHSKI.................DNFS---------
B8M2T3_TALSN/30-332-SLP-----DFVEKF------GPLIFPL-YRASLL-RKRILIV....TEA.................PVQS---------
A2QAY7_ASPNC/31-357-SLP-----NFLDSF------GPLLFPL-YRAALL-RKRILFM....AEA.................PVHE---------
A1CNU9_ASPCL/30-339-SLP-----EFLDCF------GPLIFPL-YRAALL-RKRILLM....AEA.................PVHI---------
Q2UQJ8_ASPOR/30-340-SLP-----EFLDCF------GPLIYPL-YRATLL-RKKILFM....AEA.................PVHM---------
Q5BF30_EMENI/30-339-SLP-----DFLDAF------GPLLFPL-YRAALL-RRRVLFM....AEA.................PVQV---------
F2PVM8_TRIEC/26-326-TLP-----DFLDTF------GPLIFPL-YRAALL-RKRIVFL....GDA.................PVES---------
E9CY67_COCPS/13-322-CLP-----DFKDTL------GPLIFPL-YRAALL-RKRILFL....GDA.................PVET---------
C0S3V5_PARBP/84-387-SLP-----DFMNTF------GPLVFQL-YRAALL-RKRILFV....GEA.................PVEE---------
C0NKX7_AJECG/29-332-SLP-----EFLDTF------GPLVFQL-YRAALL-RKRILLV....GEA.................PVEE---------
D5G5F9_TUBMM/21-341-SLP-----EFVDTF------GPLVFPL-YRAALT-RQRILLI....TGA.................PVEL---------
E3Q807_COLGM/29-348-SLT-----ALLDTF------GPLIFPI-HRAALL-RKRILIS....CHA.................PVRE---------
E9F1A8_METAR/37-350-SLV-----SLLDKF------GPLIFPI-HRAALL-RKRILIS....CHA.................PVHE---------
C7YNX8_NECH7/29-347-SLT-----SLLDKF------GPLIFPI-HRAALL-RKRILIS....CHA.................PVHE---------
B2AXI7_PODAN/33-356-SLT-----SLLDTF------GPLIFPV-HRAALL-RKRILIS....CHA.................PVHE---------
A6RUI2_BOTFB/28-351-SLP-----RLLDTF------GPMIFPI-YRAALL-RRRILIS....AHA.................PVHE---------
Q0V1B2_PHANO/27-300-SML-----KYLDVL------GPLVFRL-QQAALL-RKRILFV....GGP.................PVRA---------
B3RV35_TRIAD/7-273-CFS-----QFIKFF------GVKIFPL-WRLILL-QKKILFY....SPP.................PVGI---------
LCHN_XENLA/61-326-CMS-----QFIKFF------GEQIFVL-WKFALL-RKRILIF....SPP.................PVGV---------
LCHN_DANRE/114-382-CMS-----QFIRFF------GEQIMVL-WKFALL-RKRILIF....SPP.................PVGV---------
B7QCC0_IXOSC/54-313-CFS-----QFLNYF------GEKVFLL-WKFALL-KKRILFF....SPP.................PIGV---------
F2UE85_SALS5/10-285-SLS-----ELVRRF------GRRIMIL-WKLVLL-QKRVMFL....TSP.................PVDP---------
YBAG_SCHPO/6-296-..T-----ILLDHL------GPAFYCL-YKFALQ-RKRILLI....SSH.................D.DQ---------
B6K728_SCHJY/9-263-RIQ-----NEVYRF------GPQVFEL-QKSILT-KKRVLFI....THP.................PLEA---------
Q5K7R2_CRYNJ/10-298-FMP-----LLLGLL------GPNIVPV-YKAALS-GQRILLY....SQP.................PVLP---------

PF08616

A0C6F7_PARTE/251-368-SLL-----ELFEKF------NMKVRIL.YRALLQ-QKRIIFL----CHE----------------CSNQEKQIGDNMYS
A4I5V0_LEIIN/587-699-SLE-----SLIETL------GPSSLHL.LLGILT-EKKILIL----SRK----------------GEAAD.........
A5DM71_PICGU/279-393-NEL-----TIYGLQ------TPPIIVL.INALLT-GKRVIFL----SYE----------------NSSGY.........
A5DZ96_LODEL/271-385-NEL-----TIYGLQ------TPPIILL.INAVLT-GKKILFL----SYE----------------NSAGH.........
A6ZNX6_YEAS7/345-470-LVL-----KFLDKF------VPYLLKA..GQKVN-AWKLVIN----STK----------------LSKED.........
A7TRE4_VANPO/376-503-KIL-----RFLSKF------YPFINKL..TLQNF-SWRLIIN----STT----------------FSKDE.........
A8PX95_MALGO/354-466-PHL-----HSNGVY------THPVTLL.FNALIT-HKRVLFV----AYH----------------SPATV.........
B0D0E4_LACBS/418-530-PHL-----HTNGPQ------THPIIIL.FNALVT-GKRIIFL----GHK----------------RPAGE.........
C3ZXT1_BRAFL/180-291-DIF-----KCLHPV------LPHVQML.WELVLT-TEPIIVM----APS----------------PTV...........
C4R3J0_PICPG/305-418-SVL-----PYGVHN------TPFIIAL.INALLQ-RKRIIVY----SYS----------------RSCNE.........
C4Y911_CLAL4/255-369-NEM-----TVYGLS------TPPIIIL.INAFLT-GKRILFL----SYE----------------NSAGY.........
C4YQL5_CANAW/259-373-NEL-----TIYGLQ------TPPIIIL.INAILT-GKKIIFL----SYE----------------HSSGY.........
C5DJD2_LACTC/316-435-HVL-----KFLLKF------IPQLDEL..PRSRF-SWRLFVN----STK----------------LPKDT.........
C5DZH0_ZYGRC/269-391-KIS-----KFLLNF------IPLLHKR.DANDSF-HFKLVIY----SSQ----------------YKGSG.........
D2VRW9_NAEGR/366-475-SLC-----RLVTNF------KENTMLI.FNAILY-QKRIVFF----SGQ----------------QLAGQ.........
D2W4R6_NAEGR/470-587-SLV-----QLVQYF------GLETMLVCWNALLL-DKRIMVI----GSP----------------AKL...........
YG76_SCHPO/259-372-FMN-----TDISAD------INPINVL.ITALLI-SKKVLFL----TKT----------------SSASV.........
Q23F93_TETTS/358-465-SLI-----DLIKRF------QDQVMKI.WAAILK-EQRILFV----GYD----------------KSIRE.........
Q2URL2_ASPOR/377-488-PHL-----TTSGPY------THPIIIL.VNAMLT-QKRVVFL----GHN----------------RPSGE.........
Q4DMT0_TRYCC/444-555-GLE-----QMVEVC------GASFWTV.VMAILL-EKRVVVL----SRQ----------------GLAND.........
Q4P9F2_USTMA/366-478-PHL-----HTNGPS------THPIIVL.FNALVT-QKRVVFL----GYG----------------QPASH.........
Q55D43_DICDI/566-679-KVI-----GLVQKF------GNDVMKI.FNGVLS-QKRIIFL----GYG----------------CGADE.........
Q55YB7_CRYNB/357-470-AHL-----HTNGAN------THPIILI.LNALLA-NKRVMFL----GHG----------------LPANQ.........
Q6BI40_DEBHA/264-378-SEL-----TIYGQQ------TPPIIIL.INAILV-GKKIIFL----SYD----------------NSAGY.........
Q6CGA4_YARLI/272-384-PQL-----TIFGPT------TPPVIVL.INALLT-QKRVLFI----GYN----------------TPSGD.........
Q6CPS0_KLULA/322-444-SIL-----KLLARL------IPLLTEI..PDSTY-SWRLIIN----STE----------------RSKDE.........
Q75BQ9_ASHGO/342-464-HVL-----KFLRQF------IPQISLL..DRNDP-SWRLMVN----STT----------------LSKDS.........

PF07792

MESA_EMENI/79-241-MLP-----DQTHVR.SQ...DWTIFFL-PLDTGG-EGEEDD.......LAGENNKR.................K.GKRN
E7KUE5_YEASL/26-218-MIP-----SSIERN.PGK.QDITVFTL-YYNKFT-QNYQLF.......PVPKDPRFSFNLHHREQSDGSVTNSIYYDAE
B2AXK1_PODAN/123-294-MLP-----DQAHVR.NQ...DWTVFFL-HKDSSQ-EEDDAERQAKESRRARRRRRRDRA...........KGI..IHES
E9DDS1_COCPS/90-249-MLP-----DQTHVR.SQ...DWTMFFL-HRDAGS-EDENEYGDDSQGQAEKAVDEA................K...EDS
F2TNB3_AJEDA/90-246-MLP-----DQTHVR.SQ...DWTIFFL-HKDAGS-EEENEYVEPTAGQQTEYNNIS....................QEN
Q0V5R0_PHANO/110-273-MLP-----DQAHMR.NQ...DWTIFFL-HKDTTA-EEEEREERRERRRKRRRRKEGLD.............DD...DTT
C4Y911_CLAL4/3-80-MLP-----DQIHKR.PE...DYTLFLL-YVNSLT-GKLQYQ......................................
Q75BQ9_ASHGO/49-219-MIP-----NGIENR.PGE.SDFTTFIL-YKDRYA-QTFQLF.......PNDNAKGSLKPTAESH.GHLGGSPS...SRL
A7TRE4_VANPO/73-251-MIP-----NNVEYT.PGK.KDFTVFML-YYNTST-KLYQLFKPSNIKTEVQKNDNDDNDDEENE.DGDGDDDS...EYI
C5DZH0_ZYGRC/8-97-MIP-----NNAEYN.TGDEPDTTVFML-YRNRET-VKYELF...............P...............S...KQ.
Q5KLM3_CRYNJ/72-162-MMT-----SSRAMR.............-......-.........................................GV.
A2Q8P4_ASPNC/82-239-MLP-----DQTHVR.SQ...DWTIFFL-HKDTSA-DADEDDASTGKKKKKKKSRIG....................DAE
A1CRY6_ASPCL/85-243-MLP-----DQTHVR.SQ...DWTIFFL-HKDTST-EEDEDGSAATKKKRRKRAPAD....................HDA
F0XQA1_GROCL/147-345-MLP-----DQTHLR.NQ...DWTMFFL-HKDTTP-EEEDQERLEKARRREKRRRKHGHVATTDNIKTTDGTETNGLSES
E9BZT8_CAPO3/13-108-MLP-----DGVHNR.EE...DWTIFFL-NQTAPE-............................................
Q6CGA4_YARLI/9-78-MLP-----DQSHVR.NQ...DWTIFFL-HDENGL-LKYRPND....KG...............................
C0SET4_PARBP/168-287-MLP-----DQTHVR.SQ...DWTIFFL-HKDAGS-EEEQECGDSSVDQQAGNSRIR....................QEN
Q7RXB5_NEUCR/122-235-MLP-----DQAHAR.NQ...DWTIFFL-HKDSSR-EEDEADRQAKEERRRRRKRRQDRE...........QGI..IHDQ
Q6CPS0_KLULA/28-197-MIP-----NSVENH.PGK.PDFTVFVL-YKNQNV-..YQLF.......PVSKNK..T..............KG...TDL
A6RVU6_BOTFB/70-232-MLP-----DQAHVR.NQ...DWTIFFL-HKDTSQ-DEEEAEEKAERRRLRKAKKEAR..............AA...LFE
C4R3J0_PICPG/6-86-LMP-----SQLQHS.MN..........-......-............................................
B8MHD8_TALSN/85-247-MLP-----DQTHVR.SQ...DWTIFFL-HKDTES-DDEDAERESPKRRRRRRRKQQTE.............IE...QES
A0C6F7_PARTE/1-175-MIP-----DGVHKI.KQ...DKFFFRI-GNVRFV-SGQVQTYHFDYQWKPLLQSSNQT............LSY...SDD
D8QBP3_SCHCM/66-137-.TS-----VRSSVVGDQ..........-......-............................................
Q23F93_TETTS/1-96-MLP-----DGVQKF.DN...DISVFKY-K.....-............................................
D2VRW9_NAEGR/60-245-MLP-----DGSHNC.IE...DTTVFFL-RGNNEI-NNNHHNENNTSASSLNNSNSGNNN..........SSIL...SNG
D3BKL1_POLPA/154-247-MLP-----DGAHNR.DA...DWTVFFL-NRPDPD-GIL.........................................
F0ZTU4_DICPU/95-230-MLP-----DGAHKR.ND...DWTVFFL-NRPVPE-NIKSPEKSKSSSSKSSQSPQSPS............KID......
B6HSJ1_PENCW/75-232-MLP-----DQTHVR.SQ...DWTMFFL-HKDTSG-DEETDSADGKKKKKRKSQYH.....................GNQ
D4AU15_ARTBC/26-120-HRQ-----QQQHQQ.QQ..........-......-............................................
C5DJD2_LACTC/29-192-MIP-----NSAESR.PDV.ADFTVFIL-YKDKYT-RNYHVF.......PIADSK..L..............PQ...NDA

PF02141

DEN5A_HUMAN/202-390-PVK.....EVFELL------GVENVFQLFTCALL.EFQILLY-------------------------------------
DEN5B_HUMAN/187-375-PLR.....EAFELL------GLENLVQVFTCVLL.EMQILLY-------------------------------------
Q0US70_PHANO/395-592-DIY.....ALFRCL------SIPNIVTLFEFVLS.ESRIILL-------------------------------------
Q0UM90_PHANO/167-348-AMW.....PLFTCL------SIPNIVGVIEAAVSPTRRIIFT-------------------------------------
Q54JA6_DICDI/110-305-SLHDGTLQPLIETL------SSQKLLHLFISLLF.ERRVIIY-------------------------------------
Q55DD7_DICDI/109-294-DYE......LIHKM------NPAHIIRLFEFAIT.ESRVILL-------------------------------------
Q08BI6_DANRE/181-363-DFR.....TLFRCL------SDDEVLEVFASTVL.ERRIIFI-------------------------------------
Q5U3I4_DANRE/164-346-DFT.....ALFSRL------NDEELLLVFTAAVL.ERRIIFI-------------------------------------
Q0VCJ3_BOVIN/149-333-DFR.....SLMRCL------SFEQILQIFASAVL.ERRVIFL-------------------------------------
Q6DF82_XENLA/149-333-DFN.....TLMQCL------KSQIILVIFASVVL.ERRIVFV-------------------------------------
DEN2C_HUMAN/586-770-DFK.....CLFKCL------SVCHLIRVCASLLL.ERRVIFV-------------------------------------
Q4T8M0_TETNG/323-507-DFE.....CLFSSL------SLRLLLRVFTSLLL.ERRVIFT-------------------------------------
Q5RHZ1_DANRE/778-962-DLE.....SLFNCL------SVRQVVRVFASLLL.ERRVIFV-------------------------------------
Q4SCC1_TETNG/127-311-DFD.....SLLQCL------SVDKLLQVFASILL.ERRVILI-------------------------------------
A7RR72_NEMVE/298-481-SYS.....AMLRHL------GPDNCLLLFYLILT.EHKILIH-------------------------------------
Q3U2K9_MOUSE/307-491-NFS.....SLLMNL------GPENCATLLLLVLL.ESKILLH-------------------------------------
DEN4B_MOUSE/313-497-SFL.....QLLQNL------GPELAITLLLAVLT.EHKLLVH-------------------------------------
A0PJS2_DANRE/305-489-SFV.....KLLQNL------GPENTCSLLLAVLT.EHKLLLH-------------------------------------
Q4SLY3_TETNG/383-567-SLS.....TLLLNL------GPKNAATLLVLAVT.EHKILVH-------------------------------------
Q7PWX7_ANOGA/311-495-GFR.....QLLSNL------GPENCLHVLLLVLT.EQKLLIH-------------------------------------
Q9W3D2_DROME/308-492-GFH.....ILLQNL------GTDNCLHVLLLALT.EQKILIH-------------------------------------
Q9TXV4_CAEEL/347-533-QLI.....DTLKYL------GSENLMYLMLLALL.EQKILIH-------------------------------------
MTMRD_HUMAN/116-298-SVA.....LLFQQL------GIQNVLSLFCAVLT.ENKVLFH-------------------------------------
Q4SZD9_TETNG/73-244-C.........FLIP------GIQNVLSLFCAVLT.EHKILFH-------------------------------------
A6PVH0_HUMAN/128-310-SVA.....LLFRQL------GITNVLSLFCAALT.EHKVLFL-------------------------------------
Q1LXZ0_DANRE/117-299-SVA.....QLFRQL------GIVNVLCLFCAALT.EHKILFL-------------------------------------
Q7KSP6_DROME/142-325-GVH.....FLFKQL------GIKNVLILLCSVMT.ENKILFL-------------------------------------
Q177S0_AEDAE/106-289-CVS.....LLFHQL------GIKNVMLLFCAVMT.EHKILFH-------------------------------------
Q4S7I6_TETNG/216-404-PLG.....EAFSLL------GVENMVKLLTCTLL.ETQILLY-------------------------------------
A7SZQ4_NEMVE/186-373-SLK.....EMFSWL------GVENVVELFTCVLL.EHQILLL-------------------------------------
Q54VP0_DICDI/908-1097-SYR.....MLFLSL------DIRNVLSLIKCLLL.EEKILII-------------------------------------
Q2GNY8_CHAGB/440-637-DIY.....ALFRCL------SLENIVLLLECAMS.EARIIFL-------------------------------------
A7EF60_SCLS1/465-662-DIY.....ALFRAL------SIPNIVALVEFMLS.ESRIILL-------------------------------------
Q0CL54_ASPTN/423-620-DLY.....ALFRTL------SLSNIVILFEYALT.ESRIIFL-------------------------------------
DENN_SCHPO/362-562-DLY.....PLFRAL------SIPNILVLFEAALM.EAKVIFL-------------------------------------
Q4RI35_TETNG/140-326-DLH.....LPFFCL------QPGQLLQVLSCLLQ.EQRIVLF-------------------------------------
DEND3_MOUSE/187-373-DLH.....LPLLCF------RPEKVLQILTCILT.EQRIVFF-------------------------------------
A1Z7Q5_DROME/98-283-NLN.....LYYNFV------EPKEMIAVFAAMLA.ERRIIFT-------------------------------------
Q7Q1I7_ANOGA/88-273-NLN.....QYYNFV------EPKFMIGIFAAMLA.ERRIIFV-------------------------------------
Q6DCI3_XENLA/89-270-NLT.....EFLVAV------QVDTMLHLYSSLLC.ERRILIT-------------------------------------

PF09794

Q7QF11_ANOGA/7-482-TCAL------------------ILGIASLHPELISKGFQQVACVKTSRPMSPMPTFSTPVEEQHGDAPPCRTTLPAIVT
Q29HH8_DROPS/14-480-MCVL------------------ILGMASLVPRLLEKGFQEVACVRTSRPLSPMPDFTDSLQREALALAAAEAEAEAATQ
Q6BP02_DEBHA/131-552-LTQF------------------QNNLISLIPNLINN.LGNSG.....................................
A5DNM6_PICGU/119-523-LTMF------------------QNNLISLVPNLIHN.LADSS.....................................
Q2H333_CHAGB/18-368-....------------------.................DSA.....................................
AVL9_PONAB/16-520-LVGA------------------LMTVLSLFPGMIEHGLSDCSQYRPRKSMSEDGGLQESNPCADDFVSASTADVSHTNL
Q4P7V8_USTMA/140-510-LCNY------------------QYSLVSLLPGLLLN.LQDAG.....................................
Q17GP2_AEDAE/7-476-TCAL------------------ILGVVSLHPELLSKGFQEVACVKTSRPMSPMPNFGTPLDETQKFPSEPTSP......
Q6C028_YARLI/516-899-LCTS------------------QFSLVSLIPNLINN.LQDCG.....................................
Q54NJ9_DICDI/6-452-VSEA------------------IMSVLSLHSKSYDL.LFSTN.....................................
A1CPG6_ASPCL/9-384-LCMI------------------QFSLISLIPGLINS.LQDCA.....................................
Q4SKV3_TETNG/13-521-LVGA------------------LMTVLSLFPGMIEHGLVDSSSYRPRNSLSEDSSLEESVSGAEEFVSVSVTDL.....
Q6FIU1_CANGA/8-406-LCNL------------------QFGLISLIPNLLSS.LQTSA.....................................
Q08D17_XENTR/21-516-LVGA------------------LMTVLSLFPGMIEHGLTDSSQYRPRKSMSEDIEYPLVTYSDDCTSLAASGLNAKQ..
Q6CKD3_KLULA/6-399-LCNI------------------QFAFISLIPCLLSN.IQDCG.....................................
Q750W9_ASHGO/13-401-LCSL------------------QFGFISLIPNLISN.LQDCG.....................................
Q5KDB3_CRYNJ/119-529-LCTY------------------QYSLVSLIPGLLLN.LRDSG.....................................
A6RFN4_AJECN/8-299-....------------------.........................................................
AVL9_YEAST/9-401-LCNL------------------QFGLISLIPDLMSN.LQDSG.....................................
A3LPG1_PICST/85-492-LTQF------------------QNNLISLIPNLINN.LDNSG.....................................
AVL9_SCHPO/10-367-LGNF------------------QYSLLSLIPCMMSH.LQDVS.....................................
Q5AIP1_CANAL/191-588-LTQF------------------QNNMLSLMPNLINN.LDDSG.....................................
A7TEK5_VANPO/8-400-LCNL------------------QFGLISLIPNLISN.LQNSG.....................................

PF09804

Q6C716_YARLI/3-239-ATSL................VYILGLLGASSDTLPE-.....-------------------------------------
YKE7_YEAST/33-335-CNSL................AYCVFLISMLPKNLIG-NHVSD-------------------------------------
Q6FLQ0_CANGA/9-288-TNSL................LYCLATISRNSKLNMG-NTGSK-------------------------------------
A7TLL1_VANPO/24-351-CNSL................VYCISLISLIHKKNMK-AKDEY-------------------------------------
Q75DG5_ASHGO/36-366-TNAL................TYCLSVLSLIPLQLER-KLAHA-------------------------------------
Q6CP43_KLULA/3-242-CNQL................CHLLTKMASLEGGTYC-NA...-------------------------------------
A5DGT1_PICGU/16-298-AGAF................TYLLSLISLISQDTET-IQSNI-------------------------------------
Q5A7K9_CANAL/8-279-ISSF................CYLISLLSVVPQEIDF-VE...-------------------------------------
B9WCZ6_CANDC/8-285-ISSF................CYLISLLSVVPQEIDF-ISQTS-------------------------------------
C5MJC0_CANTT/11-295-ISSY................CYLLSLLSIIPQDIEL-ISKTS-------------------------------------
A3LNE8_PICST/19-334-HSAF................TYLLSLISVIPHDIET-VSKDE-------------------------------------
Q6BJB8_DEBHA/28-311-SGAF................TYLLSLLSMIPNDIKI-YSDAL-------------------------------------
B8M2T3_TALSN/30-332-TCDY................VYALALLSSLPQSLSP-FFDQD-------------------------------------
A2QAY7_ASPNC/31-357-PCSYGMITIQSLSTNTYSQLVYDLSLLASLPNSLLP-LLPQN-------------------------------------
A1CNU9_ASPCL/30-339-PCNF..............DAVYDLSLLASLPYSLLP-LLPPA-------------------------------------
Q2UQJ8_ASPOR/30-340-PCNY................VYDLSLLASLPNSLVP-LLPPT-------------------------------------
Q5BF30_EMENI/30-339-PCNY................VYDLSLLASLPNSLLP-LLPSD-------------------------------------
F2PVM8_TRIEC/26-326-SCNF................IYNISLLSSLPQNLLS-LLPST-------------------------------------
E9CY67_COCPS/13-322-SCNF................VYDLALLSSLPQTLSP-FLPPT-------------------------------------
C0S3V5_PARBP/84-387-SCNF................VYDLSLLSSLPQSLAP-LLPST-------------------------------------
C0NKX7_AJECG/29-332-SCNF................VYDLALLSSLPQSLLP-LLPAT-------------------------------------
D5G5F9_TUBMM/21-341-ACNF................VYDISILSNIPLSVAD-LLSSE-------------------------------------
E3Q807_COLGM/29-348-ICNF................VYNISVLSNIPHTVTE-LLAPT-------------------------------------
E9F1A8_METAR/37-350-ICDF................VYDISILSNIPFSVAD-RLPPS-------------------------------------
C7YNX8_NECH7/29-347-ICDF................VYNISVLSNIPLSVTD-ILPTS-------------------------------------
B2AXI7_PODAN/33-356-VCNF................VYDISVLSNIPLSVCD-VIDPS-------------------------------------
A6RUI2_BOTFB/28-351-TCDF................VYDISILSNIPLAVSD-LLEPT-------------------------------------
Q0V1B2_PHANO/27-300-MCEF................VYILSILSSLSARDSE-LLLPG-------------------------------------
B3RV35_TRIAD/7-273-ACYR................VYCCSLLSSSSISLRE-SQ...-------------------------------------
LCHN_XENLA/61-326-VCYR................VYCCCCLANVTLPGIG-ATAPE-------------------------------------
LCHN_DANRE/114-382-VCYR................VYCCCCLANVSIPGMG-VSVPE-------------------------------------
B7QCC0_IXOSC/54-313-VCYR................VYCTSTLVAHVYPDIE-TCL..-------------------------------------
F2UE85_SALS5/10-285-QCQQ................VYACCALGSHTIASFA-HTQ..-------------------------------------
YBAG_SCHPO/6-296-LYSI................IDMIVRLSSIKRSSDA-SIPIL-------------------------------------
B6K728_SCHJY/9-263-ACTL................VDFAVETGRVSSEVND-ALARP-------------------------------------
Q5K7R2_CRYNJ/10-298-LSAL................AWNIWALSLPPRAALA-NGEAE-------------------------------------

PF08616

A0C6F7_PARTE/251-368NVCNL------------------VLSLCFLVSP....-.....-------------------------------------
A4I5V0_LEIIN/587-699.VCEA------------------ALSLGIIGNMLDRD-FMARK-------------------------------------
A5DM71_PICGU/279-393.IIDS------------------ILLALKLITG...G-GILTG-------------------------------------
A5DZ96_LODEL/271-385.IIDH------------------VLLLLKIVTG...G-GILSG-------------------------------------
A6ZNX6_YEAS7/345-470.LCAF------------------ILSLANITATY.AS-DPQSY-------------------------------------
A7TRE4_VANPO/376-503.LSHF------------------ILVLSNYVNSCFDC-DATTY-------------------------------------
A8PX95_MALGO/354-466.VVEH------------------VLAACALVSG..CG-AVLRG-------------------------------------
B0D0E4_LACBS/418-530.VSSF------------------VLSACALGSG..CG-AVLRG-------------------------------------
C3ZXT1_BRAFL/180-291.CSET------------------VLALTSMISPLNFC-SDF..-------------------------------------
C4R3J0_PICPG/305-418.LLEF------------------IMAYFIIVE....N-FMSTD-------------------------------------
C4Y911_CLAL4/255-369.IIDH------------------ILLALKIITG...G-GILTG-------------------------------------
C4YQL5_CANAW/259-373.IIDH------------------ILLTLKIITG...G-GILSG-------------------------------------
C5DJD2_LACTC/316-435.LCQF------------------ILSLSNFIK....H-FDFHY-------------------------------------
C5DZH0_ZYGRC/269-391.LSQF------------------AIALSNLMGL...T-NGTRS-------------------------------------
D2VRW9_NAEGR/366-475.VVNT------------------LLSSLVMFPFLHDL-LKKRT-------------------------------------
D2W4R6_NAEGR/470-587.VSQI------------------CLTLPLLIYP....-.....-------------------------------------
YG76_SCHPO/259-372.LADF------------------VLSSCALVSG..AT-GLLQG-------------------------------------
Q23F93_TETTS/358-465.CVNF------------------ASSIQLLALP....-.....-------------------------------------
Q2URL2_ASPOR/377-488.VAEA------------------VLAACALAS....G-GILRG-------------------------------------
Q4DMT0_TRYCC/444-555.VCEA------------------ALSLGLIGNLLDPH-FVTKK-------------------------------------
Q4P9F2_USTMA/366-478.VAGF------------------VLAACALGSG..CG-AVLQG-------------------------------------
Q55D43_DICDI/566-679.ICNY------------------VLAACSMVCPPLKG-TRERC-------------------------------------
Q55YB7_CRYNB/357-470.VARM------------------VLAACALGSG..CG-QVLRG-------------------------------------
Q6BI40_DEBHA/264-378.IINN------------------ILLMLKIITG...G-GILSG-------------------------------------
Q6CGA4_YARLI/272-384.VADH------------------VLAACFLASG...G-GILRG-------------------------------------
Q6CPS0_KLULA/322-444.LCQF------------------VLALSNLIN....G-FSSEY-------------------------------------
Q75BQ9_ASHGO/342-464.LCQF------------------VLALSNFINA...F-DHQHY-------------------------------------

PF07792

MESA_EMENI/79-241RVRSSSGDEGTSADT.............NNESEVTEEEESSDE-------------------------------------
E7KUE5_YEASL/26-218NHQDAKNNRYTIVLE..............DDELECQEVQNNQN-------------------------------------
B2AXK1_PODAN/123-294DDEDDGGEEDLDDDD..............DDWDDDVSTDEEPE-------------------------------------
E9DDS1_COCPS/90-249QDGHDQTEDEEA....................TDDDGDDDDEE-------------------------------------
F2TNB3_AJEDA/90-246EGLNDDSSEAS......................VVDEDEEDDE-------------------------------------
Q0V5R0_PHANO/110-273AGDELEGADDAE...................EDDYDTESEDEP-------------------------------------
C4Y911_CLAL4/3-80...........................................-------------------------------------
Q75BQ9_ASHGO/49-219ESMILEEDE.........................NAGSSKTSL-------------------------------------
A7TRE4_VANPO/73-251DSEIFTD..............................AKDEND-------------------------------------
C5DZH0_ZYGRC/8-97...........................................-------------------------------------
Q5KLM3_CRYNJ/72-162...........................................-------------------------------------
A2Q8P4_ASPNC/82-239SGDGDSEDVGG.....................STEEESSDEEE-------------------------------------
A1CRY6_ASPCL/85-243GDDSQEEDTDAL....................TEESSDEDEDD-------------------------------------
F0XQA1_GROCL/147-345DADNEEAPEKDKDADDNDNDDYDDDDDDDDEDEDSMSTDSEPE-------------------------------------
E9BZT8_CAPO3/13-108...........................................-------------------------------------
Q6CGA4_YARLI/9-78...........................................-------------------------------------
C0SET4_PARBP/168-287EGLNDGGSEVSV...................GDEDEIEDEDEE-------------------------------------
Q7RXB5_NEUCR/122-235ER........................................C-------------------------------------
Q6CPS0_KLULA/28-197DSSLIIEEEDFEEEQE...........NGLRSGKIGSIRDDRH-------------------------------------
A6RVU6_BOTFB/70-232SGNVDPLERVEG...................SEEDSSEEDEPE-------------------------------------
C4R3J0_PICPG/6-86...........................................-------------------------------------
B8MHD8_TALSN/85-247DADSNNDEDDQS....................DAAESTDDEED-------------------------------------
A0C6F7_PARTE/1-175NVLKIRGEKESEWLDINLSN....AQIHVISHDFVSITLNPDL-------------------------------------
D8QBP3_SCHCM/66-137...........................................-------------------------------------
Q23F93_TETTS/1-96...........................................-------------------------------------
D2VRW9_NAEGR/60-245SNDGGEEAKSSPRNSQEVVE....KVDLNTSLESTILSSDQVI-------------------------------------
D3BKL1_POLPA/154-247...........................................-------------------------------------
F0ZTU4_DICPU/95-230...........................................-------------------------------------
B6HSJ1_PENCW/75-232AGADIQDEYLDD....................ISDDPDSSDDE-------------------------------------
D4AU15_ARTBC/26-120...........................................-------------------------------------
C5DJD2_LACTC/29-192RSPTILEEDEPQ...................SGLAGEASTNHN-------------------------------------

PF02141

DEN5A_HUMAN/202-390---------------------SQHYQRLMTVAETITA-------------------------------------------
DEN5B_HUMAN/187-375---------------------SQDYQRLMTVAEGITT-------------------------------------------
Q0US70_PHANO/395-592---------------------SSHTAMLHLASMAIVN-------------------------------------------
Q0UM90_PHANO/167-348---------------------SHYPAMLTIAAETVRF-------------------------------------------
Q54JA6_DICDI/110-305---------------------SENINRVSKFINAIVS-------------------------------------------
Q55DD7_DICDI/109-294---------------------SKDISVVSNGILALSS-------------------------------------------
Q08BI6_DANRE/181-363---------------------AEELGTLSQVIHAVAV-------------------------------------------
Q5U3I4_DANRE/164-346---------------------SEELSTLSQVLHAVAA-------------------------------------------
Q0VCJ3_BOVIN/149-333---------------------AEGLSTLSQCIHATAA-------------------------------------------
Q6DF82_XENLA/149-333---------------------ASDLRILSECIHAVVA-------------------------------------------
DEN2C_HUMAN/586-770---------------------ANSLSTLSKCGHAVVA-------------------------------------------
Q4T8M0_TETNG/323-507---------------------ADKLSTLSQCCHAIVA-------------------------------------------
Q5RHZ1_DANRE/778-962---------------------ADKLSTLSSCVHAVVA-------------------------------------------
Q4SCC1_TETNG/127-311---------------------ADKLSVLSRCCHAVLA-------------------------------------------
A7RR72_NEMVE/298-481---------------------SLRPALLTSVAEALTN-------------------------------------------
Q3U2K9_MOUSE/307-491---------------------SLRPAVLTGVAEAVVA-------------------------------------------
DEN4B_MOUSE/313-497---------------------SLRPDLLTSVCEALVS-------------------------------------------
A0PJS2_DANRE/305-489---------------------SLRPDVLTSVSEALLS-------------------------------------------
Q4SLY3_TETNG/383-567---------------------SLRPAVLTSVTEALVS-------------------------------------------
Q7PWX7_ANOGA/311-495---------------------SLRPAILTAVAEAVSS-------------------------------------------
Q9W3D2_DROME/308-492---------------------SLRPATLTAVAEAIVS-------------------------------------------
Q9TXV4_CAEEL/347-533---------------------SLRPWMLAAVAESVCA-------------------------------------------
MTMRD_HUMAN/116-298---------------------SASFQRLSDACRALES-------------------------------------------
Q4SZD9_TETNG/73-244---------------------SRSYQRLGEACRALEA-------------------------------------------
A6PVH0_HUMAN/128-310---------------------SRSYQRLADACRGLLA-------------------------------------------
Q1LXZ0_DANRE/117-299---------------------SSSYQRLTDACRALLA-------------------------------------------
Q7KSP6_DROME/142-325---------------------SKCYWHLTDSCRALVA-------------------------------------------
Q177S0_AEDAE/106-289---------------------STSYSRLTDSCRALTA-------------------------------------------
Q4S7I6_TETNG/216-404---------------------SQDYQRLMTVSESVTT-------------------------------------------
A7SZQ4_NEMVE/186-373---------------------SNSFHRFMLVAEGVVT-------------------------------------------
Q54VP0_DICDI/908-1097---------------------SSQYTLLTYICEIITT-------------------------------------------
Q2GNY8_CHAGB/440-637---------------------SSHTGMLHLACHALAN-------------------------------------------
A7EF60_SCLS1/465-662---------------------SSHTAMLHLASKALVS-------------------------------------------
Q0CL54_ASPTN/423-620---------------------SSHTSMLYLATRALVD-------------------------------------------
DENN_SCHPO/362-562---------------------SENLGMLGYASQALLH-------------------------------------------
Q4RI35_TETNG/140-326---------------------SADFARLTLVAESFLL-------------------------------------------
DEND3_MOUSE/187-373---------------------SSDWALLTLMAECFVA-------------------------------------------
A1Z7Q5_DROME/98-283---------------------SRHLDRLSSCIQAANA-------------------------------------------
Q7Q1I7_ANOGA/88-273---------------------SRRLDILSSCVQAANA-------------------------------------------
Q6DCI3_XENLA/89-270---------------------SSKLSTLTACVHASAA-------------------------------------------

PF09794

Q7QF11_ANOGA/7-482EQEAPHEPIAPCREADELLTDPDGRSIASAKEAALEETTTSSSSSSSPSSGSSMEAAGGGDGAGPNARAAVALLRETSVD
Q29HH8_DROPS/14-480D...........................EPKLTPESATAAEGEAEDLALVSSAASAGSQCSGDTSPHSTPNSQDLN..FA
Q6BP02_DEBHA/131-552..................................................................CPLSDFIETNGPLT
A5DNM6_PICGU/119-523..................................................................CPLIDYSETNGPLK
Q2H333_CHAGB/18-368..................................................................GPELDNYEKG..LS
AVL9_PONAB/16-520GTVR....................KVIAGNHGEDAAMKTEEPLFQVEDSSKGQEPNDTNQYLKPPSRPSPDSSESDWETL
Q4P7V8_USTMA/140-510..................................................................DPSLHTRAGR..VE
Q17GP2_AEDAE/7-476..................................VKECISGDTDPQGESSGSASSTAQQMQHSQDTDSGSTSTTREITPC
Q6C028_YARLI/516-899..................................................................SPLLHSYELG..LT
Q54NJ9_DICDI/6-452..................................................................QSISNDFQIDWTTS
A1CPG6_ASPCL/9-384..................................................................DPSADSYEQT..VK
Q4SKV3_TETNG/13-521.................................DNAALQGSGRPAAENRSSGNGAEGDNHLLKPPARTSPESGDSDWETL
Q6FIU1_CANGA/8-406..................................................................SPVLSNSYEN..VT
Q08D17_XENTR/21-516..............................ENQGPNRNTENSKIDTLLCEHEADTNGSIEKLKPPSHTSPESVESDWETL
Q6CKD3_KLULA/6-399..................................................................SPMLDTYSKN..MT
Q750W9_ASHGO/13-401..................................................................SPLLNKYERQ..LT
Q5KDB3_CRYNJ/119-529..................................................................SPALEQKRSK...V
A6RFN4_AJECN/8-299................................................................................
AVL9_YEAST/9-401..................................................................SPQLFQDISK..LN
A3LPG1_PICST/85-492..................................................................CPLIDYVETNGPLA
AVL9_SCHPO/10-367..................................................................SPSAHSLEKS..LH
Q5AIP1_CANAL/191-588..................................................................CPLIDYAETNGPLS
A7TEK5_VANPO/8-400..................................................................SPMLHKDVSD..IK

PF09804

Q6C716_YARLI/3-239--------------------------------------------------------------------------------
YKE7_YEAST/33-335--------------------------------------------------------------------------------
Q6FLQ0_CANGA/9-288--------------------------------------------------------------------------------
A7TLL1_VANPO/24-351--------------------------------------------------------------------------------
Q75DG5_ASHGO/36-366--------------------------------------------------------------------------------
Q6CP43_KLULA/3-242--------------------------------------------------------------------------------
A5DGT1_PICGU/16-298--------------------------------------------------------------------------------
Q5A7K9_CANAL/8-279--------------------------------------------------------------------------------
B9WCZ6_CANDC/8-285--------------------------------------------------------------------------------
C5MJC0_CANTT/11-295--------------------------------------------------------------------------------
A3LNE8_PICST/19-334--------------------------------------------------------------------------------
Q6BJB8_DEBHA/28-311--------------------------------------------------------------------------------
B8M2T3_TALSN/30-332--------------------------------------------------------------------------------
A2QAY7_ASPNC/31-357--------------------------------------------------------------------------------
A1CNU9_ASPCL/30-339--------------------------------------------------------------------------------
Q2UQJ8_ASPOR/30-340--------------------------------------------------------------------------------
Q5BF30_EMENI/30-339--------------------------------------------------------------------------------
F2PVM8_TRIEC/26-326--------------------------------------------------------------------------------
E9CY67_COCPS/13-322--------------------------------------------------------------------------------
C0S3V5_PARBP/84-387--------------------------------------------------------------------------------
C0NKX7_AJECG/29-332--------------------------------------------------------------------------------
D5G5F9_TUBMM/21-341--------------------------------------------------------------------------------
E3Q807_COLGM/29-348--------------------------------------------------------------------------------
E9F1A8_METAR/37-350--------------------------------------------------------------------------------
C7YNX8_NECH7/29-347--------------------------------------------------------------------------------
B2AXI7_PODAN/33-356--------------------------------------------------------------------------------
A6RUI2_BOTFB/28-351--------------------------------------------------------------------------------
Q0V1B2_PHANO/27-300--------------------------------------------------------------------------------
B3RV35_TRIAD/7-273--------------------------------------------------------------------------------
LCHN_XENLA/61-326--------------------------------------------------------------------------------
LCHN_DANRE/114-382--------------------------------------------------------------------------------
B7QCC0_IXOSC/54-313--------------------------------------------------------------------------------
F2UE85_SALS5/10-285--------------------------------------------------------------------------------
YBAG_SCHPO/6-296--------------------------------------------------------------------------------
B6K728_SCHJY/9-263--------------------------------------------------------------------------------
Q5K7R2_CRYNJ/10-298--------------------------------------------------------------------------------

PF08616

A0C6F7_PARTE/251-368--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A6ZNX6_YEAS7/345-470--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_PICPG/305-418--------------------------------------------------------------------------------
C4Y911_CLAL4/255-369--------------------------------------------------------------------------------
C4YQL5_CANAW/259-373--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
YG76_SCHPO/259-372--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
Q4P9F2_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q55YB7_CRYNB/357-470--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------

PF07792

MESA_EMENI/79-241--------------------------------------------------------------------------------
E7KUE5_YEASL/26-218--------------------------------------------------------------------------------
B2AXK1_PODAN/123-294--------------------------------------------------------------------------------
E9DDS1_COCPS/90-249--------------------------------------------------------------------------------
F2TNB3_AJEDA/90-246--------------------------------------------------------------------------------
Q0V5R0_PHANO/110-273--------------------------------------------------------------------------------
C4Y911_CLAL4/3-80--------------------------------------------------------------------------------
Q75BQ9_ASHGO/49-219--------------------------------------------------------------------------------
A7TRE4_VANPO/73-251--------------------------------------------------------------------------------
C5DZH0_ZYGRC/8-97--------------------------------------------------------------------------------
Q5KLM3_CRYNJ/72-162--------------------------------------------------------------------------------
A2Q8P4_ASPNC/82-239--------------------------------------------------------------------------------
A1CRY6_ASPCL/85-243--------------------------------------------------------------------------------
F0XQA1_GROCL/147-345--------------------------------------------------------------------------------
E9BZT8_CAPO3/13-108--------------------------------------------------------------------------------
Q6CGA4_YARLI/9-78--------------------------------------------------------------------------------
C0SET4_PARBP/168-287--------------------------------------------------------------------------------
Q7RXB5_NEUCR/122-235--------------------------------------------------------------------------------
Q6CPS0_KLULA/28-197--------------------------------------------------------------------------------
A6RVU6_BOTFB/70-232--------------------------------------------------------------------------------
C4R3J0_PICPG/6-86--------------------------------------------------------------------------------
B8MHD8_TALSN/85-247--------------------------------------------------------------------------------
A0C6F7_PARTE/1-175--------------------------------------------------------------------------------
D8QBP3_SCHCM/66-137--------------------------------------------------------------------------------
Q23F93_TETTS/1-96--------------------------------------------------------------------------------
D2VRW9_NAEGR/60-245--------------------------------------------------------------------------------
D3BKL1_POLPA/154-247--------------------------------------------------------------------------------
F0ZTU4_DICPU/95-230--------------------------------------------------------------------------------
B6HSJ1_PENCW/75-232--------------------------------------------------------------------------------
D4AU15_ARTBC/26-120--------------------------------------------------------------------------------
C5DJD2_LACTC/29-192--------------------------------------------------------------------------------

PF02141

DEN5A_HUMAN/202-390--------------------------------------------------------------------------------
DEN5B_HUMAN/187-375--------------------------------------------------------------------------------
Q0US70_PHANO/395-592--------------------------------------------------------------------------------
Q0UM90_PHANO/167-348--------------------------------------------------------------------------------
Q54JA6_DICDI/110-305--------------------------------------------------------------------------------
Q55DD7_DICDI/109-294--------------------------------------------------------------------------------
Q08BI6_DANRE/181-363--------------------------------------------------------------------------------
Q5U3I4_DANRE/164-346--------------------------------------------------------------------------------
Q0VCJ3_BOVIN/149-333--------------------------------------------------------------------------------
Q6DF82_XENLA/149-333--------------------------------------------------------------------------------
DEN2C_HUMAN/586-770--------------------------------------------------------------------------------
Q4T8M0_TETNG/323-507--------------------------------------------------------------------------------
Q5RHZ1_DANRE/778-962--------------------------------------------------------------------------------
Q4SCC1_TETNG/127-311--------------------------------------------------------------------------------
A7RR72_NEMVE/298-481--------------------------------------------------------------------------------
Q3U2K9_MOUSE/307-491--------------------------------------------------------------------------------
DEN4B_MOUSE/313-497--------------------------------------------------------------------------------
A0PJS2_DANRE/305-489--------------------------------------------------------------------------------
Q4SLY3_TETNG/383-567--------------------------------------------------------------------------------
Q7PWX7_ANOGA/311-495--------------------------------------------------------------------------------
Q9W3D2_DROME/308-492--------------------------------------------------------------------------------
Q9TXV4_CAEEL/347-533--------------------------------------------------------------------------------
MTMRD_HUMAN/116-298--------------------------------------------------------------------------------
Q4SZD9_TETNG/73-244--------------------------------------------------------------------------------
A6PVH0_HUMAN/128-310--------------------------------------------------------------------------------
Q1LXZ0_DANRE/117-299--------------------------------------------------------------------------------
Q7KSP6_DROME/142-325--------------------------------------------------------------------------------
Q177S0_AEDAE/106-289--------------------------------------------------------------------------------
Q4S7I6_TETNG/216-404--------------------------------------------------------------------------------
A7SZQ4_NEMVE/186-373--------------------------------------------------------------------------------
Q54VP0_DICDI/908-1097--------------------------------------------------------------------------------
Q2GNY8_CHAGB/440-637--------------------------------------------------------------------------------
A7EF60_SCLS1/465-662--------------------------------------------------------------------------------
Q0CL54_ASPTN/423-620--------------------------------------------------------------------------------
DENN_SCHPO/362-562--------------------------------------------------------------------------------
Q4RI35_TETNG/140-326--------------------------------------------------------------------------------
DEND3_MOUSE/187-373--------------------------------------------------------------------------------
A1Z7Q5_DROME/98-283--------------------------------------------------------------------------------
Q7Q1I7_ANOGA/88-273--------------------------------------------------------------------------------
Q6DCI3_XENLA/89-270--------------------------------------------------------------------------------

PF09794

Q7QF11_ANOGA/7-482TIASNFSSLYAI................................................EPSEWGAPLRIFH.......
Q29HH8_DROPS/14-480SSSSHRESNGRNSSLTREASVDT..........................LASNLAALCSVNPDEYRAPVSIFA.......
Q6BP02_DEBHA/131-552KPNSLNTSSRQS................................................MLRFFGLPLQVFN.......
A5DNM6_PICGU/119-523KPESLNTSSRQS................................................MLRFFGLPLQIFN.......
Q2H333_CHAGB/18-368MPTSLRTSDRNS................................................LLSYMGLPLQIFG.......
AVL9_PONAB/16-520DPSVLEDPNSKEREQLGSDQTNLFPKDSVPSESL...PITVQPQANTGQVVLIPGLISGLEEDQYGMPLAIFT.......
Q4P7V8_USTMA/140-510AADSLRSSDRKS................................................LLKFLGMPLDIFG.......
Q17GP2_AEDAE/7-476SDDAQLGSLEDAAVGRNGTNNARPALAR...............ETSVDTIASNFSSLCAIKPEEWMAPLKIFH.......
Q6C028_YARLI/516-899RATSLKTSDRQS................................................LLNFMGLPLMVFG.......
Q54NJ9_DICDI/6-452TSEEM.......................................................VLNQLGLPIPLFNDGKDNNT
A1CPG6_ASPCL/9-384KPTSLKTSDRAS................................................LLAYMGLPLQIFG.......
Q4SKV3_TETNG/13-521DPSVLEEGGTKEAAGDDQRDAAFDPNPETPIT........VQPQAVSGQGGLVQGLVSGLEEDQYGLPLPIFT.......
Q6FIU1_CANGA/8-406VADSFKSSDRLS................................................VLKFLGFPLHIFE.......
Q08D17_XENTR/21-516DPSILEECISRDEEVIWSTAPEHPDLLPTDTISSGSAPITVQPQSNTGQSVYIPGLISGLEEDQYGMPLAIFT.......
Q6CKD3_KLULA/6-399MVNSFKSSDRGS................................................VLRFLGFPLQIFT.......
Q750W9_ASHGO/13-401ACDSFKSSDRRS................................................VIRFLGFPLQIFA.......
Q5KDB3_CRYNJ/119-529RPTSLRTSDRTS................................................LLRFMGLPLRIFS.......
A6RFN4_AJECN/8-299............................................................VLAYMGLPLQIFG.......
AVL9_YEAST/9-401VVDSFKSSNRES................................................VLRFLGFPLPIFE.......
A3LPG1_PICST/85-492KPNSLNTTNRRS................................................MLRFFGLPLQIFN.......
AVL9_SCHPO/10-367KPASLQTSDKRS................................................LLAYTGFPLIIFG.......
Q5AIP1_CANAL/191-588KPQSLNTTNRVS................................................MLRFFGLPLQIFN.......
A7TEK5_VANPO/8-400VVTSFKSSDRAS................................................VLTFMGFPLHIFE.......

PF09804

Q6C716_YARLI/3-239------------------------------------------------------------.......LNLQYN-------
YKE7_YEAST/33-335------------------------------------------------------------.....EYIKPIFT-------
Q6FLQ0_CANGA/9-288------------------------------------------------------------....GSYIPTLFT-------
A7TLL1_VANPO/24-351------------------------------------------------------------....DDFISPLFT-------
Q75DG5_ASHGO/36-366------------------------------------------------------------....NMPLQTLYT-------
Q6CP43_KLULA/3-242------------------------------------------------------------...........MT-------
A5DGT1_PICGU/16-298------------------------------------------------------------....VSMSQPIYN-------
Q5A7K9_CANAL/8-279------------------------------------------------------------...TPTYSQPVYQ-------
B9WCZ6_CANDC/8-285------------------------------------------------------------...VPTYSQPVYQ-------
C5MJC0_CANTT/11-295------------------------------------------------------------...AATYSQPVYH-------
A3LNE8_PICST/19-334------------------------------------------------------------..KKHSYSQPIYN-------
Q6BJB8_DEBHA/28-311------------------------------------------------------------.....TYSQPLYN-------
B8M2T3_TALSN/30-332------------------------------------------------------------.GAPPLRPRPIFN-------
A2QAY7_ASPNC/31-357------------------------------------------------------------.GLPSPRPRPLFN-------
A1CNU9_ASPCL/30-339------------------------------------------------------------.GSPPPRPRPLFN-------
Q2UQJ8_ASPOR/30-340------------------------------------------------------------.GIPSLRPRPLFN-------
Q5BF30_EMENI/30-339------------------------------------------------------------.RLLSLRPRALFN-------
F2PVM8_TRIEC/26-326------------------------------------------------------------KDIPSFRPRPLFN-------
E9CY67_COCPS/13-322------------------------------------------------------------.DLPAFRPRALFN-------
C0S3V5_PARBP/84-387------------------------------------------------------------.ALPSLRPRPMFS-------
C0NKX7_AJECG/29-332------------------------------------------------------------.ASAALRPRPLFS-------
D5G5F9_TUBMM/21-341------------------------------------------------------------....PSRLRPLFS-------
E3Q807_COLGM/29-348------------------------------------------------------------..SSSQRLRPLFT-------
E9F1A8_METAR/37-350------------------------------------------------------------..SPTPRLRPLFT-------
C7YNX8_NECH7/29-347------------------------------------------------------------..SSTQRLRPLFS-------
B2AXI7_PODAN/33-356------------------------------------------------------------..APVQRLRPLFT-------
A6RUI2_BOTFB/28-351------------------------------------------------------------..APPQRLRPLFS-------
Q0V1B2_PHANO/27-300------------------------------------------------------------.AEALLRLPSLFS-------
B3RV35_TRIAD/7-273------------------------------------------------------------.......TQPQFY-------
LCHN_XENLA/61-326------------------------------------------------------------.......SKPFFY-------
LCHN_DANRE/114-382------------------------------------------------------------.......FRPFFY-------
B7QCC0_IXOSC/54-313------------------------------------------------------------.......CPPNFY-------
F2UE85_SALS5/10-285------------------------------------------------------------.......ARPFLY-------
YBAG_SCHPO/6-296------------------------------------------------------------....LSDLHPFYS-------
B6K728_SCHJY/9-263------------------------------------------------------------....VRSSYPLYV-------
Q5K7R2_CRYNJ/10-298------------------------------------------------------------......ISEYLGN-------

PF08616

A0C6F7_PARTE/251-368------------------------------------------------------------.............-------
A4I5V0_LEIIN/587-699------------------------------------------------------------V.......FPY..-------
A5DM71_PICGU/279-393------------------------------------------------------------FFSNYN.IFPM..-------
A5DZ96_LODEL/271-385------------------------------------------------------------LLTNYN.VFPI..-------
A6ZNX6_YEAS7/345-470------------------------------------------------------------FKGNAALIFPY..-------
A7TRE4_VANPO/376-503------------------------------------------------------------YKQNSILIFPY..-------
A8PX95_MALGO/354-466------------------------------------------------------------FVASS...IPY..-------
B0D0E4_LACBS/418-530------------------------------------------------------------FVERS...FPY..-------
C3ZXT1_BRAFL/180-291------------------------------------------------------------........RPYFT-------
C4R3J0_PICPG/305-418------------------------------------------------------------SPCTTDHLYPY..-------
C4Y911_CLAL4/255-369------------------------------------------------------------FLTSYN.VFPI..-------
C4YQL5_CANAW/259-373------------------------------------------------------------ILTNYN.VFPM..-------
C5DJD2_LACTC/316-435------------------------------------------------------------FENAQVIIFPY..-------
C5DZH0_ZYGRC/269-391------------------------------------------------------------FSNKPCLTLPF..-------
D2VRW9_NAEGR/366-475------------------------------------------------------------........FPY..-------
D2W4R6_NAEGR/470-587------------------------------------------------------------FQYNVNRVHPY..-------
YG76_SCHPO/259-372------------------------------------------------------------LTRIT...FPY..-------
Q23F93_TETTS/358-465------------------------------------------------------------.............-------
Q2URL2_ASPOR/377-488------------------------------------------------------------FTRHA...FPY..-------
Q4DMT0_TRYCC/444-555------------------------------------------------------------V.......FPY..-------
Q4P9F2_USTMA/366-478------------------------------------------------------------FAARA...FPY..-------
Q55D43_DICDI/566-679------------------------------------------------------------........FPN..-------
Q55YB7_CRYNB/357-470------------------------------------------------------------MTECA...FPY..-------
Q6BI40_DEBHA/264-378------------------------------------------------------------LLTNYN.IFPI..-------
Q6CGA4_YARLI/272-384------------------------------------------------------------FTRYA...FPY..-------
Q6CPS0_KLULA/322-444------------------------------------------------------------FDNSSICIFPY..-------
Q75BQ9_ASHGO/342-464------------------------------------------------------------FQNSSVIIFPY..-------

PF07792

MESA_EMENI/79-241------------------------------------------------------------EDGGEG.PPLMYV-------
E7KUE5_YEASL/26-218------------------------------------------------------------AIDN...E.PLFF-------
B2AXK1_PODAN/123-294------------------------------------------------------------GGEG...PPLVYV-------
E9DDS1_COCPS/90-249------------------------------------------------------------AGDG...PPLMYV-------
F2TNB3_AJEDA/90-246------------------------------------------------------------NGEG...PPLMYV-------
Q0V5R0_PHANO/110-273------------------------------------------------------------DPDG...PPLVYV-------
C4Y911_CLAL4/3-80------------------------------------------------------------.............-------
Q75BQ9_ASHGO/49-219------------------------------------------------------------SQAR...EIPLFF-------
A7TRE4_VANPO/73-251------------------------------------------------------------NLDD...IDTLYF-------
C5DZH0_ZYGRC/8-97------------------------------------------------------------.VDQ.........-------
Q5KLM3_CRYNJ/72-162------------------------------------------------------------..AG...GGLLYV-------
A2Q8P4_ASPNC/82-239------------------------------------------------------------GGEG...PPLMYV-------
A1CRY6_ASPCL/85-243------------------------------------------------------------GGEG...PPLMYV-------
F0XQA1_GROCL/147-345------------------------------------------------------------GGEG...APLIYV-------
E9BZT8_CAPO3/13-108------------------------------------------------------------.............-------
Q6CGA4_YARLI/9-78------------------------------------------------------------.............-------
C0SET4_PARBP/168-287------------------------------------------------------------NGEG...PPLIYI-------
Q7RXB5_NEUCR/122-235------------------------------------------------------------SGKG.........-------
Q6CPS0_KLULA/28-197------------------------------------------------------------LEET...EPPLFF-------
A6RVU6_BOTFB/70-232------------------------------------------------------------GGEG...PPLIYV-------
C4R3J0_PICPG/6-86------------------------------------------------------------.......RESITV-------
B8MHD8_TALSN/85-247------------------------------------------------------------SGEG...PPLMYV-------
A0C6F7_PARTE/1-175------------------------------------------------------------IYGIKGKFTQDYY-------
D8QBP3_SCHCM/66-137------------------------------------------------------------.......PDLLCV-------
Q23F93_TETTS/1-96------------------------------------------------------------.............-------
D2VRW9_NAEGR/60-245------------------------------------------------------------TEQSKKEEIFYYV-------
D3BKL1_POLPA/154-247------------------------------------------------------------.............-------
F0ZTU4_DICPU/95-230------------------------------------------------------------.......TNNNNN-------
B6HSJ1_PENCW/75-232------------------------------------------------------------GGEG...PPLMYV-------
D4AU15_ARTBC/26-120------------------------------------------------------------.......QESKQE-------
C5DJD2_LACTC/29-192------------------------------------------------------------ADTK...EPPLFF-------

PF02141

DEN5A_HUMAN/202-390------------------------------------------------------------LMFPFQWQHVY---------
DEN5B_HUMAN/187-375------------------------------------------------------------LLFPFQWQHVY---------
Q0US70_PHANO/395-592------------------------------------------------------------LLYPFQWAGVF---------
Q0UM90_PHANO/167-348------------------------------------------------------------CVRVYEWSGLY---------
Q54JA6_DICDI/110-305------------------------------------------------------------LLDPFAWQHIF---------
Q55DD7_DICDI/109-294------------------------------------------------------------LLSPLVWQHIF---------
Q08BI6_DANRE/181-363------------------------------------------------------------LLYPFIWQHTL---------
Q5U3I4_DANRE/164-346------------------------------------------------------------LLYPFVWQHTF---------
Q0VCJ3_BOVIN/149-333------------------------------------------------------------LLYPFSWAHTY---------
Q6DF82_XENLA/149-333------------------------------------------------------------LLYPFAWEHTY---------
DEN2C_HUMAN/586-770------------------------------------------------------------TLYPFTWQHTY---------
Q4T8M0_TETNG/323-507------------------------------------------------------------LLYPFTWQHTY---------
Q5RHZ1_DANRE/778-962------------------------------------------------------------LLYPFSWQHTF---------
Q4SCC1_TETNG/127-311------------------------------------------------------------LLYPFTWQHTF---------
A7RR72_NEMVE/298-481------------------------------------------------------------VLFPFTWQCPY---------
Q3U2K9_MOUSE/307-491------------------------------------------------------------MIFPFQWQCPY---------
DEN4B_MOUSE/313-497------------------------------------------------------------MIFPLHWQCPY---------
A0PJS2_DANRE/305-489------------------------------------------------------------MTFPLRWHCPY---------
Q4SLY3_TETNG/383-567------------------------------------------------------------MIFPFHWPCPY---------
Q7PWX7_ANOGA/311-495------------------------------------------------------------FLFPFKWQCPY---------
Q9W3D2_DROME/308-492------------------------------------------------------------LLFPFKWQCPY---------
Q9TXV4_CAEEL/347-533------------------------------------------------------------LMFPFHWQCPY---------
MTMRD_HUMAN/116-298------------------------------------------------------------LMFPLKYSYPY---------
Q4SZD9_TETNG/73-244------------------------------------------------------------LMFPLKYSYPY---------
A6PVH0_HUMAN/128-310------------------------------------------------------------LLFPLRYSFTY---------
Q1LXZ0_DANRE/117-299------------------------------------------------------------IMFPLKYSFTY---------
Q7KSP6_DROME/142-325------------------------------------------------------------LMYPFRYTHVY---------
Q177S0_AEDAE/106-289------------------------------------------------------------LMYPFRYSHVY---------
Q4S7I6_TETNG/216-404------------------------------------------------------------LLFPFQWQHIY---------
A7SZQ4_NEMVE/186-373------------------------------------------------------------LIFPFIWQHVY---------
Q54VP0_DICDI/908-1097------------------------------------------------------------LIHPLVYTHIY---------
Q2GNY8_CHAGB/440-637------------------------------------------------------------LLYPLKWASIF---------
A7EF60_SCLS1/465-662------------------------------------------------------------LLYPLKWASIF---------
Q0CL54_ASPTN/423-620------------------------------------------------------------LLFPITWTGVL---------
DENN_SCHPO/362-562------------------------------------------------------------LLYPLTWQGLY---------
Q4RI35_TETNG/140-326------------------------------------------------------------FLQPLSWQQPY---------
DEND3_MOUSE/187-373------------------------------------------------------------YLHPLQWQHTF---------
A1Z7Q5_DROME/98-283------------------------------------------------------------FLYPMVWQHIF---------
Q7Q1I7_ANOGA/88-273------------------------------------------------------------FLYPMVWQHIF---------
Q6DCI3_XENLA/89-270------------------------------------------------------------LLYPMYWQHIY---------

PF09794

Q7QF11_ANOGA/7-482...........EGVLC----L---PYISLPYMDLL......TDPSVK-------GYMIGASNVLF-----QHKRQL..AD
Q29HH8_DROPS/14-480...........SGNLC----L---PYLSLPYMDLL......SDPMVL-------SYVIGTSNVLF-----QQKRQL..AD
Q6BP02_DEBHA/131-552..........TKGSFW----N---PYLPLQQLSEL......SASETR-------SYMVGCSNLLF-----VNQSESLNVD
A5DNM6_PICGU/119-523..........TKGAFW----N---PYLPLQQLNAL......SSPGTK-------SFMVGSSNLLF-----VNQSMALEVD
Q2H333_CHAGB/18-368...........KGSLF----G---PYTPLQQLDVL......ADFGTK-------SYIVGSTNSLL-----LQQKDRY.SD
AVL9_PONAB/16-520...........KGYLC----L---PYMALQQHHLL......SDVTVR-------GFVAGATNILF-----RQQKHL..GD
Q4P7V8_USTMA/140-510...........PDAFF----Q---PYCPLQQIDLL.........KSR-------SWLVGTSNSIF-----KQQRDCK.ID
Q17GP2_AEDAE/7-476...........EGNLC----L---PYLSLPYMDLL......TDPSVK-------GYIIGASNVLF-----QQKRQL..AD
Q6C028_YARLI/516-899...........EGGMF----S---PYIPLQQLGDL........ALAR-------YYLVGSTNSLL-----LQQKKQH.AD
Q54NJ9_DICDI/6-452TNSDGEKVYGSGGMIL----Q---PYLPLQQISLLLPPQQGSGKTFN-------GFLVGTSNSLF-----LKNPPST.VH
A1CPG6_ASPCL/9-384...........KGSMF----G---PYTPLQQLDLL......ADYGTK-------SYVVGSTNSLL-----LQQKDRY.SD
Q4SKV3_TETNG/13-521...........KGYLC----L---PYMALQQHHLL......SDVTVR-------GFVAGATNILF-----RQQRHL..SD
Q6FIU1_CANGA/8-406...........KGGLF----S---PYTPLQQVSEI......RSPATK-------FFMVGTSNKLL-----AEQKTDI.CD
Q08D17_XENTR/21-516...........KGYLC----L---PYMALQQHHLL......SDVSVR-------GFVAGATNILF-----RQQKHL..SD
Q6CKD3_KLULA/6-399...........KGGFF----S---PYVPLQQMNDL......TASVTK-------WFVAGTSNTLL-----LEQSKTL.CD
Q750W9_ASHGO/13-401...........SGGLF----S---PYTPLQQLGDL......TSPKTK-------WYVIGTSNNLL-----LEQKDRL.AD
Q5KDB3_CRYNJ/119-529...........HDAFF----Q---PYMPLQQMDTL.........AAK-------SWLVGTTNQIV-----TQQKECR.YD
A6RFN4_AJECN/8-299...........KGSMF----G---PYIPLQRLDLL......ADYGTK-------SYVVGSTNSLL-----LQQKDRY.SD
AVL9_YEAST/9-401...........KGGLF----S---PYTPLQQMNDI......RSERTL-------FFMIGSSNTLL-----AEQKEEL.CH
A3LPG1_PICST/85-492..........TKNAFW----N---PYLPLQQLDEL.........TVE-------SFMVGCSNLLF-----VNQAEKYNID
AVL9_SCHPO/10-367...........EGSMF----S---PYTPLQLVHVL......EAKSST-------SWLAGTTNTLI-----MLNQNKM.AE
Q5AIP1_CANAL/191-588..........TKNSFW----N---PYLPLQQLDEL.........AVN-------SFMIGCSNLLF-----VNQATSYGID
A7TEK5_VANPO/8-400...........TGGFF----S---PYTPLQQINDI......NDEKSK-------FFVIGTSNSLL-----SERKDEL.CQ

PF09804

Q6C716_YARLI/3-239-----------VTVQD----S...ERLAKMN.......................NYLAITSDTIM-----LHRKSD--HD
YKE7_YEAST/33-335-----------VSTSD----I...PFLESFKKGN....................GYVATTSEEIL-----LYKPEI--YD
Q6FLQ0_CANGA/9-288-----------VGTYD----I...EDLEKHGQE.....................GFLAVTSDEIL-----LYKEEL--FD
A7TLL1_VANPO/24-351-----------IGVND----I...DFLNKVIKESGNSDYQMS............SFVACTSDEVL-----AYRPEL--YD
Q75DG5_ASHGO/36-366-----------IGIAD----L...DHLTDMVSDALHKSDPDGPHLP........SFIACTSDEIL-----AERGEL--FD
Q6CP43_KLULA/3-242-----------ITMLN----A...DQFKSFE.......................AWCATTSDEIL-----IYDTDL--FD
A5DGT1_PICGU/16-298-----------VGLHD----LSENDSVLKTP.......................HIITVTSDEIL-----MYQ.DV--YD
Q5A7K9_CANAL/8-279-----------IGLTD----MG..GELLKCR.......................GYIGSTNDDIL-----K.DNAV--YD
B9WCZ6_CANDC/8-285-----------IGLTD----MA..GELIKLK.......................GYIGSTNDDIL-----K.ESPV--YD
C5MJC0_CANTT/11-295-----------IGLND----LT..GHLMKVK.......................GYIGSTNDEIL-----K.DNPV--YD
A3LNE8_PICST/19-334-----------IGLND----LDS.DDLLKTS.......................GYIASTSDDIL-----MFQRDL--YD
Q6BJB8_DEBHA/28-311-----------IGLND----LE..SSLLEFP.......................ATIATTNDDIL-----MYQKNL--YD
B8M2T3_TALSN/30-332-----------VGIHD----I...PFLST...................NSDTYSSWIACTTDNVL-----ATKTEL--FD
A2QAY7_ASPNC/31-357-----------VGIHD----I...PHLSSFVGTL.............VNAEHDAAWIACSTDSVL-----TMKPEL--FD
A1CNU9_ASPCL/30-339-----------VGIHD----I...PYLSSFVGVS.............PSSEPDAAWIACSTDSVL-----SMKSEL--FD
Q2UQJ8_ASPOR/30-340-----------IGIHD----I...PYLSSFAGVS.............ANAQPDASWIACSTDSVL-----TMKSEL--FD
Q5BF30_EMENI/30-339-----------VGVYD----I...PYLSSFIRGS.............ADSEHDSTWIACSTDSVL-----SMKPEL--FD
F2PVM8_TRIEC/26-326-----------IGIHD----M...AQLST...................LSSTDPCWIACSSDRVL-----GLRPEL--YD
E9CY67_COCPS/13-322-----------VGVHD----L...PYLTSLSRKTS............PQKKGENCWIACTSDRVL-----GLKPEL--YD
C0S3V5_PARBP/84-387-----------IGIHD----M...PYLLSLPSPS..............ISDPDGCWIACTTDRVL-----SLKPEI--YD
C0NKX7_AJECG/29-332-----------IGIHD----M...PYIASLSYPA..............VSDPDSCWIACTTDRVL-----SLKPEL--YD
D5G5F9_TUBMM/21-341-----------IGVHD----I...PLLEEEAKRIHPTSQPPHDRD..HLGGEQGSWVACTTDGIL-----YLKNEL--YD
E3Q807_COLGM/29-348-----------IGVHD----I...PFLMEDFEASKRRKAGGNDNFAD...ESGSGWIACTTDSIL-----AMKDTL--WD
E9F1A8_METAR/37-350-----------IGVHD----I...PFLMEDFEASKRR....QDGTADSGGEAGSGWIACTTDSIL-----AMKDTL--WD
C7YNX8_NECH7/29-347-----------IGVHD----I...PFLMEDFEASKRERS.SEDAVDD...EAGSGWIACTTDSIL-----AMKDTL--WD
B2AXI7_PODAN/33-356-----------IGVHD----I...SYLMEHQAAMKKRPN.QDDQHSDPSEDSTSGWVACTTDSIL-----AMKGDL--WD
A6RUI2_BOTFB/28-351-----------IGVHD----I...PLLEDDLKASKRRAASEDTVQTEGRDEPGCGWIACTTDSIL-----ATKTHL--YD
Q0V1B2_PHANO/27-300-----------VGVHD----I...PSLEAPTTS.....................GWTACTTDEII-----STKAKL--YD
B3RV35_TRIAD/7-273-----------VNVAD----I...AELSSTK.......................TYVACTTEKVF-----ESKKNL--YD
LCHN_XENLA/61-326-----------VNVAD----I...QTLDGEG.......................SYVACTTEKIF-----EQKQDL--YD
LCHN_DANRE/114-382-----------INVAD----I...PALETEL.......................SYVACTTEKIF-----EEKKEL--YD
B7QCC0_IXOSC/54-313-----------INVTD----V...DVLAKQS.......................AYVACTTEKIF-----ESKQNL--FD
F2UE85_SALS5/10-285-----------ANLSD----I...PWMSTHS.......................NYICCVTETVF-----ELKTSL--FD
YBAG_SCHPO/6-296-----------VGLAN----T...STLLDNDLEE....................GWIACTTDTVL-----LSKSSL--YD
B6K728_SCHJY/9-263-----------IGLHD----V...DHLKQLETNS....................GWVACTTDVVL-----LDKADL--YD
Q5K7R2_CRYNJ/10-298-----------VGLMD----L...DNIKAKKG......................GWVATTSDMIF-----KSHTKL--YD

PF08616

A0C6F7_PARTE/251-368-----------LNIIQNIQGY---KSLLDKGWEQ.....QN-------------SWISIVSNPIF.....EYRREW.-WD
A4I5V0_LEIIN/587-699-----------VSVSS....V---NYFMQVPG.........-------------.YIVGTLNPIF.....DNVNPWG-WD
A5DM71_PICGU/279-393-----------IDVSK....I---DLLEKCDS.........-------------.YLAGTINPFF.....KNNDKL.-WD
A5DZ96_LODEL/271-385-----------IDVSK....I---DLLEECES.........-------------.FIAGTINPFF.....KNNDKL.-WD
A6ZNX6_YEAS7/345-470-----------MDISL....V---DGLRAYVASNSD.FVGC-------------FAIIGTANPIF.....RYQLDI.-WD
A7TRE4_VANPO/376-503-----------MDISM....V---DALRKYLNDKSGNISNK-------------FAIIGVANPIF.....KYQQNL.-WD
A8PX95_MALGO/354-466-----------VTLAS....L---DTLRSMRG.........-------------.FIAGTTHPRI.....EELGC..-WD
B0D0E4_LACBS/418-530-----------ANLNN....R---DEWEAVPA.........-------------.YIAGVTNPIF.....ESSRQ..-WD
C3ZXT1_BRAFL/180-291-----------IHDSEFKEYT---TKTQAAPP.........-------------.VVLGVTNPFF.....AKTLQH.-WP
C4R3J0_PICPG/305-418-----------VDLSQ....L---EILEKMPF.........-------------.YVAGTANIIF.......QSKPI-WD
C4Y911_CLAL4/255-369-----------IDVSK....I---DILEKCDS.........-------------.YLAGTINPFF.....KSNDKL.-WD
C4YQL5_CANAW/259-373-----------IDVSK....I---NLLEECES.........-------------.FIAGTINPFF.....KQNDRL.-WD
C5DJD2_LACTC/316-435-----------MDISF....L---DALREQLVLQNG..RRM-------------FTIVGVSNPIF.....EYQKDV.-WD
C5DZH0_ZYGRC/269-391-----------VDVSI....I---GPLKEYLALQD...RGI-------------FLIMGTTNPIF.....KSQDGL.-YD
D2VRW9_NAEGR/366-475-----------ASFSN.....---LEFLDVEG.........-------------.YIVGVCNPMF.....AQREEY.-YD
D2W4R6_NAEGR/470-587-----------VPLSEMDDVL---SATSKIPE.........-------------.YIIGTTNALFETQGKNQRTQW.-WD
YG76_SCHPO/259-372-----------IDLSN....V---ESLVKLPG.........-------------.YLAGVMNPAF.....THHADW.-WD
Q23F93_TETTS/358-465-----------LNLSKKIHLY---CHLQDLSFVE.....KK-------------SYIATVSNPLF.....ENRESW.-WD
Q2URL2_ASPOR/377-488-----------TDLTK....I---DDLLKVPG.........-------------.FIAGVTNPTF.....ANHPEW.-WD
Q4DMT0_TRYCC/444-555-----------TSVNG....L---SHFCSVPG.........-------------.YIVGTLNPIF.....EMQHTW.-WD
Q4P9F2_USTMA/366-478-----------TNLLN....L---DDLEKVPG.........-------------.YIAGVTNPRF.....EDLHA..-WD
Q55D43_DICDI/566-679-----------INLHHQ.ILI---DKLPPSTG.........-------------.VILGVSNPVF.....EERSEW.-WD
Q55YB7_CRYNB/357-470-----------ANLAS....L---DILEEFPG.........-------------.YVAGVTNPRF.....EELPMT.-WD
Q6BI40_DEBHA/264-378-----------LDVSK....I---DCLKKCDS.........-------------.YIAGTINPFF.....KYNHKL.-WD
Q6CGA4_YARLI/272-384-----------TDLSK....V---DDLLETPG.........-------------.FIAGAKNPAF.....THHPTW.-YD
Q6CPS0_KLULA/322-444-----------MEISI....I---DMFRENFTEEFT.KGNF-------------FSVVGVSNPIF.....QYQVDA.-WD
Q75BQ9_ASHGO/342-464-----------MDISM....I---DELRNEFSVKKT..GNY-------------FSIVGVSNPIF.....EMQKDV.-WD

PF07792

MESA_EMENI/79-241-----------LNLVN----TKQDNTVKRGAVVK--------------------AMAICTRHSFL--------------H
E7KUE5_YEASL/26-218-----------INVAN----TVLDTTNDRGAVIK--------------------SIAIGTPLKTF--------------F
B2AXK1_PODAN/123-294-----------LNLVN----TKQDKTVKRGAVVK--------------------AMAICTRHPFL--------------H
E9DDS1_COCPS/90-249-----------LNLVN----TKQDNSVKRGAVVK--------------------AMAICTRHSFL--------------H
F2TNB3_AJEDA/90-246-----------LNLVN----TKQDTSVKRGAVVK--------------------AMAICTRHSFL--------------H
Q0V5R0_PHANO/110-273-----------LNLVN----TKLDTTVKRGSIVK--------------------AMAICTRHSFL--------------H
C4Y911_CLAL4/3-80-----------.....----..............--------------------...........--------------.
Q75BQ9_ASHGO/49-219-----------INVVH----AKIDNANERGAVIK--------------------SLAVGTSLQNF--------------F
A7TRE4_VANPO/73-251-----------INVVN----TVIDKNNDRGAVIK--------------------SISLGTTLKIF--------------S
C5DZH0_ZYGRC/8-97-----------.....----..............--------------------...........--------------.
Q5KLM3_CRYNJ/72-162-----------LNCVR----MKEDKKMRRGAMVK--------------------AMAICTPNPYV--------------G
A2Q8P4_ASPNC/82-239-----------LNLVN----TKQDTSVKRGAVVK--------------------AMAICTRHSFL--------------H
A1CRY6_ASPCL/85-243-----------LNLVN----TKQDNTVRRGAVVK--------------------AMAICTRHSFL--------------H
F0XQA1_GROCL/147-345-----------LNLVN----TKQDKTQKRGAVVK--------------------SMAICTRHPFL--------------H
E9BZT8_CAPO3/13-108-----------....H----DSAKGSKSMPSDNK--------------------TPAVTSLDAFV--------------Y
Q6CGA4_YARLI/9-78-----------.....----..............--------------------...........--------------.
C0SET4_PARBP/168-287-----------G....----..............--------------------...........--------------.
Q7RXB5_NEUCR/122-235-----------.....----..............--------------------.......HGYL--------------H
Q6CPS0_KLULA/28-197-----------LSVVN----TFLDNSNDRGAYIK--------------------AIALGTTMTNF--------------Y
A6RVU6_BOTFB/70-232-----------LNLVN----TKQDKTAKRGAVVK--------------------AMAICTRHPFL--------------H
C4R3J0_PICPG/6-86-----------FPIYS----TYSDVEFENA....--------------------...........--------------.
B8MHD8_TALSN/85-247-----------LNLVN----TKQDNTVRRGAVVK--------------------AMAICTRHSFL--------------H
A0C6F7_PARTE/1-175-----------LACLR----NKKDATIKRGSLIR--------------------SIAVCSSDLLF--------------L
D8QBP3_SCHCM/66-137-----------LNLVR----TKHDKTWERGAKVL--------------------ALAICTRHPFI--------------Q
Q23F93_TETTS/1-96-----------...LK----QVVDQKTHKLVSEI--------------------NLNSSKELVDL--------------Y
D2VRW9_NAEGR/60-245-----------LNVQK----QKKYEGLRRAARVK--------------------SLAIVSKHPYC--------------F
D3BKL1_POLPA/154-247-----------.....----.SKNKKAKPKPKTQ--------------------GKIICTIEAFI--------------Y
F0ZTU4_DICPU/95-230-----------NNNNN----NNNNKSATAAPKVE--------------------KQISSPLMAYI--------------Y
B6HSJ1_PENCW/75-232-----------LNLVN----TKQDNTVRRGAVVK--------------------AMAICTRHSFL--------------H
D4AU15_ARTBC/26-120-----------SKPAS----KQAAEEKRENPAKA--------------------ALPRLTYLNVL--------------A
C5DJD2_LACTC/29-192-----------LSVVN----ALHDKSNDRGATIK--------------------SIALGTTMQNF--------------I

PF02141

DEN5A_HUMAN/202-390-----------VPILP----ASLLHFL.DAPV----------------------PYLMGLHSNGLDDRSKLELPQE--AN
DEN5B_HUMAN/187-375-----------VPILP----ASLLHFL.DAPV----------------------PYLMGLQSKEGTDRSKLELPQE--AN
Q0US70_PHANO/395-592-----------IPILP----ARLVQTI.EAPC----------------------PYIVGIERRYEP.....TDYPE--DE
Q0UM90_PHANO/167-348-----------VPVVH----ARHVKDLVQEPG----------------------PYILGVTSECRS.....LFTAP--TD
Q54JA6_DICDI/110-305-----------IPILP----RSLLDYC.TAPM----------------------PFIIGIHSSLLA...PIRRKPL--NE
Q55DD7_DICDI/109-294-----------ISILP----NALMPYV.AAPI----------------------PFLVGILESSLK...SFYQQPT--EQ
Q08BI6_DANRE/181-363-----------ISIVP----EILIDVV.MAPT----------------------PYLLGVQKRLAH.....LVTDQ--TD
Q5U3I4_DANRE/164-346-----------ISIVP----SVLIDVC.EAPT----------------------PYLLGVQKSMMG.....LITDH--SD
Q0VCJ3_BOVIN/149-333-----------IPVVP----ESLLGTV.CCPT----------------------PFMVGVQMRFRQ...EVLDSPM--EE
Q6DF82_XENLA/149-333-----------IPVLP----HVLIDTV.SCPA----------------------PFIVGVQNQFLS...SILDQPM--EE
DEN2C_HUMAN/586-770-----------IPVLP----ASMIDIV.CSPT----------------------PFLIGILSCSLP...QLQDLPI--EE
Q4T8M0_TETNG/323-507-----------IPVLP----ASMLDIV.CTPT----------------------PFIVGLLSSSLP...RLKELPI--EE
Q5RHZ1_DANRE/778-962-----------IPVLP----TSMVDIV.CCPT----------------------PFLVGILSSSLP...KLKELPV--EE
Q4SCC1_TETNG/127-311-----------IPVLP----ASMLDVS.CSPT----------------------PFLIGVLAPCLP...QLLELPI--EE
A7RR72_NEMVE/298-481-----------IPLCP----VALNDVL.CAPC----------------------PFIIGIDSRYFD.....QYDPP--DD
Q3U2K9_MOUSE/307-491-----------IPLCP----LSLAGVL.SAPL----------------------PFIVGVDSRYFD.....LHDPP--QD
DEN4B_MOUSE/313-497-----------IPLCP----LVLADVL.SAPV----------------------PFIVGIHSSYFD.....LHDPP--AD
A0PJS2_DANRE/305-489-----------IPLCP----LRMADVL.CAPM----------------------PFIVGVHSSYFD.....LYDPP--SD
Q4SLY3_TETNG/383-567-----------IPLCP----LALADVL.SAPC----------------------PFIVGMDSRYFD.....LYVPP--SD
Q7PWX7_ANOGA/311-495-----------IPLCP----LGLAEVL.HAPL----------------------PYLIGVDSRFFD.....LYEPP--ND
Q9W3D2_DROME/308-492-----------IPLCP----LGLAEVL.HAPL----------------------PYLIGVDSRFFD.....LYEPP--TD
Q9TXV4_CAEEL/347-533-----------IPQCP----LGLAGVL.HAPL----------------------PFIAGVDSRYFE....LYEDPP--DD
MTMRD_HUMAN/116-298-----------IPILP----AQLLEVL.SSPT----------------------PFIIGVHSVFKT.....DVHEL--LD
Q4SZD9_TETNG/73-244-----------IPILP----SRLLEVL.SSPT----------------------PFIIGVHSMFQN.....EIQEL--LD
A6PVH0_HUMAN/128-310-----------VPILP----AQLLEVL.STPT----------------------PFIIGVNAAFQA.....ETQEL--LD
Q1LXZ0_DANRE/117-299-----------VPILP----GKLLEVL.SSPT----------------------PFIIGVNSHFRS.....ETQEL--LD
Q7KSP6_DROME/142-325-----------IPILP----APLTEVL.STPT----------------------PFIMGIHSSLQT.....EITDL--LD
Q177S0_AEDAE/106-289-----------IPILP----ASLVEVL.STPT----------------------PFIMGIHSSMQT.....EVTEV--LD
Q4S7I6_TETNG/216-404-----------LPIVS----AHLYHLL.DAPV----------------------PFLMGIQRRDGAQRSSLHLPHE--AN
A7SZQ4_NEMVE/186-373-----------VPILP----AALQHFL.DAPV----------------------PFIMGLYCASEDFKANLQLPSE--AS
Q54VP0_DICDI/908-1097-----------VPVLP----EVLVDIAGSTPF----------------------PFIMGIHRSYADR.ILSKEDLL--NE
Q2GNY8_CHAGB/440-637-----------IPVLP----ARLISAL.EAPC----------------------PYIVGVERRYEK.....IELPD--DD
A7EF60_SCLS1/465-662-----------IPVLP----ARLISAL.EAPC----------------------PYIVGIERRYDN.....IVLPE--DD
Q0CL54_ASPTN/423-620-----------IPVLP----ARLIQAL.EAPC----------------------PYIVGIERRYEK.....VELPS--DD
DENN_SCHPO/362-562-----------IPVLP----RRLISCF.EAPC----------------------SYIIGTLSYFFH....MDDVPL--DN
Q4RI35_TETNG/140-326-----------VPVLS----RSMLDFL.MVPT----------------------ALLMGCHVCHFE....EVAAET--DD
DEND3_MOUSE/187-373-----------VPILS----GQMLDFV.MAPT----------------------SFLMGCHLDHFE....EVRKEA--DG
A1Z7Q5_DROME/98-283-----------IPVLP----WEFKDYL.GAPM----------------------PYLIGVPEPVLE...TVTSDEL--GE
Q7Q1I7_ANOGA/88-273-----------IPVLP----MQMKDIL.AAPM----------------------PFLIGVPEAVYD...TLRREEI--GD
Q6DCI3_XENLA/89-270-----------IPTLP----PHLLDYC.SAPM----------------------PYLIGVHSSLME...KVNIKSL--ED

PF09794

Q7QF11_ANOGA/7-482VMI..........DVESTLIDVL...DGETKREMQMSTEDLRFVDFVVRHVQTPKEDAE.....................
Q29HH8_DROPS/14-480VLV..........DIEAANLDAH...DPELRRQLVLSTEDLRYMDYIMKHVQTPKEDAE.....................
Q6BP02_DEBHA/131-552LLI..........NLDTNELSYP....KGKPEELHLTSKDKKFVNALISKIKSNEKDEWQNDI........DNEQFI...
A5DNM6_PICGU/119-523ILI..........NLDTNEVSYP....VGRGDDLLLSSKDKIFINSLLENIRKIDEQDN................YI...
Q2H333_CHAGB/18-368ILI..........NLDEDTINIT...SPSLKTALQLSTPDRRWIDFITQNVNDTWDDANPSRP........KTMGYV...
AVL9_PONAB/16-520AIV..........EVEEALIQIH...DPELRKLLNPTTADLRFADYLVRHVTENRDDVFLDG...........TGWE...
Q4P7V8_USTMA/140-510VVV..........DLEHAHLEFQ...DAKLHQMVNLTPEDRKWMDEVISSVVETWNPADPTRP........TSMGFH...
Q17GP2_AEDAE/7-476VMI..........DVENAVIDVY...DMDLKRQTQLSTEDLRFADFIIRNVQNPKEDAE.....................
Q6C028_YARLI/516-899VLV..........NMDDNTVEIL...NSSLKSPLSLSSYDKKWIERVVQAVDTSSGNSAATT.............FH...
Q54NJ9_DICDI/6-452AIV..........DIQNGEIQFK...DESLNRIMELTSSDRRFIDNIYDKVELYNRNNSNNNN........NNNNNNNNN
A1CPG6_ASPCL/9-384ILI..........NLDEDTINIS...SPSLRNALILSAADRRWIDLLTQIINDTWDEAHPQRP........KDHGYM...
Q4SKV3_TETNG/13-521AIIDVSPEEMQKSQVDEASIQIQ...DPELRKVLSLTTADLRFADYLVKHVTENRDDVFLDG...........TGWE...
Q6FIU1_CANGA/8-406IFV..........NIDDATVEFL...NKELGSALQLSGQDIKWMDTICNVVKTTWNENDDETP........KNSQFE...
Q08D17_XENTR/21-516AIV..........EVEEARIQVH...DPELRKILNPTTADLRFTDHLVKHVMENRDDVFLDG...........TGWE...
Q6CKD3_KLULA/6-399LLV..........NIDDSTVQIMNKKDKDLHQALQLSQSDKKWMDVVIQSVLKSWNQDDYSTL........RNSQFE...
Q750W9_ASHGO/13-401LLV..........NVDMKTVETIS.DDKLFAQALQLSHHDRRWMDLLIQNIVNTWNEYDLSTP........STFQFE...
Q5KDB3_CRYNJ/119-529LLV..........NIDNNTFTFP...NPKLERVVGLTAADRRWMDDVVQTVEETWGLSEGERPSYVPRHFILFFNLEFTK
A6RFN4_AJECN/8-299ILI..........NLDENTINIS...SPSLRSALSLSAADRRWIDFLTQSIYETWDDAQPERP........NTHGYL...
AVL9_YEAST/9-401IFV..........NTDNSTVDIL...DKTLNPVLQLSSHDKKWIESISGIVSDTWNENDDETP........KNSQFE...
A3LPG1_PICST/85-492LLI..........NLDTCEISFP....SGKQDELGLSHADKKFINHLINNIENERD.................DEFL...
AVL9_SCHPO/10-367VIV..........RSDTHQIEFV...DPTIKNLTSLTYTDKSWMEDIISRVESSLEMELP..............GFE...
Q5AIP1_CANAL/191-588VLI..........NLDTNEVTYP..KNLYATEDLQLSALDKKFIHHLVNCDQPTTKH................DDFI...
A7TEK5_VANPO/8-400IYV..........DTDNFTIEII...DKSLQPLLQLTANDKKWIESMSNVVSESWNENDRETP........KNSQFE...

PF09804

Q6C716_YARLI/3-239VAV----------QLSNDGVQIT---------------------------------------------------------
YKE7_YEAST/33-335IVV----------KLTSSSTIEE---------------------------------------------------------
Q6FLQ0_CANGA/9-288KAL----------ILPSDSLIHE---------------------------------------------------------
A7TLL1_VANPO/24-351IML----------KLPPNFMSND---------------------------------------------------------
Q75DG5_ASHGO/36-366MVV----------KLSNYHGVKV---------------------------------------------------------
Q6CP43_KLULA/3-242KLV----------IWDPNGIHLR---------------------------------------------------------
A5DGT1_PICGU/16-298VGV----------SLPTDNSGHV---------------------------------------------------------
Q5A7K9_CANAL/8-279IGV----------IIDEHAKVFD---------------------------------------------------------
B9WCZ6_CANDC/8-285IGV----------VIDEWARVFD---------------------------------------------------------
C5MJC0_CANTT/11-295VGV----------VIDEKASVFR---------------------------------------------------------
A3LNE8_PICST/19-334IGV----------ILDDSVTVYN---------------------------------------------------------
Q6BJB8_DEBHA/28-311YAV----------FLPNEEYGNS---------------------------------------------------------
B8M2T3_TALSN/30-332ILV----------TLPTTHSPHI---------------------------------------------------------
A2QAY7_ASPNC/31-357VLV----------TLPPAHSKNA---------------------------------------------------------
A1CNU9_ASPCL/30-339VLV----------TLPPVHSKNA---------------------------------------------------------
Q2UQJ8_ASPOR/30-340VLV----------TLPAPYSKDA---------------------------------------------------------
Q5BF30_EMENI/30-339VLV----------TLPPSHTKNA---------------------------------------------------------
F2PVM8_TRIEC/26-326VLV----------TLPPNYSRQA---------------------------------------------------------
E9CY67_COCPS/13-322VLI----------DLPPPYSKDA---------------------------------------------------------
C0S3V5_PARBP/84-387VLV----------NLPPAYTKHA---------------------------------------------------------
C0NKX7_AJECG/29-332VLV----------NLPPAYSKHA---------------------------------------------------------
D5G5F9_TUBMM/21-341VVV----------SMPPAHSKNA---------------------------------------------------------
E3Q807_COLGM/29-348MLI----------TMPPPYAPNA---------------------------------------------------------
E9F1A8_METAR/37-350MLI----------TMPPEHSTNA---------------------------------------------------------
C7YNX8_NECH7/29-347MLI----------TIPPDYASNA---------------------------------------------------------
B2AXI7_PODAN/33-356MLI----------TLPPVYSSNA---------------------------------------------------------
A6RUI2_BOTFB/28-351VLI----------TMPLPHASTS---------------------------------------------------------
Q0V1B2_PHANO/27-300VIV----------ELP......T---------------------------------------------------------
B3RV35_TRIAD/7-273AFI----------DIRNISSTSP---------------------------------------------------------
LCHN_XENLA/61-326VYV----------DNQNVKTHRE---------------------------------------------------------
LCHN_DANRE/114-382VYI----------DNQNVKTHRE---------------------------------------------------------
B7QCC0_IXOSC/54-313LYV----------DQQNLEPNSS---------------------------------------------------------
F2UE85_SALS5/10-285AFV----------FPDDKMLPGA---------------------------------------------------------
YBAG_SCHPO/6-296LAL----------YWPDNSFNAN---------------------------------------------------------
B6K728_SCHJY/9-263IAF----------LWDTDSPYPS---------------------------------------------------------
Q5K7R2_CRYNJ/10-298IFI----------DLSSNPLPPS---------------------------------------------------------

PF08616

A0C6F7_PARTE/251-368ILC----------DVNAGKIIES---------------------------------------------------------
A4I5V0_LEIIN/587-699LLC----------DLDNKSVITA---------------------------------------------------------
A5DM71_PICGU/279-393VLY----------DLDANEFHLS---------------------------------------------------------
A5DZ96_LODEL/271-385LLY----------DLDANELFLS---------------------------------------------------------
A6ZNX6_YEAS7/345-470YYY----------DVDEGVFYEN---------------------------------------------------------
A7TRE4_VANPO/376-503CYY----------DLDTETLYDS---------------------------------------------------------
A8PX95_MALGO/354-466VLC----------DCESGQIIVS---------------------------------------------------------
B0D0E4_LACBS/418-530LLL----------DIGSGNVTVA---------------------------------------------------------
C3ZXT1_BRAFL/180-291HII----------RIGE.MGNIG---------------------------------------------------------
C4R3J0_PICPG/305-418LFI----------NLDDKSILLN---------------------------------------------------------
C4Y911_CLAL4/255-369LLY----------DLDENEFHVS---------------------------------------------------------
C4YQL5_CANAW/259-373LMY----------DLDNNEFILS---------------------------------------------------------
C5DJD2_LACTC/316-435FYY----------DMDAGSL..Q---------------------------------------------------------
C5DZH0_ZYGRC/269-391YYY----------DLDNELISEA---------------------------------------------------------
D2VRW9_NAEGR/366-475LLV----------DIDKMEVKVS---------------------------------------------------------
D2W4R6_NAEGR/470-587VCL----------SVNSRKVQLA---------------------------------------------------------
YG76_SCHPO/259-372VLC----------DIDNQTIQVS---------------------------------------------------------
Q23F93_TETTS/358-465VCC----------NIQDGSVKES---------------------------------------------------------
Q2URL2_ASPOR/377-488VLC----------DLPTGRIKIS---------------------------------------------------------
Q4DMT0_TRYCC/444-555VLC----------DLDNKCVVLS---------------------------------------------------------
Q4P9F2_USTMA/366-478LLL----------NVETGRMQVA---------------------------------------------------------
Q55D43_DICDI/566-679ILC----------NIGTGKVILN---------------------------------------------------------
Q55YB7_CRYNB/357-470VLC----------NLETGKVTVS---------------------------------------------------------
Q6BI40_DEBHA/264-378LLY----------DLDSNELFLS---------------------------------------------------------
Q6CGA4_YARLI/272-384VVV----------DIENFTMDIS---------------------------------------------------------
Q6CPS0_KLULA/322-444FYY----------DLDSDSLLNS---------------------------------------------------------
Q75BQ9_ASHGO/342-464FYY----------DLDSATLLTQ---------------------------------------------------------

PF07792

MESA_EMENI/79-241IYK----------..PILLLALE---------------------------------------------------------
E7KUE5_YEASL/26-218AFK----------..NIIVLVLD---------------------------------------------------------
B2AXK1_PODAN/123-294IYK----------..PLLLLALE---------------------------------------------------------
E9DDS1_COCPS/90-249IYK----------..PLLLLALE---------------------------------------------------------
F2TNB3_AJEDA/90-246IYK----------..PLLLLALE---------------------------------------------------------
Q0V5R0_PHANO/110-273IYK----------..PLLLLALE---------------------------------------------------------
C4Y911_CLAL4/3-80.YD----------..SKTCDSKP---------------------------------------------------------
Q75BQ9_ASHGO/49-219IFK----------..PLLMMALD---------------------------------------------------------
A7TRE4_VANPO/73-251IFR----------..PVLSKLLV---------------------------------------------------------
C5DZH0_ZYGRC/8-97...----------.........V---------------------------------------------------------
Q5KLM3_CRYNJ/72-162IYK----------..PLLLLALE---------------------------------------------------------
A2Q8P4_ASPNC/82-239IYK----------..PLLLLALE---------------------------------------------------------
A1CRY6_ASPCL/85-243IYK----------..PLLLLALE---------------------------------------------------------
F0XQA1_GROCL/147-345IYK----------..PLLLLALE---------------------------------------------------------
E9BZT8_CAPO3/13-108EFT----------....EATQGW---------------------------------------------------------
Q6CGA4_YARLI/9-78...----------.........D---------------------------------------------------------
C0SET4_PARBP/168-287...----------.........K---------------------------------------------------------
Q7RXB5_NEUCR/122-235PAP----------..VSSYIQDE---------------------------------------------------------
Q6CPS0_KLULA/28-197TFK----------..PLLTMVLD---------------------------------------------------------
A6RVU6_BOTFB/70-232IYK----------..PLLLLALE---------------------------------------------------------
C4R3J0_PICPG/6-86...----------..ILSYDPKP---------------------------------------------------------
B8MHD8_TALSN/85-247IYK----------..PLLLLALE---------------------------------------------------------
A0C6F7_PARTE/1-175GIC----------.........D---------------------------------------------------------
D8QBP3_SCHCM/66-137IFK----------..PVLLMALD---------------------------------------------------------
Q23F93_TETTS/1-96KFN----------NQKDDWEIYQ---------------------------------------------------------
D2VRW9_NAEGR/60-245SLR----------..DLLSKALD---------------------------------------------------------
D3BKL1_POLPA/154-247KFS----------.......EEQ---------------------------------------------------------
F0ZTU4_DICPU/95-230SFS----------..ETDEEKGW---------------------------------------------------------
B6HSJ1_PENCW/75-232IYK----------..PLLLLALE---------------------------------------------------------
D4AU15_ARTBC/26-120VLR----------.........L---------------------------------------------------------
C5DJD2_LACTC/29-192IFK----------..PLLAMTLD---------------------------------------------------------

PF02141

DEN5A_HUMAN/202-390LCF------------V..DIDNH---------------------------------------------------------
DEN5B_HUMAN/187-375LCF------------V..DIDNH---------------------------------------------------------
Q0US70_PHANO/395-592YVL------------I..DLDAN---------------------------------------------------------
Q0UM90_PHANO/167-348ALV------------V..DLDRN---------------------------------------------------------
Q54JA6_DICDI/110-305IVF------------V..DLDKD---------------------------------------------------------
Q55DD7_DICDI/109-294VIL------------Y..NLDTL---------------------------------------------------------
Q08BI6_DANRE/181-363LLI------------V..DLSEG---------------------------------------------------------
Q5U3I4_DANRE/164-346VMI------------V..DLSTG---------------------------------------------------------
Q0VCJ3_BOVIN/149-333VLL------------V..NLCEG---------------------------------------------------------
Q6DF82_XENLA/149-333VLL------------V..DLCEG---------------------------------------------------------
DEN2C_HUMAN/586-770VLI------------V..DLCAD---------------------------------------------------------
Q4T8M0_TETNG/323-507VLV------------V..DLGSS---------------------------------------------------------
Q5RHZ1_DANRE/778-962ALM------------V..DLGTD---------------------------------------------------------
Q4SCC1_TETNG/127-311VLI------------V..DLCAD---------------------------------------------------------
A7RR72_NEMVE/298-481VTS------------V..DLDTI---------------------------------------------------------
Q3U2K9_MOUSE/307-491VVC------------I..DLDTN---------------------------------------------------------
DEN4B_MOUSE/313-497VIC------------V..DLDTN---------------------------------------------------------
A0PJS2_DANRE/305-489VVC------------V..DLDTN---------------------------------------------------------
Q4SLY3_TETNG/383-567ITC------------V..DLDTN---------------------------------------------------------
Q7PWX7_ANOGA/311-495VTC------------V..DLDTN---------------------------------------------------------
Q9W3D2_DROME/308-492VTC------------I..DLDTN---------------------------------------------------------
Q9TXV4_CAEEL/347-533VTC------------F..DLDTS---------------------------------------------------------
MTMRD_HUMAN/116-298VII------------A..DLDGG---------------------------------------------------------
Q4SZD9_TETNG/73-244VII------------A..DLDGG---------------------------------------------------------
A6PVH0_HUMAN/128-310VIV------------A..DLDGG---------------------------------------------------------
Q1LXZ0_DANRE/117-299VII------------A..DLDGG---------------------------------------------------------
Q7KSP6_DROME/142-325VIV------------V..DLDGG---------------------------------------------------------
Q177S0_AEDAE/106-289VII------------A..DLDGG---------------------------------------------------------
Q4S7I6_TETNG/216-404LCF------------V..DIDNH---------------------------------------------------------
A7SZQ4_NEMVE/186-373LCL------------V..DIDNC---------------------------------------------------------
Q54VP0_DICDI/908-1097LVI------------V..DLDNN---------------------------------------------------------
Q2GNY8_CHAGB/440-637YVL------------V..DLDRD---------------------------------------------------------
A7EF60_SCLS1/465-662YVF------------V..DLDQD---------------------------------------------------------
Q0CL54_ASPTN/423-620FVL------------V..DLDAD---------------------------------------------------------
DENN_SCHPO/362-562IPL------------VVCDLDKN---------------------------------------------------------
Q4RI35_TETNG/140-326LIL------------V..NIDDG---------------------------------------------------------
DEND3_MOUSE/187-373LVL------------I..DIDHG---------------------------------------------------------
A1Z7Q5_DROME/98-283VVI------------L..NCDTK---------------------------------------------------------
Q7Q1I7_ANOGA/88-273VVI------------L..NCDKR---------------------------------------------------------
Q6DCI3_XENLA/89-270VVI------------F..NMDTN---------------------------------------------------------

PF09794

Q7QF11_ANOGA/7-482................GSEAWIRDQLYGYMVALLKTS
Q29HH8_DROPS/14-480................GSEHWIREQFQGYILALLRTA
Q6BP02_DEBHA/131-552................GSDDFVRFEFEDYLLSLLSTT
A5DNM6_PICGU/119-523................GSDDYIRYKFEDYLCSLLSTT
Q2H333_CHAGB/18-368................GSEEFIRVQFEEYLLSLISSV
AVL9_PONAB/16-520................GGDEWIRAQFAVYIHALLAAT
Q4P7V8_USTMA/140-510................GSDDYLRVRFEDYICAMLSST
Q17GP2_AEDAE/7-476................GSEVWIREQFYGYMVALLKSS
Q6C028_YARLI/516-899................GNEDYVRLQFEDYLMGLLSAV
Q54NJ9_DICDI/6-452NNNGNNSDNDNAVYKEGCDKWIRDQFENYIVCLLSSI
A1CPG6_ASPCL/9-384................GSEEFIRLQFEEYLLALLACM
Q4SKV3_TETNG/13-521................GGDEWIRSQFVVYLHSLLSSA
Q6FIU1_CANGA/8-406................GSEDFIRWQFEDYLVGLLSSV
Q08D17_XENTR/21-516................GGDEWIRAQFALYLHSLLSAS
Q6CKD3_KLULA/6-399................GSEDYIRWQFEDYLSGLVLTV
Q750W9_ASHGO/13-401................GSEDFVRWQFEEYLTGLLSSA
Q5KDB3_CRYNJ/119-529NYKEGEKADFSFARYRGSDDDLRARFEEYILSALSSI
A6RFN4_AJECN/8-299................GSEEFIRLQFEEYLLALLSCE
AVL9_YEAST/9-401................GSEDFIRWQFEDYLTGLLSSV
A3LPG1_PICST/85-492................GNDDYIRYQFEDYLNSLISTT
AVL9_SCHPO/10-367................GSDDWIRNQFELYIFGMLATV
Q5AIP1_CANAL/191-588................GSDDYIRSKFEDYLNSLISTM
A7TEK5_VANPO/8-400................GSEDFIRWQFEDYLIGLLSSV

PF09804

Q6C716_YARLI/3-239-----------------------------------NY
YKE7_YEAST/33-335-----------------------------------SP
Q6FLQ0_CANGA/9-288-----------------------------------GL
A7TLL1_VANPO/24-351-----------------------------------ND
Q75DG5_ASHGO/36-366-----------------------------------YA
Q6CP43_KLULA/3-242-----------------------------------DS
A5DGT1_PICGU/16-298-----------------------------------KI
Q5A7K9_CANAL/8-279-----------------------------------YA
B9WCZ6_CANDC/8-285-----------------------------------YE
C5MJC0_CANTT/11-295-----------------------------------FP
A3LNE8_PICST/19-334-----------------------------------HS
Q6BJB8_DEBHA/28-311-----------------------------------YI
B8M2T3_TALSN/30-332-----------------------------------SQ
A2QAY7_ASPNC/31-357-----------------------------------AE
A1CNU9_ASPCL/30-339-----------------------------------AE
Q2UQJ8_ASPOR/30-340-----------------------------------AE
Q5BF30_EMENI/30-339-----------------------------------AS
F2PVM8_TRIEC/26-326-----------------------------------PE
E9CY67_COCPS/13-322-----------------------------------PE
C0S3V5_PARBP/84-387-----------------------------------PS
C0NKX7_AJECG/29-332-----------------------------------PV
D5G5F9_TUBMM/21-341-----------------------------------KK
E3Q807_COLGM/29-348-----------------------------------KE
E9F1A8_METAR/37-350-----------------------------------VD
C7YNX8_NECH7/29-347-----------------------------------VE
B2AXI7_PODAN/33-356-----------------------------------KE
A6RUI2_BOTFB/28-351-----------------------------------AA
Q0V1B2_PHANO/27-300-----------------------------------QQ
B3RV35_TRIAD/7-273-----------------------------------NI
LCHN_XENLA/61-326-----------------------------------HL
LCHN_DANRE/114-382-----------------------------------SL
B7QCC0_IXOSC/54-313-----------------------------------MH
F2UE85_SALS5/10-285-----------------------------------NV
YBAG_SCHPO/6-296-----------------------------------KY
B6K728_SCHJY/9-263-----------------------------------IR
Q5K7R2_CRYNJ/10-298-----------------------------------PV

PF08616

A0C6F7_PARTE/251-368------------------------------------K
A4I5V0_LEIIN/587-699------------------------------------A
A5DM71_PICGU/279-393------------------------------------T
A5DZ96_LODEL/271-385------------------------------------S
A6ZNX6_YEAS7/345-470------------------------------------N
A7TRE4_VANPO/376-503------------------------------------I
A8PX95_MALGO/354-466------------------------------------A
B0D0E4_LACBS/418-530------------------------------------K
C3ZXT1_BRAFL/180-291------------------------------------K
C4R3J0_PICPG/305-418------------------------------------F
C4Y911_CLAL4/255-369------------------------------------S
C4YQL5_CANAW/259-373------------------------------------S
C5DJD2_LACTC/316-435------------------------------------T
C5DZH0_ZYGRC/269-391------------------------------------A
D2VRW9_NAEGR/366-475------------------------------------Q
D2W4R6_NAEGR/470-587------------------------------------E
YG76_SCHPO/259-372------------------------------------S
Q23F93_TETTS/358-465------------------------------------E
Q2URL2_ASPOR/377-488------------------------------------S
Q4DMT0_TRYCC/444-555------------------------------------P
Q4P9F2_USTMA/366-478------------------------------------K
Q55D43_DICDI/566-679------------------------------------P
Q55YB7_CRYNB/357-470------------------------------------K
Q6BI40_DEBHA/264-378------------------------------------S
Q6CGA4_YARLI/272-384------------------------------------P
Q6CPS0_KLULA/322-444------------------------------------K
Q75BQ9_ASHGO/342-464------------------------------------A

PF07792

MESA_EMENI/79-241-------------------------------------
E7KUE5_YEASL/26-218-------------------------------------
B2AXK1_PODAN/123-294-------------------------------------
E9DDS1_COCPS/90-249-------------------------------------
F2TNB3_AJEDA/90-246-------------------------------------
Q0V5R0_PHANO/110-273-------------------------------------
C4Y911_CLAL4/3-80-------------------------------------
Q75BQ9_ASHGO/49-219-------------------------------------
A7TRE4_VANPO/73-251-------------------------------------
C5DZH0_ZYGRC/8-97-------------------------------------
Q5KLM3_CRYNJ/72-162-------------------------------------
A2Q8P4_ASPNC/82-239-------------------------------------
A1CRY6_ASPCL/85-243-------------------------------------
F0XQA1_GROCL/147-345-------------------------------------
E9BZT8_CAPO3/13-108-------------------------------------
Q6CGA4_YARLI/9-78-------------------------------------
C0SET4_PARBP/168-287-------------------------------------
Q7RXB5_NEUCR/122-235-------------------------------------
Q6CPS0_KLULA/28-197-------------------------------------
A6RVU6_BOTFB/70-232-------------------------------------
C4R3J0_PICPG/6-86-------------------------------------
B8MHD8_TALSN/85-247-------------------------------------
A0C6F7_PARTE/1-175-------------------------------------
D8QBP3_SCHCM/66-137-------------------------------------
Q23F93_TETTS/1-96-------------------------------------
D2VRW9_NAEGR/60-245-------------------------------------
D3BKL1_POLPA/154-247-------------------------------------
F0ZTU4_DICPU/95-230-------------------------------------
B6HSJ1_PENCW/75-232-------------------------------------
D4AU15_ARTBC/26-120-------------------------------------
C5DJD2_LACTC/29-192-------------------------------------

PF02141

DEN5A_HUMAN/202-390-------------------------------------
DEN5B_HUMAN/187-375-------------------------------------
Q0US70_PHANO/395-592-------------------------------------
Q0UM90_PHANO/167-348-------------------------------------
Q54JA6_DICDI/110-305-------------------------------------
Q55DD7_DICDI/109-294-------------------------------------
Q08BI6_DANRE/181-363-------------------------------------
Q5U3I4_DANRE/164-346-------------------------------------
Q0VCJ3_BOVIN/149-333-------------------------------------
Q6DF82_XENLA/149-333-------------------------------------
DEN2C_HUMAN/586-770-------------------------------------
Q4T8M0_TETNG/323-507-------------------------------------
Q5RHZ1_DANRE/778-962-------------------------------------
Q4SCC1_TETNG/127-311-------------------------------------
A7RR72_NEMVE/298-481-------------------------------------
Q3U2K9_MOUSE/307-491-------------------------------------
DEN4B_MOUSE/313-497-------------------------------------
A0PJS2_DANRE/305-489-------------------------------------
Q4SLY3_TETNG/383-567-------------------------------------
Q7PWX7_ANOGA/311-495-------------------------------------
Q9W3D2_DROME/308-492-------------------------------------
Q9TXV4_CAEEL/347-533-------------------------------------
MTMRD_HUMAN/116-298-------------------------------------
Q4SZD9_TETNG/73-244-------------------------------------
A6PVH0_HUMAN/128-310-------------------------------------
Q1LXZ0_DANRE/117-299-------------------------------------
Q7KSP6_DROME/142-325-------------------------------------
Q177S0_AEDAE/106-289-------------------------------------
Q4S7I6_TETNG/216-404-------------------------------------
A7SZQ4_NEMVE/186-373-------------------------------------
Q54VP0_DICDI/908-1097-------------------------------------
Q2GNY8_CHAGB/440-637-------------------------------------
A7EF60_SCLS1/465-662-------------------------------------
Q0CL54_ASPTN/423-620-------------------------------------
DENN_SCHPO/362-562-------------------------------------
Q4RI35_TETNG/140-326-------------------------------------
DEND3_MOUSE/187-373-------------------------------------
A1Z7Q5_DROME/98-283-------------------------------------
Q7Q1I7_ANOGA/88-273-------------------------------------
Q6DCI3_XENLA/89-270-------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window