Sequence alignment for CL0330

PF09794

Q5KDB3_CRYNJ/119-499VLGIAVVDFNHLIGPTVEFAFPP...SLQNALSVDENLSKELPFLALPDGAHLSEEDYSY-FHCTFSPSTHNS.....QQ
Q7QF11_ANOGA/7-482VLHILVVGFHHKKGCQVEFSYPPL.VAGTEGKGECPSGWKYLPTLALPDGSHNFSSDFVC-FNLP...............
Q29HH8_DROPS/14-480ILHILVVGFHHKLGCQVEFSHPPL.IAGSSGRNECPSGWKYLPTLALPDGSHNFVEDTVF-FNLP...............
Q6BP02_DEBHA/131-552IFAVCLVDFHHVRGPEIQWWRSN....YYPSYPQDNKLFKNLPFQALPDGSHLFEETFSN-FNLVYDFKTGKSYDDGEDY
A5DNM6_PICGU/119-523IFAVCLVDFHHSRGPEVEFWKS......NYHHNYSPSLFKNLSFQALPDGSHQHEETFSN-FSLVYDFVTGLSYDDGDDY
Q2H333_CHAGB/18-368IPLVSVVDFHHARGPEVERWFGV....DEGHDPAAEYDWTLLPFMALSDGAHALTEDFSY-FTLLRPA............
AVL9_PONAB/16-520VLHIVVVGFHHKKGCQVEFSYPPLIPGDGHDSHTLPEEWKYLPFLALPDGAHNYQEDTVF-FHLP...............
A0A0D1CNH7_USTMA/140-510ILGIAVVDFNHLVGPQIEYTYP.......KELQQDEDLVKSLPFLALPDGSHLSDEDFCY-FHLH...............
Q17GP2_AEDAE/7-476ILHILVVGFHHKKGCQVEFSYPPL.IAGSEGKQECPSGWKYLPTLALPDGSHNFNKDFVC-FNLP...............
Q6C028_YARLI/516-899LFSVCIVGFHHSLGPQIEEWFG.........PEDYSHLWPNLPFQALSDGSHSREEDFSY-FTLLFDENNKSAPGAGGYS
Q54NJ9_DICDI/6-452IEYIGVIGFHHSLGHRIEFLYP.....DLDEESKKQYNWNLLPFYGIADGVHNSFEDYTF-FIMEEIN............
A1CPG6_ASPCL/9-384APIVMVIDFHHARGPEIELCIG.....EDGTDIATENDWSLLPFMALSDGAHASTEEFSY-FTLRKKE............
Q6FIU1_CANGA/8-406ILGVCLVDFHHKRGPEVEYWEG.....LDDTGIDSQHLWPNLPFQALPDGSHSFKETFTY-FTLLYDSVNKCSPP.SNSS
Q08D17_XENTR/21-516VLHIVVVGFHHKKGCQVEFSYPSLMPGEEHDSHILPEEWKYLPFLALPDGAHNFQEDTVF-FHLP...............
Q6CKD3_KLULA/6-399VFGCGLVDFHHTRGPEIEYWYD.....GGTTALNVNNLWEYLPFQALPDGAHSYEQSFTY-FTLLYDEVNKKCCSSVGDS
Q750W9_ASHGO/13-401VFGVALVDFHHTRGPEVEHWHS.........DELQNCTWNNLPFQALPDGSHSFEETFTY-FTLLYDEGRHRGLN..GID
AVL9_YEAST/9-401IFGICLVDFHHKRGPEIEYWYG......LPEGTQSAELWPNLPFQALPDGSHSFEETFTY-FTLLYDERRQRSPP.NGAT
A3LPG1_PICST/85-492IFAICVVDFHHSRGPEIQWWKSN...YHPEYTQ...SLFKNLSFQALPDGSHLFEETFSN-FNLVYDFQNSESIDNMSDL
AVL9_SCHPO/10-367VLCLATIGFHHLRGPEIEHLFP........ESMDFPKEWSILPFLSLPDGAHSSEKDFVY-FTL................
Q5AIP1_CANAL/191-588IFAICLVDFHHQRGPEIQWWKSN...YHPDYKQ...GLFKNIPFQALPDGSHLFEETFSN-FNLVYDFDQKQSIDDFNDV
A7TEK5_VANPO/8-400IVGVGVVDFHHTRGPEVEYWHG......LPEGTDESTLWPNLPFQALPDGSHSFKETFTY-FTLLFNPKTKTCPQ.GGAT
H3CTF9_TETNG/13-493VLHIVVVGFHHKKGCQVEFSYPPLVPDEGHDSNVLPDEWRYLPFLALPDGAHNYQEDTVY-FHLP...............

PF09804

ANR2_YEAST/33-335---IFLSKFDMKKGNIIIWSKS-------IN.GAAIDLSN.IEFKSLPAGIHEQTDDVVN.FVVPKE-------------
Q6FLQ0_CANGA/9-288---VFLCQFDMSRGNTLVWSAR-------D...NDPLLKG.IEFKALPSGIHEVSDDVIR.FCIE..-------------
A7TLL1_VANPO/24-351---IFLSQFDMKRGNVIVWSKL-------NE.NCNINLQG.TEFKSLPSGVHEVSDDVIN.FILPKE-------------
Q75DG5_ASHGO/36-366---MCLTKFDVKKGNTVLWTTS-------L..APEHKLHN.IEFKTLPAGIHESEQDWVN.FVLP..-------------
A5DGT1_PICGU/16-298---TFLVQFDTKTGYKLVWSKC-------N...PSLSLSG.IEYKALPSGIHECDSSTVF.IVHK..-------------
C5MJC0_CANTT/11-295---VFLAEFDVKSGYKLVWSKS-------V..IPEFDFDG.LDYKAFPSGIHEFNNSTVL.ISHC..-------------
A3LNE8_PICST/19-334---MFLVQFEVRTGYEIVWSKS-------V..IDGYDFSG.LDFKVLPSGIHEFDKATVL.VSHL..-------------
Q6BJB8_DEBHA/28-311---LFLIHFDVRRGYQLVWSKQ-------AKSRPPIDLGG.LDYKVLPSGIQEHTTSTVF.ISHA..-------------
B8M2T3_TALSN/30-332---LFLILFDIKKGYVISWQES-------I...PGIDLEGAVEYKSLPSGLHNVSEDLIY.FV....-------------
A2QAY7_ASPNC/31-357---LFVIRFDIKAGYVISWKRT-------V...PGVEVEGAVEYKSLPSGLHNVSEDLVY.FV....-------------
A1CNU9_ASPCL/30-339---LFVIRFDIKAGYVISWKRA-------I...PGVEIEGVVEYRSLPSGLHNVSEDLIY.FV....-------------
Q5BF30_EMENI/30-339---LFVIHFDVKAGYTVTWKRT-------I...PGVEVEGAVEYKSLPSGLHNVSEDLVY.FV....-------------
F2PVM8_TRIEC/26-326---LFLIRFDIRAGYTIAWKKT-------A...SEIVLDNAVEFKSLPSGAHNVKEDLVY.FV....-------------
E9CY67_COCPS/13-322---LFLIHFDIKAGYTIVWKES-------L...PDVVLHDVVEFKSLPSGLHNVKEDLVY.FV....-------------
D5G5F9_TUBMM/21-341---LFVIYFDIKAGQTIIWKKF-------A...QGVSLSG.VEFKSLPSGLHNLVEDLVY.FV....-------------
E3Q807_COLGM/29-348---LFLIDFDVKAGYTIVWKQA-------A...PGIELEGLVEYKSLPSGLHTVPDDLIY.FV....-------------
E9F1A8_METRA/37-350---LFLIDFDVKAGYTITWKRA-------V...PHVELDGQVEYKSLPSGLHTVRHDLIY.FV....-------------
C7YNX8_NECH7/29-347---LFLIHFDVKAGYTILWKQS-------A...PGVELEGLVEYKSLPSGLHTVSEDLIY.FV....-------------
Q0V1B2_PHANO/27-300---LFLIRFDKKVGYTIAWKRT-------T...TDIELENAVEYKSLPSGLHAQASDLVY.FT....-------------
B3RV35_TRIAD/7-273---LFVISFDTKSGNVVEYCVP-------....SGVQLNA.VEFKAMPSGSHTVSEDFVY.FR....-------------
LCHN_DANRE/114-382---VFVVTFDTRSGNMIEWCLP-------....HDVNLEG.VEFKSMASGSHRISSDFIY.FR....-------------
B7QCC0_IXOSC/54-313---VFVIAFDTRAGNTVEWWTP-------....KELDISG.IEFKAMASGAHRVHTDFIY.FK....-------------
F2UE85_SALR5/10-285---VFVVDFDALKGNSLRWQYP-------....NDVELPF.VEFKAMPSGSHSVLEDFPYGFL....-------------
YBAG_SCHPO/6-296---IVLATFDAKEGYNVENYYP-------....GDFNVEG.IEYLLFPSGIQELDNCTIF.FR....-------------
Q5K7R2_CRYNJ/10-298---VFLTYFDDIKGQSVLYYSS-------L...PDIP.EGTIEHATLPSGLHNLSEDLIC.FR....-------------

PF08616

Q5KLM3_CRYNJ/384-496--------------------------------------------------------------------------------
YG76_SCHPO/260-373--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_KOMPG/305-418--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
A0A0D1DWU6_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------
E7QKR4_YEASZ/211-334--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------

PF07792

B2AXK1_PODAN/126-264--YILVASFDIDRGPIMEHQYP-------------------VAITG............DE--------------------
Q23F93_TETTS/4-94--VIFCSEFDLLKGCVVKAHYP-------------------EN............FEYDE--------------------
A0C6F7_PARTE/4-152--ALFAAEFLV.KGCVITASYP-------------------QT..G............DS--------------------
Q75BQ9_ASHGO/52-189--YILAAEFDNKLGPVLKHQFP-------------------KNLPGF........KSTNS--------------------
A1CRY6_ASPCL/88-213--YILVASFHIDRGPIMEHQYP-------------------AAISG............DE--------------------
E9DDS1_COCPS/93-219--YILVASFHVDRGPIMEHQYP-------------------AAISG............DE--------------------
C4Y911_CLAL4/6-95--FIVTAEFHVDKGPSLIHQYP-------------------NVLPG............SE--------------------
B8MHD8_TALSN/88-217--YILVASFHIDRGPIMEHQYP-------------------SAISG............DE--------------------
C5DZH0_ZYGRC/11-112--YLLTAEFDNRFGPVVRDQYP-------------------SVIPGF.EYEMREGHSQNN--------------------
A7TRE4_VANPO/76-221--FILSAEFDNKLGPKVKFQYP-------------------NSIPGF.PSSLHGAHSLDS--------------------
C4R3J0_KOMPG/9-105--YILTAEFDKSKGIVITNQHP-------------------CE.........DDSWLLSS--------------------
C5DJD2_LACTC/32-162--YIISAEFDNKVGPVIKHQHP-------------------KPLAGF......KSSTSRS--------------------
B6HSJ1_PENRW/78-202--YILVASFHIDRGPIMEHQYP-------------------AAISG............DE--------------------
F0XQA1_GROCL/150-315--YILVASFDIDKGPIMEHQYP-------------------VAITG............DE--------------------
Q7RXB5_NEUCR/125-249--YILVASFDIDRGPVMEHQYP-------------------VAITG............DE--------------------
Q6CGA4_YARLI/12-94--YVLAAEFDIDAGPVVKYQYP-------------------DTLPG............DE--------------------
D2VRW9_NAEGR/63-215--YIFLAEFDIDKGSIVKVQYP-------------------SPYP.............YA--------------------
E7KUE5_YEASL/29-188--YIISAEFDNKLGPILKHQYP-------------------KDIPGFNQFSHEQRNGNTS--------------------
C1GKI9_PARBD/94-220--YILVASFHVDRGPIMEHQYP-------------------SAISG............DE--------------------
MESA_EMENI/82-211--FILVASFHIDRGPIMEHQYP-------------------GPISS............DE--------------------
F2TNB3_AJEDA/93-216--YILVASFHVDRGPIMEHQYP-------------------SAISG............DE--------------------
Q6CPS0_KLULA/31-167--FIIAAEFDNKSGPIIKHQYP-------------------KTIPGF......KTIGSDS--------------------
A2Q8P4_ASPNC/85-209--YILVASFHIDRGPIMEHQYP-------------------AAISG............DE--------------------
Q0V5R0_PHANO/113-243--YILVASFDIDRGSIMEHQYP-------------------AAISG............DE--------------------

PF02141

DEN4C_MOUSE/307-491NSNKCICLLSHWPFFEAF.KNFLMFIYKVSVSGPH............PLPIEKHISHFMQNIPFP---------------
DEN5A_HUMAN/202-390YVSKCICLITPMSFMKAC.RSVLEQLHQAVTSPQPP...........PLPLESYIYNVLYEVPLP---------------
DEN5B_HUMAN/187-375YVSKSICLITPLPFMQAC.KKFLIQLYKAVTSQQPP...........PLPLESYIHNILYEVPLP---------------
Q0US70_PHANO/395-592WIPRAYGVMGRDASLTPFWKEWLKAVVVPMTNGAILRVPASSPRIGMWQPLERYVVNLCAEALSP---------------
Q0UM90_PHANO/167-348WIPYCLSFLSRYPLYNLL.GDYLRGMWIHWNKAT..............NLFHAEEVSRILSFPAP---------------
Q54JA6_DICDI/110-305KILECLCIISHHAWSSTF.GSMLEILETRYRVSI..............DEIHNFLAASLLS.VIP---------------
Q55DD7_DICDI/109-294IEPICYCIISRKPFFKLF.DRVFIAIQEKYEIKSK.............NSIHNLLSA.LIAYPIP---------------
DEN2C_HUMAN/586-770RLPEVYCMVSRLGCFNLF.SKILDEVEKRREMSP..............ALVYPFMRS.VMEAPFP---------------
Q5RHZ1_DANRE/778-962RLPEVYCVISRLGCFNLF.SKILDEVERRRGISA..............ALVYPFMRS.VMESPFP---------------
A7RR72_NEMVE/298-481HTNKCICILSHWPFFEAF.KKFLSQLYRISVSAQQ.............IPIERYIANMMLDVPFP---------------
DEN4B_MOUSE/313-497RSRRAIAVLSRWPAFPAF.RAFLTFLYRYSVSGPH............RLPLEAHISHFIHNVPFP---------------
Q7PWX7_ANOGA/311-495HVNKSICILSRWPFGDTF.EKWLQFLHQLSILDEKL...........PVPIERYITHLLDEVPFP---------------
Q9W3D2_DROME/308-492HMIKAICLLSHHPFGDTF.DKWLKYLHRMVLYDVNI...........PIPVERYITQLLDEVPFP---------------
MTMRD_HUMAN/116-298FAPKSLVLVSRLYYPEIF.RACLGLIYTVYVDSLN.............VSLESLIANLCAC.LVP---------------
Q1LXZ0_DANRE/117-299YAPRSLVLVSRLDHTEVF.RNCLSLIYTVHVDGLT.............VPMETVIGNLLTC.IIP---------------
Q7KSP6_DROME/142-325YAPKCLVLISRLDCAETF.KNCLGTIYTVYIENLA.............YGLETLIGNILGCIQVP---------------
Q177S0_AEDAE/106-289YAPKCLVIVSRLDYIETF.RNCLGTIYTVYLESLK.............FHLHHLIGSILGCIQVP---------------
A7SZQ4_NEMVE/186-373MVSKCISIIMPLPFITAA.MSYLQQIYHAAKTADL............PLPLESYIYNLLYEVPLP---------------
Q54VP0_DICDI/908-1097YAPKCICVLSHFPFFSSF.RVALNEIYHRVFHNPS............PIPIERYIFNLVSEIQLP---------------
Q2GNY8_CHAGB/440-637WTPRAFGILGRDPAKMGFWKEWLRAVTVPMTDGAVMRISPSSPKVGRWQPLERYVINLCTEAFSP---------------
A7EF60_SCLS1/465-662WIPRAYGILGRDGSMTSFWKEWLKAVVVPMTDGGILRVPASSPKIGRWQPLERYVVNLCTEALSP---------------
Q0CL54_ASPTN/423-620WIPRAYGILGREENMTSFWKEWLKAVVVPMTDGGVQRIPPSSPRMGVWQPLERYVMNLCTEAFSP---------------
DENN_SCHPO/362-562WIPNAYGLLSKHSHLQSFCRDWLRIVCSSIQAEDLDFIPSSDLNSLKSLNLQSFVKNICCDVPLP---------------
DEND3_MOUSE/187-373FVPFAVCVVSRFPYYNSL.KDCLSCLLTHLKLCKDFE.........VDNHIKDFAAR.LSLIPSP---------------
A1Z7Q5_DROME/98-283RTNTAMVLITYLPWHDTF.LKLLPVLAELRRTDP..............NGFRTFLSE.AYNQGIP---------------
Q7Q1I7_ANOGA/88-273KSPTAMVIITYLPWHDTF.MRFLNVLADIRKNRP..............NEFASFLAE.SYNKGVP---------------
B8JLM2_DANRE/225-405.LPEAYCIISNVACFGLF.SKIFDEVEQRRKISM..............AMIYPFMQS.LREAAFP---------------
F1N1V1_BOVIN/150-332.LPRVYCIISCIGCFGLF.SKILDEVEKRHQISM..............AIIYPFMQG.LREAAFP---------------
F1QFB0_DANRE/165-345.LPEAYCIISHVACFGLF.SKIFDEVEKRRQIST..............AMIYPFMQS.LREAPLP---------------
A0A0R4ITV8_DANRE/306-489.VKKSICVLSHWPFFSVF.QKFLTFIYRYSISGPH............VLPLEKHISSFMHNVPFP---------------
F6SD79_XENTR/91-270..RSCLCILSCLPWFEHF.YKLLNNVAEYLAKDQA.............AEIWHLLQT.LYQHPVP---------------
F7CWX4_XENTR/145-326..PEVYCIISSLGCFGLF.AKILDEVEKRREIAT..............ALIYPFMQG.LREATFP---------------
H2UHI4_TAKRU/223-407YSNKSICLLSHWPFFQSF.RSFLTFLYRYSISGPH............ALPIEKHISHFMQTVPFP---------------
H3CCM9_TETNG/318-499.LPEVYCIVSRLGCFDLF.SKILDEVEKRRAISP..............ALVQPFMRG.IMEAPFP---------------
H3CZX5_TETNG/307-489.LPEVHCIVSKLGCFNLF.AKILEEIERRREVSP..............ALVYPFMRS.VMEAPFP---------------
H3D3K0_TETNG/203-391YVSKALCLFTPLPFLHAS.RQFLSQLHQAVASHSPP...........PLPLESYIHNILYEVPLP---------------
H3DM09_TETNG/192-375..AYSFCVISKYPYFTAL.KDCLTCLSIQLRTCCLSD.........MEETVKEFAAK.LALVPIP---------------
U4PB89_CAEEL/329-512..NVSICLISRFPFFNSF.KRFLFFLHRMSSTPSCS..........HPVPIERYISHLMYEVSFP---------------

PF09794

Q5KDB3_CRYNJ/119-499HNAETNIPTNQTL-----FGISCNRQLASSEL....HRRPSDVTRSMVQKAVIVIA-------------------SHP.I
Q7QF11_ANOGA/7-482....SLTDPEQSV-----YGISCYRQIALEEV....RIRTADLTRSTVQKSVCTLL-------------------SLP.I
Q29HH8_DROPS/14-480....SLFEPAASI-----YGVSCYRQIRVEKL....KIRTADVTRSTVQKSVCILS-------------------RQP.I
Q6BP02_DEBHA/131-552NSFDGDPRHLETL-----FGCSCVRQVKTSDLSDEEISRNKDITRSIVQKAVVVIA-------------------KNQPI
A5DNM6_PICGU/119-523DNFQGDPRHLRTL-----FGCSCVRQVKTSDLSDLEMARNKDITRSIVQKAIVVIA-------------------CNQPI
Q2H333_CHAGB/18-368....TSSAPATSL-----FGISCTRQMDASQL....LNRPAEVTRSTVQKAVVVIA-------------------DSPQH
AVL9_PONAB/16-520....PRNGNGATV-----FGISCYRQIEAKAL....KVRQADITRETVQKSVCVLS-------------------KLP.L
A0A0D1CNH7_USTMA/140-510....CSKLSPSTI-----FGISCNRQIAADAL....LKKGAEVTRSTVQKAIVVLA-------------------KQP.V
Q17GP2_AEDAE/7-476....SLTDPHESI-----YGISCYRQIPVEKL....KIRTAEMTRSTVQKAVCALL-------------------SIP.I
Q6C028_YARLI/516-899DGRPFNTQTVTTL-----FGIACNRQVGVTDA....LKQDLAVTRSTVQKCVVVIC-------------------RKP.I
Q54NJ9_DICDI/6-452....PTTSPSKKL-----YGLSYFKQKNKRDLP..KQAITPEDTRSSIQKSVVILS-------------------KFP.I
A1CPG6_ASPCL/9-384....TATEPATSL-----FGIACSRQIDSNLL....LNRPSDVTRSTVQKAVVVIT-------------------DTPQT
Q6FIU1_CANGA/8-406NELGENSENYTTV-----FAISCSRQIKSDEL....IAKDEDVTRSTVQKAVVVIS-------------------FEP.I
Q08D17_XENTR/21-516....PRCGDQKTV-----YGVSCYRQIEAKAL....KVRQADVTRETVQKSVCVLS-------------------QLP.L
Q6CKD3_KLULA/6-399LKDGDQSGRYSTF-----FAISCSKQIQSDTL....IKKPKDVIRSTVQKSLVVVC-------------------RKP.I
Q750W9_ASHGO/13-401EVEEDNVDECTTL-----FAISCSRQIKSEEL....LKKGVEVTRSTVQKSLVVIS-------------------RVP.I
AVL9_YEAST/9-401DLSDDSINDNTTL-----FAISCSRQIKSDEL....VTKDKDVTRSTVQKAIVVIS-------------------RQP.I
A3LPG1_PICST/85-492NDYQGDPRHLRTL-----FGCSCVRQVKTSDLSQEERDRNKDITRSIVQKAIVIIV-------------------RKQPI
AVL9_SCHPO/10-367....PFPNDEGTV-----FGLSCTRQLNASSL....KNIPSDVTRSSVQKAVVVIT-------------------TSP.P
Q5AIP1_CANAL/191-588NNFKGDPRHLKTL-----FGCSCVRQVKTSDLTEEERERNKDITRSIVQKAIVVIT-------------------RKQPI
A7TEK5_VANPO/8-400GLTEEERKECTTL-----FAVSCSQQISSEEL....LHKDKEVTRSTVQKAIVVVS-------------------YQP.I
H3CTF9_TETNG/13-493....PLGGDKKCV-----YGVSCYRQIEAKAL....KVRQADVTRETVQKSVCVLS-------------------RVP.L

PF09804

ANR2_YEAST/33-335----LDVCQT.AKTTTYDYGIAYFKQNSFDIIENDNRI..DRSKVQMFSLGVIIDVQNASSD...SKKHFYKEIYHAYAA
Q6FLQ0_CANGA/9-288----..YEQT.QY.....YGICCYLQNAFEVLDNEGQV..DRSKVKMYSLGVIVDPSQI.........SDDLRGFNYEVT
A7TLL1_VANPO/24-351----ETSSHD.HY.....YGVAYYRQNGQEIVKKGKQV..DRNEVKMYALGILIDPNLSLKCYPDDEIFSSRHHKYI.SC
Q75DG5_ASHGO/36-366----.KEDGE.FY.....YGVALFSQNGLRLVEEEQSHGVDRSRVEMYSLAVITDPQFRLDAMAESKYYRWKPNMFI.CA
A5DGT1_PICGU/16-298----..NDDK.ML.....YGLSQYRSVTEGDNESTETS.VDRSKVKMYSLGILCDPVSK..........SWKPNEYISTG
C5MJC0_CANTT/11-295----..FQDK.IY.....YGLSKFYQYIIGDDSSDR......SNVKMYALGVLCDSKPN..........PWKPNEFIRNG
A3LNE8_PICST/19-334----..HSDK.VY.....YGLGTFRQHIVGQNQPLD.....RSTVKVYSLGIICDPATKE.......SESWKPNEFISNG
Q6BJB8_DEBHA/28-311----..CDNT.VY.....YGLGRFRQRIVGADHESSQI..SRDDVKMYSLGILCESTPN.........PMWKSNEFINNG
B8M2T3_TALSN/30-332----....HE.EY.....AGICAFINQPAA.ETER........NALMLAVGVLVPL................SFGRLGKS
A2QAY7_ASPNC/31-357----....HE.QY.....AGISAFVNWPAE.EAER........NAKMFAIGVLVPL................SSGRLGKS
A1CNU9_ASPCL/30-339----....YE.QY.....AGISAFVNLPAD.EAER........NANMFAVGVLVPL................GSGRLGKS
Q5BF30_EMENI/30-339----....HD.QY.....AGISAFVNQPAD.ESER........NAKMFSIGVLVPL................SSGRLGKS
F2PVM8_TRIEC/26-326----....HD.RY.....IGLSAFINQPAG.EAQR........NAIMLSVGILAPL................SHGRLGRS
E9CY67_COCPS/13-322----....QD.DY.....AGLSAFVNQPAD.ESER........NALMLAVGVLVPL................SQGRLGKA
D5G5F9_TUBMM/21-341----....QA.PY.....AGISAFINTPAA.EAER........NACMLSVGVLVPL................SYGRLGRS
E3Q807_COLGM/29-348----....HDGEH.....AGLSAFINTPCDEEEAR........HARMIAVGVLVPL................SYGRLGRA
E9F1A8_METRA/37-350----.....DGAH.....AGLSAFVNEPCEEEEAR........NARMIAVGVLVPL................SYGRLGRA
C7YNX8_NECH7/29-347----....HDGGH.....AGLSAFVNMPCDEEEAR........HARMIAVGVLVPL................SYGRLGRA
Q0V1B2_PHANO/27-300----....HE.GY.....AGLSAFARGEAG.SEER........NANFVSVGVLARR.................DGILGRT
B3RV35_TRIAD/7-273----...NGQ.DL.....YGLSCFKRIQVDNQEER........GVRMKSVGILCKH....................FITL
LCHN_DANRE/114-382----....KG.CY.....FGLACFANMPVESELER........GARMKSVGILSPS....................YTLL
B7QCC0_IXOSC/54-313----....RG.NF.....YGLSCFENMKVENEKER........GARMKSIGVLAQS....................YSLL
F2UE85_SALR5/10-285----....AE.GM.....YMVSCFKTIK.DAQAAR........GLRACSVGVVCTS....................PDFL
YBAG_SCHPO/6-296----....FQ.DQ.....LCLSVFSKLQHPSFERS.........AFFTSVGLILSD................DINFGEAV
Q5K7R2_CRYNJ/10-298----....HH.DL.....PGVGLFRSREKPEGENRG......RGRTMGVVGVVLAEGD...........VADLYSSKSAL

PF08616

Q5KLM3_CRYNJ/384-496-----------.H-------------------------------------------------------------------
YG76_SCHPO/260-373-----------SP-------------------------------------------------------------------
A4I5V0_LEIIN/587-699-----------RY-------------------------------------------------------------------
A5DM71_PICGU/279-393-----------YN-------------------------------------------------------------------
A5DZ96_LODEL/271-385-----------LN-------------------------------------------------------------------
A7TRE4_VANPO/376-503-----------NQ-------------------------------------------------------------------
A8PX95_MALGO/354-466-----------LH-------------------------------------------------------------------
B0D0E4_LACBS/418-530-----------LH-------------------------------------------------------------------
C3ZXT1_BRAFL/180-291-----------EA-------------------------------------------------------------------
C4R3J0_KOMPG/305-418-----------FK-------------------------------------------------------------------
C5DJD2_LACTC/316-435-----------ND-------------------------------------------------------------------
C5DZH0_ZYGRC/269-391-----------DT-------------------------------------------------------------------
D2VRW9_NAEGR/366-475-----------QT-------------------------------------------------------------------
D2W4R6_NAEGR/470-587-----------GT-------------------------------------------------------------------
Q2URL2_ASPOR/377-488-----------IH-------------------------------------------------------------------
Q4DMT0_TRYCC/444-555-----------RY-------------------------------------------------------------------
A0A0D1DWU6_USTMA/366-478-----------IH-------------------------------------------------------------------
Q55D43_DICDI/566-679-----------DY-------------------------------------------------------------------
Q6BI40_DEBHA/264-378-----------HN-------------------------------------------------------------------
Q6CGA4_YARLI/272-384-----------VH-------------------------------------------------------------------
Q6CPS0_KLULA/322-444-----------NN-------------------------------------------------------------------
Q75BQ9_ASHGO/342-464-----------KD-------------------------------------------------------------------
E7QKR4_YEASZ/211-334-----------.E-------------------------------------------------------------------
Q23F93_TETTS/358-465-----------NA-------------------------------------------------------------------

PF07792

B2AXK1_PODAN/126-264--------------------------------------------------------------------------------
Q23F93_TETTS/4-94--------------------------------------------------------------------------------
A0C6F7_PARTE/4-152--------------------------------------------------------------------------------
Q75BQ9_ASHGO/52-189--------------------------------------------------------------------------------
A1CRY6_ASPCL/88-213--------------------------------------------------------------------------------
E9DDS1_COCPS/93-219--------------------------------------------------------------------------------
C4Y911_CLAL4/6-95--------------------------------------------------------------------------------
B8MHD8_TALSN/88-217--------------------------------------------------------------------------------
C5DZH0_ZYGRC/11-112--------------------------------------------------------------------------------
A7TRE4_VANPO/76-221--------------------------------------------------------------------------------
C4R3J0_KOMPG/9-105--------------------------------------------------------------------------------
C5DJD2_LACTC/32-162--------------------------------------------------------------------------------
B6HSJ1_PENRW/78-202--------------------------------------------------------------------------------
F0XQA1_GROCL/150-315--------------------------------------------------------------------------------
Q7RXB5_NEUCR/125-249--------------------------------------------------------------------------------
Q6CGA4_YARLI/12-94--------------------------------------------------------------------------------
D2VRW9_NAEGR/63-215--------------------------------------------------------------------------------
E7KUE5_YEASL/29-188--------------------------------------------------------------------------------
C1GKI9_PARBD/94-220--------------------------------------------------------------------------------
MESA_EMENI/82-211--------------------------------------------------------------------------------
F2TNB3_AJEDA/93-216--------------------------------------------------------------------------------
Q6CPS0_KLULA/31-167--------------------------------------------------------------------------------
A2Q8P4_ASPNC/85-209--------------------------------------------------------------------------------
Q0V5R0_PHANO/113-243--------------------------------------------------------------------------------

PF02141

DEN4C_MOUSE/307-491---------------------------------------------------------------------------SPQRP
DEN5A_HUMAN/202-390---------------------------------------------------------------------------PPGRS
DEN5B_HUMAN/187-375---------------------------------------------------------------------------PPGRS
Q0US70_PHANO/395-592---------------------------------------------------------------------------ITSIT
Q0UM90_PHANO/167-348---------------------------------------------------------------------------RLNDL
Q54JA6_DICDI/110-305---------------------------------------------------------------------------APGDS
Q55DD7_DICDI/109-294---------------------------------------------------------------------------KSSTT
DEN2C_HUMAN/586-770---------------------------------------------------------------------------APGRT
Q5RHZ1_DANRE/778-962---------------------------------------------------------------------------APGKT
A7RR72_NEMVE/298-481---------------------------------------------------------------------------SPQRP
DEN4B_MOUSE/313-497---------------------------------------------------------------------------SPQRP
Q7PWX7_ANOGA/311-495---------------------------------------------------------------------------SPSIL
Q9W3D2_DROME/308-492---------------------------------------------------------------------------APSIH
MTMRD_HUMAN/116-298---------------------------------------------------------------------------AAGGS
Q1LXZ0_DANRE/117-299---------------------------------------------------------------------------IAGGS
Q7KSP6_DROME/142-325---------------------------------------------------------------------------PAGGP
Q177S0_AEDAE/106-289---------------------------------------------------------------------------PPGGP
A7SZQ4_NEMVE/186-373---------------------------------------------------------------------------PPGRT
Q54VP0_DICDI/908-1097---------------------------------------------------------------------------RPGKN
Q2GNY8_CHAGB/440-637---------------------------------------------------------------------------LSSLT
A7EF60_SCLS1/465-662---------------------------------------------------------------------------LSSKT
Q0CL54_ASPTN/423-620---------------------------------------------------------------------------NSSKT
DENN_SCHPO/362-562---------------------------------------------------------------------------PKGLL
DEND3_MOUSE/187-373---------------------------------------------------------------------------PPGPL
A1Z7Q5_DROME/98-283---------------------------------------------------------------------------DCGGS
Q7Q1I7_ANOGA/88-273---------------------------------------------------------------------------EPGAC
B8JLM2_DANRE/225-405---------------------------------------------------------------------------APGNT
F1N1V1_BOVIN/150-332---------------------------------------------------------------------------APGKT
F1QFB0_DANRE/165-345---------------------------------------------------------------------------SPGST
A0A0R4ITV8_DANRE/306-489---------------------------------------------------------------------------SAQRP
F6SD79_XENTR/91-270---------------------------------------------------------------------------QANTA
F7CWX4_XENTR/145-326---------------------------------------------------------------------------APGKT
H2UHI4_TAKRU/223-407---------------------------------------------------------------------------SIQRP
H3CCM9_TETNG/318-499---------------------------------------------------------------------------APGRT
H3CZX5_TETNG/307-489---------------------------------------------------------------------------APGRT
H3D3K0_TETNG/203-391---------------------------------------------------------------------------PPGRS
H3DM09_TETNG/192-375---------------------------------------------------------------------------PPGQL
U4PB89_CAEEL/329-512---------------------------------------------------------------------------TPRRP

PF09794

Q5KDB3_CRYNJ/119-499FGPIRDRLGVVTRAYFAQRD--FAET--KLLEDFY-----TSLETG.LEGKSGEEA.-----------------------
Q7QF11_ANOGA/7-482YGYVEVKLSLIAQAFFEQGD--FSAT--EILVKAY-----EQLNAC.LVSLEPQEI.-----------------------
Q29HH8_DROPS/14-480YGYIEVKLALIADAFFDQGD--FSCT--ELLVKAY-----QQLNAC.LLDDESRRP.-----------------------
Q6BP02_DEBHA/131-552FQIIKEKLSIISASYFLQNN--FGNT--EILESLY-----DNLNTT.FRVKEKEGVI-----------------------
A5DNM6_PICGU/119-523FTKIKEKLSIITHSFLIQER--LDNY--ELLEHLF-----ENLNDS.FKPKVDRRLS-----------------------
Q2H333_CHAGB/18-368FGMLRERLSVVTKAWFLQRE--FTDV--EILRRFQ-----ESLADEKARG.LLHDD.-----------------------
AVL9_PONAB/16-520YGLLQAKLQLITHAYFEEKD--FSQI--SILKELY-----EHM....NSSLGGASL.-----------------------
A0A0D1CNH7_USTMA/140-510FGPIREKLGIVTRAFFAQGD--LANV--DILVDFH-----STLEIG.LQSGGMSED.-----------------------
Q17GP2_AEDAE/7-476YGYVEVKLSLIAHAFFEQGD--FSCT--DILVEAF-----EQQNACLYSMDPMVEL.-----------------------
Q6C028_YARLI/516-899WGPMKDKLAVVTRAFFMQPT--FDDK--SIIRSLF-----DSLAHT.LTLSKFNSD.-----------------------
Q54NJ9_DICDI/6-452FNSFKTQLSSATICYFNQGD--FQNT--DLLVTWF-----HAQNNE.FKERNNEKLV-----------------------
A1CPG6_ASPCL/9-384VGQLREKLSVVTSAWFAQRD--FSDT--DILKKFR-----EGLIIS.....WEQNE.-----------------------
Q6FIU1_CANGA/8-406FGQIKDKLSIVTNAFFRQKD--FSDR--AIISSLY-----DSLKAT.YMPSDVPSPA-----------------------
Q08D17_XENTR/21-516YGLLQAKLQLITHAYFEEKD--FSQI--SILKELY-----EHM....NGSLGGSAI.-----------------------
Q6CKD3_KLULA/6-399LGQIKDKLAIITNALFMQRD--FTDK--TIIDTLY-----SNLNSIEYDDHD.....-----------------------
Q750W9_ASHGO/13-401FGQIKDKLSIVTNALFLQRD--FSDT--SIIYTLY-----DNLRSM.FNSAASID..-----------------------
AVL9_YEAST/9-401FGQIKDKLSIVTNAFFLQHD--FGDR--KIIQSLY-----ENLKSI.YTPASLVRN.-----------------------
A3LPG1_PICST/85-492FTKIREKLSIITKSYFQQDN--FNNV--ELLENLF-----DNLNNT.FK.LIDNELE-----------------------
AVL9_SCHPO/10-367FGHIKDNLDIVTNAYFSQGD--FSNL--DVLRDFF-----HVLTRK...........-----------------------
Q5AIP1_CANAL/191-588FTKIKDKLSIIAKSYFQQET--FDNF--EILDNLF-----ENLNGQ.FK.LVDNEMH-----------------------
A7TEK5_VANPO/8-400FGQIRDKLSIVTNVFFSQKN--FTDR--SIIVSLY-----DNLQSL.FKPMTSTSL.-----------------------
H3CTF9_TETNG/13-493YGLLQAKLQLITHAYFEEKD--FSQI--SILKELY-----EHMN....GSLGGSAL.-----------------------

PF09804

ANR2_YEAST/33-335NRYSSYLESLL.GQWIRQRD..LDKF--DIFEKFF...........................................DE
Q6FLQ0_CANGA/9-288NQYIPELQSLL.KDWSTNQGSNSNSY--EQLSTYY.............................................
A7TLL1_VANPO/24-351NEYVGDLKKLL.SDWLQNEK..YDDF--STFESFY.....NTNKKTIVKADDGSSGS...................KTIR
Q75DG5_ASHGO/36-366NEYKEDLAQLM.EQWLKSK.....SL--EVLEHYFSYNKYQPDLGSPLLMRKWPGSS....................TLT
A5DGT1_PICGU/16-298WEHIESLDSTL.YTFLRLQS..WNDY--SVFEELH.............................................
C5MJC0_CANTT/11-295WEYVDSLNEKL.VQFVHSQQ..YDNF--KPIESVL.............................................
A3LNE8_PICST/19-334WEYIEVLDSTL.VHFLQTEQ..YDNF--DIFNQLY......................DRIL............SSEPHLP
Q6BJB8_DEBHA/28-311WEYINKLDDGL.EKFLNGND..YDNF--TIFDEVF.............................................
B8M2T3_TALSN/30-332WRHAAGLKNLA.KQCANNI....SDT--QPLAEYW.....DKHHVRDNEPRLEDTPPDSPAVLR.....RPLKTDRPETL
A2QAY7_ASPNC/31-357WRHAPKLKELA.ANYAEDM....SNT--QPLTEYW.....DNYEI..RETDASAMPPDSPMESPLS.LRLRAHGDLRDAV
A1CNU9_ASPCL/30-339WRHAPKLKELA.HVYAKDM....SNT--QILSDYW.....ETYEM..RTNGASAIPPDSPLESPL....SLRFRERPDSM
Q5BF30_EMENI/30-339WRHASKLKELA.QRYSESA....FST--NSLSEYW.....ETHEL...SANETSAAPDSPLDSPLS.LRMRAHSDRPDTL
F2PVM8_TRIEC/26-326WKHAAGLKELA.IQLATDP....DDT--QPLASYW.....DKHQL...RDSEGSSPPESPLEYMS....HPKPISVPPAK
E9CY67_COCPS/13-322WRHAASLKELA.RKLANDY....GDT--KPLADYW.....EAFQL...PNYHNESPPDSPLASISG..LKPKQSTPQGAF
D5G5F9_TUBMM/21-341WRHAENLKELA.KKFAANT....EDH--APLEEYY.....ELNRIHESTEAPESPAESPSSLRYRPSSRYKPPFDSLNRH
E3Q807_COLGM/29-348WRHAEGLKGIA.SKLAEDR....KNT--GLLDEYW.....EKNKA..KGGAEQERPALESPSISF...SAQASQPKTAHH
E9F1A8_METRA/37-350WRHAENLKELA.AILAKDR....SQT--SVLEKYW.....NSHKASENEGQPNDLGPGNLPDS........PTQERR.TH
C7YNX8_NECH7/29-347WRHAEALKEMA.AKLAEDR....KNT--SILEEYW.....TANRE..KQGQGNRRLSGETPVSSP...SLHSQPLGRKGH
Q0V1B2_PHANO/27-300WGAAGRLESIA.RTIAEDE.....GV--APLEEFW.....EEQTAHARQHDNT........................KGH
B3RV35_TRIAD/7-273HLHMPFLESEV.VKQLNSP....GNY--QRLQEYFTNNIDLNESLIQPYGSNTSVLK.......................
LCHN_DANRE/114-382YRYMHFLENQV.RHQLQCP....GQY--SPLEAFY.....EDKKAVLPSGGNGLVTA.......................
B7QCC0_IXOSC/54-313HLYKPFLQKQV.RHLLESP....GLY--SDLDQFY.....LKHCSRPTLEASSELSP.......................
F2UE85_SALR5/10-285HRHRSFLRDQCQKHLVTDD....DDY--SELKQYF.....EDQKAAEATNDQAAGARVV................EVRSP
YBAG_SCHPO/6-296VKYGETLLYIA.NGL.........SL--ATLKYKFGEDASETYASEKCTSHQLSDSDFFKSLQT......SAVNLEFDSL
Q5K7R2_CRYNJ/10-298KEIYDKLENLSQSPFISSVEQDGERE--KVLDEVW.....QKYRADKVKKLEAAMDE.......................

PF08616

Q5KLM3_CRYNJ/384-496--------------------------------------------------------------------------------
YG76_SCHPO/260-373--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_KOMPG/305-418--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
A0A0D1DWU6_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------
E7QKR4_YEASZ/211-334--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------

PF07792

B2AXK1_PODAN/126-264--------------------------------------------------------------------------------
Q23F93_TETTS/4-94--------------------------------------------------------------------------------
A0C6F7_PARTE/4-152--------------------------------------------------------------------------------
Q75BQ9_ASHGO/52-189--------------------------------------------------------------------------------
A1CRY6_ASPCL/88-213--------------------------------------------------------------------------------
E9DDS1_COCPS/93-219--------------------------------------------------------------------------------
C4Y911_CLAL4/6-95--------------------------------------------------------------------------------
B8MHD8_TALSN/88-217--------------------------------------------------------------------------------
C5DZH0_ZYGRC/11-112--------------------------------------------------------------------------------
A7TRE4_VANPO/76-221--------------------------------------------------------------------------------
C4R3J0_KOMPG/9-105--------------------------------------------------------------------------------
C5DJD2_LACTC/32-162--------------------------------------------------------------------------------
B6HSJ1_PENRW/78-202--------------------------------------------------------------------------------
F0XQA1_GROCL/150-315--------------------------------------------------------------------------------
Q7RXB5_NEUCR/125-249--------------------------------------------------------------------------------
Q6CGA4_YARLI/12-94--------------------------------------------------------------------------------
D2VRW9_NAEGR/63-215--------------------------------------------------------------------------------
E7KUE5_YEASL/29-188--------------------------------------------------------------------------------
C1GKI9_PARBD/94-220--------------------------------------------------------------------------------
MESA_EMENI/82-211--------------------------------------------------------------------------------
F2TNB3_AJEDA/93-216--------------------------------------------------------------------------------
Q6CPS0_KLULA/31-167--------------------------------------------------------------------------------
A2Q8P4_ASPNC/85-209--------------------------------------------------------------------------------
Q0V5R0_PHANO/113-243--------------------------------------------------------------------------------

PF02141

DEN4C_MOUSE/307-491RILIQ...LSVHDAFILSQPV.STPL..PL..SGA---------------------------------------------
DEN5A_HUMAN/202-390LKF.....SGVYGPIICQRPS.TNEL..PL..FDF---------------------------------------------
DEN5B_HUMAN/187-375LKF.....YGVYEPVICQRPG.PSEL..PL..SDY---------------------------------------------
Q0US70_PHANO/395-592QVE.....LAVRELRMYARKEALNEI..PG.SRNI---------------------------------------------
Q0UM90_PHANO/167-348VRI.....DMKDYALCYQFPSSPTGF......QNF---------------------------------------------
Q54JA6_DICDI/110-305FTVYIYDNPFISDKKPTNLPV.SYTLKRPVSTDKS---------------------------------------------
Q55DD7_DICDI/109-294IELTTTATNSATENWVFPFLKPRTNF......DHI---------------------------------------------
DEN2C_HUMAN/586-770ITVKSYLPGAGDESIELCRPL.DSRL......EHV---------------------------------------------
Q5RHZ1_DANRE/778-962IKVKTFLPGAGNEVIELRRPM.DSRL......EHV---------------------------------------------
A7RR72_NEMVE/298-481RILIE...MTRYEPFEISQLY.HSPL..PV..SGA---------------------------------------------
DEN4B_MOUSE/313-497RILVQ...MSPYDNLLLCQPV.SSPL..PL..SGA---------------------------------------------
Q7PWX7_ANOGA/311-495LQLST....LSNNRVLLTLPE.DSPL..PR..SGA---------------------------------------------
Q9W3D2_DROME/308-492LQLSS....ESNDRILLTQPE.DSPL..PR..SGA---------------------------------------------
MTMRD_HUMAN/116-298QKLFS...LGAGDRQLIQTPL.HDSL..PI..TGT---------------------------------------------
Q1LXZ0_DANRE/117-299QRTIT...LGAGDRQVIQTPI.NDSL..PV..SGC---------------------------------------------
Q7KSP6_DROME/142-325QVRFS...IGAGDKQSLQPPQ.SSSL..PT..TGS---------------------------------------------
Q177S0_AEDAE/106-289QVRFS...IGAGDKQVLQPPI.SPTI..PV..TGS---------------------------------------------
A7SZQ4_NEMVE/186-373MRF.....NCVKESITCQRPG.PNEL..PL..FDY---------------------------------------------
Q54VP0_DICDI/908-1097PVTFS...LGGLNQCLLKQPD.PCLL..PE..PDI---------------------------------------------
Q2GNY8_CHAGB/440-637QVE.....LGVRELRLYARKEAANEI..PG.SRTI---------------------------------------------
A7EF60_SCLS1/465-662QIE.....IAVRELRLFARKEAPNEL..PE.SRNT---------------------------------------------
Q0CL54_ASPTN/423-620QVE.....LAVRELRLFARKEAANEL..PG.SRNT---------------------------------------------
DENN_SCHPO/362-562QLQ.....VNVGPLNLYAFRSPVNEI..PG.WNDV---------------------------------------------
DEND3_MOUSE/187-373HLI......FNMKPLQVVFPS.RADPESPI..VDL---------------------------------------------
A1Z7Q5_DROME/98-283LKVYY...SAGQSHFTFERPL.QFQL..PSMPENH---------------------------------------------
Q7Q1I7_ANOGA/88-273LKLHY...DRASQTFLFQRPQ.QFQL..PSIPENH---------------------------------------------
B8JLM2_DANRE/225-405VNIKSFIPDRGTEIISLTRPT.DSWL......EHV---------------------------------------------
F1N1V1_BOVIN/150-332VTLKSFIPDSGTEFISLTRPL.DSHL......EHV---------------------------------------------
F1QFB0_DANRE/165-345VSISSFIPDAGTQIIRLTRPA.DSWL......EHV---------------------------------------------
A0A0R4ITV8_DANRE/306-489RILVQ...LSPYDNLLLCQPV.SSPL..PL..SGA---------------------------------------------
F6SD79_XENTR/91-270LSP........EMLSYFIAPD.PTRL..PSVPENR---------------------------------------------
F7CWX4_XENTR/145-326VKIKSFIPESGTEIIELTRPL.DCRL......EHI---------------------------------------------
H2UHI4_TAKRU/223-407RILVQ...LSPHDSLLLSQPV.SSPL..PL..SGG---------------------------------------------
H3CCM9_TETNG/318-499ITVKNFLPGSGTEVIELCRPS.DSRL......EHV---------------------------------------------
H3CZX5_TETNG/307-489VTVKSFLPGSGNEVITLCRPV.DSRL......EHV---------------------------------------------
H3D3K0_TETNG/203-391LRF.....HGVQGPIVCQRPG.PGEL..PM..GEY---------------------------------------------
H3DM09_TETNG/192-375HLAFH....LHPLTIVLPSKE.DKDH..PV..VDL---------------------------------------------
U4PB89_CAEEL/329-512RVFMQ....LGAENISFDSHD.DSQL..PL..NGA---------------------------------------------

PF09794

Q5KDB3_CRYNJ/119-499..............................MYMGT..SLR-----ELVHKFRHRTLVL-LKMLML-QKRIM---------
Q7QF11_ANOGA/7-482................G.STR........LHFVGV..PLR-----DLLLKWRHKILIL-FKLLLL-QKRVI---------
Q29HH8_DROPS/14-480..................LRH.........FHVGL..SLR-----EIVLHWRHKTLIL-FKLLLL-QRRVV---------
Q6BP02_DEBHA/131-552KDSTSKK.QSSLNEFVERQDE.........FFVNL..NLK-----HTLSKFKTNLLVI-FKALLL-EKKIL---------
A5DNM6_PICGU/119-523IDQE........ALRIEREDE.........FFVNL..NLK-----ETVTKFRHNFLTL-FKAMLL-EKKIL---------
Q2H333_CHAGB/18-368.................EDRD.........QYLGL..SLR-----ELVREFRWQTLVL-LKCCLL-QPK..---------
AVL9_PONAB/16-520.................EGSQ.........VYLGL..SPR-----DLVLHFRHKVLIL-FKLILL-EKKVL---------
A0A0D1CNH7_USTMA/140-510.................RETV.........MYMGT..SLR-----ELVHKWRFKTLML-VKLLLL-QRRVM---------
Q17GP2_AEDAE/7-476..................APAR.......LHFVGL..PLR-----DLVLKWRHKLLIL-YKLLML-QKRII---------
Q6C028_YARLI/516-899.................TSSD.........VSIGM..SLC-----ELVSRLKQKLVVV-FKALLL-EKRVL---------
Q54NJ9_DICDI/6-452INNSFGYQMNQVLENNNNNNKKLIPINSDFLFGSM..SLK-----KLIMHFGRNSLVF-FKLIML-ERGVV---------
A1CPG6_ASPCL/9-384.................ASKD.........QNLGL..SLR-----EMIHEFKYQTLVL-FKALLL-QPKML---------
Q6FIU1_CANGA/8-406N.............FSQRENQ.........LYVGL..CLR-----KILHDFNRNALVL-LKALLL-EKKIV---------
Q08D17_XENTR/21-516.................EGSQ.........LYLGL..SPR-----DLVLHFRHKILIL-FKLILL-EKKVL---------
Q6CKD3_KLULA/6-399..................ESH.........LYVGL..NLR-----KTVYDLRKEVLVI-LKAILL-EKKVL---------
Q750W9_ASHGO/13-401..................ESN.........LFVGL..SLR-----KIIHDFRREFLVI-LKAMLL-ERKII---------
AVL9_YEAST/9-401.................AENR.........LYIGL..CLR-----KILHDFKRNALVL-LKAIML-EKKII---------
A3LPG1_PICST/85-492ENTKFTYEFSEQQKSIAKEEE.........NFVNL..NLK-----NTILKFKANFLTI-FKSLLL-DKKIL---------
AVL9_SCHPO/10-367..................EQD.........VHIALNINLK-----SFLCEWRQNALVL-LKVLLL-GKRIL---------
Q5AIP1_CANAL/191-588T.............ELEQEEE.........NYVNL..NLK-----STVGKFRSRFLII-FKSLLL-EKKVL---------
A7TEK5_VANPO/8-400.................SDSN.........MYVGL..CLR-----KIILDFKKETLVL-FKALFL-EKKII---------
H3CTF9_TETNG/13-493.................EGSQ.........VYLGL..SPR-----DLILHFRHKVLIL-FKLILL-EKKVL---------

PF09804

ANR2_YEAST/33-335NNQGHMAENSVEVFEHSPKER---------RHLVE--YLP-----YWTRKLGPLIFPL-WKASLL-QSRIL---------
Q6FLQ0_CANGA/9-288......HKKISGSLNYEVDYQ---------TSMLN--HLP-----YWLNKLGPLIFPL-FKSCLL-RERIL---------
A7TLL1_VANPO/24-351SSELTDDIEDTPVPIANINNK---------LLMLE--HLP-----FWIKKIGPLIFPL-WKSCLL-NEKIL---------
Q75DG5_ASHGO/36-366GGSYEDYAQGSKDDAETFKPS---------KSWLY--LLP-----EIIEQLGPSIFTL-WKACLL-RQRIL---------
A5DGT1_PICGU/16-298...SSLTGSQLSPNPISPKTD---------HHLLS--ALP-----DLLDVLGPLVFVL-YKQCLL-RKRIM---------
C5MJC0_CANTT/11-295.......EGMDGLSPTGPNIN---------NHLLT--KLP-----EMFRTLGPLVFVL-YKQSLL-RKNIL---------
A3LNE8_PICST/19-334VSSSSSRFLSNSSVKLTPNVH---------HHLLT--KLP-----QMFKTVGPFIFAL-YKQSLL-RKRII---------
Q6BJB8_DEBHA/28-311...DNLTNTHLKVGKPNININ---------NHLLS--KLP-----LMFQSLGPLVFSL-FKQCLL-RKKVL---------
B8M2T3_TALSN/30-332QSRSSISDAAGIETTKPFLAP---------YHPAL--SLP-----DFVEKFGPLIFPL-YRASLL-RKRIL---------
A2QAY7_ASPNC/31-357HRTRAFSDAIVLETPRPALTP---------FHPAS--SLP-----NFLDSFGPLLFPL-YRAALL-RKRIL---------
A1CNU9_ASPCL/30-339HRNRTFSDALVLEASRPALTP---------FHPAS--SLP-----EFLDCFGPLIFPL-YRAALL-RKRIL---------
Q5BF30_EMENI/30-339QRNRAISDAMVLETSRPALTP---------FHPAS--SLP-----DFLDAFGPLLFPL-YRAALL-RRRVL---------
F2PVM8_TRIEC/26-326RRQRALSDATALISSR.TLPS---------YHPAL--TLP-----DFLDTFGPLIFPL-YRAALL-RKRIV---------
E9CY67_COCPS/13-322HRGRTLSDATALLTSKQLLAP---------YHPAL--CLP-----DFKDTLGPLIFPL-YRAALL-RKRIL---------
D5G5F9_TUBMM/21-341SRTRSISDTTALAAPGQALSP---------YHPAL--SLP-----EFVDTFGPLVFPL-YRAALT-RQRIL---------
E3Q807_COLGM/29-348SRNRSASDGASLLPYGHRLSP---------YHPAW--SLT-----ALLDTFGPLIFPI-HRAALL-RKRIL---------
E9F1A8_METRA/37-350KRKGSASDGTSLAQAEHRLSP---------FHPAW--SLV-----SLLDKFGPLIFPI-HRAALL-RKRIL---------
C7YNX8_NECH7/29-347NRNRSASDGASLIPTGNTLSP---------YHPAW--SLT-----SLLDKFGPLIFPI-HRAALL-RKRIL---------
Q0V1B2_PHANO/27-300SRARAISTVSAVTKDDERLPA---------YHPAL--SML-----KYLDVLGPLVFRL-QQAALL-RKRIL---------
B3RV35_TRIAD/7-273......VRLLISEYTEYHYSI---------THPAG--CFS-----QFIKFFGVKIFPL-WRLILL-QKKIL---------
LCHN_DANRE/114-382.CPTSALAPIVNRCMHPEMKI---------THPAG--CMS-----QFIRFFGEQIMVL-WKFALL-RKRIL---------
B7QCC0_IXOSC/54-313........YKTICDGMHSMQI---------THPAG--CFS-----QFLNYFGEKVFLL-WKFALL-KKRIL---------
F2UE85_SALR5/10-285VWNLDRSVVREAEHSNQILVL---------RHEEG--SLS-----ELVRRFGRRIMIL-WKLVLL-QKRVM---------
YBAG_SCHPO/6-296FEKLQGNKFAILGANSKELSQ---------SYA..--..T-----ILLDHLGPAFYCL-YKFALQ-RKRIL---------
Q5K7R2_CRYNJ/10-298GKENELDRVHKLITERGRVPS---------AHPIA--FMP-----LLLGLLGPNIVPV-YKAALS-GQRIL---------

PF08616

Q5KLM3_CRYNJ/384-496-------------------------------------AHL-----HTNGANTHPIILI.LNALLA-NKRVM---------
YG76_SCHPO/260-373-------------------------------------FMN-----TDISADINPINVL.ITALLI-SKKVL---------
A4I5V0_LEIIN/587-699-------------------------------------SLE-----SLIETLGPSSLHL.LLGILT-EKKIL---------
A5DM71_PICGU/279-393-------------------------------------NEL-----TIYGLQTPPIIVL.INALLT-GKRVI---------
A5DZ96_LODEL/271-385-------------------------------------NEL-----TIYGLQTPPIILL.INAVLT-GKKIL---------
A7TRE4_VANPO/376-503-------------------------------------KIL-----RFLSKFYPFINKL..TLQNF-SWRLI---------
A8PX95_MALGO/354-466-------------------------------------PHL-----HSNGVYTHPVTLL.FNALIT-HKRVL---------
B0D0E4_LACBS/418-530-------------------------------------PHL-----HTNGPQTHPIIIL.FNALVT-GKRII---------
C3ZXT1_BRAFL/180-291-------------------------------------DIF-----KCLHPVLPHVQML.WELVLT-TEPII---------
C4R3J0_KOMPG/305-418-------------------------------------SVL-----PYGVHNTPFIIAL.INALLQ-RKRII---------
C5DJD2_LACTC/316-435-------------------------------------HVL-----KFLLKFIPQLDEL..PRSRF-SWRLF---------
C5DZH0_ZYGRC/269-391-------------------------------------KIS-----KFLLNFIPLLHKR.DANDSF-HFKLV---------
D2VRW9_NAEGR/366-475-------------------------------------SLC-----RLVTNFKENTMLI.FNAILY-QKRIV---------
D2W4R6_NAEGR/470-587-------------------------------------SLV-----QLVQYFGLETMLVCWNALLL-DKRIM---------
Q2URL2_ASPOR/377-488-------------------------------------PHL-----TTSGPYTHPIIIL.VNAMLT-QKRVV---------
Q4DMT0_TRYCC/444-555-------------------------------------GLE-----QMVEVCGASFWTV.VMAILL-EKRVV---------
A0A0D1DWU6_USTMA/366-478-------------------------------------PHL-----HTNGPSTHPIIVL.FNALVT-QKRVV---------
Q55D43_DICDI/566-679-------------------------------------KVI-----GLVQKFGNDVMKI.FNGVLS-QKRII---------
Q6BI40_DEBHA/264-378-------------------------------------SEL-----TIYGQQTPPIIIL.INAILV-GKKII---------
Q6CGA4_YARLI/272-384-------------------------------------PQL-----TIFGPTTPPVIVL.INALLT-QKRVL---------
Q6CPS0_KLULA/322-444-------------------------------------SIL-----KLLARLIPLLTEI..PDSTY-SWRLI---------
Q75BQ9_ASHGO/342-464-------------------------------------HVL-----KFLRQFIPQISLL..DRNDP-SWRLM---------
E7QKR4_YEASZ/211-334-------------------------------------LVL-----KFLDKFVPYLLKA..GQKVN-AWKLV---------
Q23F93_TETTS/358-465-------------------------------------SLI-----DLIKRFQDQVMKI.WAAILK-EQRIL---------

PF07792

B2AXK1_PODAN/126-264-------------------------------------HM.-----.LAELMLPDQAHV-RNQ...-DWTVF.........
Q23F93_TETTS/4-94-------------------------------------IT.-----.LAAYMLPDGVQK-FDN...-DISVF.........
A0C6F7_PARTE/4-152-------------------------------------GFH-----ELASYMIPDGVHK-IKQ...-DKFFFRIGNVRFVS
Q75BQ9_ASHGO/52-189-------------------------------------NLS-----NLAGLMIPNGIEN-RPGES.-DFTTF.........
A1CRY6_ASPCL/88-213-------------------------------------SM.-----.LAELMLPDQTHV-RSQ...-DWTIF.........
E9DDS1_COCPS/93-219-------------------------------------HM.-----.LAELMLPDQTHV-RSQ...-DWTMF.........
C4Y911_CLAL4/6-95-------------------------------------GLQ-----YLPELMLPDQIHK-RPE...-DYTLF.........
B8MHD8_TALSN/88-217-------------------------------------GM.-----.LAELMLPDQTHV-RSQ...-DWTIF.........
C5DZH0_ZYGRC/11-112-------------------------------------AVF-----NLASLMIPNNAEY-NTGDEP-DTTVF.........
A7TRE4_VANPO/76-221-------------------------------------TI.-----NLASLMIPNNVEY-TPGKK.-DFTVF.........
C4R3J0_KOMPG/9-105-------------------------------------QLQ-----DISNVLMPSQLQH-SMNRE.-SITVF.........
C5DJD2_LACTC/32-162-------------------------------------ASV-----NLASLMIPNSAES-RPDVA.-DFTVF.........
B6HSJ1_PENRW/78-202-------------------------------------SM.-----.LAELMLPDQTHV-RSQ...-DWTMF.........
F0XQA1_GROCL/150-315-------------------------------------HM.-----.LAELMLPDQTHL-RNQ...-DWTMF.........
Q7RXB5_NEUCR/125-249-------------------------------------HM.-----.LAELMLPDQAHA-RNQ...-DWTIF.........
Q6CGA4_YARLI/12-94-------------------------------------QL.-----.MAELMLPDQSHV-RNQ...-DWTIF.........
D2VRW9_NAEGR/63-215-------------------------------------TEY-----SIANLMLPDGSHN-CIE...-DTTVF.........
E7KUE5_YEASL/29-188-------------------------------------VSM-----NLASLMIPSSIER-NPGKQ.-DITVF.........
C1GKI9_PARBD/94-220-------------------------------------NM.-----.LAELMLPDQTHV-RSQ...-DWTIF.........
MESA_EMENI/82-211-------------------------------------GM.-----.LAELMLPDQTHV-RSQ...-DWTIF.........
F2TNB3_AJEDA/93-216-------------------------------------HM.-----.LAELMLPDQTHV-RSQ...-DWTIF.........
Q6CPS0_KLULA/31-167-------------------------------------TCS-----HLASLMIPNSVEN-HPGKP.-DFTVF.........
A2Q8P4_ASPNC/85-209-------------------------------------SM.-----.LAELMLPDQTHV-RSQ...-DWTIF.........
Q0V5R0_PHANO/113-243-------------------------------------TM.-----.LAELMLPDQAHM-RNQ...-DWTIF.........

PF02141

DEN4C_MOUSE/307-491-------------------------------------NFS.....SLLMNLGPENCATLLLLVLL.ESKIL---------
DEN5A_HUMAN/202-390-------------------------------------PVK.....EVFELLGVENVFQLFTCALL.EFQIL---------
DEN5B_HUMAN/187-375-------------------------------------PLR.....EAFELLGLENLVQVFTCVLL.EMQIL---------
Q0US70_PHANO/395-592-------------------------------------DIY.....ALFRCLSIPNIVTLFEFVLS.ESRII---------
Q0UM90_PHANO/167-348-------------------------------------AMW.....PLFTCLSIPNIVGVIEAAVSPTRRII---------
Q54JA6_DICDI/110-305-------------------------------------SLHDGTLQPLIETLSSQKLLHLFISLLF.ERRVI---------
Q55DD7_DICDI/109-294-------------------------------------DYE......LIHKMNPAHIIRLFEFAIT.ESRVI---------
DEN2C_HUMAN/586-770-------------------------------------DFK.....CLFKCLSVCHLIRVCASLLL.ERRVI---------
Q5RHZ1_DANRE/778-962-------------------------------------DLE.....SLFNCLSVRQVVRVFASLLL.ERRVI---------
A7RR72_NEMVE/298-481-------------------------------------SYS.....AMLRHLGPDNCLLLFYLILT.EHKIL---------
DEN4B_MOUSE/313-497-------------------------------------SFL.....QLLQNLGPELAITLLLAVLT.EHKLL---------
Q7PWX7_ANOGA/311-495-------------------------------------GFR.....QLLSNLGPENCLHVLLLVLT.EQKLL---------
Q9W3D2_DROME/308-492-------------------------------------GFH.....ILLQNLGTDNCLHVLLLALT.EQKIL---------
MTMRD_HUMAN/116-298-------------------------------------SVA.....LLFQQLGIQNVLSLFCAVLT.ENKVL---------
Q1LXZ0_DANRE/117-299-------------------------------------SVA.....QLFRQLGIVNVLCLFCAALT.EHKIL---------
Q7KSP6_DROME/142-325-------------------------------------GVH.....FLFKQLGIKNVLILLCSVMT.ENKIL---------
Q177S0_AEDAE/106-289-------------------------------------CVS.....LLFHQLGIKNVMLLFCAVMT.EHKIL---------
A7SZQ4_NEMVE/186-373-------------------------------------SLK.....EMFSWLGVENVVELFTCVLL.EHQIL---------
Q54VP0_DICDI/908-1097-------------------------------------SYR.....MLFLSLDIRNVLSLIKCLLL.EEKIL---------
Q2GNY8_CHAGB/440-637-------------------------------------DIY.....ALFRCLSLENIVLLLECAMS.EARII---------
A7EF60_SCLS1/465-662-------------------------------------DIY.....ALFRALSIPNIVALVEFMLS.ESRII---------
Q0CL54_ASPTN/423-620-------------------------------------DLY.....ALFRTLSLSNIVILFEYALT.ESRII---------
DENN_SCHPO/362-562-------------------------------------DLY.....PLFRALSIPNILVLFEAALM.EAKVI---------
DEND3_MOUSE/187-373-------------------------------------DLH.....LPLLCFRPEKVLQILTCILT.EQRIV---------
A1Z7Q5_DROME/98-283-------------------------------------NLN.....LYYNFVEPKEMIAVFAAMLA.ERRII---------
Q7Q1I7_ANOGA/88-273-------------------------------------NLN.....QYYNFVEPKFMIGIFAAMLA.ERRII---------
B8JLM2_DANRE/225-405-------------------------------------DFR.....TLFRCLSDDEVLEVFASTVL.ERRII---------
F1N1V1_BOVIN/150-332-------------------------------------DFR.....SLMRCLSFEQILQIFASAVL.ERRII---------
F1QFB0_DANRE/165-345-------------------------------------DFT.....ALFSRLNDEELLLVFTAAVL.ERRII---------
A0A0R4ITV8_DANRE/306-489-------------------------------------SFV.....KLLQNLGPENTCSLLLAVLT.EHKLL---------
F6SD79_XENTR/91-270-------------------------------------NLT.....EFLVAVQVDTMLHLYSSLLC.ERRIL---------
F7CWX4_XENTR/145-326-------------------------------------DFK.....TLLQCLNSQIILHIFASVVL.ERRVI---------
H2UHI4_TAKRU/223-407-------------------------------------SLS.....TLLLNLGPKNAATLLVLAVT.EHKIL---------
H3CCM9_TETNG/318-499-------------------------------------DFE.....CLFSSLSLRLLLRVFTSLLL.ERRVI---------
H3CZX5_TETNG/307-489-------------------------------------DFD.....SLLQCLSVDKLLQVFASILL.ERRVI---------
H3D3K0_TETNG/203-391-------------------------------------PLG.....EAFSLLGVENMVKLLTCTLL.ETQIL---------
H3DM09_TETNG/192-375-------------------------------------DLH.....LPFFCLQPGQLLQVLSCLLQ.EQRIV---------
U4PB89_CAEEL/329-512-------------------------------------QLI.....DTLKYLGSENLMYLMLLALL.EQKIL---------

PF09794

Q5KDB3_CRYNJ/119-499--------------LF----G.Y-----------------PVEKLCTY------------------QYSLVSLIPGLLLN
Q7QF11_ANOGA/7-482--------------CY----G.S-----------------PVHPTCAL------------------ILGIASLHPELISK
Q29HH8_DROPS/14-480--------------CF----G.S-----------------PVRGMCVL------------------ILGMASLVPRLLEK
Q6BP02_DEBHA/131-552--------------IY----SNN-----------------NLEMLTQF------------------QNNLISLIPNLINN
A5DNM6_PICGU/119-523--------------IF----SNN-----------------NLESLTMF------------------QNNLISLVPNLIHN
Q2H333_CHAGB/18-368--------------..----...-----------------........------------------..............
AVL9_PONAB/16-520--------------FY----I.S-----------------PVNKLVGA------------------LMTVLSLFPGMIEH
A0A0D1CNH7_USTMA/140-510--------------FF----G.Y-----------------PVEQLCNY------------------QYSLVSLLPGLLLN
Q17GP2_AEDAE/7-476--------------CF----G.S-----------------PVQPTCAL------------------ILGVVSLHPELLSK
Q6C028_YARLI/516-899--------------FY----A.S-----------------STELLCTS------------------QFSLVSLIPNLINN
Q54NJ9_DICDI/6-452--------------VF----CPQ-----------------PVSPVSEA------------------IMSVLSLHSKSYDL
A1CPG6_ASPCL/9-384--------------FF----G.S-----------------RCERLCMI------------------QFSLISLIPGLINS
Q6FIU1_CANGA/8-406--------------FY----G.S-----------------NVEALCNL------------------QFGLISLIPNLLSS
Q08D17_XENTR/21-516--------------FY----V.S-----------------PVNRLVGA------------------LMTVLSLFPGMIEH
Q6CKD3_KLULA/6-399--------------FY----G.N-----------------DVEQLCNI------------------QFAFISLIPCLLSN
Q750W9_ASHGO/13-401--------------FY----G.S-----------------NVEELCSL------------------QFGFISLIPNLISN
AVL9_YEAST/9-401--------------VY----G.N-----------------DVEALCNL------------------QFGLISLIPDLMSN
A3LPG1_PICST/85-492--------------IF----SNS-----------------SLEMLTQF------------------QNNLISLIPNLINN
AVL9_SCHPO/10-367--------------VY----D.K-----------------SAERLGNF------------------QYSLLSLIPCMMSH
Q5AIP1_CANAL/191-588--------------IY----SNN-----------------NLEALTQF------------------QNNMLSLMPNLINN
A7TEK5_VANPO/8-400--------------FY----G.N-----------------NVESLCNL------------------QFGLISLIPNLISN
H3CTF9_TETNG/13-493--------------FY----V.S-----------------PVSRLVGA------------------LMTVLSLFPGMIEH

PF09804

ANR2_YEAST/33-335--------------ILVPQGESF...................ELCNSL................AYCVFLISMLPKNLIG
Q6FLQ0_CANGA/9-288--------------VISAPGNSF...................EYTNSL................LYCLATISRNSKLNMG
A7TLL1_VANPO/24-351--------------ILNPLGGSF...................ELCNSL................VYCISLISLIHKKNMK
Q75DG5_ASHGO/36-366--------------VVNEHGQSF...................ERTNAL................TYCLSVLSLIPLQLER
A5DGT1_PICGU/16-298--------------LFHHDPVIL.................SNYTAGAF................TYLLSLISLISQDTET
C5MJC0_CANTT/11-295--------------IFNQHTKAHDDQDL......LPNGEDHLFSISSY................CYLLSLLSIIPQDIEL
A3LNE8_PICST/19-334--------------FFAKNHRHHLLDKESIENDSDSVENDIYFNHSAF................TYLLSLISVIPHDIET
Q6BJB8_DEBHA/28-311--------------IFHQNHSKI.................DNFSSGAF................TYLLSLLSMIPNDIKI
B8M2T3_TALSN/30-332--------------IV....TEA.................PVQSTCDY................VYALALLSSLPQSLSP
A2QAY7_ASPNC/31-357--------------FM....AEA.................PVHEPCSYGMITIQSLSTNTYSQLVYDLSLLASLPNSLLP
A1CNU9_ASPCL/30-339--------------LM....AEA.................PVHIPCNFD..............AVYDLSLLASLPYSLLP
Q5BF30_EMENI/30-339--------------FM....AEA.................PVQVPCNY................VYDLSLLASLPNSLLP
F2PVM8_TRIEC/26-326--------------FL....GDA.................PVESSCNF................IYNISLLSSLPQNLLS
E9CY67_COCPS/13-322--------------FL....GDA.................PVETSCNF................VYDLALLSSLPQTLSP
D5G5F9_TUBMM/21-341--------------LI....TGA.................PVELACNF................VYDISILSNIPLSVAD
E3Q807_COLGM/29-348--------------IS....CHA.................PVREICNF................VYNISVLSNIPHTVTE
E9F1A8_METRA/37-350--------------IS....CHA.................PVHEICDF................VYDISILSNIPFSVAD
C7YNX8_NECH7/29-347--------------IS....CHA.................PVHEICDF................VYNISVLSNIPLSVTD
Q0V1B2_PHANO/27-300--------------FV....GGP.................PVRAMCEF................VYILSILSSLSARDSE
B3RV35_TRIAD/7-273--------------FY....SPP.................PVGIACYR................VYCCSLLSSSSISLRE
LCHN_DANRE/114-382--------------IF....SPP.................PVGVVCYR................VYCCCCLANVSIPGMG
B7QCC0_IXOSC/54-313--------------FF....SPP.................PIGVVCYR................VYCTSTLVAHVYPDIE
F2UE85_SALR5/10-285--------------FL....TSP.................PVDPQCQQ................VYACCALGSHTIASFA
YBAG_SCHPO/6-296--------------LI....SSH.................D.DQLYSI................IDMIVRLSSIKRSSDA
Q5K7R2_CRYNJ/10-298--------------LY....SQP.................PVLPLSAL................AWNIWALSLPPRAALA

PF08616

Q5KLM3_CRYNJ/384-496--------------FL----GHG----------------LPANQVARM------------------VLAACALGSG..CG
YG76_SCHPO/260-373--------------FL----TKT----------------SSASVLADF------------------VLSSCALVSG..AT
A4I5V0_LEIIN/587-699--------------IL----SRK----------------GEAADVCEA------------------ALSLGIIGNMLDRD
A5DM71_PICGU/279-393--------------FL----SYE----------------NSSGYIIDS------------------ILLALKLITG...G
A5DZ96_LODEL/271-385--------------FL----SYE----------------NSAGHIIDH------------------VLLLLKIVTG...G
A7TRE4_VANPO/376-503--------------IN----STT----------------FSKDELSHF------------------ILVLSNYVNSCFDC
A8PX95_MALGO/354-466--------------FV----AYH----------------SPATVVVEH------------------VLAACALVSG..CG
B0D0E4_LACBS/418-530--------------FL----GHK----------------RPAGEVSSF------------------VLSACALGSG..CG
C3ZXT1_BRAFL/180-291--------------VM----APS----------------PTV..CSET------------------VLALTSMISPLNFC
C4R3J0_KOMPG/305-418--------------VY----SYS----------------RSCNELLEF------------------IMAYFIIVE....N
C5DJD2_LACTC/316-435--------------VN----STK----------------LPKDTLCQF------------------ILSLSNFIK....H
C5DZH0_ZYGRC/269-391--------------IY----SSQ----------------YKGSGLSQF------------------AIALSNLMGL...T
D2VRW9_NAEGR/366-475--------------FF----SGQ----------------QLAGQVVNT------------------LLSSLVMFPFLHDL
D2W4R6_NAEGR/470-587--------------VI----GSP----------------AKL..VSQI------------------CLTLPLLIYP....
Q2URL2_ASPOR/377-488--------------FL----GHN----------------RPSGEVAEA------------------VLAACALAS....G
Q4DMT0_TRYCC/444-555--------------VL----SRQ----------------GLANDVCEA------------------ALSLGLIGNLLDPH
A0A0D1DWU6_USTMA/366-478--------------FL----GYG----------------QPASHVAGF------------------VLAACALGSG..CG
Q55D43_DICDI/566-679--------------FL----GYG----------------CGADEICNY------------------VLAACSMVCPPLKG
Q6BI40_DEBHA/264-378--------------FL----SYD----------------NSAGYIINN------------------ILLMLKIITG...G
Q6CGA4_YARLI/272-384--------------FI----GYN----------------TPSGDVADH------------------VLAACFLASG...G
Q6CPS0_KLULA/322-444--------------IN----STE----------------RSKDELCQF------------------VLALSNLIN....G
Q75BQ9_ASHGO/342-464--------------VN----STT----------------LSKDSLCQF------------------VLALSNFINA...F
E7QKR4_YEASZ/211-334--------------IN----STK----------------LSKEDLCAF------------------ILSLANITAT.YAS
Q23F93_TETTS/358-465--------------FV----GYD----------------KSIRECVNF------------------ASSIQLLALP...L

PF07792

B2AXK1_PODAN/126-264..............FL-----------------------HKDSSQEED------------------DAERQAK.......
Q23F93_TETTS/4-94................-----------------------.........------------------..............
A0C6F7_PARTE/4-152GQVQTYHFDYQWKPLL-----------------------QSSNQTLSY------------------SD............
Q75BQ9_ASHGO/52-189..............IL-----------------------YKDRYAQTF------------------QLFPNDNA...KGS
A1CRY6_ASPCL/88-213..............FL-----------------------HKDTSTEED------------------...EDGS.......
E9DDS1_COCPS/93-219..............FL-----------------------HRDAGSEDE------------------NEYGDDS.......
C4Y911_CLAL4/6-95..............LL-----------------------YVNSL....------------------..............
B8MHD8_TALSN/88-217..............FL-----------------------HKDTESDDE------------------DAERESP.......
C5DZH0_ZYGRC/11-112..............ML-----------------------YRNRETVKY------------------ELF...........
A7TRE4_VANPO/76-221..............ML-----------------------YYNTSTKLY------------------QLF...........
C4R3J0_KOMPG/9-105..............PI-----------------------YSTYSDVEF------------------E.............
C5DJD2_LACTC/32-162..............IL-----------------------YKDKYTRNY------------------HVFPIADS...K..
B6HSJ1_PENRW/78-202..............FL-----------------------HKDTSGDEE------------------...TDSA.......
F0XQA1_GROCL/150-315..............FL-----------------------HKDTTPEEE------------------DQERLEK.......
Q7RXB5_NEUCR/125-249..............FL-----------------------HKDSSREED------------------EADRQAK.......
Q6CGA4_YARLI/12-94..............FL-----------------------HDE......------------------..............
D2VRW9_NAEGR/63-215..............FL-----------------------RGNNEINNN------------------HHNENNTSASSLNN
E7KUE5_YEASL/29-188..............TL-----------------------YYNKFTQNY------------------QLFPVPKDPRFSFN
C1GKI9_PARBD/94-220..............FL-----------------------HKDAGSEEE------------------QECGDSS.......
MESA_EMENI/82-211..............FL-----------------------PLDTGGEGE------------------EDDLAGE.......
F2TNB3_AJEDA/93-216..............FL-----------------------HKDAGSEEE------------------NEYVEPT.......
Q6CPS0_KLULA/31-167..............VL-----------------------YKNQNV..Y------------------QLFPVSKN...K..
A2Q8P4_ASPNC/85-209..............FL-----------------------HKDTSADAD------------------..EDDAS.......
Q0V5R0_PHANO/113-243..............FL-----------------------HKDTTAEEE------------------EREERRE.......

PF02141

DEN4C_MOUSE/307-491--------------LH----------------------SLRPAVLTGV------------------AEAVVAMIFPFQWQ
DEN5A_HUMAN/202-390--------------LY----------------------SQHYQRLMTV------------------AETITALMFPFQWQ
DEN5B_HUMAN/187-375--------------LY----------------------SQDYQRLMTV------------------AEGITTLLFPFQWQ
Q0US70_PHANO/395-592--------------LL----------------------SSHTAMLHLA------------------SMAIVNLLYPFQWA
Q0UM90_PHANO/167-348--------------FT----------------------SHYPAMLTIA------------------AETVRFCVRVYEWS
Q54JA6_DICDI/110-305--------------IY----------------------SENINRVSKF------------------INAIVSLLDPFAWQ
Q55DD7_DICDI/109-294--------------LL----------------------SKDISVVSNG------------------ILALSSLLSPLVWQ
DEN2C_HUMAN/586-770--------------FV----------------------ANSLSTLSKC------------------GHAVVATLYPFTWQ
Q5RHZ1_DANRE/778-962--------------FV----------------------ADKLSTLSSC------------------VHAVVALLYPFSWQ
A7RR72_NEMVE/298-481--------------IH----------------------SLRPALLTSV------------------AEALTNVLFPFTWQ
DEN4B_MOUSE/313-497--------------VH----------------------SLRPDLLTSV------------------CEALVSMIFPLHWQ
Q7PWX7_ANOGA/311-495--------------IH----------------------SLRPAILTAV------------------AEAVSSFLFPFKWQ
Q9W3D2_DROME/308-492--------------IH----------------------SLRPATLTAV------------------AEAIVSLLFPFKWQ
MTMRD_HUMAN/116-298--------------FH----------------------SASFQRLSDA------------------CRALESLMFPLKYS
Q1LXZ0_DANRE/117-299--------------FL----------------------SSSYQRLTDA------------------CRALLAIMFPLKYS
Q7KSP6_DROME/142-325--------------FL----------------------SKCYWHLTDS------------------CRALVALMYPFRYT
Q177S0_AEDAE/106-289--------------FH----------------------STSYSRLTDS------------------CRALTALMYPFRYS
A7SZQ4_NEMVE/186-373--------------LL----------------------SNSFHRFMLV------------------AEGVVTLIFPFIWQ
Q54VP0_DICDI/908-1097--------------II----------------------SSQYTLLTYI------------------CEIITTLIHPLVYT
Q2GNY8_CHAGB/440-637--------------FL----------------------SSHTGMLHLA------------------CHALANLLYPLKWA
A7EF60_SCLS1/465-662--------------LL----------------------SSHTAMLHLA------------------SKALVSLLYPLKWA
Q0CL54_ASPTN/423-620--------------FL----------------------SSHTSMLYLA------------------TRALVDLLFPITWT
DENN_SCHPO/362-562--------------FL----------------------SENLGMLGYA------------------SQALLHLLYPLTWQ
DEND3_MOUSE/187-373--------------FF----------------------SSDWALLTLM------------------AECFVAYLHPLQWQ
A1Z7Q5_DROME/98-283--------------FT----------------------SRHLDRLSSC------------------IQAANAFLYPMVWQ
Q7Q1I7_ANOGA/88-273--------------FV----------------------SRRLDILSSC------------------VQAANAFLYPMVWQ
B8JLM2_DANRE/225-405--------------FI----------------------AEELGTLSQV------------------IHAVAVLLYPFIWQ
F1N1V1_BOVIN/150-332--------------FL----------------------AEGLSTLSQC------------------IHATAALLYPFSWA
F1QFB0_DANRE/165-345--------------FI----------------------SEELSTLSQV------------------LHAVAALLYPFVWQ
A0A0R4ITV8_DANRE/306-489--------------LH----------------------SLRPDVLTSV------------------SEALLSMTFPLRWH
F6SD79_XENTR/91-270--------------IT----------------------SSKLSTLTAC------------------VHASAALLYPMYWQ
F7CWX4_XENTR/145-326--------------LV----------------------ARDLSILSEC------------------IHAVVALLYPFAWE
H2UHI4_TAKRU/223-407--------------VH----------------------SLRPAVLTSV------------------TEALVSMIFPFHWP
H3CCM9_TETNG/318-499--------------FT----------------------ADKLSTLSQC------------------CHAIVALLYPFTWQ
H3CZX5_TETNG/307-489--------------LI----------------------ADKLSVLSRC------------------CHAVLALLYPFTWQ
H3D3K0_TETNG/203-391--------------LY----------------------SQDYQRLMTV------------------SESVTTLLFPFQWQ
H3DM09_TETNG/192-375--------------LF----------------------SADFARLTLV------------------AESFLLFLQPLSWQ
U4PB89_CAEEL/329-512--------------IH----------------------SLRPWMLAAV------------------AESVCALMFPFHWQ

PF09794

Q5KDB3_CRYNJ/119-499.LRDSG..........................................................................
Q7QF11_ANOGA/7-482GFQQVACVKTSRPMSPMPTFSTPVEEQHGDAPPCRTTLPAIVTEQEAPHEPIAPCREADELLTDPDGRSIASAKEAALEE
Q29HH8_DROPS/14-480GFQEVACVRTSRPLSPMPDFTDSLQREALALAAAEAEAEAATQD...........................EPKLTPESA
Q6BP02_DEBHA/131-552.LGNSG..........................................................................
A5DNM6_PICGU/119-523.LADSS..........................................................................
Q2H333_CHAGB/18-368...DSA..........................................................................
AVL9_PONAB/16-520GLSDCSQYRPRKSMSEDGGLQESNPCADDFVSASTADVSHTNLGTVR....................KVIAGNHGEDAAM
A0A0D1CNH7_USTMA/140-510.LQDAG..........................................................................
Q17GP2_AEDAE/7-476GFQEVACVKTSRPMSPMPNFGTPLDETQKFPSEPTSP........................................VKE
Q6C028_YARLI/516-899.LQDCG..........................................................................
Q54NJ9_DICDI/6-452.LFSTN..........................................................................
A1CPG6_ASPCL/9-384.LQDCA..........................................................................
Q6FIU1_CANGA/8-406.LQTSA..........................................................................
Q08D17_XENTR/21-516GLTDSSQYRPRKSMSEDIEYPLVTYSDDCTSLAASGLNAKQ................................ENQGPNR
Q6CKD3_KLULA/6-399.IQDCG..........................................................................
Q750W9_ASHGO/13-401.LQDCG..........................................................................
AVL9_YEAST/9-401.LQDSG..........................................................................
A3LPG1_PICST/85-492.LDNSG..........................................................................
AVL9_SCHPO/10-367.LQDVS..........................................................................
Q5AIP1_CANAL/191-588.LDDSG..........................................................................
A7TEK5_VANPO/8-400.LQNSG..........................................................................
H3CTF9_TETNG/13-493GLVDSSSYRPRNSLSEDSSLEESVSGAEEFVSVSVTDL......................................DNAA

PF09804

ANR2_YEAST/33-335--------------------------------------------------------------------------------
Q6FLQ0_CANGA/9-288--------------------------------------------------------------------------------
A7TLL1_VANPO/24-351--------------------------------------------------------------------------------
Q75DG5_ASHGO/36-366--------------------------------------------------------------------------------
A5DGT1_PICGU/16-298--------------------------------------------------------------------------------
C5MJC0_CANTT/11-295--------------------------------------------------------------------------------
A3LNE8_PICST/19-334--------------------------------------------------------------------------------
Q6BJB8_DEBHA/28-311--------------------------------------------------------------------------------
B8M2T3_TALSN/30-332--------------------------------------------------------------------------------
A2QAY7_ASPNC/31-357--------------------------------------------------------------------------------
A1CNU9_ASPCL/30-339--------------------------------------------------------------------------------
Q5BF30_EMENI/30-339--------------------------------------------------------------------------------
F2PVM8_TRIEC/26-326--------------------------------------------------------------------------------
E9CY67_COCPS/13-322--------------------------------------------------------------------------------
D5G5F9_TUBMM/21-341--------------------------------------------------------------------------------
E3Q807_COLGM/29-348--------------------------------------------------------------------------------
E9F1A8_METRA/37-350--------------------------------------------------------------------------------
C7YNX8_NECH7/29-347--------------------------------------------------------------------------------
Q0V1B2_PHANO/27-300--------------------------------------------------------------------------------
B3RV35_TRIAD/7-273--------------------------------------------------------------------------------
LCHN_DANRE/114-382--------------------------------------------------------------------------------
B7QCC0_IXOSC/54-313--------------------------------------------------------------------------------
F2UE85_SALR5/10-285--------------------------------------------------------------------------------
YBAG_SCHPO/6-296--------------------------------------------------------------------------------
Q5K7R2_CRYNJ/10-298--------------------------------------------------------------------------------

PF08616

Q5KLM3_CRYNJ/384-496--------------------------------------------------------------------------------
YG76_SCHPO/260-373--------------------------------------------------------------------------------
A4I5V0_LEIIN/587-699--------------------------------------------------------------------------------
A5DM71_PICGU/279-393--------------------------------------------------------------------------------
A5DZ96_LODEL/271-385--------------------------------------------------------------------------------
A7TRE4_VANPO/376-503--------------------------------------------------------------------------------
A8PX95_MALGO/354-466--------------------------------------------------------------------------------
B0D0E4_LACBS/418-530--------------------------------------------------------------------------------
C3ZXT1_BRAFL/180-291--------------------------------------------------------------------------------
C4R3J0_KOMPG/305-418--------------------------------------------------------------------------------
C5DJD2_LACTC/316-435--------------------------------------------------------------------------------
C5DZH0_ZYGRC/269-391--------------------------------------------------------------------------------
D2VRW9_NAEGR/366-475--------------------------------------------------------------------------------
D2W4R6_NAEGR/470-587--------------------------------------------------------------------------------
Q2URL2_ASPOR/377-488--------------------------------------------------------------------------------
Q4DMT0_TRYCC/444-555--------------------------------------------------------------------------------
A0A0D1DWU6_USTMA/366-478--------------------------------------------------------------------------------
Q55D43_DICDI/566-679--------------------------------------------------------------------------------
Q6BI40_DEBHA/264-378--------------------------------------------------------------------------------
Q6CGA4_YARLI/272-384--------------------------------------------------------------------------------
Q6CPS0_KLULA/322-444--------------------------------------------------------------------------------
Q75BQ9_ASHGO/342-464--------------------------------------------------------------------------------
E7QKR4_YEASZ/211-334--------------------------------------------------------------------------------
Q23F93_TETTS/358-465--------------------------------------------------------------------------------

PF07792

B2AXK1_PODAN/126-264--------------------------------------------------------------------------------
Q23F93_TETTS/4-94--------------------------------------------------------------------------------
A0C6F7_PARTE/4-152--------------------------------------------------------------------------------
Q75BQ9_ASHGO/52-189--------------------------------------------------------------------------------
A1CRY6_ASPCL/88-213--------------------------------------------------------------------------------
E9DDS1_COCPS/93-219--------------------------------------------------------------------------------
C4Y911_CLAL4/6-95--------------------------------------------------------------------------------
B8MHD8_TALSN/88-217--------------------------------------------------------------------------------
C5DZH0_ZYGRC/11-112--------------------------------------------------------------------------------
A7TRE4_VANPO/76-221--------------------------------------------------------------------------------
C4R3J0_KOMPG/9-105--------------------------------------------------------------------------------
C5DJD2_LACTC/32-162--------------------------------------------------------------------------------
B6HSJ1_PENRW/78-202--------------------------------------------------------------------------------
F0XQA1_GROCL/150-315--------------------------------------------------------------------------------
Q7RXB5_NEUCR/125-249--------------------------------------------------------------------------------
Q6CGA4_YARLI/12-94--------------------------------------------------------------------------------
D2VRW9_NAEGR/63-215--------------------------------------------------------------------------------
E7KUE5_YEASL/29-188--------------------------------------------------------------------------------
C1GKI9_PARBD/94-220--------------------------------------------------------------------------------
MESA_EMENI/82-211--------------------------------------------------------------------------------
F2TNB3_AJEDA/93-216--------------------------------------------------------------------------------
Q6CPS0_KLULA/31-167--------------------------------------------------------------------------------
A2Q8P4_ASPNC/85-209--------------------------------------------------------------------------------
Q0V5R0_PHANO/113-243--------------------------------------------------------------------------------

PF02141

DEN4C_MOUSE/307-491--------------------------------------------------------------------------------
DEN5A_HUMAN/202-390--------------------------------------------------------------------------------
DEN5B_HUMAN/187-375--------------------------------------------------------------------------------
Q0US70_PHANO/395-592--------------------------------------------------------------------------------
Q0UM90_PHANO/167-348--------------------------------------------------------------------------------
Q54JA6_DICDI/110-305--------------------------------------------------------------------------------
Q55DD7_DICDI/109-294--------------------------------------------------------------------------------
DEN2C_HUMAN/586-770--------------------------------------------------------------------------------
Q5RHZ1_DANRE/778-962--------------------------------------------------------------------------------
A7RR72_NEMVE/298-481--------------------------------------------------------------------------------
DEN4B_MOUSE/313-497--------------------------------------------------------------------------------
Q7PWX7_ANOGA/311-495--------------------------------------------------------------------------------
Q9W3D2_DROME/308-492--------------------------------------------------------------------------------
MTMRD_HUMAN/116-298--------------------------------------------------------------------------------
Q1LXZ0_DANRE/117-299--------------------------------------------------------------------------------
Q7KSP6_DROME/142-325--------------------------------------------------------------------------------
Q177S0_AEDAE/106-289--------------------------------------------------------------------------------
A7SZQ4_NEMVE/186-373--------------------------------------------------------------------------------
Q54VP0_DICDI/908-1097--------------------------------------------------------------------------------
Q2GNY8_CHAGB/440-637--------------------------------------------------------------------------------
A7EF60_SCLS1/465-662--------------------------------------------------------------------------------
Q0CL54_ASPTN/423-620--------------------------------------------------------------------------------
DENN_SCHPO/362-562--------------------------------------------------------------------------------
DEND3_MOUSE/187-373--------------------------------------------------------------------------------
A1Z7Q5_DROME/98-283--------------------------------------------------------------------------------
Q7Q1I7_ANOGA/88-273--------------------------------------------------------------------------------
B8JLM2_DANRE/225-405--------------------------------------------------------------------------------
F1N1V1_BOVIN/150-332--------------------------------------------------------------------------------
F1QFB0_DANRE/165-345--------------------------------------------------------------------------------
A0A0R4ITV8_DANRE/306-489--------------------------------------------------------------------------------
F6SD79_XENTR/91-270--------------------------------------------------------------------------------
F7CWX4_XENTR/145-326--------------------------------------------------------------------------------
H2UHI4_TAKRU/223-407--------------------------------------------------------------------------------
H3CCM9_TETNG/318-499--------------------------------------------------------------------------------
H3CZX5_TETNG/307-489--------------------------------------------------------------------------------
H3D3K0_TETNG/203-391--------------------------------------------------------------------------------
H3DM09_TETNG/192-375--------------------------------------------------------------------------------
U4PB89_CAEEL/329-512--------------------------------------------------------------------------------

PF09794

Q5KDB3_CRYNJ/119-499.............................SPALEQKRSK...VRPTSLRTSDRTS.........................
Q7QF11_ANOGA/7-482TTTSSSSSSSPSSGSSMEAAGGGDGAGPNARAAVALLRETSVDTIASNFSSLYAI.........................
Q29HH8_DROPS/14-480TAAEGEAEDLALVSSAASAGSQCSGDTSPHSTPNSQDLN..FASSSSHRESNGRNSSLTREASVDT..............
Q6BP02_DEBHA/131-552.............................CPLSDFIETNGPLTKPNSLNTSSRQS.........................
A5DNM6_PICGU/119-523.............................CPLIDYSETNGPLKKPESLNTSSRQS.........................
Q2H333_CHAGB/18-368.............................GPELDNYEKG..LSMPTSLRTSDRNS.........................
AVL9_PONAB/16-520KTEEPLFQVEDSSKGQEPNDTNQYLKPPSRPSPDSSESDWETLDPSVLEDPNSKEREQLGSDQTNLFPKDSVPSESL...
A0A0D1CNH7_USTMA/140-510.............................DPSLHTRAGR..VEAADSLRSSDRKS.........................
Q17GP2_AEDAE/7-476CISGDTDPQGESSGSASSTAQQMQHSQDTDSGSTSTTREITPCSDDAQLGSLEDAAVGRNGTNNARPALAR.........
Q6C028_YARLI/516-899.............................SPLLHSYELG..LTRATSLKTSDRQS.........................
Q54NJ9_DICDI/6-452.............................QSISNDFQIDWTTSTSEEM................................
A1CPG6_ASPCL/9-384.............................DPSADSYEQT..VKKPTSLKTSDRAS.........................
Q6FIU1_CANGA/8-406.............................SPVLSNSYEN..VTVADSFKSSDRLS.........................
Q08D17_XENTR/21-516NTENSKIDTLLCEHEADTNGSIEKLKPPSHTSPESVESDWETLDPSILEECISRDEEVIWSTAPEHPDLLPTDTISSGSA
Q6CKD3_KLULA/6-399.............................SPMLDTYSKN..MTMVNSFKSSDRGS.........................
Q750W9_ASHGO/13-401.............................SPLLNKYERQ..LTACDSFKSSDRRS.........................
AVL9_YEAST/9-401.............................SPQLFQDISK..LNVVDSFKSSNRES.........................
A3LPG1_PICST/85-492.............................CPLIDYVETNGPLAKPNSLNTTNRRS.........................
AVL9_SCHPO/10-367.............................SPSAHSLEKS..LHKPASLQTSDKRS.........................
Q5AIP1_CANAL/191-588.............................CPLIDYAETNGPLSKPQSLNTTNRVS.........................
A7TEK5_VANPO/8-400.............................SPMLHKDVSD..IKVVTSFKSSDRAS.........................
H3CTF9_TETNG/13-493LQGSGRPAAENRSSGNGAEGDNHLLKPPARTSPESGDSDWETLDPSVLEEGGTKEAAGDDQRDAAFDPNPETPIT.....

PF09804

ANR2_YEAST/33-335-----------------------------------------NHVSD.....EYIK-------------------------
Q6FLQ0_CANGA/9-288-----------------------------------------NTGSK....GSYIP-------------------------
A7TLL1_VANPO/24-351-----------------------------------------AKDEY....DDFIS-------------------------
Q75DG5_ASHGO/36-366-----------------------------------------KLAHA....NMPLQ-------------------------
A5DGT1_PICGU/16-298-----------------------------------------IQSNI....VSMSQ-------------------------
C5MJC0_CANTT/11-295-----------------------------------------ISKTS...AATYSQ-------------------------
A3LNE8_PICST/19-334-----------------------------------------VSKDEK..KHSYSQ-------------------------
Q6BJB8_DEBHA/28-311-----------------------------------------YSDAL.....TYSQ-------------------------
B8M2T3_TALSN/30-332-----------------------------------------FFDQDG.APPLRPR-------------------------
A2QAY7_ASPNC/31-357-----------------------------------------LLPQNG.LPSPRPR-------------------------
A1CNU9_ASPCL/30-339-----------------------------------------LLPPAG.SPPPRPR-------------------------
Q5BF30_EMENI/30-339-----------------------------------------LLPSDR.LLSLRPR-------------------------
F2PVM8_TRIEC/26-326-----------------------------------------LLPSTKDIPSFRPR-------------------------
E9CY67_COCPS/13-322-----------------------------------------FLPPTD.LPAFRPR-------------------------
D5G5F9_TUBMM/21-341-----------------------------------------LLSSE....PSRLR-------------------------
E3Q807_COLGM/29-348-----------------------------------------LLAPTS..SSQRLR-------------------------
E9F1A8_METRA/37-350-----------------------------------------RLPPSS..PTPRLR-------------------------
C7YNX8_NECH7/29-347-----------------------------------------ILPTSS..STQRLR-------------------------
Q0V1B2_PHANO/27-300-----------------------------------------LLLPGA.EALLRLP-------------------------
B3RV35_TRIAD/7-273-----------------------------------------SQ..........TQ-------------------------
LCHN_DANRE/114-382-----------------------------------------VSVPE.......FR-------------------------
B7QCC0_IXOSC/54-313-----------------------------------------TCL.........CP-------------------------
F2UE85_SALR5/10-285-----------------------------------------HTQ.........AR-------------------------
YBAG_SCHPO/6-296-----------------------------------------SIPIL....LSDLH-------------------------
Q5K7R2_CRYNJ/10-298-----------------------------------------NGEAE......ISE-------------------------

PF08616

Q5KLM3_CRYNJ/384-496-----------------------------------------QVLRGMTECA...F-------------------------
YG76_SCHPO/260-373-----------------------------------------GLLQGLTRIT...F-------------------------
A4I5V0_LEIIN/587-699-----------------------------------------FMARKV.......F-------------------------
A5DM71_PICGU/279-393-----------------------------------------GILTGFFSNYN.IF-------------------------
A5DZ96_LODEL/271-385-----------------------------------------GILSGLLTNYN.VF-------------------------
A7TRE4_VANPO/376-503-----------------------------------------DATTYYKQNSILIF-------------------------
A8PX95_MALGO/354-466-----------------------------------------AVLRGFVASS...I-------------------------
B0D0E4_LACBS/418-530-----------------------------------------AVLRGFVERS...F-------------------------
C3ZXT1_BRAFL/180-291-----------------------------------------SDF..........R-------------------------
C4R3J0_KOMPG/305-418-----------------------------------------FMSTDSPCTTDHLY-------------------------
C5DJD2_LACTC/316-435-----------------------------------------FDFHYFENAQVIIF-------------------------
C5DZH0_ZYGRC/269-391-----------------------------------------NGTRSFSNKPCLTL-------------------------
D2VRW9_NAEGR/366-475-----------------------------------------LKKRT........F-------------------------
D2W4R6_NAEGR/470-587-----------------------------------------.....FQYNVNRVH-------------------------
Q2URL2_ASPOR/377-488-----------------------------------------GILRGFTRHA...F-------------------------
Q4DMT0_TRYCC/444-555-----------------------------------------FVTKKV.......F-------------------------
A0A0D1DWU6_USTMA/366-478-----------------------------------------AVLQGFAARA...F-------------------------
Q55D43_DICDI/566-679-----------------------------------------TRERC........F-------------------------
Q6BI40_DEBHA/264-378-----------------------------------------GILSGLLTNYN.IF-------------------------
Q6CGA4_YARLI/272-384-----------------------------------------GILRGFTRYA...F-------------------------
Q6CPS0_KLULA/322-444-----------------------------------------FSSEYFDNSSICIF-------------------------
Q75BQ9_ASHGO/342-464-----------------------------------------DHQHYFQNSSVIIF-------------------------
E7QKR4_YEASZ/211-334-----------------------------------------DPQSYFKGNAALIF-------------------------
Q23F93_TETTS/358-465-----------------------------------------NLSKK....I...H-------------------------

PF07792

B2AXK1_PODAN/126-264-----------------------------------------..............-------------------------
Q23F93_TETTS/4-94-----------------------------------------..............-------------------------
A0C6F7_PARTE/4-152-----------------------------------------..............-------------------------
Q75BQ9_ASHGO/52-189-----------------------------------------LKPTAESHGHLGGS-------------------------
A1CRY6_ASPCL/88-213-----------------------------------------..............-------------------------
E9DDS1_COCPS/93-219-----------------------------------------..............-------------------------
C4Y911_CLAL4/6-95-----------------------------------------..............-------------------------
B8MHD8_TALSN/88-217-----------------------------------------..............-------------------------
C5DZH0_ZYGRC/11-112-----------------------------------------..............-------------------------
A7TRE4_VANPO/76-221-----------------------------------------.............K-------------------------
C4R3J0_KOMPG/9-105-----------------------------------------..............-------------------------
C5DJD2_LACTC/32-162-----------------------------------------.............L-------------------------
B6HSJ1_PENRW/78-202-----------------------------------------..............-------------------------
F0XQA1_GROCL/150-315-----------------------------------------..............-------------------------
Q7RXB5_NEUCR/125-249-----------------------------------------..............-------------------------
Q6CGA4_YARLI/12-94-----------------------------------------..............-------------------------
D2VRW9_NAEGR/63-215-----------------------------------------SNSGNNNSSILSNG-------------------------
E7KUE5_YEASL/29-188-----------------------------------------LHHREQSDGSVTNS-------------------------
C1GKI9_PARBD/94-220-----------------------------------------..............-------------------------
MESA_EMENI/82-211-----------------------------------------..............-------------------------
F2TNB3_AJEDA/93-216-----------------------------------------..............-------------------------
Q6CPS0_KLULA/31-167-----------------------------------------.............T-------------------------
A2Q8P4_ASPNC/85-209-----------------------------------------..............-------------------------
Q0V5R0_PHANO/113-243-----------------------------------------..............-------------------------

PF02141

DEN4C_MOUSE/307-491-----------------------------------------CPYI-----------------------------------
DEN5A_HUMAN/202-390-----------------------------------------HVYV-----------------------------------
DEN5B_HUMAN/187-375-----------------------------------------HVYV-----------------------------------
Q0US70_PHANO/395-592-----------------------------------------GVFI-----------------------------------
Q0UM90_PHANO/167-348-----------------------------------------GLYV-----------------------------------
Q54JA6_DICDI/110-305-----------------------------------------HIFI-----------------------------------
Q55DD7_DICDI/109-294-----------------------------------------HIFI-----------------------------------
DEN2C_HUMAN/586-770-----------------------------------------HTYI-----------------------------------
Q5RHZ1_DANRE/778-962-----------------------------------------HTFI-----------------------------------
A7RR72_NEMVE/298-481-----------------------------------------CPYI-----------------------------------
DEN4B_MOUSE/313-497-----------------------------------------CPYI-----------------------------------
Q7PWX7_ANOGA/311-495-----------------------------------------CPYI-----------------------------------
Q9W3D2_DROME/308-492-----------------------------------------CPYI-----------------------------------
MTMRD_HUMAN/116-298-----------------------------------------YPYI-----------------------------------
Q1LXZ0_DANRE/117-299-----------------------------------------FTYV-----------------------------------
Q7KSP6_DROME/142-325-----------------------------------------HVYI-----------------------------------
Q177S0_AEDAE/106-289-----------------------------------------HVYI-----------------------------------
A7SZQ4_NEMVE/186-373-----------------------------------------HVYV-----------------------------------
Q54VP0_DICDI/908-1097-----------------------------------------HIYV-----------------------------------
Q2GNY8_CHAGB/440-637-----------------------------------------SIFI-----------------------------------
A7EF60_SCLS1/465-662-----------------------------------------SIFI-----------------------------------
Q0CL54_ASPTN/423-620-----------------------------------------GVLI-----------------------------------
DENN_SCHPO/362-562-----------------------------------------GLYI-----------------------------------
DEND3_MOUSE/187-373-----------------------------------------HTFV-----------------------------------
A1Z7Q5_DROME/98-283-----------------------------------------HIFI-----------------------------------
Q7Q1I7_ANOGA/88-273-----------------------------------------HIFI-----------------------------------
B8JLM2_DANRE/225-405-----------------------------------------HTLI-----------------------------------
F1N1V1_BOVIN/150-332-----------------------------------------HTYI-----------------------------------
F1QFB0_DANRE/165-345-----------------------------------------HTFI-----------------------------------
A0A0R4ITV8_DANRE/306-489-----------------------------------------CPYI-----------------------------------
F6SD79_XENTR/91-270-----------------------------------------HIYI-----------------------------------
F7CWX4_XENTR/145-326-----------------------------------------HTYI-----------------------------------
H2UHI4_TAKRU/223-407-----------------------------------------CPYI-----------------------------------
H3CCM9_TETNG/318-499-----------------------------------------HTYI-----------------------------------
H3CZX5_TETNG/307-489-----------------------------------------HTFI-----------------------------------
H3D3K0_TETNG/203-391-----------------------------------------HIYL-----------------------------------
H3DM09_TETNG/192-375-----------------------------------------QPYV-----------------------------------
U4PB89_CAEEL/329-512-----------------------------------------CPYI-----------------------------------

PF09794

Q5KDB3_CRYNJ/119-499.......................LLRFMGLPLR----IFS..................HDAFFQPYMPLQQMDTL.....
Q7QF11_ANOGA/7-482.......................EPSEWGAPLR----IFH..................EGVLCLPYISLPYMDLL.....
Q29HH8_DROPS/14-480............LASNLAALCSVNPDEYRAPVS----IFA..................SGNLCLPYLSLPYMDLL.....
Q6BP02_DEBHA/131-552.......................MLRFFGLPLQ----VFN.................TKGSFWNPYLPLQQLSEL.....
A5DNM6_PICGU/119-523.......................MLRFFGLPLQ----IFN.................TKGAFWNPYLPLQQLNAL.....
Q2H333_CHAGB/18-368.......................LLSYMGLPLQ----IFG..................KGSLFGPYTPLQQLDVL.....
AVL9_PONAB/16-520PITVQPQANTGQVVLIPGLISGLEEDQYGMPLA----IFT..................KGYLCLPYMALQQHHLL.....
A0A0D1CNH7_USTMA/140-510.......................LLKFLGMPLD----IFG..................PDAFFQPYCPLQQIDLL.....
Q17GP2_AEDAE/7-476......ETSVDTIASNFSSLCAIKPEEWMAPLK----IFH..................EGNLCLPYLSLPYMDLL.....
Q6C028_YARLI/516-899.......................LLNFMGLPLM----VFG..................EGGMFSPYIPLQQLGDL.....
Q54NJ9_DICDI/6-452.......................VLNQLGLPIP----LFNDGKDNNTTNSDGEKVYGSGGMILQPYLPLQQISLLLPPQQ
A1CPG6_ASPCL/9-384.......................LLAYMGLPLQ----IFG..................KGSMFGPYTPLQQLDLL.....
Q6FIU1_CANGA/8-406.......................VLKFLGFPLH----IFE..................KGGLFSPYTPLQQVSEI.....
Q08D17_XENTR/21-516PITVQPQSNTGQSVYIPGLISGLEEDQYGMPLA----IFT..................KGYLCLPYMALQQHHLL.....
Q6CKD3_KLULA/6-399.......................VLRFLGFPLQ----IFT..................KGGFFSPYVPLQQMNDL.....
Q750W9_ASHGO/13-401.......................VIRFLGFPLQ----IFA..................SGGLFSPYTPLQQLGDL.....
AVL9_YEAST/9-401.......................VLRFLGFPLP----IFE..................KGGLFSPYTPLQQMNDI.....
A3LPG1_PICST/85-492.......................MLRFFGLPLQ----IFN.................TKNAFWNPYLPLQQLDEL.....
AVL9_SCHPO/10-367.......................LLAYTGFPLI----IFG..................EGSMFSPYTPLQLVHVL.....
Q5AIP1_CANAL/191-588.......................MLRFFGLPLQ----IFN.................TKNSFWNPYLPLQQLDEL.....
A7TEK5_VANPO/8-400.......................VLTFMGFPLH----IFE..................TGGFFSPYTPLQQINDI.....
H3CTF9_TETNG/13-493...VQPQAVSGQGGLVQGLVSGLEEDQYGLPLP----IFT..................KGYLCLPYMALQQHHLL.....

PF09804

ANR2_YEAST/33-335-----------------------PIFTVSTS-D----I..------------------.PFLESFKKG............
Q6FLQ0_CANGA/9-288-----------------------TLFTVGTY-D----I..------------------.EDLEKHGQE............
A7TLL1_VANPO/24-351-----------------------PLFTIGVN-D----I..------------------.DFLNKVIKESGNS........
Q75DG5_ASHGO/36-366-----------------------TLYTIGIA-D----L..------------------.DHLTDMVSDALHKSD......
A5DGT1_PICGU/16-298-----------------------PIYNVGLH-D----LSE------------------NDSVLKTP..............
C5MJC0_CANTT/11-295-----------------------PVYHIGLN-D----L..------------------TGHLMKVK..............
A3LNE8_PICST/19-334-----------------------PIYNIGLN-D----LD.------------------SDDLLKTS..............
Q6BJB8_DEBHA/28-311-----------------------PLYNIGLN-D----L..------------------ESSLLEFP..............
B8M2T3_TALSN/30-332-----------------------PIFNVGIH-D----I..------------------.PFLST....NSD.........
A2QAY7_ASPNC/31-357-----------------------PLFNVGIH-D----I..------------------.PHLSSFVGTLVNA........
A1CNU9_ASPCL/30-339-----------------------PLFNVGIH-D----I..------------------.PYLSSFVGVSPSS........
Q5BF30_EMENI/30-339-----------------------ALFNVGVY-D----I..------------------.PYLSSFIRGSADS........
F2PVM8_TRIEC/26-326-----------------------PLFNIGIH-D----M..------------------.AQLST....LSS.........
E9CY67_COCPS/13-322-----------------------ALFNVGVH-D----L..------------------.PYLTSLSRKTSPQ........
D5G5F9_TUBMM/21-341-----------------------PLFSIGVH-D----I..------------------.PLLEEEAKRIHPTSQPPHDRD
E3Q807_COLGM/29-348-----------------------PLFTIGVH-D----I..------------------.PFLMEDFEASKRRKAGGN.DN
E9F1A8_METRA/37-350-----------------------PLFTIGVH-D----I..------------------.PFLMEDFEASKRRQDGT..AD
C7YNX8_NECH7/29-347-----------------------PLFSIGVH-D----I..------------------.PFLMEDFEASKRERSSE..DA
Q0V1B2_PHANO/27-300-----------------------SLFSVGVH-D----I..------------------.PSLEAPTTS............
B3RV35_TRIAD/7-273-----------------------PQFYVNVA-D----I..------------------.AELSSTK..............
LCHN_DANRE/114-382-----------------------PFFYINVA-D----I..------------------.PALETEL..............
B7QCC0_IXOSC/54-313-----------------------PNFYINVT-D----V..------------------.DVLAKQS..............
F2UE85_SALR5/10-285-----------------------PFLYANLS-D----I..------------------.PWMSTHS..............
YBAG_SCHPO/6-296-----------------------PFYSVGLA-N----T..------------------.STLLDNDLE............
Q5K7R2_CRYNJ/10-298-----------------------YLGNVGLM-D----L..------------------.DNIKAKKG.............

PF08616

Q5KLM3_CRYNJ/384-496-----------------------PY..ANLA-S....L---------------------DILEEFPG........-----
YG76_SCHPO/260-373-----------------------PY..IDLS-N....V---------------------ESLVKLPG........-----
A4I5V0_LEIIN/587-699-----------------------PY..VSVS-S....V---------------------NYFMQVPG........-----
A5DM71_PICGU/279-393-----------------------PM..IDVS-K....I---------------------DLLEKCDS........-----
A5DZ96_LODEL/271-385-----------------------PI..IDVS-K....I---------------------DLLEECES........-----
A7TRE4_VANPO/376-503-----------------------PY..MDIS-M....V---------------------DALRKYLNDKSGNISN-----
A8PX95_MALGO/354-466-----------------------PY..VTLA-S....L---------------------DTLRSMRG........-----
B0D0E4_LACBS/418-530-----------------------PY..ANLN-N....R---------------------DEWEAVPA........-----
C3ZXT1_BRAFL/180-291-----------------------PYFTIHDS-EFKEYT---------------------TKTQAAPP........-----
C4R3J0_KOMPG/305-418-----------------------PY..VDLS-Q....L---------------------EILEKMPF........-----
C5DJD2_LACTC/316-435-----------------------PY..MDIS-F....L---------------------DALREQLVLQNG..RR-----
C5DZH0_ZYGRC/269-391-----------------------PF..VDVS-I....I---------------------GPLKEYLALQD...RG-----
D2VRW9_NAEGR/366-475-----------------------PY..ASFS-N.....---------------------LEFLDVEG........-----
D2W4R6_NAEGR/470-587-----------------------PY..VPLS-EMDDVL---------------------SATSKIPE........-----
Q2URL2_ASPOR/377-488-----------------------PY..TDLT-K....I---------------------DDLLKVPG........-----
Q4DMT0_TRYCC/444-555-----------------------PY..TSVN-G....L---------------------SHFCSVPG........-----
A0A0D1DWU6_USTMA/366-478-----------------------PY..TNLL-N....L---------------------DDLEKVPG........-----
Q55D43_DICDI/566-679-----------------------PN..INLH-HQ.ILI---------------------DKLPPSTG........-----
Q6BI40_DEBHA/264-378-----------------------PI..LDVS-K....I---------------------DCLKKCDS........-----
Q6CGA4_YARLI/272-384-----------------------PY..TDLS-K....V---------------------DDLLETPG........-----
Q6CPS0_KLULA/322-444-----------------------PY..MEIS-I....I---------------------DMFRENFTEEFT.KGN-----
Q75BQ9_ASHGO/342-464-----------------------PY..MDIS-M....I---------------------DELRNEFSVKKT..GN-----
E7QKR4_YEASZ/211-334-----------------------PY..MDIS-L....V---------------------DGLRAYVASNSD.FVG-----
Q23F93_TETTS/358-465-----------------------LY..CHLQ-D....L---------------------.SFVEKKS........-----

PF07792

B2AXK1_PODAN/126-264-----------------------.ESRRARRRRRRDR.............AKGIIHESD...........DEDDGGEEDL
Q23F93_TETTS/4-94-----------------------.KYKLKQVVDQKTH...........................................
A0C6F7_PARTE/4-152-----------------------.DNVLKIRGEKESE.........................WLDINLSNAQIHVISHDF
Q75BQ9_ASHGO/52-189-----------------------PSSRLES...........................................MILEEDE
A1CRY6_ASPCL/88-213-----------------------.AATKKKRRKRAPA.................................DHDAGDDSQE
E9DDS1_COCPS/93-219-----------------------.QGQAEKAVDEAKE.................................DSQDGHDQTE
C4Y911_CLAL4/6-95-----------------------.TGKLQYQYDSKTC...........................................
B8MHD8_TALSN/88-217-----------------------.KRRRRRRRKQQTE.................................IEQESDADSN
C5DZH0_ZYGRC/11-112-----------------------PSKQVDQV.................................................
A7TRE4_VANPO/76-221-----------------------PSNIKTEVQKNDND.................................DNDDEENEDG
C4R3J0_KOMPG/9-105-----------------------.NAILSYDPKPHSLPS.........................................
C5DJD2_LACTC/32-162-----------------------PQNDARS..........................................PTILEEDE
B6HSJ1_PENRW/78-202-----------------------.DGKKKKKRKSQYH.................................GNQAGADIQD
F0XQA1_GROCL/150-315-----------------------.ARRREKRRRKHGHVATTDNIKTTDGTETNGLSESDADNEEAPEKDKDADDNDNDDY
Q7RXB5_NEUCR/125-249-----------------------.EERRRRRKRRQDR.............EQGIIHESD...........DEDD......
Q6CGA4_YARLI/12-94-----------------------.NGLLKYRPNDKGD...........................................
D2VRW9_NAEGR/63-215-----------------------SNDGGEEAKSSPRN......................................SQEVV
E7KUE5_YEASL/29-188-----------------------IYYDAENHQDAKNN.................................RYTIVLEDDE
C1GKI9_PARBD/94-220-----------------------.VDQ.QAGNSRIRQ.................................ENEGLNDGGS
MESA_EMENI/82-211-----------------------.NNKRKGKRNRVRS...................................SSGDEGTS
F2TNB3_AJEDA/93-216-----------------------.AGQ.QTEYNNISQ.................................ENEGLNDDSS
Q6CPS0_KLULA/31-167-----------------------KGTDLDS..........................................SLIIEEED
A2Q8P4_ASPNC/85-209-----------------------.TGKKKKKKKSRIG.................................DAESGDGDSE
Q0V5R0_PHANO/113-243-----------------------.RRRKRRRRKEGLD.................................DDDTTAGDEL

PF02141

DEN4C_MOUSE/307-491-----------------------PLCPLSLA----------------------------GVL.SAPLP------------
DEN5A_HUMAN/202-390-----------------------PILPASLL----------------------------HFL.DAPVP------------
DEN5B_HUMAN/187-375-----------------------PILPASLL----------------------------HFL.DAPVP------------
Q0US70_PHANO/395-592-----------------------PILPARLV----------------------------QTI.EAPCP------------
Q0UM90_PHANO/167-348-----------------------PVVHARHV----------------------------KDLVQEPGP------------
Q54JA6_DICDI/110-305-----------------------PILPRSLL----------------------------DYC.TAPMP------------
Q55DD7_DICDI/109-294-----------------------SILPNALM----------------------------PYV.AAPIP------------
DEN2C_HUMAN/586-770-----------------------PVLPASMI----------------------------DIV.CSPTP------------
Q5RHZ1_DANRE/778-962-----------------------PVLPTSMV----------------------------DIV.CCPTP------------
A7RR72_NEMVE/298-481-----------------------PLCPVALN----------------------------DVL.CAPCP------------
DEN4B_MOUSE/313-497-----------------------PLCPLVLA----------------------------DVL.SAPVP------------
Q7PWX7_ANOGA/311-495-----------------------PLCPLGLA----------------------------EVL.HAPLP------------
Q9W3D2_DROME/308-492-----------------------PLCPLGLA----------------------------EVL.HAPLP------------
MTMRD_HUMAN/116-298-----------------------PILPAQLL----------------------------EVL.SSPTP------------
Q1LXZ0_DANRE/117-299-----------------------PILPGKLL----------------------------EVL.SSPTP------------
Q7KSP6_DROME/142-325-----------------------PILPAPLT----------------------------EVL.STPTP------------
Q177S0_AEDAE/106-289-----------------------PILPASLV----------------------------EVL.STPTP------------
A7SZQ4_NEMVE/186-373-----------------------PILPAALQ----------------------------HFL.DAPVP------------
Q54VP0_DICDI/908-1097-----------------------PVLPEVLV----------------------------DIAGSTPFP------------
Q2GNY8_CHAGB/440-637-----------------------PVLPARLI----------------------------SAL.EAPCP------------
A7EF60_SCLS1/465-662-----------------------PVLPARLI----------------------------SAL.EAPCP------------
Q0CL54_ASPTN/423-620-----------------------PVLPARLI----------------------------QAL.EAPCP------------
DENN_SCHPO/362-562-----------------------PVLPRRLI----------------------------SCF.EAPCS------------
DEND3_MOUSE/187-373-----------------------PILSGQML----------------------------DFV.MAPTS------------
A1Z7Q5_DROME/98-283-----------------------PVLPWEFK----------------------------DYL.GAPMP------------
Q7Q1I7_ANOGA/88-273-----------------------PVLPMQMK----------------------------DIL.AAPMP------------
B8JLM2_DANRE/225-405-----------------------SIVPEILI----------------------------DVV.MAPTP------------
F1N1V1_BOVIN/150-332-----------------------PVVPESLL----------------------------GTV.CCPTP------------
F1QFB0_DANRE/165-345-----------------------SIVPSVLI----------------------------DVC.EAPTP------------
A0A0R4ITV8_DANRE/306-489-----------------------PLCPLRMA----------------------------DVL.CAPMP------------
F6SD79_XENTR/91-270-----------------------PTLPPHLL----------------------------DYC.SAPMP------------
F7CWX4_XENTR/145-326-----------------------PVLPHVLI----------------------------DTV.SCPAP------------
H2UHI4_TAKRU/223-407-----------------------PLCPLALA----------------------------DVL.SAPCP------------
H3CCM9_TETNG/318-499-----------------------PVLPASML----------------------------DIV.CTPTP------------
H3CZX5_TETNG/307-489-----------------------PVLPASML----------------------------DVS.CSPTP------------
H3D3K0_TETNG/203-391-----------------------PIVSAHLY----------------------------HLL.DAPVP------------
H3DM09_TETNG/192-375-----------------------PVLSRSML----------------------------DFL.MVPTA------------
U4PB89_CAEEL/329-512-----------------------PQCPLGLA----------------------------GVL.HAPLP------------

PF09794

Q5KDB3_CRYNJ/119-499....AAKSWLVGTTNQIV-----TQQKECR.YDLLV---NIDNNTFTFP...NPKLERVVGLTAADRRWMDDVVQTVEET
Q7QF11_ANOGA/7-482.TDPSVKGYMIGASNVLF-----QHKRQL..ADVMI---DVESTLIDVL...DGETKREMQMSTEDLRFVDFVVRHVQTP
Q29HH8_DROPS/14-480.SDPMVLSYVIGTSNVLF-----QQKRQL..ADVLV---DIEAANLDAH...DPELRRQLVLSTEDLRYMDYIMKHVQTP
Q6BP02_DEBHA/131-552.SASETRSYMVGCSNLLF-----VNQSESLNVDLLI---NLDTNELSYP....KGKPEELHLTSKDKKFVNALISKIKSN
A5DNM6_PICGU/119-523.SSPGTKSFMVGSSNLLF-----VNQSMALEVDILI---NLDTNEVSYP....VGRGDDLLLSSKDKIFINSLLENIRKI
Q2H333_CHAGB/18-368.ADFGTKSYIVGSTNSLL-----LQQKDRY.SDILI---NLDEDTINIT...SPSLKTALQLSTPDRRWIDFITQNVNDT
AVL9_PONAB/16-520.SDVTVRGFVAGATNILF-----RQQKHL..GDAIV---EVEEALIQIH...DPELRKLLNPTTADLRFADYLVRHVTEN
A0A0D1CNH7_USTMA/140-510....KSRSWLVGTSNSIF-----KQQRDCK.IDVVV---DLEHAHLEFQ...DAKLHQMVNLTPEDRKWMDEVISSVVET
Q17GP2_AEDAE/7-476.TDPSVKGYIIGASNVLF-----QQKRQL..ADVMI---DVENAVIDVY...DMDLKRQTQLSTEDLRFADFIIRNVQNP
Q6C028_YARLI/516-899...ALARYYLVGSTNSLL-----LQQKKQH.ADVLV---NMDDNTVEIL...NSSLKSPLSLSSYDKKWIERVVQAVDTS
Q54NJ9_DICDI/6-452GSGKTFNGFLVGTSNSLF-----LKNPPST.VHAIV---DIQNGEIQFK...DESLNRIMELTSSDRRFIDNIYDKVELY
A1CPG6_ASPCL/9-384.ADYGTKSYVVGSTNSLL-----LQQKDRY.SDILI---NLDEDTINIS...SPSLRNALILSAADRRWIDLLTQIINDT
Q6FIU1_CANGA/8-406.RSPATKFFMVGTSNKLL-----AEQKTDI.CDIFV---NIDDATVEFL...NKELGSALQLSGQDIKWMDTICNVVKTT
Q08D17_XENTR/21-516.SDVSVRGFVAGATNILF-----RQQKHL..SDAIV---EVEEARIQVH...DPELRKILNPTTADLRFTDHLVKHVMEN
Q6CKD3_KLULA/6-399.TASVTKWFVAGTSNTLL-----LEQSKTL.CDLLV---NIDDSTVQIMNKKDKDLHQALQLSQSDKKWMDVVIQSVLKS
Q750W9_ASHGO/13-401.TSPKTKWYVIGTSNNLL-----LEQKDRL.ADLLV---NVDMKTVETIS.DDKLFAQALQLSHHDRRWMDLLIQNIVNT
AVL9_YEAST/9-401.RSERTLFFMIGSSNTLL-----AEQKEEL.CHIFV---NTDNSTVDIL...DKTLNPVLQLSSHDKKWIESISGIVSDT
A3LPG1_PICST/85-492....TVESFMVGCSNLLF-----VNQAEKYNIDLLI---NLDTCEISFP....SGKQDELGLSHADKKFINHLINNIENE
AVL9_SCHPO/10-367.EAKSSTSWLAGTTNTLI-----MLNQNKM.AEVIV---RSDTHQIEFV...DPTIKNLTSLTYTDKSWMEDIISRVESS
Q5AIP1_CANAL/191-588....AVNSFMIGCSNLLF-----VNQATSYGIDVLI---NLDTNEVTYP..KNLYATEDLQLSALDKKFIHHLVNCDQPT
A7TEK5_VANPO/8-400.NDEKSKFFVIGTSNSLL-----SERKDEL.CQIYV---DTDNFTIEII...DKSLQPLLQLTANDKKWIESMSNVVSES
H3CTF9_TETNG/13-493.SDVTVRGFVAGATNILF-----RQQRHL..SDAII---DVDEASIQIQ...DPELRKVLSLTTADLRFADYLVKHVTEN

PF09804

ANR2_YEAST/33-335......NGYVATTSEEIL-----LYKPEI--YDIVV---KLTSSSTIEE-------------------------------
Q6FLQ0_CANGA/9-288.......GFLAVTSDEIL-----LYKEEL--FDKAL---ILPSDSLIHE-------------------------------
A7TLL1_VANPO/24-351..DYQMSSFVACTSDEVL-----AYRPEL--YDIML---KLPPNFMSND-------------------------------
Q75DG5_ASHGO/36-366PDGPHLPSFIACTSDEIL-----AERGEL--FDMVV---KLSNYHGVKV-------------------------------
A5DGT1_PICGU/16-298.......HIITVTSDEIL-----MYQ.DV--YDVGV---SLPTDNSGHV-------------------------------
C5MJC0_CANTT/11-295.......GYIGSTNDEIL-----K.DNPV--YDVGV---VIDEKASVFR-------------------------------
A3LNE8_PICST/19-334.......GYIASTSDDIL-----MFQRDL--YDIGV---ILDDSVTVYN-------------------------------
Q6BJB8_DEBHA/28-311.......ATIATTNDDIL-----MYQKNL--YDYAV---FLPNEEYGNS-------------------------------
B8M2T3_TALSN/30-332....TYSSWIACTTDNVL-----ATKTEL--FDILV---TLPTTHSPHI-------------------------------
A2QAY7_ASPNC/31-357...EHDAAWIACSTDSVL-----TMKPEL--FDVLV---TLPPAHSKNA-------------------------------
A1CNU9_ASPCL/30-339...EPDAAWIACSTDSVL-----SMKSEL--FDVLV---TLPPVHSKNA-------------------------------
Q5BF30_EMENI/30-339...EHDSTWIACSTDSVL-----SMKPEL--FDVLV---TLPPSHTKNA-------------------------------
F2PVM8_TRIEC/26-326....TDPCWIACSSDRVL-----GLRPEL--YDVLV---TLPPNYSRQA-------------------------------
E9CY67_COCPS/13-322..KKGENCWIACTSDRVL-----GLKPEL--YDVLI---DLPPPYSKDA-------------------------------
D5G5F9_TUBMM/21-341HLGGEQGSWVACTTDGIL-----YLKNEL--YDVVV---SMPPAHSKNA-------------------------------
E3Q807_COLGM/29-348FADESGSGWIACTTDSIL-----AMKDTL--WDMLI---TMPPPYAPNA-------------------------------
E9F1A8_METRA/37-350SGGEAGSGWIACTTDSIL-----AMKDTL--WDMLI---TMPPEHSTNA-------------------------------
C7YNX8_NECH7/29-347VDDEAGSGWIACTTDSIL-----AMKDTL--WDMLI---TIPPDYASNA-------------------------------
Q0V1B2_PHANO/27-300.......GWTACTTDEII-----STKAKL--YDVIV---ELP......T-------------------------------
B3RV35_TRIAD/7-273.......TYVACTTEKVF-----ESKKNL--YDAFI---DIRNISSTSP-------------------------------
LCHN_DANRE/114-382.......SYVACTTEKIF-----EEKKEL--YDVYI---DNQNVKTHRE-------------------------------
B7QCC0_IXOSC/54-313.......AYVACTTEKIF-----ESKQNL--FDLYV---DQQNLEPNSS-------------------------------
F2UE85_SALR5/10-285.......NYICCVTETVF-----ELKTSL--FDAFV---FPDDKMLPGA-------------------------------
YBAG_SCHPO/6-296......EGWIACTTDTVL-----LSKSSL--YDLAL---YWPDNSFNAN-------------------------------
Q5K7R2_CRYNJ/10-298.......GWVATTSDMIF-----KSHTKL--YDIFI---DLSSNPLPPS-------------------------------

PF08616

Q5KLM3_CRYNJ/384-496------..YVAGVTNPRF.....EELPMT.-WDVLC---NLETGKVTVS-------------------------------
YG76_SCHPO/260-373------..YLAGVMNPAF.....THHADW.-WDVLC---DIDNQTIQVS-------------------------------
A4I5V0_LEIIN/587-699------..YIVGTLNPIF.....DNVNPWG-WDLLC---DLDNKSVITA-------------------------------
A5DM71_PICGU/279-393------..YLAGTINPFF.....KNNDKL.-WDVLY---DLDANEFHLS-------------------------------
A5DZ96_LODEL/271-385------..FIAGTINPFF.....KNNDKL.-WDLLY---DLDANELFLS-------------------------------
A7TRE4_VANPO/376-503------KFAIIGVANPIF.....KYQQNL.-WDCYY---DLDTETLYDS-------------------------------
A8PX95_MALGO/354-466------..FIAGTTHPRI.....EELGC..-WDVLC---DCESGQIIVS-------------------------------
B0D0E4_LACBS/418-530------..YIAGVTNPIF.....ESSRQ..-WDLLL---DIGSGNVTVA-------------------------------
C3ZXT1_BRAFL/180-291------..VVLGVTNPFF.....AKTLQH.-WPHII---RIGE.MGNIG-------------------------------
C4R3J0_KOMPG/305-418------..YVAGTANIIF.......QSKPI-WDLFI---NLDDKSILLN-------------------------------
C5DJD2_LACTC/316-435------MFTIVGVSNPIF.....EYQKDV.-WDFYY---DMDAGSL..Q-------------------------------
C5DZH0_ZYGRC/269-391------IFLIMGTTNPIF.....KSQDGL.-YDYYY---DLDNELISEA-------------------------------
D2VRW9_NAEGR/366-475------..YIVGVCNPMF.....AQREEY.-YDLLV---DIDKMEVKVS-------------------------------
D2W4R6_NAEGR/470-587------..YIIGTTNALFETQGKNQRTQW.-WDVCL---SVNSRKVQLA-------------------------------
Q2URL2_ASPOR/377-488------..FIAGVTNPTF.....ANHPEW.-WDVLC---DLPTGRIKIS-------------------------------
Q4DMT0_TRYCC/444-555------..YIVGTLNPIF.....EMQHTW.-WDVLC---DLDNKCVVLS-------------------------------
A0A0D1DWU6_USTMA/366-478------..YIAGVTNPRF.....EDLHA..-WDLLL---NVETGRMQVA-------------------------------
Q55D43_DICDI/566-679------..VILGVSNPVF.....EERSEW.-WDILC---NIGTGKVILN-------------------------------
Q6BI40_DEBHA/264-378------..YIAGTINPFF.....KYNHKL.-WDLLY---DLDSNELFLS-------------------------------
Q6CGA4_YARLI/272-384------..FIAGAKNPAF.....THHPTW.-YDVVV---DIENFTMDIS-------------------------------
Q6CPS0_KLULA/322-444------FFSVVGVSNPIF.....QYQVDA.-WDFYY---DLDSDSLLNS-------------------------------
Q75BQ9_ASHGO/342-464------YFSIVGVSNPIF.....EMQKDV.-WDFYY---DLDSATLLTQ-------------------------------
E7QKR4_YEASZ/211-334------CFAIIGTANPIF.....RYQLDI.-WDYYY---DVDEGVFYEN-------------------------------
Q23F93_TETTS/358-465------..YIATVSNPLF.....ENRESW.-WDVCC---NIQDGSVKES-------------------------------

PF07792

B2AXK1_PODAN/126-264DDDDDDWDDDV...STDE.EPEGGEGPPL--V.YVL---NLVNTKQDKT-------------------------------
Q23F93_TETTS/4-94...............KLVSEINLNSSKEL--V.DLY---KFNNQKDDWE-------------------------------
A0C6F7_PARTE/4-152VSITLNPDLIYGIKGKFTQD.........--..YYL---ACLRNKKDAT-------------------------------
Q75BQ9_ASHGO/52-189NAGSSKTSLSQ.............AREIP--L.FFI---NVVHAKIDNA-------------------------------
A1CRY6_ASPCL/88-213EDTDALTEE.....SSDEDEDDGGEGPPL--M.YVL---NLVNTKQDNT-------------------------------
E9DDS1_COCPS/93-219DEEATDDDG.D...DDDEE...AGDGPPL--M.YVL---NLVNTKQDNS-------------------------------
C4Y911_CLAL4/6-95........................DSKP.--F.FVY---TIVNNVPDQN-------------------------------
B8MHD8_TALSN/88-217NDEDDQSDAAE...STDDEED.SGEGPPL--M.YVL---NLVNTKQDNT-------------------------------
C5DZH0_ZYGRC/11-112.............................--I.CFV---NVVYAQEDKS-------------------------------
A7TRE4_VANPO/76-221DGDDDSEYIDSEIFTDAKDENDNLDDIDT--L.YFI---NVVNTVIDKN-------------------------------
C4R3J0_KOMPG/9-105.............................--..VIL---SISYFKSDDS-------------------------------
C5DJD2_LACTC/32-162PQ........SGLAGEASTNHNADTKEPP--L.FFL---SVVNALHDKS-------------------------------
B6HSJ1_PENRW/78-202EYLDDISDDPD...SSDDE...GGEGPPL--M.YVL---NLVNTKQDNT-------------------------------
F0XQA1_GROCL/150-315DDDDDDDDEDEDSMSTDS.EPEGGEGAPL--I.YVL---NLVNTKQDKT-------------------------------
Q7RXB5_NEUCR/125-249DLDDDDWDDDE...STDEDEPEGGEGPPL--V.YVL---NL........-------------------------------
Q6CGA4_YARLI/12-94............................M--F.YVL---NLVNTKFDKD-------------------------------
D2VRW9_NAEGR/63-215EKVDLNTSLESTILSSDQVITEQSKKEEI--FYYVL---NVQKQKKYEG-------------------------------
E7KUE5_YEASL/29-188LE...........CQEVQNNQNAIDNE.P--L.FFI---NVANTVLDTT-------------------------------
C1GKI9_PARBD/94-220EVSVGDEDEIE...DEDEE...NGEGPPL--M.YVL---NLVNTKQDTS-------------------------------
MESA_EMENI/82-211ADTNNESEVTEEEESSDEED..GGEGPPL--M.YVL---NLVNTKQDNT-------------------------------
F2TNB3_AJEDA/93-216EASVVDEDE......EDDE...NGEGPPL--M.YVL---NLVNTKQDTS-------------------------------
Q6CPS0_KLULA/31-167FEEEQENGLRSGKIGSIRDDRHLEETEPP--L.FFL---SVVNTFLDNS-------------------------------
A2Q8P4_ASPNC/85-209DVGGSTEEE.....SSDEEE..GGEGPPL--M.YVL---NLVNTKQDTS-------------------------------
Q0V5R0_PHANO/113-243EGADDAEEDDYDTESEDEPDP...DGPPL--V.YVL---NLVNTKLDTT-------------------------------

PF02141

DEN4C_MOUSE/307-491--------FIVGVDSRYFD.....LHDPP--QDVVCI..DLDTN------------------------------------
DEN5A_HUMAN/202-390--------YLMGLHSNGLDDRSKLELPQE--ANLCFV..DIDNH------------------------------------
DEN5B_HUMAN/187-375--------YLMGLQSKEGTDRSKLELPQE--ANLCFV..DIDNH------------------------------------
Q0US70_PHANO/395-592--------YIVGIERRYEP.....TDYPE--DEYVLI..DLDAN------------------------------------
Q0UM90_PHANO/167-348--------YILGVTSECRS.....LFTAP--TDALVV..DLDRN------------------------------------
Q54JA6_DICDI/110-305--------FIIGIHSSLLA...PIRRKPL--NEIVFV..DLDKD------------------------------------
Q55DD7_DICDI/109-294--------FLVGILESSLK...SFYQQPT--EQVILY..NLDTL------------------------------------
DEN2C_HUMAN/586-770--------FLIGILSCSLP...QLQDLPI--EEVLIV..DLCAD------------------------------------
Q5RHZ1_DANRE/778-962--------FLVGILSSSLP...KLKELPV--EEALMV..DLGTD------------------------------------
A7RR72_NEMVE/298-481--------FIIGIDSRYFD.....QYDPP--DDVTSV..DLDTI------------------------------------
DEN4B_MOUSE/313-497--------FIVGIHSSYFD.....LHDPP--ADVICV..DLDTN------------------------------------
Q7PWX7_ANOGA/311-495--------YLIGVDSRFFD.....LYEPP--NDVTCV..DLDTN------------------------------------
Q9W3D2_DROME/308-492--------YLIGVDSRFFD.....LYEPP--TDVTCI..DLDTN------------------------------------
MTMRD_HUMAN/116-298--------FIIGVHSVFKT.....DVHEL--LDVIIA..DLDGG------------------------------------
Q1LXZ0_DANRE/117-299--------FIIGVNSHFRS.....ETQEL--LDVIIA..DLDGG------------------------------------
Q7KSP6_DROME/142-325--------FIMGIHSSLQT.....EITDL--LDVIVV..DLDGG------------------------------------
Q177S0_AEDAE/106-289--------FIMGIHSSMQT.....EVTEV--LDVIIA..DLDGG------------------------------------
A7SZQ4_NEMVE/186-373--------FIMGLYCASEDFKANLQLPSE--ASLCLV..DIDNC------------------------------------
Q54VP0_DICDI/908-1097--------FIMGIHRSYADR.ILSKEDLL--NELVIV..DLDNN------------------------------------
Q2GNY8_CHAGB/440-637--------YIVGVERRYEK.....IELPD--DDYVLV..DLDRD------------------------------------
A7EF60_SCLS1/465-662--------YIVGIERRYDN.....IVLPE--DDYVFV..DLDQD------------------------------------
Q0CL54_ASPTN/423-620--------YIVGIERRYEK.....VELPS--DDFVLV..DLDAD------------------------------------
DENN_SCHPO/362-562--------YIIGTLSYFFH....MDDVPL--DNIPLVVCDLDKN------------------------------------
DEND3_MOUSE/187-373--------FLMGCHLDHFE....EVRKEA--DGLVLI..DIDHG------------------------------------
A1Z7Q5_DROME/98-283--------YLIGVPEPVLE...TVTSDEL--GEVVIL..NCDTK------------------------------------
Q7Q1I7_ANOGA/88-273--------FLIGVPEAVYD...TLRREEI--GDVVIL..NCDKR------------------------------------
B8JLM2_DANRE/225-405--------YLLGVQKRLAH.....LVTDQ--TDLLIV..DLSE.------------------------------------
F1N1V1_BOVIN/150-332--------FMVGVQMRFRQ...EVLDSPM--EEVLLV..NLCE.------------------------------------
F1QFB0_DANRE/165-345--------YLLGVQKSMMG.....LITDH--SDVMIV..DLST.------------------------------------
A0A0R4ITV8_DANRE/306-489--------FIVGVHSSYFD.....LYDPP--SDVVCV..DLDTN------------------------------------
F6SD79_XENTR/91-270--------YLIGVHSSLME...KVNIKSL--EDVVIF..NVDTN------------------------------------
F7CWX4_XENTR/145-326--------FIVGVQNQFLS...HILDQPM--EEVLLV..DLCK.------------------------------------
H2UHI4_TAKRU/223-407--------FIVGVDSRYFD.....LYIPP--ADITCV..DLDTN------------------------------------
H3CCM9_TETNG/318-499--------FIVGLLSSSLP...RLKELPI--EEVLVV..DLG..------------------------------------
H3CZX5_TETNG/307-489--------FLIGVLAPCLP...QLLELPI--EEVLIV..DLCA.------------------------------------
H3D3K0_TETNG/203-391--------FLMGIQRRDGAQRSSLHLPHE--ANLCFV..DIDNH------------------------------------
H3DM09_TETNG/192-375--------LLMGCHVCHFE....EVAAET--DDLILV..NIDD.------------------------------------
U4PB89_CAEEL/329-512--------FIAGVDSRYFE....LYEDPP--DDVTCF..DLDT.------------------------------------

PF09794

Q5KDB3_CRYNJ/119-499WGLSEGER...PSYR...................GSDDDLRARFEEYILSALSSI
Q7QF11_ANOGA/7-482KEDAE.............................GSEAWIRDQLYGYMVALLKTS
Q29HH8_DROPS/14-480KEDAE.............................GSEHWIREQFQGYILALLRTA
Q6BP02_DEBHA/131-552EKDEWQNDIDNEQFI...................GSDDFVRFEFEDYLLSLLSTT
A5DNM6_PICGU/119-523DEQDN........YI...................GSDDYIRYKFEDYLCSLLSTT
Q2H333_CHAGB/18-368WDDANPSRPKTMGYV...................GSEEFIRVQFEEYLLSLISSV
AVL9_PONAB/16-520RDDVFLDG...TGWE...................GGDEWIRAQFAVYIHALLAAT
A0A0D1CNH7_USTMA/140-510WNPADPTRPTSMGFH...................GSDDYLRVRFEDYICAMLSST
Q17GP2_AEDAE/7-476KEDAE.............................GSEVWIREQFYGYMVALLKSS
Q6C028_YARLI/516-899SGNSAATT.....FH...................GNEDYVRLQFEDYLMGLLSAV
Q54NJ9_DICDI/6-452NRNNSNNNNNNNNNNNNNNNNGNNSDNDNAVYKEGCDKWIRDQFENYIVCLLSSI
A1CPG6_ASPCL/9-384WDEAHPQRPKDHGYM...................GSEEFIRLQFEEYLLALLACM
Q6FIU1_CANGA/8-406WNENDDETPKNSQFE...................GSEDFIRWQFEDYLVGLLSSV
Q08D17_XENTR/21-516RDDVFLDG...TGWE...................GGDEWIRAQFALYLHSLLSAS
Q6CKD3_KLULA/6-399WNQDDYSTLRNSQFE...................GSEDYIRWQFEDYLSGLVLTV
Q750W9_ASHGO/13-401WNEYDLSTPSTFQFE...................GSEDFVRWQFEEYLTGLLSSA
AVL9_YEAST/9-401WNENDDETPKNSQFE...................GSEDFIRWQFEDYLTGLLSSV
A3LPG1_PICST/85-492RD.........DEFL...................GNDDYIRYQFEDYLNSLISTT
AVL9_SCHPO/10-367LEMELP......GFE...................GSDDWIRNQFELYIFGMLATV
Q5AIP1_CANAL/191-588TKH........DDFI...................GSDDYIRSKFEDYLNSLISTM
A7TEK5_VANPO/8-400WNENDRETPKNSQFE...................GSEDFIRWQFEDYLIGLLSSV
H3CTF9_TETNG/13-493RDDVFLDG...TGWE...................GGDEWIRSQFVVYLHSLLSS.

PF09804

ANR2_YEAST/33-335-----------------------------------------------------SP
Q6FLQ0_CANGA/9-288-----------------------------------------------------GL
A7TLL1_VANPO/24-351-----------------------------------------------------ND
Q75DG5_ASHGO/36-366-----------------------------------------------------YA
A5DGT1_PICGU/16-298-----------------------------------------------------KI
C5MJC0_CANTT/11-295-----------------------------------------------------FP
A3LNE8_PICST/19-334-----------------------------------------------------HS
Q6BJB8_DEBHA/28-311-----------------------------------------------------YI
B8M2T3_TALSN/30-332-----------------------------------------------------SQ
A2QAY7_ASPNC/31-357-----------------------------------------------------AE
A1CNU9_ASPCL/30-339-----------------------------------------------------AE
Q5BF30_EMENI/30-339-----------------------------------------------------AS
F2PVM8_TRIEC/26-326-----------------------------------------------------PE
E9CY67_COCPS/13-322-----------------------------------------------------PE
D5G5F9_TUBMM/21-341-----------------------------------------------------KK
E3Q807_COLGM/29-348-----------------------------------------------------KE
E9F1A8_METRA/37-350-----------------------------------------------------VD
C7YNX8_NECH7/29-347-----------------------------------------------------VE
Q0V1B2_PHANO/27-300-----------------------------------------------------QQ
B3RV35_TRIAD/7-273-----------------------------------------------------NI
LCHN_DANRE/114-382-----------------------------------------------------SL
B7QCC0_IXOSC/54-313-----------------------------------------------------MH
F2UE85_SALR5/10-285-----------------------------------------------------NV
YBAG_SCHPO/6-296-----------------------------------------------------KY
Q5K7R2_CRYNJ/10-298-----------------------------------------------------PV

PF08616

Q5KLM3_CRYNJ/384-496------------------------------------------------------K
YG76_SCHPO/260-373------------------------------------------------------S
A4I5V0_LEIIN/587-699------------------------------------------------------A
A5DM71_PICGU/279-393------------------------------------------------------T
A5DZ96_LODEL/271-385------------------------------------------------------S
A7TRE4_VANPO/376-503------------------------------------------------------I
A8PX95_MALGO/354-466------------------------------------------------------A
B0D0E4_LACBS/418-530------------------------------------------------------K
C3ZXT1_BRAFL/180-291------------------------------------------------------K
C4R3J0_KOMPG/305-418------------------------------------------------------F
C5DJD2_LACTC/316-435------------------------------------------------------T
C5DZH0_ZYGRC/269-391------------------------------------------------------A
D2VRW9_NAEGR/366-475------------------------------------------------------Q
D2W4R6_NAEGR/470-587------------------------------------------------------E
Q2URL2_ASPOR/377-488------------------------------------------------------S
Q4DMT0_TRYCC/444-555------------------------------------------------------P
A0A0D1DWU6_USTMA/366-478------------------------------------------------------K
Q55D43_DICDI/566-679------------------------------------------------------P
Q6BI40_DEBHA/264-378------------------------------------------------------S
Q6CGA4_YARLI/272-384------------------------------------------------------P
Q6CPS0_KLULA/322-444------------------------------------------------------K
Q75BQ9_ASHGO/342-464------------------------------------------------------A
E7QKR4_YEASZ/211-334------------------------------------------------------.
Q23F93_TETTS/358-465------------------------------------------------------E

PF07792

B2AXK1_PODAN/126-264------------------------------------------------------V
Q23F93_TETTS/4-94------------------------------------------------------I
A0C6F7_PARTE/4-152------------------------------------------------------I
Q75BQ9_ASHGO/52-189------------------------------------------------------N
A1CRY6_ASPCL/88-213------------------------------------------------------V
E9DDS1_COCPS/93-219------------------------------------------------------V
C4Y911_CLAL4/6-95------------------------------------------------------V
B8MHD8_TALSN/88-217------------------------------------------------------V
C5DZH0_ZYGRC/11-112------------------------------------------------------N
A7TRE4_VANPO/76-221------------------------------------------------------N
C4R3J0_KOMPG/9-105------------------------------------------------------Y
C5DJD2_LACTC/32-162------------------------------------------------------N
B6HSJ1_PENRW/78-202------------------------------------------------------V
F0XQA1_GROCL/150-315------------------------------------------------------Q
Q7RXB5_NEUCR/125-249------------------------------------------------------.
Q6CGA4_YARLI/12-94------------------------------------------------------V
D2VRW9_NAEGR/63-215------------------------------------------------------L
E7KUE5_YEASL/29-188------------------------------------------------------N
C1GKI9_PARBD/94-220------------------------------------------------------V
MESA_EMENI/82-211------------------------------------------------------V
F2TNB3_AJEDA/93-216------------------------------------------------------V
Q6CPS0_KLULA/31-167------------------------------------------------------N
A2Q8P4_ASPNC/85-209------------------------------------------------------V
Q0V5R0_PHANO/113-243------------------------------------------------------V

PF02141

DEN4C_MOUSE/307-491-------------------------------------------------------
DEN5A_HUMAN/202-390-------------------------------------------------------
DEN5B_HUMAN/187-375-------------------------------------------------------
Q0US70_PHANO/395-592-------------------------------------------------------
Q0UM90_PHANO/167-348-------------------------------------------------------
Q54JA6_DICDI/110-305-------------------------------------------------------
Q55DD7_DICDI/109-294-------------------------------------------------------
DEN2C_HUMAN/586-770-------------------------------------------------------
Q5RHZ1_DANRE/778-962-------------------------------------------------------
A7RR72_NEMVE/298-481-------------------------------------------------------
DEN4B_MOUSE/313-497-------------------------------------------------------
Q7PWX7_ANOGA/311-495-------------------------------------------------------
Q9W3D2_DROME/308-492-------------------------------------------------------
MTMRD_HUMAN/116-298-------------------------------------------------------
Q1LXZ0_DANRE/117-299-------------------------------------------------------
Q7KSP6_DROME/142-325-------------------------------------------------------
Q177S0_AEDAE/106-289-------------------------------------------------------
A7SZQ4_NEMVE/186-373-------------------------------------------------------
Q54VP0_DICDI/908-1097-------------------------------------------------------
Q2GNY8_CHAGB/440-637-------------------------------------------------------
A7EF60_SCLS1/465-662-------------------------------------------------------
Q0CL54_ASPTN/423-620-------------------------------------------------------
DENN_SCHPO/362-562-------------------------------------------------------
DEND3_MOUSE/187-373-------------------------------------------------------
A1Z7Q5_DROME/98-283-------------------------------------------------------
Q7Q1I7_ANOGA/88-273-------------------------------------------------------
B8JLM2_DANRE/225-405-------------------------------------------------------
F1N1V1_BOVIN/150-332-------------------------------------------------------
F1QFB0_DANRE/165-345-------------------------------------------------------
A0A0R4ITV8_DANRE/306-489-------------------------------------------------------
F6SD79_XENTR/91-270-------------------------------------------------------
F7CWX4_XENTR/145-326-------------------------------------------------------
H2UHI4_TAKRU/223-407-------------------------------------------------------
H3CCM9_TETNG/318-499-------------------------------------------------------
H3CZX5_TETNG/307-489-------------------------------------------------------
H3D3K0_TETNG/203-391-------------------------------------------------------
H3DM09_TETNG/192-375-------------------------------------------------------
U4PB89_CAEEL/329-512-------------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window