Sequence alignment for CL0331

PF04350

A3M9J2_ACIBT/73-221--------------------------------------------------------------------------------
B1KP68_SHEWM/48-192--------------------------------------------------------------------------------
A3L2L2_PSEAI/58-202--------------------------------------------------------------------------------
A1TKV8_ACIAC/65-211--------------------------------------------------------------------------------
Q0AF43_NITEC/50-192--------------------------------------------------------------------------------
A6T3F9_JANMA/58-199--------------------------------------------------------------------------------
Q9PGD1_XYLFA/51-201--------------------------------------------------------------------------------
Q6AS36_DESPS/56-201--------------------------------------------------------------------------------
Q3JEG7_NITOC/49-192--------------------------------------------------------------------------------
A5GEZ7_GEOUR/43-188--------------------------------------------------------------------------------
A8GZ26_SHEPA/51-192--------------------------------------------------------------------------------
A4BQU6_9GAMM/49-200--------------------------------------------------------------------------------
Q0I056_SHESR/48-192--------------------------------------------------------------------------------
Q1ZLT6_PHOAS/47-193--------------------------------------------------------------------------------
Q21UC1_RHOFD/65-206--------------------------------------------------------------------------------
Q1GYG3_METFK/49-194--------------------------------------------------------------------------------
A0Y285_9GAMM/56-197--------------------------------------------------------------------------------
A5EW42_DICNV/50-200--------------------------------------------------------------------------------
A3Y0G4_9VIBR/53-196--------------------------------------------------------------------------------
Q0EXA4_9PROT/51-193--------------------------------------------------------------------------------
Q1K2X2_DESAC/43-188--------------------------------------------------------------------------------
Q46WJ0_CUPPJ/59-200--------------------------------------------------------------------------------
A7MXC8_VIBHB/47-190--------------------------------------------------------------------------------
B7WV77_COMTE/66-211--------------------------------------------------------------------------------
A6F2X5_9ALTE/58-201--------------------------------------------------------------------------------
Q2S9Q2_HAHCH/58-200--------------------------------------------------------------------------------
Q3SM92_THIDA/49-189--------------------------------------------------------------------------------
Q1N2I2_9GAMM/61-205--------------------------------------------------------------------------------
Q08Z00_STIAD/19-166--------------------------------------------------------------------------------
Q0A4Z0_ALHEH/49-191--------------------------------------------------------------------------------
A0Y8X2_9GAMM/58-199--------------------------------------------------------------------------------
A0LFN6_SYNFM/50-195--------------------------------------------------------------------------------
Q1YS06_9GAMM/58-199--------------------------------------------------------------------------------
D7HR04_VIBCL/50-193--------------------------------------------------------------------------------
Q15Y40_PSEA6/54-194--------------------------------------------------------------------------------
Q1LI84_RALME/59-200--------------------------------------------------------------------------------
B3E9T2_GEOLS/43-188--------------------------------------------------------------------------------
Q306N4_MYXXD/43-190--------------------------------------------------------------------------------
Q39X09_GEOMG/43-188--------------------------------------------------------------------------------
Q8DCM4_VIBVU/47-190--------------------------------------------------------------------------------
A0KN32_AERHH/49-192--------------------------------------------------------------------------------
B9M3J0_GEOSF/43-188--------------------------------------------------------------------------------
Q1Q8Q5_PSYCK/75-221--------------------------------------------------------------------------------
Q74BL1_GEOSL/43-188--------------------------------------------------------------------------------
B5E8I1_GEOBB/43-188--------------------------------------------------------------------------------
Q489N7_COLP3/51-194--------------------------------------------------------------------------------
Q2BLX7_9GAMM/56-196--------------------------------------------------------------------------------
O05128_NEIGO/50-200--------------------------------------------------------------------------------
Q21H80_SACD2/59-202--------------------------------------------------------------------------------
A5IFY3_LEGPC/49-198--------------------------------------------------------------------------------
Q1QZY6_CHRSD/58-200--------------------------------------------------------------------------------
Q5H3Q8_XANOR/51-201--------------------------------------------------------------------------------
Q5E2F6_VIBF1/46-189--------------------------------------------------------------------------------
Q6F7E1_ACIAD/73-220--------------------------------------------------------------------------------
A1KBQ8_AZOSB/62-203--------------------------------------------------------------------------------
A1SRB3_PSYIN/46-187--------------------------------------------------------------------------------
Q0VMB5_ALCBS/61-210--------------------------------------------------------------------------------
Q7NZU0_CHRVO/47-188--------------------------------------------------------------------------------
A1SB17_SHEAM/51-192--------------------------------------------------------------------------------
Q2INP0_ANADE/50-195--------------------------------------------------------------------------------
A0Z8J0_9GAMM/58-201--------------------------------------------------------------------------------
Q1Z012_PHOPR/47-192--------------------------------------------------------------------------------
A4BAN3_9GAMM/60-209--------------------------------------------------------------------------------
A4A8J9_9GAMM/58-201--------------------------------------------------------------------------------
Q47JL0_DECAR/63-205--------------------------------------------------------------------------------
Q5P5N9_AROAE/61-202--------------------------------------------------------------------------------
Q12SM2_SHEDO/51-192--------------------------------------------------------------------------------
A1WDV6_VEREI/65-209--------------------------------------------------------------------------------
A8ZSX7_DESOH/54-197--------------------------------------------------------------------------------
A6D0B8_9VIBR/44-187--------------------------------------------------------------------------------
A6FBL6_9GAMM/49-190--------------------------------------------------------------------------------
Q3A2N2_PELCD/43-188--------------------------------------------------------------------------------
Q1ZHK9_9GAMM/46-187--------------------------------------------------------------------------------
Q4KJJ2_PSEF5/58-202--------------------------------------------------------------------------------
Q60BY6_METCA/48-198--------------------------------------------------------------------------------

PF10741

A9BY16_DELAS/76-187--------------------------------------------------------------------------------
A1WFQ5_VEREI/74-182--------------------------------------------------------------------------------
A1TUQ5_ACIAC/72-183--------------------------------------------------------------------------------
Q5P6R2_AROAE/78-190--------------------------------------------------------------------------------
A0Z1M0_9GAMM/71-181--------------------------------------------------------------------------------
A4A5M0_9GAMM/74-184--------------------------------------------------------------------------------
Q87ZW3_PSESM/77-193--------------------------------------------------------------------------------
B1J7E6_PSEPW/76-193--------------------------------------------------------------------------------
Q1QQ81_NITHX/73-181--------------------------------------------------------------------------------
A5EBI2_BRASB/75-183--------------------------------------------------------------------------------
Q89HH7_BRAJA/79-189--------------------------------------------------------------------------------
Q2VNU3_9BACT/73-185--------------------------------------------------------------------------------
Q212Z0_RHOPB/75-181--------------------------------------------------------------------------------
A5EF22_BRASB/73-180--------------------------------------------------------------------------------
A4YMS4_BRASO/72-179--------------------------------------------------------------------------------
A7IH66_XANP2/71-186--------------------------------------------------------------------------------
Q5H4L2_XANOR/85-200--------------------------------------------------------------------------------
Q3RHI6_XYLFA/76-191--------------------------------------------------------------------------------
B4SJ91_STRM5/76-192--------------------------------------------------------------------------------
Q609V5_METCA/84-198--------------------------------------------------------------------------------
Q3JD24_NITOC/76-192--------------------------------------------------------------------------------
B0T7N6_CAUSK/73-179--------------------------------------------------------------------------------
Q8KZ83_GLUDI/87-194--------------------------------------------------------------------------------
Q0BR92_GRABC/89-202--------------------------------------------------------------------------------
A5FWX4_ACICJ/79-187--------------------------------------------------------------------------------
Q82WG9_NITEU/68-173--------------------------------------------------------------------------------
Q9RW97_DEIRA/74-187--------------------------------------------------------------------------------
Q07N82_RHOP5/69-181--------------------------------------------------------------------------------

PF03245

O80285_9CAUD/31-149--------------------------------------------------------------------------------
A7MK05_CROS8/30-153--------------------------------------------------------------------------------
Q9ZXB6_BPH19/29-154--------------------------------------------------------------------------------
Q7N318_PHOLL/26-149--------------------------------------------------------------------------------
A1ACE3_ECOK1/29-154--------------------------------------------------------------------------------
Q56118_9CAUD/29-155--------------------------------------------------------------------------------
Q1RCX8_ECOUT/33-157--------------------------------------------------------------------------------
Q2A0C4_9VIRU/30-151--------------------------------------------------------------------------------
Q76H63_9CAUD/29-154--------------------------------------------------------------------------------
Q2A095_9VIRU/28-149--------------------------------------------------------------------------------
Q1I6B5_PSEE4/33-166--------------------------------------------------------------------------------
Q9KXD2_BPVT2/29-154--------------------------------------------------------------------------------
A7MLQ7_CROS8/30-153--------------------------------------------------------------------------------
Q48C47_PSE14/33-153--------------------------------------------------------------------------------
A4WC46_ENT38/29-152--------------------------------------------------------------------------------
A2P359_VIBCL/23-146--------------------------------------------------------------------------------
B0KHE2_PSEPG/21-146--------------------------------------------------------------------------------
Q1GXR8_METFK/50-191--------------------------------------------------------------------------------
Q8X2A4_ECO57/29-154--------------------------------------------------------------------------------
A4WB39_ENT38/29-154--------------------------------------------------------------------------------
Q7N0Y2_PHOLL/26-149--------------------------------------------------------------------------------
Q1VCK5_VIBAL/31-155--------------------------------------------------------------------------------
B1JDA4_PSEPW/32-158--------------------------------------------------------------------------------
A6UZ52_PSEA7/32-149--------------------------------------------------------------------------------
A1JLU8_YERE8/29-147--------------------------------------------------------------------------------
Q7CID8_YERPE/26-151--------------------------------------------------------------------------------
A8CGF5_BPP22/29-144--------------------------------------------------------------------------------
Q8XYQ5_RALSO/38-173--------------------------------------------------------------------------------
Q2NV02_SODGM/25-149--------------------------------------------------------------------------------
Q6HAE1_9ENTR/26-151--------------------------------------------------------------------------------

PF05137

D4BI19_9ENTR/97-171--------------------------------------------------------------------------------
C7R7X0_KANKD/100-176--------------------------------------------------------------------------------
C7QTE2_CYAP0/114-206--------------------------------------------------------------------------------
C6BWY3_DESAD/355-431--------------------------------------------------------------------------------
D3SD46_THISK/100-177--------------------------------------------------------------------------------
C8X4Y9_DESRD/100-179--------------------------------------------------------------------------------
D0L237_HALNC/100-184--------------------------------------------------------------------------------
D0WBB7_NEILA/103-177--------------------------------------------------------------------------------
D2ZYQ1_NEIMU/103-177--------------------------------------------------------------------------------
D2Z429_9BACT/103-180--------------------------------------------------------------------------------
B2FNI0_STRMK/286-360--------------------------------------------------------------------------------
B1EI39_9ESCH/97-171--------------------------------------------------------------------------------
C1DHR0_AZOVD/100-178--------------------------------------------------------------------------------
Q1N2I1_9GAMM/100-174--------------------------------------------------------------------------------
Q7NZT9_CHRVO/100-177--------------------------------------------------------------------------------
A8T9N5_9VIBR/101-179--------------------------------------------------------------------------------
B3R7C3_CUPTR/105-187--------------------------------------------------------------------------------
Q74C93_GEOSL/96-176--------------------------------------------------------------------------------
B9TC62_RICCO/24-102--------------------------------------------------------------------------------
A8GZ25_SHEPA/100-177--------------------------------------------------------------------------------
Q74BL0_GEOSL/100-177--------------------------------------------------------------------------------
Q061N8_9SYNE/111-200--------------------------------------------------------------------------------
A4G9P6_HERAR/100-182--------------------------------------------------------------------------------
Q1IRM8_KORVE/109-189--------------------------------------------------------------------------------
C4K8E6_HAMD5/100-172--------------------------------------------------------------------------------
A0YSX4_LYNSP/116-236--------------------------------------------------------------------------------
Q21H79_SACD2/100-177--------------------------------------------------------------------------------
D6SKS7_9DELT/355-426--------------------------------------------------------------------------------
Q1Q6D7_9BACT/347-419--------------------------------------------------------------------------------
A5EF21_BRASB/284-357--------------------------------------------------------------------------------
B4UDC4_ANASK/100-177--------------------------------------------------------------------------------
F2G6J6_ALTMD/100-177--------------------------------------------------------------------------------
Q5P5N8_AROAE/100-177--------------------------------------------------------------------------------
A5GEZ6_GEOUR/100-177--------------------------------------------------------------------------------
A1ARQ3_PELPD/96-177--------------------------------------------------------------------------------
B5JTT5_9GAMM/102-177--------------------------------------------------------------------------------
Q1PJI8_PROMR/111-194--------------------------------------------------------------------------------
B2Q5V2_PROST/100-173--------------------------------------------------------------------------------
Q0BZ78_HYPNA/235-307--------------------------------------------------------------------------------
Q87L63_VIBPA/101-179--------------------------------------------------------------------------------
B4VRN9_9CYAN/118-234--------------------------------------------------------------------------------
B8D2D6_HALOH/94-167--------------------------------------------------------------------------------
Q4FQH8_PSYA2/100-200--------------------------------------------------------------------------------
P74187_SYNY3/116-221--------------------------------------------------------------------------------
Q3IJC1_PSEHT/100-177--------------------------------------------------------------------------------
A5WCG1_PSYWF/77-165--------------------------------------------------------------------------------
A5KTK0_9BACT/97-178--------------------------------------------------------------------------------
Q6LVG0_PHOPR/101-179--------------------------------------------------------------------------------
Q2JVP2_SYNJA/119-199--------------------------------------------------------------------------------
C5BRK2_TERTT/100-177--------------------------------------------------------------------------------
Q31KD7_SYNE7/115-203--------------------------------------------------------------------------------
Q05VH9_9SYNE/427-512--------------------------------------------------------------------------------
Q212Y9_RHOPB/275-348--------------------------------------------------------------------------------
A0Z1L9_9GAMM/260-333--------------------------------------------------------------------------------
Q8YY23_NOSS1/115-220--------------------------------------------------------------------------------
A3CR63_STRSV/106-183--------------------------------------------------------------------------------
A3LJ85_PSEAI/100-178--------------------------------------------------------------------------------
Q7NA52_PHOLL/101-175--------------------------------------------------------------------------------
B4A5T7_SALNE/97-171--------------------------------------------------------------------------------
Q21T59_RHOFD/119-218--------------------------------------------------------------------------------
Q7MH79_VIBVY/111-189--------------------------------------------------------------------------------
B6SE77_9NEIS/102-181--------------------------------------------------------------------------------
B5EI36_GEOBB/95-175--------------------------------------------------------------------------------
A4YMS3_BRASO/280-353--------------------------------------------------------------------------------
A8MGF2_ALKOO/105-178--------------------------------------------------------------------------------
B2TQM7_CLOBB/105-181--------------------------------------------------------------------------------
Q988B3_RHILO/273-346--------------------------------------------------------------------------------
Q82SK2_NITEU/100-177--------------------------------------------------------------------------------
Q2S9Q1_HAHCH/100-176--------------------------------------------------------------------------------
C0N3G0_9GAMM/100-177--------------------------------------------------------------------------------
B8E235_DICTD/101-179--------------------------------------------------------------------------------
Q7NHV0_GLOVI/113-196--------------------------------------------------------------------------------
A3JEF9_9ALTE/100-177--------------------------------------------------------------------------------
A7H854_ANADF/100-177--------------------------------------------------------------------------------
Q8RAF0_THETN/99-173--------------------------------------------------------------------------------
A0ZCZ0_NODSP/113-219--------------------------------------------------------------------------------
Q1K2X1_DESAC/100-177--------------------------------------------------------------------------------
B2FSH6_STRMK/100-187--------------------------------------------------------------------------------
B6EM38_ALISL/101-179--------------------------------------------------------------------------------
A7IH65_XANP2/278-351--------------------------------------------------------------------------------
Q3KJA6_PSEPF/100-178--------------------------------------------------------------------------------
B7DM24_9BACL/96-194--------------------------------------------------------------------------------
Q2P6L7_XANOM/100-189--------------------------------------------------------------------------------
B0C6K6_ACAM1/111-215--------------------------------------------------------------------------------
B7S0Z0_9GAMM/110-187--------------------------------------------------------------------------------
B1BAN5_CLOBO/105-183--------------------------------------------------------------------------------
C1I9R3_9CLOT/106-178--------------------------------------------------------------------------------
B1Y308_LEPCP/100-183--------------------------------------------------------------------------------
A1SRB2_PSYIN/100-177--------------------------------------------------------------------------------
Q4KJJ3_PSEF5/100-178--------------------------------------------------------------------------------
B8KUT7_9GAMM/100-177--------------------------------------------------------------------------------
A1HQ13_9FIRM/97-173--------------------------------------------------------------------------------
B9YYQ5_9NEIS/100-177--------------------------------------------------------------------------------
B9M3J1_GEOSF/100-177--------------------------------------------------------------------------------
B5FBN6_VIBFM/101-179--------------------------------------------------------------------------------
C0QK71_DESAH/391-463--------------------------------------------------------------------------------
B7KDY8_CYAP7/115-226--------------------------------------------------------------------------------
B8KB93_VIBPA/101-179--------------------------------------------------------------------------------
Q8RHE9_FUSNN/314-386--------------------------------------------------------------------------------
A3Z3C8_9SYNE/419-506--------------------------------------------------------------------------------
F2G3R3_ALTMD/118-196--------------------------------------------------------------------------------
B3E9T1_GEOLS/100-177--------------------------------------------------------------------------------
B5E8I0_GEOBB/100-177--------------------------------------------------------------------------------
B8ESJ7_METSB/292-365--------------------------------------------------------------------------------
A9BY15_DELAS/240-313--------------------------------------------------------------------------------
B1Y072_LEPCP/116-203--------------------------------------------------------------------------------
B2J1B9_NOSP7/115-223--------------------------------------------------------------------------------
C4ZLJ2_THASP/100-177--------------------------------------------------------------------------------
A0KN33_AERHH/100-177--------------------------------------------------------------------------------
A1AMQ0_PELPD/100-177--------------------------------------------------------------------------------
C4GJE0_9NEIS/102-182--------------------------------------------------------------------------------
Q0A4Z1_ALHEH/100-180--------------------------------------------------------------------------------
C4Z597_EUBE2/445-523--------------------------------------------------------------------------------
A6FBL5_9GAMM/100-175--------------------------------------------------------------------------------
Q12FF4_POLSJ/100-183--------------------------------------------------------------------------------
A1JSD8_YERE8/100-174--------------------------------------------------------------------------------
Q5ZX05_LEGPH/100-178--------------------------------------------------------------------------------
Q0AIN5_NITEC/95-174--------------------------------------------------------------------------------
A5FWX5_ACICJ/271-344--------------------------------------------------------------------------------
B0JRP4_MICAN/116-221--------------------------------------------------------------------------------
B9MDE7_ACIET/100-183--------------------------------------------------------------------------------
Q1NNC6_9DELT/33-111--------------------------------------------------------------------------------
C0DV41_EIKCO/103-177--------------------------------------------------------------------------------
C3JZE1_PSEFS/252-326--------------------------------------------------------------------------------
Q609V6_METCA/282-355--------------------------------------------------------------------------------
C3MFK9_RHISN/275-348--------------------------------------------------------------------------------
B5ZIQ8_GLUDA/257-330--------------------------------------------------------------------------------
A6TTT3_ALKMQ/105-178--------------------------------------------------------------------------------
Q1YS07_9GAMM/100-177--------------------------------------------------------------------------------
B0U6Y4_XYLFM/289-362--------------------------------------------------------------------------------
C4LB15_TOLAT/100-177--------------------------------------------------------------------------------
Q1IGB1_PSEE4/101-174--------------------------------------------------------------------------------
B5YJ53_THEYD/106-182--------------------------------------------------------------------------------
Q6MPI9_BDEBA/121-198--------------------------------------------------------------------------------
A8AQU9_CITK8/73-147--------------------------------------------------------------------------------
C0QLC6_DESAH/100-179--------------------------------------------------------------------------------
B1XPF2_SYNP2/120-215--------------------------------------------------------------------------------
Q0EXA3_9PROT/100-177--------------------------------------------------------------------------------
Q3JD25_NITOC/289-364--------------------------------------------------------------------------------
Q1QZY7_CHRSD/101-177--------------------------------------------------------------------------------
A3RW17_RALSL/108-190--------------------------------------------------------------------------------
Q08YZ9_STIAD/84-208--------------------------------------------------------------------------------
Q6AS37_DESPS/100-178--------------------------------------------------------------------------------
A0Z8I9_9GAMM/100-177--------------------------------------------------------------------------------
Q1ZHK8_9GAMM/100-177--------------------------------------------------------------------------------
B6BVV6_9PROT/465-539--------------------------------------------------------------------------------
B9JMG5_AGRRK/265-338--------------------------------------------------------------------------------
Q21UC2_RHOFD/100-183--------------------------------------------------------------------------------
Q3SM93_THIDA/100-177--------------------------------------------------------------------------------
B7WVX0_COMTE/100-183--------------------------------------------------------------------------------
C4IH38_CLOBU/105-181--------------------------------------------------------------------------------
C0EQU7_NEIFL/103-177--------------------------------------------------------------------------------
A2SKH6_METPP/100-183--------------------------------------------------------------------------------
B6J4A1_COXB1/85-157--------------------------------------------------------------------------------
A3YUA5_9SYNE/109-199--------------------------------------------------------------------------------
B3PI74_CELJU/100-177--------------------------------------------------------------------------------
B5YEE0_DICT6/384-462--------------------------------------------------------------------------------
B5XTU2_KLEP3/97-171--------------------------------------------------------------------------------
Q3R4G6_XYLFA/100-184--------------------------------------------------------------------------------
A2PCR9_VIBCL/103-181--------------------------------------------------------------------------------
A1WFQ6_VEREI/278-351--------------------------------------------------------------------------------
Q489N8_COLP3/100-177--------------------------------------------------------------------------------
A4BAN2_9GAMM/100-178--------------------------------------------------------------------------------
A5EBI1_BRASB/276-349--------------------------------------------------------------------------------
A0Y8X3_9GAMM/100-177--------------------------------------------------------------------------------
Q306N5_MYXXD/101-221--------------------------------------------------------------------------------
Q60BY7_METCA/110-193--------------------------------------------------------------------------------
A9BA85_PROM4/113-200--------------------------------------------------------------------------------
Q2VNU4_9BACT/249-322--------------------------------------------------------------------------------
Q2BLX6_9GAMM/100-174--------------------------------------------------------------------------------
Q07N81_RHOP5/265-338--------------------------------------------------------------------------------
A0LPH8_SYNFM/376-449--------------------------------------------------------------------------------
Q89HH6_BRAJA/288-361--------------------------------------------------------------------------------
Q2C0P4_9GAMM/101-179--------------------------------------------------------------------------------
C5CQG6_VARPS/100-183--------------------------------------------------------------------------------
B2A7F7_NATTJ/100-174--------------------------------------------------------------------------------
Q47JL1_DECAR/100-177--------------------------------------------------------------------------------
C3KAI0_PSEFS/101-176--------------------------------------------------------------------------------
Q2P7E4_XANOM/286-359--------------------------------------------------------------------------------
A4BQU5_9GAMM/101-178--------------------------------------------------------------------------------
B7IAW1_ACIB5/100-189--------------------------------------------------------------------------------
Q2LWS9_SYNAS/100-178--------------------------------------------------------------------------------
A8GKR2_SERP5/100-174--------------------------------------------------------------------------------
A4A8K0_9GAMM/100-177--------------------------------------------------------------------------------
A1WDV7_VEREI/100-186--------------------------------------------------------------------------------
A5GFB1_GEOUR/96-176--------------------------------------------------------------------------------
A4CEN2_9GAMM/100-177--------------------------------------------------------------------------------
B5EP45_ACIF5/100-177--------------------------------------------------------------------------------
Q2RI86_MOOTA/98-173--------------------------------------------------------------------------------
Q1GYG2_METFK/100-177--------------------------------------------------------------------------------
Q3A2N1_PELCD/100-177--------------------------------------------------------------------------------
B9M0Z2_GEOSF/96-176--------------------------------------------------------------------------------
Q1QQ80_NITHX/271-344--------------------------------------------------------------------------------
A0LFN5_SYNFM/100-180--------------------------------------------------------------------------------
Q88CU8_PSEPK/100-173--------------------------------------------------------------------------------
B0K9C0_THEP3/99-173--------------------------------------------------------------------------------
B1J2J1_PSEPW/100-173--------------------------------------------------------------------------------
A4WFI2_ENT38/96-170--------------------------------------------------------------------------------
Q15Y39_PSEA6/100-177--------------------------------------------------------------------------------
A1KBQ9_AZOSB/100-177--------------------------------------------------------------------------------
B2IBE2_BEII9/274-346--------------------------------------------------------------------------------
A1TUQ6_ACIAC/264-337--------------------------------------------------------------------------------
A6M144_CLOB8/105-181--------------------------------------------------------------------------------
A3ISW4_9CHRO/116-208--------------------------------------------------------------------------------
A8ZSX8_DESOH/100-178--------------------------------------------------------------------------------
Q5QWC4_IDILO/117-193--------------------------------------------------------------------------------
B0A4I7_YERPE/100-174--------------------------------------------------------------------------------
Q39UI3_GEOMG/96-176--------------------------------------------------------------------------------
B7LS95_ESCF3/97-171--------------------------------------------------------------------------------
B4WYC6_9GAMM/101-177--------------------------------------------------------------------------------
Q8DGH5_THEEB/111-198--------------------------------------------------------------------------------
B6C334_9GAMM/100-177--------------------------------------------------------------------------------
B8FQ80_DESHD/405-487--------------------------------------------------------------------------------
A6D0B9_9VIBR/100-178--------------------------------------------------------------------------------

PF04612

C6BGG9_RALP1/26-185------------------RDAATTFWMQREPRERRILAGGGVVLLLVIVYL-----------------------------
A3UEX1_9RHOB/7-165------------------FTPLIKAFQARTAREQALLAGLAVLVVLTIAWF-----------------------------
Q0K5X1_CUPNH/40-199------------------QERFNAFWSARNPREQAILAGGGALLALVIGYL-----------------------------
GSPM_PECCC/1-161------------------MNELRQRWQAMSQRERQLMVVCAAVLLLCVVYY-----------------------------
Q1IB25_PSEE4/11-155------------------RGQARQRWQALAPRERRAVALAGAVLGSFFCWQ-----------------------------
Q21EQ3_SACD2/4-161------------------VNEFKEWWGNASSRDQISLVVCSVCVALYILFM-----------------------------
Q31WM9_SHIBS/22-178------------------EHWLAQHLAGRSPREKGMLLAAVVFLFSVGYYV-----------------------------
A1WZN8_HALHL/10-173------------------RAEAERFWSARNPRERWLLGSGGLLVLVVVPYV-----------------------------
Q7MPY7_VIBVY/5-163------------------LNMFQAWWSSISQREQRLVVVCGVFGLIGLIYW-----------------------------
Q1ZIZ1_9GAMM/2-159------------------QEKWRIWWATSNIKERRLVVVIVLFLAFSLCYW-----------------------------
A6VAT2_PSEA7/20-183------------------LRRAQAYWRRLAPRERRTVAGGGLALGLALTWQ-----------------------------
B1YQ40_BURA4/7-166------------------NQTLAQFWGERSQRERTLLGWGGAVLAVAIAYS-----------------------------
Q7BSV4_ECO57/1-160------------------MNELKKRLQYVSPRERRLLIGCVALLVVVFVYY-----------------------------
Q3KBE0_PSEPF/17-170------------------NAELQARWQPLAVREKRMVGGMAALLLGLFVWV-----------------------------
Q0I0D9_SHESR/1-158------------------MDNLRTWWQGLASREQQIVGFGAVFLVIGVFYW-----------------------------
A3WP21_9GAMM/17-175------------------VQSAQQRWAQLAVREQNLVKGLGAVIIVAIIYF-----------------------------
A8AIM9_CITK8/5-159------------------IAQLKARYQNYSDRERGLITLCAAAMCCAVIYY-----------------------------
Q1LHW4_RALME/25-184------------------REQVDVFWTARNPREQAILGGGAVVLVLVFGYL-----------------------------
Q5QY94_IDILO/12-171------------------LDLGKQRWQQFNQREQSLLAVLAGVLFIAFLYF-----------------------------
Q9ABP4_CAUCR/5-157------------------LEAARLWWTGRTGREQVLLAVMVAALVVVIGWY-----------------------------
A4VFT9_PSEU5/13-169------------------DSPLWQRWQRLAPRERTSLSLLGAFLLAVLFYL-----------------------------
Q8FCY8_ECOL6/7-160------------------REMIKSWWAEKSTSEKQIVAALAVLSLGVFCWL-----------------------------
Q1ZL56_PHOAS/1-160------------------MAEIKAWWKALSQREQYLVMGAGGVLLLAILYW-----------------------------
A1SR65_PSYIN/2-159------------------VERLNTWWESITEREQQLSLVSVLLILIAIIYW-----------------------------
GSPM_VIBCH/5-164------------------LAPVQAWWRSVTPREQKMVMGMGALTVLAIAYW-----------------------------
Q02HH6_PSEAB/22-191------------------LLRLQAYWRQLAPRERKILAGGGLALCLALTWQ-----------------------------
A0YBF1_9GAMM/11-168------------------LQQFSVRYESLENRDRLAIKLLLGFIVTVIIIF-----------------------------
Q87TC8_VIBPA/6-164------------------ISQAQAWWSGISQREQRLVLGCGAFAILGILYW-----------------------------
GSPM_AERHY/2-162------------------MDKLQGWWRSISAREQRLVAVGGSCLLIGFCYW-----------------------------
A6T4U0_KLEP7/1-158------------------MANLLIWWRQRTPSEQRLLLGLTGLLAACAFWY-----------------------------
A6EW52_9ALTE/11-176------------------VGKLIAQYDQLPRRDQQALSVLAVAILLGILYF-----------------------------
A3MPL1_BURM7/14-173------------------NEALSQFWEARTAREKLLLGWGGAVLALAIAYS-----------------------------
Q9ZFW8_PSEAC/14-170------------------QNPLMLRWQGLPPRDRLALGLLAAFLLLVLLYL-----------------------------
Q0A613_ALHEH/2-163------------------KERLLAHWQGLEPRERRILLAGALVLAVLLPWG-----------------------------
Q0ASQ4_MARMM/5-163------------------FAPVLAWWDGLSSREQVMMAVLGALAMILLVSL-----------------------------
A1JQE2_YERE8/1-159------------------MTKIKQRWQNYSKREQLIFSLGGLVLLGLIVSQ-----------------------------
Q31J18_THICR/7-166------------------KQTALQIWKGFSQRDQRAIMILGGVLLCAVLYF-----------------------------
A6V156_PSEA7/5-149------------------PSALHARWLRLPTRERRALLGLAAFLGLSLAWV-----------------------------
A3SDU2_9RHOB/1-150------------------MKA....FAALNPRERRLVGIVLPLAIVVVGYQ-----------------------------
A3YCB4_9GAMM/14-171------------------LLPLLQKYQALSKREQKLVACLAFVLFIYLLYS-----------------------------
Q1YQU6_9GAMM/7-161------------------VRGISAWLSQRQPRERIIVVVGAGIVFVVAVYL-----------------------------
Q1N4H7_9GAMM/22-176------------------YQSVHNWYSQLGTNDQSIVKVLLFVISLVLIYA-----------------------------
A1U0C6_MARAV/11-176------------------VGKLIARYDQLPTRDRQALTALGIALLLALIYL-----------------------------
Q02PQ8_PSEAB/17-174------------------TSQLAIRWRGLPARDRLALLWLGAFLLLVVLYL-----------------------------
A2SKJ8_METPP/13-167------------------SEQWRARWRRMARRERRLITAAAIVVGVALVWM-----------------------------
Q1NDR5_9SPHN/1-158------------------MDRLGLYWAERSPRERWMLGVMFALLAIVILWF-----------------------------
F2GBM0_ALTMD/1-159------------------MNALLEKYKALTEREQKLVLISAVMIAIALFYF-----------------------------
A6D4H3_9VIBR/5-163------------------LLSAQSWWLSISQREQRLVLACSVVAIIGIIYW-----------------------------
Q4KD21_PSEF5/17-183------------------RAQALGHWNGLALREKRLLGATALGLLGLLLWL-----------------------------
Q5E1Y6_VIBF1/1-161------------------MKAFMAWWQSISPRERILVAGGGVALLIAVIYW-----------------------------
B2T7P8_BURPP/6-165------------------AQTWAGFWEQRTEREKALLTWGGGVLAVVIAWS-----------------------------
Q8PPI2_XANAC/5-157------------------LQRGTQWWQTRAPRERRMLGVMCAALAAFVGWY-----------------------------
A4BDW7_9GAMM/6-161------------------LEPLREKWLSLSRRDQQAARLLGISLLIAIIVF-----------------------------
Q8P5C5_XANCP/5-144------------------RHRSHRWWQQRAPRERVMLAVMGAAIAAFIAWY-----------------------------
A1S1Y3_SHEAM/1-158------------------MDKLKAWWDGLATREQQLVGAGGFMLVIAVFYF-----------------------------
GSPM_KLEPN/1-158------------------MHNLLALWQQRTRRERCLLLGMAVVLLIGLVYY-----------------------------
A5V9H7_SPHWW/17-167------------------RQKAIGLWQARSRREQWLLGGLAAMVALYVLVA-----------------------------
GSPM_ERWCH/1-160------------------MNELRRRWQVMSQRERLMALACGGLVVLCLLYY-----------------------------
Q2Y7T4_NITMU/2-161------------------RKQLRKAWESRSPRERRVITILGMILSAGL.YL-----------------------------
A4XWF6_PSEMY/17-173------------------RSTLAQRWQGLPARDRLALLVLSLFLLLVLFYL-----------------------------
A1W3T9_ACISJ/17-159------------------LAALRAHWARMAPREQSLVLAAAAVVGLALLWW-----------------------------
A3UP97_VIBSP/5-162------------------IEPLQAWWASISQREQRLVIGCSILLILGVVYW-----------------------------
Q15ZB6_PSEA6/1-159------------------MNTLKQKFSQLTEREQRLVLISAVVVVVGMFYW-----------------------------

PF12693

Q8DDT8_VIBVU/244-403-------------------FKHWKVW..QKVAISGSLLIAALVAQQVLTIQ-----------------------------
Q8P5C4_XANCP/217-355-------------------RRGLTP...RRLAWLGVLLLISPLLLLGAQAL-----------------------------
Q8PPI3_XANAC/214-362-------------------EQKRAP...RRLAVLAALVLLSPVLLLLAQTL-----------------------------
Q9ABP5_CAUCR/216-368-------------------GRGGL....RRLAILTAAAVLSPLLLMIAQIA-----------------------------
Q8CZX5_YERPE/243-396-------------------IVNNSVF..LRVASWFFLLFLVMSLNGWYQGY-----------------------------
GSPL_ERWCH/242-399-------------------KQALLPW..RNVLIALSAWLLLVLGESVWTHY-----------------------------
GSPL_PECCC/268-425-------------------QNTLLPW..RGVGIAFACYLLLVVADAGWAHY-----------------------------
Q9ZGT8_ECO57/266-425-------------------YARFRPW..RYVAGALLACVFLAGSNAGLAHY-----------------------------
GSPL_KLEPN/240-398-------------------QPTPRRW..RPVIVAALALLLLWSSNCLHDHL-----------------------------
Q88P00_PSEPK/218-362-------------------RSLPAAS..RQQQRLLAACLVLATVWGGLWLS-----------------------------
O86440_PSEPU/213-361-------------------RTFVGPS..RAQRQLLAACLLLACTWGGLWLA-----------------------------
Q87TC9_VIBPA/245-404-------------------GKYWKVW..QKAAIAAGVLLVVVVAQQLLVVH-----------------------------
GSPL_VIBCH/249-407-------------------LRYWQIW..RKVAIAAGLFVAVSISYSLFQAH-----------------------------
Q8EKC1_SHEON/239-395-------------------SKHLLQW..KNAAIVLAVAIVLSLVNKGLTIH-----------------------------
GSPL_AERHY/243-389-------------------SRYWLQW..RKVAVVAGLLLLVALTQRGMHLY-----------------------------
GSPL_PSEAE/226-382-------------------SSQWRRW..RPLLGLVGLWLVLQWGFTLVQAW-----------------------------
Q9ZFW9_PSEAC/223-381-------------------SGQWQRW..RPLAGLLGLWLVLQWGFNLAQGW-----------------------------
Q8VPC1_ECOLX/234-392-------------------RKQWARW..RVMILPILLILVALAVERGVTLW-----------------------------
GSPL_ECOLI/237-387-------------------SKS.GKWLARLAVSCLVLAILSFVGSRSIALW-----------------------------
Q8XUS4_RALSO/317-476-------------------GMDWSAW..RLPIALAVLIAVAQLIGMNTQWL-----------------------------
Q9ZF77_BURPE/291-444-------------------FDRATFMRLRLPLALAATTLAIAVIGANAHWW-----------------------------
Q9I5P2_PSEAE/207-381-------------------SAGNGTW..KMPLFCAALALLVWVAGLNLYAG-----------------------------
Q8GBD8_YEREN/245-399-------------------KVRGN....KLLVALAAVYLLTFVTEPTLSGY-----------------------------

PF10721

A8A0B0_ECOHS/1-160-------------------------MNQIFTVILLVLVG........F...-----------------------------
A5W5S5_PSEP1/4-164-------------------------WVGCAAVLVLL.VSHWTA....Y...-----------------------------
Q858E9_BPE15/10-160-------------------------WKQLLIVLMLAALVIVGV....VAWN-----------------------------
B1J5E9_PSEPW/4-165-------------------------WVIRSALLLALLASYWGV....Y...-----------------------------
Q8Z7W1_SALTI/12-170-------------------------WLQLAFILLMAGA.........F...-----------------------------
Q57Q93_SALCH/12-178-------------------------WKPLAEILLVAFLLCAGA....YWCY-----------------------------
Q46YK2_CUPPJ/9-168-------------------------WLAAIVGMALA...........F...-----------------------------
Q4KA36_PSEF5/4-166-------------------------WLLRGGLLVLVLASYWGI....Y...-----------------------------
A9ABH5_BURM1/1-157-------------------------MTLLKLVLPYVLALLLGV........-----------------------------
Q87Y73_PSESM/9-169-------------------------WKVLAIVAVLISCWVWG.....F...-----------------------------
Q48J34_PSE14/4-169-------------------------FAYRIGGALLILLALAGALYGAY...-----------------------------
A1AE00_ECOK1/10-160-------------------------WKQLLIVLMLAALFIVGV....VAWN-----------------------------
Q88MI7_PSEPK/4-164-------------------------WVGLAAAVVLV.ASHWGA....Y...-----------------------------
VG55_BPN15/14-172-------------------------WKPLFVLIFAASA.........F...-----------------------------
Q9F9Z1_9ENTR/18-187-------------------------IHYQVAAVVLTGVMVWGLSHWRY...-----------------------------
Q7WK95_BORBR/4-167-------------------------WRRSAVVALLSAAL............-----------------------------
B0KJQ0_PSEPG/12-176-------------------------WWLIALVLVAGGQQYRVV....I...-----------------------------

PF04375

Q8XWW4_RALSO/305-691PSSPAPTVSQTPVPTSVPTPGPAAASPGLAPAPAAPTMTAGAGPGRGGWLLWAALIL......ALVVVAGLQIRNERLAR
Q9HTT7_PSEAE/4-374AVTPQDDARTSTSTPSPVAPDASRRSGTATGLALLALLVGVAGLGAGGWSFWQVQQLQGTERDQLAQLEDARGKTESLAQ
Q9CK22_PASMU/71-451ESVKKEPAKQARAESKNTAETVVVKKGGGTGLALLALLVA.LGLGAAGYYF............GLQQVDHIQHKLSALEQ
Q9KVM3_VIBCH/33-397SPAPNQPAAKKTLDSTPAQDKPPQPNSQGKKLASVALLLV.LALGAGFAYV............HQQQKSEFNNQLQAVRA
HEMX_ECOLI/8-372SAVVEETREAVDTTSQPVATEKKSKNNTALILSAVAIAIA.LAAGIGLYGW............GKQQAVNQTATSDALAN

PF04350

A3M9J2_ACIBT/73-221----------------------I...DNAQAQESNLLNEFREKDSKL----RNLQQYQVQLQ--------EMQANFNQQL
B1KP68_SHEWM/48-192----------------------VAQLDKEQRTELQLREDFKSKYQLA----ANLKLYREQLA--------VMESQFAELL
A3L2L2_PSEAI/58-202----------------------L...EQQAAQEESLKQQFATKAFQA----ANLEAYKAQMK--------EMEESFGALL
A1TKV8_ACIAC/65-211----------------------L...DAERAKEVSLREDYQRKLVKA----VSLDALKKQRE--------QVQQYVIQLE
Q0AF43_NITEC/50-192----------------------L...EQVQQEEDTLKATFIAKKNSA----VNLDLFRVQLA--------EVEQTLGTLL
A6T3F9_JANMA/58-199----------------------L...DRAVAEEVTLKDAYKSKVQQA----INLVGLRKQKE--------QVNEYVSTLE
Q9PGD1_XYLFA/51-201----------------------L...GVLEGKERELRSEFQKQQERA----VNLQPLKQQLV--------QMEEVLKQML
Q6AS36_DESPS/56-201----------------------I...TRLQQQEKNTQQTVTVAKNKA----ANLAKFQKEVE--------ATTLDFETQA
Q3JEG7_NITOC/49-192----------------------L...EDFKKKEPGLKATFEAKQAKA----ANLESYEKQME--------EMKLSFGTML
A5GEZ7_GEOUR/43-188----------------------L...KGFQAKLEELQKKITEDKKVA----DNISKYKKEYD--------QLQNELKTAL
A8GZ26_SHEPA/51-192----------------------L...SAEQNKEQQLKTDFKSKYQLA----ANLKLYREQLA--------TMEIQFAELL
A4BQU6_9GAMM/49-200----------------------L...EQARARETELKKQFERKQRIA----ANLEKYQKQLT--------DMEASFGAML
Q0I056_SHESR/48-192----------------------IDVYNAEQRKEEQLREDFKTKYQLA----ANLKLYREQLA--------VMEEQFAELL
Q1ZLT6_PHOAS/47-193----------------------L...EQMKHKEQTLKSQLVSRASQV----AALPRVKEQVA--------ELNRRYNEMI
Q21UC1_RHOFD/65-206----------------------L...ATEQATEVKLREEYKVKLGKA----VNLEALKKQRE--------QVLQYVTQLE
Q1GYG3_METFK/49-194----------------------L...EQARAKEKELRDTFLAKKRQA----INLEAYKQQMV--------EIERTFGALV
A0Y285_9GAMM/56-197----------------------Y...HNAVSKEVDLRSTYRTKYAVA----SKLDIYRQQMI--------EMEDKFSQLL
A5EW42_DICNV/50-200----------------------I...AANEAKIASLEKSFADIFQKT----VDLQQYQVRAN--------ELWNILEGLL
A3Y0G4_9VIBR/53-196----------------------L...QQMKQQEQTLKATLRIKANKV----AALPKLQSQLD--------ELTSRYDYLL
Q0EXA4_9PROT/51-193----------------------I...AQQQAQAKVQQMRLIKNKRLA----HNLPRKQREYA--------QLEKQLKVAL
Q1K2X2_DESAC/43-188----------------------L...AKQQKNNKKVLVELQEKRRIA----NNLPRFKAEYE--------KMKKQLDLAL
Q46WJ0_CUPPJ/59-200----------------------L...DRQRAEQENLKQAYQSKVVQV----ANLEALREQKK--------QVELRVAQLE
A7MXC8_VIBHB/47-190----------------------L...NTLIQEEQTLKVALRIKANKV----AALPQLQSQLD--------ELTTRYELLL
B7WV77_COMTE/66-211----------------------L...DGERATEVTLREDYSKKVVKA----VSLDGLKKQRE--------QVQQYVTQLE
A6F2X5_9ALTE/58-201----------------------L...DRVEKTEQELRKRYEDKAYQV----ANLEVFKAQME--------EMEETFGALV
Q2S9Q2_HAHCH/58-200----------------------L...ETKQTEEIDLRKQFEGKAAQV----SNLEEYKAQMV--------EMEKTFGDLL
Q3SM92_THIDA/49-189----------------------V...DAAKQKETELRSVFATKKNQA----INLEAYRKQLT--------DIEQAFGALL
Q1N2I2_9GAMM/61-205----------------------Y...DQVVQQESQLKEEFKTKAFRV----NNLDEYKQQLQ--------DIEESFGTLL
Q08Z00_STIAD/19-166----------------------I...KKQVEQRRKLDLDLAEKSEIA----QNLNERRRELD--------VLDQKLAEAL
Q0A4Z0_ALHEH/49-191----------------------L...ERAEAREPDLLRELDQKKHRA----ANLDAYRRQKE--------QIETELVEML
A0Y8X2_9GAMM/58-199----------------------L...VQEQKKELDLRSEFERKAYQA----ANLNAYRTQMV--------QMEESFGALV
A0LFN6_SYNFM/50-195----------------------L...AKVTASVAEQQKKLASLKEAA----ARVDKLQKELA--------ASEADFNSLL
Q1YS06_9GAMM/58-199----------------------T...DRAATQEHELLQQYQSKAFLA----ANLDAYRQQMI--------ELDETFGALL
D7HR04_VIBCL/50-193----------------------I...ALLKQEEETVKATLRIKANKV----AVLPQIQAQLD--------ELKERYDFLL
Q15Y40_PSEA6/54-194----------------------L...EKVQLQEVDLKASYQGKYNIA----VNLPAYQEQLK--------RLEKDFSSML
Q1LI84_RALME/59-200----------------------L...DRKRAEQETLKQQFQTKVAQV----ANLDALVAQKA--------EVEKRVALAE
B3E9T2_GEOLS/43-188----------------------L...TELKAQHQQLQAEVDENTKIA----NNLPKIQKEYN--------DLNLELEKAL
Q306N4_MYXXD/43-190----------------------I...GWAVAERRKLDLELADKSEIA----QNLNERRREMD--------VLEQKLSEAL
Q39X09_GEOMG/43-188----------------------L...KELRGRLEGLQNEVREKERIA----NNLPKLKREYQ--------QLQKDLDLAL
Q8DCM4_VIBVU/47-190----------------------L...QRMVTEEQTLKISARIKATKV----AALPQLQSQLD--------ELTQRYEFLL
A0KN32_AERHH/49-192----------------------L...TQETNKEAELKAQFESKAMLA----ANLGAYKTQMV--------QLEQLVDTQL
B9M3J0_GEOSF/43-188----------------------F...KTLQTQLEDLSRQASEAQKLA----NNLPKYKQEYE--------QLQNELKLAL
Q1Q8Q5_PSYCK/75-221----------------------I...TAAESQQQTLLDSYREKESRA----RHLQAYQAQVI--------QMEAEFNTLL
Q74BL1_GEOSL/43-188----------------------L...TALRGKLEKLQTEVQEKTRIA----NNLPKLKKEYQ--------QLQKDLENAL
B5E8I1_GEOBB/43-188----------------------L...KELKAKQEELQKQIQESRSIA----NNLPRFKAEYE--------QLKKDLDNAL
Q489N7_COLP3/51-194----------------------L...DRVSYEEKTLKESYRAKYHVA----ANLDLFRAQMV--------EAEDTFANQL
Q2BLX7_9GAMM/56-196----------------------L...RKEISKEQQLKDIYAQKAHQV----ANLEALQKQME--------DVEERFAELK
O05128_NEIGO/50-200----------------------L...EEYEAKETELKNTYKQKSIDA----ASLNNLRDELA--------SIRSAFDIML
Q21H80_SACD2/59-202----------------------L...EAAKSQEKTLKVSFEGKAHEA----ANLDAYRTQMV--------KMEESFGEVI
A5IFY3_LEGPC/49-198----------------------L...EIQEAQEIALKTEFEKKQHQA----ANLQAYRNQLQ--------LMNERFGTML
Q1QZY6_CHRSD/58-200----------------------L...DSLQARERTLLAEYEARAYQA----ANLDQMRTQMA--------ELDARMQALL
Q5H3Q8_XANOR/51-201----------------------L...EGLEGTESQLRTEFETQQGRA----VNLEPLKQQLA--------QMEQVLQQML
Q5E2F6_VIBF1/46-189----------------------I...EQSKLDEISLKTTVKYKYNQV----AAMPKMKDQLN--------ELNLRYEFLS
Q6F7E1_ACIAD/73-220----------------------I...QTAQAQEKNLLNEFREKQSKL----RNLQQYQHQLE--------EMRASFNQQL
A1KBQ8_AZOSB/62-203----------------------L...TQREAEEVQLRQDWVSKKKQA----ISLDEHKRQLA--------EIDRQFGALL
A1SRB3_PSYIN/46-187----------------------L...AKVEEKEIALKNEFKTKAALS----SHLEEYRTQMV--------DIRLVFKGLL
Q0VMB5_ALCBS/61-210----------------------L...DQQKKEEATLLQAYEKKAFQA----HNLDQFRKQLV--------EMEQTFGALL
Q7NZU0_CHRVO/47-188----------------------L...NQSRQQEATLKQTFVDKKRQA----VNLDALEQQLK--------EIDASFGALL
A1SB17_SHEAM/51-192----------------------L...KREQDKEVQLRQDFQSKYQLA----ANLKLYREQLK--------EMEAQFAELL
Q2INP0_ANADE/50-195----------------------I...ARAKTEQARLDREYIEKTSIA----NNLNQFRREKE--------LLEERLRQAL
A0Z8J0_9GAMM/58-201----------------------L...TAERGNEAELRRDFERLSFEA----ANLEAYKRQML--------EMEESFGALV
Q1Z012_PHOPR/47-192----------------------L...TQLKQNEVELRSRVINRASLV----AALPTVKQQIN--------ELNKRYQLVI
A4BAN3_9GAMM/60-209----------------------Y...DSALAKEPTLKQQYRAKSFQV----ANLDAFKEQLR--------KMEEDFSALL
A4A8J9_9GAMM/58-201----------------------L...ASEQSRESTLKQDYEKKAFQV----ANLDAYRRQMA--------EMEESFGALI
Q47JL0_DECAR/63-205----------------------L...DSKEREEQSLKQQFLDKKRQA----VNLDLYVQQLA--------EIDRSFGALL
Q5P5N9_AROAE/61-202----------------------L...ETREAEEAELRQSWVSKKKLA----VNLDAYKLQLE--------ETDRQFGALL
Q12SM2_SHEDO/51-192----------------------L...SYEQNEEIKLRQDFENKYRLA----ANLKLYREQLV--------VMEAQFAELL
A1WDV6_VEREI/65-209----------------------L...EEARSKETALRDGYRQKLVKA----VNLDVLKKQRE--------QIQQYVIQLE
A8ZSX7_DESOH/54-197----------------------I...AKIDKQYETVAKELNVAKQKA----AQLGALQEEWA--------EKEEKFKLVM
A6D0B8_9VIBR/44-187----------------------L...ERAVQLEQRLKLELKTVVAQT----ANLPNKKQQLE--------LVRSRYQRLL
A6FBL6_9GAMM/49-190----------------------L...ENIEKKEASLKLQFEAKARLA----GNLGLYTEQMS--------EMENLFNHML
Q3A2N2_PELCD/43-188----------------------L...DRLQRQKGGLERKLAEDRRIA----DNLPKFRAEYE--------KLEKQLEVAL
Q1ZHK9_9GAMM/46-187----------------------L...EAEQNKEFILKKDFKLKAALA----SNLEAYQEQMI--------EIHVILDELI
Q4KJJ2_PSEF5/58-202----------------------L...ERQRQEETRLRQEFAGKARQG----ANLPRYQEQLA--------VIRNSFDLLL
Q60BY6_METCA/48-198----------------------L...EDQQRREQELKETFEIKQKKA----VNLEEYKLQLA--------DIEKTFGDLL

PF10741

A9BY16_DELAS/76-187-------------------------------------------------------------------------RAQHVYP
A1WFQ5_VEREI/74-182-------------------------------------------------------------------------LAQYVYA
A1TUQ5_ACIAC/72-183-------------------------------------------------------------------------RAQYIYP
Q5P6R2_AROAE/78-190-------------------------------------------------------------------------LSRYAYP
A0Z1M0_9GAMM/71-181-------------------------------------------------------------------------VADHIYP
A4A5M0_9GAMM/74-184-------------------------------------------------------------------------LREMAFP
Q87ZW3_PSESM/77-193-------------------------------------------------------------------------ASSTSLL
B1J7E6_PSEPW/76-193-------------------------------------------------------------------------AQRNSLL
Q1QQ81_NITHX/73-181-------------------------------------------------------------------------PSGSPFL
A5EBI2_BRASB/75-183-------------------------------------------------------------------------PGGSVFV
Q89HH7_BRAJA/79-189-------------------------------------------------------------------------HPGTPFL
Q2VNU3_9BACT/73-185-------------------------------------------------------------------------PAGSPFL
Q212Z0_RHOPB/75-181-------------------------------------------------------------------------PAGSPFL
A5EF22_BRASB/73-180-------------------------------------------------------------------------RKGSAFL
A4YMS4_BRASO/72-179-------------------------------------------------------------------------ARGSAFL
A7IH66_XANP2/71-186-------------------------------------------------------------------------WAGAPVL
Q5H4L2_XANOR/85-200-------------------------------------------------------------------------ESRPGFL
Q3RHI6_XYLFA/76-191-------------------------------------------------------------------------RSRPGFL
B4SJ91_STRM5/76-192-------------------------------------------------------------------------QQRPGFL
Q609V5_METCA/84-198-------------------------------------------------------------------------EQAKNLF
Q3JD24_NITOC/76-192-------------------------------------------------------------------------AANAYYL
B0T7N6_CAUSK/73-179-------------------------------------------------------------------------SGAAFRI
Q8KZ83_GLUDI/87-194-------------------------------------------------------------------------PRPALLI
Q0BR92_GRABC/89-202-------------------------------------------------------------------------AANTAFL
A5FWX4_ACICJ/79-187-------------------------------------------------------------------------AGRDAYL
Q82WG9_NITEU/68-173-------------------------------------------------------------------------SISTLVF
Q9RW97_DEIRA/74-187-------------------------------------------------------------------------VEREKFL
Q07N82_RHOP5/69-181-------------------------------------------------------------------------HDANLFV

PF03245

O80285_9CAUD/31-149---------------------------ELARAESAESN....LVLAN....LTIADMQKRQR........DVAKLDARYT
A7MK05_CROS8/30-153---------------------------ALKESQASLTKVNRELNLAK....DTISDMQTRQR........DVAALDAKYT
Q9ZXB6_BPH19/29-154---------------------------NAITYKEQRDKKVSELELAN....ATITDMQQRQR........DVAALDARYS
Q7N318_PHOLL/26-149---------------------------ELQREQRVTKQQQEDIQQLT....DTINYQNAHIT........MLNELDVKHT
A1ACE3_ECOK1/29-154---------------------------NAIAYKEQRDKKVSELKLAI....ATIADMQQRQR........DVAALDAKYS
Q56118_9CAUD/29-155---------------------------NAIAYKEQRDTVTHKLTLAN....ATITDMTKRQR........DVADLDARYI
Q1RCX8_ECOUT/33-157---------------------------NAITYKAQRDKNARELTLAN....AVITDIQMRQR........DVAALDAKYT
Q2A0C4_9VIRU/30-151---------------------------RLVVAERQLSEAQLR...EA....RTLSALQARQQ........AIADIDARYT
Q76H63_9CAUD/29-154---------------------------NAITYKVQRDTVTQKLALAN....ATITDMQTRQR........DVAELDARYT
Q2A095_9VIRU/28-149---------------------------RAVSFEQQAGEAQRR...EN....NLRAQVVSRQQ........AIADIDARYT
Q1I6B5_PSEE4/33-166---------------------------LAESEALQAQQKVEQVEALNEQLLAERDRRQALEQ........RLHNDETRHY
Q9KXD2_BPVT2/29-154---------------------------NALTYKAQRDKKARELEQAN....ATITDMQVRQR........DVAALDAKYS
A7MLQ7_CROS8/30-153---------------------------SLTKAEASLTKVNHELKLAK....DDIEDMQRRQR........DVATLDAKYT
Q48C47_PSE14/33-153---------------------------VVQERNSAITERDGLREAAR....IRGEQLAARDQ............LDTHHT
A4WC46_ENT38/29-152---------------------------NATEYKKQRDQKTTALNLAN....ATITDMTTRQR........DVAALDAKYT
A2P359_VIBCL/23-146---------------------------HISAQNSEIKQLTQALEAKT....AQEKDQKERIA........RLSEIGRKHL
B0KHE2_PSEPG/21-146---------------------------KIEAQSLALDQATHQVATLQ....AAAESRRNTIK........LLADLDTQHT
Q1GXR8_METFK/50-191---------------------------EAAEKARWVARDNAALRAAN....AEIAELNTQARVQERQHAEAVATISRQFQ
Q8X2A4_ECO57/29-154---------------------------NALTYKAQRDKKARELEQAN....ATITDMQVRQR........DVAALDAKYS
A4WB39_ENT38/29-154---------------------------NATEYKKQRDEKTQALNMAN....ATITDMTTRQR........DVAALDAKYT
Q7N0Y2_PHOLL/26-149---------------------------KYTKQLDTTVKLQSELLEQQ....NEIVNQQERIR........LLSKLDNQHT
Q1VCK5_VIBAL/31-155---------------------------RADIAESQLTLVKSEIQGYI....SALHQQRVQIQ........SFNQLGEKHA
B1JDA4_PSEPW/32-158---------------------------LAQQAQAQAVAMATRVLEVR.......EQNQRLER........QLHESETRHY
A6UZ52_PSEA7/32-149---------------------------DLQDARREVAGLQQAAQVAG.......ELLAARDA............LDLKHT
A1JLU8_YERE8/29-147---------------------------KYLQAERLASERQ...........STIEEMAKRQQ........ISAALDAKYT
Q7CID8_YERPE/26-151---------------------------EAAKLQRDVVEIASVANQQK....KDLQLIEAQRQ........AVAAIDIKTT
A8CGF5_BPP22/29-144---------------------------NAITYKEQRDK.......AT....SIIADMQKRQR........DVAELDARYT
Q8XYQ5_RALSO/38-173---------------------------IATLQRDQAEKDRQQARADEAQLRQEREKRAGLER........QLGELDARHY
Q2NV02_SODGM/25-149---------------------------QYKGAEETLRQVELEVKSRL....AEIEQLSRQIQ........TIAVLDLQHT
Q6HAE1_9ENTR/26-151---------------------------QSIIWKEKSKEANASVRKYE....NQIELIQSQHR........KLAELDEHHT

PF05137

D4BI19_9ENTR/97-171--------------------------------------------------------------------------------
C7R7X0_KANKD/100-176--------------------------------------------------------------------------------
C7QTE2_CYAP0/114-206--------------------------------------------------------------------------------
C6BWY3_DESAD/355-431--------------------------------------------------------------------------------
D3SD46_THISK/100-177--------------------------------------------------------------------------------
C8X4Y9_DESRD/100-179--------------------------------------------------------------------------------
D0L237_HALNC/100-184--------------------------------------------------------------------------------
D0WBB7_NEILA/103-177--------------------------------------------------------------------------------
D2ZYQ1_NEIMU/103-177--------------------------------------------------------------------------------
D2Z429_9BACT/103-180--------------------------------------------------------------------------------
B2FNI0_STRMK/286-360--------------------------------------------------------------------------------
B1EI39_9ESCH/97-171--------------------------------------------------------------------------------
C1DHR0_AZOVD/100-178--------------------------------------------------------------------------------
Q1N2I1_9GAMM/100-174--------------------------------------------------------------------------------
Q7NZT9_CHRVO/100-177--------------------------------------------------------------------------------
A8T9N5_9VIBR/101-179--------------------------------------------------------------------------------
B3R7C3_CUPTR/105-187--------------------------------------------------------------------------------
Q74C93_GEOSL/96-176--------------------------------------------------------------------------------
B9TC62_RICCO/24-102--------------------------------------------------------------------------------
A8GZ25_SHEPA/100-177--------------------------------------------------------------------------------
Q74BL0_GEOSL/100-177--------------------------------------------------------------------------------
Q061N8_9SYNE/111-200--------------------------------------------------------------------------------
A4G9P6_HERAR/100-182--------------------------------------------------------------------------------
Q1IRM8_KORVE/109-189--------------------------------------------------------------------------------
C4K8E6_HAMD5/100-172--------------------------------------------------------------------------------
A0YSX4_LYNSP/116-236--------------------------------------------------------------------------------
Q21H79_SACD2/100-177--------------------------------------------------------------------------------
D6SKS7_9DELT/355-426--------------------------------------------------------------------------------
Q1Q6D7_9BACT/347-419--------------------------------------------------------------------------------
A5EF21_BRASB/284-357--------------------------------------------------------------------------------
B4UDC4_ANASK/100-177--------------------------------------------------------------------------------
F2G6J6_ALTMD/100-177--------------------------------------------------------------------------------
Q5P5N8_AROAE/100-177--------------------------------------------------------------------------------
A5GEZ6_GEOUR/100-177--------------------------------------------------------------------------------
A1ARQ3_PELPD/96-177--------------------------------------------------------------------------------
B5JTT5_9GAMM/102-177--------------------------------------------------------------------------------
Q1PJI8_PROMR/111-194--------------------------------------------------------------------------------
B2Q5V2_PROST/100-173--------------------------------------------------------------------------------
Q0BZ78_HYPNA/235-307--------------------------------------------------------------------------------
Q87L63_VIBPA/101-179--------------------------------------------------------------------------------
B4VRN9_9CYAN/118-234--------------------------------------------------------------------------------
B8D2D6_HALOH/94-167--------------------------------------------------------------------------------
Q4FQH8_PSYA2/100-200--------------------------------------------------------------------------------
P74187_SYNY3/116-221--------------------------------------------------------------------------------
Q3IJC1_PSEHT/100-177--------------------------------------------------------------------------------
A5WCG1_PSYWF/77-165--------------------------------------------------------------------------------
A5KTK0_9BACT/97-178--------------------------------------------------------------------------------
Q6LVG0_PHOPR/101-179--------------------------------------------------------------------------------
Q2JVP2_SYNJA/119-199--------------------------------------------------------------------------------
C5BRK2_TERTT/100-177--------------------------------------------------------------------------------
Q31KD7_SYNE7/115-203--------------------------------------------------------------------------------
Q05VH9_9SYNE/427-512--------------------------------------------------------------------------------
Q212Y9_RHOPB/275-348--------------------------------------------------------------------------------
A0Z1L9_9GAMM/260-333--------------------------------------------------------------------------------
Q8YY23_NOSS1/115-220--------------------------------------------------------------------------------
A3CR63_STRSV/106-183--------------------------------------------------------------------------------
A3LJ85_PSEAI/100-178--------------------------------------------------------------------------------
Q7NA52_PHOLL/101-175--------------------------------------------------------------------------------
B4A5T7_SALNE/97-171--------------------------------------------------------------------------------
Q21T59_RHOFD/119-218--------------------------------------------------------------------------------
Q7MH79_VIBVY/111-189--------------------------------------------------------------------------------
B6SE77_9NEIS/102-181--------------------------------------------------------------------------------
B5EI36_GEOBB/95-175--------------------------------------------------------------------------------
A4YMS3_BRASO/280-353--------------------------------------------------------------------------------
A8MGF2_ALKOO/105-178--------------------------------------------------------------------------------
B2TQM7_CLOBB/105-181--------------------------------------------------------------------------------
Q988B3_RHILO/273-346--------------------------------------------------------------------------------
Q82SK2_NITEU/100-177--------------------------------------------------------------------------------
Q2S9Q1_HAHCH/100-176--------------------------------------------------------------------------------
C0N3G0_9GAMM/100-177--------------------------------------------------------------------------------
B8E235_DICTD/101-179--------------------------------------------------------------------------------
Q7NHV0_GLOVI/113-196--------------------------------------------------------------------------------
A3JEF9_9ALTE/100-177--------------------------------------------------------------------------------
A7H854_ANADF/100-177--------------------------------------------------------------------------------
Q8RAF0_THETN/99-173--------------------------------------------------------------------------------
A0ZCZ0_NODSP/113-219--------------------------------------------------------------------------------
Q1K2X1_DESAC/100-177--------------------------------------------------------------------------------
B2FSH6_STRMK/100-187--------------------------------------------------------------------------------
B6EM38_ALISL/101-179--------------------------------------------------------------------------------
A7IH65_XANP2/278-351--------------------------------------------------------------------------------
Q3KJA6_PSEPF/100-178--------------------------------------------------------------------------------
B7DM24_9BACL/96-194--------------------------------------------------------------------------------
Q2P6L7_XANOM/100-189--------------------------------------------------------------------------------
B0C6K6_ACAM1/111-215--------------------------------------------------------------------------------
B7S0Z0_9GAMM/110-187--------------------------------------------------------------------------------
B1BAN5_CLOBO/105-183--------------------------------------------------------------------------------
C1I9R3_9CLOT/106-178--------------------------------------------------------------------------------
B1Y308_LEPCP/100-183--------------------------------------------------------------------------------
A1SRB2_PSYIN/100-177--------------------------------------------------------------------------------
Q4KJJ3_PSEF5/100-178--------------------------------------------------------------------------------
B8KUT7_9GAMM/100-177--------------------------------------------------------------------------------
A1HQ13_9FIRM/97-173--------------------------------------------------------------------------------
B9YYQ5_9NEIS/100-177--------------------------------------------------------------------------------
B9M3J1_GEOSF/100-177--------------------------------------------------------------------------------
B5FBN6_VIBFM/101-179--------------------------------------------------------------------------------
C0QK71_DESAH/391-463--------------------------------------------------------------------------------
B7KDY8_CYAP7/115-226--------------------------------------------------------------------------------
B8KB93_VIBPA/101-179--------------------------------------------------------------------------------
Q8RHE9_FUSNN/314-386--------------------------------------------------------------------------------
A3Z3C8_9SYNE/419-506--------------------------------------------------------------------------------
F2G3R3_ALTMD/118-196--------------------------------------------------------------------------------
B3E9T1_GEOLS/100-177--------------------------------------------------------------------------------
B5E8I0_GEOBB/100-177--------------------------------------------------------------------------------
B8ESJ7_METSB/292-365--------------------------------------------------------------------------------
A9BY15_DELAS/240-313--------------------------------------------------------------------------------
B1Y072_LEPCP/116-203--------------------------------------------------------------------------------
B2J1B9_NOSP7/115-223--------------------------------------------------------------------------------
C4ZLJ2_THASP/100-177--------------------------------------------------------------------------------
A0KN33_AERHH/100-177--------------------------------------------------------------------------------
A1AMQ0_PELPD/100-177--------------------------------------------------------------------------------
C4GJE0_9NEIS/102-182--------------------------------------------------------------------------------
Q0A4Z1_ALHEH/100-180--------------------------------------------------------------------------------
C4Z597_EUBE2/445-523--------------------------------------------------------------------------------
A6FBL5_9GAMM/100-175--------------------------------------------------------------------------------
Q12FF4_POLSJ/100-183--------------------------------------------------------------------------------
A1JSD8_YERE8/100-174--------------------------------------------------------------------------------
Q5ZX05_LEGPH/100-178--------------------------------------------------------------------------------
Q0AIN5_NITEC/95-174--------------------------------------------------------------------------------
A5FWX5_ACICJ/271-344--------------------------------------------------------------------------------
B0JRP4_MICAN/116-221--------------------------------------------------------------------------------
B9MDE7_ACIET/100-183--------------------------------------------------------------------------------
Q1NNC6_9DELT/33-111--------------------------------------------------------------------------------
C0DV41_EIKCO/103-177--------------------------------------------------------------------------------
C3JZE1_PSEFS/252-326--------------------------------------------------------------------------------
Q609V6_METCA/282-355--------------------------------------------------------------------------------
C3MFK9_RHISN/275-348--------------------------------------------------------------------------------
B5ZIQ8_GLUDA/257-330--------------------------------------------------------------------------------
A6TTT3_ALKMQ/105-178--------------------------------------------------------------------------------
Q1YS07_9GAMM/100-177--------------------------------------------------------------------------------
B0U6Y4_XYLFM/289-362--------------------------------------------------------------------------------
C4LB15_TOLAT/100-177--------------------------------------------------------------------------------
Q1IGB1_PSEE4/101-174--------------------------------------------------------------------------------
B5YJ53_THEYD/106-182--------------------------------------------------------------------------------
Q6MPI9_BDEBA/121-198--------------------------------------------------------------------------------
A8AQU9_CITK8/73-147--------------------------------------------------------------------------------
C0QLC6_DESAH/100-179--------------------------------------------------------------------------------
B1XPF2_SYNP2/120-215--------------------------------------------------------------------------------
Q0EXA3_9PROT/100-177--------------------------------------------------------------------------------
Q3JD25_NITOC/289-364--------------------------------------------------------------------------------
Q1QZY7_CHRSD/101-177--------------------------------------------------------------------------------
A3RW17_RALSL/108-190--------------------------------------------------------------------------------
Q08YZ9_STIAD/84-208--------------------------------------------------------------------------------
Q6AS37_DESPS/100-178--------------------------------------------------------------------------------
A0Z8I9_9GAMM/100-177--------------------------------------------------------------------------------
Q1ZHK8_9GAMM/100-177--------------------------------------------------------------------------------
B6BVV6_9PROT/465-539--------------------------------------------------------------------------------
B9JMG5_AGRRK/265-338--------------------------------------------------------------------------------
Q21UC2_RHOFD/100-183--------------------------------------------------------------------------------
Q3SM93_THIDA/100-177--------------------------------------------------------------------------------
B7WVX0_COMTE/100-183--------------------------------------------------------------------------------
C4IH38_CLOBU/105-181--------------------------------------------------------------------------------
C0EQU7_NEIFL/103-177--------------------------------------------------------------------------------
A2SKH6_METPP/100-183--------------------------------------------------------------------------------
B6J4A1_COXB1/85-157--------------------------------------------------------------------------------
A3YUA5_9SYNE/109-199--------------------------------------------------------------------------------
B3PI74_CELJU/100-177--------------------------------------------------------------------------------
B5YEE0_DICT6/384-462--------------------------------------------------------------------------------
B5XTU2_KLEP3/97-171--------------------------------------------------------------------------------
Q3R4G6_XYLFA/100-184--------------------------------------------------------------------------------
A2PCR9_VIBCL/103-181--------------------------------------------------------------------------------
A1WFQ6_VEREI/278-351--------------------------------------------------------------------------------
Q489N8_COLP3/100-177--------------------------------------------------------------------------------
A4BAN2_9GAMM/100-178--------------------------------------------------------------------------------
A5EBI1_BRASB/276-349--------------------------------------------------------------------------------
A0Y8X3_9GAMM/100-177--------------------------------------------------------------------------------
Q306N5_MYXXD/101-221--------------------------------------------------------------------------------
Q60BY7_METCA/110-193--------------------------------------------------------------------------------
A9BA85_PROM4/113-200--------------------------------------------------------------------------------
Q2VNU4_9BACT/249-322--------------------------------------------------------------------------------
Q2BLX6_9GAMM/100-174--------------------------------------------------------------------------------
Q07N81_RHOP5/265-338--------------------------------------------------------------------------------
A0LPH8_SYNFM/376-449--------------------------------------------------------------------------------
Q89HH6_BRAJA/288-361--------------------------------------------------------------------------------
Q2C0P4_9GAMM/101-179--------------------------------------------------------------------------------
C5CQG6_VARPS/100-183--------------------------------------------------------------------------------
B2A7F7_NATTJ/100-174--------------------------------------------------------------------------------
Q47JL1_DECAR/100-177--------------------------------------------------------------------------------
C3KAI0_PSEFS/101-176--------------------------------------------------------------------------------
Q2P7E4_XANOM/286-359--------------------------------------------------------------------------------
A4BQU5_9GAMM/101-178--------------------------------------------------------------------------------
B7IAW1_ACIB5/100-189--------------------------------------------------------------------------------
Q2LWS9_SYNAS/100-178--------------------------------------------------------------------------------
A8GKR2_SERP5/100-174--------------------------------------------------------------------------------
A4A8K0_9GAMM/100-177--------------------------------------------------------------------------------
A1WDV7_VEREI/100-186--------------------------------------------------------------------------------
A5GFB1_GEOUR/96-176--------------------------------------------------------------------------------
A4CEN2_9GAMM/100-177--------------------------------------------------------------------------------
B5EP45_ACIF5/100-177--------------------------------------------------------------------------------
Q2RI86_MOOTA/98-173--------------------------------------------------------------------------------
Q1GYG2_METFK/100-177--------------------------------------------------------------------------------
Q3A2N1_PELCD/100-177--------------------------------------------------------------------------------
B9M0Z2_GEOSF/96-176--------------------------------------------------------------------------------
Q1QQ80_NITHX/271-344--------------------------------------------------------------------------------
A0LFN5_SYNFM/100-180--------------------------------------------------------------------------------
Q88CU8_PSEPK/100-173--------------------------------------------------------------------------------
B0K9C0_THEP3/99-173--------------------------------------------------------------------------------
B1J2J1_PSEPW/100-173--------------------------------------------------------------------------------
A4WFI2_ENT38/96-170--------------------------------------------------------------------------------
Q15Y39_PSEA6/100-177--------------------------------------------------------------------------------
A1KBQ9_AZOSB/100-177--------------------------------------------------------------------------------
B2IBE2_BEII9/274-346--------------------------------------------------------------------------------
A1TUQ6_ACIAC/264-337--------------------------------------------------------------------------------
A6M144_CLOB8/105-181--------------------------------------------------------------------------------
A3ISW4_9CHRO/116-208--------------------------------------------------------------------------------
A8ZSX8_DESOH/100-178--------------------------------------------------------------------------------
Q5QWC4_IDILO/117-193--------------------------------------------------------------------------------
B0A4I7_YERPE/100-174--------------------------------------------------------------------------------
Q39UI3_GEOMG/96-176--------------------------------------------------------------------------------
B7LS95_ESCF3/97-171--------------------------------------------------------------------------------
B4WYC6_9GAMM/101-177--------------------------------------------------------------------------------
Q8DGH5_THEEB/111-198--------------------------------------------------------------------------------
B6C334_9GAMM/100-177--------------------------------------------------------------------------------
B8FQ80_DESHD/405-487--------------------------------------------------------------------------------
A6D0B9_9VIBR/100-178--------------------------------------------------------------------------------

PF04612

C6BGG9_RALP1/26-185-------------------VLWEPAFEGQRRIEKA----------LPQMRTQLAEMETLGQE---ARGLSAIAAAPVPRG
A3UEX1_9RHOB/7-165-------------------GVLAPAMSWRADAARR----------YANAAEGYESILVQASE---YRALS.AQAVNADDR
Q0K5X1_CUPNH/40-199-------------------VLWEPAADGRERLARN----------LPKLRADLAEMESLAQE---ARGLK.ATPAPALRG
GSPM_PECCC/1-161-------------------AILQPWQEREDLWERT----------ISREQQTVNWMQKQASS---IPRGNQAQGDNSQRD
Q1IB25_PSEE4/11-155-------------------VLVAPALTRIEHWNTE----------TPKLRSQAQALDALLGQ---RSA............
Q21EQ3_SACD2/4-161-------------------GVLSPLYDMRDAQVRS----------HESAVVTLARVKELAAQ---IKGSGEGNGRSGGP.
Q31WM9_SHIBS/22-178-------------------LIWQPLSERIVQQETM----------LQQLVAMNTRLRSAAPD---IIAARKSATTTPA..
A1WZN8_HALHL/10-173-------------------AVWEPLTERRDQLQAQ----------VAEQRQDLAWMRSAAEE---IHAHD.GDNGSAEPV
Q7MPY7_VIBVY/5-163-------------------GVLQPINARAEQAQLR----------IQSEKQLLSWVSEKADE---LTGLR.ASGGVSFSN
Q1ZIZ1_9GAMM/2-159-------------------GAWKPLSTRLDNSEIQ----------LLRTQKTLSWVQEKASL---LLKSGRGSQVAQVPQ
A6VAT2_PSEA7/20-183-------------------LFVEPPLARIEHWQAE----------LPRLRSQAAAVDAVLGE---VEALR....GPLLDG
B1YQ40_BURA4/7-166-------------------VLWSPAQEGRARIRRE----------LPTMRSELAQMTAQANE---AKSLTAAAQGVAPTG
Q7BSV4_ECO57/1-160-------------------VLWQPWLIREDKWRTV----------VTREKNTVEWMKQQVPN---IKRRE.ASMPEQGEP
Q3KBE0_PSEPF/17-170-------------------ALVQPPLKKIAASQVE----------TPKLRAQAEALEVLLRD---VSVRPDGQ.......
Q0I0D9_SHESR/1-158-------------------GIWTPIANAEANALRN----------LTAQQQTLTYVKQTANK---IAGLK.QSGAKPTMS
A3WP21_9GAMM/17-175-------------------AIWQPTYSAQQLAERR----------LEGQQQQLLWLREQVAR---YQSLS.ATQAQSEVS
A8AIM9_CITK8/5-159-------------------GGIIPLDHMIQNSQST----------LMRQKETLRWMRDEIDK---NH.....LQAKVLKT
Q1LHW4_RALME/25-184-------------------LLWEPASVEGARLMRN----------LPVLRADLAEMETLAQE---ARGLS.ANRAPSLRG
Q5QY94_IDILO/12-171-------------------VIWQPSSQAVANAERQ----------LAAQQQQYQWVQQAIAR---YKKLEESSSEQQSAS
Q9ABP4_CAUCR/5-157-------------------GVATPLWSAAKTAQVR----------VDKAATQLATLRGLAA.---......GASRATAGG
A4VFT9_PSEU5/13-169-------------------WLWLPAQRQAAEARDY----------YQAQRELHAYMEQNTEL---ARQME.RSNQVELAP
Q8FCY8_ECOL6/7-160-------------------AVIKPIDTYIEEHQSH----------AQKIKKDIKWMQDQAST---HGLLGHPALTQ....
Q1ZL56_PHOAS/1-160-------------------GLWQPLNQRTELAQTR----------IQSERQLLSWVEGKANK---ITAFKRAGGTVNVSD
A1SR65_PSYIN/2-159-------------------GIWQPLSIGLDNSENQ----------LQRAQQTLSTTQQRATL---LVSAGVGQGSAVSEN
GSPM_VIBCH/5-164-------------------GIWQPLSERTAQAQAR----------LQTEKQLLSWVSENAND---IVTLRAQGGSDAPSD
Q02HH6_PSEAB/22-191-------------------VFIDPPLARIEHWQAE----------LPRLRAQAAAVDGVLRE---VEALR....GPTLSG
A0YBF1_9GAMM/11-168-------------------GMILPASNYKASSEAY----------YRNSLETLTWMQGNKPL---IDSVS.QRRLVRDSG
Q87TC8_VIBPA/6-164-------------------GLLQPMSQRAELAQSR----------IQSEKQLLTWVQDKADD---ITALR.KSGGVSFSN
GSPM_AERHY/2-162-------------------IVWQPIANRIAERERQ----------VLSQQQTLAWLKEKGEE---VLAMQGGQGRQIDTS
A6T4U0_KLEP7/1-158-------------------GLWQPWRAREAQWRQT----------LVKEQASLRWMTEQAPR---LQQLS.QQPAPAAKE
A6EW52_9ALTE/11-176-------------------GVWRPATGFHDEAVDA----------RERATELLAWLETNRKS---LERLS.SAGTSQGGA
A3MPL1_BURM7/14-173-------------------VLWSPAQEGRARIQRE----------LPTMRHELAEMTAQANE---ARTLAGAAQGVAPTG
Q9ZFW8_PSEAC/14-170-------------------LLWRPVSQNLERARGF----------LQQQRTLHAYLQEHAPQ---VRARQ.VAPQASIEP
Q0A613_ALHEH/2-163-------------------GIWLPLSDRAETLRGE----------VAEARAQQAWMAAAAER---VRQAG.GATAVPGEG
Q0ASQ4_MARMM/5-163-------------------LIIQPLLGAHDRARDS----------YAASMRLYRAVEADADT---VQALAAAAPASTAPA
A1JQE2_YERE8/1-159-------------------GIVAPLENYQHQSTQN----------LHSAQRDFAALLQQQER---ISRLQAQRPPQYAL.
Q31J18_THICR/7-166-------------------LIWLPSEHAKQQAQQK----------LALSQQKWDWLNEQLPK---VAQRGPVLPASTLKT
A6V156_PSEA7/5-149-------------------LLWQPQRQALLDAERH----------YQDELRLHADLQRLPGD---......TGGGPRIDA
A3SDU2_9RHOB/1-150-------------------FLWAPLHRAQAEARAD----------IQAFR.....LVQDTAA---LASVDTIVSLQPLNE
A3YCB4_9GAMM/14-171-------------------LLWVPIHQQKEVAQKR----------VDANLKSYYLLVENAPL---LTKSL.GDSGVKLED
Q1YQU6_9GAMM/7-161-------------------ALL.PSLERSTELQER----------HRILQADLHWLSEQSDS---VSRLSNSCVDKTIKP
Q1N4H7_9GAMM/22-176-------------------WIWQPAVDARDAANKS----------FNKELSFHESLKENAYR---FKG...GSSSNQPSG
A1U0C6_MARAV/11-176-------------------LIWQPVTQFHDRAASS----------RENAAELLAWMRANETT---IQRLG.SAGGAATTA
Q02PQ8_PSEAB/17-174-------------------ALWRPAERHLQSARQY----------FTEQRALHAYIQQQAPN---VRQADAAAPQAQIDP
A2SKJ8_METPP/13-167-------------------LGVQPAWRSLRDTPAQ----------IDAVEFQLQQMQRQAAE---ARELR.KLPTVKPAQ
Q1NDR5_9SPHN/1-158-------------------GIAVPLDRAQRDARDR----------LVEATERNAAIRATVAQ---LKALP.RAPANVGST
F2GBM0_ALTMD/1-159-------------------AVWSPLNTALDKQKQL----------LDNQQSLLVWVKDSGAR---AQQLRRSTGSKRAFS
A6D4H3_9VIBR/5-163-------------------GILAPFAQRTENAQMR----------IQSERQLLSWVSEQADT---IVEKR.RAGGVVVSK
Q4KD21_PSEF5/17-183-------------------LLIQPPLKKIDYWQAE----------TPKLRSQAEALEVLLHE---VAAGSRNAPGE....
Q5E1Y6_VIBF1/1-161-------------------GGIKPLNDRAELAQNR----------INNERNLLAWVQKKADT---IITLR.GGASSSSQS
B2T7P8_BURPP/6-165-------------------VLWAPAQEGRSHLRES----------LPAMQRQLAQMTAQANE---ARQLSAAAQGVAPTG
Q8PPI2_XANAC/5-157-------------------ALYVPLRHWHDRAWAR----------YADAAQLALDASAQAAS---TRRAA.ALGSA....
A4BDW7_9GAMM/6-161-------------------GLIVPLASWRQDLQRE----------LANAQQTLQELTALAPQ---AMAVTGGATELNPS.
Q8P5C5_XANCP/5-144-------------------AILVPLRQWRSTAQAR----------YDTAAQAL..LDAQGRQ---RSAVV..........
A1S1Y3_SHEAM/1-158-------------------GIWSPISNAEEAALGR----------LKAQQQTLSYVKDTANR---LAGLR.QSGSRPSLT
GSPM_KLEPN/1-158-------------------TLWQPWQNREAQWRQT----------LAREQASLQWMRQQTPL---IRQLRNQKPPTAPE.
A5V9H7_SPHWW/17-167-------------------MVILPVQRARAQALSD----------IRTYESLSARLRSAGPL---GQ.....APAQPQAG
GSPM_ERWCH/1-160-------------------LIWAPWQESVRQWQMT----------VERERQTVRWMQQQPPR---FRRRK.VRGGRXPVA
Q2Y7T4_NITMU/2-161-------------------GLVSSADRARTRLRSN----------LPQLRVQAEEFEQQAAE---YERIK.VTPSPPPLS
A4XWF6_PSEMY/17-173-------------------LLWQPAQRHAQAARAA----------FEEQRALYAYLQSRAPE---VRGRD.LQPRSSPDP
A1W3T9_ACISJ/17-159-------------------VLLAPALQQLRGSGAR----------HAAVDAQLQRMQALQAE---ALQLK.DAPRPPGGE
A3UP97_VIBSP/5-162-------------------GLIQPLSQRAELAQSR----------IQSEKQLLAWVTDKANQ---VVELR.GSGGISASQ
Q15ZB6_PSEA6/1-159-------------------LVWSPLNQAIERDQKA----------LDSQKSLLSWVQKSANR---AIQLRAAKGVSAGFN

PF12693

Q8DDT8_VIBVU/244-403-------------------RYESQAQAYREESERI----------F....RQVMPGRNKIPTVSYLKRQMEDEIRRL...
Q8P5C4_XANCP/217-355-------------------RYEIGAQLLQRRAVAV----------QGVQATGATP.........................
Q8PPI3_XANAC/214-362-------------------RYEIGARVLQARTATQ----------LGVHDAAAVPAALQARR..................
Q9ABP5_CAUCR/216-368-------------------HDQWTARALERQATKL----------A....VSLAPQASRYED......AVGYALSRL...
Q8CZX5_YERPE/243-396-------------------KIVRDTGALSKVAQDF----------Y....ADFLPPAYHGGD...VNTSFNKYISDL...
GSPL_ERWCH/242-399-------------------QWYRQADYWRQESVRV----------Y....RKLFPDEKQVVN...PRAQMQRHLQEV...
GSPL_PECCC/268-425-------------------QLYQQAEHWRQESVRV----------Y....RQIFPSETNVVN...PRAQMQQHLQRT...
Q9ZGT8_ECO57/266-425-------------------RLWQQAQFWRYESVRV----------Y....QQLFPSEKAVKD...PRRQMLRHLQQ....
GSPL_KLEPN/240-398-------------------MLGQQADAAVQASRDF----------Y....RQWFQTEKNVVN...PRLQMQQHLRQM...
Q88P00_PSEPK/218-362-------------------QQWRQAQLWRSQVIAV----------T.........GEQASPR...HAAQALKRLRESV.L
O86440_PSEPU/213-361-------------------QQWRQVQLWQAQVLAV----------T.........GEQAGPR...QAAQALKRLREAE.L
Q87TC9_VIBPA/245-404-------------------KYEAQAQAYREESERI----------F....RQVFPNKNRIPTVSYLKHQMTDEERRL...
GSPL_VIBCH/249-407-------------------QYEAQADAYRAESERI----------F....RSIFPDKQKIPTVTYLKRQMSDEMARL...
Q8EKC1_SHEON/239-395-------------------QVNGQIADLKAQSEAI----------Y....QQVVPGNTRIVN...LRSQMESQLRSL...
GSPL_AERHY/243-389-------------------QLAEQDKALKAEIRQV----------Y....TRIFPGENRIVN...VRSQMAQHLKLL...
GSPL_PSEAE/226-382-------------------QLQREGDRYAAQSAEL----------Y....RQLFPEDRKLIN...LRAQFDQHLADS...
Q9ZFW9_PSEAC/223-381-------------------QLQREGERYAVANEAL----------Y....RELFPEDRKVIN...LRAQFDQHLAEA...
Q8VPC1_ECOLX/234-392-------------------SVSEQVAQSRTQAEEQ----------F....LTLFPEQKRIVN...LRSQVTMALKKY...
GSPL_ECOLI/237-387-------------------HTLKIEDQLQQQQQET----------W....QRYFPQIKRTHN...FRFYFKQQLAQ....
Q8XUS4_RALSO/317-476-------------------TLRAEQKRLDAAMRTQ----------L....QTAFPNTPVILD...PPAQMRRQVQQLRLA
Q9ZF77_BURPE/291-444-------------------KLSRERDALAAQITET----------L....LSTFPKTTTVLD...PAAQMTRQLDRLRIA
Q9I5P2_PSEAE/207-381-------------------QLAEQGQSLQRQSSQR----------V....QQAFPELPVVLD...PLRQARERRDAY..L
Q8GBD8_YEREN/245-399-------------------YAQQHAEQIQQKTQQL----------Y....LKNFPGATPPKQ...WIQGIAQQIHQL...

PF10721

A8A0B0_ECOHS/1-160-------------------VVGNVWSDRGWQTKWA..........ERDAA....ELSQEVNVQFAARIIEQGRTISRDEA
A5W5S5_PSEP1/4-164-------------------EHGRSVELAKAGQQSA..........RRDSG....DRLAEVIGERSARLEEHRSADAQQEA
Q858E9_BPE15/10-160-------------------VHGDRQYDAGYAQAKA..........DRKAE............DDKARQHDEKEKATNE..
B1J5E9_PSEPW/4-165-------------------QHGRSMERAEAAQASA..........ERDSG....DRLAEVIGERSARQEEQRRATAQEEA
Q8Z7W1_SALTI/12-170-------------------IAGNVWSDRGWQKKWA..........DRDSA....ESSQEVNAQTAARIIEQGRIIARDEA
Q57Q93_SALCH/12-178-------------------SRGYQKADSSWKFQWA..........QRDLT....DATAALQQEVTERAKEKRRQHAADEE
Q46YK2_CUPPJ/9-168-------------------GGGRLVQSRADAKKYD..........AERTKAALSAAVDQVKATDRARAEEQRRTAAQTEI
Q4KA36_PSEF5/4-166-------------------QHGRSNESAEWQARWN..........ARDAG....DKQAWAIYERAERDKEQDRQNSINKA
A9ABH5_BURM1/1-157-------------------AAGVYGEHLISAREIA..........DMKAD....AATAQAKAVDAARAEEQRRTAAQSEI
Q87Y73_PSESM/9-169-------------------NHGSNKVEADWQQKWD..........RELKT....QSQAVASTTTEYRTEEQRRQKAANQV
Q48J34_PSE14/4-169-------------------RHGVTVTDMAWKAKWA..........EEVSA....QSEAVATTATEYRTEEQRRQNAANQV
A1AE00_ECOK1/10-160-------------------IHGSRQYDAGYAQAQE..........DQKQA............DDKARS...QRDQEKTQI
Q88MI7_PSEPK/4-164-------------------EHGRSVEQAQAGQVSA..........KRDSG....DRLAEVIGERGARQQEHQRAQAQEEA
VG55_BPN15/14-172-------------------IAGNVWSNRAWEKRWA..........DRDSA....ESSQKVNAQTAARMIEQGRIIARDEA
Q9F9Z1_9ENTR/18-187-------------------TVGYHAADTQWQQRQA..........EQERA....DALALLAAETRERKWEQQRQTDMNKV
Q7WK95_BORBR/4-167-------------------AAGAAWTAQGWRKDAAIARQAAAFALERDR.....QAQATVAALEAVREEGRRRTAAVEKA
B0KJQ0_PSEPG/12-176-------------------AEGAEADARAETAKSD..........KALADYRLEVSERNLRAAAQARTEEQRRQTMANEE

PF04375

Q8XWW4_RALSO/305-691EVRQRAQQNE.........TLAQEMRVLSRNNQDAFAQLQQKFGALDARTAETRDRQGALEQASQDLLRNRDDWQRAEIE
Q9HTT7_PSEAE/4-374RNQQLAARLDALPTADELEARRRLVVELQGDQQHLSEQLKKVLGQ........................SRQQWRLAEAE
Q9CK22_PASMU/71-451QTTNITPAKVDLPTFEQERQQIAQLMRSIRDNEEKLQQLEKELAGKDHSLSALQNQVNRMSAAAKQ..QQPNDWLLSEAD
Q9KVM3_VIBCH/33-397ELKQTRDALNA........QLEQTVSKATSQATEITHRAETVLEQQQKSIESLQLAVADIKGR......RPNDWLLAEAD
HEMX_ECOLI/8-372QLTALQKAQE.........SQKAELEGIIKQQAAQLKQANRQQETLAKQLDEVQQKVATISGS......DAKTWLLAQAD

PF04350

A3M9J2_ACIBT/73-221EQLPKETEIPSLVEDI-NLTG--VNS---G-L----K--FKNIRLED.EVK---------..QEI-----FIEQPIAI--
B1KP68_SHEWM/48-192KMLPSKNEMPGLLDDL-TFVA--TDS---G-L----K--IDSLDWRE.VIQ---------..RDF-----YIEFPISM--
A3L2L2_PSEAI/58-202RQLPSDTEVPGLLEDI-TRTG--LGS---G-L----E--FEEIKLLP.EVT---------..QQF-----YIELPIQI--
A1TKV8_ACIAC/65-211KQLPSKAEMAALLSDI-NQAG--LGR---S-L----Q--FELFRPGQ.VVV---------..RDY-----YAELPIAI--
Q0AF43_NITEC/50-192KQLPNKSELDALLVDI-NRAG--LGR---G-L----Q--FELFKPNAKETV---------..REF-----YAELPVSV--
A6T3F9_JANMA/58-199KQLPSKAEMDALLSDI-NQAG--LGR---G-L----A--FELFKPGQ.VVV---------..RDY-----YAELPIVI--
Q9PGD1_XYLFA/51-201RQLPSKTEMPDLIVDI-SQTA--LSS---G-L----V--NELFQPGD.EVL---------..KEF-----YAEKPISL--
Q6AS36_DESPS/56-201ALLPKEKEIPKLLKDI-SALG--SNT---G-L----D--FISFKPLA.NRP---------..KDF-----YAEIPISI--
Q3JEG7_NITOC/49-192RQLPSKTEVADLLVDI-SQTG--LSS---G-L----E--FEFFKPSS.ELP---------..ADF-----YAELPIQI--
A5GEZ7_GEOUR/43-188TELPNQKEIPSLLTSI-TSAG--KSA---G-L----D--FLLFKPKP.EES---------..KDF-----YAAVPVDI--
A8GZ26_SHEPA/51-192KMLPSKNEMPGLLDDI-TFVA--TDS---G-L----N--IKSLDWDS.EIA---------..RDF-----YIEFPIKI--
A4BQU6_9GAMM/49-200RQLPSQAEVAKLLVDI-SQTG--LAS---G-L----E--FELFKPRE.SIR---------..KEF-----YAELPVSI--
Q0I056_SHESR/48-192KMLPSENEMPGLLDDL-TFVA--TDA---G-L----R--IKSLNWEP.EIQ---------..RDF-----YIEFPIKM--
Q1ZLT6_PHOAS/47-193EQLPEEQELASLLAGI-NDIG--VNN---G-L----V--FQSIKWAP.RVE---------..HEL-----YYELPINM--
Q21UC1_RHOFD/65-206KQLPSKAEMDALLSDI-NQAG--LGR---S-L----Q--FDLFRPGQ.VTV---------..KDY-----YAELPIAV--
Q1GYG3_METFK/49-194KQLPDRSQMDGLLTDI-NQAG--LER---G-L----E--FELFKPGQ.EVI---------..ADF-----YAEMPISI--
A0Y285_9GAMM/56-197KRLPTSNEIPGLLDDL-SYVG--TTS---G-L----T--FLKIGWLP.EVE---------..KEF-----YTELPIKI--
A5EW42_DICNV/50-200KYLPESDQAPELIKEV-NQSA--LNS---S-I----A--ITKFSPAA.EVK---------..SES-----YTINPFIL--
A3Y0G4_9VIBR/53-196EQLPVQKELASMLASV-NELG--LDN---A-L----T--FTRIDWGQ.KQN---------..KEF-----LYRLPLNI--
Q0EXA4_9PROT/51-193NMLPKKSQIPDLLESV-SWAG--KDS---G-L----E--FATFKPEG.EVN---------..RQI-----YAEVPVTF--
Q1K2X2_DESAC/43-188NELPNESEIPNLLTSV-AGLA--RDN---G-L----E--VVEFKPGK.ERT---------..KGF-----YAEVPVSL--
Q46WJ0_CUPPJ/59-200RQLPNKTEMDALLADV-NHAG--VAR---G-L----Q--FELFKPQA.AVL---------..KPY-----FAEIPVNL--
A7MXC8_VIBHB/47-190QQLPAQKELATMLASV-NELG--IDN---K-L----T--FTRIDWGD.KES---------..EHF-----LYRLPLNI--
B7WV77_COMTE/66-211KQLPSKAEMAALLSDI-NQAG--LGR---S-L----Q--FEVFRPGA.MVT---------..KEY-----YAELPIAL--
A6F2X5_9ALTE/58-201RQLPSETEVPGLLEDI-TNTA--LGS---G-L----S--LQEVKLQG.EQR---------..RDF-----YAELPINI--
Q2S9Q2_HAHCH/58-200KQLPSDTEVPGLLEDI-SSIG--SLS---G-L----E--LSSIDLRS.EVS---------..KEF-----YVELPIDI--
Q3SM92_THIDA/49-189KQLPNKQEMDALITDV-NQAG--LGR---G-L----Q--FELFRPEA.ETV---------..SEF-----YAETPIRV--
Q1N2I2_9GAMM/61-205RQLPRDTEVPGLLDDI-TTAA--LGA---G-L----E--MRSIELDK.EVD---------..TEF-----YTELPINI--
Q08Z00_STIAD/19-166TELPEKRDLDELLAQI-NDIG--KKS---G-L----E--ISRVEPGK.ESV---------GGGEF-----FARIPLKM--
Q0A4Z0_ALHEH/49-191GRLPGDVAQPSLVEDI-SLQA--SGA---G-L----E--IASYNTRS.PTQ---------..REF-----YAELPVDM--
A0Y8X2_9GAMM/58-199SQLPSDTEVPGLLEDI-TNKG--LSS---G-L----D--INSITLSN.EIV---------..QEF-----YVEKPFQI--
A0LFN6_SYNFM/50-195ALLPDQKEIPGLLESV-SQLG--AKV---G-L----E--NVLFQPQP.EQP---------..KEF-----YSVIPIRL--
Q1YS06_9GAMM/58-199KQLPKDTEVPGLLEDI-TEVA--YDS---G-L----V--MKSINLQP.EKI---------..SEF-----YVELPIKI--
D7HR04_VIBCL/50-193RQLPVQKELASMLASV-NQLG--LDS---S-L----T--FTRIDWGE.RES---------..QEF-----LYRLPLNI--
Q15Y40_PSEA6/54-194KSLPTSNETPGLLDDI-TFVG--TSA---G-L----T--FKLLNWQK.EVP---------..KEF-----YTELPIQI--
Q1LI84_RALME/59-200HQLPNSTEMDALLADV-NHAG--VAR---G-L----Q--FELFKPQP.ATI---------..KAY-----YAEIPVNL--
B3E9T2_GEOLS/43-188TELPNSKEIPSLLTSI-TATG--KNA---G-L----D--FLVFRPKP.EVV---------..KDF-----YAEVPVDI--
Q306N4_MYXXD/43-190TELPEQRDIEELLAQI-NDIG--KKS---G-L----E--LSSVTPGK.ESV---------GGGEF-----FARIPIKM--
Q39X09_GEOMG/43-188TELPNQKEIPSLLTGI-TSVG--KSA---G-N----D--FLLFRPKP.EVS---------..KDF-----YAEVPVDI--
Q8DCM4_VIBVU/47-190KQLPVQKELATMLASV-NELG--IQS---K-L----T--FTRIDWGE.KQT---------..KDF-----LYQLPLNI--
A0KN32_AERHH/49-192KQLPNTHEVAGLLDDI-SFIA--TDN---G-L----K--LNRINWEP.EIK---------..HEF-----STELPMRI--
B9M3J0_GEOSF/43-188TELPNQKEIPSLLTSI-ANAG--KSA---G-L----E--FLLFKPKP.EEP---------..KDF-----YAAVPVDI--
Q1Q8Q5_PSYCK/75-221DQLPKDTRVSELVEGI-NMTG--VGS---N-I----R--FQDISVEP.EIE---------..NEF-----FIEQPIRI--
Q74BL1_GEOSL/43-188TELPNQKEIPSLLTGI-TSVG--KGA---G-L----D--FLLFRPKG.EVP---------..KDF-----YAEVPVDI--
B5E8I1_GEOBB/43-188TELPNQKEIPSLLTSI-STQG--KGA---G-L----D--FLLFRPKP.EVP---------..KDF-----YAEVPVDI--
Q489N7_COLP3/51-194RSLPNSHEIPGLLDDI-TFVG--TTS---G-L----D--FVKLEWQP.EIS---------..KEI-----YIELPIDI--
Q2BLX7_9GAMM/56-196KQLPTQKEVPGLLDDL-TLLG--TGS---G-L----S--IGSISLQS.ETK---------..QDF-----YIELPINI--
O05128_NEIGO/50-200KQLPTDAEIPNLVQEL-HQAG--SSN---G-L----R--LDSVMPQP.PVD---------..DGP-----IKKLPYSI--
Q21H80_SACD2/59-202KQLPEEIEVPDLLEDL-DSKV--ADS---R-L----E--MIKIDPLE.SRN---------..TEF-----YVELPIKI--
A5IFY3_LEGPC/49-198KQLPAKNEMPGLLEEI-SKTG--IAS---G-L----K--FELFAPQP.EVV---------..HDF-----YVELPIKI--
Q1QZY6_CHRSD/58-200EMLPSDAEIPALLDDI-SDAA--QDH---Q-L----V--IDSIRLRA.PVP---------..QTF-----YIEQPFDI--
Q5H3Q8_XANOR/51-201RQLPSKTEMPDLIIDV-SQTA--LSS---G-L----S--NELFQPGP.ESP---------..KEF-----YAEKPIAL--
Q5E2F6_VIBF1/46-189QQLPAQKELASMLSGI-NQVG--IQN---K-L----T--FTRIDWGE.KQN---------..KTF-----LYKLPLNI--
Q6F7E1_ACIAD/73-220TQLPKESEIPGLVEDI-NMTG--VNS---G-L----K--FKNIRLEN.EVK---------..QEF-----FIEQPISI--
A1KBQ8_AZOSB/62-203KQLPNRAEMDSLLSDI-NQAG--LGR---G-L----Q--FELFKPGA.DQV---------..KDF-----YAEMPIDL--
A1SRB3_PSYIN/46-187NRLPSSAEVASLLDDI-SFVG--ADN---G-L----Q--FKSINWGI.KTE---------..GEL-----STEVPISI--
Q0VMB5_ALCBS/61-210KQLPKDTEVPGLLEDI-THTG--LGS---G-L----E--FENIELRD.EME---------..KEF-----YAELPINI--
Q7NZU0_CHRVO/47-188KQLPTKSDMDTLLTEI-NQAG--IGR---G-L----Q--FDLFKPGG.ETR---------..TAE-----MAEVPITL--
A1SB17_SHEAM/51-192KMLPSENEMDGLLDDV-TFVA--TDS---G-L----H--IESLDWEG.AVQ---------..RDF-----YIEFPIKM--
Q2INP0_ANADE/50-195AELPEDKKIDELLQLL-QDRA--QKA---G-L----E--IGTIEPRP.AVT---------..ERF-----YARIPIPM--
A0Z8J0_9GAMM/58-201SQLPSDTEVPGLLEDI-TNKG--EQN---G-L----A--ISKIDLLP.EVP---------..QEF-----YIELPISI--
Q1Z012_PHOPR/47-192VQLPVEKELASLLSGI-NDIG--VNN---G-L----E--FQGIQWGG.RIE---------..KTQ-----YYELPLNM--
A4BAN3_9GAMM/60-209DQLPNDIDLPSLLDDI-STTG--TQS---G-L----E--IDTITPQA.DVV---------..QEF-----YIETPISI--
A4A8J9_9GAMM/58-201SQLPSDTEVPGLLEDI-TNKG--LLN---G-L----A--ISSIDLQP.EVS---------..REF-----YVELPIAI--
Q47JL0_DECAR/63-205KQLPDKSEIEALLIEV-NQAG--LGR---G-L----Q--FELFKPGQ.EQV---------..KDF-----YAELPITV--
Q5P5N9_AROAE/61-202KQLPNRAEMDSLLSDI-NQAG--LGR---G-L----Q--FELFKPGA.EVV---------..KDF-----YAEMPIEV--
Q12SM2_SHEDO/51-192KMLPSENEMPGLLDDL-TFVA--TDA---G-L----K--ITSLDWEA.EIE---------..RDF-----YIEFPIKM--
A1WDV6_VEREI/65-209KQLPSKAEMAALLSDI-NQAG--LGR---S-L----Q--FELFKPGQ.VVA---------..KNY-----YAELPIAI--
A8ZSX7_DESOH/54-197AALPDKKEIPSLLSEI-SRAG--NSA---G-L----E--FTRFVPQQ.ESI---------..RDF-----YAEIPVAI--
A6D0B8_9VIBR/44-187HLLPVQQELATLLAGV-NQEG--LHN---Q-L----T--FTRIDWGK.RAS---------..EHF-----LYKLPINI--
A6FBL6_9GAMM/49-190KQLPSKSETAGLLDDL-SYIG--QHN---G-L----Q--LRRFKWLK.EVK---------..RDF-----SYEVPVSL--
Q3A2N2_PELCD/43-188RELPNKKEISSLLVGI-SSLA--KNT---G-L----E--VVEFKPSA.PVP---------..QGF-----YAQVPVSL--
Q1ZHK9_9GAMM/46-187QKLPSKKEIASLLDDI-SFIG--ANN---G-L----L--FKSINWGA.LKD---------..AEL-----SVEVPITI--
Q4KJJ2_PSEF5/58-202RQLPSDTEVPGLLEDI-SRVG--LGS---G-L----A--FEEIRLQP.EVA---------..RQF-----YVELPIQI--
Q60BY6_METCA/48-198RQLPDRTQVPDLLVDV-SQTG--LAS---G-L----E--FELFKPGG.EVS---------..KEF-----YAELPIEI--

PF10741

A9BY16_DELAS/76-187GDSDSTQTGNGVQQQL-RSVM--DRA...G-L----S--VTSSQVKA.TSE-----------EGP.....YERISVSM--
A1WFQ5_VEREI/74-182ANLDASQVGNNAQQRI-RDIF--SAA...G-L----Q--IVSSQVLP.PKE-----------QGN.....VDQIPLAV--
A1TUQ5_ACIAC/72-183ADQDASLTGNAAQQKV-RDIF--GAA...G-L----Q--VSSSQVLP.AKE-----------DKG.....FDRIPVNV--
Q5P6R2_AROAE/78-190ATADAARIGTDMQQRI-RQLA--EAA...G-L----G--VAGSQILP.ARP-----------HAG.....FTQIPLKL--
A0Z1M0_9GAMM/71-181ESSAAEAVAASLQAEA-RRIL--SEA...G-M----D--ITNSQVLR.PRK-----------RDQ.....FDYVAVKI--
A4A5M0_9GAMM/74-184ATDDPSALAARLQADI-RQIL--SEA...G-M----S--VSNSQVMP.VRQ-----------GEL.....FDQVAVKL--
Q87ZW3_PSESM/77-193PGEDPSAVAADLMQRI-ADLI--SSQASTG-G----G--CELTQRMP.ITP-----------.EQDSAEPYRQVKVSL--
B1J7E6_PSEPW/76-193PGEDPNAVAADLMQRA-VDQV--KAQAHVG-P----G--CDITQRMP.IAP-----------AEQDQAEPYRPVKVSL--
Q1QQ81_NITHX/73-181EGATVTVAGAALLQRV-SAAV--TKF...G-G----N--VLSSQVDL.HGS-----------QSK.....VGFLTIIA--
A5EBI2_BRASB/75-183EGRTVTIAGAALVQRL-TEAV--TKV...G-G----S--VLSTQVDL.PAA-----------RAS.....TSAISVVA--
Q89HH7_BRAJA/79-189EGPTVTVAGANLLQRV-AAAV--GNV...G-G----L--VQSSQVDV.SGA-----------QVK.....DGFVGLVV--
Q2VNU3_9BACT/73-185EGRTVTVAGAALQQRV-VAAV--RDA...G-G----N--VLSSQVDL.QGS-----------QAK.....QGYVSLSA--
Q212Z0_RHOPB/75-181EGATASVAGAALLQRV-AAAT--KLM...H-G----N--TLSSQLDL.AGS-----------AAK.....AGSIRATS--
A5EF22_BRASB/73-180EGPTVTVAGAVLLQRL-GDVV--TRH...S-G----S--MSSSQLDV.QGP-----------RAN.....DGHISVTA--
A4YMS4_BRASO/72-179EGPTVTVAGAALLQRL-GEVV--SRH...G-G----S--TSSSQLDV.QGP-----------RAK.....EGQISVTA--
A7IH66_XANP2/71-186EGPTVTVAGAALMQRI-AAAV--ERA...G-G----R--ITSSRPEL.QGT-----------PAG.....PGFVAVAA--
Q5H4L2_XANOR/85-200PETSAELASAGLVQRL-ERAV--VEASPGN-R----S--CAISNRSP.LQP-----------ESKNR...FTRVAVQV--
Q3RHI6_XYLFA/76-191PESSVELASAGLVKRL-EGVV--NDASPGN-R----S--CAIINRSP.LQP-----------DMHDR...FVRVAVQV--
B4SJ91_STRM5/76-192REATAEAAAAALGGKL-QDAV--AMASPGN-R----S--CTISNRTP.LTD-----------NRRDAE..FVRVAMQV--
Q609V5_METCA/84-198SQATPALAAADLQSRI-KDTV--TSA...G-G----E--LISTQVIP.ERK-----------EDQ.....FTRIAVKV--
Q3JD24_NITOC/76-192EQQSAPLAATELRRRV-KAVV--ESS...G-G----V--LTSTQSLP.VVE-----------NEL.....FPKVGIRV--
B0T7N6_CAUSK/73-179TAPNPSMAAEALKQKL-VTRL--GEA...G-G----T--VTAAQEVKNDVP-----------NGW........VSVRA--
Q8KZ83_GLUDI/87-194GGATDAIASANLQDLL-QQAA--SAN...G-A----T--LSTAENVP.AAM-----------VGR.....YQRIGLHI--
Q0BR92_GRABC/89-202QSPNDAANAAQIQESV-RALS--QQT...G-V----S--LLSVETLP.ADT-----------LGT.....YRKISLRL--
A5FWX4_ACICJ/79-187PGGSAAIAGARLQGAV-QSLA--ATH...R-I----G--LDSAELLP.PVS-----------LGS.....VERIRLRI--
Q82WG9_NITEU/68-173PSSNDN...AAFVDAV-NMLI--HDS...D-V----Q--LLELRTAD.PFN-----------DGN.....LTRFALDV--
Q9RW97_DEIRA/74-187RALPPTANFGQVVANL-RQTV--SAA...G-G----D--LKTLNFAG.SGA-----------AGANLPAGVRPIGMTM--
Q07N82_RHOP5/69-181VAETATTAAAEVDRLV-RAIV--SKD...S-S----T--VLSTQATIEQGD-----------GPA.....SRRIELQA--

PF03245

O80285_9CAUD/31-149KELADANATIESLRAD-VSAG--RKR-----L----Q..VAA..TCA-...-------------------..KSTTGA--
A7MK05_CROS8/30-153QELADAQATIDQLHDD-VASG--KRR-----L----Q..LHA..TCT-K..-------------------..QSASGT--
Q9ZXB6_BPH19/29-154RELADARAENETLRAD-VAAG--HRS-----L----R..INA..TCP-G..-------------------PVREATGT--
Q7N318_PHOLL/26-149KELANAKSEIDVLRND-VAAG--HRR-----L----R..IAA..TCN-Q..-------------------..GEAGSS--
A1ACE3_ECOK1/29-154RELANAQAENETLRAD-VAAG--RKR-----L----R..VNA..SCS-A..-------------------AVREATGP--
Q56118_9CAUD/29-155KELADAKAENDALRDD-VAAG--RRR-----L----L..VNA..TCP-AM.-------------------PTGKSTSA--
Q1RCX8_ECOUT/33-157KELADAKAENDALRDD-VAAG--RRR-----L----H..IKA..VCQ-S..-------------------.VREATTA--
Q2A0C4_9VIRU/30-151QELTHAQNELAQLERD-VAAG--RRR-----V----R..LRA..NCP-G..-------------------.VSASGPT--
Q76H63_9CAUD/29-154KELADAKAENDALRRK-LDNG--.GR-----V----L..VKG..KCP-VS.-------------------SSAETSSA--
Q2A095_9VIRU/28-149QELTHSHQELARLERD-VAAG--RRR-----L----Q..VRA..VCP-G..-------------------.VSDSGTA--
Q1I6B5_PSEE4/33-166QELTDAQQTQARLRDR-LATA--DLR-----L----SVLVERDTGCA-A..-------------------.VPATTAT--
Q9KXD2_BPVT2/29-154RELADARAENETLRAD-VAAG--RKR-----L----R..INA..TCS-G..-------------------TVREATGT--
A7MLQ7_CROS8/30-153KDLADAQKNIAQLERD-VAAG--RKR-----L----Q..LNA..TCS-A..-------------------..QGAPGT--
Q48C47_PSE14/33-153EELNRARAQINTLQLA-VADG--RYR-----L----R..IKA..VCP-A..-------------------.MPGTAGT--
A4WC46_ENT38/29-152KDLADAKKQLYDLQRC-VSSG--KCG-----L----R..VNA..RCA-T..-------------------..NRTASA--
A2P359_VIBCL/23-146EKLNDAKSENDALRDD-LRTQ--RKR-----V----F..VKA..SCP-V..-------------------..QSANSA--
B0KHE2_PSEPG/21-146QERERANQTNASLRAD-VAAG--NRR-----L----S..FLA.TSCG-A..-------------------..TGSATT--
Q1GXR8_METFK/50-191EQLHHVKSQKDSVIAD-LRAG--AVR-----L----RIPVTPASTSA-ACS-------------------GIPAEAFA--
Q8X2A4_ECO57/29-154RELADARAENETLRAD-VAAG--RKR-----L----R..INA..TCP-G..-------------------TVREATGT--
A4WB39_ENT38/29-154KELADAKAENDALQRK-LDNG--.GR-----V----H..VKG..KCP-VP.-------------------ATAKTAIT--
Q7N0Y2_PHOLL/26-149KELANAKSEIDVLRND-VAAG--HRR-----L----R..IAA..TCH-Q..-------------------..GQAGSS--
Q1VCK5_VIBAL/31-155AELSAAKEEIDRLSDS-LSTG--PKR-----V----Y..VQA..DCP-A..-------------------.VPEATST--
B1JDA4_PSEPW/32-158QELSNAQQSQARLRDR-LATA--DVR-----L----SALVERDAACA-A..-------------------.VPTAAGA--
A6UZ52_PSEA7/32-149QELNDERNANERLRAA-VDAG--RQR-----L----H..VKA..TCP-A..-------------------PVPTDAGA--
A1JLU8_YERE8/29-147QELADAKSQIEALRAD-VAVG--RRR-----L----R..LNA..QCV-S..-------------------TASPQTGT--
Q7CID8_YERPE/26-151KELADVKSENERLRTD-IASG--TKR-----L----Q..LNA..TCS-K..-------------------PAPKTTGP--
A8CGF5_BPP22/29-144KELADANATIETLRAD-VSAG--RKR-----L----Q..VSA..TCP-...-------------------..KSTTGA--
Q8XYQ5_RALSO/38-173EELNNAKTENARLAAA-LAAG--TRQ-----L----S..IRARCTAP-AD.-------------------GVPSTTSG--
Q2NV02_SODGM/25-149RELEHDKKRIAQLERD-VADG--RRR-----L----Q..INA..ICP-A..-------------------.VPTDSTA--
Q6HAE1_9ENTR/26-151EKLNEAEQENTVLRTQ-LARG--HRR-----M----L..VSGQISCP-D..-------------------..RTSPST--

PF05137

D4BI19_9ENTR/97-171----------QILQEL.AALL--P.E---Q.A----W--LTKIT..W-QQG.......................TLEL--
C7R7X0_KANKD/100-176----------RMFDEL.VHVV--P.E---G.I----N--LTSWE..R-KGI.......................NLTF--
C7QTE2_CYAP0/114-206----------AILQEI.ENQI--P.A---N.V----N--VGSIQ..Q-EGL.......................KLTI--
C6BWY3_DESAD/355-431----------HVFRDL.GDSV--P.A---Q.V----K--LDTMR..L-DQS......................GKITL--
D3SD46_THISK/100-177----------HLFDQL.VETL--P.D---G.T----Y--LNEVR..Q-EGE.......................RIRL--
C8X4Y9_DESRD/100-179----------RYLDAL.VSLL--PED---E.I----W--FESLQ..F-SRS......................RGISL--
D0L237_HALNC/100-184----------HLMEEF.VKTL--P.D---G.I----Q--LTDIS..I-KGD......................KTISI--
D0WBB7_NEILA/103-177----------KILDSL.NEAV--P.E---S.T----Y--LTSLD.AV-TAD.......................SYRL--
D2ZYQ1_NEIMU/103-177----------YIIDSL.NVVI--P.D---N.T----Y--ITSLD..A-ENP......................TSYKI--
D2Z429_9BACT/103-180----------EIFRQI.ELSL--P.D---G.V----W--LSSVK..A-EAG.......................SLHL--
B2FNI0_STRMK/286-360----------EIWNEL.TRRL--P.E---G.T----Y--LEKLA..I-ENN.......................NLQL--
B1EI39_9ESCH/97-171----------PALEAL.ATFL--P.E---Q.A----W--LTTMN..W-QQE.......................TLQV--
C1DHR0_AZOVD/100-178----------RVFDQL.ARTL--P.D---G.V----Y--FTSLS..M-TGQ.......................SIVI--
Q1N2I1_9GAMM/100-174----------RVFDEM.ARVI--P.D---E.V----F--FVSVK..V-KGK.......................RFTV--
Q7NZT9_CHRVO/100-177----------HLFDQL.VRQT--P.D---G.V----Y--LKSFK..Q-TGN.......................QVTL--
A8T9N5_9VIBR/101-179----------EFMNLM.LSVI--P.E---G.V----H--VDKIK..M-NDY.......................KVEI--
B3R7C3_CUPTR/105-187----------QLLEEL.VRQV--P.E---G.V----Y--LTSLK..Q-AGE.......................AFTI--
Q74C93_GEOSL/96-176----------LLLNRL.EEVV--P.E---G.V----A--LGAIDPSL-KDG.......................TLKL--
B9TC62_RICCO/24-102----------SILDEL.ARQL--P.E---G.V----F--LKSVK..Q-LED.......................EIEL--
A8GZ25_SHEPA/100-177----------HVLDEL.VRVV--P.P---G.I----Y--LSSIE..K-KGS.......................MLWI--
Q74BL0_GEOSL/100-177----------RRLATL.SDAT--P.E---K.L----W--LTKYS..E-NGP.......................NVSI--
Q061N8_9SYNE/111-200----------ALFGEL.RRLM--P.I---A.M----Q--LDQAQ..V-DGN.......................QLEL--
A4G9P6_HERAR/100-182----------YLMDEL.AQQV--P.E---G.V----Y--LKSFK..Q-DGQ.......................RVLL--
Q1IRM8_KORVE/109-189----------NLLASL.GDTV--NGT---EAV----W--LSKMT..D-SGA.......................AIDL--
C4K8E6_HAMD5/100-172----------TLLNQL.SNFI--P.E---R.C----W--LLEIK..Q-KDQ.......................TLIL--
A0YSX4_LYNSP/116-236----------ALSQEL.AELM--QVA---G.V----K--INTIK..Q-TEPEFTATPAAAPAEGQASTTAKDTAMLEI--
Q21H79_SACD2/100-177----------RYFDEF.AKAV--P.D---G.I----Y--VTSLK..R-VGN.......................ALTI--
D6SKS7_9DELT/355-426----------EILAEV.TRVV--P.D---T.A----W--LSSFA..C-FET.......................QVDI--
Q1Q6D7_9BACT/347-419----------DIILEL.ARIL--P.N---D.A----W--AKTIK..I-DNN.......................LFEI--
A5EF21_BRASB/284-357----------LALDAL.SRVL--P.D---N.T----Y--VTELR..M-DKD.......................KLQI--
B4UDC4_ANASK/100-177----------KMLDQL.AQLT--P.K---R.L----W--LTKLE..Q-KGD.......................SLAF--
F2G6J6_ALTMD/100-177----------IVFDEL.AKLV--P.P---G.V----A--FETMT..R-TNN.......................RIEI--
Q5P5N8_AROAE/100-177----------HLLNEL.AVHM--P.E---G.V----Y--LKSIK..Q-NGP.......................KIAL--
A5GEZ6_GEOUR/100-177----------SRLAKL.SDAV--P.E---K.L----W--LTKYT..E-NAG.......................NVSI--
A1ARQ3_PELPD/96-177----------ELLERL.ENAT--P.G---Q.V----S--LAAFS..L-DAKD....................ANLLKI--
B5JTT5_9GAMM/102-177----------HSFEDI.VTAL--P.D---G.I----W--VSKIL..Q-KGD.......................SITV--
Q1PJI8_PROMR/111-194----------ALFKEI.SLII--P.K---D.I----Q--LLEFN..S-NGN.......................SLFM--
B2Q5V2_PROST/100-173----------NLLYKL.PELT--P.Q---K.S----W--LAKVS..L-TGN.......................NLEI--
Q0BZ78_HYPNA/235-307----------EMLARL.NEHT--P.Q---T.A----W--WTGMD..M-TGT.......................EIRL--
Q87L63_VIBPA/101-179----------DFMNLM.PAVI--P.E---G.V----Y--VDKIK..M-NDL.......................EIEI--
B4VRN9_9CYAN/118-234----------AILQDI.RDRV--P.T---G.V----Q--IQAIE..Q-TETETKAAEGT......EGSAPLPTINVEI--
B8D2D6_HALOH/94-167----------SLLEEL.GNIT--P.D---Y.V----M--LQNVN..L-SED......................NKINI--
Q4FQH8_PSYA2/100-200----------RLWDDL.AKAI--P.P---A.L----Y--LNNLK..R-EGD.......................VLTL--
P74187_SYNY3/116-221----------ALFQEI.TNQL--P.Q---E.V----Q--LQSIQ..Q-EGN.......................VITL--
Q3IJC1_PSEHT/100-177----------QIMDEV.AKIV--P.A---G.V----Y--LTKLE..R-RGN.......................QIHV--
A5WCG1_PSYWF/77-165----------ALWRDI.AKAV--P.E---G.L----Y--LTGIK..R-QGN.......................LLSV--
A5KTK0_9BACT/97-178----------TLITDI.AKSL--P.N---G.T----V--LTSLT..L-TPGSF...................GKQMSL--
Q6LVG0_PHOPR/101-179----------HLFSML.PALV--P.Q---G.V----Y--LDNIS..L-KEG.......................NVLL--
Q2JVP2_SYNJA/119-199----------AILEEL.RRRI--PGQ---G.V----W--ITNIS..A-SGD.......................TVNI--
C5BRK2_TERTT/100-177----------HYFDEF.ARAV--P.D---G.V----F--VTTLS..K-SGN.......................RISV--
Q31KD7_SYNE7/115-203----------AILTDL.SRRT--P.V---A.V----Q--ISKIE..Q-AGK.......................KVTL--
Q05VH9_9SYNE/427-512----------ALLEQL.RRIT--P.Q---G.I----Q--LKDLN..V-NDD.......................TIKL--
Q212Y9_RHOPB/275-348----------MAIEAL.SALL--P.D---D.T----Y--ATDVR..I-EGN.......................KLQL--
A0Z1L9_9GAMM/260-333----------PEIHRL.TQLL--P.D---S.A----Y--VTQFT..Q-EGR.......................SIRL--
Q8YY23_NOSS1/115-220----------AMLEDL.RDRI--P.A---S.V----Q--IEIVR..Q-TPPTPPAAGQ.........PPGNPAGGIEI--
A3CR63_STRSV/106-183----------AFMDFL.NKNV--T.R---N.L----V--FDDIK..I-NND.......................NVEI--
A3LJ85_PSEAI/100-178----------RVFDQL.VRTL--P.D---G.V----Y--FTDLK..M-TGK.......................NIAI--
Q7NA52_PHOLL/101-175----------QLFNEL.PELL--P.E---G.S----W--LTAFD..D-QAG.......................QLKL--
B4A5T7_SALNE/97-171----------SILTDL.ANLL--P.E---Q.A----W--LTSLN..Y-QQE.......................TLEL--
Q21T59_RHOFD/119-218----------ARLQLV.ARSI--P.A---Q.V----W--VTELK..A-DDN.......................QLAL--
Q7MH79_VIBVY/111-189----------AFMNLM.TELI--P.E---G.V----Y--VDKIK..M-NTN.......................DVEL--
B6SE77_9NEIS/102-181----------RIIDTL.NQLV--P.D---G.A----Y--LLSLKGDA-SKNLV...................SNKYAI--
B5EI36_GEOBB/95-175----------ALLDKL.EGVV--P.A---G.V----A--LTQVEPVL-KDQ.......................ALKL--
A4YMS3_BRASO/280-353----------LVLEAL.ARVL--P.D---N.T----Y--LTELR..I-EKD.......................KLLI--
A8MGF2_ALKOO/105-178----------DILNKI.YHSI--P.E---N.L----Y--LTSLS..I-NSS.......................EVNI--
B2TQM7_CLOBB/105-181----------LVLTSI.NSTI--P.S---Q.I----S--FKTLQ..I-NND.......................ILII--
Q988B3_RHILO/273-346----------RVWAEL.THLL--P.D---T.A----W--LTDLS..A-KGD.......................DLTI--
Q82SK2_NITEU/100-177----------HMLDEV.ARRV--P.E---G.V----Y--LKGFK..Q-TNE.......................HLRL--
Q2S9Q1_HAHCH/100-176----------RVFDEL.VKTN--P.D---G.V----Y--FTNLV..K-KGE.......................TLEI--
C0N3G0_9GAMM/100-177----------KVFDSL.PRLV--P.E---G.V----N--LERVK..R-TGN.......................KINF--
B8E235_DICTD/101-179----------DLFETL.NRIT--P.K---N.L----W--VKSFN..L-DSS......................DNINI--
Q7NHV0_GLOVI/113-196----------AVMEDL.RRRV--P.E---G.V----W--LNVLS..S-ATTKE...................GDIVTL--
A3JEF9_9ALTE/100-177----------RVFDEL.VRTV--P.D---G.L----Y--FTDLK..K-VGD.......................RLDL--
A7H854_ANADF/100-177----------KMLDEL.ATLT--P.K---R.L----W--LRKLE..E-KGG.......................AVTI--
Q8RAF0_THETN/99-173----------KLSEDV.ASNL--P.Q---D.V----S--ITHLK..Y-DNK.......................VLEI--
A0ZCZ0_NODSP/113-219----------AMLQDL.RDRI--P.A---A.V----Q--IETIQ..Q-IEPTSPGRGQ.........QPTKLVAGLEI--
Q1K2X1_DESAC/100-177----------HIMDDL.ITAL--P.D---N.L----W--VTDFK..E-KGG.......................NITL--
B2FSH6_STRMK/100-187----------HLFDAL.VRTI--P.D---G.V----V--LTALQ..Q-EGD.......................MLTL--
B6EM38_ALISL/101-179----------QILNIL.PEVI--T.E---G.V----Y--LNKIR..M-DAR.......................SIEM--
A7IH65_XANP2/278-351----------LVLEAL.SQAL--P.D---D.T----Y--VTELQ..M-EGD.......................RVEV--
Q3KJA6_PSEPF/100-178----------RIFDQL.ARTL--P.D---G.V----Y--FTDVK..M-VGK.......................TLSI--
B7DM24_9BACL/96-194----------VILKGL.AHDL--A.P---S.T----T--VDSIQ..Q-IGS.......................TLTL--
Q2P6L7_XANOM/100-189----------HLFDSL.VRTI--P.D---G.V----A--LTNIK..Q-DGD.......................ILTL--
B0C6K6_ACAM1/111-215----------ATLQDI.RDRV--P.P---T.L----Q--VTKIQ..Q-KAATPPAQAGQPNAQAATVAALSAPTQLTI--
B7S0Z0_9GAMM/110-187----------RILDQL.VRTI--P.D---G.V----F--YSKLT..T-KDR.......................SISI--
B1BAN5_CLOBO/105-183----------DLIDDI.SSTV--P.K---S.V----S--FQNIT..V-SDK.......................TVTI--
C1I9R3_9CLOT/106-178----------ELLDKL.SSTL--P.T---E.V----T--FNSIN..I-TNT.......................EISI--
B1Y308_LEPCP/100-183----------HMLNEL.AART--P.E---G.V----Y--LTLVK..Q-EGQ.......................AVLV--
A1SRB2_PSYIN/100-177----------HLFNIL.PQVV--P.T---G.I----Y--LNSIT..F-ANE.......................QVDV--
Q4KJJ3_PSEF5/100-178----------RIFQQL.ARSL--P.D---G.V----Y--FTEVD..L-QGQ.......................NLGI--
B8KUT7_9GAMM/100-177----------RILDQL.VRTL--P.D---G.V----F--YTELT..T-EEG.......................MITI--
A1HQ13_9FIRM/97-173----------ALVARL.GIVT--P.P---Q.V----W--LTEVA..A-AEN......................GAVRL--
B9YYQ5_9NEIS/100-177----------HIFDQL.VRQT--P.D---G.V----Y--LRDFR..Q-TGR.......................SFDL--
B9M3J1_GEOSF/100-177----------SRLAML.SDAV--P.D---K.L----W--LTKYS..E-SAG.......................TISL--
B5FBN6_VIBFM/101-179----------QLLNIL.PDII--T.E---G.I----Y--LNKVR..M-HER.......................EVEI--
C0QK71_DESAH/391-463----------DTLKAL.SVIV--P.K---E.T----W--LQGFT..Y-SEK.......................GMQI--
B7KDY8_CYAP7/115-226----------ALLQEI.SNVI--P.Q---S.V----H--IGTIE..Q-VELEPETGKS........ENPAKKATQLKI--
B8KB93_VIBPA/101-179----------DFMNTL.PQLI--P.E---G.V----Y--VDKVK..M-NGL.......................QVRV--
Q8RHE9_FUSNN/314-386----------SLLEEL.SYLC--P.S---G.V----K--ISSIE..Y-DEN......................KIFNI--
A3Z3C8_9SYNE/419-506----------ALLEQL.RQVT--P.A---G.V----Q--LQSLR..V-QGN.......................AIEL--
F2G3R3_ALTMD/118-196----------EVMDDL.ANYH--N.Q---N.L----W--LTRID..I-DTQ.......................KIRL--
B3E9T1_GEOLS/100-177----------TRLATL.SDVT--P.D---Q.L----W--LESYK..E-AGS.......................DIRI--
B5E8I0_GEOBB/100-177----------SRLAAL.SDAL--P.P---K.L----W--LTKYA..E-NGN.......................SVTI--
B8ESJ7_METSB/292-365----------VVYDEL.SRIL--P.D---D.S----Y--LTELR..V-ESD.......................KVQI--
A9BY15_DELAS/240-313----------QVMAAL.TQLF--P.D---D.T----A--VQRVS..F-SGS.......................KLAI--
B1Y072_LEPCP/116-203----------AVLQAL.ARQA--D.P---A.V----W--ITGLSLGQ-DGD.......................TMEL--
B2J1B9_NOSP7/115-223----------AMLQDL.RDRI--P.T---A.V----Q--IETIR..Q-IPPVAVAADQ.........PPSNPAGGLEI--
C4ZLJ2_THASP/100-177----------HLFNEL.AQRL--P.D---G.V----Y--LKSVK..Q-TGR.......................QVRV--
A0KN33_AERHH/100-177----------RLFNQL.PSLV--P.N---G.V----Y--LNTLA..L-QNN.......................QIDV--
A1AMQ0_PELPD/100-177----------RRLATL.SDCT--P.D---K.L----W--LTSYG..E-TGT.......................DIKI--
C4GJE0_9NEIS/102-182----------RIVDTV.NQLV--P.D---G.A----Y--LTSIQ..N-IGGSDA................NISNTYTL--
Q0A4Z1_ALHEH/100-180----------QLLEEM.VNIL--H.D---G.I----Y--FTSIR..Q-RNS.......................QISI--
C4Z597_EUBE2/445-523----------DFVDYL.EKNV--P.S---D.V----V--ISGFT..I-SSG.......................AVSI--
A6FBL5_9GAMM/100-175----------QLMNTL.PQLV--P.A---G.V----N--LAKLT..F-KND.......................IIKI--
Q12FF4_POLSJ/100-183----------YLLSEL.VKQL--P.D---G.V----Y--INSMK..Q-DNQ.......................TVLI--
A1JSD8_YERE8/100-174----------VLLQQL.SQQI--P.D---N.C----W--LISLI..P-QSD.......................KLVF--
Q5ZX05_LEGPH/100-178----------HLFDEL.IKIT--P.P---G.V----Y--ITKMQ..R-EHD.......................VVTL--
Q0AIN5_NITEC/95-174----------ALFDSL.ELAA--S.K---E.V----A--LLSLQPSV-SGR.......................TVRI--
A5FWX5_ACICJ/271-344----------LMLAAL.TRAL--P.D---R.S----Y--LTDLS..L-RDR.......................VATL--
B0JRP4_MICAN/116-221----------AILQEI.RQQT--P.P---S.V----Q--LTSVQ..Q-VEVPAAPDQ..........GQPNPATQLKI--
B9MDE7_ACIET/100-183----------HLLNEL.VAQL--P.D---G.V----Y--ITSLK..Q-IDQ.......................TVTM--
Q1NNC6_9DELT/33-111----------RILDEV.SNRT--P.S---RRL----W--LNSLR..L-SDQ.......................TLSI--
C0DV41_EIKCO/103-177----------RMIDSL.NTVA--P.E---G.V----Y--LTGIK..A-KDV......................STYTL--
C3JZE1_PSEFS/252-326----------ALLNEL.TACL--P.S---D.T----W--LDQLE..V-NDG......................ADVSF--
Q609V6_METCA/282-355----------DVLNEL.SKVM--P.D---D.T----W--LNGLQ..Y-KEG.......................HLVV--
C3MFK9_RHISN/275-348----------TMWEEL.SGIV--P.D---S.S----Y--LTNLT..V-KAK.......................VVEI--
B5ZIQ8_GLUDA/257-330----------EVLAAT.TRLL--P.D---D.T----V--LTDLI..L-RQG.......................QLII--
A6TTT3_ALKMQ/105-178----------ELMLQI.SKQI--P.N---D.I----F--FESMS..I-NGE.......................QVHI--
Q1YS07_9GAMM/100-177----------KIFDEL.VRAV--P.D---G.T----Y--LDSLE..L-NNA.......................SFKV--
B0U6Y4_XYLFM/289-362----------EVWEEL.SRRL--P.N---G.T----Y--LEKFA..I-EDG.......................QLHL--
C4LB15_TOLAT/100-177----------RLFNDL.PVVV--S.N---G.V----Y--LQSLN..F-SPL.......................GIDV--
Q1IGB1_PSEE4/101-174----------ALFSDL.EMAM--P.E---G.A----R--LHELD..V-QGS.......................RVQL--
B5YJ53_THEYD/106-182----------SILSTI.VKKL--P.D---G.V----W--LTGLQ..F-DE........................AVTV--
Q6MPI9_BDEBA/121-198----------RVLDLL.QTVI--P.E---K.A----W--LTRVQ..V-NPT.......................RVNI--
A8AQU9_CITK8/73-147----------SVLEGM.AALL--P.E---Q.A----W--LTRLS..W-QQG.......................TLEL--
C0QLC6_DESAH/100-179----------TLLDAMTSLVV--P.E---Q.M----W--ITSIK..T-QDP.......................TVTL--
B1XPF2_SYNP2/120-215----------AILQEV.GDLT--P.P---G.L----K--ITSFE..Q-SDN.......................QVLV--
Q0EXA3_9PROT/100-177----------KTLHEI.ALLI--P.E---N.V----W--LNQIS..E-QGG.......................SLLL--
Q3JD25_NITOC/289-364----------ELLYEL.TRIL--P.D---N.V----W--LQQLT..F-SRGK.....................AELDI--
Q1QZY7_CHRSD/101-177----------RIFDQL.AATL--V.E---G.V----H--YDRLT..R-KGD.......................RLDL--
A3RW17_RALSL/108-190----------QLLEEL.VRQV--P.D---G.I----Y--LTALK..Q-EGD.......................RYTV--
Q08YZ9_STIAD/84-208----------RMLDAL.SLAM--P.K---K.L----W--LENFS..E-EKG.......................GVKI--
Q6AS37_DESPS/100-178----------HVLDEV.SNSV--D.N---KRM----W--INSLD..Q-NGG.......................SLRI--
A0Z8I9_9GAMM/100-177----------RIMDQL.VRTV--P.D---G.L----F--YTSLV..S-GDG.......................KIEI--
Q1ZHK8_9GAMM/100-177----------RLFNIL.SKEV--P.E---G.I----Y--LKKVS..F-VNN.......................KVLV--
B6BVV6_9PROT/465-539----------KLFEKL.IRDI--P.K---D.V----E--LDRVI..I-RDN.......................TFQI--
B9JMG5_AGRRK/265-338----------MIWEEL.TRIL--P.D---S.T----W--LTDMS..I-RNG.......................QVTI--
Q21UC2_RHOFD/100-183----------HLLTEL.VKQL--P.D---G.V----Y--IVSMR..Q-DNQ.......................TVTL--
Q3SM93_THIDA/100-177----------HLFDQM.IRLL--P.E---G.L----Y--LKSFK..Q-VGD.......................TVTI--
B7WVX0_COMTE/100-183----------YMLNEL.VKQL--P.E---G.V----Y--ISSIK..Q-DGL.......................SVTM--
C4IH38_CLOBU/105-181----------ELLNKI.NSTI--P.S---E.I----T--FKNLV..V-ANN.......................TLSI--
C0EQU7_NEIFL/103-177----------YILDSL.NALT--P.D---N.T----Y--LTALE..A-ESP......................ISYKI--
A2SKH6_METPP/100-183----------YLLNEL.VKQT--P.E---G.V----Y--LTTIK..Q-DGQ.......................VVAI--
B6J4A1_COXB1/85-157----------SPIKLI.SEAL--P.K---Q.G----I--LTKLS..F-DSG.......................TWTL--
A3YUA5_9SYNE/109-199----------ALMTDL.AGRT--P.A---E.L----Q--LTSVV..V-GKD.......................DLQL--
B3PI74_CELJU/100-177----------RYFDEF.AKAV--P.D---G.V----Y--VTMVD..K-KGS.......................AITI--
B5YEE0_DICT6/384-462----------LFLSDL.KYMV--P.Q---N.V----W--LTSVD..I-GVD......................KKLTI--
B5XTU2_KLEP3/97-171----------PRLLAL.AADL--P.A---Q.A----W--LTRLD..Y-QGA.......................VLTV--
Q3R4G6_XYLFA/100-184----------HLFDSL.ARTI--P.D---G.V----V--LTTIK..Q-EGN.......................SLTL--
A2PCR9_VIBCL/103-181----------EFMNQM.PNLI--P.E---G.V----Y--VDKIK..M-NGH.......................QIEI--
A1WFQ6_VEREI/278-351----------RVMELL.TQAL--P.D---D.T----T--VFTLQ..I-QGS.......................KVSL--
Q489N8_COLP3/100-177----------QVLDEI.AKII--P.N---G.I----Y--IIELE..K-QGN.......................TLQL--
A4BAN2_9GAMM/100-178----------HVFEEL.VNAT--P.D---G.V----Y--FTDLS..S-SGN.......................TIQV--
A5EBI1_BRASB/276-349----------IVLETL.SKIL--P.D---D.T----Y--VLEMH..V-END.......................RLQI--
A0Y8X3_9GAMM/100-177----------RVFDEM.VRTL--P.D---G.V----F--YMSLV..R-TKD.......................EIKL--
Q306N5_MYXXD/101-221----------RMMDAL.ASAT--P.K---K.V----W--VKTFS..E-NNN.......................AVSI--
Q60BY7_METCA/110-193----------HLFDEI.ARTV--P.E---G.V----S--LRDLT..Q-EER.......................AITV--
A9BA85_PROM4/113-200----------AFLKEI.SNII--P.S---G.I----K--LTSLS..I-KGG.......................KIVL--
Q2VNU4_9BACT/249-322----------IVIEAL.SRVL--P.D---D.T----Y--LTELR..I-LGD.......................KMQI--
Q2BLX6_9GAMM/100-174----------RNFDEL.VRVL--P.D---G.V----H--YSSLT..R-TGA.......................NVSI--
Q07N81_RHOP5/265-338----------ELLDAL.SAAL--P.D---H.A----F--LIDFR..F-EKD.......................EIRI--
A0LPH8_SYNFM/376-449----------EVLSFL.TQVT--P.E---D.T----W--LNYLS..I-KKG.......................QLML--
Q89HH6_BRAJA/288-361----------IVLESL.SRLL--P.D---H.T----Y--VTEMH..L-SGN.......................KIQI--
Q2C0P4_9GAMM/101-179----------QLLNQL.PNVV--P.G---G.V----Y--LESLN..L-NSQ.......................RVGI--
C5CQG6_VARPS/100-183----------HLLNEL.VRQL--P.D---G.V----Y--LTSMK..Q-DNQ.......................TVTL--
B2A7F7_NATTJ/100-174----------QHFEEL.SQNM--P.Q---G.L----W--LEEYT..A-AEP......................EEISI--
Q47JL1_DECAR/100-177----------YLLSEL.VKQV--P.E---G.I----Y--LKAVK..Q-DGL.......................KINI--
C3KAI0_PSEFS/101-176----------QLLDQL.ARAV--P.D---G.V----H--LHEVV..A-KGD.......................TVSI--
Q2P7E4_XANOM/286-359----------EIWDEL.SRRL--P.G---G.T----Y--LEKFS..V-EGG.......................QLQL--
A4BQU5_9GAMM/101-178----------HLFHQF.VTTL--P.D---G.L----Y--LTSIK..E-QGS.......................HVTV--
B7IAW1_ACIB5/100-189----------RLVDEL.VRVT--P.S---A.M----Y--LTKFS..R-TGD.......................KFTI--
Q2LWS9_SYNAS/100-178----------YYLDRL.NSAV--PAQ---D.A----W--LDKVS..Q-QET.......................GLQL--
A8GKR2_SERP5/100-174----------QLLQQL.STLL--P.A---P.V----W--LIALE..S-HSQ.......................NITL--
A4A8K0_9GAMM/100-177----------RVLDQL.VRTV--P.D---G.V----F--YTNVS..A-RGV.......................DLRV--
A1WDV7_VEREI/100-186----------HLLAEL.VKQL--P.D---G.M----F--ITGIR..Q-AEQ.......................TITM--
A5GFB1_GEOUR/96-176----------VLLDNL.EAVV--P.E---G.V----A--ISAIEPDP-KKQ.......................ILKL--
A4CEN2_9GAMM/100-177----------QIMDEL.AKMV--P.S---G.V----Y--LTSLE..R-KDR.......................ALQI--
B5EP45_ACIF5/100-177----------HLFNTL.ARVT--P.D---G.V----F--LTHLK..Q-AGD.......................SITV--
Q2RI86_MOOTA/98-173----------PILKTI.DEAL--P.E---E.V----W--LTGLE..E-DEGK.....................GLLTL--
Q1GYG2_METFK/100-177----------MMLDEI.SRQL--P.E---G.M----Y--LRALK..Q-QGN.......................LVTV--
Q3A2N1_PELCD/100-177----------HLLDDL.NRAL--P.D---K.L----W--LESFQ..E-ESG.......................GVKI--
B9M0Z2_GEOSF/96-176----------NFLEQL.ESVV--P.E---G.V----T--LSTVEPDV-EKR.......................TLKL--
Q1QQ80_NITHX/271-344----------MVLEAI.SRVL--P.D---T.T----Y--VTELR..I-DTD.......................KMQI--
A0LFN5_SYNFM/100-180----------RVLALL.SVQL--PPE---R.M----W--FDRLS..Q-VGT.......................TITL--
Q88CU8_PSEPK/100-173----------GVFADL.EGAL--P.E---G.V----Q--LIGLS..L-DSG.......................RLQV--
B0K9C0_THEP3/99-173----------GILQNL.ASNI--P.E---K.V----S--IDSLK..Y-EKN.......................ILEI--
B1J2J1_PSEPW/100-173----------TLFTDL.ERAL--P.E---G.V----Q--VVELR..V-EGE.......................RLHL--
A4WFI2_ENT38/96-170----------PTLVSL.ALAL--P.E---Q.A----W--LTQMS..F-QQS.......................SLIL--
Q15Y39_PSEA6/100-177----------IVLDEL.ARVV--P.P---G.V----S--FARFS..R-TIN.......................RVEI--
A1KBQ9_AZOSB/100-177----------HLFNEL.AKAT--P.D---G.V----Y--LKSVK..Q-VGA.......................RITL--
B2IBE2_BEII9/274-346----------GILDDL.SKVL--P.D---H.A----H--LDDFS..L-DKG.......................VLRI--
A1TUQ6_ACIAC/264-337----------KVLDRL.TQLL--P.D---D.T----Y--LQSFR..L-QGA.......................KVTI--
A6M144_CLOB8/105-181----------VLLMDI.SSTV--P.S---E.V----S--FKNLD..I-SDN.......................TITI--
A3ISW4_9CHRO/116-208----------AILREI.ETQI--P.A---N.V----Q--VGSIV..Q-TDT.......................GVTI--
A8ZSX8_DESOH/100-178----------LLLREI.AELT--V.K---GRM----W--ITRLE..E-SGN.......................TVFV--
Q5QWC4_IDILO/117-193----------EFLHEL.AEIT--P.E---D.I----W--LTDFS..M-SGE.......................NIRL--
B0A4I7_YERPE/100-174----------ILLQQL.SQQI--P.E---R.C----W--LMALR..Q-QGD.......................VLSF--
Q39UI3_GEOMG/96-176----------LLLDQL.ESVV--P.D---G.V----T--LSSIEPKL-KEG.......................TLTL--
B7LS95_ESCF3/97-171----------PALYAL.AEQL--P.E---K.A----W--FTKMA..W-QKD.......................RLML--
B4WYC6_9GAMM/101-177----------YVFDEL.VKTL--P.D---G.V----F--YNEIK..R-VGD.......................LYTI--
Q8DGH5_THEEB/111-198----------AVMRSM.ATQT--P.V---G.V----Q--IRKIT..Q-GGAT....................SPELTI--
B6C334_9GAMM/100-177----------HVFDKI.VRAL--P.D---G.I----Y--LESIK..R-QEH.......................TNML--
B8FQ80_DESHD/405-487----------QEIREL.TAYA--P.E---G.I----Y--LERIE..I-KGR.......................TLLI--
A6D0B9_9VIBR/100-178----------AVMNLI.PALI--P.Q---G.V----Y--IDKIR..M-RGQ.......................RFKL--

PF04612

C6BGG9_RALP1/26-185A.........ELQQAL-NTSL--TNH---G-L....K--ATRMA--M-SGE----------------------.SVQV--
A3UEX1_9RHOB/7-165E.........PLRTLA-DRTA--RER---G-L....A--ISRVQ--P-LED----------------------GRLGV--
Q0K5X1_CUPNH/40-199D.........ALTQAL-QDSL--GQH---G-L....K--ATRLA--A-GAD----------------------NSVQV--
GSPM_PECCC/1-161V.........SLPILI-SQST--KRY---G-L....T--VVRLQ--P-QGS----------------------.QASV--
Q1IB25_PSEE4/11-155..........DLAGAL-AQSL--DEA---G-L...RA--HSQLD--A-EGD----------------------.GWHL--
Q21EQ3_SACD2/4-161..........SIVDLV-DSSL--RSH---G-L....R--LSNMQ--P-SGR----------------------SDVRL--
Q31WM9_SHIBS/22-178..........QVSRVI-SDSA--SAH---S-V....V--IKRIA--E-RGE----------------------.NIQV--
A1WZN8_HALHL/10-173TD......ERSLLSLV-DRAA--REA---G-ID..DQ--LSRVQ--P-DGD----------------------GTLRV--
Q7MPY7_VIBVY/5-163Q.........PLNQVI-ASSA--RQF---K-V....E--LQRVQ--P-RNE----------------------.MLQV--
Q1ZIZ1_9GAMM/2-159S.........SLVEVI-NRSA--KRS---G-I....S--FTRIL--N-RND----------------------.TLEV--
A6VAT2_PSEA7/20-183A.........ADAQAI-GRSL--RDQ---G-L....D--GFQLE--A-IGP----------------------GQWQL--
B1YQ40_BURA4/7-166L.........ALKDAL-TASL--SDH---G-L....Q--GAQVQ--V-VGN----------------------.GVQI--
Q7BSV4_ECO57/1-160L.........GLSAAV-TRTS--AAY---G-V....S--VTRLQ--P-QGE----------------------.RLAV--
Q3KBE0_PSEPF/17-170..........NLEQSL-QQTL--QAS---G-L....G--GHYQL--A-AAS----------------------AGWQL--
Q0I0D9_SHESR/1-158G.........SLSSVV-NQTA--GTY---G-L....V--ITRMQ--P-QGD----------------------.KIQV--
A3WP21_9GAMM/17-175G.........SLSQRV-NEAA--ASN---K-I....Q--IARMQ--P-QNN----------------------.GLIV--
A8AIM9_CITK8/5-159N.........NPRTVI-EESA--KEI---H-L....A--LSDIR--Q-DER----------------------.SLSF--
Q1LHW4_RALME/25-184D.........ALTQAL-QDSL--VQH---G-L....K--ATRLM--T-TGD----------------------NAVQI--
Q5QY94_IDILO/12-171G.........SVSQRI-NRAA--AAQ---D-I....Q--IARLQ--P-QGQ----------------------.EYLL--
Q9ABP4_CAUCR/5-157A.........APQAVV-EAAA--SRV---G-L....P--IARHR--Q-DAN----------------------GRFTI--
A4VFT9_PSEU5/13-169E.........QLQGVI-TESA--QQG---N-L....S--IESFD--N-GSD----------------------GSLQV--
Q8FCY8_ECOL6/7-160..........PIKNIL-LEEA--KRE---N-L....T--IT.LE--N-GPD----------------------NTLTI--
Q1ZL56_PHOAS/1-160K.........GLNQVV-NETT--ERF---K-I....E--LIRMQ--P-RND----------------------.AIQV--
A1SR65_PSYIN/2-159Q.........NVTQIV-TISA--QQN---G-I....T--FSRII--N-RNE----------------------.QVEV--
GSPM_VIBCH/5-164Q.........PLNQVI-TNST--RQF---N-I....E--LIRVQ--P-RGE----------------------.MMQV--
Q02HH6_PSEAB/22-191T.........ADAEAI-RRSL--RDQ---G-L....D--GFQLD--A-PQP----------------------GQWQL--
A0YBF1_9GAMM/11-168Q.........SLLGIA-NKTS--KGF---N-L....T--FKRYQ--P-VGE----------------------SGLSL--
Q87TC8_VIBPA/6-164Q.........PLNQLV-SSSA--RRF---K-V....E--LIRVQ--P-RND----------------------.SVQV--
GSPM_AERHY/2-162G.........TLEGVV-NRTA--FNQ---K-I....K--IARLQ--P-QGQ----------------------.ELQV--
A6T4U0_KLEP7/1-158..........ALTALV-MREA--ASH---G-L....T--VIRLQ--P-QGK----------------------.RLQI--
A6EW52_9ALTE/11-176AGGDTPADGRALMALV-TRSA--SEA---G-L....S--LQRFE--P-SGE----------------------DAIRV--
A3MPL1_BURM7/14-173V.........ALKDAL-AASL--SDH---G-L....A--AAAPQ--V-VGG----------------------.GVQI--
Q9ZFW8_PSEAC/14-170A.........ALQGLV-TASA--ASQ---G-L....N--VERLD--N-QGD----------------------GGLQV--
Q0A613_ALHEH/2-163RA.......DSLLGRV-DRSA--GDY---G-LG..ER--LERLQ--P-DGD----------------------QRVRV--
Q0ASQ4_MARMM/5-163Q.........SLRAVA-GSMA--LRH---D-I....A--LARMV--P-GED----------------------GRLTV--
A1JQE2_YERE8/1-159..........SADRAL-HESA--HQK---N-M....T--ITLLE--A-NAN----------------------.RAVV--
Q31J18_THICR/7-166T........EGLMQFI-QAQL--RQL---N-LY..QT--IERIE--T-QGH----------------------.KVVV--
A6V156_PSEA7/5-149T.........ALPGLL-ARSS--AQA---R-L....N--VERMD--S-EGS----------------------GRMNL--
A3SDU2_9RHOB/1-150T.........PLATRI-TTSA--SAA---N-L....T--LRRIE--P-END----------------------.SIRV--
A3YCB4_9GAMM/14-171RS......GQALQALV-SRTM--RKQ---K-L....V--AQRMN--L-DGD----------------------SRLQV--
Q1YQU6_9GAMM/7-161G.........AAKDVI-NRLV--RRN---Q-I....K--LVKIA--E-QAQ----------------------GKYAL--
Q1N4H7_9GAMM/22-176G.........SILSIV-SATA--KAK---K-I....E--LRRFE--P-DGA----------------------TRLRI--
A1U0C6_MARAV/11-176AGADKPEDGRALMALV-TRSA--GEA---G-L....S--LQRFE--P-SGE----------------------GAIRV--
Q02PQ8_PSEAB/17-174A.........ALQGMV-TASA--AQA---G-L....S--VERLD--N-EGE----------------------GAVQV--
A2SKJ8_METPP/13-167A...........EAAL-RGAT--ERL---G-.....T--NARLT--L-QGD----------------------.RATL--
Q1NDR5_9SPHN/1-158V.........PLDQFV-GQSA--GEA---G-L....T--LERAQ--A-QGN----------------------DRMDI--
F2GBM0_ALTMD/1-159G.........SLPQAV-NRTT--AQH---D-I....A--ISRMQ--P-QGD----------------------.ELQV--
A6D4H3_9VIBR/5-163Q.........PLNQVI-TSST--NRF---N-V....E--LIRMQ--P-RND----------------------.QLQV--
Q4KD21_PSEF5/17-183..........SLEQAL-RQAL--DAA---G-LQGRYQ--LQHAD--Q-AGP----------------------ESWRL--
Q5E1Y6_VIBF1/1-161AI.......RPMNQVI-PSST--RQF---K-I....E--LIRMQ--P-RGE----------------------.QMQV--
B2T7P8_BURPP/6-165A.........ALKDAL-TASL--SDH---G-L....A--ATQVQ--V-IGN----------------------.AVQI--
Q8PPI2_XANAC/5-157..........ALADII-ASSA--RDA---G-V....N--ITSQQ--R-SAV----------------------GGVDV--
A4BDW7_9GAMM/6-161..........IMNSEI-RRQA--ARY---G-I....E--IQRFE--P-DGE----------------------.LLRV--
Q8P5C5_XANCP/5-144..........TLADIL-.QAA--RDA---G-V....A--IVPAP--R-AVA----------------------GAVEL--
A1S1Y3_SHEAM/1-158G.........SMTNVV-NQTA--SRY---G-L....T--ITRMQ--P-QGN----------------------.KIQL--
GSPM_KLEPN/1-158..........EPSTVI-MREA--ARH---G-L....T--IVRLQ--P-QGS----------------------.RLSL--
A5V9H7_SPHWW/17-167G.........SPAAVL-SASA--ARF---G-M.....--.VPVV--N-EGG----------------------EGIRV--
GSPM_ERWCH/1-160I.........SANGIG-AQSA--VRY---G-I....T--VLRMQ--P-QES----------------------.QVSV--
Q2Y7T4_NITMU/2-161G.........DLHALA-QTQA--DIL---G-LS..HA--LNGID--A-LGD----------------------DQVQV--
A4XWF6_PSEMY/17-173A.........RLQGLV-TASA--AEQ---G-L....V--IERLD--G-EGQ----------------------GAVQV--
A1W3T9_ACISJ/17-159..........ALRTLQ-STLA--QQL---G-.....A--AAQMN--V-AGD----------------------.RATV--
A3UP97_VIBSP/5-162..........PLNQSV-PASM--RRF---N-I....E--LIRVQ--P-RGE----------------------.MLQV--
Q15ZB6_PSEA6/1-159G.........SLAQAA-NQTA--ANA---N-I....P--IARMQ--P-QGD----------------------.ELQV--

PF12693

Q8DDT8_VIBVU/244-403SGGGAGDSMLQWMAQLPGTIG..QVK---N-F----E--VLSIKYDG-NRG-----------------------EVRI..
Q8P5C4_XANCP/217-355...VSADAFAAQLAAVIAAVD..SVP---G-A----E--LDMLAYQQ-AQ.-----------------------PVRA..
Q8PPI3_XANAC/214-362QAGTATDRLAMQLSTLFAAVD..TLP---A-A----E--LDQLDYNP-AQ.-----------------------PLRA..
Q9ABP5_CAUCR/216-368AASQSGQGFGDLSASYLSMVE..STP---G-V----T--LDTLVY.G-EEG-----------------------AIRS..
Q8CZX5_YERPE/243-396DLKKNNVSFIKLLNAVSYYTA...DE---N-V----D--VRSFNFNY-SDG-----------------------EISF..
GSPL_ERWCH/242-399RAGVSGFALTEQMNRLQQLVA..QNE---G-V----S--LQSLSYDR-SRD-----------------------ELRL..
GSPL_PECCC/268-425AAGGAGKALLDQLTPLQQLMT..QNS---A-I----K--IQSLSYDG-AAG-----------------------EFRL..
Q9ZGT8_ECO57/266-425STGNNIPELGSVMRQLQQLLS..ETS---T-I----R--LQALAWDS-SSQ-----------------------TLKI..
GSPL_KLEPN/240-398KNAGARPALISRLGALQQIID..DTP---G-I----R--LRTLSFDA-ARN-----------------------ALQL..
Q88P00_PSEPK/218-362QQQLRTRQLDDLQARLQTWLR..DNP---G-L----R--LQAVRFDG-QRW-----------------------HLRL..
O86440_PSEPU/213-361QQQLRVRQLADLQGRLQAWLQ..AHP---G-W----R--LQAVRFDG-QRW-----------------------HVRV..
Q87TC9_VIBPA/245-404SGGSTDVAMLSWLAALPATLG..QVK---D-L----E--ITSFKYDG-QRG-----------------------EVRI..
GSPL_VIBCH/249-407SGGASVGSVLKWLSPLPEALK..GV.---N-L----Q--LQSIKFDS-NRS-----------------------EIRL..
Q8EKC1_SHEON/239-395QGQGSGAEFFSMLAGLQDAFK..QVP---E-L----K--PNSLRFES-ARN-----------------------EIRM..
GSPL_AERHY/243-389.GQTPQDGVLLLLTELAPTFA..EVP---G-L----K--PQVLRFDA-ARG-----------------------ELRL..
GSPL_PSEAE/226-382ASSGGEGQLLGLLGQAATVIG..GEP---T-V----S--VEQLDFSA-ARG-----------------------DVAL..
Q9ZFW9_PSEAC/223-381AGS.GQSQLLALLDQAAAAIG.EGGA---Q-V----Q--VDQLDFNA-QRG-----------------------DLAF..
Q8VPC1_ECOLX/234-392RPQADDTRLLAELSAIASTLKSASLS---D-I----E--MRGFTFDQ-KRQ-----------------------ILHL..
GSPL_ECOLI/237-387....QYPEAVPLLYHLQTLLL..EHP---E-L----Q--LMEANYSQ-KQK-----------------------SLTL..
Q8XUS4_RALSO/317-476AGKAAPEDFLPLADRFAQAAA..GLA---P-D----A--LLALDYHG-RAL-----------------------VVTL..
Q9ZF77_BURPE/291-444AGELSPNDFLSLASGLARSLG..PLP---P-N----G--IASLDYHD-RRL-----------------------DVGFKP
Q9I5P2_PSEAE/207-381AGKADGDAAPGLAALLHGAGEAMPFL---A-G----R--LQRLDYHA-GEL-----------------------DLELLP
Q8GBD8_YEREN/245-399EKDITPPGLLSQLRAAMPILQ..SLT---G-V----K--TQAMEWQS-ETL-----------------------ALTF..

PF10721

A8A0B0_ECOHS/1-160VKDAQQKAAEISARAADLSDSVNQLR---A------E--ATKYAIRL-DAA-------------------QH..TANL--
A5W5S5_PSEP1/4-164RVKAHEERTIADAGATDADAAGQRLR---S------G--STQF....-AAA-------------------VSCPSTDI--
Q858E9_BPE15/10-160.REAQRALDRARNDALDAAARAGRLQ---Q------Q--LVAI....-...-------------------REQLRQYN--
B1J5E9_PSEPW/4-165RAHAQEERTIADAGADGADAAGQRLR---D------E--SAKL....-AAA-------------------VSCPGTDT--
Q8Z7W1_SALTI/12-170VKDAQAQAAKSAATAAGLSATVSQLR---T------E--AKKLATRL-DAA-------------------KH..TANL--
Q57Q93_SALCH/12-178RKRADEELAKIQADADAAERARGGLQ---Q------Q--LAAVQRQL-AGS-------------------ETGRLSAL--
Q46YK2_CUPPJ/9-168ANAAKKDADTARADALAAGDAAERLR---Q------R--VNEL...L-AAA-------------------RAGKDTAA--
Q4KA36_PSEF5/4-166VQDGQRKIDSAIADAVTARAAAGSLQ---R------T--VDDL...T-ERL-------------------KRTPSSNS--
A9ABH5_BURM1/1-157AKDANQQRTAALADAFAARAAAGSLQ---Q------R--VDQL...V-AAA-------------------RH.....P--
Q87Y73_PSESM/9-169ANDARQEQAVAIADAVVADASGDRLR---S------E--AGKL....-AAS-------------------ASCVPSDP--
Q48J34_PSE14/4-169ANDARQEQTAALTDAAVADAAGDRLR---I------Q--AGKL....-AAT-------------------ASCVPSDT--
A1AE00_ECOK1/10-160EREAQSRIDVARVDAEHANAAADSLR---A------E--LDKT....-...-------------------KRLAEHYT--
Q88MI7_PSEPK/4-164RVHGHEERSIASAGADGADAAGQRLR---D------E--GAKL....-AAA-------------------VSCPGADT--
VG55_BPN15/14-172VKNAKEKAAAARDASARLAGTVSQLQ---Q------Q--ARKLATRL-DAA-------------------KH..TADL--
Q9F9Z1_9ENTR/18-187AIHAEEELAAARDAAADAQRTGQRLQ---H------T--VTTLQRQL-ASR-------------------ETRRLSAA--
Q7WK95_BORBR/4-167RDDAQELAAAAAANAVGARAERDRLR---T------H--ANAL....-..A-------------------RAAVARDP--
B0KJQ0_PSEPG/12-176GESARQQLELAQSRADTAESAAGGLR---R------E--IDRL....-.RR-------------------GHRATCDT--

PF04375

Q8XWW4_RALSO/305-691RSLEVASEQLQLTGNVSGALATLQTI---D-A----R--LATVDKPQ-FRAMRRAVARDIAKLKAMPAVDLSGAAIRL--
Q9HTT7_PSEAE/4-374HLLRLASLRLSALQDVGSATELVQGA---D-D----I--LRAQNDPG-AYAARAKLAASLEALRALPEPDRTGLFVQL--
Q9CK22_PASMU/71-451FLLNNALRKLVLDNDVDTGVSLLKIA---D-E----T--LEKMSDPR-VSMVRTAINNDLKQLLAVNNVDQNVIMQRL--
Q9KVM3_VIBCH/33-397YLVKLAGRKLFLEHDVETATQLMESA---D-Q----R--IAALNDPS-LTALRKAMANDITTLKNIPLIDRDGLVLRL--
HEMX_ECOLI/8-372FLVKLAGRKLWSDQDVTTAAALLKSA---D-A----S--LADMNDPS-LITVRRAITDDIASLSAVSQVDYDGIILKL--

PF04350

A3M9J2_ACIBT/73-221EATG-------DYHAFG-------------------------------------------------AFVSSIAAL-----
B1KP68_SHEWM/48-192SVTG-------EYHELG-------------------------------------------------QLVSGVARL-----
A3L2L2_PSEAI/58-202SVVG-------GYHDLA-------------------------------------------------TFVSGVSSL-----
A1TKV8_ACIAC/65-211RVTG-------KYHDIG-------------------------------------------------AFAADIANL-----
Q0AF43_NITEC/50-192RVTG-------NYHDIG-------------------------------------------------AFASDVAQL-----
A6T3F9_JANMA/58-199KVTG-------SYHDVG-------------------------------------------------AFTSDIANL-----
Q9PGD1_XYLFA/51-201RMVG-------SYHQFA-------------------------------------------------AFVSGVASL-----
Q6AS36_DESPS/56-201QVRG-------PYHNVG-------------------------------------------------SFFDQINKL-----
Q3JEG7_NITOC/49-192RVIG-------NYHQFG-------------------------------------------------EFVSKVAAL-----
A5GEZ7_GEOUR/43-188SVSG-------SFYNIA-------------------------------------------------DFFVSVANL-----
A8GZ26_SHEPA/51-192VVGG-------DYHELG-------------------------------------------------HLVGGVAQL-----
A4BQU6_9GAMM/49-200RVRG-------TYQEFA-------------------------------------------------HFVSAVANL-----
Q0I056_SHESR/48-192SVTG-------DYHQIG-------------------------------------------------NMVSGVAKL-----
Q1ZLT6_PHOAS/47-193QLTG-------NYEQIG-------------------------------------------------KFAEAVARL-----
Q21UC1_RHOFD/65-206RVTG-------RYHDIG-------------------------------------------------AFASDIANL-----
Q1GYG3_METFK/49-194KVTG-------TYHDLG-------------------------------------------------QFAGDIARL-----
A0Y285_9GAMM/56-197EVVG-------TYHEFG-------------------------------------------------EFVGKVAQL-----
A5EW42_DICNV/50-200VTKT-------RFENFA-------------------------------------------------TFAEALTKL-----
A3Y0G4_9VIBR/53-196ELTG-------DYHEIG-------------------------------------------------DFSAAIAKL-----
Q0EXA4_9PROT/51-193NLSG-------SFRQLL-------------------------------------------------TFLKRVGEM-----
Q1K2X2_DESAC/43-188KLKG-------NYHEMA-------------------------------------------------LFCEAVSNL-----
Q46WJ0_CUPPJ/59-200KVTG-------RYHDVA-------------------------------------------------QFNADVAAL-----
A7MXC8_VIBHB/47-190ELTG-------DFHDIG-------------------------------------------------RFSQAIATL-----
B7WV77_COMTE/66-211KVTG-------RYHDIG-------------------------------------------------AFASDIAFL-----
A6F2X5_9ALTE/58-201RVSG-------SYHELA-------------------------------------------------TFVSSVASL-----
Q2S9Q2_HAHCH/58-200KVQG-------GYHDLA-------------------------------------------------SFVSGVAGL-----
Q3SM92_THIDA/49-189KVTG-------GYHDVA-------------------------------------------------AFVSDVSKL-----
Q1N2I2_9GAMM/61-205DVVG-------EYHDFG-------------------------------------------------AFVSAVAGL-----
Q08Z00_STIAD/19-166TVSG-------NYHEIA-------------------------------------------------MFMQEIANM-----
Q0A4Z0_ALHEH/49-191RVIG-------TYEQLG-------------------------------------------------QFVSGVANM-----
A0Y8X2_9GAMM/58-199VVRG-------NYHDIA-------------------------------------------------TFVSGIASL-----
A0LFN6_SYNFM/50-195DLLG-------SFNDLE-------------------------------------------------VFLDNVSKL-----
Q1YS06_9GAMM/58-199DVTG-------DYHDFG-------------------------------------------------SFASGVASL-----
D7HR04_VIBCL/50-193ELTG-------SYHDIG-------------------------------------------------DFSQAIAKL-----
Q15Y40_PSEA6/54-194EVTG-------NYHAFG-------------------------------------------------KFVSDIAAL-----
Q1LI84_RALME/59-200KVTG-------RYHDVA-------------------------------------------------LFNADVAAL-----
B3E9T2_GEOLS/43-188TVSG-------SYFSVA-------------------------------------------------NFFAAVANL-----
Q306N4_MYXXD/43-190TVSG-------NYHEIA-------------------------------------------------LFLQEMANM-----
Q39X09_GEOMG/43-188SISG-------TFHSVA-------------------------------------------------NFFTAVGKL-----
Q8DCM4_VIBVU/47-190ELTG-------DYHDIG-------------------------------------------------EFSEAIARL-----
A0KN32_AERHH/49-192EVVG-------TYHEIG-------------------------------------------------KFTADMAAL-----
B9M3J0_GEOSF/43-188SVSG-------TFYQIG-------------------------------------------------SFFQAVSAL-----
Q1Q8Q5_PSYCK/75-221AALG-------DYHQFG-------------------------------------------------SFISGLAAL-----
Q74BL1_GEOSL/43-188SVSG-------SFYGVA-------------------------------------------------NFFTAVGNL-----
B5E8I1_GEOBB/43-188AVAG-------TYYQVA-------------------------------------------------DFFLSVGKL-----
Q489N7_COLP3/51-194EVIG-------PYHSFG-------------------------------------------------QFVSKIAGL-----
Q2BLX7_9GAMM/56-196SVIG-------SYHQLG-------------------------------------------------QFVSGIAAL-----
O05128_NEIGO/50-200SITG-------NYEQIS-------------------------------------------------QFTRDVGSL-----
Q21H80_SACD2/59-202EVLG-------GYHEFG-------------------------------------------------AFVSGVAGM-----
A5IFY3_LEGPC/49-198TIVG-------SYMQLA-------------------------------------------------RFLSRVAEM-----
Q1QZY6_CHRSD/58-200EVRG-------GYHEIA-------------------------------------------------AFLGSVAAL-----
Q5H3Q8_XANOR/51-201RMVG-------SYHQFG-------------------------------------------------AFVSGVASL-----
Q5E2F6_VIBF1/46-189ELTG-------QYHDIG-------------------------------------------------SFSEAMADL-----
Q6F7E1_ACIAD/73-220EATG-------DYHAFG-------------------------------------------------AFVSGIAAL-----
A1KBQ8_AZOSB/62-203IVTG-------GYHDLG-------------------------------------------------EFAADVARM-----
A1SRB3_PSYIN/46-187QVIG-------RYQDLG-------------------------------------------------NFAADIAAL-----
Q0VMB5_ALCBS/61-210QVIG-------DYHGFG-------------------------------------------------SFVSGVASL-----
Q7NZU0_CHRVO/47-188RLTG-------TYNDLA-------------------------------------------------AFVNDVAQL-----
A1SB17_SHEAM/51-192VVSG-------DYHQMG-------------------------------------------------SMVSGVAKL-----
Q2INP0_ANADE/50-195SVTG-------SFHEIA-------------------------------------------------TFFDALGRM-----
A0Z8J0_9GAMM/58-201VAVG-------SYHDLG-------------------------------------------------AFISGMAGL-----
Q1Z012_PHOPR/47-192QLTG-------NYEQIG-------------------------------------------------KFAASIAQL-----
A4BAN3_9GAMM/60-209SVRG-------SYHEMG-------------------------------------------------NFVSAMAAI-----
A4A8J9_9GAMM/58-201VASG-------SYHDLG-------------------------------------------------AFVSGMAGL-----
Q47JL0_DECAR/63-205KING-------GYHDFG-------------------------------------------------AFAADIAKL-----
Q5P5N9_AROAE/61-202RIVG-------AYHDLG-------------------------------------------------TFAEDVAGM-----
Q12SM2_SHEDO/51-192TVNG-------NYHEIG-------------------------------------------------DMVSAVAKL-----
A1WDV6_VEREI/65-209RVSG-------KYHDIG-------------------------------------------------AFAADIAHL-----
A8ZSX7_DESOH/54-197SITG-------PYHSIS-------------------------------------------------LFFEKIAEM-----
A6D0B8_9VIBR/44-187ELTG-------NYNDIG-------------------------------------------------HFSQAIAQL-----
A6FBL6_9GAMM/49-190EVIG-------TFHQLG-------------------------------------------------QFTSDIAAL-----
Q3A2N2_PELCD/43-188RLKG-------SFHEIA-------------------------------------------------MFSYHVGNM-----
Q1ZHK9_9GAMM/46-187EVEG-------NYQQLG-------------------------------------------------QFAADIAAL-----
Q4KJJ2_PSEF5/58-202TVTG-------AYHDLA-------------------------------------------------SFVSGVAGL-----
Q60BY6_METCA/48-198RVVG-------TYMEFG-------------------------------------------------AFVSGLASL-----

PF10741

A9BY16_DELAS/76-187TAEG-------PWPAVQ-------------------------------------------------MALASVRAI-----
A1WFQ5_VEREI/74-182RTEG-------ELMALQ-------------------------------------------------SALAVMSSQ-----
A1TUQ5_ACIAC/72-183RAEG-------DMLAVQ-------------------------------------------------SALAVLNSQ-----
Q5P6R2_AROAE/78-190TVDG-------SLEGLR-------------------------------------------------SLLAGFDRE-----
A0Z1M0_9GAMM/71-181VARG-------TLTQLD-------------------------------------------------QGLSELDQF-----
A4A5M0_9GAMM/74-184TTAG-------SLSALD-------------------------------------------------AALAGIAAY-----
Q87ZW3_PSESM/77-193TLNC-------AIEPLT-------------------------------------------------AILHALEYQ-----
B1J7E6_PSEPW/76-193TLAC-------AIEPLA-------------------------------------------------ALLHALEYG-----
Q1QQ81_NITHX/73-181SCDI-------EQTGLQ-------------------------------------------------QLLYDIEAG-----
A5EBI2_BRASB/75-183SCEL-------EQPALQ-------------------------------------------------QLLYDIEAG-----
Q89HH7_BRAJA/79-189SCEL-------EQPALQ-------------------------------------------------KLLYDLEAG-----
Q2VNU3_9BACT/73-185NCEV-------GQGALQ-------------------------------------------------QLLYDLESG-----
Q212Z0_RHOPB/75-181SFEI-------EPASLQ-------------------------------------------------RLLYNLEAG-----
A5EF22_BRASB/73-180NLEV-------AEVALQ-------------------------------------------------SVLYELEAG-----
A4YMS4_BRASO/72-179NFDA-------EQAALQ-------------------------------------------------PILYDLEAG-----
A7IH66_XANP2/71-186SLDI-------GEDALQ-------------------------------------------------KLLYDIEAG-----
Q5H4L2_XANOR/85-200RLRC-------GTPELA-------------------------------------------------SVLYSLENG-----
Q3RHI6_XYLFA/76-191RLRC-------GTPELA-------------------------------------------------LVLYSLESG-----
B4SJ91_STRM5/76-192RLRC-------GVAELA-------------------------------------------------TVLHSLETG-----
Q609V5_METCA/84-198RLNG-------STEVLR-------------------------------------------------QVLYEIESE-----
Q3JD24_NITOC/76-192RMTG-------DTEILQ-------------------------------------------------KVLYDLEAS-----
B0T7N6_CAUSK/73-179DATM-------TLTQFN-------------------------------------------------TCLRGIENE-----
Q8KZ83_GLUDI/87-194VVAA-------SYRNLV-------------------------------------------------RLIATLERS-----
Q0BR92_GRABC/89-202SVRG-------SWPAII-------------------------------------------------ALIAGLGEA-----
A5FWX4_ACICJ/79-187SMTA-------TYPALI-------------------------------------------------GFLDALGAA-----
Q82WG9_NITEU/68-173RINA-------PEEKLV-------------------------------------------------HLLKSLERH-----
Q9RW97_DEIRA/74-187SVNG-------RFPQLF-------------------------------------------------QILRSLELQ-----
Q07N82_RHOP5/69-181TIEG-------RIEAIQ-------------------------------------------------RVLFNLETS-----

PF03245

O80285_9CAUD/31-149GGMV-------DGESPR-------------------------------------------------..LTANAEL-----
A7MK05_CROS8/30-153ASLD-------DAASPG-------------------------------------------------..LTDSAER-----
Q9ZXB6_BPH19/29-154ARVD-------NATGPQ-------------------------------------------------..LADTVTR-----
Q7N318_PHOLL/26-149SRLD-------DAASPR-------------------------------------------------..LNPAAEQ-----
A1ACE3_ECOK1/29-154TSVD-------NATIPR-------------------------------------------------..LADTAER-----
Q56118_9CAUD/29-155ASVD-------NASRPR-------------------------------------------------..LADSAQR-----
Q1RCX8_ECOUT/33-157SGVD-------NAASPR-------------------------------------------------..LADTAER-----
Q2A0C4_9VIRU/30-151ASVD-------AATSAG-------------------------------------------------..LTDATRG-----
Q76H63_9CAUD/29-154SGMG-------NDATVE-------------------------------------------------..LSPVAGR-----
Q2A095_9VIRU/28-149ARLD-------DAARAR-------------------------------------------------..FDDAARR-----
Q1I6B5_PSEE4/33-166GGV.-------DHGAVR-------------------------------------------------ARLDPAHAR-----
Q9KXD2_BPVT2/29-154SGVD-------NATGPR-------------------------------------------------..LADTAER-----
A7MLQ7_CROS8/30-153TRVD-------DGASPR-------------------------------------------------..LTDAAER-----
Q48C47_PSE14/33-153TGLA-------DAGSAE-------------------------------------------------..LAADARS-----
A4WC46_ENT38/29-152TGLD-------DATSPR-------------------------------------------------..LTDSAER-----
A2P359_VIBCL/23-146GSVG-------DGEAPQ-------------------------------------------------..LNEAARE-----
B0KHE2_PSEPG/21-146AGLG-------.HAEAR-------------------------------------------------AELDPAAAE-----
Q1GXR8_METFK/50-191SAAG-------RDGGAR-------------------------------------------------AELSAEAAE-----
Q8X2A4_ECO57/29-154SGVG-------NDAAVE-------------------------------------------------..LSPVAGR-----
A4WB39_ENT38/29-154SGMG-------NDETIE-------------------------------------------------..LSDVAGR-----
Q7N0Y2_PHOLL/26-149GSVG-------HADTPR-------------------------------------------------..LNPATEQ-----
Q1VCK5_VIBAL/31-155RSMG-------NANTPR-------------------------------------------------..LGAAAEQ-----
B1JDA4_PSEPW/32-158GGV.-------DHASVR-------------------------------------------------ARLEPAHAA-----
A6UZ52_PSEA7/32-149AGLA-------AAGAAE-------------------------------------------------..LDRTARQ-----
A1JLU8_YERE8/29-147ASMD-------DATAPR-------------------------------------------------..LTDAAQR-----
Q7CID8_YERPE/26-151ASVP-------DDASAR-------------------------------------------------..LTNAAER-----
A8CGF5_BPP22/29-144SGMG-------DGESPR-------------------------------------------------..LTADAEL-----
Q8XYQ5_RALSO/38-173AGLG-------DGGAAT-------------------------------------------------AILYGEDAA-----
Q2NV02_SODGM/25-149ARMD-------DAAGAR-------------------------------------------------..LADAAQR-----
Q6HAE1_9ENTR/26-151RSLG-------YDGPFE-------------------------------------------------..LSADTGQ-----

PF05137

D4BI19_9ENTR/97-171TGNAL......NFAALK-------------------------------------------------TLETQLR.Q.....
C7R7X0_KANKD/100-176TGQAE......TNPRIS-------------------------------------------------EFMRKMD.A.....
C7QTE2_CYAP0/114-206SGFAV......DYDDLN-------------------------------------------------DFLLLLQ.G.....
C6BWY3_DESAD/355-431QGEAK......SEISLM-------------------------------------------------ALLENIS.S.....
D3SD46_THISK/100-177TGRAE......SNTRIS-------------------------------------------------TLMRRID.G.....
C8X4Y9_DESRD/100-179RGVAL......DNQAFA-------------------------------------------------QYVQQLR.E.....
D0L237_HALNC/100-184QGYAD......AQARVA-------------------------------------------------DYLRQLN.G.....
D0WBB7_NEILA/103-177NGRTS......SDNRVA-------------------------------------------------AMMRAMP.N.....
D2ZYQ1_NEIMU/103-177TGRAI......SDNKIA-------------------------------------------------MFMRSLP.S.....
D2Z429_9BACT/103-180NGFSY......NENDVV-------------------------------------------------LFATGLI.D.....
B2FNI0_STRMK/286-360IGLS.........REAS-------------------------------------------------QLVQLLQ.D.....
B1EI39_9ESCH/97-171KGLTT......SISALN-------------------------------------------------ALETALR.Q.....
C1DHR0_AZOVD/100-178EGAAE......SNNRVS-------------------------------------------------NLMRNLD.G.....
Q1N2I1_9GAMM/100-174DGRAS......SNDEIS-------------------------------------------------QLMRNFD.E.....
Q7NZT9_CHRVO/100-177TGYAQ......SGARVS-------------------------------------------------SYMRLLG.Q.....
A8T9N5_9VIBR/101-179SGIAD......STARLT-------------------------------------------------TMIDNME.R.....
B3R7C3_CUPTR/105-187AGVAQ......SNERIS-------------------------------------------------ELLRNLG.S.....
Q74C93_GEOSL/96-176SGAAR......SFGALR-------------------------------------------------SLMENLE.S.....
B9TC62_RICCO/24-102KGVAD......TNARIA-------------------------------------------------TLVHNLG.S.....
A8GZ25_SHEPA/100-177EGRSE......SNNNVA-------------------------------------------------NMMRKIE.A.....
Q74BL0_GEOSL/100-177GGVAV......DEDLIA-------------------------------------------------AFMRNLQ.Q.....
Q061N8_9SYNE/111-200RGVAAQ...PNGLRSVN-------------------------------------------------ALMLSLA.Q.....
A4G9P6_HERAR/100-182NGYAQ......SNERVS-------------------------------------------------ELLRNLGNH.....
Q1IRM8_KORVE/109-189TGTAL......SNNAVA-------------------------------------------------NLMANLK.K.....
C4K8E6_HAMD5/100-172DGISH......DYNSIA-------------------------------------------------LFIEGLS.Q.....
A0YSX4_LYNSP/116-236TGIAN......SFTQLS-------------------------------------------------DFMLLLK.Q.....
Q21H79_SACD2/100-177DGVSE......SNSRVS-------------------------------------------------AFMRKLN.A.....
D6SKS7_9DELT/355-426QGEA.........DSAT-------------------------------------------------AVLEAME.D.....
Q1Q6D7_9BACT/347-419EGDAV.........SST-------------------------------------------------HLIPILE.N.....
A5EF21_BRASB/284-357AGTS.........QDAA-------------------------------------------------ALVRLIE.Q.....
B4UDC4_ANASK/100-177TGIAA......SIDEVS-------------------------------------------------ELMTALK.G.....
F2G6J6_ALTMD/100-177EGVSD......SNNRLS-------------------------------------------------DFMRALE.N.....
Q5P5N8_AROAE/100-177FGYAQ......SNSRVS-------------------------------------------------HLMRNLD.G.....
A5GEZ6_GEOUR/100-177SGIAF......SEDLIA-------------------------------------------------EFMRNLQ.A.....
A1ARQ3_PELPD/96-177EGRAR......NFGQVR-------------------------------------------------SYLERLE.D.....
B5JTT5_9GAMM/102-177NGYAE......SNARVS-------------------------------------------------AYMRNLD.E.....
Q1PJI8_PROMR/111-194KAKVSN...EKYLGALN-------------------------------------------------SFLLNLD.N.....
B2Q5V2_PROST/100-173AAVSY......DFHDIS-------------------------------------------------QLITRLE.S.....
Q0BZ78_HYPNA/235-307TGLSD.........NAA-------------------------------------------------AVLTAL........
Q87L63_VIBPA/101-179SGISD......STPRLA-------------------------------------------------TMLDNME.R.....
B4VRN9_9CYAN/118-234SGLAR......SFDDVN-------------------------------------------------NFLLTLQ.Q.....
B8D2D6_HALOH/94-167IGIAR......DEKELM-------------------------------------------------VFVNNLK.K.....
Q4FQH8_PSYA2/100-200TGLAD......NPNVVS-------------------------------------------------SLIRNLD.N.....
P74187_SYNY3/116-221SGFAG......NYGSLN-------------------------------------------------DFLLTLQ.S.....
Q3IJC1_PSEHT/100-177LGKSE......SNNRLS-------------------------------------------------TLLREVQ.G.....
A5WCG1_PSYWF/77-165TGKAS......TAQQVT-------------------------------------------------DLMAALE.R.....
A5KTK0_9BACT/97-178SAAAK......NYTRAL-------------------------------------------------ELKSSLE.K.....
Q6LVG0_PHOPR/101-179NGVGD......SNGRLA-------------------------------------------------SLLSNAE.R.....
Q2JVP2_SYNJA/119-199QGGAL......DFPLVN-------------------------------------------------DFLLTLL.D.....
C5BRK2_TERTT/100-177EGVSE......SNNRVS-------------------------------------------------TFMRQLD.E.....
Q31KD7_SYNE7/115-203QGSSS......NYDSVN-------------------------------------------------DLLLTLQ.Q.....
Q05VH9_9SYNE/427-512SGAVQGGGRPGPLERIN-------------------------------------------------ALVLALG.K.....
Q212Y9_RHOPB/275-348VGIT.........RNAP-------------------------------------------------SLIQILE.Q.....
A0Z1L9_9GAMM/260-333RGRGT.........DAA-------------------------------------------------SLQQAMT.K.....
Q8YY23_NOSS1/115-220TGLAR......SFNDVN-------------------------------------------------DFLLLLQ.Q.....
A3CR63_STRSV/106-183NGSSQ......EHLSIA-------------------------------------------------KFEEELR.K.....
A3LJ85_PSEAI/100-178AGAAE......SNNRVS-------------------------------------------------NLMRNMD.A.....
Q7NA52_PHOLL/101-175VANSL......DYSSMT-------------------------------------------------SLLDNLE.N.....
B4A5T7_SALNE/97-171EGLAR......TFDALL-------------------------------------------------TLETSLR.H.....
Q21T59_RHOFD/119-218TGFTL......EPAALN-------------------------------------------------DWVGKLA.A.....
Q7MH79_VIBVY/111-189AGISD......STARLA-------------------------------------------------TMLDNLE.R.....
B6SE77_9NEIS/102-181TGKAI......SDNKVA-------------------------------------------------VLMTALP.S.....
B5EI36_GEOBB/95-175AGVAY......GFSNLR-------------------------------------------------TLLENME.Q.....
A4YMS3_BRASO/280-353AGVT.........QDAP-------------------------------------------------ALVRLIE.Q.....
A8MGF2_ALKOO/105-178TGLAK......DKLSIA-------------------------------------------------KFQSGLM.A.....
B2TQM7_CLOBB/105-181QGISS......SRDAVG-------------------------------------------------EFQHNLK.E.....
Q988B3_RHILO/273-346SGFS.........TSAA-------------------------------------------------ELIQPID.A.....
Q82SK2_NITEU/100-177AGYAQ......SNAWVS-------------------------------------------------TLMRNLD.A.....
Q2S9Q1_HAHCH/100-176KGVGE......SNSRIS-------------------------------------------------SLMRRLD.E.....
C0N3G0_9GAMM/100-177DGVAQ......SNARVS-------------------------------------------------VFMSQVD.N.....
B8E235_DICTD/101-179EGFAL......NYKEIA-------------------------------------------------IFLDQLD.K.....
Q7NHV0_GLOVI/113-196EGFAL......RFEDVA-------------------------------------------------ALQLTLR.D.....
A3JEF9_9ALTE/100-177VGMAE......SNSRIS-------------------------------------------------SLMRQFE.D.....
A7H854_ANADF/100-177DGTAS......TIDDVS-------------------------------------------------ELMTALG.G.....
Q8RAF0_THETN/99-173EGEAL......HEGDVA-------------------------------------------------VFMLNLR.S.....
A0ZCZ0_NODSP/113-219TGIAS......SFNDVN-------------------------------------------------DFVLTLQ.Q.....
Q1K2X1_DESAC/100-177KGVGL......SEDDVA-------------------------------------------------DFMTNLD.A.....
B2FSH6_STRMK/100-187EGRTQ......SNARVS-------------------------------------------------AYMRNLE.T.....
B6EM38_ALISL/101-179KGFSD......SNARLA-------------------------------------------------TMLDKLE.R.....
A7IH65_XANP2/278-351TGVS.........REAA-------------------------------------------------ALIRLLE.Q.....
Q3KJA6_PSEPF/100-178SGAAE......SNNRVS-------------------------------------------------DLMRNLD.A.....
B7DM24_9BACL/96-194AGRTN......SVASVA-------------------------------------------------AFEAAVS.R.....
Q2P6L7_XANOM/100-189EGRSQ......SNARVS-------------------------------------------------AYMRKLE.S.....
B0C6K6_ACAM1/111-215TGNAI......SFNDVN-------------------------------------------------DFVLTLR.K.....
B7S0Z0_9GAMM/110-187NGIAE......SNNRVS-------------------------------------------------SLMRRLD.G.....
B1BAN5_CLOBO/105-183QGTSQ......TRVGVG-------------------------------------------------EFEHNLK.E.....
C1I9R3_9CLOT/106-178QAVST......SRVAVG-------------------------------------------------EIEHNLK.R.....
B1Y308_LEPCP/100-183SGIAQ......TNERVS-------------------------------------------------EFLRNTAYN.....
A1SRB2_PSYIN/100-177RGMSE......SNNRLA-------------------------------------------------EMTRNID.N.....
Q4KJJ3_PSEF5/100-178SGAAE......SNNRVS-------------------------------------------------DLMRNLQ.A.....
B8KUT7_9GAMM/100-177QGVAE......SNNRVS-------------------------------------------------SLMRRLD.A.....
A1HQ13_9FIRM/97-173KGMAA......AYPDLA-------------------------------------------------AYVKKLE.Q.....
B9YYQ5_9NEIS/100-177SGYAL......SGARVS-------------------------------------------------NYMRTLA.Q.....
B9M3J1_GEOSF/100-177SGAAF......SEDDIA-------------------------------------------------ALMKNLQ.A.....
B5FBN6_VIBFM/101-179KGFSD......SNSRLA-------------------------------------------------SMLDKLE.R.....
C0QK71_DESAH/391-463EGTAR.........SAS-------------------------------------------------EMISLLE.A.....
B7KDY8_CYAP7/115-226NGYAK......TFDDVN-------------------------------------------------KFVLTLQ.R.....
B8KB93_VIBPA/101-179SGISD......TTSRLA-------------------------------------------------TMLDNLE.S.....
Q8RHE9_FUSNN/314-386EGSTG......KIDNVV-------------------------------------------------KFLENIT.N.....
A3Z3C8_9SYNE/419-506SGEAQASLDPGPLERIN-------------------------------------------------ALVLALA.A.....
F2G3R3_ALTMD/118-196SGQTI......APSSIP-------------------------------------------------QWLKKLQ.Q.....
B3E9T1_GEOLS/100-177SGLAY......NEELIA-------------------------------------------------QFIRALE.A.....
B5E8I0_GEOBB/100-177AGVAM......SEELIA-------------------------------------------------VFMKSLQ.A.....
B8ESJ7_METSB/292-365VGVA.........RDAT-------------------------------------------------GLIRLIE.Q.....
A9BY15_DELAS/240-313QGLS.........SNAS-------------------------------------------------NVVQLMS.K.....
B1Y072_LEPCP/116-203QGRMA......DAAALP-------------------------------------------------AYLRRLQ.N.....
B2J1B9_NOSP7/115-223TGFAR......SFNDVN-------------------------------------------------DFLLSLQ.Q.....
C4ZLJ2_THASP/100-177VGLAQ......SNARVS-------------------------------------------------HFMRNVE.A.....
A0KN33_AERHH/100-177NGKTE......AYGRVA-------------------------------------------------SMMRRID.G.....
A1AMQ0_PELPD/100-177SGFAL......NEDLIA-------------------------------------------------AFMRNIE.S.....
C4GJE0_9NEIS/102-182VGKAI......SDNKVA-------------------------------------------------MFMTALP.S.....
Q0A4Z1_ALHEH/100-180QGRSR......SPQEVS-------------------------------------------------VFLQNID.N.....
C4Z597_EUBE2/445-523SGKAG......SKASVA-------------------------------------------------LLIQQLQ.K.....
A6FBL5_9GAMM/100-175NGTSD......SNTRLA-------------------------------------------------VLLRNIE.E.....
Q12FF4_POLSJ/100-183IGVAQ......SNERVS-------------------------------------------------ELLRNLANN.....
A1JSD8_YERE8/100-174EAVSQ......DYAAIH-------------------------------------------------DFLARLG.R.....
Q5ZX05_LEGPH/100-178WGYSE......SNTSIS-------------------------------------------------ILMRNIE.A.....
Q0AIN5_NITEC/95-174SGEAR......NLAGLV-------------------------------------------------EYVQALE.Q.....
A5FWX5_ACICJ/271-344DGES.........PNAA-------------------------------------------------GLVARLA.A.....
B0JRP4_MICAN/116-221SGFAS......SYEAVN-------------------------------------------------DYLLTLQ.A.....
B9MDE7_ACIET/100-183QGMAQ......SNERVS-------------------------------------------------EMLRNLANN.....
Q1NNC6_9DELT/33-111AGIGL......DNPTVA-------------------------------------------------QYMRNLE.G.....
C0DV41_EIKCO/103-177SGKAT......SDSKIA-------------------------------------------------DFMRVIP.S.....
C3JZE1_PSEFS/252-326SGQS.........AKAS-------------------------------------------------ALITRIK.G.....
Q609V6_METCA/282-355QGQS.........PSAS-------------------------------------------------SLIARME.T.....
C3MFK9_RHISN/275-348SGFS.........KASS-------------------------------------------------ELIPLIE.G.....
B5ZIQ8_GLUDA/257-330SGQSA.........TAT-------------------------------------------------GLIETLS.K.....
A6TTT3_ALKMQ/105-178QGNAY......LKLDIA-------------------------------------------------QMEHNLR.Y.....
Q1YS07_9GAMM/100-177SGYSE......SNNRIS-------------------------------------------------ALMRNLD.M.....
B0U6Y4_XYLFM/289-362MGMS.........NDAS-------------------------------------------------SLVRLLE.G.....
C4LB15_TOLAT/100-177VGKAE......AYNRVA-------------------------------------------------STMRLID.G.....
Q1IGB1_PSEE4/101-174TGMAA......SASVVA-------------------------------------------------LLLRRME.Q.....
B5YJ53_THEYD/106-182EGIGF......SNLNVV-------------------------------------------------AFVDNLK.A.....
Q6MPI9_BDEBA/121-198QGLAL......SDFEVS-------------------------------------------------QFLEALT.K.....
A8AQU9_CITK8/73-147EGYAT......TFLALN-------------------------------------------------TLETALR.R.....
C0QLC6_DESAH/100-179KGIAY......DNKTVA-------------------------------------------------DFMTRIE.A.....
B1XPF2_SYNP2/120-215RGNAR......TFNEVN-------------------------------------------------DFVLNLP.E.....
Q0EXA3_9PROT/100-177TGQAE......SNKAVA-------------------------------------------------IFMRKLD.Q.....
Q3JD25_NITOC/289-364RGEAA.........EAS-------------------------------------------------ALIALLE.V.....
Q1QZY7_CHRSD/101-177SGVAR......ANRRVS-------------------------------------------------DQLRQLA.S.....
A3RW17_RALSL/108-190SGVAQ......SNERVS-------------------------------------------------DLLRNLG.T.....
Q08YZ9_STIAD/84-208VGSAV......SHDEVA-------------------------------------------------EFMRSLG.GMVWTP
Q6AS37_DESPS/100-178SGIAL......DNRTIS-------------------------------------------------DFMNTLK.S.....
A0Z8I9_9GAMM/100-177EGVAE......SNNRVS-------------------------------------------------SLMRRLE.A.....
Q1ZHK8_9GAMM/100-177QGESE......SYNHVS-------------------------------------------------NMLRKIE.A.....
B6BVV6_9PROT/465-539FGNSL......NVMSVN-------------------------------------------------NFYNTFM.Q.....
B9JMG5_AGRRK/265-338TGFS.........NSAA-------------------------------------------------DLIAILG.A.....
Q21UC2_RHOFD/100-183QGVAQ......SNERVS-------------------------------------------------ELLRNLGNN.....
Q3SM93_THIDA/100-177DGYTQ......SSARVS-------------------------------------------------TLMRNLD.D.....
B7WVX0_COMTE/100-183QGTAQ......SNERIS-------------------------------------------------EMLRNLTDG.....
C4IH38_CLOBU/105-181QGTAS......NRTSIA-------------------------------------------------ELEHNLK.Q.....
C0EQU7_NEIFL/103-177SGHAV......SDNKIA-------------------------------------------------VMMRSLP.S.....
A2SKH6_METPP/100-183NGIAQ......TNERVS-------------------------------------------------EFLRNTAYN.....
B6J4A1_COXB1/85-157TGLSN......GANVVW-------------------------------------------------NFIQKIK.K.....
A3YUA5_9SYNE/109-199KGRTAD...PGAFERIN-------------------------------------------------AMVLRLK.T.....
B3PI74_CELJU/100-177EGVAE......SYNRVA-------------------------------------------------SFMRNLD.A.....
B5YEE0_DICT6/384-462EGYSL......DTEGVA-------------------------------------------------DFLLALS.Q.....
B5XTU2_KLEP3/97-171NGLAL......NLQALA-------------------------------------------------GLERILT.N.....
Q3R4G6_XYLFA/100-184QGRSQ......SNVRVS-------------------------------------------------TYMRNIE.G.....
A2PCR9_VIBCL/103-181TGISD......STARLA-------------------------------------------------TMLDNLE.K.....
A1WFQ6_VEREI/278-351TGQT.........GNAA-------------------------------------------------ALMQLLS.A.....
Q489N8_COLP3/100-177TGKSE......SNNHLA-------------------------------------------------NMIRAVE.L.....
A4BAN2_9GAMM/100-178SARAD......KALTIS-------------------------------------------------DFLRNID.R.....
A5EBI1_BRASB/276-349SGMT.........QDAP-------------------------------------------------ALIRLIE.Q.....
A0Y8X3_9GAMM/100-177QGIAE......SNQRVS-------------------------------------------------SLMRKVD.K.....
Q306N5_MYXXD/101-221DGSAV......SHDEVA-------------------------------------------------EFMRGLN.GVVWTP
Q60BY7_METCA/110-193NGFAQ......SNARVS-------------------------------------------------AYMRNLE.G.....
A9BA85_PROM4/113-200EGLAVE...DKGVEAIN-------------------------------------------------RFVIKLA.S.....
Q2VNU4_9BACT/249-322VGVT.........RDAP-------------------------------------------------SLIRLIE.Q.....
Q2BLX6_9GAMM/100-174TGMAA......DKLDVS-------------------------------------------------TLMRNLD.Q.....
Q07N81_RHOP5/265-338SGIS.........TRAP-------------------------------------------------ELVATLE.R.....
A0LPH8_SYNFM/376-449RGES.........KSAI-------------------------------------------------KYLSELS.K.....
Q89HH6_BRAJA/288-361GGIT.........RDAP-------------------------------------------------SLIPLIE.Q.....
Q2C0P4_9GAMM/101-179KGVGD......SNGHLA-------------------------------------------------ALLGGAE.Q.....
C5CQG6_VARPS/100-183QGMAQ......SNERVS-------------------------------------------------ELLRNLGNN.....
B2A7F7_NATTJ/100-174SGYAN......TVFDVM-------------------------------------------------VFLQELE.T.....
Q47JL1_DECAR/100-177TGNAQ......SNARIS-------------------------------------------------ALMRNLE.A.....
C3KAI0_PSEFS/101-176SGSAE......SSQDIA-------------------------------------------------QLMRRLE.A.....
Q2P7E4_XANOM/286-359IGLS.........NEAS-------------------------------------------------SLVRRLE.G.....
A4BQU5_9GAMM/101-178TGVAE......SNARVS-------------------------------------------------NYMENLD.G.....
B7IAW1_ACIB5/100-189EGKAE......SPNTVA-------------------------------------------------ELLRNLE.A.....
Q2LWS9_SYNAS/100-178EGVAR......TNMVLS-------------------------------------------------RFMRNLE.A.....
A8GKR2_SERP5/100-174RGLGR......RYEAVL-------------------------------------------------QFEQQLT.A.....
A4A8K0_9GAMM/100-177NGVAE......SNNRVS-------------------------------------------------SLMRRLD.A.....
A1WDV7_VEREI/100-186QGVTY......SNEQVS-------------------------------------------------ELLRNLADN.....
A5GFB1_GEOUR/96-176SGAAT......NFNNVR-------------------------------------------------QFVENLE.S.....
A4CEN2_9GAMM/100-177VGKSE......SNNRLS-------------------------------------------------SMLRQLE.G.....
B5EP45_ACIF5/100-177DGYSQ......ANDQVA-------------------------------------------------AFMRNIE.A.....
Q2RI86_MOOTA/98-173TGGST......SLGAVG-------------------------------------------------DFLNNLQ.G.....
Q1GYG2_METFK/100-177EGVAD......TNARVA-------------------------------------------------TLVRNLS.G.....
Q3A2N1_PELCD/100-177KGVGV......SEKSVA-------------------------------------------------GFITALE.S.....
B9M0Z2_GEOSF/96-176TGYGK......TFTDLR-------------------------------------------------RFFEVLS.S.....
Q1QQ80_NITHX/271-344VGLT.........RNAP-------------------------------------------------SLIRLLE.Q.....
A0LFN5_SYNFM/100-180DGTAM......SNEALV-------------------------------------------------EFMRNLE.S.....
Q88CU8_PSEPK/100-173TGLAA......SGAVVA-------------------------------------------------QFMRDLN.R.....
B0K9C0_THEP3/99-173DGQAL......SESDIA-------------------------------------------------AFMLNLR.S.....
B1J2J1_PSEPW/100-173AGLAA......SSAVIA-------------------------------------------------QLMRDLG.R.....
A4WFI2_ENT38/96-170KGYAT......TLLSLQ-------------------------------------------------KLTDSLK.H.....
Q15Y39_PSEA6/100-177NGVSD......SNNRLA-------------------------------------------------NFMRNVS.D.....
A1KBQ9_AZOSB/100-177VGYAQ......SNARVS-------------------------------------------------ALMRNLE.E.....
B2IBE2_BEII9/274-346SGVS.........RHVS-------------------------------------------------ELVPLLE.G.....
A1TUQ6_ACIAC/264-337VGMT.........ANAS-------------------------------------------------TLMQLLG.N.....
A6M144_CLOB8/105-181KGVST......SRSAVA-------------------------------------------------ELKHNLS.S.....
A3ISW4_9CHRO/116-208GGYAM......GYDDLN-------------------------------------------------DFVLTLQ.S.....
A8ZSX8_DESOH/100-178SGIAM......DNKTVA-------------------------------------------------TFMTRIE.E.....
Q5QWC4_IDILO/117-193HGQAL......NSEALV-------------------------------------------------LWMDKFG.Q.....
B0A4I7_YERPE/100-174EVISR......DYATIN-------------------------------------------------AFLAMLG.R.....
Q39UI3_GEOMG/96-176AGTAK......EFRNLR-------------------------------------------------TFVENLE.G.....
B7LS95_ESCF3/97-171SGLAA......NIASLT-------------------------------------------------ALEQMLR.S.....
B4WYC6_9GAMM/101-177DGVAE......SNNRIS-------------------------------------------------RLMRNLG.D.....
Q8DGH5_THEEB/111-198EGTAT......SFDAVN-------------------------------------------------DFILLLQNR.....
B6C334_9GAMM/100-177NGVAT......SNARVS-------------------------------------------------VLMRNLD.A.....
B8FQ80_DESHD/405-487QGLAT......ESLEVQ-------------------------------------------------RMFQQLK.......
A6D0B9_9VIBR/100-178FGISE......NTALLA-------------------------------------------------EMLERFE.Q.....

PF04612

C6BGG9_RALP1/26-185QLDKV------PFGAVA-------------------------------------------------EWLQEVR-Q-----
A3UEX1_9RHOB/7-165WMEQA------DADSLM-------------------------------------------------GWLSLLS-R-----
Q0K5X1_CUPNH/40-199QLDKV------PFGAVS-------------------------------------------------GWLQDVR-Q-----
GSPM_PECCC/1-161TLGQS------DFNSLL-------------------------------------------------RWLGELE-Q-----
Q1IB25_PSEE4/11-155AWRQA------PAEPAM-------------------------------------------------AWLQRIP-P-----
Q21EQ3_SACD2/4-161RLDEV------SFNSLL-------------------------------------------------AWLNEME-V-----
Q31WM9_SHIBS/22-178WIDPV------VFNDLL-------------------------------------------------NWLNALD-E-----
A1WZN8_HALHL/10-173WMDRV------PFDELM-------------------------------------------------NWLDGLQ-R-----
Q7MPY7_VIBVY/5-163WVAPM------PFNRLV-------------------------------------------------DWLTFLK-E-----
Q1ZIZ1_9GAMM/2-159WIADV------EFNNTM-------------------------------------------------DWLTLLK-N-----
A6VAT2_PSEA7/20-183DFASA------SGEALL-------------------------------------------------RWLARSP-T-----
B1YQ40_BURA4/7-166QLKNV------PFPVWT-------------------------------------------------QWLDDAR-R-----
Q7BSV4_ECO57/1-160TLAPV------EFNALM-------------------------------------------------QWLTQLE-R-----
Q3KBE0_PSEPF/17-170TFDAA------PADAVL-------------------------------------------------DWLLSQP-R-----
Q0I0D9_SHESR/1-158WMDDV------PFDALL-------------------------------------------------NYLSDLV-Q-----
A3WP21_9GAMM/17-175SVDET------SYQQAM-------------------------------------------------SWLYALE-Q-----
A8AIM9_CITK8/5-159VVEQV------NIYELK-------------------------------------------------NWLREVN-V-----
Q1LHW4_RALME/25-184QLDKV------PFGSVA-------------------------------------------------GWLQDVR-L-----
Q5QY94_IDILO/12-171SVDEV------AFSDLL-------------------------------------------------SFLAELE-Q-----
Q9ABP4_CAUCR/5-157WIAAI------DSKILL-------------------------------------------------PWTAGLE-R-----
A4VFT9_PSEU5/13-169SLPGA------SYALLL-------------------------------------------------RWFDTLQ-.-----
Q8FCY8_ECOL6/7-160NPVTA------PLENVS-------------------------------------------------RWLTTAQ-I-----
Q1ZL56_PHOAS/1-160WVKPV------PFNALL-------------------------------------------------NWLSYLQ-D-----
A1SR65_PSYIN/2-159QVSNV------EFDRFI-------------------------------------------------NWVSVLS-S-----
GSPM_VIBCH/5-164WIQPL------PFSQLV-------------------------------------------------SWIAYLQ-E-----
Q02HH6_PSEAB/22-191DFASV------SGEALL-------------------------------------------------RWLARSP-A-----
A0YBF1_9GAMM/11-168WLENE------SFNNVI-------------------------------------------------LWLERLD-K-----
Q87TC8_VIBPA/6-164WIKPL------AFNQLV-------------------------------------------------DWLRYLK-E-----
GSPM_AERHY/2-162WIDTV------QFDDLL-------------------------------------------------IWLASLA-D-----
A6T4U0_KLEP7/1-158TLQHC------AFQALI-------------------------------------------------DWLDAPA-.-----
A6EW52_9ALTE/11-176WLEGA------PFTEVA-------------------------------------------------SWLERLN-T-----
A3MPL1_BURM7/14-173QLKNA------SFPAWT-------------------------------------------------QWLDDVR-R-----
Q9ZFW8_PSEAC/14-170SLQPV------EFARLL-------------------------------------------------QWLVSLQ-.-----
Q0A613_ALHEH/2-163WLERA------DFDQML-------------------------------------------------YWLDALA-.-----
Q0ASQ4_MARMM/5-163NIDRA------ETAAIL-------------------------------------------------AWLVDLD-R-----
A1JQE2_YERE8/1-159APLTL------PFSQLL-------------------------------------------------SWLEQLE-A-----
Q31J18_THICR/7-166EFKEV------NAPRLF-------------------------------------------------RWLSQQE-.-----
A6V156_PSEA7/5-149ALEG.------QLADLL-------------------------------------------------GWFESLG-.-----
A3SDU2_9RHOB/1-150TLDDT------PFATIL-------------------------------------------------LWLSDLE-E-----
A3YCB4_9GAMM/14-171WVENT------SYSDIN-------------------------------------------------KWMTILA-.-----
Q1YQU6_9GAMM/7-161SLESI------NANRLL-------------------------------------------------QFAHQLA-.-----
Q1N4H7_9GAMM/22-176WLDKA------EFDAVI-------------------------------------------------DWIEILE-A-----
A1U0C6_MARAV/11-176WLENA------AYADVA-------------------------------------------------AWLERLH-S-----
Q02PQ8_PSEAB/17-174ALQPA------PFAKLL-------------------------------------------------PWLEQLN-.-----
A2SKJ8_METPP/13-167TLSGV------PGEALA-------------------------------------------------AWLGEVR-S-----
Q1NDR5_9SPHN/1-158AIASV------RPIALF-------------------------------------------------SWLSTLE-.-----
F2GBM0_ALTMD/1-159WVDQA------PFNAVL-------------------------------------------------DWLKAME-.-----
A6D4H3_9VIBR/5-163WIKPI------PFEFFV-------------------------------------------------NWLFYLQ-E-----
Q4KD21_PSEF5/17-183TFEQA------PADAVV-------------------------------------------------GWLLGAP-R-----
Q5E1Y6_VIBF1/1-161WVKPL------PFNSLV-------------------------------------------------NWLAFLR-D-----
B2T7P8_BURPP/6-165QLKNA------SFPAWT-------------------------------------------------AWVDDVR-K-----
Q8PPI2_XANAC/5-157QIEAV------SAAALF-------------------------------------------------GWLERLR-Q-----
A4BDW7_9GAMM/6-161WLDDA------RYPSVV-------------------------------------------------QWLGGLE-.-----
Q8P5C5_XANCP/5-144QIDAV------NSPALF-------------------------------------------------AWLERLR-T-----
A1S1Y3_SHEAM/1-158WMDDV------PFDALL-------------------------------------------------GYLGDLV-Q-----
GSPM_KLEPN/1-158TVQPA------DFQALM-------------------------------------------------AWLDALG-.-----
A5V9H7_SPHWW/17-167TVADA------PYESLL-------------------------------------------------RWIAEVE-Q-----
GSPM_ERWCH/1-160TLARS------DFNNLL-------------------------------------------------HWLAELE-Q-----
Q2Y7T4_NITMU/2-161TFKAV------PFADWL-------------------------------------------------KWTVAMQ-.-----
A4XWF6_PSEMY/17-173SLQPA------AFAQLL-------------------------------------------------RWIELLE-.-----
A1W3T9_ACISJ/17-159TFKGA------PAEALA-------------------------------------------------QWLNQAR-S-----
A3UP97_VIBSP/5-162WIKPV------PFNKFV-------------------------------------------------DWLTYLK-E-----
Q15ZB6_PSEA6/1-159WVDQA------PFNGVL-------------------------------------------------DWLKSLE-.-----

PF12693

Q8DDT8_VIBVU/244-403QAKSN------DFQIFE......-------------------------------------------QARVKLS-------
Q8P5C4_XANCP/217-355TLVHD------DDAQLQ......-------------------------------------------QLLARLR-------
Q8PPI3_XANAC/214-362TLLHT------DDASLQ......-------------------------------------------QLSARLA-------
Q9ABP5_CAUCR/216-368TIVYN------NYSDMD......-------------------------------------------QLRLGAK-------
Q8CZX5_YERPE/243-396DIEGD------DDLINE......-------------------------------------------MLNDKTN-------
GSPL_ERWCH/242-399SLRAT------SYAQME......-------------------------------------------QFRQQAQ-------
GSPL_PECCC/268-425ALQGT------SYQELE......-------------------------------------------QFQQQAA-------
Q9ZGT8_ECO57/266-425DLQAA------SFQALE......-------------------------------------------HFQQIAG-------
GSPL_KLEPN/240-398EISAV------SSQALE......-------------------------------------------QFSQRAR-------
Q88P00_PSEPK/218-362EGEGS------APPWPD......-------------------------------------------MAAAAGA-------
O86440_PSEPU/213-361EGEGA------APPWGE......-------------------------------------------MASAVGA-------
Q87TC9_VIBPA/245-404HARSS------DFQPFE......-------------------------------------------QARVKLA-------
GSPL_VIBCH/249-407EATSR------DFQSFE......-------------------------------------------QARTQLE-------
Q8EKC1_SHEON/239-395QVTAK------NYAQIE......-------------------------------------------KFKEIVG-------
GSPL_AERHY/243-389QVTAP------GFAEIE......-------------------------------------------RFRELAG-------
GSPL_PSEAE/226-382QVRAP------GFDVLE......-------------------------------------------RLRSRLS-------
Q9ZFW9_PSEAC/223-381NLRAS------DFAALE......-------------------------------------------SLRARLQ-------
Q8VPC1_ECOLX/234-392QLRAA------NFASFD......-------------------------------------------KLRSALA-------
GSPL_ECOLI/237-387KMSAK------SEANID......-------------------------------------------RFCELTQ-------
Q8XUS4_RALSO/317-476....K------EGTDTN......-------------------------------------------MLRTAAA-------
Q9ZF77_BURPE/291-444ETKVD------P...........-------------------------------------------DFAQRLA-------
Q9I5P2_PSEAE/207-381GLPGG------DAAAWQGELGKH-------------------------------------------GLQADAS-------
Q8GBD8_YEREN/245-399NLAEP------ELLA........-------------------------------------------RIPRQNA-------

PF10721

A8A0B0_ECOHS/1-160AAAVRGKTTKAAEGMLT-------------------------------------------------NMLGDIAAE-----
A5W5S5_PSEP1/4-164AAIARGETATRAAMVLS-------------------------------------------------DLLSRSVET-----
Q858E9_BPE15/10-160AIVGAGSSAADTGVLLA-------------------------------------------------DVLSKSLER-----
B1J5E9_PSEPW/4-165AAVTRGQAATRAAMVLS-------------------------------------------------ELLERSVDT-----
Q8Z7W1_SALTI/12-170AAAVRSKTAGADATVLA-------------------------------------------------DMFGSLAEE-----
Q57Q93_SALCH/12-178AAASQAK..AETGILLA-------------------------------------------------QLLGEADDL-----
Q46YK2_CUPPJ/9-168AGGGQDKPGGDPLDVLV-------------------------------------------------DVLGRSDRT-----
Q4KA36_PSEF5/4-166CTAAASQAAARTALVLA-------------------------------------------------DLFKRADQR-----
A9ABH5_BURM1/1-157ATSAGSPAAADALDLLA-------------------------------------------------DVLGRADQR-----
Q87Y73_PSESM/9-169GIADRGKNAARAAMVLS-------------------------------------------------DLLSRADSR-----
Q48J34_PSE14/4-169GATERGKAATRAAMVLS-------------------------------------------------ELLGRADAR-----
A1AE00_ECOK1/10-160GSFPTGTPASKVIGVLA-------------------------------------------------DMLEESNRV-----
Q88MI7_PSEPK/4-164AAVARGQAATRAAMVLS-------------------------------------------------DLLTRSVET-----
VG55_BPN15/14-172AAAVRGKTAGANAAVLA-------------------------------------------------DMLGSLAAE-----
Q9F9Z1_9ENTR/18-187TAIGTDDLGGQPGVLFA-------------------------------------------------ELFRRADQR-----
Q7WK95_BORBR/4-167DAADGSPTGASAVDLLA-------------------------------------------------YMLSRVSGR-----
B0KJQ0_PSEPG/12-176IAAQQRTAGASAVVVLG-------------------------------------------------GLLEESDRM-----

PF04375

Q8XWW4_RALSO/305-691DDAIN------GIDALPLVSSAAPLESGQAAPASRGRPAKPGKGAAPASAFAASPAAESGWSAGVRAWWSRLWHDVRSEL
Q9HTT7_PSEAE/4-374AALRE------QVNQLQPLTPTFK............EGESGASNVAWGDGNSTWE...........LWWEKISRYIRIDF
Q9CK22_PASMU/71-451SQLAN------TIDELTVLDVNFD...............AVNNNEKLTDSLD..............DWKENAEKSATSFL
Q9KVM3_VIBCH/33-397ISLQQ------QIDSLPLANAILP.............ADQPQTSQAVSENID..............DWQTNLKNSLKAFA
HEMX_ECOLI/8-372NQLSN------QVDNLRLADNDSD............GSPMDSDGEELSSSIS..............EWRINLQKSWQNFM

PF04350

A3M9J2_ACIBT/73-221-----------------------------------PRIV..TMH-----DFTVDVS....PAKDN...KSDIPV------
B1KP68_SHEWM/48-192-----------------------------------PRIV..SLH-----DFVIKKS....DTG..........G------
A3L2L2_PSEAI/58-202-----------------------------------PRIV..TLH-----DFEIKPA....SPD.......NTSK------
A1TKV8_ACIAC/65-211-----------------------------------SRIV..TLN-----NIALSPA....NAKD.....APAGS------
Q0AF43_NITEC/50-192-----------------------------------PRIV..TLQ-----DIEIIPG....KDR..........Q------
A6T3F9_JANMA/58-199-----------------------------------PRIV..TLN-----NMNLVVT....KGN..........T------
Q9PGD1_XYLFA/51-201-----------------------------------PRVVILTMH-----DMSLKPK....TNKNN...VSTRGL------
Q6AS36_DESPS/56-201-----------------------------------ERIV..SVK-----SVKMTSP....KKED......GEML------
Q3JEG7_NITOC/49-192-----------------------------------PRIV..TLH-----NFAIENQ....DKE........SGK------
A5GEZ7_GEOUR/43-188-----------------------------------PRIV..NIN-----NVNFADI....KNVN......GRTT------
A8GZ26_SHEPA/51-192-----------------------------------PRIV..SLH-----DFVIKRN....DSG..........E------
A4BQU6_9GAMM/49-200-----------------------------------PRIV..TLH-----NISINQN....GPARTGPNKNQGTP------
Q0I056_SHESR/48-192-----------------------------------PRIV..SLH-----DFTIKRD....ESG..........N------
Q1ZLT6_PHOAS/47-193-----------------------------------PRIV..NLN-----NAELSRVKPLGEPD.........ET------
Q21UC1_RHOFD/65-206-----------------------------------SRIV..TLN-----NLTILPG....KEG..........T------
Q1GYG3_METFK/49-194-----------------------------------PRIV..TLN-----DIVINTAGKDSKDG..........R------
A0Y285_9GAMM/56-197-----------------------------------PRIV..SLH-----DFSITSS....GEK..........Q------
A5EW42_DICNV/50-200-----------------------------------DRIM..NIV-----NFDLNVA....PQEDQN.FIDEKNM------
A3Y0G4_9VIBR/53-196-----------------------------------PRII..SFD-----DVNWQRV....SQE........SST------
Q0EXA4_9PROT/51-193-----------------------------------PRIV..DVK-----HLRLSTG....KSK.........GD------
Q1K2X2_DESAC/43-188-----------------------------------ARIV..NVT-----NLDLGKP....KMSD......GVAQ------
Q46WJ0_CUPPJ/59-200-----------------------------------SRIV..SMQ-----NLQLANT....KEG..........A------
A7MXC8_VIBHB/47-190-----------------------------------PRII..TFQ-----DVTWQRV....SQE........SET------
B7WV77_COMTE/66-211-----------------------------------SRIV..TLN-----NLSIAPG....VGGK......DADV------
A6F2X5_9ALTE/58-201-----------------------------------PRIV..TLH-----DLTITPT....GGD........GEQ------
Q2S9Q2_HAHCH/58-200-----------------------------------SRIV..TLH-----DFTIKSG....KEG.........EA------
Q3SM92_THIDA/49-189-----------------------------------SRIV..TLH-----DIAMVPS....KD...........L------
Q1N2I2_9GAMM/61-205-----------------------------------SRIV..TLH-----DFEVVSA....NTA.......DQNK------
Q08Z00_STIAD/19-166-----------------------------------RRIV..NVN-----GIKLDKP....TIKN......EKVI------
Q0A4Z0_ALHEH/49-191-----------------------------------DRIV..TLH-----NLTIEPR....DGS.........DR------
A0Y8X2_9GAMM/58-199-----------------------------------PRIV..TLH-----DFEILQS....DDA..........T------
A0LFN6_SYNFM/50-195-----------------------------------NRIL..KVE-----TLTLNRV....KDKG......SGSG------
Q1YS06_9GAMM/58-199-----------------------------------PRIV..TLH-----DYVIKQS....DGS..........R------
D7HR04_VIBCL/50-193-----------------------------------PRII..NFD-----DVDWQRV....SQE........SST------
Q15Y40_PSEA6/54-194-----------------------------------PRIV..TVH-----DFEVSQE....VSN...........------
Q1LI84_RALME/59-200-----------------------------------SRIV..SMG-----NLNMSVS....KDG..........T------
B3E9T2_GEOLS/43-188-----------------------------------PRIV..NIT-----NVDFAEV....RSVN......NRMM------
Q306N4_MYXXD/43-190-----------------------------------RRIV..NVN-----NIKFDSA....KLKN......EKVV------
Q39X09_GEOMG/43-188-----------------------------------PRIV..NIT-----DVSFADI....KQAG......GKTS------
Q8DCM4_VIBVU/47-190-----------------------------------PRII..SFT-----DVTWHRV....SME........SST------
A0KN32_AERHH/49-192-----------------------------------PRIV..ILE-----SFTLGQG....KEQ........GDM------
B9M3J0_GEOSF/43-188-----------------------------------PRIV..NIS-----NVNFTEI....KTGK......GLTT------
Q1Q8Q5_PSYCK/75-221-----------------------------------PRII..TMH-----DFEVSNP....QPTL.....DVLPE------
Q74BL1_GEOSL/43-188-----------------------------------PRIV..NIT-----NVSFTDI....KPVG......GKTT------
B5E8I1_GEOBB/43-188-----------------------------------PRIV..NIT-----NVNVSDI....KESN......GRTT------
Q489N7_COLP3/51-194-----------------------------------PRIV..TLH-----DFKISIS....QSD........SEI------
Q2BLX7_9GAMM/56-196-----------------------------------PRIV..TLH-----NYSITPT....GQQ...........------
O05128_NEIGO/50-200-----------------------------------SRII..TLE-----SLKIAQS....PENGGN.PDGKSSI------
Q21H80_SACD2/59-202-----------------------------------PRIV..TLG-----DFEISIK....NKE........TGQ------
A5IFY3_LEGPC/49-198-----------------------------------NRIV..TLH-----EFSVEGV....SSGDGK..TVSQDE------
Q1QZY6_CHRSD/58-200-----------------------------------PRIV..TLH-----DFTLTPV....NEG.........DT------
Q5H3Q8_XANOR/51-201-----------------------------------PRVVILTMH-----DINLKPK....DPKAG...IGARGA------
Q5E2F6_VIBF1/46-189-----------------------------------PRIV..SLE-----NIDIQRV....SKE........SST------
Q6F7E1_ACIAD/73-220-----------------------------------PRIV..TLH-----DFVIEAK....QSKEK....TDIPE------
A1KBQ8_AZOSB/62-203-----------------------------------PRIV..TLN-----NVALESA....KDG..........R------
A1SRB3_PSYIN/46-187-----------------------------------PRIV..ILD-----NLTLTKG....EQG..........L------
Q0VMB5_ALCBS/61-210-----------------------------------PRIV..TLH-----DFTVARP....AKGNQK..QAPLGL------
Q7NZU0_CHRVO/47-188-----------------------------------SRIV..TIG-----EISLTPT....SGN..........R------
A1SB17_SHEAM/51-192-----------------------------------PRIV..SLH-----DFVIKHQ....DGD..........I------
Q2INP0_ANADE/50-195-----------------------------------QRIV..NVT-----DIVLDGP....KDVN......GKIL------
A0Z8J0_9GAMM/58-201-----------------------------------PRIV..TLH-----DFNIASS....GSN........TNQ------
Q1Z012_PHOPR/47-192-----------------------------------PRIV..TLK-----DVDLTVT....EHGQ......NKNT------
A4BAN3_9GAMM/60-209-----------------------------------PRIV..TLH-----DFSVRRA....GGAGAN..NDSEAP------
A4A8J9_9GAMM/58-201-----------------------------------PRIV..TLH-----DFTISAS....SSN........SAA------
Q47JL0_DECAR/63-205-----------------------------------PRIV..TLN-----NISITSA....KDG.........GQ------
Q5P5N9_AROAE/61-202-----------------------------------PRIV..TLN-----NIAIEGQ....KDG..........T------
Q12SM2_SHEDO/51-192-----------------------------------PRIV..SLH-----DFSIVKD....ESG..........E------
A1WDV6_VEREI/65-209-----------------------------------SRIV..TLN-----NIAIAPT....GAR.......GANM------
A8ZSX7_DESOH/54-197-----------------------------------SRIV..NVR-----GINISAS....KNA........EDT------
A6D0B8_9VIBR/44-187-----------------------------------SRMV..LIE-----DAEWQRV....SLE........SSV------
A6FBL6_9GAMM/49-190-----------------------------------PRIV..TLE-----DFTITKL....QGE..........L------
Q3A2N2_PELCD/43-188-----------------------------------TRIV..NLS-----NLRMGNA....KVED......GRNL------
Q1ZHK9_9GAMM/46-187-----------------------------------PRIV..ILD-----RLLLKKT....ENG..........T------
Q4KJJ2_PSEF5/58-202-----------------------------------PRIV..TLH-----DFRIQSV....AAG.......NPAL------
Q60BY6_METCA/48-198-----------------------------------PRIV..TVH-----NVKIVSR....SADGAG.PKPGEAE------

PF10741

A9BY16_DELAS/76-187-----------------------------------RPTI--WVD-----DLQVNLRG.....SLQNTNPQLAPD------
A1WFQ5_VEREI/74-182-----------------------------------NPAI--IID-----GLNVQ........TLGAVNADKPQK------
A1TUQ5_ACIAC/72-183-----------------------------------LPLV--LID-----DLEIQVNV.....GFGNVDPKSAPR------
Q5P6R2_AROAE/78-190-----------------------------------TPVI--LVD-----NLQVNASVP....RVRRGQPQPQER------
A0Z1M0_9GAMM/71-181-----------------------------------RPVI--FVE-----SLDAFPN......RRRRKQETATQV------
A4A5M0_9GAMM/74-184-----------------------------------RPQL--LIE-----SLDTFPV......RANARNADEEQS------
Q87ZW3_PSESM/77-193-----------------------------------RPFL--FVD-----EMSMRR.......DANAPATGAAGK------
B1J7E6_PSEPW/76-193-----------------------------------QPSL--FID-----QLSIRR.......SAAAPAKGPAGR------
Q1QQ81_NITHX/73-181-----------------------------------MPFL--FVD-----QLVVQTPT.....GFAASGEGK...------
A5EBI2_BRASB/75-183-----------------------------------LPFL--FVD-----QLHVQQPL.....AAAASESGR...------
Q89HH7_BRAJA/79-189-----------------------------------MPFL--FVE-----QLDVQVPQTT...ALNDSGTGR...------
Q2VNU3_9BACT/73-185-----------------------------------MPFL--FID-----QLVVQMPQSAGG.ASVETEAAR...------
Q212Z0_RHOPB/75-181-----------------------------------MPFL--FVD-----ELVIQA.......SSGSTNPGK...------
A5EF22_BRASB/73-180-----------------------------------MPYL--FVD-----ELVVEGN......SSLATSGGK...------
A4YMS4_BRASO/72-179-----------------------------------MPCL--FID-----ALVVEGS......AVSAASAGK...------
A7IH66_XANP2/71-186-----------------------------------QPFL--FVD-----QLAIQSEATTSG.ARTVDGGGQPMA------
Q5H4L2_XANOR/85-200-----------------------------------TPRL--FVD-----NLNVMAQ......RYQLSPNESGNG------
Q3RHI6_XYLFA/76-191-----------------------------------SPRL--FVN-----NLNVMAQ......RYPLSPNESGHG------
B4SJ91_STRM5/76-192-----------------------------------SPRL--FVD-----NLNLIAQ......RFQQSPNESGLG------
Q609V5_METCA/84-198-----------------------------------QPVL--FVE-----NLNLRPIRVPP..RPGQKQAAMPDK------
Q3JD24_NITOC/76-192-----------------------------------RPLL--FVD-----DLQVRSRQIRRRSRHDRRTIIEETQ------
B0T7N6_CAUSK/73-179-----------------------------------APYV--VID-----YASIN........ADEAFRTGRSGP------
Q8KZ83_GLUDI/87-194-----------------------------------SPAV--VID-----GLHI.........HKSDNEDAAANM------
Q0BR92_GRABC/89-202-----------------------------------SPQI--IAD-----EIQMHASIAG...AIKPGDIGYSPP------
A5FWX4_ACICJ/79-187-----------------------------------TPRM--LVN-----RLDLH........ATGAPATGADLP------
Q82WG9_NITEU/68-173-----------------------------------RPLL--IID-----RAVVL........ATAAASDGTSPP------
Q9RW97_DEIRA/74-187-----------------------------------NRFT--TVD-----NVSLQ........TQGDAGTGGGGT------
Q07N82_RHOP5/69-181-----------------------------------APMM--LVD-----TFTMQPIE.....RGASRKEAQAPL------

PF03245

O80285_9CAUD/31-149-----------------------------------NYYR--LRS-----GIDRITA--------------QVNY------
A7MK05_CROS8/30-153-----------------------------------DYFT--LRE-----RIETVTR--------------QLSG------
Q9ZXB6_BPH19/29-154-----------------------------------DYFT--LRE-----RLMTMQK--------------QLEG------
Q7N318_PHOLL/26-149-----------------------------------DYFD--LRK-----MIVENEQ--------------QTKA------
A1ACE3_ECOK1/29-154-----------------------------------DYFT--LRD-----RLMTMQM--------------QLEG------
Q56118_9CAUD/29-155-----------------------------------DYFT--LKE-----RVTTMQK--------------QLEG------
Q1RCX8_ECOUT/33-157-----------------------------------DYFT--LRE-----RLITMQK--------------QLEG------
Q2A0C4_9VIRU/30-151-----------------------------------NYFT--LRR-----RIETANR--------------QING------
Q76H63_9CAUD/29-154-----------------------------------NVLG--IRD-----GIISDQA--------------ALRT------
Q2A095_9VIRU/28-149-----------------------------------DYFT--LRS-----RIDIASR--------------QING------
Q1I6B5_PSEE4/33-166-----------------------------------RIVA--ITD-----DGDRGLI--------------ALRA------
Q9KXD2_BPVT2/29-154-----------------------------------DYFI--LRE-----RLITMQK--------------QLEG------
A7MLQ7_CROS8/30-153-----------------------------------DYFT--LME-----RIETVTR--------------QLSG------
Q48C47_PSE14/33-153-----------------------------------DYFT--LRD-----ELALSRQ--------------MILG------
A4WC46_ENT38/29-152-----------------------------------DYFT--LRE-----RIETVTK--------------QLTG------
A2P359_VIBCL/23-146-----------------------------------DYLR--LRE-----MIAETEL--------------QVSY------
B0KHE2_PSEPG/21-146-----------------------------------RIVR--IAN-----DGDDAIR--------------QLTA------
Q1GXR8_METFK/50-191-----------------------------------FLVG--LAS-----EADEVVE--------------QLTS------
Q8X2A4_ECO57/29-154-----------------------------------NVLG--IRD-----GIISDQA--------------ALRM------
A4WB39_ENT38/29-154-----------------------------------NVLG--IRS-----GIISDQT--------------ALRT------
Q7N0Y2_PHOLL/26-149-----------------------------------DYFD--LRR-----MIVENEQ--------------QTKY------
Q1VCK5_VIBAL/31-155-----------------------------------DYLR--LRR-----MIIENEQ--------------QTKY------
B1JDA4_PSEPW/32-158-----------------------------------RIIA--ITD-----EGDRGLM--------------ALRA------
A6UZ52_PSEA7/32-149-----------------------------------DYYA--LRD-----DLALTRR--------------MVLA------
A1JLU8_YERE8/29-147-----------------------------------DYLR--LRE-----RIDIATK--------------QITG------
Q7CID8_YERPE/26-151-----------------------------------DYLS--LRE-----RIGIATS--------------QISG------
A8CGF5_BPP22/29-144-----------------------------------NYYR--LRS-----GIDRITA--------------QVNY------
Q8XYQ5_RALSO/38-173-----------------------------------DIQA--LVA-----DADAIAA--------------ALRF------
Q2NV02_SODGM/25-149-----------------------------------HYFT--LRR-----RIDIARE--------------QING------
Q6HAE1_9ENTR/26-151-----------------------------------RILS--IRE-----GIIRDQQ--------------KLMY------

PF05137

D4BI19_9ENTR/97-171...................................QPLF--E..-----LNRAGET--------------QQDT......
C7R7X0_KANKD/100-176...................................AERL--D..-----TKSLRDV--------------NKEN......
C7QTE2_CYAP0/114-206...................................SEIF--QAD-----KTAIIEA--------------KLEDLPIENQ
C6BWY3_DESAD/355-431...................................TEIF--S..-----NAVLASM--------------SKLE......
D3SD46_THISK/100-177...................................SPWL--A..-----DSNLQII--------------ETRE......
C8X4Y9_DESRD/100-179...................................SPYI--Q..-----SIQTRRT--------------SRRR......
D0L237_HALNC/100-184...................................SDYI--D.S-----AIIVGSG--------------ILAQ......
D0WBB7_NEILA/103-177...................................TGIF--K..-----QPELLSI--------------KKNN......
D2ZYQ1_NEIMU/103-177...................................TGIF--T..-----QPELLEI--------------KKID......
D2Z429_9BACT/103-180...................................SPVI--E..-----QVGFPNT--------------RRVS......
B2FNI0_STRMK/286-360...................................APQW--R..-----KVNLTGV--------------LQAD......
B1EI39_9ESCH/97-171...................................DTSF--QLN-----QRGTTQQ--------------DAQG......
C1DHR0_AZOVD/100-178...................................SEWL--E..-----APNLTAV--------------KAVT......
Q1N2I1_9GAMM/100-174...................................SAWF--S..-----DPNLLKV--------------QAGT......
Q7NZT9_CHRVO/100-177...................................SETF--D..-----APVLVEV--------------SSSI......
A8T9N5_9VIBR/101-179...................................SPKL--R..-----DVGMHSI--------------VHGK......
B3R7C3_CUPTR/105-187...................................VAWL--D..-----KAELVES--------------KAVTMT....
Q74C93_GEOSL/96-176...................................STHF--T..-----DVLLLNQ--------------GQLS......
B9TC62_RICCO/24-102...................................SPIM--H..-----NPNLVEI--------------KANT......
A8GZ25_SHEPA/100-177...................................SAWL--Q..-----DPNMQSI--------------VAQN......
Q74BL0_GEOSL/100-177...................................TEDY--T..-----NVELIVS--------------EQTE......
Q061N8_9SYNE/111-200...................................SGLF--QPD-----GVVLKRA--------------QLQA......
A4G9P6_HERAR/100-182...................................SPWL--E..-----RPDLIEI--------------RSTGVG....
Q1IRM8_KORVE/109-189...................................TGLF--K..-----NVELKET--------------VQDA......
C4K8E6_HAMD5/100-172...................................KILI--H..-----NIELQKV--------------SQKK......
A0YSX4_LYNSP/116-236...................................SPFF--DDE-----QTKLLSA--------------RLKDNPTKLV
Q21H79_SACD2/100-177...................................SKYF--D..-----EPDLKTV--------------DAVP......
D6SKS7_9DELT/355-426...................................SFLF--S..-----RVRFSAP--------------VTRT......
Q1Q6D7_9BACT/347-419...................................SPLL--S..-----AIGLASP--------------VTKT......
A5EF21_BRASB/284-357...................................SAHF--K..-----HATFSAP--------------TTRS......
B4UDC4_ANASK/100-177...................................STYF--K..-----DVELKKT--------------SAKT......
F2G6J6_ALTMD/100-177...................................SKVF--V..-----AAELSTI--------------KSDS......
Q5P5N8_AROAE/100-177...................................SPFL--E..-----QPGLVEV--------------KSAT......
A5GEZ6_GEOUR/100-177...................................SDDF--S..-----NIDLQVS--------------EQSE......
A1ARQ3_PELPD/96-177...................................SAGF--G..-----EILLLSH--------------ADLD......
B5JTT5_9GAMM/102-177...................................SDWF--K..-----EPTLVNI--------------ENDK......
Q1PJI8_PROMR/111-194...................................SEFI--EFD-----DIDLKEI--------------KSQN......
B2Q5V2_PROST/100-173...................................NPLL--H..-----QVQLIKM--------------GKT.......
Q0BZ78_HYPNA/235-307...................................TSAF--PDQ-----TVRFEET--------------VADT......
Q87L63_VIBPA/101-179...................................SAKL--L..-----DVEMHSI--------------VHGK......
B4VRN9_9CYAN/118-234...................................SPFF--QEE-----ETHIVSA--------------QLEENPAKLE
B8D2D6_HALOH/94-167...................................SELF--E..-----MVQLLTV--------------RKSQ......
Q4FQH8_PSYA2/100-200...................................SKWM--G..-----NSAVSNI--------------QQNITAYQAA
P74187_SYNY3/116-221...................................SKFL--QAN-----KTKLMTA--------------NAAALPITGE
Q3IJC1_PSEHT/100-177...................................SYLL--E..-----RPVMQGI--------------VAGD......
A5WCG1_PSYWF/77-165...................................STWL--H..-----QVQVQHI--------------QVAGAD....
A5KTK0_9BACT/97-178...................................SDLF--S..-----DVSIESI--------------GNAG......
Q6LVG0_PHOPR/101-179...................................SEWL--K..-----DVAMHSI--------------EATK......
Q2JVP2_SYNJA/119-199...................................SNFV--T..-----SAVLNSA--------------SRVE......
C5BRK2_TERTT/100-177...................................SPWF--S..-----DPNLRSV--------------VASP......
Q31KD7_SYNE7/115-203...................................SRFF--TAS-----SLRIEEA--------------KLGATPTQNT
Q05VH9_9SYNE/427-512...................................LPQT--QAD-----GVKVVKV--------------TRND......
Q212Y9_RHOPB/275-348...................................SPHF--S..-----SAVFFAP--------------TTRA......
A0Z1L9_9GAMM/260-333...................................EPAF--K..-----QVTAPQA--------------ISRV......
Q8YY23_NOSS1/115-220...................................SRFL--KSA-----DTKIITA--------------SLADAP....
A3CR63_STRSV/106-183...................................SEKF--N..-----HIFVDNI--------------TREE......
A3LJ85_PSEAI/100-178...................................SEWL--T..-----APTLNEV--------------KAVT......
Q7NA52_PHOLL/101-175...................................NGQL--S..-----EIQLKKM--------------TTTE......
B4A5T7_SALNE/97-171...................................YVSF--PLN-----RTGATRQ--------------DAQG......
Q21T59_RHOFD/119-218...................................SPLL--EGQ-----KLSTVKV--------------EHASAAVLKT
Q7MH79_VIBVY/111-189...................................STFL--K..-----EVEMHSI--------------VHDK......
B6SE77_9NEIS/102-181...................................TGIF--E..-----QPELVKI--------------EKTD......
B5EI36_GEOBB/95-175...................................SPNF--S..-----EVYLLSQ--------------SEVK......
A4YMS3_BRASO/280-353...................................SAHF--T..-----HATFSAP--------------TTRS......
A8MGF2_ALKOO/105-178...................................VDNY--E..-----DSFISHI--------------SIKE......
B2TQM7_CLOBB/105-181...................................LSIM--N..-----DVFVNSI--------------DIDG......
Q988B3_RHILO/273-346...................................SPLF--S..-----APEFASP--------------VVKV......
Q82SK2_NITEU/100-177...................................SSWM--E..-----SPLLIEI--------------KAAT......
Q2S9Q1_HAHCH/100-176...................................SDWF--K..-----EPNLTSV--------------KALR......
C0N3G0_9GAMM/100-177...................................NEEY--G..-----ESRLNVI--------------KRTS......
B8E235_DICTD/101-179...................................SDLV--K..-----NVSLGFA--------------QKVG......
Q7NHV0_GLOVI/113-196...................................SPFV--..A-----DAIVVDA--------------VKEEG.....
A3JEF9_9ALTE/100-177...................................SDWF--T..-----NPNLSNV--------------STAD......
A7H854_ANADF/100-177...................................STQF--R..-----NVELKKT--------------ASKT......
Q8RAF0_THETN/99-173...................................INYV--E..-----DVKALLI--------------ELNE......
A0ZCZ0_NODSP/113-219...................................SKFL--ESS-----DSKITTA--------------TLVDAPL...
Q1K2X1_DESAC/100-177...................................SAYY--K..-----NVRLKVT--------------KQKT......
B2FSH6_STRMK/100-187...................................SGWM--T..-----NPELSII--------------QASA......
B6EM38_ALISL/101-179...................................STQI--V..-----DVEMHSI--------------VSGQ......
A7IH65_XANP2/278-351...................................SRQF--A..-----EATFVAP--------------TTRA......
Q3KJA6_PSEPF/100-178...................................SDWF--D..-----APNLNEV--------------KATT......
B7DM24_9BACL/96-194...................................EPFT--S..-----SASFTAA--------------ALQGSGSNVP
Q2P6L7_XANOM/100-189...................................SGWM--T..-----NPDLSII--------------EAKI......
B0C6K6_ACAM1/111-215...................................SPFL--TVA-----QTQLMSS--------------ERKTDQK...
B7S0Z0_9GAMM/110-187...................................SDWL--A..-----GPNLDKV--------------NAAT......
B1BAN5_CLOBO/105-183...................................LGIF--E..-----EVHVPDI--------------SENS......
C1I9R3_9CLOT/106-178...................................LDNI--Q..-----DVYIGGI--------------SGDE......
B1Y308_LEPCP/100-183...................................SAWL--E..-----RPELVEI--------------KVTAAT....
A1SRB2_PSYIN/100-177...................................SGWL--G..-----EAYISSI--------------ISGP......
Q4KJJ3_PSEF5/100-178...................................AEGF--A..-----APSLTEV--------------KNAV......
B8KUT7_9GAMM/100-177...................................SEWL--Q..-----DPNLDAV--------------VAAP......
A1HQ13_9FIRM/97-173...................................DDIF--A..-----EPVLVKA--------------ERDG......
B9YYQ5_9NEIS/100-177...................................STTF--D..-----APVLVEV--------------KAAI......
B9M3J1_GEOSF/100-177...................................IPDF--T..-----NVELQVS--------------EQTE......
B5FBN6_VIBFM/101-179...................................SSQI--T..-----SVEMHSI--------------ISGQ......
C0QK71_DESAH/391-463...................................SPLF--K..-----DVVFMTT--------------IRKD......
B7KDY8_CYAP7/115-226...................................SPFF--KAD-----ATKIEKA--------------ELADLPIEVE
B8KB93_VIBPA/101-179...................................STHI--R..-----NVEMHSI--------------VHDT......
Q8RHE9_FUSNN/314-386...................................SKNF--KLY-----NYDYILR--------------KENE......
A3Z3C8_9SYNE/419-506...................................LPIS--EPD-----GVKVVKA--------------TRSG......
F2G3R3_ALTMD/118-196...................................SPFF--Q..-----GKAFSSV--------------KFDE......
B3E9T1_GEOLS/100-177...................................SSEY--E..-----KVDLVVS--------------EQKD......
B5E8I0_GEOBB/100-177...................................SGAF--S..-----NVELVVS--------------EQNE......
B8ESJ7_METSB/292-365...................................SPQF--T..-----HAVFFAP--------------TTRL......
A9BY15_DELAS/240-313...................................APGF--L..-----EVRMPSA--------------VTRA......
B1Y072_LEPCP/116-203...................................EALF--H..-----GRQFAQL--------------SLQR......
B2J1B9_NOSP7/115-223...................................SRFL--KST-----ESRILTA--------------TLVDPPPI..
C4ZLJ2_THASP/100-177...................................SAFL--E..-----QPRLIEA--------------KAVT......
A0KN33_AERHH/100-177...................................SGWL--G..-----QSQISTI--------------FAAD......
A1AMQ0_PELPD/100-177...................................SSDY--M..-----GVELLVS--------------EQKE......
C4GJE0_9NEIS/102-182...................................TGVF--D..-----TPKLDSI--------------NKTD......
Q0A4Z1_ALHEH/100-180...................................STLL--G..-----DPDLDSF--------------EAGGA.....
C4Z597_EUBE2/445-523...................................NPAI--L..-----NVDVPTI--------------SESK......
A6FBL5_9GAMM/100-175...................................STWL--R..-----DGNLDSI--------------IALS......
Q12FF4_POLSJ/100-183...................................SPWL--T..-----KPELVEI--------------TAGSVT....
A1JSD8_YERE8/100-174...................................QSLL--A..-----NVRLQRI--------------AQRD......
Q5ZX05_LEGPH/100-178...................................NVWI--Q..-----NPVLTEI--------------KKNV......
Q0AIN5_NITEC/95-174...................................EPVF--R..-----NVHLASY--------------KTRQ......
A5FWX5_ACICJ/271-344...................................DPHF--A..-----DPAFAAP--------------VTRS......
B0JRP4_MICAN/116-221...................................SPFL--QGK-----KTAIESA--------------ALADLPV...
B9MDE7_ACIET/100-183...................................TPWF--S..-----KPELVEI--------------VAANVA....
Q1NNC6_9DELT/33-111...................................SPLL--A..-----DADLISS--------------SQTE......
C0DV41_EIKCO/103-177...................................TNVF--G..-----QPSLDSI--------------NKVE......
C3JZE1_PSEFS/252-326...................................CHSL--E..-----NAQFEGV--------------IQPD......
Q609V6_METCA/282-355...................................SEEF--K..-----NTSFVSP--------------VTKD......
C3MFK9_RHISN/275-348...................................SDLF--E..-----AAQFASP--------------VVKV......
B5ZIQ8_GLUDA/257-330...................................DPVF--R..-----NPVFVAP--------------VTRV......
A6TTT3_ALKMQ/105-178...................................NGDF--Y..-----EIFIPSI--------------TEND......
Q1YS07_9GAMM/100-177...................................SNKY--A..-----NSNLTKV--------------QHDA......
B0U6Y4_XYLFM/289-362...................................SKLW--R..-----TPSLSSV--------------LQSN......
C4LB15_TOLAT/100-177...................................SGWL--G..-----QTTINSI--------------FAND......
Q1IGB1_PSEE4/101-174...................................ADVL--Q..-----DLELVHL--------------RHGA......
B5YJ53_THEYD/106-182...................................TPEL--Q..-----DVYLVES--------------QQTE......
Q6MPI9_BDEBA/121-198...................................SVFL--M..-----DVNLVSS--------------SETV......
A8AQU9_CITK8/73-147...................................HPDF--LLA-----GSGATQQ--------------DAQG......
C0QLC6_DESAH/100-179...................................SPLF--S..-----GVDLKNI--------------KMKV......
B1XPF2_SYNP2/120-215...................................SPLL--QGE-----EIYIVSA--------------NLVDNPITTA
Q0EXA3_9PROT/100-177...................................SPMF--T..-----DVRLDVI--------------SRVV......
Q3JD25_NITOC/289-364...................................SPYF--Q..-----SVQFRSP--------------VTTN......
Q1QZY7_CHRSD/101-177...................................SPVF--A..-----TPELADV--------------HAVD......
A3RW17_RALSL/108-190...................................VPWL--D..-----RAELGES--------------VATTMT....
Q08YZ9_STIAD/84-208KGMGRLVEQRRDAKTSRVELLTPDASIEEFPVASIKPFF--S..-----NIDLKDA--------------TQQT......
Q6AS37_DESPS/100-178...................................SPFI--R..-----EVNLTGT--------------SMQQ......
A0Z8I9_9GAMM/100-177...................................SDWL--Q..-----APNLDGV--------------AAAP......
Q1ZHK8_9GAMM/100-177...................................SGWL--G..-----DVNINSI--------------VTAN......
B6BVV6_9PROT/465-539...................................DNNF--E..-----NIKIDSF--------------RRKD......
B9JMG5_AGRRK/265-338...................................SPLL--S..-----NPSFASQ--------------VLRA......
Q21UC2_RHOFD/100-183...................................TPWF--S..-----KPELVEI--------------VAGTVT....
Q3SM93_THIDA/100-177...................................SPWF--E..-----SAGLVEI--------------KAAT......
B7WVX0_COMTE/100-183...................................SPWF--S..-----KPELMEI--------------VAKTVD....
C4IH38_CLOBU/105-181...................................LTIM--D..-----DTYVNSI--------------KNAG......
C0EQU7_NEIFL/103-177...................................TGIF--L..-----QPELLSI--------------KKVD......
A2SKH6_METPP/100-183...................................STWL--E..-----KPELVEI--------------KAASLT....
B6J4A1_COXB1/85-157...................................TKLF--N..-----SISISHL--------------SQKS......
A3YUA5_9SYNE/109-199...................................SELI--DPA-----SVNLSRA--------------IRTD......
B3PI74_CELJU/100-177...................................SDWF--A..-----SPNLTSV--------------TAAP......
B5YEE0_DICT6/384-462...................................YERI--K..-----NVKLESA--------------ILEV......
B5XTU2_KLEP3/97-171...................................VAGF--APA-----KAGGTQR--------------DAEG......
Q3R4G6_XYLFA/100-184...................................SGWM--T..-----NPDLSII--------------EAKE......
A2PCR9_VIBCL/103-181...................................SDKL--T..-----DVEMHEI--------------VSGN......
A1WFQ6_VEREI/278-351...................................HPVL--R..-----DVRAPTA--------------AMRP......
Q489N8_COLP3/100-177...................................SDLF--V..-----DATPESI--------------TADD......
A4BAN2_9GAMM/100-178...................................SEWF--D..-----NAFMTEM--------------VSVK......
A5EBI1_BRASB/276-349...................................SPQF--S..-----RATFYAP--------------TTRT......
A0Y8X3_9GAMM/100-177...................................SDWF--A..-----SPNLTAV--------------KEKL......
Q306N5_MYXXD/101-221KGMGRLVDRRRDSKTARVEMLTSDATIEEFPEAQVSPFF--K..-----NIDLQTA--------------KQVG......
Q60BY7_METCA/110-193...................................SEWL--Y..-----DPVLEVI--------------ENKQDAQ...
A9BA85_PROM4/113-200...................................SKFF--K.P-----AIIIDNI--------------KNEG......
Q2VNU4_9BACT/249-322...................................TSHF--S..-----RATFFAP--------------TTRS......
Q2BLX6_9GAMM/100-174...................................SLWF--G..-----EPSLSSV--------------GQVQ......
Q07N81_RHOP5/265-338...................................SGRF--A..-----DVKFISA--------------TTRL......
A0LPH8_SYNFM/376-449...................................VDGL--A..-----DVRFASP--------------VTKN......
Q89HH6_BRAJA/288-361...................................SQHF--T..-----RATFYAP--------------TTRS......
Q2C0P4_9GAMM/101-179...................................SKWF--I..-----NVDMHSL--------------VTTK......
C5CQG6_VARPS/100-183...................................SPWL--V..-----KPELVEI--------------TSATVS....
B2A7F7_NATTJ/100-174...................................NTHH--E..-----QLELDSL--------------TEGE......
Q47JL1_DECAR/100-177...................................SPWL--E..-----QPQLVES--------------KAVV......
C3KAI0_PSEFS/101-176...................................AQGA--H..-----STRLQQV--------------RTDG......
Q2P7E4_XANOM/286-359...................................SPLW--R..-----TPSLTGV--------------LQSD......
A4BQU5_9GAMM/101-178...................................SHWL--T..-----DPDLNVI--------------EVKD......
B7IAW1_ACIB5/100-189...................................SPWY--R..-----NAFMNSF--------------LANE......
Q2LWS9_SYNAS/100-178...................................LNIF--E..-----TVELISS--------------RQKD......
A8GKR2_SERP5/100-174...................................LPLL--Q..-----NYRLAEV--------------VQRQ......
A4A8K0_9GAMM/100-177...................................SDWL--K..-----DPNLDAV--------------RAAP......
A1WDV7_VEREI/100-186...................................TPWL--T..-----KPELAEI--------------VAGSNFAA..
A5GFB1_GEOUR/96-176...................................SNFF--T..-----TVFLENQ--------------AEIK......
A4CEN2_9GAMM/100-177...................................SYLF--E..-----KPVMQDI--------------VAVE......
B5EP45_ACIF5/100-177...................................SRIF--E..-----KPELNII--------------SKSK......
Q2RI86_MOOTA/98-173...................................SNLW--Q..-----AVTLQEV--------------KGDG......
Q1GYG2_METFK/100-177...................................SEWL--Q..-----SPNLVEI--------------KSAT......
Q3A2N1_PELCD/100-177...................................SPYF--R..-----DVDLKVT--------------KQVE......
B9M0Z2_GEOSF/96-176...................................SAYF--K..-----NVFLENQ--------------SAIK......
Q1QQ80_NITHX/271-344...................................SPQF--S..-----RATFFAP--------------TTRD......
A0LFN5_SYNFM/100-180...................................SPYI--EKG-----SVNLIHS--------------RQTV......
Q88CU8_PSEPK/100-173...................................SNVL--L..-----DLELKRI--------------KSLP......
B0K9C0_THEP3/99-173...................................ISYV--E..-----DVKVISV--------------DLTD......
B1J2J1_PSEPW/100-173...................................SGIL--L..-----DLELKRI--------------KSMP......
A4WFI2_ENT38/96-170...................................FAGF--TLG-----PAGELQQ--------------DNQG......
Q15Y39_PSEA6/100-177...................................STVF--N..-----DGELSSI--------------VADT......
A1KBQ9_AZOSB/100-177...................................SPFL--E..-----QPGLVEV--------------KAAT......
B2IBE2_BEII9/274-346...................................TSIF--S..-----EAGFTGA--------------TTRE......
A1TUQ6_ACIAC/264-337...................................EAGF--K..-----EVRAPSA--------------ATRM......
A6M144_CLOB8/105-181...................................LPKM--Q..-----DVYVNSI--------------DNSG......
A3ISW4_9CHRO/116-208...................................SPLL--KAE-----QTMIETA--------------TLEDFPI...
A8ZSX8_DESOH/100-178...................................SSLF--S..-----GVDLSNL--------------VHEE......
Q5QWC4_IDILO/117-193...................................SGVL--S..-----DKRFAVV--------------ELKR......
B0A4I7_YERPE/100-174...................................QPLL--V..-----NVSLQGI--------------TQQD......
Q39UI3_GEOMG/96-176...................................APRF--S..-----DVFLQSQ--------------TEVK......
B7LS95_ESCF3/97-171...................................NASF--LLI-----HTGATQQ--------------DAKG......
B4WYC6_9GAMM/101-177...................................SSWF--Q..-----SANLQNV--------------TALE......
Q8DGH5_THEEB/111-198...................................STFF--DGK-----ATRLIKA--------------ERSTADNK..
B6C334_9GAMM/100-177...................................SPVF--R..-----NPRLDVI--------------QRTG......
B8FQ80_DESHD/405-487...................................ALGW--R..-----KVQLAKY--------------QTAG......
A6D0B9_9VIBR/100-178...................................EPTV--S..-----YVEIHSI--------------VHGR......

PF04612

C6BGG9_RALP1/26-185-----------------------------------AQRM--KVI-----DTNIKYVG.............ATAL------
A3UEX1_9RHOB/7-165-----------------------------------EHGV--NAE-----RVSLDRE..............GETR------
Q0K5X1_CUPNH/40-199-----------------------------------QQRM--KVI-----DARIVYVG.............ATAL------
GSPM_PECCC/1-161-----------------------------------KNGV--KVI-----SLDVNAVE............QSPGI------
Q1IB25_PSEE4/11-155-----------------------------------RLGL--TIG-----QLSLRR...............DPGA------
Q21EQ3_SACD2/4-161-----------------------------------EKGL--QVK-----DMSIAESS.............NIGM------
Q31WM9_SHIBS/22-178-----------------------------------KYAL--RVT-----QIDASAAE.............KTGM------
A1WZN8_HALHL/10-173-----------------------------------AAGV--EVD-----ALTVERTQ.............EDGL------
Q7MPY7_VIBVY/5-163-----------------------------------KQGI--EVE-----FMDIDRGK.............ESGL------
Q1ZIZ1_9GAMM/2-159-----------------------------------KYGI--EVL-----NVDINQAL.............KPGY------
A6VAT2_PSEA7/20-183-----------------------------------ALRL--SVD-----QARVTRLEAPT......EEQAAGGL------
B1YQ40_BURA4/7-166-----------------------------------QFKV--QVG-----EAHVTGLK.............EDGQ------
Q7BSV4_ECO57/1-160-----------------------------------RHRI--RTM-----VFDVAAQG............NPPGQ------
Q3KBE0_PSEPF/17-170-----------------------------------NFSL--QVV-----EARLQRADDAA.......TDDTAGT------
Q0I0D9_SHESR/1-158-----------------------------------KKGL--SLE-----SVDLAEAD.............AAGY------
A3WP21_9GAMM/17-175-----------------------------------TYQL--QVT-----TLDLARLD.............ELGK------
A8AIM9_CITK8/5-159-----------------------------------TSGV--QLQ-----KMDLRPVD.............RQSD------
Q1LHW4_RALME/25-184-----------------------------------QQRL--KVT-----DTRISYVG.............ATAL------
Q5QY94_IDILO/12-171-----------------------------------RQGL--SLK-----AVDIAKLN.............TPGQ------
Q9ABP4_CAUCR/5-157-----------------------------------EGAV--KVT-----DFTASRL..............DNGL------
A4VFT9_PSEU5/13-169-----------------------------------GQGV--SVT-----EVSLERA..............GEGL------
Q8FCY8_ECOL6/7-160-----------------------------------TYGI--VIE-----DLQFTLA..............GNEE------
Q1ZL56_PHOAS/1-160-----------------------------------NFGI--ETQ-----FIDISKTD.............QNGM------
A1SR65_PSYIN/2-159-----------------------------------QYSV--SVL-----NADISRAD.............EEGY------
GSPM_VIBCH/5-164-----------------------------------RQGV--SVD-----AIDIDRGK.............VNGV------
Q02HH6_PSEAB/22-191-----------------------------------ALRL--SVS-----EAQVTRLDAPSEERSGSSNELSGGL------
A0YBF1_9GAMM/11-168-----------------------------------RHGI--SVD-----EISVDRDE.............QDGL------
Q87TC8_VIBPA/6-164-----------------------------------QQGI--EVE-----FLDIDRTD.............QAGM------
GSPM_AERHY/2-162-----------------------------------QHGV--QVQ-----VIEVAREN............LAPGL------
A6T4U0_KLEP7/1-158-----------------------------------MRGV--NAI-----SLSVTGQP............SRPGW------
A6EW52_9ALTE/11-176-----------------------------------GHGV--EID-----QASMDRQN.............DPGI------
A3MPL1_BURM7/14-173-----------------------------------QFKA--QVV-----EAHVSALK.............EDGQ------
Q9ZFW8_PSEAC/14-170-----------------------------------EQGV--RVE-----EAGLERA..............DKGL------
Q0A613_ALHEH/2-163-----------------------------------ETGV--RVH-----ALSLEPLD.............APGR------
Q0ASQ4_MARMM/5-163-----------------------------------RYGI--RAQ-----ASTLDRD..............ADGF------
A1JQE2_YERE8/1-159-----------------------------------QYGL--QAS-----QLKLVADV............DNLSR------
Q31J18_THICR/7-166-----------------------------------QQGL--IAY-----SADLKPL..............QPGI------
A6V156_PSEA7/5-149-----------------------------------RSGV--EVT-----SLDLE....................------
A3SDU2_9RHOB/1-150-----------------------------------QHDV--RVE-----ALEVDRRP.............APGR------
A3YCB4_9GAMM/14-171-----------------------------------KEKV--SIY-----SVQFASR..............ELGV------
Q1YQU6_9GAMM/7-161-----------------------------------CQGL--KTN-----LLDVSRS..............DATV------
Q1N4H7_9GAMM/22-176-----------------------------------EKGI--LVE-----QISLDKV..............SSGR------
A1U0C6_MARAV/11-176-----------------------------------NHGV--VID-----QAALDRGN.............GPGQ------
Q02PQ8_PSEAB/17-174-----------------------------------GQGV--QVA-----EAGLDRQ..............VDGR------
A2SKJ8_METPP/13-167-----------------------------------AARA--RPD-----EAKLSHG..............PNGY------
Q1NDR5_9SPHN/1-158-----------------------------------GQGV--RVV-----TMSARPSP.............TAGS------
F2GBM0_ALTMD/1-159-----------------------------------NMGV--VIL-----QADIAEAD.............APGY------
A6D4H3_9VIBR/5-163-----------------------------------SHGV--TVE-----NMDIDKAD.............LSGV------
Q4KD21_PSEF5/17-183-----------------------------------QFSL--QVV-----EARLQRADAAA.......AQDSAGT------
Q5E1Y6_VIBF1/1-161-----------------------------------SQGI--NVQ-----FLDLNKTD.............VEGV------
B2T7P8_BURPP/6-165-----------------------------------QFKV--QVS-----EAHATALK.............EDGQ------
Q8PPI2_XANAC/5-157-----------------------------------AHGL--APT-----QLSVAR...............EQGQ------
A4BDW7_9GAMM/6-161-----------------------------------NMGI--GHT-----ELALDDRP.............NPGF------
Q8P5C5_XANCP/5-144-----------------------------------AHGL--APT-----QLQITR...............HAQQ------
A1S1Y3_SHEAM/1-158-----------------------------------QKGL--SLE-----LLDVGETD.............TPGM------
GSPM_KLEPN/1-158-----------------------------------QAGM--TTA-----TLAVTAVA............QQPGW------
A5V9H7_SPHWW/17-167-----------------------------------TSRL--RVV-----RLRLDRRP.............SSGF------
GSPM_ERWCH/1-160-----------------------------------KNGV--ITQ-----GIDVTAVP............NSPGI------
Q2Y7T4_NITMU/2-161-----------------------------------LQRV--RFE-----KGRIEALP.............EPGI------
A4XWF6_PSEMY/17-173-----------------------------------GQGI--RVE-----ELGLDRR..............EENQ------
A1W3T9_ACISJ/17-159-----------------------------------TARA--VPL-----EARLVQSA.................------
A3UP97_VIBSP/5-162-----------------------------------KQGV--EVE-----FMDIDRSD.............SPGV------
Q15ZB6_PSEA6/1-159-----------------------------------EMGV--SIL-----DLDIAEAD.............APGQ------

PF12693

Q8DDT8_VIBVU/244-403-----------------------------------EQ.F--QVE.....QGQLNR---------------TGDA------
Q8P5C4_XANCP/217-355-----------------------------------SAGW--QVR.....PASSQA---------------VETR------
Q8PPI3_XANAC/214-362-----------------------------------DAGW--HLD.....PGSSQV---------------EDGR------
Q9ABP5_CAUCR/216-368-----------------------------------RLGL--ELT.....EQSTAS---------------EGGR------
Q8CZX5_YERPE/243-396-----------------------------------L..F--NAR.....VEVIRS---------------GEDK------
GSPL_ERWCH/242-399-----------------------------------AY.F--QIP.....PGEMKQ---------------EKDH------
GSPL_PECCC/268-425-----------------------------------AY.Y--QVQ.....AGEMRQ---------------ENDR------
Q9ZGT8_ECO57/266-425-----------------------------------EK.Y--LIQ.....PGEIRQ---------------QPQG------
GSPL_KLEPN/240-398-----------------------------------AR.F--RVQ.....TGEMKP---------------RADG------
Q88P00_PSEPK/218-362-----------------------------------TV..--..............---------------QVQD------
O86440_PSEPU/213-361-----------------------------------QV..--..........QVNG---------------DASS------
Q87TC9_VIBPA/245-404-----------------------------------EK.F--NVE.....QGQLNR---------------SDNV------
GSPL_VIBCH/249-407-----------------------------------QY.F--AVE.....QGQLNK---------------NGEQ------
Q8EKC1_SHEON/239-395-----------------------------------RR.F--QMD.....GGTMNS---------------GEDQ------
GSPL_AERHY/243-389-----------------------------------KR.F--EVQ.....QGEGAQ---------------HRGQ------
GSPL_PSEAE/226-382-----------------------------------ESGL--AVQ.....LGSASR---------------DGST------
Q9ZFW9_PSEAC/223-381-----------------------------------EAGL--AVD.....MGSASR---------------EDNG------
Q8VPC1_ECOLX/234-392-----------------------------------TD.Y--VVQ.....QDALQK---------------EGDA------
GSPL_ECOLI/237-387-----------------------------------SW.L--PME.........KT---------------EKDP------
Q8XUS4_RALSO/317-476-----------------------------------TVGL--KMET...AEAPRGG---------------EAAV------
Q9ZF77_BURPE/291-444-----------------------------------RNGL--............TG---------------EIDS------
Q9I5P2_PSEAE/207-381-----------------------------------DKGW--QVRAMEAPPAPAAG---------------AADS------
Q8GBD8_YEREN/245-399-----------------------------------NK.L--NIT.....THPMDQ---------------QHTL------

PF10721

A8A0B0_ECOHS/1-160-----------------------------------AQLY--AEIAD---KRYIAGV--------------TCQR------
A5W5S5_PSEP1/4-164-----------------------------------NREL--ARAYD---LAQIAGQ--------------QCQA------
Q858E9_BPE15/10-160-----------------------------------NRQL--AEYAD---RAAEAGR--------------VCEK------
B1J5E9_PSEPW/4-165-----------------------------------NREL--AKAYD---QARIAGH--------------QCEQ------
Q8Z7W1_SALTI/12-170-----------------------------------AQYY--AERSD---ESYRAGM--------------TCER------
Q57Q93_SALCH/12-178-----------------------------------AGKF--AKEAD---ERYVAGS--------------TCER------
Q46YK2_CUPPJ/9-168-----------------------------------SGIL--ADYAD---RLKVAGL--------------SCER------
Q4KA36_PSEF5/4-166-----------------------------------AGDL--AADAD---QSRSRGV--------------TCEQ------
A9ABH5_BURM1/1-157-----------------------------------AGEL--AEYAD---RARIAGQ--------------QCER------
Q87Y73_PSESM/9-169-----------------------------------AGEL--ARHAD---RLTVALQ--------------ACNA------
Q48J34_PSE14/4-169-----------------------------------AGEL--AKAYD---QSRIAGL--------------ACER------
A1AE00_ECOK1/10-160-----------------------------------YNAT--AAEAE---KYRIAGE--------------SCEQ------
Q88MI7_PSEPK/4-164-----------------------------------NREL--AKAYD---QSRIAGE--------------QCRR------
VG55_BPN15/14-172-----------------------------------AKYY--AERSD---ESYRAGM--------------TCQR------
Q9F9Z1_9ENTR/18-187-----------------------------------AGEL--AAYAD---RTRVKWQ--------------ACGR------
Q7WK95_BORBR/4-167-----------------------------------AEAL--AGVAD---RARIAGL--------------TCER------
B0KJQ0_PSEPG/12-176-----------------------------------AGDL--ATALE---RSRIAGL--------------TCEA------

PF04375

Q8XWW4_RALSO/305-691GQIVQVRRVDQTD----------------------ALLL--SSDQAWFLRENLKLWLMNARLALLSRNEAVFRADLGRAD
Q9HTT7_PSEAE/4-374NAGQDIR......----------------------.PLL--AGEQLAQVRLTIGLALEQAQWAALNGKQEVYEQALKQAQ
Q9CK22_PASMU/71-451NHFIRITPRNTSD----------------------KVLL--APNQDIYLRENIRLRLQIAIMAVPRQQDELYKQSLETVA
Q9KVM3_VIBCH/33-397DNFITFRSRDGNV----------------------IPLL--SPTQHFYLRENLQAKLETAIKGVYTEQQTLYRIALDTAA
HEMX_ECOLI/8-372DNFITIRRRDDTA----------------------VPLL--APNQDIYLRENIRSRLLVAAQAVPRHQEETYRQALENVS

PF04350

A3M9J2_ACIBT/73-221----------------------------------------LNYSIKAKTYRYVG--------------
B1KP68_SHEWM/48-192----------------------------------------LGMEIMAKTYRFKE--------------
A3L2L2_PSEAI/58-202----------------------------------------LRMSILAKTYRYND--------------
A1TKV8_ACIAC/65-211----------------------------------------LSMDATARTFRYLD--------------
Q0AF43_NITEC/50-192----------------------------------------LILNATAKTFRYLD--------------
A6T3F9_JANMA/58-199----------------------------------------LTLDAVAKTFRYLD--------------
Q9PGD1_XYLFA/51-201----------------------------------------LELSGTVKTYRYLD--------------
Q6AS36_DESPS/56-201----------------------------------------LTSNCQLVTYQFTN--------------
Q3JEG7_NITOC/49-192----------------------------------------LAMDITAKTYRYFA--------------
A5GEZ7_GEOUR/43-188----------------------------------------LKVNCLATTFRFID--------------
A8GZ26_SHEPA/51-192----------------------------------------LGMDILAKTYRFKE--------------
A4BQU6_9GAMM/49-200----------------------------------------LRMALSAKTYWYLA--------------
Q0I056_SHESR/48-192----------------------------------------LAMDILAKTYRFKE--------------
Q1ZLT6_PHOAS/47-193----------------------------------------LSLKVSATTYRFKM--------------
Q21UC1_RHOFD/65-206----------------------------------------LAMDATAKTFRYLD--------------
Q1GYG3_METFK/49-194----------------------------------------LVIEAVARTYRYLD--------------
A0Y285_9GAMM/56-197----------------------------------------LTFSVVAKTYRYEE--------------
A5EW42_DICNV/50-200----------------------------------------IDVSAQLQTYVYDS--------------
A3Y0G4_9VIBR/53-196----------------------------------------LHFRVRAYTYQFKS--------------
Q0EXA4_9PROT/51-193----------------------------------------LTVAGQAVTYRFVE--------------
Q1K2X2_DESAC/43-188----------------------------------------LSISNTVVTYRFVE--------------
Q46WJ0_CUPPJ/59-200----------------------------------------LTMEAVAMAYRTLD--------------
A7MXC8_VIBHB/47-190----------------------------------------LHFRVRANTYQFKP--------------
B7WV77_COMTE/66-211----------------------------------------LSMEATARTFRYLD--------------
A6F2X5_9ALTE/58-201----------------------------------------LNMQVLARTYRYRA--------------
Q2S9Q2_HAHCH/58-200----------------------------------------LSMDIQAKTYRYNA--------------
Q3SM92_THIDA/49-189----------------------------------------LNMDATVKTYRYLD--------------
Q1N2I2_9GAMM/61-205----------------------------------------LNLKIVAKTYRYNS--------------
Q08Z00_STIAD/19-166----------------------------------------LESSFVATTFRFVE--------------
Q0A4Z0_ALHEH/49-191----------------------------------------LGMNMTARTYWYLD--------------
A0Y8X2_9GAMM/58-199----------------------------------------LNMKITAKTYRYKD--------------
A0LFN6_SYNFM/50-195----------------------------------------LQVGCTIVTYRFVD--------------
Q1YS06_9GAMM/58-199----------------------------------------LNMQIDARTYRYKA--------------
D7HR04_VIBCL/50-193----------------------------------------LHFRVRAYTYQFKQ--------------
Q15Y40_PSEA6/54-194----------------------------------------LKLTLAAKTYRAEL--------------
Q1LI84_RALME/59-200----------------------------------------LSMEAVAMAYRALD--------------
B3E9T2_GEOLS/43-188----------------------------------------TKVNCLATTFRFLG--------------
Q306N4_MYXXD/43-190----------------------------------------LQSEFQATTFRFVE--------------
Q39X09_GEOMG/43-188----------------------------------------VKVNCLATTFRFLD--------------
Q8DCM4_VIBVU/47-190----------------------------------------LHFRVKANTYQFKS--------------
A0KN32_AERHH/49-192----------------------------------------IAMSMLAKTYKYNG--------------
B9M3J0_GEOSF/43-188----------------------------------------IKVNCLATTFRFLD--------------
Q1Q8Q5_PSYCK/75-221----------------------------------------LNLVLQTKTYRSKE--------------
Q74BL1_GEOSL/43-188----------------------------------------VKVNCLATTFRFIE--------------
B5E8I1_GEOBB/43-188----------------------------------------LKVSCLATTFRFLD--------------
Q489N7_COLP3/51-194----------------------------------------LNLKLQAKTYRYQE--------------
Q2BLX7_9GAMM/56-196----------------------------------------VTMNISAKTYRFDD--------------
O05128_NEIGO/50-200----------------------------------------LNLSAIATTYQAKS--------------
Q21H80_SACD2/59-202----------------------------------------LRLDILAKTYKYKA--------------
A5IFY3_LEGPC/49-198----------------------------------------LVMAITAKIYRYRA--------------
Q1QZY6_CHRSD/58-200----------------------------------------LRLSLLARTYSYRE--------------
Q5H3Q8_XANOR/51-201----------------------------------------LELSGTVKTYRYLD--------------
Q5E2F6_VIBF1/46-189----------------------------------------LHFRVMAYTYQFRG--------------
Q6F7E1_ACIAD/73-220----------------------------------------VDYAVKAKTYRYIG--------------
A1KBQ8_AZOSB/62-203----------------------------------------LKLNAKAITYRYLD--------------
A1SRB3_PSYIN/46-187----------------------------------------MTLNVIAKTYRYKE--------------
Q0VMB5_ALCBS/61-210----------------------------------------LRMDITAKTYRYSS--------------
Q7NZU0_CHRVO/47-188----------------------------------------LTMDATARTYRALE--------------
A1SB17_SHEAM/51-192----------------------------------------LTMDILAKTYRFKE--------------
Q2INP0_ANADE/50-195----------------------------------------LNGKFLATTFMFVE--------------
A0Z8J0_9GAMM/58-201----------------------------------------LEMNIVAKTYRYRD--------------
Q1Z012_PHOPR/47-192----------------------------------------LSLKVSASTYRFKA--------------
A4BAN3_9GAMM/60-209----------------------------------------LQMSIQAKTYRYKG--------------
A4A8J9_9GAMM/58-201----------------------------------------LSMNITAKTYRYKD--------------
Q47JL0_DECAR/63-205----------------------------------------LSLDATTKTFRYLD--------------
Q5P5N9_AROAE/61-202----------------------------------------LKLDARATTYRYLD--------------
Q12SM2_SHEDO/51-192----------------------------------------LSMNILAKTYRFKE--------------
A1WDV6_VEREI/65-209----------------------------------------LTLDATARTFRYLD--------------
A8ZSX7_DESOH/54-197----------------------------------------LSTQCTTVTYRFLS--------------
A6D0B8_9VIBR/44-187----------------------------------------LHFRVQAATYQLHE--------------
A6FBL6_9GAMM/49-190----------------------------------------LKVNMIARTYRYKG--------------
Q3A2N2_PELCD/43-188----------------------------------------LSVECKATTFQFID--------------
Q1ZHK9_9GAMM/46-187----------------------------------------LSLNVIAKTYRYKG--------------
Q4KJJ2_PSEF5/58-202----------------------------------------LRMSIEARTYRYDA--------------
Q60BY6_METCA/48-198----------------------------------------LVMTALVKTYRYLD--------------

PF10741

A9BY16_DELAS/76-187----------------------------------------LSAQFTVSIFR-----------------
A1WFQ5_VEREI/74-182----------------------------------------LSIQFDLFVLR-----------------
A1TUQ5_ACIAC/72-183----------------------------------------LSVAFGLSVLR-----------------
Q5P6R2_AROAE/78-190----------------------------------------LVGQLDLSVLH-----------------
A0Z1M0_9GAMM/71-181----------------------------------------LTVSLQLLSLR-----------------
A4A5M0_9GAMM/74-184----------------------------------------VTAVMQLMVLR-----------------
Q87ZW3_PSESM/77-193----------------------------------------LVVHLLVRGYL-----------------
B1J7E6_PSEPW/76-193----------------------------------------LEVHLLIRGYL-----------------
Q1QQ81_NITHX/73-181----------------------------------------LRILLTVSGQW-----------------
A5EBI2_BRASB/75-183----------------------------------------LRVLVTVSGQW-----------------
Q89HH7_BRAJA/79-189----------------------------------------VRVILGISGQW-----------------
Q2VNU3_9BACT/73-185----------------------------------------MRVQIDVSGLW-----------------
Q212Z0_RHOPB/75-181----------------------------------------LRVLLGVSGQW-----------------
A5EF22_BRASB/73-180----------------------------------------LRVTITVSGQW-----------------
A4YMS4_BRASO/72-179----------------------------------------LRVTITLSGQW-----------------
A7IH66_XANP2/71-186----------------------------------------LKVTFTAYGQW-----------------
Q5H4L2_XANOR/85-200----------------------------------------LDIAFELAGYL-----------------
Q3RHI6_XYLFA/76-191----------------------------------------LDVAFELAGFL-----------------
B4SJ91_STRM5/76-192----------------------------------------LDVSFELAGYL-----------------
Q609V5_METCA/84-198----------------------------------------LSIDFDAVGYM-----------------
Q3JD24_NITOC/76-192----------------------------------------LTISFELYGYM-----------------
B0T7N6_CAUSK/73-179----------------------------------------LLIRLQISALH-----------------
Q8KZ83_GLUDI/87-194----------------------------------------MECDMSVYAFR-----------------
Q0BR92_GRABC/89-202----------------------------------------IDMTMTVSALA-----------------
A5FWX4_ACICJ/79-187----------------------------------------LHASFTVSGFR-----------------
Q82WG9_NITEU/68-173----------------------------------------LSVELRIWAFA-----------------
Q9RW97_DEIRA/74-187----------------------------------------LGSTLGLTVYT-----------------
Q07N82_RHOP5/69-181----------------------------------------LQATLTLSAYW-----------------

PF03245

O80285_9CAUD/31-149----------------------------------------LQEYVRTQ.CL-----------------
A7MK05_CROS8/30-153----------------------------------------LQAYVREQ.CL-----------------
Q9ZXB6_BPH19/29-154----------------------------------------AQDYIRTQ.CT-----------------
Q7N318_PHOLL/26-149----------------------------------------LQDYIRAE.CQ-----------------
A1ACE3_ECOK1/29-154----------------------------------------AQEYIRTQ.CI-----------------
Q56118_9CAUD/29-155----------------------------------------AQDYIRTQ.CQ-----------------
Q1RCX8_ECOUT/33-157----------------------------------------TQKYINEQ.CR-----------------
Q2A0C4_9VIRU/30-151----------------------------------------LQDYVRQV.CL-----------------
Q76H63_9CAUD/29-154----------------------------------------LQEYIRTQ.CL-----------------
Q2A095_9VIRU/28-149----------------------------------------LQDYVRRV.CL-----------------
Q1I6B5_PSEE4/33-166----------------------------------------CQAYVRAL.AP-----------------
Q9KXD2_BPVT2/29-154----------------------------------------TQKYINEQ.CR-----------------
A7MLQ7_CROS8/30-153----------------------------------------LQAYVREQ.CL-----------------
Q48C47_PSE14/33-153----------------------------------------LQDYIRQV.VQ-----------------
A4WC46_ENT38/29-152----------------------------------------LQSYVREQ.CL-----------------
A2P359_VIBCL/23-146----------------------------------------LQEYIKTQ.CL-----------------
B0KHE2_PSEPG/21-146----------------------------------------LQDWVSKA.CP-----------------
Q1GXR8_METFK/50-191----------------------------------------CQALLRAD.RQ-----------------
Q8X2A4_ECO57/29-154----------------------------------------LQEYIRTQ.CI-----------------
A4WB39_ENT38/29-154----------------------------------------LQEYINTQ.CL-----------------
Q7N0Y2_PHOLL/26-149----------------------------------------LQEYIKTQ.CQ-----------------
Q1VCK5_VIBAL/31-155----------------------------------------LQDYIRTQ.CL-----------------
B1JDA4_PSEPW/32-158----------------------------------------CQDYVRGL.LR-----------------
A6UZ52_PSEA7/32-149----------------------------------------LQDYARS..CS-----------------
A1JLU8_YERE8/29-147----------------------------------------LQEYINKV.CL-----------------
Q7CID8_YERPE/26-151----------------------------------------LQDYITNV.CL-----------------
A8CGF5_BPP22/29-144----------------------------------------LQEYIRSQ.CL-----------------
Q8XYQ5_RALSO/38-173----------------------------------------FQGRERAIQTR-----------------
Q2NV02_SODGM/25-149----------------------------------------LQDYARQV.CL-----------------
Q6HAE1_9ENTR/26-151----------------------------------------LQSYIRQF.CL-----------------

PF05137

D4BI19_9ENTR/97-171................QG.......RWQ............FHYRLTR---------------------
C7R7X0_KANKD/100-176..............KGIP.......AQI............FVLEAEQ---------------------
C7QTE2_CYAP0/114-206......TPSEDITIDYPQ.......GVK............YTISTEL---------------------
C6BWY3_DESAD/355-431...............QGQ.......GFR............FVVELDF---------------------
D3SD46_THISK/100-177.............DGSLQ.......VRD............FRLDANQ---------------------
C8X4Y9_DESRD/100-179.............VQNLD.......LVE............FQTEIST---------------------
D0L237_HALNC/100-184.............NPDKKGP..SSNRYV............FSITASV---------------------
D0WBB7_NEILA/103-177.................S.......YQE............FTLQATL---------------------
D2ZYQ1_NEIMU/103-177.................N.......YQE............FNIKSMI---------------------
D2Z429_9BACT/103-180.............REGTS.......LVE............FRLLCSI---------------------
B2FNI0_STRMK/286-360.............GAASG.......RDR............FTMTAEL---------------------
B1EI39_9ESCH/97-171.........................RWQ............FEYQLTR---------------------
C1DHR0_AZOVD/100-178............AGALDQ.......ANV............FRLSVRQ---------------------
Q1N2I1_9GAMM/100-174................NG.......FND............FDLLVDQ---------------------
Q7NZT9_CHRVO/100-177.............VNNQR.......VSA............FTLNAGI---------------------
A8T9N5_9VIBR/101-179............VRFGKE.......FQT............FRVSFMF---------------------
B3R7C3_CUPTR/105-187..........NNLREQRR.......LFD............FSMRFAY---------------------
Q74C93_GEOSL/96-176............VGEKQK.......GIS............FTVTCKV---------------------
B9TC62_RICCO/24-102............NALSVK.......EYE............FVLRVYL---------------------
A8GZ25_SHEPA/100-177.............EELRQ.......LQR............FTLRVTI---------------------
Q74BL0_GEOSL/100-177.............IGGVK.......AKR............FELTCVI---------------------
Q061N8_9SYNE/111-200.............SSGNQTTAATNGRVM............YSLIAEF---------------------
A4G9P6_HERAR/100-182...........QGKDAKR.......VFE............FTINAGI---------------------
Q1IRM8_KORVE/109-189............GVKDYQ.......AFN............FTLTCEK---------------------
C4K8E6_HAMD5/100-172.........................KGV............FYFTIAI---------------------
A0YSX4_LYNSP/116-236VD..ESQGGSNNL.....PD..LQPVVE............YKIETNL---------------------
Q21H79_SACD2/100-177.............ELGEQ.......AAK............FTIHLKM---------------------
D6SKS7_9DELT/355-426................GE.......RDR............FSLEAVV---------------------
Q1Q6D7_9BACT/347-419...............QSG.......REK............FRIKGKV---------------------
A5EF21_BRASB/284-357..............VDGT.......GER............FRIEADI---------------------
B4UDC4_ANASK/100-177.............DKTFR.......LVE............FALSANV---------------------
F2G6J6_ALTMD/100-177.............STARA.......ISN............FTLTFSI---------------------
Q5P5N8_AROAE/100-177.............LNNRR.......VSE............FALNIGI---------------------
A5GEZ6_GEOUR/100-177.............ISGTK.......VKK............FDITFIL---------------------
A1ARQ3_PELPD/96-177............LGEKGR.......GVG............FSISCRA---------------------
B5JTT5_9GAMM/102-177............D...AD.......GAA............FSLEVTQ---------------------
Q1PJI8_PROMR/111-194............SNTKSK.......EYL............FEIKTKI---------------------
B2Q5V2_PROST/100-173................RQ.......VNY............LHVSAHY---------------------
Q0BZ78_HYPNA/235-307............PEGKQK......................FVILITE---------------------
Q87L63_VIBPA/101-179............ARFGKE.......FQT............FKVSFMF---------------------
B4VRN9_9CYAN/118-234VPEKEGGETVAEIT....YE..LPKVVG............YTVETSL---------------------
B8D2D6_HALOH/94-167.........................DLS............FQIKAGV---------------------
Q4FQH8_PSYA2/100-200PV...LENTVTTPGEQQRPIYPEDSYVQ............FVITTKV---------------------
P74187_SYNY3/116-221GATAETGGTEEPSADQAASGVVIPAGVS............YTIQTEI---------------------
Q3IJC1_PSEHT/100-177.............KSSRL.......LSD............FNMEFYV---------------------
A5WCG1_PSYWF/77-165...........AIKEDETIKILPAANMD............FVISSQH---------------------
A5KTK0_9BACT/97-178.............PDNTS.......TTG............YGLTVTL---------------------
Q6LVG0_PHOPR/101-179............GINSED.......LTS............FKASFSM---------------------
Q2JVP2_SYNJA/119-199..................GTPETEPSVT............YGLTVTI---------------------
C5BRK2_TERTT/100-177.............ADGEQ.......ASR............FKMDLMA---------------------
Q31KD7_SYNE7/115-203G....ENSPKLSN.............VN............YRIVGEL---------------------
Q05VH9_9SYNE/427-512.............KDDAS.......TVS............FSLTWAL---------------------
Q212Y9_RHOPB/275-348..............ANEP.......GER............FHIEARL---------------------
A0Z1L9_9GAMM/260-333..............GNTG.......LEQ............FFLDIQL---------------------
Q8YY23_NOSS1/115-220..........VQAGSGNSAGIKPPQVVK............YTIQSSL---------------------
A3CR63_STRSV/106-183.............KDNNT.......VYK............FNIKILT---------------------
A3LJ85_PSEAI/100-178............QGAVDQ.......ANV............FQLTVQQ---------------------
Q7NA52_PHOLL/101-175................QQ.......IRQ............FIIDANW---------------------
B4A5T7_SALNE/97-171.........................RWQ............FHYQLTR---------------------
Q21T59_RHOFD/119-218LAGTAVPAAVSASASAAR......PMWS............FSLVSAL---------------------
Q7MH79_VIBVY/111-189............KRFGKS.......FQT............FTVSFVF---------------------
B6SE77_9NEIS/102-181.................D.......GQQ............FILNALL---------------------
B5EI36_GEOBB/95-175............VGKSQQ.......GIG............FTISCKV---------------------
A4YMS3_BRASO/280-353..............AEEA.......GER............FRIEAGI---------------------
A8MGF2_ALKOO/105-178........................GYYD............FTLNVTM---------------------
B2TQM7_CLOBB/105-181............ALEG.........NYS............FDIKCIL---------------------
Q988B3_RHILO/273-346..............PGQD.......GEH............FTISAKI---------------------
Q82SK2_NITEU/100-177.............ANGIR.......LSE............FDLNVRL---------------------
Q2S9Q1_HAHCH/100-176..............DGES.......KST............FNMTVKQ---------------------
C0N3G0_9GAMM/100-177.............SKDNA.......IRK............FTVEVNE---------------------
B8E235_DICTD/101-179.............EPPLV.......SIN............FRIVAQY---------------------
Q7NHV0_GLOVI/113-196............K.....DG..TPATVA............YKIEARL---------------------
A3JEF9_9ALTE/100-177.............ARRAG.......YSQ............FNLSVSQ---------------------
A7H854_ANADF/100-177.............DGGFR.......TVD............FTLTATV---------------------
Q8RAF0_THETN/99-173................KN.......VYK............YVIQVKV---------------------
A0ZCZ0_NODSP/113-219..........PPGTNENDVEIKLPPVVR............YTIKSTM---------------------
Q1K2X1_DESAC/100-177.............SGGLR.......LQN............FELSCKV---------------------
B2FSH6_STRMK/100-187...............GDK.......SAAGPVSDIKALPYMFKVTVKL---------------------
B6EM38_ALISL/101-179............TMFGHE.......MSR............FDVSFRL---------------------
A7IH65_XANP2/278-351..............PGEA.......GER............FQISARV---------------------
Q3KJA6_PSEPF/100-178............AGQVDQ.......ANV............FQLTVRQ---------------------
B7DM24_9BACL/96-194GAGQMALGHAIVAGSGGTS.....YRYD............YMLTVVL---------------------
Q2P6L7_XANOM/100-189............QDKAGQ.......PGASSMDT.KTLPYVFTLKVKL---------------------
B0C6K6_ACAM1/111-215..........TQVS...........LVQ............HQLETTI---------------------
B7S0Z0_9GAMM/110-187.............TYGDQ.......ATT............FNLTVKV---------------------
B1BAN5_CLOBO/105-183............NDENSY.......SFN............FNISFKL---------------------
C1I9R3_9CLOT/106-178.........................IYT............FDIKCVL---------------------
B1Y308_LEPCP/100-183..........PNARDQKR.......LFD............FSVRLTL---------------------
A1SRB2_PSYIN/100-177.............TEPIK.......LSQ............FVMKFVV---------------------
Q4KJJ3_PSEF5/100-178.............DAQQG.......LNN...........LFRLNVGQ---------------------
B8KUT7_9GAMM/100-177.............EFGDQ.......AAT............FTLTVGV---------------------
A1HQ13_9FIRM/97-173............ARTVTR......................FELTVKV---------------------
B9YYQ5_9NEIS/100-177.............VNNQR.......VSE............FTLRLGM---------------------
B9M3J1_GEOSF/100-177.............IAKTK.......AKR............FDITLKL---------------------
B5FBN6_VIBFM/101-179............KIFGHD.......VSS............FEVSFKL---------------------
C0QK71_DESAH/391-463............KEGNEK......................FKIGLKV---------------------
B7KDY8_CYAP7/115-226NK..ENLTENNLI.....IT..FPKGIQ............YTIVTQL---------------------
B8KB93_VIBPA/101-179............PRFNKK.......FQS............FNVSFSF---------------------
Q8RHE9_FUSNN/314-386........................................IEFKLEI---------------------
A3Z3C8_9SYNE/419-506.............DDGGPV.....QAVT............FSLTWGL---------------------
F2G3R3_ALTMD/118-196............VEDTDN.......VKQ............FLISTDF---------------------
B3E9T1_GEOLS/100-177.............VSGTK.......LKR............FDLTFRI---------------------
B5E8I0_GEOBB/100-177.............TAGVK.......AKR............FELQVQI---------------------
B8ESJ7_METSB/292-365..............PSDA.......GQH............FFIEAHI---------------------
A9BY15_DELAS/240-313..............SGSN.......KES............YTVEAVL---------------------
B1Y072_LEPCP/116-203............VEAGAEGNLAISAYTE............FVLRTQL---------------------
B2J1B9_NOSP7/115-223.........PGAAQPSSGVTIKPPQVVK............YTIQSGM---------------------
C4ZLJ2_THASP/100-177.............QDNRR.......LSE............FSLDIAI---------------------
A0KN33_AERHH/100-177.............VAPVS.......LSQ............FSMMFQV---------------------
A1AMQ0_PELPD/100-177.............MDGSK.......IKR............FDLACKL---------------------
C4GJE0_9NEIS/102-182.................N.......GQE............FKITANL---------------------
Q0A4Z1_ALHEH/100-180...........DGEGQPR.......YYN............FAARTTQ---------------------
C4Z597_EUBE2/445-523............DSLGIS.......QAT............FSLSCTF---------------------
A6FBL5_9GAMM/100-175............AEEGNR......................FEMRFSV---------------------
Q12FF4_POLSJ/100-183..........LSQRDQRR.......VAN............FSMRVGL---------------------
A1JSD8_YERE8/100-174................DG.......HFR............FLAHADW---------------------
Q5ZX05_LEGPH/100-178............EKKQSP.......NNE............FKLSFVL---------------------
Q0AIN5_NITEC/95-174.............DDSHH.......PIV............FSIMATW---------------------
A5FWX5_ACICJ/271-344..............LNGG.......GDV............FSIRVRL---------------------
B0JRP4_MICAN/116-221.........QVDN.KYKNINVTFPQAVQ............FVITAQL---------------------
B9MDE7_ACIET/100-183..........LTPKDQRR.......VAS............FNLRFRL---------------------
Q1NNC6_9DELT/33-111.............VGGHR.......LQS............FTLNISI---------------------
C0DV41_EIKCO/103-177.................S.......VQE............FELTVAV---------------------
C3JZE1_PSEFS/252-326..............AQTG.......KDQ............FSLRAHL---------------------
Q609V6_METCA/282-355..............VSNG.......LER............FQIASDA---------------------
C3MFK9_RHISN/275-348..............PGFE.......GDR............FTISFRQ---------------------
B5ZIQ8_GLUDA/257-330..............EGQN.......ASL............FSIRADV---------------------
A6TTT3_ALKMQ/105-178........................GFYS............FSITFKV---------------------
Q1YS07_9GAMM/100-177.............RMGEQ.......GSV............FDLQVEI---------------------
B0U6Y4_XYLFM/289-362..............VGSS.......VNR............FVITAEL---------------------
C4LB15_TOLAT/100-177.............TTLMK.......LSE............FSMRFSV---------------------
Q1IGB1_PSEE4/101-174.................G.......GDE............FVVTARL---------------------
B5YJ53_THEYD/106-182.............FEKQA.......VYK............FIIKFKL---------------------
Q6MPI9_BDEBA/121-198.............TDGVS.......LKK............FEISCLL---------------------
A8AQU9_CITK8/73-147.........................RWQ............FHYPLKR---------------------
C0QLC6_DESAH/100-179............IDKTLQ.......MKE............FELLCNK---------------------
B1XPF2_SYNP2/120-215QV...DFPRPVAS.....FS..MPQVVD............YTVSISL---------------------
Q0EXA3_9PROT/100-177.............VNNLP.......VRK............FSLKVTR---------------------
Q3JD25_NITOC/289-364..............ARTG.......RDR............FHITAQI---------------------
Q1QZY7_CHRSD/101-177..............GVPS.......LKR............FNLSVET---------------------
A3RW17_RALSL/108-190..........NNLKEQRR.......LFN............FTIRFTW---------------------
Q08YZ9_STIAD/84-208.............TKGGSGDLNPLTTVK............FNLMLTA---------------------
Q6AS37_DESPS/100-178.............VSGRN.......LKK............FSLTCAV---------------------
A0Z8I9_9GAMM/100-177.............SYGDQ.......ATT............FKLTVSV---------------------
Q1ZHK8_9GAMM/100-177.............DTDIK.......WYQ............FSMEFKV---------------------
B6BVV6_9PROT/465-539.............RSMNF......................FELVGVI---------------------
B9JMG5_AGRRK/265-338..............PGQE.......GER............FSIQMRI---------------------
Q21UC2_RHOFD/100-183..........LAPREQRR.......VAN............FTIRVRL---------------------
Q3SM93_THIDA/100-177.............VNNLR.......ANE............FVLTVKQ---------------------
B7WVX0_COMTE/100-183..........VTAKDKRR.......AAA............FTLRFNL---------------------
C4IH38_CLOBU/105-181............AVEG.........EYS............FDIKCVL---------------------
C0EQU7_NEIFL/103-177.................N.......YQE............FTLKSSI---------------------
A2SKH6_METPP/100-183..........TPNREQKR.......LFD............FVVKVGL---------------------
B6J4A1_COXB1/85-157.........................YVS............FTLRLSR---------------------
A3YUA5_9SYNE/109-199............TDPNQPKKGPESGLVE............FELSAAF---------------------
B3PI74_CELJU/100-177.............SEGEQ.......ASS............FKMTVQT---------------------
B5YEE0_DICT6/384-462.............LQNRQ.......IQR............FEIVGYI---------------------
B5XTU2_KLEP3/97-171.........................RWQ............FSFTLAE---------------------
Q3R4G6_XYLFA/100-184.........................QDKNTLIDSRALPYVFTIKAKL---------------------
A2PCR9_VIBCL/103-181............KRFGKQ.......FQS............FKVSFQF---------------------
A1WFQ6_VEREI/278-351..............PGAS.......KDI............FSIELTL---------------------
Q489N8_COLP3/100-177.............GSPKL.......LSS............FKMKVKI---------------------
A4BAN2_9GAMM/100-178............EGSEVV.......GHN............FKLRINR---------------------
A5EBI1_BRASB/276-349..............AGEA.......GER............FHIEARI---------------------
A0Y8X3_9GAMM/100-177.............EYGEQ.......ASE............FNMLFSI---------------------
Q306N5_MYXXD/101-221.................GAQVGVPILVE............FKITMTS---------------------
Q60BY7_METCA/110-193..........GRGKEREK.......GSR............FTLRMKQ---------------------
A9BA85_PROM4/113-200..............QLASLDEGDGFNLR............FKILGEV---------------------
Q2VNU4_9BACT/249-322..............PSES.......GER............FSIEAHI---------------------
Q2BLX6_9GAMM/100-174................ED.......SNS............FNLNVPV---------------------
Q07N81_RHOP5/265-338..............DDGR.......ADH............FQLQMRA---------------------
A0LPH8_SYNFM/376-449..............PSSD.......MER............FNVQVQI---------------------
Q89HH6_BRAJA/288-361..............PSDP.......GER............FHIEAQI---------------------
Q2C0P4_9GAMM/101-179............GSQSEQ.......LSQ............FNASFDL---------------------
C5CQG6_VARPS/100-183..........LSQRDQRR.......VAN............FTMRIGL---------------------
B2A7F7_NATTJ/100-174..............GAYY......................FNINGEL---------------------
Q47JL1_DECAR/100-177.............VNGRR.......VYE............