Sequence alignment for CL0332

PF02261

PAND_FRASN/1-116----MFRTML------------------NSKIHRATV--TQADLHYVGSVTID--------ADLMAAADLLPGEQ-----
PAND_DELAS/1-116----MFRTLL------------------KSKIHRVKT--TQCELHYEGSCAID--------EDLLDAANIVENEQ-----
PAND_THEP3/1-116----MQRFMM------------------KSKIHRAIV--TDANLNYQGSITID--------KNLMELADILPNEK-----
PAND_CHLPB/1-116----MRVHLL------------------KSKIHNAVV--TSGDLQYEGSITID--------SELLDLANMIPNEK-----
PAND_EXIS2/1-116----MLRTFM------------------HAKLHKARV--TEANLHYVGSITID--------EDLLDAVGILENEK-----
PAND_HYDS0/1-114----MKRHIL------------------RAKIHRATV--TGANLNYEGSISID--------ERLLEAGKFVVFEK-----
PAND_CLOCE/1-116----MNITLL------------------SGKIHRATV--TQAELNYVGSITID--------QDLLEAAGIMEYEK-----
PAND1_RHILO/1-115----M.RKLV------------------AGKLHGIHV--TEANLNYHGSITLD--------PDHCEAAGILPMEF-----
PAND_YERPA/1-116----MIRTML------------------QGKLHRVKV--TQADLHYEGSCAID--------QDFLEAAGILEYEA-----
PAND_SYNFM/1-116----MQRLML------------------KSKIHRARV--TEANLHYEGSLTID--------ETLMKAADILPYEQ-----
PAND_XANC8/1-116----MHLSLL------------------KAKIHRATV--THSELNYEGSIAID--------GLLLEATGIREFEQ-----
PAND_STAAE/1-116----MIRTMM------------------NAKIHRARV--TESNLNYVGSITID--------SDILEAVDILPNEK-----
A3Y5M2_9GAMM/1-116----MQITLL------------------KGKLHMACV--TQAELWYDGSCAID--------SDLVKLAGLREFEK-----
PAND_FRATT/1-110----MLISVL------------------KSKISYATV--TGKDLFYVGSITID--------SEIMKQANIIENEK-----
PAND_SYNWW/1-116----MLRHML------------------KSKIHRAVV--TDANLNYVGSITID--------RDLMDAADILENEK-----
PAND_BACTN/1-117----MMIEVL------------------KSKIHCARV--TEANLNYMGSITID--------EDLLDAANMIPGEK-----
PAND_MYCTU/1-116----MLRTML------------------KSKIHRATV--TCADLHYVGSVTID--------ADLMDAADLLEGEQ-----
PAND_PSYWF/1-116----MLLTLL------------------KGKLHRARV--THADLHYEGSCGID--------GDLLDLAGIRENES-----
PAND_SYNAS/1-116----MQRLML------------------KSKIHRATV--TDADLHYEGSISID--------EALMEAADLLPYEK-----
PAND_HALWD/1-112----MRRWLL------------------KSKLHRARV--TGTEKDYEGSISID--------AALLSEADIAVGEQ-----
A5FR67_DEHSB/1-115----M.RIML------------------KSKIHRATI--TDACIDYEGSITID--------KNLMQAANLLPYEQ-----
Q2BMJ5_9GAMM/1-114----MLQTFL------------------KCKLHRVTV--THAELHYEGSCAID--------GVLLDKSGIREYEL-----
A2TRK7_9FLAO/1-116----MLVNVV------------------KSKIHRVKV--TGAELHYIGSITID--------EDLMDASKIIEGER-----
PAND_ANADF/1-116----MRRTFF------------------KSKIHRATV--THADLDYEGSVSID--------EDLLDASGILEYEA-----
PAND_METCA/1-116----MQTTML------------------KAKLHRARV--THSELEYEGSCAID--------GSLLDCAGIREYEQ-----
PAND_CAUCR/1-116----MLLTML------------------KAKLHRATV--TQADLDYEGSIAID--------RDLLDASGILPNEQ-----
PAND_LEGPL/2-117----AYRKML------------------KSKIHRACV--TQADLDYEGSITIS--------PELLKAANILPYEA-----
PAND_HYPNA/1-116----MILSML------------------KAKLHGATV--TQCDLHYEGSVSID--------QDLLDASGILPHEK-----
PAND_BURM7/1-117----MQRHML------------------KSKIHRAAV--THCELHYEGSCAID--------EDLLEAANIVENER-----
PAND_SHIFL/1-116----MIRTML------------------QGKLHRVKV--THADLHYEGSCAID--------QDFLDAAGILENEA-----
A1HRR3_9FIRM/1-116----MFRTLF------------------KSKLHRATV--TEACLNYVGSITID--------EDLMDAADILINEK-----
Q1Q7I9_9BACT/1-116----MLREMC------------------KSKIHGATV--TETNLEYNGSITID--------KSLLTAVDILHYER-----
Q4MSV5_BACCE/1-116----MFRTMM------------------RAKLHRATV--TEANLNYVGSITID--------EDLMDAVNIVENEK-----
A6DE22_9PROT/1-116----MTIEML------------------YSKIHRATV--TDANLNYVGSITID--------EELMQEANLLVGQK-----
PAND_HELHP/1-115----MQFEML------------------YSKIHRAKV--SDANLNYVGSITID--------KTLAQSANLLAGMK-----
PAND_DECAR/1-116----MQRTML------------------KSKLHRVTA--THADLHYEGSCAID--------EDLLEAANIKEYEQ-----
Q1NKA1_9DELT/1-116----MLRTML------------------KSKIHRATV--VDAELHYEGSLAVD--------AELMAAVDLAPFER-----
PAND_HELAH/1-115----MTFEML------------------YSKIHRATI--TDANLNYVGSITID--------ENLAKLAKLREGMK-----
PAND_FERNB/1-114----MMEIML------------------KAKIHMATV--TEKEIEYEGSIGID--------EELLELSGIKINEM-----
PAND_CARHZ/1-116----MFLTMM------------------KGKIHRATV--TEANLNYVGSITID--------EELLDASGILPNEK-----
PAND_PELCD/1-116----MKRKML------------------KSKIHRATV--TGADLHYEGSITID--------SELMKQADILPYEA-----
Q3Y069_ENTFC/1-116----MKVTML------------------KGKIHRATV--EQAELDYVGSITVD--------MNLLEAAGIYEYEK-----
PAND_PELPD/1-116----MERIML------------------KSKIHRATI--TGADLEYEGSITID--------RDLMDAADIVSYEK-----
PAND_CORGL/1-116----MLRTIL------------------GSKIHRATV--TQADLDYVGSVTID--------ADLVHAAGLIEGEK-----
PAND_CORJK/1-116----MLRTML------------------KSKIHRATV--TQADLHYVGSCTID--------ADLMEAADILEGEQ-----
PAND_SALTO/1-116----MLRTML------------------KSKIHRATV--TQADLHYVGSVTVD--------QDLLDAADLLPGEQ-----
A5FLR1_FLAJ1/1-116----MQIQVI------------------KSKIHRVKV--TGADLNYIGSITID--------ETLLEASNIIEGEK-----
Q4EEK3_LISMN/1-116----MFRTMM------------------NGKIHRATV--TEANLNYVGSITID--------SAILEAVDMLPNEK-----
PAND_THEM4/1-114----MQEILL------------------KSKIHMAKV--TDKSINYMGSIGID--------VELLEKSNIKPYEL-----
PAND_LACPL/1-116----MLIDML------------------KGKIHRATV--TQADLEYVGSITID--------ETLMEASGILEYEK-----
PAND_CLOB8/1-116----MILTML------------------KGKIHRATV--TQAELNYVGSITID--------KTLMEAAGILENEK-----
A0ZJP2_NODSP/1-116----MQRTVL------------------LAKIHNCTL--TGANINYVGSISID--------EVLLDKAGILPYEQ-----
PAND_NEIG1/1-116----MFRTIL------------------GGKIHRATV--TEADLNYVGSITVD--------QDLLDAAGICPNEK-----
PAND_RHOBA/5-120----PYRKML------------------AAKIHRATV--TGADVNYEGSLTVP--------PELLVAAKIHPYES-----
PAND_POLSQ/1-116----MNRIML------------------LAKIHRATV--TEADLHYEGSCGID--------EDLLDAANMREFEK-----
PAND_ARTS2/1-116----MNRTMF------------------KSKIHRATV--THADLHYVGSVTVD--------LDLLEAADILPGEL-----
A3YJG2_CAMJU/1-115----MNITLL------------------KSKIHRASV--TEARLDYIGSISID--------EKLLQASGILEYEK-----
C6BDP6_RALP1/1-116----MQRNML------------------RAKLHRATV--TQADLDYEGSCGID--------EDLLDAADMREYEK-----
PAND_BRAJA/1-116----MQITLM------------------KGKIHRASV--TEADLHYEGSISID--------RTLLEAAGMVINER-----
A5HYW7_CLOBH/1-116----MTITML------------------KSKIHRATV--TEANLNYVGSITID--------KYLMDKANILEYEK-----
PAND_BACLD/1-116----MYRTLM------------------SAKLHRARV--TEANLNYVGSVTID--------EDLLDAVGMMANEK-----
PAND_CAMFF/1-115----MEIEML------------------YSKIHRATV--TDANLNYVGSITID--------ERLMKAANLLEFQK-----
PAND_ALCBS/1-116----MQCTML------------------KAKLHQARV--THAELEYEGSCAID--------GDLMDMAGILEYEQ-----
PAND_CALS8/1-116----MLIEVL------------------KSKIHRATV--TEANLNYVGSITID--------EELMEAAGILENEK-----
PAND_BORA1/1-116----MQRIML------------------RAKLHRVTV--TEADLHYEGSCGID--------EDLLDAAGMREFER-----
PAND_SACEN/1-116----MFRTML------------------KSKIHRATV--TQADLHYVGSVTVD--------ADLMDAADLLEGEQ-----
PAND_ARCB4/1-116----MTFEML------------------YSKIHRATV--SDANLNYVGSITID--------EDLMKAANLRVGQK-----
PAND_DEIRA/1-116----MERIMF------------------RAKIHRATV--TQADLDYVGSVTID--------QDLLDAADILVNEK-----
PAND_METFK/1-116----MQRTML------------------KSKLHRVHV--THSELDYEGSCAID--------EALLEAADIKEYQQ-----
A3LK27_PSEAI/1-116----MHAIML------------------KAKLHRAEV--THAVLDYEGSCAID--------GDWLDLSGIREYEQ-----
PAND_HALHL/1-116----MQLNML------------------KGKLHQARV--TQTELEYEGSCAID--------LDLLEAVGIHEYEQ-----
PAND_BACP2/1-116----MYRTFM------------------TSKLHKATV--TEANLHYVGSITID--------EDLLDAAGMMANEK-----
PAND_DESPS/1-116----MLHQMM------------------KAKLHRATI--SAADLNYEGSLTID--------TDLLKASGIRPYER-----
A6CRW6_9BACI/1-116----MFRTMM------------------SGKIHRATV--TEANLNYVGSITID--------QDILDSVGMLPNEK-----
PAND_ALHEH/1-116----MQLNML------------------KCKLHQACV--TDTELDYEGSCAID--------ANLMDAAGIREFEQ-----
PAND_MOOTA/1-116----MWRIMM------------------KSKLHRATV--TAADLNYIGSITID--------SDLMAAADILPNEK-----
PAND_ACIC1/1-116----MLRTML------------------HAKIHRATV--TRADLHYVGSITLD--------LDLMEAADILPGEL-----
A4J0V8_DESRM/1-116----MLLFMF------------------KSKIHRATV--TEANLNYMGSITID--------QELMKAAGILPNEK-----
PAND_RHOFD/1-116----MLRTLL------------------KSKIHRATV--TDCELHYEGSCAID--------EDLLDAANLLENEQ-----
Q4HTD1_CAMUP/1-115----MQITML------------------KSKIHRATV--SEARLDYVGSISID--------EELLKASGLYEYEK-----
Q2B3X0_9BACI/1-116----MFRTMM------------------NGKIHRAKV--TEANLNYVGSITID--------KDLLDAAGMADNEK-----
PAND_PORGI/1-117----MYVEVL------------------KSKIHRVTI--TEANLNYVGSITID--------EDLMDAANIIAGEK-----
PAND_MYCS2/1-116----MQRVLL------------------ASKIHRATV--TQADLHYVGSITID--------AELMAAADIVEGEQ-----
A7AC80_9PORP/1-117----MFIEVV------------------KSKIHRVTV--TEANLNYIGSITVD--------EDLLDAANLIANEK-----
PAND_GEOKA/1-116----MFRTLM------------------NAKIHRARV--TEANLDYVGSITID--------EDILDAVGIVANEK-----
A5Z641_9FIRM/1-116----MQINML------------------KSKIHRATV--VQSELDYVGSITVD--------EDLMDASGIYEYEK-----
PAND_MAGSA/2-116----M..KII------------------RAKLHGIRV--TNADLNYHGSITLD--------PEQCEMAGIYPMEF-----
PAND_SULDN/1-116----MTIEML------------------YSKIHRATV--TDANLNYVGSITVD--------EELLEASMLRVGQK-----
PAND_NITOC/1-116----MYLTLL------------------KSKLHRACV--THIELEYEGSCAID--------SVLLSTAGIQEYEQ-----
A1ZXU1_9BACT/1-116----MLVEVL------------------HSKIHRAKV--TQAELHYVGSITID--------EDLMDAAGLFENQK-----
PAND_AQUAE/1-116----MLREML------------------KSKIHRLTV--TDADLHYEGSLSLD--------EYLMELADLKPFEK-----
PAND_CLOAB/1-116----MHLNML------------------KSKIHRATV--VQADLNYVGSITID--------RNLMDKANILEYEK-----
Q0F249_9PROT/1-116----MKLTML------------------KSKVHRATV--THAELDYEGSCAID--------QDLLDAANILQFEQ-----
A3EU20_9BACT/1-116----MLRSML------------------RSKIHRATV--TESDLEYEGSLTLD--------EKLMEASGLLPFEQ-----
Q1N0Z0_9GAMM/1-116----MQSIML------------------KAKLHQARV--THAVLEYEGSCAID--------GNLLDMAGIQEYEQ-----
A6EB29_9SPHI/1-116----MIIEVL------------------KSKIHRVRV--TQAELNYVGSITID--------EDLMDAAQIIANEK-----
PAND_SALRD/1-116----MDLSML------------------RAKLHRLRV--TEADLYYEGSITID--------EELLDAAGLLPYEK-----
PAND_CLONN/1-116----MELNML------------------KSKIHRVTV--TQAELSYVGSITID--------KALMKAANILEYEK-----
A4CIR3_ROBBH/1-116----MQIEVV------------------KSKIHRVRV--TGADLNYIGSITID--------EDLMDAANIIQGEK-----
PAND_THICR/1-116----MQITLL------------------KSKLHRVTT--THSELDYEGSCAID--------GHFLEVAGIREYEQ-----
PAND_LEPBL/1-116----MQITVM------------------KGKIHRATV--TDADLNYEGSLTVD--------MDLVDAAGMRVYEK-----
A3UFV3_9RHOB/1-116----MQLTMM------------------KTKLHRAAV--TQADLHYEGSISID--------QDLLDAAGILVNEQ-----
PAND_ACIAD/1-116----MLSRLL------------------KCKIHRAVV--THAELHYEGSCAID--------GVLMDLAGIREYEE-----
A5YSZ1_9EURY/2-113----SQRQFF------------------YAKIHRATV--TQTNPDYDGSITID--------DQLLTAASIKPFER-----
A6QCL0_SULNB/1-116----MNITML------------------YSKLHRATV--TDANLNYVGSITID--------QNLLDAASMRVGQK-----
PAND_WOLSU/1-116----MKFDML------------------WSKIHRATV--TDANLNYVGSITID--------EELMEAAELLVGQK-----
A4D939_9NOSO/1-111----M.RIML------------------KSKIHRATV--TEANVNYIGSITVD--------KVLMEKADILPGEK-----
PAND_THIDA/1-116----MQRTML------------------KSKLHRATV--THSELHYEGSCAID--------ESLLEAANIHEYEQ-----
PAND_TRIEI/2-119----TTIKLM------------------HAKLHRVRV--TDAKPDYVGSVTID--------SDLLEKVGILPLEE-----
Q1VSW7_9FLAO/1-115----MQIHLI------------------KSKIHRVTV--TGANLNYIGSITID--------ENLMDAANLVEGEK-----
PAND_CHRSD/1-116----MYTIML------------------KAKLHMARV--THAVLDYEGSCAID--------GELLDLAGIRENEQ-----
PAND_PELTS/1-116----MFLTML------------------KSKIHRATV--TESNLNYMGSITID--------EELMEAADILPNEK-----
PAND_OCEIH/1-116----MYRTMM------------------KSKIHRAVV--TEANLNYVGSITID--------EAILNQVDILPNEK-----
A3ZRB8_9PLAN/1-116----MIRTFL------------------KSKIHRATC--TEACLDYEGSVTID--------SLLMDAADLLDHEQ-----
A6DL83_9BACT/1-117----MKLEVL------------------KSKIHKAVV--TQADLNYEGSLGID--------QDLMDKVGLLPYEK-----
A3THR8_9MICO/1-116----MYRYML------------------HSKIHRATV--TQADLHYVGSLTID--------LDLMEAADLLPGQQ-----
A7B9U1_9ACTO/4-119----MTREMA------------------IGKIHRAVV--TGADLHYVGSITVD--------EDLLDAANIVPGQK-----
PAND_CLOTH/1-116----MFITLM------------------KSKIHRATV--TEANLDYVGSITID--------EDLMEAADIMENEK-----
PAND_BDEBA/1-114----MNISLL------------------RTKIHRATV--TGADLNYEGSVSIC--------PDLIKASGLLMNER-----
PAND_CLOK5/1-116----MQLNML------------------KSKIHRATV--TEANLNYVGSITID--------RELMESAHIIEYEK-----
A4GIZ0_9DELT/1-115----MQRIML------------------KSKLHRARV--TATEIDYEGSIAID--------EDLLDRVGIMPLEQ-----
PAND_THEP1/1-112----MLNIYL------------------KSKIHMAKI--TRKEVYYEGSIEVD--------EELMEKAGISEGEV-----
PAND_BACHD/1-116----MFRTMM------------------KAKLHRARV--TESNLNYVGSITID--------EDIMDAVDIVENEK-----
PAND_BACSK/1-116----MYRTMM------------------KAKLHRARV--TESNLNYVGSITID--------EDLMDAVDLLENEK-----
PAND_THELT/1-113----M.RFML------------------KSKLHMACV--TDKNINYEGSIEID--------EELMNIVDLKENEL-----
A0YMY3_LYNSP/1-116----MYRTLL------------------LAKIHNCTI--TAANLEYVGSISID--------QTLLEAADILVHEQ-----
PAND_THEFY/1-116----MLRTML------------------NGKIHRATV--THADLHYVGSITID--------ADLMDAANLVDGEQ-----
Q1YRP6_9GAMM/1-116----MLSTFL------------------KAKLHMGSV--TQAELWYDGSCAID--------ADLLALSGMREFEQ-----
A4BLN7_9GAMM/8-123----MYLTML------------------KCKLHQARV--THAELEYEGSCAID--------ADLLAAAGIHDYQQ-----
Q9F5E9_AGRRH/25-140----AVEKYV------------------GAKLHGLRV--TDAKLNYHGSITID--------ADFCREVGLKPLEY-----
PAND_HERAR/1-116----MQRIML------------------RAKIHRAKV--TQADLHYEGSCGID--------ADLLEAADIKVGEK-----
PAND2_GLOVI/1-116----MLRTVL------------------LGKIHRATV--TGACLEYVGSISVD--------SRLLAAAGILPHEQ-----
A6FEN6_9GAMM/1-116----MQTTML------------------KGKLHQARV--THAELNYEGSCAID--------QDMLDASGILEYEA-----
A3ITB4_9CHRO/2-119----GTIKLM------------------HAKLHRVQV--TEANIDYVGSITID--------PILLDKVGMLPLEE-----
E0TCT9_PARBH/1-116----MLLTLL------------------KAKIHGATL--TMTDLHYEGSIAID--------EDLLEASGILPYEQ-----
PAND_AGRT5/1-115----M.IRIV------------------RAELHGITV--TGADLDYHGSITLD--------PEHCDLAGIRPLEF-----
A6BKS6_9FIRM/1-116----MTLELL------------------KGKIHRATV--VQAELDYVGSITVD--------EALLEAAGILEYEK-----
A6GSN1_9BURK/1-116----MHREML------------------LGKIHRAKV--THCELHYEGSCAID--------ENLLEASGIIEFQR-----
PAND_CLAM3/1-116----MLRTMM------------------TAKIHRATV--THADLHYVGSVTVD--------RDLLDAADILVGER-----
A7BTY6_9GAMM/10-125----MQYTLL------------------KAKLHRACV--THAELDYEGSCAID--------EHLMDLAGIHEYEQ-----
PAND_VESOH/1-116----MKRIFL------------------SAKLHKVTT--TAVELNYEGSCEID--------GVLLDAAGIGAFEQ-----
A4BJA8_9GAMM/1-116----MDLIML------------------KAKLHQARV--THAVPDYEGSCAIS--------GDLLDMAGIREYEQ-----
Q1ZIP1_9GAMM/1-116----MKKTML------------------TGKLHQARI--THAELNYEGSCAID--------QDLLDQSGILEYEK-----
PAND_COXBU/1-111----MLISVL------------------KSKISYATI--TQKELFYIGSITID--------EAIMERAQLTINEQ-----
Q2Q0G2_9ZZZZ/4-119----SRRTLL------------------SGKIHRATV--TLADLDYIGSVSID--------KDLLDASGICEWEK-----
PAND_XANP2/1-115----M.RKIV------------------AGKLHGLTV--TGADLNYHGSITLD--------PEHCEEAGILPLEF-----
A7VF86_9CLOT/1-116----MNITML------------------KSKIHRAVV--TQAELNYVGSITVD--------SELLKEAGILEYEM-----
PAND_CHRVO/1-116----MQRNML------------------KSKLHRVTT--THAELHYIGSCAID--------ENLLEAADILEYEE-----
PAND_GRAFK/1-116----MQIHVV------------------KSKIHRVKV--TGADLDYIGSITID--------EDLMEAASIIEGEK-----
PAND1_FRASC/2-117----IYREML------------------KSKIHRAVV--RQADLHYVGSITID--------ATLMAAAGLWPGEK-----
PAND_MYXXD/1-116----MRRILF------------------KSKIHRATV--TQADLDYEGSVTID--------RDLLRAADIVENEK-----
PAND_METPP/1-116----MNRLML------------------RAKLHRATV--TEADLHYEGSCGID--------AALLEAADMREFEQ-----
PAND_SYNY3/2-119----GSIRLM------------------HAKLHRVCV--TEANVNYVGSITID--------PVMLERVGLLPLEE-----
Q0YSK6_9CHLB/1-116----MKLHVL------------------KSKIHNAIV--TSGDLEYEGSITID--------NELLEMVDMIPNEK-----
A0YAT3_9GAMM/1-116----MLTKML------------------KAKLHMACI--TQAELWYDGSCAID--------RDLVELAGMREFEQ-----
PAND_DESHY/1-116----MFRTMM------------------KSKIHRATV--TEANLKYVGSITID--------EELLEVADILPNEK-----
PAND_CAMHC/1-114----MTISML------------------QSKIHRATV--TDANLNYVGSITID--------EELIKKAGMLEFQK-----
PAND_THET8/1-116----MKRVMF------------------HAKIHRATV--TQADLHYVGSVTVD--------QDLLDAAGILPFEQ-----
D1NAU1_9BACT/1-116----MQKIML------------------SGKIHTARL--TACLLDYEGSLEID--------PELLAEAGILPYEK-----
A6CEU4_9PLAN/2-117----MKRVLL------------------KSKIHRATV--TEANLEYNGSVTID--------RELMDAADIVEYEQ-----
PAND_MARMM/1-116----MRLTMM------------------KCKLHRATV--TQADLHYEGSISID--------RDYLEAAGILPHEQ-----
PAND_NOCFA/1-116----MLRTMM------------------KSKIHRATV--THADLHYVGSVTVD--------QDLLDAADLLEGEQ-----
PAND_PYRIL/1-110----M.PVLL------------------RAKAHGLVV--TGKNLHYEGSLTLG--------RDIIEAAGFYPLEK-----

PF01568

AIOA_ALCFA/697-802FWL.NNGR.N------------------NEVWQTAY.--HDQYNSLMQERYPM--------....AYIEMNPDDC-----
Q6AR14_DESPS/566-672LKL.TTGR.V------------------VAHYHTGT.--MTRRCWGLNGVAPH--------....ELVEIHPHDA-----
Q8TYH8_METKA/567-671LIL.TTGR.V------------------YAHYHTRT.--ITRRSRLLSEEVPE--------....SFVEIHPKDA-----
NASC_BACSU/597-704LYL.TTGR.V------------------MSHYLTGV.--QTRKSAALAARHFE--------....SFMEIHPQTA-----
Q7CTK6_AGRT5/578-689LTL.NTGR.I------------------RDQWHTMT.--RTGKSARLTAHIAE--------....PFAEIHPRDA-----
Q93V06_EUBAC/780-886LVL.TTGR.I------------------LYQYHTTT.--MTGKTEGISSNYSE--------....SFIEVNPSTA-----
Q6AQG2_DESPS/776-881LLL.NTDR.S------------------LFHFH.GT.--MTRRVFGLNVLDRG--------....ENLIIHPEDA-----
Q9Y8S7_AERPE/872-979YWV.VNGR.Y------------------NAIWQTGY.--ADPNVVEIMARHPM--------....NIVQVNPEDA-----
Q5SLU3_THET8/550-661LIL.LTPP.A------------------HRFLNTTY.--GDVKALVEAEGGE.--------....PRLLIHPEDA-----
PSRA_WOLSU/642-757LYF.VQGK.T------------------PVRSNSHT.--GNVPWLNNLMEYD.--------.....AIWIHPKTA-----
P77908_MOOTH/788-893FLF.TTGR.N------------------LYHYHT.V.--ISRKSRGLEEMCPA--------....PVVEINDNDA-----
Q7N4R0_PHOLL/662-784YRL.TSVK.N------------------GFYCHSQQ.--RSLTRLRKKSPYP.--------.....KLEINSRLA-----
Q82M26_STRAW/523-628IRL.TTGR.R------------------LDSYNTGV.--QSGGFASPLRRGE.--------.....FVELCPEDA-----
Q97CU9_THEVO/558-664FIL.TTGR.N------------------YYHWHSGT.--MTRRSDILERESPS--------....PYVEISMMDA-----
Q50569_METTF/569-676FIL.TTGR.I------------------IFHYHTGT.--MTRRSETLDREVPT--------....GFVEINDEDA-----
Q66FE2_YERPS/574-681LAL.CTVR.E------------------VGHYSCRS.--MTGNCATLKILADE--------...PGYVQIHPEDA-----
O30061_ARCFU/768-880YFY.ITRN.A------------------LYRVHSTHS--NNITMLELQDFRP.--------.....RVWLHPITA-----
O28351_ARCFU/4-102VEV.ISGR.T------------------LNQGATVE.--EKLTEEYFNAVN..--------.....YAEINEEDW-----
Q5NYZ4_AROAE/1082-1203LSW.ITPH.S------------------KWGIHSSYQ--DNLRMLSLFRGGP.--------.....YVWVSEDDA-----
Q9UWR0_THELI/527-630PVM.ITVR.Y------------------VGQFQTGT.--MTKRSPPLNIRWQD--------....LLILVSEEDA-----
NAPA_DESDA/643-749LYL.TSMR.V------------------IDHWHTAT.--MTGKVPELQKANPI--------....AFVEINEEDA-----
Q8KS88_ECOLX/244-359LQL.TGFH.Y------------------KARTHSSY.--GNIDVLQQACPQ..--------.....EVWINPIDA-----
Q7MDT0_VIBVY/578-691WRL.NSGR.Q------------------RDQWHTMT.--RTGHIEKLAASELE--------....PSVYLNRLSA-----
Q6LXU9_METMP/3-104FML.NTGR.T------------------IWQGEAIE.--AGKNLEMYRKAAA.--------.....VCYMNPEDM-----
Q8TLZ3_METAC/3-105IRI.ITYS.D------------------IFQDKAMV.--ENRFGEEYRNLSA.--------.....VIKMDPADL-----
Q50743_METTF/772-878LVL.VTGR.N------------------LYQYHTRS.--MTARVEELESFSDH--------....EELLMNPADA-----
Q7WE27_BORBR/634-755LYL.VANQ.P------------------ANKLHSQF.--DYGGYSQASKREGR--------....EVCTLHPALA-----
Q9AAI1_CAUCR/584-695MAL.NTGR.I------------------RDQWHTMT.--RTGLAPDLCRHAPE--------....PYVEVHPDDA-----
Q67RJ5_SYMTH/722-835LQV.INPH.Y------------------PRRSHSVF.--DNVTWLREAFPS..--------.....MVMLNSQDA-----
Q7NJF0_GLOVI/643-744LVL.VTVR.S------------------YSQHNTVV.--YKAGDTYRGMPHR.--------....NCILMHPEDA-----
Q67S40_SYMTH/583-693IAL.ITPA.A------------------HHFLNSTF.--ANLPRMREREGAP.--------.....TIFLNPADA-----
Q835I7_ENTFA/792-898YLM.STGR.M------------------LYHYNTRA.--MTGRTEGINQIANH--------....SYIEINAVDA-----
Q5YWD3_NOCFA/753-860MLL.DNGRMQ------------------DGEPNLAG.--IARPA.........--------.....VARLSAATA-----
Q8U1G6_PYRFU/524-629LRL.LSPT.Y------------------RMTITSQY.--HNTYGIIDE.....--------.....KIYMNPKDA-----
Q44289_NOSS1/613-724FVL.TTGR.L------------------YGHWHTQT.--RTGRIEKIRAMHPE--------....PFIEIHPRDA-----
Q6LP69_PHOPR/589-700LSL.NSGR.I------------------RDQWHTMT.--RTGLSARLGAHKPE--------....PFVSVNPIDA-----
Q64CK0_9ARCH/5-104VNL.ISGR.T------------------TVQGRNLD.--SKMSEEYFEEVA..--------.....RCDLNKADM-----
Q5P7E5_AROAE/591-702LHL.TTGR.L------------------RDQWHGMS.--RSGKVARLYNHVDE--------....ARIEMHADDL-----
Q9EYG2_AMYMD/565-672LQA.TTGR.V------------------LQHYQSGA.--QTRLIGELNDVVPE--------....VFVEVHPDTA-----
Q67P16_SYMTH/711-814LWL.VPVD.R------------------LYAGGSTA.--RFDSEFNHVQPRP.--------.....VALLNPADA-----
Q6D8G5_ERWCT/624-746LHF.ISIQ.P------------------SDRLHSQL.--AATPQVAANKTAGK--------....ETLYMHPQDA-----
Q8ZW28_PYRAE/515-613AYV.LTFPPN------------------PLYTNSQF.--RDI....YGEPEP.--------.....AVYLNPSDF-----
Q62J72_BURMA/638-752FVL.MAGE.R------------------RAYNANQI.--YRDPTWRKVDPHG.--------.....SLRIHPDDA-----
Q984M7_RHILO/386-496FRL.TTSP.A------------------RNFLNSTF.--AETPVSKEKEGRP.--------.....ALLLHPDDA-----
Q9WX89_CLOPF/577-684FNL.NTGRGT------------------VGQWHTHT.--RTREIQAVTNIVSQ--------...KAYVDINRKDA-----
FMDC_METWO/275-374VIY.NSGS.T------------------IREGQIIK.--GGNKLTDDYIDEC.--------....ARCCISPEDY-----
SERA_THASE/785-898FVY.NTPH.T------------------RWGVHSFAR--TDQWMLRHQRGEP.--------.....DVRLNPAAM-----
Q8XA96_ECO57/674-787LQL.ITWK.G------------------KNRANSTQ.--YANPWLQEVQTQ..--------.....KLWLNPQDA-----
P28179_WOLSU/805-916LNM.LSGR.L------------------VAQFGTGT.--ETRSAHYLAEVQPE--------....MFVEIHPETA-----
Q6LPM8_PHOPR/681-802LWL.QSCH.P------------------DQRLHSQMC--ESDEYRATYTVQGR--------....EPVYISPEDA-----
TORZ_HAEIN/680-802LAL.VTPH.P------------------YYRLHSQL.--AHTSLRQKYAVNDR--------....EPVMIHPEDA-----
Q67MQ2_SYMTH/622-728FNL.NSGR.V------------------QEHYHTGT.--KTRKVPELNALVPT--------....AYVELNPRDA-----
Q5UZ91_HALMA/585-685LTL.TTAR.E------------------ADGYNTGV.--RSRGGEAGAL....--------.....VARIHPETV-----
Q97ZA1_SULSO/548-650YIL.ITGR.V------------------VTRYNSDE.--LIKRVPGYRNFSS.--------.....DLLINPEDA-----
Q7UMT4_RHOBA/623-725LRL.MTVR.S------------------EGQFNTVV.--YEEEDLYRNQDRR.--------....DIILMNPDDL-----
O25163_HELPY/649-770FHL.ISPH.P------------------KYRVNSQL.--DNTWVRNVYKIQGR--------....EPVMINELDA-----
Q5LNM0_SILPO/563-671FTL.ITPS.S------------------SKRTNATF.--GSHADSLDPE....--------.....MVEMHPEDA-----
Q9KF71_BACHD/592-699ILL.TTGR.V------------------LTQYLSGT.--QTRRSDALLFKEPE--------....PFVLLHPETA-----
Q8KF36_CHLTE/797-921FYF.TYGK.V------------------PVVSHAST.--NSNNALLAAVTEPK--------KGQFMGLWMNAAKA-----
Q73SH3_MYCPA/470-584FAL.ITGR.T------------------VYHFHTRT.--KTARAQQLQDAAPE--------....VWVEVSERDA-----
Q9HL15_THEAC/841-948LHL.NNGR.I------------------LEHFHEGN.--ETYRSPGLKEKVPG--------....TFVEVSPELA-----
P72261_CUPNE/641-748LRL.VTIR.S------------------HDQYNTTI.--YAMDDRYRGVFGRR--------....DVLFMNPADL-----
O66590_AQUAE/549-657FIL.LTGR.L------------------KNNWHTMT.--RTGKSPELLKGEIP--------....PFVIMNPRDA-----
Q8E8Z1_SHEON/815-926LAL.TSGR.L------------------VEYEGGGE.--ETRSNPWLAELQQE--------....MFIEISPADA-----
Q975S3_SULTO/545-647IIL.ITVR.N------------------VTRYNTDV.--ITGRIPGYGKYES.--------.....LIYVSQEDA-----
Q6LHJ1_PHOPR/877-982FYF.STFKHQ------------------LRSPYSVAL--KSITALGVSN....--------.....FIQMNENDA-----
Q73Y53_MYCPA/606-717FLL.NTGR.L------------------PHQWHTMT.--KTGKVAKLNKLNPG--------....PFVEIHPDDA-----
Q5LSC3_SILPO/576-694FTL.IGRR.Q------------------ARSHNSWT.--QNSPRLVKGRNRC.--------.....TLEVNPADA-----
Q48944_METBA/3-104VLL.ISGS.T------------------INEGRLAK.--GGDKFTDEYTMEC.--------....ASCWISPVDF-----
Q9UYM9_PYRAB/574-678FWL.TNFR.L------------------VGQFHTGT.--MSNRTKSLKKRWPG--------....PYVMINERDA-----
Q5LQU6_SILPO/635-751LHM.ISNQ.P------------------RNKLHSQL.--DHGSVSRADRPKGV--------....EPVMMHPADA-----
Q8YXZ5_NOSS1/641-742LIL.GTGR.S------------------YGQHNTVV.--YRSEDKYRGMPHR.--------....LCILMNYFDV-----
Q5LV68_SILPO/807-913FVL.ITGR.Q------------------LEHWHTGS.--MTRRASVLDAVEPE--------....ANCSMHPATL-----
Q7WQ64_BORBR/651-773LVL.STAK.S------------------GWFVHSSH.--RYVASLRRKSPDP.--------.....QVYLSTEAA-----
Q8E9C6_SHEON/742-856FQL.ISWH.H------------------KGRVHSTH.--ANYPWLKEANDQ..--------.....VAWINPLDA-----
Q5V6J3_HALMA/570-676LVL.TTGR.A------------------LQHFNSGA.--LTRRSETLMRMRGE--------....DVLEIHPDDA-----
Q9V0J3_PYRAB/558-659LIL.TTVR.V------------------MSHYNTGE.--MTMRSPSLVKLMSE--------....PVVYISESDA-----
Q8EH03_SHEON/710-830LQL.MGYH.T------------------KGRTHSSY.--HNVPWLREAAED..--------.....AVWMNPADA-----
O29065_ARCFU/614-731LILSTGGR.V------------------PYYFHSQY.--RQNPWLRELQPDP.--------.....VALIHPETA-----
Q5U9M0_NOCSJ/627-747LYL.SSNQ.P------------------AHRLHSQY.--DQGVVSVDAKVEGR--------....ERIRLSIQDA-----
Q5P3W2_AROAE/574-684LAL.ISPP.A------------------RNFLNTSF.--ANLPRFIGEERGP.--------.....SLEIHPADA-----
PHSA_SALTY/637-742LYF.IQGK.V------------------AVHTNGAT.--QYVPLLSELMWDN.--------.....AVWVHPQTA-----
Q5YVJ8_NOCFA/592-712LKL.IGRR.H------------------LRSNNSWL.--HNLPSMVKGKDRC.--------.....TALMHPRDA-----
Q7UYU5_RHOBA/635-741IVL.LTGRGT------------------VSQWHTQT.--RTRQSPLLRSLYPN--------...QPYVEMHPRDA-----
Q8NR68_CORGL/1101-1222VRY.LTTH.N------------------KWSIHSQYY--DNLHVLSISRGGQ.--------.....VIWMSNKDA-----
O87815_CUPNE/815-920LIL.TTGR.I------------------LSQYNVGG.--QTRRTDNVYWHA.E--------....DRLEIHPHDA-----
Q87XL6_PSESM/606-726LLL.IGRR.H------------------VRSNNSWM.--HNYHRLVKGKPRH.--------.....QLLMHPDDL-----

PF11769

A3RY58_RALSL/17-217VAMAGCASVQPVA.....YSGVASS....SYMKPNLQDTSGRVPYNYATQ.VD........WRKYRRIMIEPVTV.....
A5W3J4_PSEP1/15-215LAVAACSSNRVDPKD...YSGFLKD...YSRLQEAKSP.SGDPVMRWIDPKVN........INQYSQVFVEPSQF.....
Q3BN61_XANC5/17-217VSLIGCASTRPTP.....YRQLPSS....SYLRPHDGSRGGRMPYAYHGQ.VD........WSRYRTALVEPVSI.....
Q6SG91_9BACT/21-223ALIVGCSASPTTPEIS............HDGLVLQD...DTKFGLVYAKPGVD........IRDYENFAVHHCTV.....
Q7WM33_BORBR/16-217LLLAGCASQRAPK.....ESGFLGD...YSQLREEQV..PGGARLIYRDAALK........PRQYTAMWLSPVEY.....
Q1YZ11_PHOPR/30-233STFTYCL.FKLSPNKQRDNEQRYPE...NKTLKEVDFD.SLEKGVQWVSDAVQ........PHYYTSLIVPKVEL.....
Q1I9J6_PSEE4/15-215LALVACSSNRVDPKD...YSGFLKD...YSRLKPAESV.SGVPVMRWVDPDIK........ASQYTKVFIEPSQF.....
B0KFL6_PSEPG/15-215LMLQGCASKYVESDQ...YSGFLKD...YSILKEDKSP.SGAPVMRWIKPGVD........AKRYTSVYIEPSQL.....
Q212W3_RHOPB/96-293MTLSGCATAPLV......QGTGLSS...YDGLQQSD...GKITKSRLHVKKEQ........VAAAKTINIAPTLF.....
B1J950_PSEPW/15-215LTLVGCSSNLTQPDE...YSGFLKD...YSRLKEAESP.TGAPVMRWIDPQLD........INKYTSFYVEPSQL.....
Q2K737_RHIEC/28-222VAAAGCSSVPLK......EGGTLTS...YSHLGPAK...GKLSKSRVYVDGLS........LAPIKTVAIEPTSF.....
A3UTR3_VIBSP/12-213LFTAGCSSNMPDKQ....EIQSVDS...NHYFIDSQFD.DDRKGVSWIAKDSA........SLHFNQIEFTTVSM.....
C4ZVH0_ECOBW/16-216LALSGCASKITQPDK...YSGFLNN...YSDLKETTSA.TGKPVLRWVDPSFD........QSKYDSIVWNPITY.....
A4XXD7_PSEMY/14-214IGTAACSNTLVAPEQ...YSGFLQD...YSRLSEQQSP.SGAKVARWVDPDLQ........VGRYNQLLLEPSQF.....
A6DT86_9BACT/12-211ALFLGCASKTVDEKE...YSGFLKS...YKHLKETEAS.DGVDVLAWTSDAFK........KGKYHSILLEPVAL.....
Q89V44_BRAJA/17-217AAAAGCASVAPVP.....YSEMASS....AYMAPDKSDASGRVPYRYSTP.VD........WRAYNKVILDPVVL.....
A6T9U9_KLEP7/16-216LALTGCAAKVAQPDQ...YSGFLKD...YSSLKETTSA.SGKPELRWIDPNFN........PANYDNIVYHPVTY.....
A4A7W3_9GAMM/19-227ALLSACAEQPSIQQGEGAETI.......LGGLAKVD...NSRADLAYVDPNAD........YARYTKVLIEPLDL..DNV
A5ELW2_BRASB/19-218LC.AGCNTVTPVA.....YSEVASA....RYLAPNAADASGRMPYRYSAP.AD........WRSYDKVMLDPVVI.....
A4XNM5_PSEMY/14-214LLLSGCASQTTSPTQ...FSGYLAD...YSQLQPATSA.TGAPVLRWISPQFK........AESYSAVYIEKPTF.....
Q4KCT9_PSEF5/15-215LGMVGCSSKVPQPDE...YSGFLSD...YSQLKEAKSP.SGVEVMRWIDPKLK........LSNYSSVYIEPTQF.....
Q4UPK0_XANC8/17-217LLLCSCASTRPLP.....YSQLPSS....SYLRPHDGSRGDRMPYAYQGD.AN........WSRYRAGIVEPVSI.....
A6CW22_9VIBR/12-210LAVTGCTNTLPTQSDYKPQDS.......YRHFAVETI..GTYDGVSWYEQGFS........LNNYAALELGTVTA.....
A1V9P8_DESVV/17-214LALTACAAHKMESK....PSGFLRD...YQGLSKGR...DDQAGLIWIKPGIK........AGDYDGIVIDRVQT.....
A8G034_SHESH/17-223LLLSGCGVVQDYR.....QSQMFKS...FDDFRPGP...EGGSDLIWAKPGIKSIKDLNEILGQYDSVIVDQVWL.....
Q3KD98_PSEPF/15-215LGVVGCSSKTVAPDE...YSGFLKD...YSQLREAKSP.SGAEVMRWIDPKVD........IGKFTSFYVEPTQL.....
Q8EJG6_SHEON/12-210VLLGGCSVKERA......MSGFQVVP..FDAFKTSE...SNPNQRIYKEPGVD........LRQYNQVLLDPIQF.....
A5KWT3_9GAMM/14-215IFLFGCAGGPIK......TATKFTT...YEDFQPGP...DGGVDLVWARIGLRDADRLKSKLDDYDSVVIDQIFV.....
Q3KCQ9_PSEPF/15-215LSLSGCSSKKLPTEP...QAGFLRD...YSVLKEGQTA.SGQTILSWVSPALA........RGRYTRVYLAPSEF.....
A4WAC4_ENT38/16-216LALAGCASKVAQPDQ...YSGFLKD...YSGLQETTSA.TGKPTLRWVDPSYD........PSKYDSIVYNPITY.....
A5G885_GEOUR/18-218LLMGGCA.ASMQSRSVDLKESRLVN...PSIMEKGT...GDQALYRYVNPKMD........VKQYTKIMIDPVLI.....
Q02QJ6_PSEAB/14-214AALVGCSNGQVKPEN...YSGFIGD...YSTLAPATAP.SGAPLLRWVDPQAD........VRRYQRIYIEPSRF.....
Q72FH0_DESVH/17-213SLLAGCAAHRGERVS...KSGFLRD...YSQLKPGD...EGMAVLIYRKPDAD........MRKYQNIIIDPVRV.....
Q1MF14_RHIL3/37-231MAVAGCSSVPLK......EAGTLSS...YGNLGAPK...GKLSKSRVYVDGTR........LSPAKTVSIVPTTF.....
A8H2Z2_SHEPA/23-232LGLTACSSEPAS.LQQGPDAEMTKE.....GLVRVD...HSKLDLSYARPDVN........WANYTKLYFEPVKVTNDHP
A0KEU2_AERHH/12-210ILLGGCAVKNQV......SHSLQAIP..LTAFQQSE...SNPNQRIYKEPGVD........LRQYHQVLLDPLQF.....
A5EPN2_BRASB/27-221LGLAGCATAPMT......QSGALAS...YQTLSESN...GVLAKSVLNVDKDA........VLAASTIRIMPTSF.....
A6AUE5_VIBHA/20-221FILSGCAGGPVV......SATKFTS...YEDFRPGP...EGGVDLVWARVGLRDATRLKEKMDDYDSVVIDRVMV.....
Q6D6W2_ERWCT/17-217VVLAGCASNPPVR.....YSGIASS....SQLAQNSGEHADRIPYRYTTP.VD........WKQYTHVIIDPVSI.....
A8GI51_SERP5/13-213LTLTACSSSVTEKEK...FSTFLPD...YNNITKSQSA.SGKDVLYWKDKNVD........FSKYKYLVYQPMIY.....
A0YG64_9GAMM/14-211LTLTACAHQVPEPGPLNDQGLTTYS...HRAFEELA...........IQQPID........FSQYKKVKFDPVTV.....
A2SGK3_METPP/19-196AAASACSTVMVPP.....RADFLSS...YAALTPDADRGSASSRSVMVIDPAR..............VTIDAIEW.....
A5KUS9_9GAMM/12-213LFTVGCASSVPNKE....EIKSVDS...EHYFVDSKFD.DDMAGMSWIAKDSA........SYHFNQFKFNSVEI.....
A5G4X5_GEOUR/18-219LQFGGCAVGSYQARSVDLNASPLVN...PDVLVKGT...GDEALYRYVKPGVD........VKKYDKVMIDPVLV.....
Q4ZSE5_PSEU2/17-217FLAAGCASHEPSP.....YSGIESS....LEMRPNEQDSTGRIPFKYTTA.VN........WNKYDQIMLEPVVI.....
A1AL14_PELPD/18-218LQMGGCA.GSYQARSVDLKESPLVN...PEILVEGS...GNQALYRYVNPKAE........VKSYNKVMIDPVII.....
Q392W5_BURS3/17-217VALAGCAGVQPAR.....YSSIESS....PYLRSDPQDKSGRVPYRYALP.AD........WHSYRKLILDPVAI.....
Q2BPS6_9GAMM/15-215FQLAACSSQSPKPLE...GQALYTD...HPWVENAR.........IWVKPGFS.....VDQLARYSAIDVESVEV.....
A4BRI2_9GAMM/34-238VALAGCSATQKEKPKLEADGCAMIPPNICEQLTPGT...KNQAGLRYVTPDVP........WSQYTKVMISPVTV.....
Q1I974_PSEE4/15-211LGLSACSSKPAP.......SGFLSD...YSLLTRQQTP.SDQTVLSWVDPRWP........KGRYIEVYLQPSQY.....
A0YF98_9GAMM/15-222LVLIACSLPLSVNAEQDKPPETS.....YDGLVMVK...QSKSSVVYSKADAD........FSEYDKILLLPSEV.....
Q47Z55_COLP3/17-219SLVIGCNSTNPTNAPQVS..........PEGMELKK...STRSTVAYKKEGVD........FSEYDKVQILPSAV.....
A7MLE9_CROS8/16-216LLLAGCSSSTTKPEQ...YSGFLKD...YSGLEKTTSS.TGKPVMRWVAPGFN........LNNYDSIVYNPVVY.....
Q1Z110_PHOPR/13-215LVLLGCSSRLPTEDER..QTQFIKN...NDKLVEVEYI.EDATGLQWVSPTVE........ASEYNKILINDVGI.....
Q481J3_COLP3/20-224LLLSGCINITDQQ.....HSGFLKN...YEGFEDVYDP.DYTKVYRSENFTID.......MLADLKRVKLVPFEM.....
Q1MBJ8_RHIL3/28-228SSVAACTTPDPTV.....YSGLASA....SQLQPNSEDKTGRVPYRYQTK.VN........WSQYNRIIVDPVAV.....
B2JWQ4_BURP8/17-221VLVAGCASNNTPTKSE..YSGFLGD...YSNLQQTQDA.KGETFLRYINPKLT........PANYSAVIVEPISM.....
Q7NTV3_CHRVO/46-251VLTLCCALGLSLPAWADTADNLFTVP..LDAFQPGK...MVPGQRVYQKPGVE........LKAYHSVLLEPLLF.....
A6F9D1_9GAMM/1-203MMVSACSFTNYEQLDKS.NAGFIED...YSKLERIETN.DGLKSFRYASDRIK........SGVYDKVIIDPVEF.....
Q2LRC4_SYNAS/42-242FLLAIPVGFTADNS....FSGFLGDPARYDLLKPGP...KDGARLRWLKEGVD........IKKYNKFMVDSVIF.....
A8GLB6_SERP5/17-218LLLAGCSSKVTTTKQ...YSGFLSD...YSKLQETTSP.SGHKTLRWIDPSYK........ESNYRGLYFQPVVY.....
A4SXI7_POLSQ/15-222ILLAACSNTPSLVSQPMPKSGFLPN...YSLLVPTSTSVQDVRLWRYRIAGVN........PGTYTAVILDPIEL.....
A1JQJ1_YERE8/17-218IFVAGCTSNVTTSAQ...YSGFISD...YSKLQEAESA.SGQKVLRWVSPDFN........AKKYTGVYYTPLVY.....
A6CY09_9VIBR/12-211TVLSGCAGSLPDKE....EMVTLND...GRTYEEQKYN.SHEDGYVWHSSDLK........KDEYQNIIVHDVNV.....

PF02261

PAND_FRASN/1-116--------------------------------VTIVDINNGARLETYAIS--------GPA-GSGIIGIN--GAAARLVH
PAND_DELAS/1-116--------------------------------VHIWNIDNGERFVTYAIK--------GQR-GSGMISVN--GSAARRAA
PAND_THEP3/1-116--------------------------------VQVLNINNGARFDTYAIE--------GER-GSGTICIN--GAAARLCQ
PAND_CHLPB/1-116--------------------------------VLCVNNNNGERFETYIIE--------GKA-GSREIQLN--GAAARCAL
PAND_EXIS2/1-116--------------------------------VQVTNNQNGARIETYAIK--------GAR-GSGVICLN--GAAARHFQ
PAND_HYDS0/1-114--------------------------------VDIYNVNNGNRFSTYVIP--------GKP-GE..ISLN--GAAARLCM
PAND_CLOCE/1-116--------------------------------VCVVNINNGIRLETYTIA--------GEK-GSGIICLN--GAAARYAQ
PAND1_RHILO/1-115--------------------------------VEIWNKNSGARISTYVIL--------GER-GSRCCILN--GAAARTCQ
PAND_YERPA/1-116--------------------------------IDIYNVDNGQRFSTYAIA--------AER-GSRIISVN--GAAARCAC
PAND_SYNFM/1-116--------------------------------IKVYNVFNGARFDTYAIA--------GPA-GSGVFCLN--GAAARMGA
PAND_XANC8/1-116--------------------------------VHIWDVTNGARFSTYAIR--------AEQ-GSGIISLN--GGAARHVQ
PAND_STAAE/1-116--------------------------------VAIVNNNNGARFETYVIA--------GER-GSGKICLN--GAASRLVE
A3Y5M2_9GAMM/1-116--------------------------------IDIYNVSNGERFHTYVIL--------AEA-GSGTISMN--GAAARRVQ
PAND_FRATT/1-110--------------------------------VQVVNLNNGERLETYVIK--------GEP-NSKTIALN--GPAARRCE
PAND_SYNWW/1-116--------------------------------VTIVNNNNGARFDTYVIE--------GER-GSKVICLN--GAASRLVQ
PAND_BACTN/1-117--------------------------------VYIADNNNGERFETYIIK--------GER-GSGKICLN--GAAARKVQ
PAND_MYCTU/1-116--------------------------------VTIVDIDNGARLVTYAIT--------GER-GSGVIGIN--GAAAHLVH
PAND_PSYWF/1-116--------------------------------IDIYNVSNGKRFRTYAIR--------AEA-GSGIISLN--GAAAYMAD
PAND_SYNAS/1-116--------------------------------VAIYDVNNGERFTTYVIT--------GKR-GSGVICLN--GAAARKVA
PAND_HALWD/1-112--------------------------------VQVVNVTNGERFETYTIE--------GE.-.SRQMELN--GAAARLAE
A5FR67_DEHSB/1-115--------------------------------VHVVNVNNGTRLETYVIE--------GSA-GSGQICLN--GAAARMGM
Q2BMJ5_9GAMM/1-114--------------------------------IHIYNINNGERFSTYAIR--------AEE-NSGIISVN--GAAAHKAS
A2TRK7_9FLAO/1-116--------------------------------VQIVNVTNGERLETYAIP--------GPR-NSGEITLN--GAAARKVA
PAND_ANADF/1-116--------------------------------VHVWNITRGTRLQTYAIK--------GER-GSGVICIN--GAAAHLNK
PAND_METCA/1-116--------------------------------IQIYNVNNGERFTTYAIR--------AAD-GSGTISVN--GAAARLAA
PAND_CAUCR/1-116--------------------------------VDVLNITNGARFTTYAIE--------APR-GSKVIGVN--GAAARLVQ
PAND_LEGPL/2-117--------------------------------VNVWNITAGTRFETYAIT--------GEK-GSTDICVN--GAAAHLVT
PAND_HYPNA/1-116--------------------------------VDIWNVTNGARIQTYALE--------APR-GSRTIGVN--GAAARHFA
PAND_BURM7/1-117--------------------------------IDIWNVNNGERFSTYAIK--------GER-GSGMISLN--GSAARRAQ
PAND_SHIFL/1-116--------------------------------IDIWNVTNGKRFSTYAIA--------AER-GSRIISVN--GAAAHCAS
A1HRR3_9FIRM/1-116--------------------------------VQVVNINNGARFETYVIA--------GER-GSGTICLN--GAAARLVQ
Q1Q7I9_9BACT/1-116--------------------------------VQVLNINNGTRVETYVIE--------GEQ-DSGIICLN--GAAARWAQ
Q4MSV5_BACCE/1-116--------------------------------VQIVNNNNGARLETYVIR--------GER-GSGVVCLN--GAAARLVQ
A6DE22_9PROT/1-116--------------------------------VDIVNINNGERFSTYVIK--------GKK-GKRDICLN--GAAARKVH
PAND_HELHP/1-115--------------------------------VEIVNINNGERFSTYVIY--------GDK-.KGEICLN--GAAARKVQ
PAND_DECAR/1-116--------------------------------IDIWNVNNGERFTTYAIR--------AER-GSGVISVN--GSAARRAA
Q1NKA1_9DELT/1-116--------------------------------VHVYNMNNGERFETYVIK--------APA-GSGMIGLR--GAAARKGQ
PAND_HELAH/1-115--------------------------------VEIVNINNGERFSTYVIL--------GKK-.RGEICVN--GAAARKVA
PAND_FERNB/1-114--------------------------------VLISDVNNGNRFITYVIP--------EPR-GSRKISLN--GAAARLVE
PAND_CARHZ/1-116--------------------------------VQVVNINNGARLETYTIP--------GPR-GSGIISLN--GAAARLCQ
PAND_PELCD/1-116--------------------------------VDIWNVTYGTRFQTYAIE--------GQP-GSGVICIN--GAAARMVS
Q3Y069_ENTFC/1-116--------------------------------VQIVDVNNGNRFETYTIA--------GER-GTGMICLN--GAAARCVS
PAND_PELPD/1-116--------------------------------VAVWDVTNGSRLETYAIE--------GER-GSGVICLN--GAAARLVA
PAND_CORGL/1-116--------------------------------VAIVDITNGARLETYVIV--------GDA-GTGNICIN--GAAAHLIN
PAND_CORJK/1-116--------------------------------IDIVDIDNGNRLTTYAIT--------GDR-GTGVIGIN--GAAARLIS
PAND_SALTO/1-116--------------------------------VAIVDVTNGARLETYVIP--------GRR-GSGVIGIN--GAAAHLVH
A5FLR1_FLAJ1/1-116--------------------------------VSIVNINNGERFETYAIK--------GEK-NSGEITLN--GPAARKVQ
Q4EEK3_LISMN/1-116--------------------------------VQIVNNNNGARIETYIIP--------GEP-GSGVICLN--GAAARHVQ
PAND_THEM4/1-114--------------------------------VLVADVNNGQRFVTYTIP--------EEK-GSRKIVVN--GAAARLVE
PAND_LACPL/1-116--------------------------------VQIADVNNGARFETYVIA--------GPR-DSGVICLN--GATARCAS
PAND_CLOB8/1-116--------------------------------VQIVDINNGARLETYVIP--------GKR-ESGVICLN--GAAARLVQ
A0ZJP2_NODSP/1-116--------------------------------VQVVNNANGERFITYTIP--------APA-NSGIIELN--GAAARLGI
PAND_NEIG1/1-116--------------------------------VAIVNNNNGERFETYTIA--------GKR-GSGVICLN--GAAARLVQ
PAND_RHOBA/5-120--------------------------------LHVWNVTRGTRLETYAIE--------GLP-NSNDVCAN--GAAAHLIR
PAND_POLSQ/1-116--------------------------------IELYNINNGNRFSTYIIK--------AVR-GSGIISLN--GAAARKAH
PAND_ARTS2/1-116--------------------------------VAIVDVTNGARLETYTIA--------GER-GSGVIGIN--GAAAHLMH
A3YJG2_CAMJU/1-115--------------------------------VQVVNVNNGARFETYTIA--------TQE-.EGVVCLN--GAAARLAE
C6BDP6_RALP1/1-116--------------------------------IELYNVNNGERFSTYIIK--------GKR-GSGEISLN--GAAARRAH
PAND_BRAJA/1-116--------------------------------VEIYNVETGTRFATYVIE--------APP-MSGTMSLN--GAAARLVM
A5HYW7_CLOBH/1-116--------------------------------VQIVDIDNGNRFETYVIA--------GEK-HSGVICLN--GAAARMVQ
PAND_BACLD/1-116--------------------------------VQIVNNNNGARLETYIIP--------GER-GSGVVCLN--GAAARLVQ
PAND_CAMFF/1-115--------------------------------VEILDINNGERFQTYVIK--------GEK-.KGEICLN--GAAARKVC
PAND_ALCBS/1-116--------------------------------IQIYNIDNGERFETYAIR--------GEA-GSKIISVN--GAAAHKAQ
PAND_CALS8/1-116--------------------------------VQVVNINNGERFETYVIK--------GER-GSGTICLN--GAAARLVQ
PAND_BORA1/1-116--------------------------------IELYNVTNGERFDTYIIK--------AAR-GSGAISLN--GAAARRAQ
PAND_SACEN/1-116--------------------------------VAIVDVTNGARLETYVIT--------GER-GSGVIGIN--GAAAHLIE
PAND_ARCB4/1-116--------------------------------VDIVNINNGERFQTYIIK--------GKA-GSKDMCLN--GAAARKVE
PAND_DEIRA/1-116--------------------------------VDIWNITNGNRLHTYALS--------GPR-GSGVIGIN--GAAAHLMR
PAND_METFK/1-116--------------------------------IDIYNVNNGERFTTYAIR--------AER-NSGIISVN--GAAARKAS
A3LK27_PSEAI/1-116--------------------------------IQIYNVDNGERFTTYAIR--------AEN-GSKMISVN--GAAAHKAK
PAND_HALHL/1-116--------------------------------IHVYNIENGERFVTYAII--------GER-GSRMISMN--GAAAHKCN
PAND_BACP2/1-116--------------------------------VQIVNNHNGARLETYIIP--------GER-KSGVICLN--GAAARLVQ
PAND_DESPS/1-116--------------------------------IYVYNVNNGERFETYAIE--------GEA-GSGAIQLN--GAAARKGM
A6CRW6_9BACI/1-116--------------------------------VQIVNNNNGARLETYIIP--------GER-GSGVFCLN--GAAARLVQ
PAND_ALHEH/1-116--------------------------------IHVYNLANGARFTTYAIR--------GEA-GSRMISMN--GAAAHLCS
PAND_MOOTA/1-116--------------------------------VQVVDNNNGARLETYAIP--------GPA-GSGVICAN--GAAARLVQ
PAND_ACIC1/1-116--------------------------------VAVADINNGNRLETYVIA--------GER-GSGVVGIN--GAAARLVH
A4J0V8_DESRM/1-116--------------------------------VQVVNNNNGARLETYVIE--------GEP-GSGVICLN--GAAARLVQ
PAND_RHOFD/1-116--------------------------------IHIWNINNGERFVTYAIR--------GER-GTGIISVN--GSAARRAA
Q4HTD1_CAMUP/1-115--------------------------------VQVVNVNNGARFETYTIA--------TKE-.KGAICLN--GAAARQVQ
Q2B3X0_9BACI/1-116--------------------------------VQIVNNNNGARFETYIIP--------GER-GSGVVCLN--GAAARLVQ
PAND_PORGI/1-117--------------------------------VQIVDNNNGARLETYTIP--------GKR-GSGVICLN--GAAARIVH
PAND_MYCS2/1-116--------------------------------VHVVDITSGARLVTYAIT--------GTP-GSGVIGIN--GAAAHLIS
A7AC80_9PORP/1-117--------------------------------VAIVNNNNGERFETYIIK--------GER-GSGVVCLN--GAAARKAQ
PAND_GEOKA/1-116--------------------------------VQVVNNHNGARFETYVIP--------GER-GSGVFCLN--GAAARLVQ
A5Z641_9FIRM/1-116--------------------------------VQIADVNNGNRFETYVIA--------GER-GSGMICLN--GAAAHMVS
PAND_MAGSA/2-116--------------------------------VDIWNKNSAARISTYVIF--------GEP-GSRCCVLN--GAAARTCQ
PAND_SULDN/1-116--------------------------------VEILNINNGERFSTYIIL--------GER-GKRDICLN--GAAARKVH
PAND_NITOC/1-116--------------------------------IHIYNLTNGERFVTYAIR--------AED-NSGIISVN--GAAAHKAC
A1ZXU1_9BACT/1-116--------------------------------VQVVDINNGERLETYVIK--------GER-GSGQICLN--GAAARKVQ
PAND_AQUAE/1-116--------------------------------IDVYNINNGARFQTYVIP--------APR-YSGEVKLN--GAAARLGH
PAND_CLOAB/1-116--------------------------------VEIANINNGARFETYVIA--------GEA-GSGIICLN--GAAARCAQ
Q0F249_9PROT/1-116--------------------------------LHIYNVANGERFTTYAIT--------APR-GSGTIGVN--GAAAHKAS
A3EU20_9BACT/1-116--------------------------------VVVSNLNNGERFTTYVIP--------GKA-GSGTVCLN--GPTARKGA
Q1N0Z0_9GAMM/1-116--------------------------------IQIYNLENGERFTTYAIR--------GEE-GSNMISVN--GAAAHLAD
A6EB29_9SPHI/1-116--------------------------------VQIVNNNNGERFETYVIK--------GER-GTGTVCLN--GATARKVQ
PAND_SALRD/1-116--------------------------------VQVVNVNNGSRLETYTIP--------GEA-GERTVCLN--GPAARLAA
PAND_CLONN/1-116--------------------------------VQIVDIDNGARFETYVIP--------GEE-NSKVICLN--GAAARCVQ
A4CIR3_ROBBH/1-116--------------------------------VQIVNNNNGERLETYAIP--------GPR-GSGELTLN--GAAARKVA
PAND_THICR/1-116--------------------------------IQIYNVNNGNRFTTYAIR--------AEE-NTGIISVN--GAAAHKAA
PAND_LEPBL/1-116--------------------------------VSVVNINNGARFETYIIE--------GKR-GSGEICLN--GAAARLGM
A3UFV3_9RHOB/1-116--------------------------------VDVLNINNGQRFTTYAIS--------APR-GSKMFGIN--GAAARLAQ
PAND_ACIAD/1-116--------------------------------IHVWNVTNGKRFTTYAIR--------GED-HSGIISVN--GGAAHQAE
A5YSZ1_9EURY/2-113--------------------------------VQVVNVDTGARLETYTLE--------GD.-.SGVIELN--GAAAHRAK
A6QCL0_SULNB/1-116--------------------------------IDIVNINNGERFSTYIIS--------GER-GKGDICLN--GAAARKVH
PAND_WOLSU/1-116--------------------------------VEILDVNNGERFSTYVIR--------GER-GSREICLN--GAAARKVA
A4D939_9NOSO/1-111--------------------------------VMVVDNTNGNRLETYVLE--------GEE-NSGVICMN--GGSAHLVN
PAND_THIDA/1-116--------------------------------IQIYNVSNGERFTTYAIR--------AAR-GSGVISVN--GAAAHKAN
PAND_TRIEI/2-119--------------------------------VQIVNLNNGQRWLTYVLP--------GQA-GSGMVCPN--GGAALLCK
Q1VSW7_9FLAO/1-115--------------------------------IQVVNNSNGERLETYAIP--------GER-GSGEITLN--GAAARKVS
PAND_CHRSD/1-116--------------------------------IQIYDVENGNRFTTYAIR--------GEA-GSRLISIN--GAAAHQAQ
PAND_PELTS/1-116--------------------------------VQVVNNNNGARFETYVIK--------GPR-GSGVICLN--GAAARLVQ
PAND_OCEIH/1-116--------------------------------VQIVNNNNGARLETYVIA--------GER-NSGTICLN--GAAARLVQ
A3ZRB8_9PLAN/1-116--------------------------------VDIYNITTGSRLTTYAIL--------GEP-GSGVICIN--GAAAHLVN
A6DL83_9BACT/1-117--------------------------------ILVSNLNNGERLETYVIP--------AER-GSRSFLLN--GSAARLGA
A3THR8_9MICO/1-116--------------------------------VDVVDVDNGNRLTTYAIE--------GER-GSGIVCIN--GAAARLIS
A7B9U1_9ACTO/4-119--------------------------------VDIVDVNNGERLSTYTIA--------GER-GGGTIQLN--GAAAHKVS
PAND_CLOTH/1-116--------------------------------VQVVDNNNGNRFETYVIK--------GER-GSGMICLN--GAAARLVH
PAND_BDEBA/1-114--------------------------------VDIYNCNNGARFSTYVIK--------GKK-GE..ICLN--GAAARHVQ
PAND_CLOK5/1-116--------------------------------IQVVDIDNGNRLETYVIA--------GEK-GSKVICLN--GAAARHVQ
A4GIZ0_9DELT/1-115--------------------------------VHIFNINSGARFITYVIN--------AER-GSGIFSIN--GAAARLTQ
PAND_THEP1/1-112--------------------------------VLVVNVNNAARFVTYVIK--------GKR-GSREINLY--GAAARLGE
PAND_BACHD/1-116--------------------------------VQIVNNNNGARFETYVIK--------GPR-GSGVFCLN--GAAARLVQ
PAND_BACSK/1-116--------------------------------VQIVNNNNGERFETYVIK--------GPR-GEGGICLN--GAAARKVQ
PAND_THELT/1-113--------------------------------VLIADLNNGQRFETYVIK--------GKP-GSGTISLN--GAAARLVE
A0YMY3_LYNSP/1-116--------------------------------VQVVNLANGERLITYAIA--------APP-GSGAIELN--GAAARLGM
PAND_THEFY/1-116--------------------------------VHVVNITNGHRLVTYVLT--------GER-GSGVIGIN--GAAARLVA
Q1YRP6_9GAMM/1-116--------------------------------IDIYNITNGERLTTYVIV--------AEA-GSGIISMN--GAAARKFQ
A4BLN7_9GAMM/8-123--------------------------------IHIYNMANGERFATYAIR--------AES-GSRIISMN--GAAAHKAK
Q9F5E9_AGRRH/25-140--------------------------------VEIWNKMSGARISTYVLY--------GDP-GSRCCILN--GAAARTCQ
PAND_HERAR/1-116--------------------------------IELYNINNGERFSTYAIQ--------GAR-GSGEISLN--GAAARCAH
PAND2_GLOVI/1-116--------------------------------VHVVNLNNGARLVTYAIE--------ASE-GSGAVVLN--GAAARLAA
A6FEN6_9GAMM/1-116--------------------------------IDIYNIDNGERFSTYAIA--------GER-GSKIISVN--GAAARKAA
A3ITB4_9CHRO/2-119--------------------------------VDIVNLNNGNRFSTYVIP--------GEA-GKGEICPN--GGAALLCQ
E0TCT9_PARBH/1-116--------------------------------VDIWNVTNGARLSTYAMA--------GQR-GSGQLLLN--GAAARLAH
PAND_AGRT5/1-115--------------------------------VDIWNKQSGARISTYVIF--------GEA-GSKCCILN--GAAARTCQ
A6BKS6_9FIRM/1-116--------------------------------VQIVDVNNGSRFETYTIS--------GQR-GSGMICLN--GAAARCVS
A6GSN1_9BURK/1-116--------------------------------IDIYVIDNGERFSTYAIK--------GER-GSGMISLN--GAAARRAQ
PAND_CLAM3/1-116--------------------------------VSIVDVTNGARLDTYTIA--------GER-GSGVLGIN--GAAAHLVD
A7BTY6_9GAMM/10-125--------------------------------LHIYNIDNGERFTTYAIR--------AER-NSKIISIN--GAAAHKAQ
PAND_VESOH/1-116--------------------------------IQIYNINNGNRFTTYTIL--------GKD-NSGIISVN--GAAARKVN
A4BJA8_9GAMM/1-116--------------------------------IQIYNITNGERFTTYAIR--------GEE-GEGIISVN--GAAALKAN
Q1ZIP1_9GAMM/1-116--------------------------------IEIYNIETGGRFSTYAIS--------GER-GSKIISVN--GAAARMAA
PAND_COXBU/1-111--------------------------------VQIVNLNNGERLETYVIP--------GKR-NSNIIALN--GPAARKGE
Q2Q0G2_9ZZZZ/4-119--------------------------------VAILDVTNGTRLETYAIT--------APR-GSGEVCIN--GAAAHLVQ
PAND_XANP2/1-115--------------------------------VEIWNRNSGARISTYVIL--------GER-GSRCCVLN--GAAARTCQ
A7VF86_9CLOT/1-116--------------------------------VQIVDIENGNRFETYTIA--------GEP-GSGVMCLN--GAAARQVQ
PAND_CHRVO/1-116--------------------------------VQIWNVTNGERFATYAIK--------AER-GSGVISVN--GSAARRAA
PAND_GRAFK/1-116--------------------------------VQIVNNNNGERLETYVIP--------GLR-NTGEITLN--GAAARKVA
PAND1_FRASC/2-117--------------------------------VDVLDITNGARLSTYVIE--------GEA-DSGTIGIN--GAAAHLIS
PAND_MYXXD/1-116--------------------------------VAVWNITQGTRLETYALE--------GEA-GSGVICIN--GAAAHLNK
PAND_METPP/1-116--------------------------------IELYNVNNGERFSTYVIP--------APP-GSGVISLN--GAAARKAH
PAND_SYNY3/2-119--------------------------------VDIINLSNGNRFSTYVLP--------GQA-HSKEICPN--GGAALLCQ
Q0YSK6_9CHLB/1-116--------------------------------VLVVNNNNGERFETYIIK--------GEH-GSRVIQLN--GAAARCAL
A0YAT3_9GAMM/1-116--------------------------------IDIYNVSNGERFSTYIIL--------AEP-GSGTISMN--GAAARKVQ
PAND_DESHY/1-116--------------------------------VQVVNNNNGARLETYVIP--------GKR-GERTVCLN--GAAARLVQ
PAND_CAMHC/1-114--------------------------------VDILDINNGERFSTYIIK--------GKK-..GEICLN--GAAARKVC
PAND_THET8/1-116--------------------------------VDIYDITNGARLTTYALP--------GER-GSGVIGIN--GAAAHLVK
D1NAU1_9BACT/1-116--------------------------------ILVVNRNNGERLETYAIP--------GEP-GSKVFCLN--GPAAHRGK
A6CEU4_9PLAN/2-117--------------------------------VQIYNITSGTRLTTYAII--------GEP-GSGVICIN--GAAAHLVK
PAND_MARMM/1-116--------------------------------VDVLNINNGERFTTYAIE--------APR-GSRTFGIN--GAAARLAQ
PAND_NOCFA/1-116--------------------------------VCIVDIDNGARLETYVIA--------GER-GSGVIGIN--GAAAHLVH
PAND_PYRIL/1-110--------------------------------VEVYNVTNGARFTTYVIP--------GRP-GE..VVLN--GAAARLGE

PF01568

AIOA_ALCFA/697-802--------------------------------KQLD.VTGGDIVEVYNDF--------G..-..STFAMV..YPVAE.IK
Q6AR14_DESPS/566-672--------------------------------LCLG.IIDGDLVRVASRR--------G..-..AVEARA..QVTTR.VI
Q8TYH8_METKA/567-671--------------------------------ERYG.VRDGELVVVETPY--------G..-..EWRCRA..RVTDR.VR
NASC_BACSU/597-704--------------------------------ATYN.IEDRVLVKIESPR--------G..-..SITVRS..KLSEQ.IR
Q7CTK6_AGRT5/578-689--------------------------------QALG.IKSADLVELESPH--------G..-..KVLLRA..LVSER.QA
Q93V06_EUBAC/780-886--------------------------------NKLG.IEDGEMVRVVSRR--------G..-..SVETNV..RVTEI.VE
Q6AQG2_DESPS/776-881--------------------------------EKFS.LTDGEIVEVRSRR--------G..-..AVKVAV..EINDS.CR
Q9Y8S7_AERPE/872-979--------------------------------AKEG.LENGDIVVIYNDY--------G..-..STTAMV..WVTRV.VA
Q5SLU3_THET8/550-661--------------------------------EARG.IRDGMLVHIRSPW--------G..-..RITRKA..HVTEA.PI
PSRA_WOLSU/642-757--------------------------------SKLG.IKNGDAIELYNKF--------S..-..SQKSKA..LITEG.VR
P77908_MOOTH/788-893--------------------------------ARLG.IREGEMIEIVSRR--------G..-..KVRVKA..LVTDR.IP
Q7N4R0_PHOLL/662-784--------------------------------EKKG.INNGDWVEVITRN--------G..-..EARFKA..SLDDN.IA
Q82M26_STRAW/523-628--------------------------------ERYG.VVVGEQVQVASRR--------G..-..AVVAPV..WIDPA.LR
Q97CU9_THEVO/558-664--------------------------------KQLN.IRDGQAIDVESRH--------G..-..RITLPA..KVTDK.IP
Q50569_METTF/569-676--------------------------------LELG.IKNGDMVKVKTRR--------G..-..EIEITA..RVTPE.IM
Q66FE2_YERPS/574-681--------------------------------SYLG.VIDQALIWISSRR--------G..-..RVIARA..SVTER.AN
O30061_ARCFU/768-880--------------------------------KENG.IAEGDLVEVYNDR--------G..-..RVYGYA..VLDEG.LH
O28351_ARCFU/4-102--------------------------------NALG.LQEGDRVKVKTEF--------G..-..EVVVFA..KKGD..VP
Q5NYZ4_AROAE/1082-1203--------------------------------KEIG.LKDNDWVEAINAN--------G..-..ATMARA..VVSQR.VP
Q9UWR0_THELI/527-630--------------------------------QKWG.IKDGDRVKLVSEN--------G..-..KYIGTV..KVSKT.VI
NAPA_DESDA/643-749--------------------------------ARTG.IKHGDSVIVETRR--------D..-..AMELPA..RVSDV.CR
Q8KS88_ECOLX/244-359--------------------------------QARG.IRHGDTVRVFNNN--------G..-..EMLIAA..KVTPR.IL
Q7MDT0_VIBVY/578-691--------------------------------EKLE.LQAGELAYITNPQ--------TL.-.QSLLAKV..VIDES.MA
Q6LXU9_METMP/3-104--------------------------------DALG.VKDGDAIKVTSEY--------G..-..EVAVNA..ITTDQPAP
Q8TLZ3_METAC/3-105--------------------------------KQLN.VKKGDTVVLKNSF--------G..-..TIVVKAEESGYET.PH
Q50743_METTF/772-878--------------------------------SSMG.IREGDTVEVTSER--------G..-..SLRVRA..GVTDE.VM
Q7WE27_BORBR/634-755--------------------------------RARE.IGEGDIVRIYSPR--------G..-..SCLAAA..TLSTD.IR
Q9AAI1_CAUCR/584-695--------------------------------RAVG.LTEGALARVMTTR--------A..-..EAVAVA..KLSDR.QR
Q67RJ5_SYMTH/722-835--------------------------------AARG.IKDGDTVLITSRH--------G..-..KVLRRA..HVTDL.IM
Q7NJF0_GLOVI/643-744--------------------------------AAAG.FAEHERVTVTGKV--------G..-..QKEQVE..IIFGA.PK
Q67S40_SYMTH/583-693--------------------------------AARN.IRSGDWVRVFNDR--------G..-..SVRLQA..QVGDW.SQ
Q835I7_ENTFA/792-898--------------------------------QALG.IQEGDKVEVHSRR--------G..-..KIETYA..AVGNR.VF
Q5YWD3_NOCFA/753-860--------------------------------AEIG.AADGDLVEVASER--------G..-..VLTLPL..AVTP..MP
Q8U1G6_PYRFU/524-629--------------------------------QERK.IKDGDKVIVFNEY--------G..-..RVITRA..KITED.VP
Q44289_NOSS1/613-724--------------------------------AKLG.ITDNVVVEVRSRR--------G..-..SAKFPA..KVTKA.IS
Q6LP69_PHOPR/589-700--------------------------------EHYA.LQHGTIATLTSPF--------G..-..NVQVRV..DISKQ.VN
Q64CK0_9ARCH/5-104--------------------------------DKLG.VAADEPVKVKTSH--------G..-..EVVVKA..KEDAG.TP
Q5P7E5_AROAE/591-702--------------------------------ALRG.LKSGDLVHVRSRR--------G..-..DVVLRA..EASSE.IR
Q9EYG2_AMYMD/565-672--------------------------------KRAG.LEEGDRAVVRSRR--------G..-..ETVARV..RFTQS.LK
Q67P16_SYMTH/711-814--------------------------------ARLG.LSRGDMVELAAGE--------A..-..KLALPV..EISKR.VV
Q6D8G5_ERWCT/624-746--------------------------------AARD.IVDRSQVEVRNAR--------G..-..RILAGV..QITDG.VK
Q8ZW28_PYRAE/515-613--------------------------------VS.......DCVVLYNEN--------G..-..EAVLKA..KPSPH.VP
Q62J72_BURMA/638-752--------------------------------AALG.VADGDKLVCASAT--------G..-..SIEVVA..ELDDS.VR
Q984M7_RHILO/386-496--------------------------------ADLG.LADGDRVEVGNQR--------G..-..DLVLHA..KFFDG.IK
Q9WX89_CLOPF/577-684--------------------------------EKLD.IKENDEVLIHSSN--------G..-.HTSKFIA..RLTDN.LK
FMDC_METWO/275-374--------------------------------KLLG...EPENVVVSSHG--------N..-..EVVLRA..VEDPG.IQ
SERA_THASE/785-898--------------------------------ARKG.IKDGDQVRIFNSS--------G..-..EFFAMA..KAWPG.LP
Q8XA96_ECO57/674-787--------------------------------KQRG.ISEGDSVKIYNDR--------G..-..VSIIPV..EITPR.II
P28179_WOLSU/805-916--------------------------------TDLG.VKHGDMVWVHGTN--------G..-.AKILVKA..RHSYK.VN
Q6LPM8_PHOPR/681-802--------------------------------KARG.IKDGDLVRVFNER--------G..-..QLLAGA..KVSDN.YP
TORZ_HAEIN/680-802--------------------------------AARG.IKDGDIVRIHSKR--------G..-..QVLAGA..AVTEN.II
Q67MQ2_SYMTH/622-728--------------------------------EALG.VQYGDRVCIESRR--------G..-..QIEAKV..VVTSQ.VA
Q5UZ91_HALMA/585-685--------------------------------AEHSELVTDETLTVETRR--------G..-..SATVDI..DRDAG.VP
Q97ZA1_SULSO/548-650--------------------------------TKLN.IKDGDMVKVVSKC--------G..-..MAVMKA..KLTNE.VK
Q7UMT4_RHOBA/623-725--------------------------------QRLG.LTHDQRVTVENEI--------G..-..SMPGIL..ARGYEKIR
O25163_HELPY/649-770--------------------------------NKLG.IRHGEIVEVFNAR--------G..-..RLLAGA..FVTKN.IR
Q5LNM0_SILPO/563-671--------------------------------ARLG.LDDGVPVVLRNGR--------G..-..AVELRV..KITDA.TR
Q9KF71_BACHD/592-699--------------------------------SSYQ.IQDEDWVMVRSPY--------G..-..EAKLKA..RQSEG.IR
Q8KF36_CHLTE/797-921--------------------------------KTLG.LSNGQEVEVTNLR--------Y..-..GPKVKATLFTTEM.IR
Q73SH3_MYCPA/470-584--------------------------------RRLD.IEAGDLVHVSTPR--------G..-..RITCAA..RVGG..IR
Q9HL15_THEAC/841-948--------------------------------AERG.LKDGDLVRITSKW--------G..-..SIKVRV..LVTDR.VS
P72261_CUPNE/641-748--------------------------------AARG.LEHGDLVDIETIA--------AGR-QLRFEKIT..AIEYE.IA
O66590_AQUAE/549-657--------------------------------EELG.IEEGEEV.ILSAK--------G..-..KEITRV..VRFGN.VK
Q8E8Z1_SHEON/815-926--------------------------------ADRG.IRDGDNVFVHSPE--------G..-.AKITVKA..MVTPR.VV
Q975S3_SULTO/545-647--------------------------------LELK.IRDNEEVLVTSEC--------G..-..KMNFRV..MISKD.VQ
Q6LHJ1_PHOPR/877-982--------------------------------KKYG.LTTGDKARIATPK--------G..-..AAIEGI..VQADTTVA
Q73Y53_MYCPA/606-717--------------------------------ARLG.IGEHDRVEIASRR--------G..-..RAVLPA..VVSDR.VR
Q5LSC3_SILPO/576-694--------------------------------ARLG.LGEGDPARVTSAA--------G..-..TVTLPV..EITDA.MA
Q48944_METBA/3-104--------------------------------ASLC...SPSKVKVTSQN--------GK.-.HSIVVYT..KCTDS.VQ
Q9UYM9_PYRAB/574-678--------------------------------KRLG.IRSGDLVRVETRR--------G..-..SLVARA..EVTEN.IR
Q5LQU6_SILPO/635-751--------------------------------AARK.LTGGQIVRLHNTR--------G..-..ACLAEL..RLSDA.IR
Q8YXZ5_NOSS1/641-742--------------------------------KKAG.LQEHQRVTVKGDK--------G..-..KLDNIE..IICGA.IL
Q5LV68_SILPO/807-913--------------------------------RAMG.IEPGDMIRLTTRR--------G..-..SVQVMV..RADRA.IA
Q7WQ64_BORBR/651-773--------------------------------RDRG.IASGDWVRVRTPY--------G..-..EVALRA..KINAD.LH
Q8E9C6_SHEON/742-856--------------------------------QRYG.VVNGKKMTLTNPR--------D..-.AKMVITA..KVTTR.VM
Q5V6J3_HALMA/570-676--------------------------------AARG.IEDGDTVIVENDR--------G..-..SVTVSA..AVTAA.IR
Q9V0J3_PYRAB/558-659--------------------------------KKYG.IKDGDLVKVETRR--------G..-..SIVLKA..KISK..VK
Q8EH03_SHEON/710-830--------------------------------LGRG.LRGGDKVQMWNDR--------G..-..TVELPV..RITPR.VA
O29065_ARCFU/614-731--------------------------------EKYG.IKDGDWIWIETPR--------G..-..RIRQRA..RLFEA.MN
Q5U9M0_NOCSJ/627-747--------------------------------AERS.IENGMIVRVFNDR--------G..-..ACLAAA..WVDEG.LE
Q5P3W2_AROAE/574-684--------------------------------AARG.IVEGDRLRIFNDR--------G..-..AFHARA..VPTDR.VR
PHSA_SALTY/637-742--------------------------------QEKG.IKTGDEIWLENAT--------G..-..KEKGKA..LVTPG.IR
Q5YVJ8_NOCFA/592-712--------------------------------QARG.LVDGEQVEVTSST--------G..-..SIVVTL..EVSDE.IR
Q7UYU5_RHOBA/635-741--------------------------------AELD.VEHGDLVRVRSRR--------G..-..HADATA..CLTHS.VQ
Q8NR68_CORGL/1101-1222--------------------------------EKLG.IADNDWIEAYNRN--------G..-..VVSARA..IVSHR.IP
O87815_CUPNE/815-920--------------------------------EERG.IKDGDWVGVQSRA--------G..-..DTVLRA..IVNER.MQ
Q87XL6_PSESM/606-726--------------------------------SHRG.LSDGQQVRVSSRV--------G..-..VIEVEV..LGSLD.MM

PF11769

A3RY58_RALSL/17-217..........YRG.ADHQFGDMSE.TDR....AALASYMQAKFAEKLQSR..FELA..NDA.GPNTLRLKLTLTGADTTT
A5W3J4_PSEP1/15-215..........YPK.PQPTTV.ISQ.QTL....QEITRYFNEALRREMGSV..MPLA..KGP.GPGVIVVRPAITAVSTSN
Q3BN61_XANC5/17-217..........YRG.ADAQFEGVPE.QDK....RMLADLMQREFGDAIGQR..WQPT..TAI.GPDTLRVRLTLTGAKPSK
Q6SG91_9BACT/21-223.AFRKNWQRDQNSTRRSTSRRIND.SDMDAIRVSLGELCETEFLSVLSTEPVYSVVPEEQA.AAGTLLLKPNIINLDVVA
Q7WM33_BORBR/16-217..........YPS.PQPSAQ.VSM.ETL....TELQNYLDQSLRRKIGRE..IRLV..NGP.GPGVAKARIAITAVGSES
Q1YZ11_PHOPR/30-233..........EQN.KTHSKQ.IPE.TVL....EKLSTVVTKQLRSNISSD..IKVV..DKV.GPHVAQINLRISRATANP
Q1I9J6_PSEE4/15-215..........YPK.PQPTNV.ISA.QTL....QEITRYFNEAMRRELGSV..LTLV..KEP.GPNTIVVRPAITAVSTST
B0KFL6_PSEPG/15-215..........YPK.PQPTDK.VPQ.STL....TGITQYYDQTLKNHFSQV..LPLA..TSP.GPRVLVVRPAITAVSAQT
Q212W3_RHOPB/96-293..............PPNAAPTLSS.EQR....ALVANAVNRALCISLSDR..FEVI..AAG.RPADLTVRAAVTHATETD
B1J950_PSEPW/15-215..........YPK.PQPTEK.IPQ.STL....QGITNYYDTALKRELGKS..LPLA..TSP.GPGTIVVRPAITGVSSKT
Q2K737_RHIEC/28-222..............AFSAATRIKSPEDR....AMVSNALDRALCISLSDR..YQMV..ESG.EPADLTIRSVVTDIVPTN
A3UTR3_VIBSP/12-213............K.SSGVDQHVSK.EVQ....SQFKAQIHKKMDEKLAEK..LQGYKNVVL.ENKELDISVKLYDINDIP
C4ZVH0_ECOBW/16-216..........YPV.PKPSTQ.VGQ.KVL....DKILNYTNTEMKEAIAQR..KPLV..TTA.GPRSLIFRGAITGVDTSK
A4XXD7_PSEMY/14-214..........YPT.PQPSPR.LSQ.DTL....QDITQYFDAALRRELGKV..MPLT..DTP.SAGTLVLRPAITAVSAST
A6DT86_9BACT/12-211..........YPD.LPSDDD.MSK.QTT....KVMLDHFNKALKSELSKT..VKLA..DSP.GQGVARLRIAITSIDKTI
Q89V44_BRAJA/17-217..........YRG.KDHQFGDMSD.KDK....ATLAAYMQNSFAERLRGR..FALV..RER.GPNTLRIRLTLTGAVTNT
A6T9U9_KLEP7/16-216..........YPV.PKPTTQ.VGE.KAL....QDILNYTNKELKQAISER..KPLA..TTA.GKRSLIFRGAITGVDSSK
A4A7W3_9GAMM/19-227EIVQPDATRSMVNRYNREWE.LTD.EDK....AKLQTAFNDAMEKALQAGGAFEIA..SDG.GDDVIRLEAMVTRIAPVA
A5ELW2_BRASB/19-218..........YRG.RDHQFGDMSE.ADK....ARLAGYMRTRFLDSLSAR..FQPV..HRR.GPNTLRVRLTLTGAVANT
A4XNM5_PSEMY/14-214..........HPQ.PVPNEQ.ISA.QTL....EEVRNYLHQALIREVQGR..MKVL..SEP.TMDSLVLRSAITGVTVTT
Q4KCT9_PSEF5/15-215..........YPQ.PQPTAK.IPQ.STL....TAITRYYDQALQREVSKS..LPLA..TGP.GPGVIVVRAAITAVTSKT
Q4UPK0_XANC8/17-217..........YRG.PDAQFEDVPE.QDK....RMLAEYMQQEFSGAITQR..WQRA..TTP.LADTVRIRITLTGAKPNK
A6CW22_9VIBR/12-210.............ERKANQAYVSQ.SVV....DTLRSELEQSLRKRIENH...SVK..SSMNSKQTLEVAVDVQNIEGVS
A1V9P8_DESVV/17-214..........WIK.SDTTFKGVDA.KEL....DALTTFFSDALVREVGKV..MPIV..AKP.GPKTLVLRTAITDIVPSN
A8G034_SHESH/17-223..........VLD.DKTRYDNLSE.EEV....IGVSEYLVEKIKQKAATR..FELV..DNP.KGKTLRISVALTNIETPN
Q3KD98_PSEPF/15-215..........YPK.PQPTVK.IPQ.QTL....NGITSYYDQALKRELGKS..LPLA..SGP.GPGVIVVRAAITAVSSKT
Q8EJG6_SHEON/12-210..........IRQ.ENGKWYLLTA.NEQ....NEIGRYYHAKFQNELMKNG.VKIA..TES.GPGVIRVQAAVTNFDLTR
A5KWT3_9GAMM/14-215..........LAE.EGS....LDQ.EEI....QELTDHMVSRLEEKISPH..KVIV..DEP.SGKTLRLSIALSNVETPN
Q3KCQ9_PSEPF/15-215..........YPR.PQPSPR.IPQ.STL....SGVTHYYDAALRLELGKV..LPLA..SKP.GPNTLIVKPAITQVAAST
A4WAC4_ENT38/16-216..........YPV.PKPTTQ.IGQ.KLL....DDLLAYTNTKMKAAMAQH..KPLV..ATP.GPRSLIFRGAVTGVSSKK
A5G885_GEOUR/18-218.............EKQAELDAEDL.ANY....QKLANNAYVYLNKELEQD..YKIV..QSP.EPGTMRIQLAIVDADNSK
Q02QJ6_PSEAB/14-214..........YPV.PKPNDK.VSA.KTL....ADITTYYDQALRRELGKS..LPLA..SAP.GPGILVLKPAITAVSSHT
Q72FH0_DESVH/17-213..........LLG.PEAQWE.VEP.GEL....YNLAREYRAALIREVSPL..YPVV..DTP.SPETMRLRVALTDIKPGS
Q1MF14_RHIL3/37-231..............AFNAATRVKSNADR....VMVANALDRALCISLSDK..YQLV..SAG.QPADLTIRSVVTDIVPTN
A8H2Z2_SHEPA/23-232ADYQPPKIDKRADGLNATYELP.Q.EAL....AKMSEQFSLTVKEVFNSEQPFELV..AQP.GPNTLVIEAAVTDIRLSA
A0KEU2_AERHH/12-210..........IRQ.ENGQWYLLTA.NEQ....NEIGRYYHATFQRELMNHG.VKIA..SAP.GPGVMRVQAAITNFDLTR
A5EPN2_BRASB/27-221..............SGQANEVLSD.EQR....RLVANAVDRALCLNLSER..FTVV...APYEKADLTTRTFITQATATD
A6AUE5_VIBHA/20-221..........VVQ.ESE....LDD.EEI....QELTTYMVEQLKARISPV..KKIV..DQP.GEKTLRLSIAVSNVETPN
Q6D6W2_ERWCT/17-217..........YQG.SDNQFNDMSQ.QDK....QSLATYMQDTFSKTLRSR..FNEV..TSP.APGTLRLKLTLTGADTTT
A8GI51_SERP5/13-213..........FPR.PKPSEI.VSQ.QAL....DNILSYTNRQFKQAMGSH..FTLE..DVP.RENTLIFRGAITAIDTQK
A0YG64_9GAMM/14-211.AYDDAKRRDVLNRGDDAFQ.FDD.REL....AVFNRQFLKGFSTAWQKQFGWEVT..DAA.GSDVILVKAAIVDLYLYG
A2SGK3_METPP/19-196..............RADTGTDITE.EER....RALLGHLRGALLERVHTL........PRAQTGHPAVLRAAITRVETVS
A5KUS9_9GAMM/12-213............K.NAGIDKRVSK.EVQ....EQFKAQILSTMNEKLEHK..LQGYENVML.DNQVLDISVALYGIDDIP
A5G4X5_GEOUR/18-219.............RKDGELDKDEL.ENF....QKLANNAYVYLTRELEKD..YKVV..QAP.GPGTFRVQMAIIDADSSK
Q4ZSE5_PSEU2/17-217..........YTG.VDAQFSGLER.KDR....ITLANDMTVKFSEALGRH..FRFT..ATP.GRGTLRIRLTLTGAETTV
A1AL14_PELPD/18-218.............YKDGELDKDQL.ENL....QALANNAHVYLSKELEQD..YTVV..TSA.EPGTMRIQWAIIDADSSK
Q392W5_BURS3/17-217..........YHG.TDHQFGDLTD.QDK....TTLAAYMGDTFAKKLGKR..FELT..NTP.GPGTLRVKLTLTGAVTTT
Q2BPS6_9GAMM/15-215............DRVEGEYANVTP.AEL....KMIQTFFPAMLQQVLTPQ..TNSK..KEPLQGKKIKLKVILLEASRAE
A4BRI2_9GAMM/34-238..............WGGEQPKLSG.ADR....QALASYLHNALVKAFEAK..FPTV..DKP.GPGVIRIQAAISDAEAAT
Q1I974_PSEE4/15-211..........YPA.PTPSTR.IPQ.ATL....SAISHYYDATLRSELGKV..MTVV..DKP.GPNTLVVRPAITHVSAYT
A0YF98_9GAMM/15-222.AFKKNWRRDYNRSQISTVDRVRE.SDVTRIKSRVAKLFDETFSDELSSIEGFTLV..TEP.VPNALILRPSVLDLDVNA
Q47Z55_COLP3/17-219.AFKKNWKRDYNRDQVSLSTRIND.ADVIRMKAEMAELFDEVFKEEFGKDANFSLV..DKV.SSKTLVVRPAIINLDVSA
A7MLE9_CROS8/16-216..........YPT.PKPTAQ.ISQ.KVL....DGLLNYTNDKLKTAAASR..KPLV..TTP.GPRSVIFRGAITAVDSSK
Q1Z110_PHOPR/13-215..........HQN.AKAVRQ.IPE.RVL....DKVSERLTTIVKQEFTRG..AEVV..DKA.GANTATLNIMISRASTDF
Q481J3_COLP3/20-224..........WVT.PSADAK.FSP.EEL....NELSQYFHQQMSARLSANN.YEVV..ELM.GPRTLIIQGAFSGVKFED
Q1MBJ8_RHIL3/28-228..........YNG.PDNQFGKVLE.KDK....AFLANYMQVQFTEKLKTR..FAVV..STP.APATLRLHLTLTGAKATT
B2JWQ4_BURP8/17-221..........YPK.AEPTEQ.LSQ.ATI....DQVRSYATTCLTQSMASK..VRVV..QAP.GPGVLRLQVAITGVASTA
Q7NTV3_CHRVO/46-251..........LRQSEDGSWELLQA.GDE....NAIVNYFHDRMQAELKAAG.VPEA..LQP.APGVARMRVAVTGLSQDR
A6F9D1_9GAMM/1-203..........YPR.EVASEQ.LTQ.ALF....DQTKSYLNKRLVEVISLS..MDVV..DKP.QEGTIRLTPRITAIKTSA
Q2LRC4_SYNAS/42-242..........YLA.DSSEYKGIDP.QEM....KELADSFNRELVAAFKDK..WPIV..AEP.GPDVVRIRIAITNIKPSK
A8GLB6_SERP5/17-218..........FPA.EKPTTR.VSQ.DTL....NKIKAYSTQRIKAALQDR..FTIL..KSPAGSRVLVAKLAITAVSAED
A4SXI7_POLSQ/15-222..............KQNVTQNVSL.ATI....NQAKASLQASMVEAVNARGNIRIV..TKP.GPGVARISVGITGAESSA
A1JQJ1_YERE8/17-218..........YPS.STPTHR.VNQ.KTL....DEILAYANKRLKEAVSHQ..LPLV..NSPKRRNTLIVRAAITAVSAED
A6CY09_9VIBR/12-211............HVSKTIDRLLTD.QTV....ENFKQELKGTLSEKSSKLFPTDAA......SQHQAIVDVNIIKVEDIG

PF02261

PAND_FRASN/1-116PGD----LVIIISYGI-----------------MDDAEA.--RR------------------------------.HVPKV
PAND_DELAS/1-116VGD----LLIIASFAQ-----------------VHETDV.--AT------------------------------.HQPQL
PAND_THEP3/1-116VGD----IIIIISYAI-----------------MDDEEA.--KN------------------------------.YKPKV
PAND_CHLPB/1-116PGD----EIIIMTFAE-----------------IEAREA.--KS------------------------------.FKPMI
PAND_EXIS2/1-116IGD----EVIIMAYAQ-----------------LTNEEI.--AT------------------------------.HVPKV
PAND_HYDS0/1-114PGD----IIIIASYAE-----------------VEEEEL.--HH------------------------------.FRPYL
PAND_CLOCE/1-116VSD----KVIIMAYAQ-----------------MTKEEA.--QK------------------------------.HKPNV
PAND1_RHILO/1-115PDD----PIIVCNSIY-----------------LDEAH.I--TS------------------------------.LKPRI
PAND_YERPA/1-116VGD----KLIICSYVQ-----------------MSYAAA.--RL------------------------------.HHPKV
PAND_SYNFM/1-116AGD----LIIIATYAQ-----------------YDEAEI.--AR------------------------------.HQPKV
PAND_XANC8/1-116VGD----LIIVAAFAS-----------------MSEDQA.--KT------------------------------.FKPNL
PAND_STAAE/1-116VGD----VVIIMTYAQ-----------------LNEEEI.--KN------------------------------.HAPKV
A3Y5M2_9GAMM/1-116VGD----RIIIAAYAD-----------------MDEKEA.--DN------------------------------.FEPKL
PAND_FRATT/1-110IGD----QLFIISYTQ-----------------VDPTR..--EN------------------------------.IKPKL
PAND_SYNWW/1-116KGD----VVIILTYTV-----------------LQDEEC.--HN------------------------------.HKPRL
PAND_BACTN/1-117PDD----IVIIMSYAL-----------------MDFEEA.--KS------------------------------.FKPTV
PAND_MYCTU/1-116PGD----LVILIAYAT-----------------MDDARA.--RT------------------------------.YQPRI
PAND_PSYWF/1-116LGD----IVIICAYAQ-----------------MDEQEA.--DT------------------------------.HKPKL
PAND_SYNAS/1-116KGD----LVIIASYVI-----------------VDGEEA.--KG------------------------------.WKPTC
PAND_HALWD/1-112TGD----VIIVISYGL-----------------YVKDEQ.--..------------------------------.PEPTV
A5FR67_DEHSB/1-115KGD----KVIILGYSL-----------------ITEEDT.--LI------------------------------.HQPNL
Q2BMJ5_9GAMM/1-114KGD----LLIIASYVQ-----------------LDEKEA.--DE------------------------------.HQPTL
A2TRK7_9FLAO/1-116KGD----ILILITYAF-----------------MELDEA.--KE------------------------------.FKPTL
PAND_ANADF/1-116PGD----LVILATFAE-----------------LDEAEA.--RG------------------------------.FKPTV
PAND_METCA/1-116VGD----IVIICAYVG-----------------LNQAEL.--AA------------------------------.YRPNL
PAND_CAUCR/1-116KND----LVIVVTYCQ-----------------MPAEEA.--RN------------------------------.YAPTV
PAND_LEGPL/2-117PGD----LVIIASFTQ-----------------ILEEDC.--AA------------------------------.HEPTV
PAND_HYPNA/1-116VGD----TVIIAAFCG-----------------VEAEKA.--RQ------------------------------.HAPTV
PAND_BURM7/1-117LGD----LVIIAAFAM-----------------IDEQEL.--KA------------------------------GWKPDL
PAND_SHIFL/1-116VGD----IVIIASFVT-----------------MPDEEA.--RT------------------------------.WRPNV
A1HRR3_9FIRM/1-116PGD----KVIIITYAM-----------------MDDTAA.--RT------------------------------.FRPTV
Q1Q7I9_9BACT/1-116PGD----RVIIIAYCL-----------------INNKDA.--IG------------------------------.WKPKI
Q4MSV5_BACCE/1-116PGD----KVIIICYGL-----------------VAEENI.--HK------------------------------.QEPKI
A6DE22_9PROT/1-116PGD----KIIIIAYAS-----------------MSIEEA.--KK------------------------------.FKPAV
PAND_HELHP/1-115IGD----IIIIIAYAT-----------------YTHNEL.--EH------------------------------.YKPTI
PAND_DECAR/1-116PGD----ILIIATFAV-----------------YNEVEL.--AK------------------------------.HEPDL
Q1NKA1_9DELT/1-116PGD----MVIIVNYAH-----------------YSAKEL.--SD------------------------------.HQPQI
PAND_HELAH/1-115IGD----VVIILAYAS-----------------MNEDEM.--NV------------------------------.HKPCI
PAND_FERNB/1-114KGD----KIIIMAFGL-----------------YSKDEY.--..------------------------------.KSPKI
PAND_CARHZ/1-116IGD----KVIIIAYAL-----------------MEEKEA.--KQ------------------------------.WQPKV
PAND_PELCD/1-116KGD----MVIIASWID-----------------IDADKA.--AA------------------------------.YEPKL
Q3Y069_ENTFC/1-116TGD----KIILMAYCE-----------------LNENEV.--KD------------------------------.HRPKV
PAND_PELPD/1-116PKD----VVIIASFVN-----------------MSNQAA.--IK------------------------------.HEPKL
PAND_CORGL/1-116PGD----LVIIMSYLQ-----------------ATDAEA.--KA------------------------------.YEPKI
PAND_CORJK/1-116PGD----LVIIIGYAQ-----------------YSEEDL.--KN------------------------------.YASRV
PAND_SALTO/1-116PGD----LVILIAYGQ-----------------LEDAQA.--RG------------------------------.YQPRI
A5FLR1_FLAJ1/1-116KDD----IIIIISYAT-----------------LDFEEA.--KT------------------------------.FKPWI
Q4EEK3_LISMN/1-116VGD----VVIIMSYGM-----------------FTTEEA.--KT------------------------------.HEPKI
PAND_THEM4/1-114QGD----RVIIMAFGM-----------------YENDEY.--..------------------------------.KGPRV
PAND_LACPL/1-116VGD----KVIIMNYAQ-----------------FEPEEA.--KH------------------------------.AKPYV
PAND_CLOB8/1-116PGD----KVIIIAYAQ-----------------MNEDEA.--RK------------------------------.YKPSV
A0ZJP2_NODSP/1-116TGD----RVIIMAYGQ-----------------FTPEEL.--KN------------------------------.YSPTV
PAND_NEIG1/1-116KGD----IVIIMSYIQ-----------------LSEPEI.--AA------------------------------.HEPKV
PAND_RHOBA/5-120PGD----HVILAAYAM-----------------VPEADA.--AT------------------------------.HKPRL
PAND_POLSQ/1-116VGD----HLIICTYGS-----------------VPDAEV.--NN------------------------------.HVPKI
PAND_ARTS2/1-116END----IVILITYAE-----------------MTTEEA.--KA------------------------------.YTPKV
A3YJG2_CAMJU/1-115VGD----KVIIMSYAD-----------------FNEEEA.--KT------------------------------.FKPKV
C6BDP6_RALP1/1-116VGD----LLIICTYAP-----------------MNEEEV.--AS------------------------------.YKPKV
PAND_BRAJA/1-116PGD----KIIIVAYAS-----------------FDEAEA.--KK------------------------------.FKPHV
A5HYW7_CLOBH/1-116KGD----KIIIMSYCN-----------------LTIDEA.--NK------------------------------.FNPTV
PAND_BACLD/1-116VGD----VVIIVSYAM-----------------MSEEEA.--KT------------------------------.HKPKV
PAND_CAMFF/1-115IGD----IIIIVSYAS-----------------MKRKKA.--KN------------------------------.FSPTI
PAND_ALCBS/1-116PGD----RVIICAYAN-----------------YTSAEL.--IN------------------------------.FKPSL
PAND_CALS8/1-116VGD----KVIIMAYCL-----------------LTMEEY.--KT------------------------------.HMPKI
PAND_BORA1/1-116VGD----LMIICTYGP-----------------MSEEES.--AT------------------------------.HKPKV
PAND_SACEN/1-116PGD----LVILISYGV-----------------MDELEA.--RS------------------------------.VRPKV
PAND_ARCB4/1-116IGD----KIIVIAYAT-----------------FSEAEL.--EN------------------------------.YKPTV
PAND_DEIRA/1-116PGD----MVIIAAFGN-----------------FSEEEA.--RT------------------------------.LEPKV
PAND_METFK/1-116PGD----LLIIATYAS-----------------YTEAEL.--AQ------------------------------.FKPQL
A3LK27_PSEAI/1-116VGD----RVIICAYAH-----------------YSEAEL.--AS------------------------------.HKPRM
PAND_HALHL/1-116EGD----RVIICAYAG-----------------VPESEL.--GE------------------------------.FQPRL
PAND_BACP2/1-116PGD----EVIIIAYGM-----------------LSEGEA.--KT------------------------------.HTPKV
PAND_DESPS/1-116IGD----FLIIVTYAL-----------------CSDDEV.--DE------------------------------.HRPNV
A6CRW6_9BACI/1-116PGD----VIIVISYKL-----------------VAEENA.--HT------------------------------.HVPKV
PAND_ALHEH/1-116EGD----RIIICCYAN-----------------VDESEL.--DR------------------------------.HEPAL
PAND_MOOTA/1-116PGD----IIIIIAYGI-----------------FDDREA.--RT------------------------------.YQPRV
PAND_ACIC1/1-116PGD----LVIIMSYVQ-----------------LPDAEA.--RR------------------------------.HHPRV
A4J0V8_DESRM/1-116PGD----TVIIIAYTM-----------------IGEQEA.--RD------------------------------.FKPKV
PAND_RHOFD/1-116VGD----LIIIAAFAQ-----------------VPEAQL.--DG------------------------------.FKPQL
Q4HTD1_CAMUP/1-115VGD----KIIIMAYAN-----------------LEEKEL.--KE------------------------------.HKPKV
Q2B3X0_9BACI/1-116VGD----TVIIISYAL-----------------VPEEKV.--DS------------------------------.HKPKV
PAND_PORGI/1-117PGD----IIIIMAYAW-----------------MPMEEA.--KV------------------------------.FKPAV
PAND_MYCS2/1-116PGN----LVIIMSFVH-----------------LDEAER.--AD------------------------------.HRANV
A7AC80_9PORP/1-117PGD----IIIIMSYAL-----------------MDFEEA.--KT------------------------------.FKPSV
PAND_GEOKA/1-116KGD----VIIVISYVL-----------------VPEEKI.--AA------------------------------.HRPKI
A5Z641_9FIRM/1-116LGD----KIIIMSYAQ-----------------MDPSEI.--KD------------------------------.NKPKV
PAND_MAGSA/2-116KGD----ELIIAASAD-----------------ISGPEKL--YD------------------------------.IKPRI
PAND_SULDN/1-116KGD----KIIIVAYAT-----------------YDEKEL.--QN------------------------------.YKPRV
PAND_NITOC/1-116PGD----RLIICTYAV-----------------FERSEM.--DS------------------------------.FKPLL
A1ZXU1_9BACT/1-116VGD----LIIIIAYAM-----------------MEIEEA.--KK------------------------------.YEPRV
PAND_AQUAE/1-116KGD----LIIIASYAQ-----------------YTEEEL.--EN------------------------------.YAPKL
PAND_CLOAB/1-116AGD----KVIIMCYCS-----------------LTPEEA.--SE------------------------------.HRPKV
Q0F249_9PROT/1-116PGD----LLIICTYAE-----------------LDAAEA.--AH------------------------------.FNPTL
A3EU20_9BACT/1-116VGD----RVIIFCYAH-----------------YNEEEL.--KG------------------------------.YRPVI
Q1N0Z0_9GAMM/1-116VGH----RVIICAYAN-----------------YSEEEL.--KN------------------------------.FKPRM
A6EB29_9SPHI/1-116VGD----ILIIMSYGS-----------------LPIEEA.--KK------------------------------.YHPIL
PAND_SALRD/1-116PGD----EVIVIAYAE-----------------LTPSEA.--RE------------------------------.HHPRV
PAND_CLONN/1-116VGD----KVIIMCYCS-----------------MDEQEA.--KD------------------------------.YKPIV
A4CIR3_ROBBH/1-116VGD----ILILITYAW-----------------MDVESA.--KA------------------------------.FNPAL
PAND_THICR/1-116PGD----LLIIATYAS-----------------MDEKEA.--EE------------------------------.FKPIM
PAND_LEPBL/1-116KGD----KIIVITYAQ-----------------VEENELP--ID------------------------------.YIPKV
A3UFV3_9RHOB/1-116PGD----RIIVVGYAG-----------------MAAEEA.--RQ------------------------------.FVPTV
PAND_ACIAD/1-116VGD----LVIIATFGD-----------------FTEVEA.--NA------------------------------.HKPRL
A5YSZ1_9EURY/2-113VGD----TIIIIAYTL-----------------TPANNR.--..------------------------------.PVPTI
A6QCL0_SULNB/1-116KGD----KIIIIAYAT-----------------MTEEEA.--DS------------------------------.HSPKI
PAND_WOLSU/1-116IGD----KIIIVAYAQ-----------------YDRSEL.--SS------------------------------.YKPTV
A4D939_9NOSO/1-111SGD----LITLLAFEV-----------------TDEI...--..------------------------------.KEPKK
PAND_THIDA/1-116PGD----LVIIATYAT-----------------YNELEM.--AR------------------------------.YAPEL
PAND_TRIEI/2-119KDD----ILIIWANEQ-----------------CDRAEVL--EN------------------------------GHKAKI
Q1VSW7_9FLAO/1-115PGD----ILILMAYAI-----------------MTPEEA.--KT------------------------------.FQPKL
PAND_CHRSD/1-116VGD----RVIICSYAH-----------------YAEHEL.--AT------------------------------.HQPAL
PAND_PELTS/1-116PGD----LVIIISYAI-----------------MDAGEA.--RT------------------------------.YRPAV
PAND_OCEIH/1-116PGD----TVIIIAYAL-----------------LSQEEL.--QS------------------------------.FHPKV
A3ZRB8_9PLAN/1-116PQD----LVIIASYAQ-----------------YNEQEL.--AD------------------------------.YAPIV
A6DL83_9BACT/1-117VGD----RIIIMNFAY-----------------FDIEDIK--KG------------------------------.HKPTV
A3THR8_9MICO/1-116PGD----TVIIIAYAS-----------------MSDEDA.--RA------------------------------.HDPHV
A7B9U1_9ACTO/4-119VGD----LVIIMAYAQ-----------------VPESLV.--RT------------------------------.IKPSV
PAND_CLOTH/1-116PGD----LIIIISYGI-----------------FDREEA.--KT------------------------------.FNPKV
PAND_BDEBA/1-114KGD----LVIICSYCG-----------------LSMDEA.--KK------------------------------.HEPTV
PAND_CLOK5/1-116PGD----KVILMTYCQ-----------------MDEEEA.--KI------------------------------.HKPIV
A4GIZ0_9DELT/1-115IND----RIIVAAYGM-----------------INTDQ..--EK------------------------------.HNAQV
PAND_THEP1/1-112EGD----RVIIMAFTF-----------------SDKP...--..------------------------------.VKAKT
PAND_BACHD/1-116EGD----VIIVISYAL-----------------VAEENV.--KE------------------------------.HQPKV
PAND_BACSK/1-116PGD----VVIILSYAM-----------------MENAEA.--LA------------------------------.HQPKV
PAND_THELT/1-113KGD----RIIVMSFGI-----------------FNDGEY.--..------------------------------.SGPKV
A0YMY3_LYNSP/1-116TGD----RIIVMSYGQ-----------------LTPEEI.--KT------------------------------.HIPQI
PAND_THEFY/1-116PGD----LVIIISYVQ-----------------LTEAER.--AT------------------------------.HRPHV
Q1YRP6_9GAMM/1-116VGD----RIIIASYGQ-----------------FSELEA.--AE------------------------------.HKPKL
A4BLN7_9GAMM/8-123PGD----RVIICCYAL-----------------MPEADL.--EG------------------------------.HQPVL
Q9F5E9_AGRRH/25-140QGD----EIIIASSVF-----------------CEVDD.I--IK------------------------------.LKPRV
PAND_HERAR/1-116LGD----LMIICTYGP-----------------MTDEEI.--AT------------------------------.YTPKI
PAND2_GLOVI/1-116AGD----QVIVLAYGQ-----------------GTAVEL.--EH------------------------------.HQPQV
A6FEN6_9GAMM/1-116VGD----RIIICAYVR-----------------MDNEEA.--KQ------------------------------.HKPSL
A3ITB4_9CHRO/2-119PGD----LLIIYAYEN-----------------CDRQEVL--QR------------------------------GHTARV
E0TCT9_PARBH/1-116VGD----RVIISAFAQ-----------------FEADEV.--ER------------------------------.HRPSI
PAND_AGRT5/1-115RGD----QVIICSSSY-----------------VEETA.L--YD------------------------------.TAPMV
A6BKS6_9FIRM/1-116TGD----KIIIMAYGQ-----------------YTPDEA.--KE------------------------------.HKPAV
A6GSN1_9BURK/1-116KGD----LVIIAAYGT-----------------LDDQEC.--KT------------------------------.FQPKL
PAND_CLAM3/1-116VGD----VVILIAYGQ-----------------MTTEEA.--RA------------------------------.LEPRV
A7BTY6_9GAMM/10-125PGH----RIIICVYVG-----------------LTPQEM.--AL------------------------------.HEPIL
PAND_VESOH/1-116VGD----VLIIAAYAL-----------------YSEEEL.--EG------------------------------.YAPRL
A4BJA8_9GAMM/1-116VGD----RIIICAYAN-----------------FSEKEL.--ET------------------------------.FKPSM
Q1ZIP1_9GAMM/1-116VGD----RVIICAYAS-----------------LSAEEI.--TQ------------------------------.HKPSL
PAND_COXBU/1-111IGD----QLFILSYAL-----------------IDPTQ..--EK------------------------------.LDPVL
Q2Q0G2_9ZZZZ/4-119PGD----IVIILSYAE-----------------VEEENI.--GS------------------------------.HTPRI
PAND_XANP2/1-115PGD----EVIICNSVY-----------------VPEGE.I--VA------------------------------.LRPRV
A7VF86_9CLOT/1-116VGD----HIILMCYAS-----------------MTPEEA.--KE------------------------------.YRPTV
PAND_CHRVO/1-116PGD----LLIIASFAQ-----------------YEDAEL.--KG------------------------------.HSPKL
PAND_GRAFK/1-116KGD----ILIIIAYGI-----------------MELEEA.--RN------------------------------.FKPSL
PAND1_FRASC/2-117PGD----LVIIVGYAL-----------------MAEEDA.--RS------------------------------.YQPNV
PAND_MYXXD/1-116PGD----LVILATFAE-----------------VEEAEV.--AN------------------------------.WKPTV
PAND_METPP/1-116VGD----LLIICTYAP-----------------MNDAEV.--AT------------------------------.HKPKV
PAND_SYNY3/2-119PGD----RLIIFAYEL-----------------CDRREVL--QK------------------------------GHQAKV
Q0YSK6_9CHLB/1-116AGD----EIIIMTFAV-----------------MDEDEA.--RN------------------------------.YKPMV
A0YAT3_9GAMM/1-116VGD----RIIIATYGH-----------------LDDDEL.--AA------------------------------.FKPKL
PAND_DESHY/1-116VGD----EVIIIAYGI-----------------FTDEAA.--RT------------------------------.YEPKV
PAND_CAMHC/1-114IGD----LVIIVSYAQ-----------------MSTDEA.--LN------------------------------.FKPKI
PAND_THET8/1-116PGD----LVILVAYGV-----------------FDEEEA.--RN------------------------------.LKPTV
D1NAU1_9BACT/1-116VGD----VVTIMAFSV-----------------CTLEEA.--AV------------------------------.IAPTV
A6CEU4_9PLAN/2-117PQD----LVIIASYAE-----------------YKEKEA.--RR------------------------------.HQPKV
PAND_MARMM/1-116VGD----RIIVVAYAE-----------------MEAAEA.--EQ------------------------------.HDPVV
PAND_NOCFA/1-116PGD----LVILIAYGM-----------------MNEQEI.--AE------------------------------.YDPKV
PAND_PYRIL/1-110VGD----VIIVAAYEC-----------------VANPAS.--..------------------------------.HIATI

PF01568

AIOA_ALCFA/697-802RGQ----TFMLFGYVN.................GIQGDVT...T------------------------------DWTDRN
Q6AR14_DESPS/566-672QGL----VFMTFHYTE.................SSGNMLT..NS------------------------------AADPIT
Q8TYH8_METKA/567-671EGT----IFTPFHFGE....................NVLT.PHD------------------------------VRDPES
NASC_BACSU/597-704KDT----VFVPIHWAD................AQNVNDLI..GE------------------------------ALDPAC
Q7CTK6_AGRT5/578-689RGS----VFAPMHWND............QFASRARIDVVV..AP------------------------------VTDPHS
Q93V06_EUBAC/780-886EDV----VFMPFHFAK.................GAANMIT..NS------------------------------KLDPKA
Q6AQG2_DESPS/776-881PGS----VSMSFHFSE.................TPTNMLT..SG------------------------------ALDPVA
Q9Y8S7_AERPE/872-979PGT----IFLIMAHPK................AVGANAVT..TP------------------------------SVDPAA
Q5SLU3_THET8/550-661PGT----VVLEGTWWEK...........WAPDGKGVNHLT..SE------------------------------RLTDLG
PSRA_WOLSU/642-757EDT----LFGYFGFGHVSKD.....LKRAYGKGVNSNALM..PS------------------------------FTSPNS
P77908_MOOTH/788-893RGQ----VFMNFHFHE.................AAANLLT..IA------------------------------ALDPVA
Q7N4R0_PHOLL/662-784YDT----IIAEFGWWQACPDYGKEGFPAIGKNSSNYNALI.SDD------------------------------SCDPIS
Q82M26_STRAW/523-628PGL----AFMTMHFPD................EVDTNRLT..IE------------------------------ANCPIA
Q97CU9_THEVO/558-664TGI----IFVPFHFKE.................ARVNLLV..GD------------------------------NLDPYS
Q50569_METTF/569-676KGV----LFIPFHFAE.................CAANMLT.SAD------------------------------ELDPEA
Q66FE2_YERPS/574-681RGA----VYMTYQWWI.................GACNELT..VD------------------------------HVDPVS
O30061_ARCFU/768-880PSV----IIFEQGWWS............RYLRGTSYNSLT..FP------------------------------WIKPTH
O28351_ARCFU/4-102KGM----IFIPMGPYA....................NMVI...D------------------------------PSTDGT
Q5NYZ4_AROAE/1082-1203RGM----ALMYHAQEKTVNVP...GSPSTGKRGGILNSVT..RV------------------------------IVKPTN
Q9UWR0_THELI/527-630PGT----IKAPWHEGV....................NRIM..GL------------------------------KIDEKT
NAPA_DESDA/643-749PGL----IAVPFFDPK.................KLVNKLF..LD------------------------------ATDPVS
Q8KS88_ECOLX/244-359PGV----TAIGQGAWLKADM.....FGDRVDHGGSINILT..SH------------------------------RPSPLA
Q7MDT0_VIBVY/578-691FGE----LFMSMHWAG............RYGGQSQVNAVV..SA------------------------------TGDPIS
Q6LXU9_METMP/3-104LGM----IFIPMGPWA....................NRVV...L------------------------------PDTEST
Q8TLZ3_METAC/3-105RGI----AYMPNSPWS....................NMLV...S------------------------------DGTGGT
Q50743_METTF/772-878EGV----VFMTFHFAD.................APANVLT..GG------------------------------DRDPFS
Q7WE27_BORBR/634-755EDV----VRLPTGAWYDPEQD...ERGLPMCVHGNPNAVT.RDA------------------------------GTSSLA
Q9AAI1_CAUCR/584-695RGS----LFMPMHWTD............AFAPAGRANALV..AP------------------------------MTDPSS
Q67RJ5_SYMTH/722-835PGV----VGLPHGAWVEMD......EEKQIDKAGADNILC....------------------------------GGIPSG
Q7NJF0_GLOVI/643-744RGA----ALMFYPE.....................INDII..RP------------------------------PVDLRC
Q67S40_SYMTH/583-693PGV----AVSPSIWWSR...........HMPDGVGINVLT..TD------------------------------RPTDMG
Q835I7_ENTFA/792-898PQE----VFMTFHFPD.................GNVNEIT..NA------------------------------VFDDIA
Q5YWD3_NOCFA/753-860DRV----VWVPLNSPGCA.........VPARLATPAGAVV.RIR------------------------------RAGPAP
Q8U1G6_PYRFU/524-629RGV----VVMYKAFWP.............SLLGWNVNFLT.TDK------------------------------KVEEYG
Q44289_NOSS1/613-724PGT----VFVPMHWGK............LWADDAEANALT..HS------------------------------ESCPDS
Q6LP69_PHOPR/589-700QGQ----LFMPIHWNN............VTSSAGKVCNLI..SP------------------------------KTDDIS
Q64CK0_9ARCH/5-104EGI----AFMPMGPWA....................NALV...S------------------------------GDTHGA
Q5P7E5_AROAE/591-702SGQ----AFIAMHWGG............NSLNSAGANALT..LR------------------------------DFDPYS
Q9EYG2_AMYMD/565-672PDL----IFLPFHFPG................EQRANLFT..NP------------------------------ALDPVS
Q67P16_SYMTH/711-814AGT----VQAIRGLTA.................APVNLLT...A------------------------------GAAPVA
Q6D8G5_ERWCT/624-746PGV----VIMSTGAWFEPGFG..QKTWHPVEQSGNANVLT.LDI------------------------------GTSPLT
Q8ZW28_PYRAE/515-613RGV----I.VYTGIGK.............DLRGVPINTLA..RG------------------------------EPGPYG
Q62J72_BURMA/638-752RGM----VTLPHGYGMRY........KGGPPVGPELNRLT.SGA------------------------------HCDPLS
Q984M7_RHILO/386-496RGV----VIAEGIWPNS...........AHERGEGINVLT..GA------------------------------DAPAPY
Q9WX89_CLOPF/577-684EKT----LYAPIHYIE...................TNLLT..PS------------------------------VFDPYS
FMDC_METWO/275-374MGT----IFIPRGIWA....................NVLT...P------------------------------PYTEST
SERA_THASE/785-898ENM----LFSEHGWEQY...........LYKNMTHYNSVN..AE------------------------------LINPLE
Q8XA96_ECO57/674-787PGV----VAMQAGAWWQPD.......AQGIDRGGCANVLS..ST------------------------------RITALA
P28179_WOLSU/805-916KTS----VFLPQNFGG.............MYQGESLVPYH..IA------------------------------GTEPYV
Q6LPM8_PHOPR/681-802TGV----IRIHEGAWYGPLN....EKIGAIDTYGDPNTVT.QDI------------------------------GSSELA
TORZ_HAEIN/680-802KGT----VALHEGAWYDPMYL..GESEKPLCKNGCANVLT.RDE------------------------------GTSKLA
Q67MQ2_SYMTH/622-728PGS----CFVPMHFGE.................GPVNRLT..VW------------------------------AVDPFS
Q5UZ91_HALMA/585-685RGM----VWLPIHHPA...................TNRLT..LS------------------------------DRDPQS
Q97ZA1_SULSO/548-650VGH----TFAYMHDYY...................VNNVV..CD------------------------------DLDDIS
Q7UMT4_RHOBA/623-725PGN----ALMYYPE.....................SNVLV..AR------------------------------YADPQS
O25163_HELPY/649-770QGV----LSIQKGAWYDPEDE...RVRNPRCNAGHVNTLT.SLR------------------------------PTSSMT
Q5LNM0_SILPO/563-671PGV----LYSPKGTWRE...........SSATGQTVNALI.PSD------------------------------IRTDIE
Q9KF71_BACHD/592-699EDT----VFVPFHWAG................SVSINHVV..AP------------------------------ELDPTS
Q8KF36_CHLTE/797-921PDT----VFLPSAYGSKNKK.....LSIAGGKGTALNELM..PY------------------------------SIEPIA
Q73SH3_MYCPA/470-584DGV----LFVPFHYGYWD........RDGGDHQRAGNELT..AT------------------------------DWDPAS
Q9HL15_THEAC/841-948GKE----LYMPMNSGG................DSAVNNLT..SR------------------------------LMDPTA
P72261_CUPNE/641-748PGS----VAAYYPE.....................ANRLV.PLD------------------------------YIDEDS
O66590_AQUAE/549-657RGH----IFAPFGYPS..............EYGEPTNLLT..SD------------------------------RTDPYS
Q8E8Z1_SHEON/815-926PGE----CFMPYHFAG.............VFEGESLAKNY..PE------------------------------GTVPYV
Q975S3_SULTO/545-647KGT----AIMYMHDPK...................VNYII..CD------------------------------ELDEIT
Q6LHJ1_PHOPR/877-982KGC----IAVPLGYGH...............TAFGASDIT...I------------------------------DGKTLT
Q73Y53_MYCPA/606-717PGN----CFAPFHWND............AFGEYLSINAVT..ND------------------------------AVDPIS
Q5LSC3_SILPO/576-694PGV----LSMPQGWGQKQGR....LTAATRTETVSINDLT.DDS------------------------------RTDPLS
Q48944_METBA/3-104PGQ----VFMPRAIWS....................NVII...D------------------------------PDTLST
Q9UYM9_PYRAB/574-678EGV----VAMPWHWGF....................NYLT.KDD------------------------------AIDEFS
Q5LQU6_SILPO/635-751PGV----IQIATGAWLDP........QGDLCRRGNPNMLT.LDK------------------------------GTSKLA
Q8YXZ5_NOSS1/641-742EGV----AFMFYPE.....................ANVLF..KA------------------------------KIDPQS
Q5LV68_SILPO/807-913QDN----VFLPFAYVE.................AAANILT..NA------------------------------ALDPYG
Q7WQ64_BORBR/651-773ANV----AIAEFGWWQGCEGLGRADGAIVGPASSNINAIM.TDR------------------------------HRDPVS
Q8E9C6_SHEON/742-856PGV----IAMGHGAWHQPD.......ANGVDHGGSVNVLV..SR------------------------------KASPTA
Q5V6J3_HALMA/570-676PGV----VFCTFHYLD.................PLANALT..GD------------------------------ALDPVA
Q9V0J3_PYRAB/558-659EGV----IVVPFHFDA....................NILT..ND------------------------------ALNK.A
Q8EH03_SHEON/710-830PGV----VALGQGAWYQPDIARIGRSGHPIDVGGCINTLT..RY------------------------------QPSPFA
O29065_ARCFU/614-731PRY----VFAQASWYYPEK.......PDLGIFESNANVLTSNKP------------------------------PFDPCI
Q5U9M0_NOCSJ/627-747AGV----VQLPTGAWYFPSV....SDTGPIESHGNPNVLT.ADR------------------------------PTSRLA
Q5P3W2_AROAE/574-684PGL----VVAPSVWWRK...........LSGDGENVNAVT..SK------------------------------ALTDMG
PHSA_SALTY/637-742PDT----LFVYMGFGA..................KAGAKT..AA------------------------------TTHGIH
Q5YVJ8_NOCFA/592-712PGA----VAVPHGWGHREPGV..GWSVAASLPGANVNLLP.DPA------------------------------LTDRFS
Q7UYU5_RHOBA/635-741PGQ----VFMPMHYEC...................TNQLT..LS------------------------------HFDPHS
Q8NR68_CORGL/1101-1222EGT----VFMNHAQERTAGTP...LNEKSGRRGGTHNSLT..RI------------------------------MIKPVH
O87815_CUPNE/815-920PGV----VYTTFHFPE.................SGANVIT..TD------------------------------NSDWAT
Q87XL6_PSESM/606-726PGV----VSLPHGWGHSRSGV..KMEIARNQPGVSANDLT.DER------------------------------QLDELS

PF11769

A3RY58_RALSL/17-217PVLGTLSRFDIAGGIYNGVQTV...RGREGTFTGFVMYAVEIYDASSNRLLNAYVTKQYPSPW...NLGASIG.SLSAAK
A5W3J4_PSEP1/15-215EGLKPY.EVIPIALIAAGVNTA....MGGRDQDVDVGVEAAFLDGASQKVLAQVVRKGAGQEL...ENDTQKL.TLNDVK
Q3BN61_XANC5/17-217RVLGTFMKVDIGGGAYNAVQAA...RGKEGAFSGSVSYAVEIFDASSDRLLAAYVEKQYPNAM...NIKASLG.AYDAAK
Q6SG91_9BACT/21-223PDVSSPGVSRSY.................TTESGEMTLFLEVADASTGETLFRIVDRRRNLNAMRLQWSNSVT.NTADAK
Q7WM33_BORBR/16-217EALAAY.QYIPVALAITGARAV...LEGGRPQQATIAIESKVTDSQTGQLLWASVRGGTGERVRAIAQGQASV.PASALK
Q1YZ11_PHOPR/30-233EDLKLT.KVIPIGAVIGAVKMA....LGTRNQSVRIIIEAQIVDSISNKPLAERVSVIEAAGVL..ENDKSSL.RYEQIE
Q1I9J6_PSEE4/15-215EGLKPY.EVIPIALVAAAVNTA....AGGRDQAVDIAVEAAFLDGGNQKVLAQVVRKGSGKDL...ENDTTQL.TLNDVK
B0KFL6_PSEPG/15-215KSLRPY.EVIPIALIAAGISTA....TGIRDQDTSIATEAAFLDGDSNQVVAEVVRKGAGTEL...DDSSQVM.QAKDAK
Q212W3_RHOPB/96-293EAAAGVSVAASIGTKFVDMGSVPIPIPRVPIGLGELSIEAEAVD.RGGRQQAAIVWARGATAF...FSSPRVS.KAGDAY
B1J950_PSEPW/15-215KGLRPY.EVIPIALVAAGVSAA....TGIRDQDTTIATEVAFIDAQTNKVIAQGVRKGAGQQL...DNSSQVM.QASDAK
Q2K737_RHIEC/28-222KTMAGVSTVVTVGTGLALPVGV....PRLPVGLGGLAVEAEAVD.KSGAQRAAMVWARGANSL...QNNPRVS.EVGDAY
A3UTR3_VIBSP/12-213EDMRVT.EFIPVGSVIGAVKYA....AGTRDRSIRILASVDLKDHDSSQLIGRRIFVVNDNGVL..ENDKSEI.TIEMLD
C4ZVH0_ECOBW/16-216EGLQFY.EVVPVALVVAGTQMA....TGHRTMDTRLYFEGELIDAATNKPVIKVVRQGEGKDL...NNESTPM.AFENIK
A4XXD7_PSEMY/14-214EGLQPY.EVIPIALMVAAASTA....AGTRDQQVEIATEAAVIDAQNSRVVAQVVRKGTGLNL...ENDHQVL.SVENVK
A6DT86_9BACT/12-211QDYKWY.SYIPITFVVTSAGEL....TGFRDKATVLNVEAELVDSITNEAQIAVVRKDFGSNI...DEENQI..TMDDIK
Q89V44_BRAJA/17-217PVLGTLSRFDLAGAVYNGVQAA...RDGEGTMTGSVVYGVEIFDAATSRLLSAYVTKQYPGAY...DIKASVG.ALAAAT
A6T9U9_KLEP7/16-216EGLQFY.EVIPVAMIVAGTQAA....TGHRTMDTDLYFEAEVIDASTNKPVIKVVRKGEGKTL...ANENTPL.TVDTLK
A4A7W3_9GAMM/19-227PKDDMQSRTTARSTVI.............TQGGGSISVAIMLADGDSGEPLAIIKDSRSSMNSNMWSVNNSVT.NMAEVR
A5ELW2_BRASB/19-218PVLGTASRFDLAGAVYNGVQSA...RDGEGLLTGSVFYVAEIFDAADGRLLNAFVSKQYPTPY...DIKASVG.ALAAAE
A4XNM5_PSEMY/14-214EGLKAY.EVIPVALVVAAATTA....AGTRDRDSEIFIELEALDARNSEPMVRVVRKGHGLTL...ENSSTQL.TLDDLK
Q4KCT9_PSEF5/15-215EGLKPY.EIIPVALVAAAVSTA....SGIRDQETTLATEAAFLDGSTHAVIAEVVRKGTGKPL...ENDTQVM.QASDVK
Q4UPK0_XANC8/17-217RVIGTIMKVDIGGGSYNAVQAA...RGKEGAFSGSVSYAVEIFDAQSNRLLAAYVEKQYPSAL...NIKASLG.AYDAAK
A6CW22_9VIBR/12-210GAVKPT.DFIPIGAVIDLAKVV....SGTRDRNLRLIVSVELVESESKQVVGKRLFVITDKGVL..ENRNSEI.TVKLLE
A1V9P8_DESVV/17-214PVTGTLSSIVPIGIVASGATAA...VTGEHIGVGEAAIEMELLDGATGSRLAAAVDRRSGTKAPFRG.......SLTDAE
A8G034_SHESH/17-223PILAVTSSLLPFGLGISTISKV...VTGEHTNVGSATIEMMISDANSGKPIVAVIDRKAGSK....DLSTMID.STDDAR
Q3KD98_PSEPF/15-215EGLHAY.EVIPVALVAAAVSTA....SGIRDQETTLATEAVFLDGGTNKVAAQVVRKGTGKPL...ENDSQVM.KADDVK
Q8EJG6_SHEON/12-210PELKLR.DLLPAKIAIDVTKEA....IGMEPYLLKVGSMSQLLDSQSGKLLVRVLDARESDDT...IQKDSPI.TASELE
A5KWT3_9GAMM/14-215PILAVTSSVLPFGLAMSTISKV...ATGEHTNVGSASVELLVSDAQDGTPLFAAIDREAGNK....DFSTMID.SLDDAK
Q3KCQ9_PSEPF/15-215QGLRFY.EWLPVTLVAAGVSSA....TGIRDRDSEIATEVSFEDGSTGEVVAEVVRKGKGVPL...ENDKQVM.TPDNVK
A4WAC4_ENT38/16-216EGLQFY.EVVPVALVIAGTQMA....SGHRTMDTHLYFEGELIDAATGKPVIKVVRKGEGSEL...NNENSPM.TLATLK
A5G885_GEOUR/18-218PVRNVTSSILPIGIGISLVSYA...ATGKPTGVGEITVEFKGTDAMTGELLGAALDKRVGGK....DVKGVFD.TWHNAD
Q02QJ6_PSEAB/14-214QGLRPY.EVIPIALIAAGMSTA....VGIRDQDTQIATEAMLLDGGDNKVLAKMVRQGTGKAL...DDSDQPI.TGDDVK
Q72FH0_DESVH/17-213PVRGVL.TLLPVGMAIAGATKA...TTGEFSDVGKVETEMELIDSVTGERLGAAVDRQVGTKAPFRG.......EFDDAR
Q1MF14_RHIL3/37-231KAMAGVSTVVTVGTGFVLPVSV....PRLPAGLGGLAVEAEAVD.SGGVQRAAIVWSRGANSL...QNSPRVS.EVGDAY
A8H2Z2_SHEPA/23-232PLESSRRSFSSMGRTY.............TENSGSMMLLAVIKDGETGEVLAKAADRGQGFNQ..WSQNTQVF.NWGDVK
A0KEU2_AERHH/12-210PDPKLR.DLLPAKIAINVTREV....IGKEPYLLKVGSMAQLLDSQNGKLLVRVMDARESPDT...THKDSPI.TASEME
A5EPN2_BRASB/27-221PVAAGASKVVS...AVPGALGVPVPVPRLPIGLGSLTVEAEAVD.RKGRQQAAMVWARGANSF...TNSPVLS.QAGDAY
A6AUE5_VIBHA/20-221PVLAVTSSILPVGLGISTISKI...TTGEHTNVGSATVELLVSDSESDTPLFAAIDRQAGNK....DFSTMID.SLDDAK
Q6D6W2_ERWCT/17-217PVAGTFTKFDLAGGPYNIVQSI...RGKEGLLNGSVNYAVEIYDATTNKLLNAYLAKQYPNAM...NVSASVG.ALSAAE
A8GI51_SERP5/13-213KGLQVY.EVLPITLLVAATQSV....TGHRTMESAVYMEGEFIDASTNQPVIKVVRKASGENL...NNEKSQL.KVADVK
A0YG64_9GAMM/14-211SIKNN..EPLPGTTI..............TDESSKMVIEVTLLDSQSGKVLLDSRGKKTTGWRGQITRTSSVS.YWNDAY
A2SGK3_METPP/19-196PSLNAVSALLLFAPL................DRGGAAVEIEALAPDTGQQLAALSLGYFTPLS...DMKVRFS.RLAPAQ
A5KUS9_9GAMM/12-213EDMRLT.EFIPFGSIIGAVKYA....AGTRDRSIRVLASVDLKDHDSDELVGRRIFVVNDNGVL..ENEKSAI.TIEMLD
A5G4X5_GEOUR/18-219PVRNTLSTLMPIGIGLSLVKYS...VTGKQSGVGEITIEMKITDADTGELLGAALDRRVGGK....EISKLWS.KWHNAD
Q4ZSE5_PSEU2/17-217AGLSTFSRFDIGMGSYNLFQAA...RDRKGTFTGSVSYAVEIYDASTSQLLASYVTRQYPKVY...DIGSTFG.SLSAAQ
A1AL14_PELPD/18-218PARNTISTLSPIGIGLNIVKMS...VTGKQMGVGEITLQMKITDASSGELLGAALDRRVGGK....TITKLWS.SWYNAD
Q392W5_BURS3/17-217TFAGAFAHFDLAGNVYNGVQAI...RGREGAFTGSVMYAVEIRDAATNRLINAYVTKQYPNAM...NIGASFG.ALSAAR
Q2BPS6_9GAMM/15-215PEKSAL.DYIPFRLVMDLGKDAYNSYAGLEETVFKAAFRLNGYDANTDELLFSLEERMSGEPY...TSEAGSK.EFVEIQ
A4BRI2_9GAMM/34-238PVLRSVSMAIPQAHVLSTLKYA...ATGTYPFVGSAQGEVMATDAVTGKVLAAGVDRRVGGG....SVATAAQWEWGDAE
Q1I974_PSEE4/15-211QDLRWF.EWLPVTLVAAGISSA....TGMRDRDSDIGTELVFEAGTSGRVIAEAMLSGTGTPL...QNDAQTM.TADNVK
A0YF98_9GAMM/15-222PDINSMNRSRVY.................TRTAGQGTLLLEVYDAVSGEILARVVDVRQTRDNGFHSWASKPR.NNADAK
Q47Z55_COLP3/17-219PDMRSAINVKTY.................ADDAGQATLFIELYDGVSGEILARAVNTAVAGDNSYHQWANRVS.NRADAK
A7MLE9_CROS8/16-216EGLQFY.EVLPIALVVAGTEVA....TGHRTMDTSLFFEGELIDAATQKTVVKVVRKGEGKDL...NNEKTPL.TVDNLK
Q1Z110_PHOPR/13-215EDLQIT.EVLPYGALIGSAKAL....LGTRDRNVRILVESQLIDSQTEEVLAERVGVILAKGIL..ENDDVDL.EYEQIK
Q481J3_COLP3/20-224PELMPT.DFVPFRMVMNAGNLAYLEIVDKQDVTTKVSVEIEFLKGIRRERVLAAISTKYVDT....TIANSGEDNMTVVK
Q1MBJ8_RHIL3/28-228AVLGTVTRIDVAGGLYNTVQAV...RGREGSMTGSVNYAVEIYDAASNRLLSSYVTKQYPNAM...NIGASFT.AMDASM
B2JWQ4_BURP8/17-221EGLKPY.QVVPMAFVATMAVNS....IAGAPQQAKLLVEARGTDSVSGDVLAKVVRTHTGEKLGRVASNEPVI.TFESVK
Q7NTV3_CHRVO/46-251PGVNAA.DLLPVKAVFNLARLA....AGKEPYLLKIASMAQLEDAQDGSLLAGTVNLRQSDKN...KTKEQPM.TLELVK
A6F9D1_9GAMM/1-203GDLKVR.ELIPIGSVIALSKEA....LGYRYENVDVYMAFKATDSMDGSLIGSSIKQGKGEEI...SGANEVV.TFDKIK
Q2LRC4_SYNAS/42-242PGVSAVTSIIPIGLGVSLVKKG...ATGGWSGSGETGIELMTMDSMTDEVIAMAVDRRNA......EFEQRFS.KWGSAN
A8GLB6_SERP5/17-218EDMKFY.EVVPVAAVVAGTMAA....SGHRTQNTTLYIEGELIDQDTGKTVLEVVRKTYGKTV...SNDSTPV.TAEDVK
A4SXI7_POLSQ/15-222DSLQPW.NFTPIGLAMNAAAYA....GGVNSKTPALVVESKITDSKSNELLGEGLAVVQGESFRTAAGSVESF.IAMTKK
A1JQJ1_YERE8/17-218KNLEVY.EMIPIAAVIAGTMAA....SGNRAQQAALYLEVQVIDSNTGKPVIVVVRKAYGKEV...SNSGEPI.TANQVK
A6CY09_9VIBR/12-211EDVKAR.EIIPIGAIVALAKEA....AGTRDRSVRLLVDVDIKDKDDGHLLARRIFVVNNNGVL..ENDKSKI.TQKILD

PF02261

PAND_FRASN/1-116LFVD.AENRIVG
PAND_DELAS/1-116VFVD.DANRQVE
PAND_THEP3/1-116IFVD.ENNKPVN
PAND_CHLPB/1-116LIVD.KHNNPKR
PAND_EXIS2/1-116AVLD.QENSIKQ
PAND_HYDS0/1-114VYVD.DKNNILE
PAND_CLOCE/1-116VFVD.DNNRITR
PAND1_RHILO/1-115VTFD.QDNHILD
PAND_YERPA/1-116AYFE.GENQLQR
PAND_SYNFM/1-116VLLD.GDNRPLS
PAND_XANC8/1-116VYVD.AHNAISH
PAND_STAAE/1-116AVMN.EDNVIIE
A3Y5M2_9GAMM/1-116VYLN.EDNSVER
PAND_FRATT/1-110VDLK......TG
PAND_SYNWW/1-116VFMD.GNNNIKE
PAND_BACTN/1-117IFPDPATNSVVK
PAND_MYCTU/1-116VFVD.AYNKPID
PAND_PSYWF/1-116VYCN.EDNTVKD
PAND_SYNAS/1-116VFVD.PENQIKH
PAND_HALWD/1-112LLLD.EENRISE
A5FR67_DEHSB/1-115VYVD.ALNRITK
Q2BMJ5_9GAMM/1-114CYFE...NAKAD
A2TRK7_9FLAO/1-116CFPN.EETNLLK
PAND_ANADF/1-116VLVD.RKNKIVE
PAND_METCA/1-116VYVD.ENNQITR
PAND_CAUCR/1-116VLLD.EGNLIKK
PAND_LEGPL/2-117VFVD.QFNRLKE
PAND_HYPNA/1-116VLLG.EGNEIKR
PAND_BURM7/1-117VFVD.EDNKIKG
PAND_SHIFL/1-116AYFE.GDNEMKR
A1HRR3_9FIRM/1-116VFLD.EANRIVE
Q1Q7I9_9BACT/1-116ILVD.AKNKLIK
Q4MSV5_BACCE/1-116AVLD.DNNQIIE
A6DE22_9PROT/1-116LILD.DKNNIIE
PAND_HELHP/1-115VQVN.ESNQILS
PAND_DECAR/1-116IYVD.TQNRIVR
Q1NKA1_9DELT/1-116VLLD.EQNRIKR
PAND_HELAH/1-115VLVN.EKNEILE
PAND_FERNB/1-114LIMN.SDNTVKE
PAND_CARHZ/1-116VFVD.EYNKIVK
PAND_PELCD/1-116VFVD.DKNVPTT
Q3Y069_ENTFC/1-116VFVD.DNNKVER
PAND_PELPD/1-116VFVD.GKNRMLP
PAND_CORGL/1-116VHVD.ADNRIVA
PAND_CORJK/1-116VFVD.GNNKQVE
PAND_SALTO/1-116VHVD.SGNRIVD
A5FLR1_FLAJ1/1-116IFPN.ENDNSLT
Q4EEK3_LISMN/1-116VVLD.EKNHIEM
PAND_THEM4/1-114LIMN.EDNEVVE
PAND_LACPL/1-116VLVD.DENRLTK
PAND_CLOB8/1-116VFMN.DDNTIKE
A0ZJP2_NODSP/1-116VIVD.EKNRLLE
PAND_NEIG1/1-116VLVD.GNNKIRD
PAND_RHOBA/5-120IFVD.DNNQLSH
PAND_POLSQ/1-116VLVG.DNNSIKE
PAND_ARTS2/1-116VHVD.KDNKIVQ
A3YJG2_CAMJU/1-115VFVD.ENNTATK
C6BDP6_RALP1/1-116VLLG.EGNKIKA
PAND_BRAJA/1-116VRVD.RDNRILA
A5HYW7_CLOBH/1-116LFVD.NKNNIEK
PAND_BACLD/1-116AVLN.ERNEIEE
PAND_CAMFF/1-115VHVN.EKNEINE
PAND_ALCBS/1-116IYMA.EGNEVKG
PAND_CALS8/1-116VFVD.DNNKIVK
PAND_BORA1/1-116VLVD.DANRVKE
PAND_SACEN/1-116IFVD.ADNRIVE
PAND_ARCB4/1-116VLVD.DKNNIEL
PAND_DEIRA/1-116VLVD.AKNRLLE
PAND_METFK/1-116VYVD.ADNRIKN
A3LK27_PSEAI/1-116LYMA.PGNQLSH
PAND_HALHL/1-116AYLD.ADNRITQ
PAND_BACP2/1-116VVLN.KENQIEQ
PAND_DESPS/1-116VLLN.PDNTIKE
A6CRW6_9BACI/1-116AIMD.KDNNIVE
PAND_ALHEH/1-116VYCD.GDNRITH
PAND_MOOTA/1-116IFLD.ARNKITA
PAND_ACIC1/1-116VFVD.AENRIIG
A4J0V8_DESRM/1-116VMVD.EKNKITE
PAND_RHOFD/1-116VFVD.ANNRVQH
Q4HTD1_CAMUP/1-115VFVD.DENAITK
Q2B3X0_9BACI/1-116VIMG.EGNSITG
PAND_PORGI/1-117VFPDTATNKIIL
PAND_MYCS2/1-116VHVD.ADNHIVT
A7AC80_9PORP/1-117VFPDTATNKLIE
PAND_GEOKA/1-116AIMD.ENNRIVQ
A5Z641_9FIRM/1-116VFVD.DENKITR
PAND_MAGSA/2-116LTFL.PDNHVDQ
PAND_SULDN/1-116VLVN.DNNDIEE
PAND_NITOC/1-116IYLD.DRNFITH
A1ZXU1_9BACT/1-116IFPD.ENNQVIN
PAND_AQUAE/1-116IFVN.EKNQPVE
PAND_CLOAB/1-116VFVN.DDNSISN
Q0F249_9PROT/1-116VYVD.HDNSITH
A3EU20_9BACT/1-116VKVD.GKNAIRS
Q1N0Z0_9GAMM/1-116IYMQ.EGNEVSH
A6EB29_9SPHI/1-116VFPD.DNNHLLK
PAND_SALRD/1-116VHVD.ENNDVTK
PAND_CLONN/1-116VFAN.EDNTINK
A4CIR3_ROBBH/1-116VFPN.EETNLLN
PAND_THICR/1-116VYFD.EKNQITH
PAND_LEPBL/1-116VHVD.ENNR.KR
A3UFV3_9RHOB/1-116VLLD.ENNDVVS
PAND_ACIAD/1-116VYAN.PDNTVNH
A5YSZ1_9EURY/2-113VHVT.DTNEIET
A6QCL0_SULNB/1-116VILD.DDNGIAQ
PAND_WOLSU/1-116VLVD.EKNDIVQ
A4D939_9NOSO/1-111IIVD.ENNKFLK
PAND_THIDA/1-116VYVD.AANAIVD
PAND_TRIEI/2-119FVAD.ENNHCRE
Q1VSW7_9FLAO/1-115VFPN.EK.NLLK
PAND_CHRSD/1-116VYLQ.DGNQISH
PAND_PELTS/1-116VMVD.GRNKIVE
PAND_OCEIH/1-116AIMD.ESNRVKQ
A3ZRB8_9PLAN/1-116VQVD.QRNQIMT
A6DL83_9BACT/1-117AVLN.EVNEIEL
A3THR8_9MICO/1-116VFVD.KDNKIVE
A7B9U1_9ACTO/4-119VFVD.GSNKIVS
PAND_CLOTH/1-116VFVD.EKNKIIN
PAND_BDEBA/1-114VFVN.AKNKVTE
PAND_CLOK5/1-116IFLD.ENNSIFQ
A4GIZ0_9DELT/1-115TLLD.ESNRVVE
PAND_THEP1/1-112IVLN.EKNEIIQ
PAND_BACHD/1-116AVLN.ESNQIVE
PAND_BACSK/1-116AILD.ENNRIVE
PAND_THELT/1-113AILN.EKNQVIH
A0YMY3_LYNSP/1-116VFVD.EKNRILE
PAND_THEFY/1-116VHVD.ANNRIVA
Q1YRP6_9GAMM/1-116VYLN.PDNTVER
A4BLN7_9GAMM/8-123VYCD.EQNRISH
Q9F5E9_AGRRH/25-140LVFG.EKNEIID
PAND_HERAR/1-116VFVD.EDNHFAG
PAND2_GLOVI/1-116VYVD.AQNRIVS
A6FEN6_9GAMM/1-116VYLN.QVNDIVR
A3ITB4_9CHRO/2-119IVAD.EHNKIQD
E0TCT9_PARBH/1-116VLVN.PDNSVKS
PAND_AGRT5/1-115LTFT.PKNDVKD
A6BKS6_9FIRM/1-116VFVD.EENKVNR
A6GSN1_9BURK/1-116VFVD.DNNVIAE
PAND_CLAM3/1-116VHVD.VGNRIRA
A7BTY6_9GAMM/10-125VYLD.EKNTITG
PAND_VESOH/1-116CYVN.NKNILTK
A4BJA8_9GAMM/1-116VYMN.ADNSVSH
Q1ZIP1_9GAMM/1-116VYLD.ADNNIVR
PAND_COXBU/1-111VDLK.....LND
Q2Q0G2_9ZZZZ/4-119VLVN.SENKISE
PAND_XANP2/1-115LTFD.KDNRVTS
A7VF86_9CLOT/1-116VFVN.ENNSISR
PAND_CHRVO/1-116VFVD.GDNRLTE
PAND_GRAFK/1-116VFPD.EETNLLK
PAND1_FRASC/2-117VFVN.GDNQLVR
PAND_MYXXD/1-116VFVD.KDNRVVP
PAND_METPP/1-116VLLG.PGNRIES
PAND_SYNY3/2-119LVTN.ESNETVD
Q0YSK6_9CHLB/1-116LIVD.RENNPKS
A0YAT3_9GAMM/1-116VYLN.DDNSVER
PAND_DESHY/1-116IFVD.EGNNPVK
PAND_CAMHC/1-114VHVN.SKNEALE
PAND_THET8/1-116VLVD.ERNRILE
D1NAU1_9BACT/1-116IVLN.EKNEIVM
A6CEU4_9PLAN/2-117VLVD.SQNSQVI
PAND_MARMM/1-116VLLD.EHNKVIA
PAND_NOCFA/1-116VFVD.ERNRPVE
PAND_PYRIL/1-110AIF..EGNKLKE

PF01568

AIOA_ALCFA/697-802IIPY-Y.KGT.W
Q6AR14_DESPS/566-672QTPE-L.KIC.A
Q8TYH8_METKA/567-671GIPE-Y.KYV.P
NASC_BACSU/597-704KMPG-F.KVC.A
Q7CTK6_AGRT5/578-689GQPA-S.KNV.G
Q93V06_EUBAC/780-886KIPE-L.KVC.A
Q6AQG2_DESPS/776-881KTPG-T.KIC.A
Q9Y8S7_AERPE/872-979QNPD-Y.KLT.L
Q5SLU3_THET8/550-661GGST-F.HST.P
PSRA_WOLSU/642-757GMDL-..HVF.G
P77908_MOOTH/788-893KIPI-I.KPV.L
Q7N4R0_PHOLL/662-784GASP-L.RSF.R
Q82M26_STRAW/523-628GTAE-F.KAS.A
Q97CU9_THEVO/558-664KIPE-F.KVV.A
Q50569_METTF/569-676KMPE-L.KVS.A
Q66FE2_YERPS/574-681KTPE-F.KHC.A
O30061_ARCFU/768-880IVYF-VPGIWEP
O28351_ARCFU/4-102GMPQ-F.KGV.K
Q5NYZ4_AROAE/1082-1203MVGG-YAQLAYS
Q9UWR0_THELI/527-630GLPQ-L.KAC.S
NAPA_DESDA/643-749REPE-Y.KIC.A
Q8KS88_ECOLX/244-359KGNP-S.HSN.L
Q7MDT0_VIBVY/578-691GQPA-F.KSS.L
Q6LXU9_METMP/3-104AMPS-F.KGP.L
Q8TLZ3_METAC/3-105GVPK-F.KDI.S
Q50743_METTF/772-878GMPG-L.KFT.P
Q7WE27_BORBR/634-755QGCS-G.QLT.A
Q9AAI1_CAUCR/584-695GQPE-F.KHT.P
Q67RJ5_SYMTH/722-835QGIS-AWNSC.I
Q7NJF0_GLOVI/643-744GIPA-F.KRN.P
Q67S40_SYMTH/583-693GGAS-F.HTN.L
Q835I7_ENTFA/792-898TIPE-Y.KVC.A
Q5YWD3_NOCFA/753-860QTGP-VAAVVAA
Q8U1G6_PYRFU/524-629KASA-F.HST.W
Q44289_NOSS1/613-724LQPE-L.KAC.A
Q6LP69_PHOPR/589-700GQPE-F.KFT.P
Q64CK0_9ARCH/5-104GMPS-Y.KGI.D
Q5P7E5_AROAE/591-702KQPE-L.KHA.A
Q9EYG2_AMYMD/565-672RMPE-F.KVC.A
Q67P16_SYMTH/711-814VTVA-..KLAVE
Q6D8G5_ERWCT/624-746QGPN-A.MSC.L
Q8ZW28_PYRAE/515-613GTPR-L.YTT.Y
Q62J72_BURMA/638-752RTPY-H.KYV.P
Q984M7_RHILO/386-496GGAA-F.HDN.K
Q9WX89_CLOPF/577-684KEPS-Y.KTV.Q
FMDC_METWO/275-374GSPM-Y.KGV.P
SERA_THASE/785-898LVGG-YGHVKFA
Q8XA96_ECO57/674-787KGNS-H.QTM.L
P28179_WOLSU/805-916IGES-C.NTI.T
Q6LPM8_PHOPR/681-802QATS-A.NTV.I
TORZ_HAEIN/680-802QGNS-P.NTC.I
Q67MQ2_SYMTH/622-728KEPN-Y.KQQ.A
Q5UZ91_HALMA/585-685DEPN-F.KQC.A
Q97ZA1_SULSO/548-650KTPR-Y.KIT.F
Q7UMT4_RHOBA/623-725KTPA-F.KGV.V
O25163_HELPY/649-770QAIS-A.NTA.L
Q5LNM0_SILPO/563-671RGAC-Y.NET.F
Q9KF71_BACHD/592-699RMPA-F.KRT.K
Q8KF36_CHLTE/797-921ASFM-S.QEF.T
Q73SH3_MYCPA/470-584KQPS-F.KTA.A
Q9HL15_THEAC/841-948HTPA-Y.KEL.P
P72261_CUPNE/641-748GTPS-Y.KSV.P
O66590_AQUAE/549-657KEPD-L.KYS.G
Q8E8Z1_SHEON/815-926IGES-A.NTI.L
Q975S3_SULTO/545-647KTPK-Y.KYT.E
Q6LHJ1_PHOPR/877-982GIPE-R.KGG.M
Q73Y53_MYCPA/606-717NQPE-F.KAC.A
Q5LSC3_SILPO/576-694GNAA-F.NGL.P
Q48944_METBA/3-104GSPL-Y.KGA.P
Q9UYM9_PYRAB/574-678KMPE-L.KTA.A
Q5LQU6_SILPO/635-751QGPI-A.HSC.L
Q8YXZ5_NOSS1/641-742GTPA-Y.KRV.P
Q5LV68_SILPO/807-913KIPE-F.KYA.A
Q7WQ64_BORBR/651-773GSVP-L.RAT.V
Q8E9C6_SHEON/742-856RGIP-A.NTA.R
Q5V6J3_HALMA/570-676EIPE-Y.KHS.A
Q9V0J3_PYRAB/558-659GTPE-L.KYS.S
Q8EH03_SHEON/710-830KGNP-Q.HTN.R
O29065_ARCFU/614-731GSTT-F.RAM.L
Q5U9M0_NOCSJ/627-747AGPS-I.NAL.V
Q5P3W2_AROAE/574-684GGPT-F.YDC.L
PHSA_SALTY/637-742CGNL-LPHVTSP
Q5YVJ8_NOCFA/592-712GNSA-V.NNT.W
Q7UYU5_RHOBA/635-741GQPS-Y.KDC.A
Q8NR68_CORGL/1101-1222VAGG-YGHLTYG
O87815_CUPNE/815-920NCPE-Y.KVT.A
Q87XL6_PSESM/606-726GNAA-L.NGV.P

PF11769

A3RY58_RALSL/17-217TGVEKGADALVA
A5W3J4_PSEP1/15-215PVLDGWAKDMRA
Q3BN61_XANC5/17-217AGIGLGAQQLVD
Q6SG91_9BACT/21-223RILNAWGEQFRE
Q7WM33_BORBR/16-217PLIDEWTDNVAR
Q1YZ11_PHOPR/30-233KDVDNFVKEVRT
Q1I9J6_PSEE4/15-215PVLDGWASDMRR
B0KFL6_PSEPG/15-215AVLDGWAKDMVG
Q212W3_RHOPB/96-293ELAGSFGEDFAT
B1J950_PSEPW/15-215KVLDSWASDVHQ
Q2K737_RHIEC/28-222ALAGKFSSEFSR
A3UTR3_VIBSP/12-213KNVEQITQQAVD
C4ZVH0_ECOBW/16-216QVIDDMATDATM
A4XXD7_PSEMY/14-214PVIDGWASDMRQ
A6DT86_9BACT/12-211KTLDKWAKNTGN
Q89V44_BRAJA/17-217AGLDKGADALMA
A6T9U9_KLEP7/16-216QVIDDMAVDAVK
A4A7W3_9GAMM/19-227RNFSSWAKQIHD
A5ELW2_BRASB/19-218AGIDKGADVLVA
A4XNM5_PSEMY/14-214PVLDSWARDARD
Q4KCT9_PSEF5/15-215NVIDGWAYDMHQ
Q4UPK0_XANC8/17-217AGIRKGADQFVQ
A6CW22_9VIBR/12-210PDVKEISDNVSA
A1V9P8_DESVV/17-214DACNYWAQLVGK
A8G034_SHESH/17-223DAIDWWVERIGS
Q3KD98_PSEPF/15-215SVIDGWASDLHQ
Q8EJG6_SHEON/12-210KMIDKWAAGRAK
A5KWT3_9GAMM/14-215DAINYWVERLGD
Q3KCQ9_PSEPF/15-215AVLDGWATDLSQ
A4WAC4_ENT38/16-216KVVDDMATDATM
A5G885_GEOUR/18-218AALKYWAQRTRY
Q02QJ6_PSEAB/14-214AVLDGWAADMRM
Q72FH0_DESVH/17-213DAFDFWAKRLAR
Q1MF14_RHIL3/37-231SLASKFSSEFSR
A8H2Z2_SHEPA/23-232TVYRSWVNDFKN
A0KEU2_AERHH/12-210KMIDQWAAGRAK
A5EPN2_BRASB/27-221DLAASFSADFGQ
A6AUE5_VIBHA/20-221DAINWWVDRLGV
Q6D6W2_ERWCT/17-217VGIDKAAEELAD
A8GI51_SERP5/13-213NAIDTIANDIKE
A0YG64_9GAMM/14-211QAFLQWASLLGN
A2SGK3_METPP/19-196LALRKAAADFSE
A5KUS9_9GAMM/12-213KNIEQITKQAVD
A5G4X5_GEOUR/18-219DALQYWAKRLNY
Q4ZSE5_PSEU2/17-217AGISRGADELVE
A1AL14_PELPD/18-218EALKYWAKKIRF
Q392W5_BURS3/17-217TGIDKGADALVA
Q2BPS6_9GAMM/15-215RLLESWAERLHV
A4BRI2_9GAMM/34-238NAMDKWAEMTVT
Q1I974_PSEE4/15-211AVLDGWAVGLRQ
A0YF98_9GAMM/15-222ALVRKWASKLSS
Q47Z55_COLP3/17-219RMIRKWAKALRI
A7MLE9_CROS8/16-216QVIDDMATDARM
Q1Z110_PHOPR/13-215ETVELFTQDIVH
Q481J3_COLP3/20-224ELLDMWAAKFVD
Q1MBJ8_RHIL3/28-228VGIRKGADALRA
B2JWQ4_BURP8/17-221PIMDDWCDTVSK
Q7NTV3_CHRVO/46-251PLIDEWCRQSAR
A6F9D1_9GAMM/1-203PLLEVWIKDAKH
Q2LRC4_SYNAS/42-242DAFKFWSEKIVS
A8GLB6_SERP5/17-218AAIDDVVTDITN
A4SXI7_POLSQ/15-222VVLASLEASASP
A1JQJ1_YERE8/17-218STIDGLVYDIIN
A6CY09_9VIBR/12-211ANVNRITEQSVD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window