Sequence alignment for CL0337

PF00472

Q6C4Y3_YARLI/237-350SSVAAD.DIQFAPGEVRIDVM.RAQGAGGQHVN-KTESA....................VRL.VHI.......--PTK..
A5CFS6_9ZZZZ/1-133MLKIND.SLSIPFQEIEVSAI.RSRGAGGQNVN-KVSTA....................IHI.RFDVRASTAL--SDHDK
A7FFJ2_YERP3/9-140VLIISN.SVTLASGEIELTAI.RAQGAGGQHVN-KTSTA....................IHL.RFDIKA.SSL--PEYYK
RF2_CHLPN/224-337EIDDQI.KIEIRPNDLRIDTF.RSSGAGGQHVN-VTESA....................VRI.THL.......--PSG..
A9L1I1_SHEB9/212-324EIDDDI.TIDINPSDLRIDTY.RASGAGGQHVN-KTESA....................IRI.THL.......--PTN..
Q1NYN4_9FLAO/211-324EEDYNN.NINIVLSDLKRETF.RASGAGGQHVN-KTESA....................IRL.THI.......--PTG..
RF1_MARAV/210-323EADEAE.AVEINKADLRVDTF.RSSGAGGQHVN-KTDSA....................IRI.THL.......--PTG..
Q26FH6_FLABB/206-319PEAEEF.DVELDMTEVRIERT.TSTGPGGQSVN-TTYSA....................IKL.HHE.......--PTG..
Q47QP1_THEFY/4-136NPLGAP.RVELRDDELVWRFS.RSSGPGGQHAN-TASTR....................VSL.SLDVTTTAVL--TEEQR
Q1NMR1_9DELT/5-136PMLINN.EISLPEAEIELRAM.RAGGPGGQHVN-KAATA....................IHL.FFDIRA.SSL--PEQVK
RF1_EHRRG/208-321PEIEEV.DLKIDEKDLRIDVY.RSSGPGGQSVN-TTDSA....................VRI.THI.......--PSG..
A5IA45_LEGPC/10-127LTEKMT.NLHIYETDLSEKFI.LGSGKGGQKLH-KTAST....................VYL.KHL.......--PTG..
RF1_THET8/203-316PKAEEE.DFALNMDEIRIDVM.RASGPGGQGVN-TTDSA....................VRV.VHL.......--PTG..
RF2_SACEN/223-334VVEETD.HVEIPEKDIRVDVF.RSSGPGGQSVN-TTDSA....................VRI.THI.......--PTG..
Q05FU9_CARRP/96-209NINLDN.NLKLKNEDLKIEIC.KSSGSGGQHVN-KTNSA....................IKI.IHL.......--PTK..
Q7WZQ7_9GAMM/156-269EITMKVHNIKINTNELRIDTY.RSSGAGGQHVN-TTDSA....................VRI.THL.......--PTK..
Q3SIP9_THIDA/1-133MIRVNA.EIELDEREIQEDFV.RASGPGGQNVN-KVSSA....................VQL.RFDVAHSPSL--PQPVR
A1SGG6_NOCSJ/18-144P.GLPA.GLVVPEGELVERFS.RSPGPGGQSVN-TTDSR....................VEL.EYDAAVSTVL--DDAQR
A5GWL3_SYNR3/4-136DLVIHQ.RLAIPAAELQWRFT.RSSGPGGQNVN-KLETA....................VEL.LFDLQASSVL--GEVRR
RF1_MYCPU/211-323EIDDDI.EVEINPSDLKIDTF.RSSGAGGQSVN-TTDSA....................VRI.THI.......--PTG..
Q4UA63_THEAN/203-336VVNFKK.NRQLLKKDLIIESM.RSSGKGGQNVN-KVETAGNLLFLKSIFTKSTIDIFVLVRV.YHK.......--PTG..
B0UQN2_METS4/2-134ALDCTP.SISIDESELEESFV.RASGPGGQNVN-KVATA....................VQL.RFDVRRSPSL--PNAVA
A8WV66_CAEBR/18-132KLKGYK.FPEVKKDDCEQKYI.SGWGPGGQKVN-TAQNA....................VQL.THR.......--PTG..
A7AQR8_BABBO/53-174LRRILR.ERHGSEYPLREYYI.KGTGPGGQKVN-KSSNC....................VQLIRYS.......--PALG.
Q4W6B7_DESVU/230-343DVGQEI.TVDIKETDLRIDIF.RSSGPGGQSVN-TTSSA....................VRI.THL.......--PTG..
RF1_STRPF/209-322PEVEEV.EYDIDQKDLRVDIY.HASGAGGQNVN-KVATA....................VRM.VHI.......--PTG..
A4EBF6_9ACTN/206-319PEAEEI.DVQINQSDLRIDTY.CASGPGGQCVN-TTYSA....................VRI.THL.......--PTN..
Q5DDV9_SCHJA/271-384PNYGDV.DVDISDDDLKWEFH.RPTGPGGQNLN-KSTSA....................VRL.THL.......--PTG..
O66115_ZYMMB/3-134KYFITQ.RISIDSDSIEEYFI.RASGPGGQNVN-KVSSA....................VEL.RFDMAI.SGL--PELVI
A5KEB9_PLAVS/287-400RKKIKK.KMNLKKSDLIIETK.RSGGPGGQSVN-KNETC....................VKV.LHK.......--PTN..
Q213N7_RHOPB/169-282VVDNTI.KIDIAESDVRVDTM.RSGGAGGQHVN-KTESA....................VRL.THI.......--PTG..
A6WX48_OCHA4/19-151IIRITN.RLTIREDDLEESFI.RASGPGGQNVN-KVSTA....................VQL.RFHAVR.AGL--PEDIL
A5V621_SPHWW/3-135LIPVTR.SIAIDSDEIEESFT.RAGGPGGQGVN-TTDSA....................VML.RFDVRNSPNL--PDAVK
Q6A8B5_PROAC/207-320PDVDET.EVDIDPAEVRVDVY.RSSGPGGQGVN-TTDSA....................VRL.THL.......--PTG..
B4SGJ9_PELPB/222-334EAPPDV.EIDVRKEDLELSTF.RSGGKGGQNVN-KVETA....................VRI.KHL.......--PTG..
Q16L13_AEDAE/263-376PRPDEF.EIELKDKDLKIETK.RASGAGGQHVN-TTDSA....................VRI.VHL.......--PTG..
RF1_HYPNA/200-312PAPENI.EIEVRADDIRIDTM.RSSGAGGQHVN-TTDSA....................VRI.THL.......--PTG..
Q8IC21_PLAF7/212-324GNNKMN.DFVINKSDLVIQTM.RSGGKGGQNVN-KVETA....................VRI.LHK.......--PTN..
RF2_AQUAE/223-336QIDEDI.KIEIKPEDLKIETF.RASGAGGQYVN-KTDTA....................VRI.THI.......--PTG..
A1U4S4_MARAV/1-132MLKLSN.AVELADWEIQITQI.RSQGAGGQNVN-KVASA....................VHL.RFDILH.STL--PPFYK
RF1_SYMTH/206-319PEMEEV.DIEIKPEDLKIEVQ.RAGGAGGQHVN-KTESA....................VRM.THL.......--PTG..
A9A0M9_DESOH/1-133MLTISR.NIAIDENELTFKFI.RASGPGGQNVN-KVASA....................VQL.RFDVAHSPSL--PGPVK
A7TJJ1_VANPO/249-362REAEAY.ERTFKPDEIRIDVM.RARGKGGQHVN-TTDSA....................VRL.THF.......--PSG..
RF1_BIFAA/213-326ADEDDD.EIEIDPKDLKIDIF.MSSGPGGQSVN-TTYSA....................VRM.THI.......--PTG..
Q1JMP0_STRPC/194-307ELDDTI.EVEVRDDDIKMDTF.RSGGAGGQNVN-KVSTG....................VRL.THI.......--PTG..
RF1_BDEBA/206-319PEVEVS.EIKIPMSDVRIETM.RSQGSGGQSVN-RTESA....................VRV.VHL.......--PTG..
RF1_HELAH/206-319PEVDDV.EISINPSDLKIEVF.RAGGHGGQCVN-TTDSA....................VRI.THL.......--PTN..
Q9C7K9_ARATH/359-472LGDGST.RVEINDSDLRIERF.RSGGAGGQHAN-TTDSA....................VRI.VHI.......--PTG..
A9BD41_PROM4/206-319KLEEEV.ELDIPEKDLEITTS.RSGGAGGQNVN-KVETA....................VRI.VHL.......--PSG..
F2G9V3_ALTMD/2-133ELRISR.TIAIDESEADLQAI.RAQGSGGQNVN-KVSSA....................IHL.RFDIHA.SSL--PERLK
A1TPJ3_ACIAC/10-141PAAGRA.PLRVDEREIVFTAM.RAQGPGGQNVN-KVSSA....................VQL.RFDIAA.SSL--PEDVK
A4FN91_SACEN/4-136DLPVTR.RLAIPAAELSERFS.RSSGPGGQGVN-TTDSR....................VEL.SFDLARTPSL--PDELR
Q2ISE1_RHOP2/1-132MLRISR.NLAIDDDDIEISFV.RASGPGGQNVN-KLSTA....................AQL.RFDTTK.IAL--PEDAA
Q40KD7_EHRCH/80-193VINEDT.NIEILDKDLRIDTY.RASGAGGQHVN-KTESA....................VRI.THI.......--PSG..
RF1M_MOUSE/287-400PQPDEV.DVKVDPKDLRVDTF.RARGAGGQHVN-TTDSA....................VRL.VHI.......--PTG..
A3ZUC9_9PLAN/205-318PEPEDV.EFELNPEDYEVERYAASSGPGGQHVN-KTASA....................VRL.IHK.......--.DG..
B9LKG2_CHLSY/169-282EVDDAP.EVEIKPEDLRIDVF.RSGGHGGQGVN-TTDSA....................VRI.THL.......--PTG..
A3Z8U8_9SYNE/212-325PEADPV.EVQIDPTELEISTA.RSGGAGGQNVN-KVETA....................VDL.LHK.......--PTG..
RF1_DEHSC/206-319PQVEEV.DIDINMDEVRVDIF.HSSGAGGQNVQ-KVATA....................IRL.THM.......--PTG..
B4SFS2_PELPB/1-132MLQITE.TIAIPDEEIELQTM.RAQGAGGQNVN-KVETA....................VHL.RFDVKA.SSL--PEDFR
Q8YN74_NOSS1/1-132MLQISQ.KIIIPDSEIEISAI.RSQGAGGQNVN-KVSTA....................IHL.RFNIEA.SSL--PTFYK
A6GH88_9DELT/3-135DLLVTA.AVVIPARELSWTAV.ASGGPGGQHVN-KVATK....................VQL.RWTLANSESL--PEWAR
Q4V049_XANC8/5-137PIQITP.NLAIPPGEIVERFV.RASGAGGQNVN-KVSTA....................VEL.RFDVAGSPSL--PEPLR
Q8ENI8_OCEIH/185-298EMSDDV.DIDIRTEDIKVDTY.RASGAGGQHVN-TTDSA....................VRI.THL.......--PTN..
RF1M_SCHPO/243-356VSNDES.SSLYDSSEVKIEVM.RSRGAGGQHVN-RTESA....................VRL.THI.......--PTG..
A4YAS6_SHEPC/6-137MIKISN.RVELQENEIEWQFI.RSSGAGGQHLN-KVSTA....................AQL.IFDIKS.SSL--PEFYQ
A5K0W5_PLAVS/127-240HTDEHR.KDEVNLKDLRIKTF.RSSKPGGQNVN-KIESG....................VSI.LHK.......--PTG..
A3ZTS2_9PLAN/183-296EIPDSE.EVEIDEEDVRIDTY.RASGAGGQHVN-KTDSA....................IRL.THL.......--PTG..
A6EKN5_9SPHI/229-342PEAEEI.DLYINPADIDLQTS.RSGGAGGQNVN-KVETK....................VQL.THR.......--PSG..
A4HZC8_LEIIN/438-538PFVSAALVRNAKRCSVAYETA.RASGPGGQATN-VTETQ....................VYA.KLAID...GA--PA...
Q1LHN6_RALME/2-133MRRMAD.DFFIPHQEYDITAI.RAQGAGGQNIN-KVSNA....................VHL.RYDVRA.SSL--EPDHK
A1BIW3_CHLPD/2-133AHKETS.SITIPRAEIELSTM.RSEGAGGQNVN-KVETA....................VHL.RFAIKD.SSL--SDEVK
Q83MV7_TROWT/204-317EVDAPG.EIEITNDEIRIDVF.RSSGPGGQSVN-TTDSA....................VRI.THL.......--PTG..
A3SP41_9RHOB/223-335VVDDDI.EIEVNPADIRIDTY.RSSGAGGQHVN-TTDSA....................VRI.THH.......--PTG..
Q8A1V6_BACTN/167-287LVDDSI.EVNILPACISWDTF.RSGGAGGQNVN-KVESG....................VRL.RYQYK...DP--YTGEE
ICT1_MOUSE/63-194EHAKQA.SSYIPLDRLSISYC.RSSGPGGQNVN-KVNSK....................AEV.RFHLASADWI--EEPVR
RF1_MYCPE/209-322PELEEV.ELVINNSDLKIDTY.RASGAGGQHIN-KTESA....................VRI.THI.......--PTG..
A5TTN5_FUSNP/207-320EVEDVQ.EVTVDPKDLKIDTY.RSGGAGGQHVN-MTDSA....................VRI.THL.......--PTG..
Q1D377_MYXXD/223-336EVDDTI.QIDIPEKDIDLKFI.RGGGAGGQKVN-KTSST....................AQL.RHL.......--PTG..
Q0FEF1_9RHOB/1-133MIKITN.KINIEEWEITESFM.RSSGPGGQHVN-KVSSA....................VEL.RFEAERSPNL--PPFVK
RF1_ONYPE/203-316PEAEEL.ELKIDWHDIRTDTF.NSSGPGGQSVN-TTKSA....................VRL.THI.......--PSG..
Q4N9A1_THEPA/87-205KVF....EISEPNSKLEEKYI.KASGPGGQKIN-KSAIC....................VQL.NYS......N--PSGS.
Q26EB2_FLABB/237-350LADDTI.EIDINPADIKWDFA.RSSGAGGQNVN-KVETK....................AIL.THH.......--PSG..
Q0BYR4_HYPNA/6-137DLRISD.AITVPAWELSEAFV.RASGPGGQNVN-KVSSA....................VQL.TWHVQA.SSL--PAPVK
A4HE77_LEIBR/140-253PVLDPV.SVDVHESDCKIDFV.RGSGPGGQGMQ-SSSNC....................VVL.THK.......--PSG..
RF1_BUCCC/208-321EVPKSK.RIILNTSDLKIDTF.RSSGAGGQHVN-TTDSA....................VRI.THL.......--PTG..
Q0S637_RHOSR/16-148DLEITR.SLVVPAAELQWRFS.RAGGPGGQGVN-TTDSR....................VEL.RVNLWTLSTL--SRSQL
Q2S1N4_SALRD/222-342EVDDSI.GVDLSEGEIELQTF.RSGGKGGQHVN-KVETG....................VRL.IWTGTLSNGE--ETT..
Q1GD68_SILST/1-133MLRIND.DITLQDWELTESFM.RASGPGGQNVN-KVSSA....................VEL.RFEAERSPHL--PGPVK
A6NQT8_9FIRM/225-338DLPEDA.DVEIRPEEYEMQVF.RSSGAGGQHIN-KTSSA....................VRL.IHH.......--ATG..
A2TQJ7_9FLAO/1-128MHREQL......LQELSFKAS.KSSGPGGQHAN-KTSSR....................IEL.SWSLPETLAF--TEEEI
Q54IC8_DICDI/281-396ISDDSI.KINIDPKDLHFETL.RSSGAGGQHVN-KTESA....................VRI.VHI.......--PTG..
Q3JDZ2_NITOC/1-133MITVTP.HIQLREEELHFQFV.LASGPGGQNVN-KVATA....................VQL.RFDAAHSPSL--PEDVR
A5KAJ9_PLAVS/67-185KKLE...GIGVFPKDIEETFI.KGTGKGGQKVN-KTNNC....................VMI.RY........--ASGEG
Q2KZU8_BORA1/1-132MLHIKD.SLYLDERELDFGMI.RAQGAGGQNVN-KVSSA....................VHL.RFDVPA.SSL--PDAVK
A4RYN9_OSTLU/133-246EEDMEE.VVKVPDTDLEVTTM.RSGGAGGQNVN-KVETA....................VRI.KHI.......--PTG..
A6P081_9FIRM/203-316PEAEEV.DVDINPADIEMQVF.RSSGAGGQHIN-KTSSA....................VRL.IHK.......--PTG..
Q11R84_CYTH3/218-331EVDETI.NIEINMGDVEWDTF.RAGGAGGQNVN-KVETA....................VRL.KHK.......--PSG..
RF1_MARMM/205-317PQPEDI.DIELDMGDVRVDTM.RASGAGGQHVN-KTDSA....................VRM.THI.......--PTG..
RF1M_CAEEL/232-345PEPEEV.SVVVPSDSVKIEAM.RASGPGGQNVN-KRSTA....................VRM.THK.......--ETG..

PF10213

Q6BHR9_DEBHA/152-275EY..KPEPTKDSPIKLSFNSD-FSDG...SNSL.NRKVT--------------------LSC-NIEDL...NL..NEKQQ
Q0UNP6_PHANO/225-345PF..TPPTH.TTPFRFRYTSY-LNEP....HPA.ANKVV--------------------VEF-DPTDL...SL..PPKSV
Q7QIE1_ANOGA/164-272HY..........PVTCVTSDY-CHALPTIRNPL.SRIVT--------------------VQV-ELGAL...QL..DRHAR
Q5AI30_CANAL/149-276PY..TPRPRTEAPIRLTYNSD-FTDDTSSAH...NRKVA--------------------LKV-SLRDL...NL..NPKQQ
Q5KKI5_CRYNJ/92-233KF..TPP...TAPIRLTSTID-LARP....DSRYHTKCV--------------------LLV-PIAAL...PL.STPEAV
Q4P1X3_USTMA/101-247AY..TPPKP.EQCLQFRFQHY-QGEN....HPA.SRKVV--------------------LTV-NVDELVKVGAVKDTPSK
YA2F_SCHPO/103-225SF..KKPAD.SQIFRFESDVQ-MSSF....EKM.NPKVV--------------------VTF-KVTNI..PLL..EEKQR
RT35_DANRE/159-267HF..........PIQVQSKDF-VSSGLSLRNPD.ARIVT--------------------LKV-KHSSL...NL..DDHAR
RT35_HUMAN/146-254HF..........PIEIDSTDY-VSSGPSVRNPR.ARVVV--------------------LRV-KLSSL...NL..DDHAK
Q0VFU1_XENTR/153-261NF..........PINFQTLDY-VSAGPSLRNPK.ARVVS--------------------MQV-KLSSL...NL..DDHSR
Q16WG3_AEDAE/160-283HF..........PVDYISTDY-CHALPTIRNPL.SRIVT--------------------VQL-KVDTL...KL..NKHAK
Q9NEI6_CAEEL/188-296HL..........PISIEYSTY-IHQGTSIRDIR.SRVVT--------------------MKI-HVAEL...KL..SENQM
Q6C9T8_YARLI/244-376PFDVKEADKKASPLTFKYTSY-TGEE....ADE.EAKVV--------------------CYF-DPANL...GL..SDKGL
Q0CSW1_ASPTN/191-313PF..SLPPE.THLLRFRYTTY-MGEQ....HPA.ENKVV--------------------VEL-STKDLTPKYL..SEAQR
Q5BBX6_EMENI/190-312PF..TLPPE.THILRFRYTTY-MGES....HPA.ENKVV--------------------VEL-SSSDLVPRYL..TEAQR
Q2GTQ2_CHAGB/188-309PF..QPPTE.QEILRFRYTTY-MGEF....HPA.DRKVV--------------------VEF-CPADM..QDL..TAAQQ
Q9P5J2_NEUCS/186-307PF..VPPTS.EEVLRFRYTTY-MGEF....HPA.DRKVV--------------------VEF-CPKDL..RDL..SEVQQ
Q750S9_ASHGO/156-283EY..RPPSRKTQPVLYRYTTY-IGEE....HPN.SRKVV--------------------LSV-LTADL...GL..NEAQL
Q6CQD0_KLULA/156-283EY..KRPSTKTHPVAYRYTTY-LGEE....HPN.SRKVV--------------------LSV-KTSDL...GL..EQREL
RT24_YEAST/171-299EY..KRPSPESHPVTYRYTSY-VGEE....HPN.SRKVV--------------------LSV-KTKEL...GL..EEKSL
Q6FVM5_CANGA/158-289EY..KPPSA.SDVVTYKYFTY-VGEE....HPN.SRKVV--------------------LSL-KTESL...GL..EPRAL

PF00472

Q6C4Y3_YARLI/237-350..............-----------------..TMVVMQNSRSQRQNKEMAFMILRGRLAEQ...K........RREQAA
A5CFS6_9ZZZZ/1-133RRVLRLRDQRISKE-----------------GVIVIKAQRFRSQDKNRSDALEKLAEMIRKA...L.......VEKKPRK
A7FFJ2_YERP3/9-140ERLLLLNSHLVTAE-----------------GVVIIKAQEYRSQDMNREAALARLVALIRQA...M.......VVEKARR
RF2_CHLPN/224-337..............-----------------..VVVSCQNERSQIQNRESCMKMLQAKLYQQ...V........LQERLE
A9L1I1_SHEB9/212-324..............-----------------..TVVQCQNDRSQHKNKDAAMKQLKAKLFEL...E........MLKQNA
Q1NYN4_9FLAO/211-324..............-----------------..IIAECQEERSQHKNYEKAMKVLRARIYQS...E........LKIKNE
RF1_MARAV/210-323..............-----------------..IVVECQEERSQHKNRAKALSLLASRLQNA...E........LEKQQK
Q26FH6_FLABB/206-319..............-----------------..MIVSCQDQKSSHKNLEKALKVLRSRLYEM...E........LAKKME
Q47QP1_THEFY/4-136ERVLRR.LGPRLVD-----------------GVLTVSAQDFRSQARNREVAWERLAALLSEA...AR......PPARKRR
Q1NMR1_9DELT/5-136GRLLTLNDRRITAE-----------------GTVVIKAVAHRSQEQNKEEARRRLRDLIIAA...S.......RVPKKRR
RF1_EHRRG/208-321..............-----------------..IVVIQQDEKSQHKNKNKALKVLRARLYDL...E........KQKRDA
A5IA45_LEGPC/10-127..............-----------------..MEVKCQESRSREDNRYFARQRLCEKLQAVFSDEKTKTQQRIEKIKRQ
RF1_THET8/203-316..............-----------------..IMVTCQDSRSQIKNREKALMILRSRLLEM...K........RAEEAE
RF2_SACEN/223-334..............-----------------..IVVSCQNEKSQLQNKAAALRVLQSKLLA..............KKKEQ
Q05FU9_CARRP/96-209..............-----------------..IAVECSDERSQNLNKTKALIILNMKILKF...Q........KNNYNT
Q7WZQ7_9GAMM/156-269..............-----------------..IVVECQSERSQHSNKERALTLLKTKLYDF...D........KKKGEV
Q3SIP9_THIDA/1-133DRLLVLAGRRVTQD-----------------GVLIIEAERYRSQRRNRDDALERLLALIREA...C.......EVETPRR
A1SGG6_NOCSJ/18-144ARVV......GRLG-----------------SPVRVVASEHRSQHRNRVAARERLAERLREA...LA......PPPPPRR
A5GWL3_SYNR3/4-136QRLQQR.LGSKLSG-----------------GVLRVVAAEHRSQWRNRQLALERLAELLREG...LK......PPPKPRR
RF1_MYCPU/211-323..............-----------------..IISSSQEGRSQISNRELALKILKAKLYDH...E........NQKKLE
Q4UA63_THEAN/203-336..............-----------------..LSVKVQQERTNTQNREIAIRMLTKLVDQH...Y........LKKLNE
B0UQN2_METS4/2-134IRLMKLAGRRLTAE-----------------GVLVITAQEHRTQDRNRAEARERLAELVREA...A.......IPPKPRR
A8WV66_CAEBR/18-132..............-----------------..TVVKVHESRLLPKNIEIAFERMKVVLDRQ...INGDNCYEEQLKRLQ
A7AQR8_BABBO/53-174..............-----------------VNIVVKCHKHRSLLDNRIEATRILLRRLDQAVTAQSRALRQAEEKSKRR
Q4W6B7_DESVU/230-343..............-----------------..ISAQCQNEKSQHSNRDTAMQILRARLYEL...E........LRKLEE
RF1_STRPF/209-322..............-----------------..IKVEMQEERTQQKNRDKAMKIIRARVADH...F........AQIAQD
A4EBF6_9ACTN/206-319..............-----------------..TVVQSQEQRSQIQNREVCMQMLRARLYEM...E........LEKQQA
Q5DDV9_SCHJA/271-384..............-----------------..IIVSCQRERHQHTNKKHALGMLKEKLRDI...Q........LKSQLH
O66115_ZYMMB/3-134NRLQEIAASRINNK-----------------GILVIQAQRFRDQPLNRQDAFERLVELIRSA...T.......FIPKKRK
A5KEB9_PLAVS/287-400..............-----------------..ISVEVQKTSSQMQNRNMAIEALKTKLFSF...Y........YQQEKD
Q213N7_RHOPB/169-282..............-----------------..VAVVCQAGRSQHKNKAQAWDMLRARLYEI...E........LKKREE
A6WX48_OCHA4/19-151SRLFKLAGQKGTKD-----------------GDILIEANRFRTQERNREDARERLIALIAKA...AE......PPPPPRK
A5V621_SPHWW/3-135IRLDAIAGSRMTRE-----------------GVLVLRSEGARSQLLNRQEVRERLFDLIREA...T.......FVPKKRK
Q6A8B5_PROAC/207-320..............-----------------..IVASCQNERSQLQNKAEAMRMLRAKVAAL...A........AQQAAD
B4SGJ9_PELPB/222-334..............-----------------..IVVGCQEERSQFQNRERAMKMLMAQLYQR...Q........RDEEDA
Q16L13_AEDAE/263-376..............-----------------..MAVECQTERSQVKNKEIAKQKLLAKLTQQ...E........LESKFN
RF1_HYPNA/200-312..............-----------------..IMVTSS.EKSQHVNREKAMDQLKIRLYER...E........RAEKDA
Q8IC21_PLAF7/212-324..............-----------------..ISVKASSERTQLLNKRNALKRIYEKLLYL.............QTEAL
RF2_AQUAE/223-336..............-----------------..ITVSCQQERSQYQNKRKALELLKAKLYQL...E........MKKLEE
A1U4S4_MARAV/1-132ERLMALSDQRISKD-----------------GVIVIKGQSFRTFEQNKEDALNRLKTLIQEA...V.......KPQKARR
RF1_SYMTH/206-319..............-----------------..IVVYCADERSQMQNREKALRVLRARVADY...Y........AQQAKS
A9A0M9_DESOH/1-133NRLIKLAGRRISEE-----------------GVLVIEAKRFREQGKNRQDAIDRLVALVARA...L.......VVPRARK
A7TJJ1_VANPO/249-362..............-----------------..IVISMQDERSQHKNKAKAFAILKSKLAEI...E........RLEKEE
RF1_BIFAA/213-326..............-----------------..ITVNMQDEKSQIQNRAAALRVLKSRLLAM...K........HEQEAA
Q1JMP0_STRPC/194-307..............-----------------..IVVSSTVDRTQYGNRDRAMKMLQAKLYQL...E........QEKKAQ
RF1_BDEBA/206-319..............-----------------..IDVKCQEGKSQSTNRERAFQILYAKLQQI...E........DEKARK
RF1_HELAH/206-319..............-----------------..ISVSMQDEKSQHKNKDKALKILKARLYEK...Q........IEEQQL
Q9C7K9_ARATH/359-472..............-----------------..ITATCQNERSQHSNKASAMAVLQSRLDQL...E........MARQTA
A9BD41_PROM4/206-319..............-----------------..LAVRCTQERSQLQNKEKAMALLKAKLMII...A........QEQRAS
F2G9V3_ALTMD/2-133EKLLQAKDKRVTNE-----------------GVFVLKAQNYRTQEQNREDALARLVEWIKAA...T.......IEQKTRI
A1TPJ3_ACIAC/10-141ARLLALPDARITQA-----------------GVVVIKAQQFRTQEANRLDALQRLDALVARA...A.......RPPRVRR
A4FN91_SACEN/4-136RRAVER.LGHRLVD-----------------GVVTIAASEHRSQLANRQAARERLAALLAEA...VA......PPPRKRR
Q2ISE1_RHOP2/1-132LRLINLAGQRMTKE-----------------GVIVIHAQRFRTQERNKADAIDRLLELLRAA...M.......VRPIPRR
Q40KD7_EHRCH/80-193..............-----------------..IVVQCQNNRSQHQNLAEAHNLLKSRLYQL...K........LQEKEK
RF1M_MOUSE/287-400..............-----------------..LVVECQQERSQLKNKEIALRVLRARLYQQ...I........IEKDRC
A3ZUC9_9PLAN/205-318..............-----------------..VIVQCCEERSQHKNLAKALRLLKTKLYEV...K........RAEEEK
B9LKG2_CHLSY/169-282..............-----------------..IVVTCQNERSQIQNRELAMRVLRARLLER...E........LQRQAE
A3Z8U8_9SYNE/212-325..............-----------------..IRVFCTQERSQLQNRERALEILRAKLYER...Q........LAEANA
RF1_DEHSC/206-319..............-----------------..LVVCCQDERSQLKNKNKAFAVLRARLMEL...E........QSKVDE
B4SFS2_PELPB/1-132EKLLLLKDHRMTKD-----------------GVIIIKAQRYRSQEKNRTDALMRLQALLQHV...A.......LPVKKRK
Q8YN74_NOSS1/1-132EQLLKLNDRRINQE-----------------GVVVIKAQEHRSQEQNKEEALQRLKELIKGA...V.......ILPQPRK
A6GH88_9DELT/3-135ARLVAAAGRFIDRD-----------------GNLLISCASTRSQDRNRELARERLADMVRAA...L.......DRPKRRR
Q4V049_XANC8/5-137ARLLSRRDRRMTAD-----------------GVLVIDAQRFRTQDRNREDARERLAEIINAC...L.......SVPKRRV
Q8ENI8_OCEIH/185-298..............-----------------..IIVTCQNERSQIKNREAAMKMLKSKLYQL...E........VEKQRQ
RF1M_SCHPO/243-356..............-----------------..ITVSMQDSRSQHQNKEKAFLVLNSRLAAL...N........AAKENE
A4YAS6_SHEPC/6-137ERLLNKADHRITKS-----------------GKIIIKCQASRSQDANRQTALEQFIALVASV...G.......EVQKKRI
A5K0W5_PLAVS/127-240..............-----------------..MQTECQEERTQEMNKKIALKRLTEKISHL...R........HKQSEE
A3ZTS2_9PLAN/183-296..............-----------------..VVVQCQNERSQHKNRAQAWKMLRSRIARI...E........EERREA
A6EKN5_9SPHI/229-342..............-----------------..IVVVCQQERSQLGNRVIAMEMLRSKLYDI...E........LQKKNG
A4HZC8_LEIIN/438-538..............-----------------..YTAEAQDSRSALSNKEAALDKL...................QQQRRL
Q1LHN6_RALME/2-133ERLLALHDHRITRD-----------------GVVVIKAQQHRSLELNREEAIRRLHELVRSV...A.......EPPRVRR
A1BIW3_CHLPD/2-133ERLLEIRDRRISKK-----------------GIVIIKAQRFRSQEKNREDAICRLHELLLKA...V.......DEPEERR
Q83MV7_TROWT/204-317..............-----------------..IVVSCQNEKSQIQNRESAMRILRARLIAK...R........QDEIEK
A3SP41_9RHOB/223-335..............-----------------..IVVT.SSEKSQHQNRDIAMKALKSRLYQM...E........LDRRTA
Q8A1V6_BACTN/167-287..............-----------------EEILIENTETRDQPKNRENAMRQLRSILYDK...E........LQHRMA
ICT1_MOUSE/63-194QKIALTHKNKINKA-----------------GELVLTSESSRYQFRNLAECLQKIRDMIAEA............SQVPKE
RF1_MYCPE/209-322..............-----------------..IFVACQEGKSQIENRETAMKMLRAKLWEK...K........EEENRK
A5TTN5_FUSNP/207-320..............-----------------..IVVQCQDERSQLKNREKAMKHLLTKLYEM...E........QEKQRS
Q1D377_MYXXD/223-336..............-----------------..IIITCQTERSQSANKDMAFKILRGRLYEL...E........MKKREA
Q0FEF1_9RHOB/1-133ARLRKIAGRKWTKD-----------------GALIITAEKHRLQPLNRALALKKLKTLIIEA...T.......EQPKYRI
RF1_ONYPE/203-316..............-----------------..ISVACQEGKSQHENKDKAFTILKTRIYNQ...M........LTAKQE
Q4N9A1_THEPA/87-205..............-----------------IKINIKTKKHRTLILNRIEATEILIAKLKEIKDKEIMDEKREQFKESMR
Q26EB2_FLABB/237-350..............-----------------..IVIHNSETRSQLENREKAMQMLKSQLFEI...E........LQKRNA
Q0BYR4_HYPNA/6-137ERFAKLFASRITAD-----------------GRLMLEASEHRSQVLNRTAARERLAEMILKA...S.......VPPKRRV
A4HE77_LEIBR/140-253..............-----------------..ISVKCHQCRSALGNKELALQMVAQQILAR...R........VKEQNS
RF1_BUCCC/208-321..............-----------------..CVVECQDERSQHKNKEKALSVLSAKIYSK...M........NAEKKL
Q0S637_RHOSR/16-148ERMQVQ.LGHRLVD-----------------GVITVTASETRSQLRNRRAARARMAALLRAA...VL......AETRTRR
Q2S1N4_SALRD/222-342..............-----------------..VRAACTQERSQHQNRRRAREMLKSRIYQA...E........RELKEE
Q1GD68_SILST/1-133TRLRRIAGRRWTND-----------------GALILQCDETRSQARNREIIRERLAELIRRA...L.......IKPKRRI
A6NQT8_9FIRM/225-338..............-----------------..IVVSCQTERSQFQNKDTCLRMLRAKLVEL...K........MQQHAE
A2TQJ7_9FLAO/1-128VRLTDKLAHRLTKE-----------------GVLQLASQASRSQHKNKDDVIKRFFSLLEVA...I.......QVPKVRK
Q54IC8_DICDI/281-396..............-----------------..ISVLSSSERSQHQNKSNGLLLLKSKLYSH...E........LKKKIE
Q3JDZ2_NITOC/1-133QRLMKLAGNRLTKE-----------------GELLITAKRFRSQERNRQDAIKRLVALLQQA...A.......EKPKPRR
A5KAJ9_PLAVS/67-185..............-----------------EKIIIKCHKHRCLQKNRIYARELLYDKITSVRDNLEDAITHEIEKEKRR
Q2KZU8_BORA1/1-132QAVLALPDSRLSKE-----------------GVLIIKAQAFRSQDKNRADAIERLLAVLRQA...L.......FKDPPRR
A4RYN9_OSTLU/133-246..............-----------------..ITVKAEEHRTQQLNRQAAMLRIKAKLTAL...A........EEARVA
A6P081_9FIRM/203-316..............-----------------..MVVECQQERSQFQNRDKAMQILRSRLYEA...E........QQRVSA
Q11R84_CYTH3/218-331..............-----------------..LIIECQQERSQIQNKDKALKLLKSRLYQI...E........IDKRNE
RF1_MARMM/205-317..............-----------------..LVVVCQ.EKSQHQNRARAQEILKAKLYDM...Q........REAANA
RF1M_CAEEL/232-345..............-----------------..IAVHCMDERFQHLNIQIAYKRLAAILMQK...Q........VDAMLE

PF10213

Q6BHR9_DEBHA/152-275RKFKILATNRFNHH........TN........SIKFSSNQHAEATQNARHLVSIFNRLLEAS---K-------DL.SDDF
Q0UNP6_PHANO/225-345SKLIKLAGPRYNPG........TS........VVKLSCEKFDTQAQNKRFLGESIEALLKEA---K-------DM.TDDF
Q7QIE1_ANOGA/164-272DKLLRLVGERYDPD........TD........LLTIVTDRCPLKKQNYDYAIYLLTALYHES---N-------T..VEPW
Q5AI30_CANAL/149-276HKFKVLAGDKFNHD........ED........TFQLKSERYPEAAQNVNWLVDTFNKLLTEA---K-------DLSKDDY
Q5KKI5_CRYNJ/92-233HRFKLLAGPRWTPGKPGRNEFIKDENSDGENGWIKVSEERFESARQNRRSASDILERLVNAA---N-------DRESPLP
Q4P1X3_USTMA/101-247HKLLLLAGSRFHPK........SNAAAKQGEGVIKISCELFPNERQNMKWCSDTLDALVKEA---N-------VR.TKEV
YA2F_SCHPO/103-225HVLRLLVGPRYNPE........ED........LVRISSDKYSSALQNKYHLIKILTSLIEES---K-------RN.AEKF
RT35_DANRE/159-267KKMIKLAEKRYCKE........TD........TLTITTDSCPLRQQNYDYAMYLLTVLYHES---W-------K..SEAW
RT35_HUMAN/146-254KKLIKLVGERYCKT........TD........VLTIKTDRCPLRRQNYDYAVYLLTVLYHES---W-------N..TEEW
Q0VFU1_XENTR/153-261KKLIKLAGPRYDST........TD........TLTLRSDRCPVRRQNRDYTLYLLTVLYHES---W-------K..TEAW
Q16WG3_AEDAE/160-283DKFLRLVGERYNPD........TD........VLTLVTDRCPLKKQNYDYAMYLLTALYHES---N-------V..VEPW
Q9NEI6_CAEEL/188-296EKLIRLAANRYDEK........TG........KMTIITDRCHTRQQNLDYAHYLLTVLYHEA---Q-------K..VEKW
Q6C9T8_YARLI/244-376HKFKLLSGQNYDAL........TG........QCKFASKRHPSAPENKHYLLTQILKLKTEA---E-------Q..GDSF
Q0CSW1_ASPTN/191-313QTFLKLVGPRYNPD........TD........IVRMSCEKFASRAQNKRYLADIVNDLIKES---K-------E..GDAF
Q5BBX6_EMENI/190-312QTLLKLVGPRYNPD........TD........IIRMSCEKFDTRAQNKRYLGDLIETLLKEA---K-------E..GDSF
Q2GTQ2_CHAGB/188-309LKLKKLAGPRYNPE........KD........IIKMSCERFEHQAQNKRYLGDLVDKMVATA---K-------DP.TDMF
Q9P5J2_NEUCS/186-307RKLMKLAGPRYNPE........KD........IIKMSCEKFEHQAQNKRYLGDLIEKMIAAA---K-------DP.KDTF
Q750S9_ASHGO/156-283HKLRLLARTRYDHT........TD........ILKMSSDRYEHAAQNARYLADKLQALINEA---S-------DL.TDDF
Q6CQD0_KLULA/156-283HKLRLLAKTRYDST........TD........TLRMSSDRYEEPAQNAKYLNSILLELLKEA---K-------DL.KDDF
RT24_YEAST/171-299HKFRILARSRYDHT........TD........IFKMSSDKFEHASQNARYLHDILQRLLAES---K-------DLTEDDF
Q6FVM5_CANGA/158-289HKFRVLARTRYDHE........TD........LFKMSSDKFPEAQQNAKYLGDILKRLLQEA---K-------DLSKDDF

PF00472

Q6C4Y3_YARLI/237-350KSKNARTSQVSATDRSDK..IRTYNF.HQNRVTDHR
A5CFS6_9ZZZZ/1-133PTKATKKSREKRLDEKTK..........RGRLKELR
A7FFJ2_YERP3/9-140ATKPTKGSKIRRVEGKVR..........KGATKALR
RF2_CHLPN/224-337KQSLDRKDKKE.IAWGSQ..IRNYVFQPYTLVKDVR
A9L1I1_SHEB9/212-324DKQAAEDAKSD.IGWGSQ..IRSYVL.DDARIKDLR
Q1NYN4_9FLAO/211-324KLSKERKSLISTGDRSAK..IRTYNY.PQGRVTDHR
RF1_MARAV/210-323SMAETRKSLVGSGDRSER..IRTYNF.PQGRVTDHR
Q26FH6_FLABB/206-319ADSEKRKSMVSSGDRSAK..IRTYNY.SQGRVTDHR
Q47QP1_THEFY/4-136PTKLSRAAKERRLREKRH..........RSALKRLR
Q1NMR1_9DELT/5-136PTRPGKAARERRLAAKAK..........AGRLKALR
RF1_EHRRG/208-321EISQLRKSQIGSGDRSER..IRTYNF.PQSRITDHR
A5IA45_LEGPC/10-127KRRRSRRSKQKMLDEKSR..........QSQLKTLR
RF1_THET8/203-316RLRKTRLAQIGTGERSEK..IRTYNF.PQSRVTDHR
RF2_SACEN/223-334ERAELDALKDSGSSWGNQ..MRSYVLHPYQMVKDLR
Q05FU9_CARRP/96-209QLNNVRKKLISNSERAKK..IRTYNF.TNNKITDHI
Q7WZQ7_9GAMM/156-269ERINIEKKKAG.ICWGNQ..IRSYVL.DAQRIKDLR
Q3SIP9_THIDA/1-133PTRPTLASQKRRLEGKQR..........RGETKKLR
A1SGG6_NOCSJ/18-144PTKPTRGSQQRRLEAKKQ..........RGRTKSLR
A5GWL3_SYNR3/4-136ATKPTRGSQRRRLDAKKQ..........RGQIKQQR
RF1_MYCPU/211-323KVGQYRK.LAGSGARSEK..IRTYNY.PQDRVTDHR
Q4UA63_THEAN/203-336KVNEIKGEDLV.GTWGSH..IRTYTLNPEQRVKDHR
B0UQN2_METS4/2-134PTRPTRASKTRRLDAKSH..........RGGVKRLR
A8WV66_CAEBR/18-132QAKEVKANKKRDQARKEK..........KVFKKELE
A7AQR8_BABBO/53-174ILKLTAAEKARKKFEKQL..........RSEKKSIR
Q4W6B7_DESVU/230-343EKKAQYAGKDA.IGFGSQ..IRTYTLQPYRLVKDHR
RF1_STRPF/209-322EQDAERKSTVGTGDRSER..IRTYNF.PQNRVTDHR
A4EBF6_9ACTN/206-319ELGAERQSQIGHGNRSEK..IRTYNQ.PQDRVTDHR
Q5DDV9_SCHJA/271-384LIDSIRQSHLGNLDRSEK..IRTYNF.PQDRITDHR
O66115_ZYMMB/3-134PTKATYASKQRRLDGKSK..........RSMVKSHA
A5KEB9_PLAVS/287-400LFFKCRRSHKMSGDRSEK..IRSYNF.INDFVTDHL
Q213N7_RHOPB/169-282QAAADQAAKTD.IGWGHQ..IRSYVLQPYQMVKDLR
A6WX48_OCHA4/19-151KTRPTKGSVERRLKAKSG..........RSDIKKGR
A5V621_SPHWW/3-135PTKPSRAAKAKRMDGKSK..........RSAVKNLR
Q6A8B5_PROAC/207-320ENDRMRRDQVRTVDRSAR..VRTYNF.PENRLTDHR
B4SGJ9_PELPB/222-334RKREIEGKKKK.IEWGSQ..IRSYVL.DDRRIKDHR
Q16L13_AEDAE/263-376ATQSMKKSQVGSSLRNEK..IRTYNY.NQDRITDHR
RF1_HYPNA/200-312ARSEARASQIGSGDRSQK..VRTYNY.PENRLTDHR
Q8IC21_PLAF7/212-324KNKKYELANKSLTHFGEQ..IRNYVLYGNKMIKDTR
RF2_AQUAE/223-336KKKQYEGEKTD.IGWGHQ..IRSYVFHPYKLIKDLR
A1U4S4_MARAV/1-132PTRPTKSSQRRRVDNKTR..........RGEIKSLR
RF1_SYMTH/206-319EEEQLRRAQVGTGERSEK..IRTYNF.PQDRVTDHR
A9A0M9_DESOH/1-133KTAPTKASKRRTVDEKVY..........RGRVKQRR
A7TJJ1_VANPO/249-362KERSARKEQVSTTDRSDK..IRTYNY.PQNRITDHR
RF1_BIFAA/213-326EAADMRHSQVRSLDRSER..IRTYNF.PENRIVDHR
Q1JMP0_STRPC/194-307EVDALKGDKKE.ITWGSQ..IRSYVFTPYTMVKDHR
RF1_BDEBA/206-319EASDVRLEQIGTGDRSER..IRTYNF.PQTRITDHR
RF1_HELAH/206-319ANAKDRKEQVGSGDRSER..IRTYNY.PQNRLSEHR
Q9C7K9_ARATH/359-472MNAQHTQSLTE.ISWGNQ..IRTYVLHPYRMVKDLR
A9BD41_PROM4/206-319QIADIRGDIVE.AAWGNQ..IRNYVFHPYQMVKDLR
F2G9V3_ALTMD/2-133KTKVSRAAKARRVDVKKQ..........QGAKKSMR
A1TPJ3_ACIAC/10-141ATQPSYGERQRRLQDKRE..........RSGTKALR
A4FN91_SACEN/4-136ATKPTRASQHRRLAGKKR..........RSEVKRGR
Q2ISE1_RHOP2/1-132ATRPTLGSKKRRLEGKKH..........RGDIKAGR
Q40KD7_EHRCH/80-193KMAEEHNKRCN.IGWGNQ..IRSYVMHPYQMVKDIR
RF1M_MOUSE/287-400QQQNARKLQVGTRAQSER..IRTYNF.TQDRVTDHR
A3ZUC9_9PLAN/205-318QRSDHRKSLVGSGDRSQR..IRTYNF.PENRVTDHR
B9LKG2_CHLSY/169-282ERARLRGEYRE.AAFGNQ..MRTYYLHPSTLVKDHR
A3Z8U8_9SYNE/212-325RESSARRAQVGTGDRSEK..IRTYNA.KDNRVTDHR
RF1_DEHSC/206-319ERTESRRAQVGQADRSEK..IRTYNF.PQDRLTDHR
B4SFS2_PELPB/1-132PTSPTKSSKERRIESKVK..........RGAVKATR
Q8YN74_NOSS1/1-132PTKPTRGSQKRRLDSKTK..........RAEIKSMR
A6GH88_9DELT/3-135PTKPSRAAKRRRLDDKRR..........QSQKKQGR
Q4V049_XANC8/5-137ATKPSHGAKLRRLDAKRE..........RSQIKRGR
Q8ENI8_OCEIH/185-298ELDDIRGEQKE.IGWGSQ..IRSYVFHPYSMVKDHR
RF1M_SCHPO/243-356AERLKRKNQVTSSDRSEK..LRTYNF.NQNRVTDHR
A4YAS6_SHEPC/6-137PTRATKGSQTRRLETKKQ..........KGATKAMR
A5K0W5_PLAVS/127-240QLRRERSKLVKDSSRSRR..IRTYNF.FRGYITDHV
A3ZTS2_9PLAN/183-296EEAARYKTQAK.VGFGSQ..IRNYFLHPDQRVKDAR
A6EKN5_9SPHI/229-342DIAARRKTMVSTGDRSAK..IRTYNY.PQGRVTDHR
A4HZC8_LEIIN/438-538QFNDTLAKQEKAELVQAQ............LVTKMQ
Q1LHN6_RALME/2-133ATRPTLASRKRRIEAKTQ..........RGQVKALR
A1BIW3_CHLPD/2-133ATKRTRASREKRLESKEK..........RSAIKSLR
Q83MV7_TROWT/204-317TTHAARKSQIRAMDRSER..IRTYNF.PENRVVDHR
A3SP41_9RHOB/223-335DINAAHEAKGD.AGWGNQ..IRSYVLQPYQMVKDLR
Q8A1V6_BACTN/167-287EQAKVEAGKKK.IEWGSQ..IRSYVF.DDRRVKDHR
ICT1_MOUSE/63-194PSKEDARLQRLRIEKMNR.........ERLRQKRLN
RF1_MYCPE/209-322NISDLRKGQVGTGERAEK..IRTYNY.PQNRVTDHR
A5TTN5_FUSNP/207-320EVESERRLQVGTGDRAEK..IRTYNF.PDGRITDHR
Q1D377_MYXXD/223-336ARDAAEAQKKD.ISFGSQ..IRSYVLAPYRMVKDLR
Q0FEF1_9RHOB/1-133KTKPTRASQRRRIDSKTK..........RGQIKMLR
RF1_ONYPE/203-316EENKHRKNLVGTGERSEK..IRTYNY.PQNRITDHR
Q4N9A1_THEPA/87-205NRELSEKSKYRRMVYKKN..........RSFIKKMR
Q26EB2_FLABB/237-350ARDEIESGKMK.IEWGSQ..IRNYVMHPYKLVKDVR
Q0BYR4_HYPNA/6-137KTKPTAGSVRRRIAAKKR..........RSEVKSLR
A4HE77_LEIBR/140-253SLHKAWQNQWSSGERSDR..MRTYNY.PQNRVTDHR
RF1_BUCCC/208-321KNSLMRKSLLGTGERSDR..NRTYNF.SQNRVTDHR
Q0S637_RHOSR/16-148PTKATKGSHRRRLDAKKQ..........RGQTKNLR
Q2S1N4_SALRD/222-342EKERLESSKKS.IEWGSQ..IRSYVLHPYKMVNDHR
Q1GD68_SILST/1-133ATKPTRGSVERRLKAKKT..........RAEVKSLR
A6NQT8_9FIRM/225-338KLSDIKGVQLK.IEWGSQ..IRSYVFMPYQLVKDNR
A2TQJ7_9FLAO/1-128KKRPSKLAKLKRLKAKKE..........QSEKKANR
Q54IC8_DICDI/281-396AEKSFRDELGK.NSWASDSVVRNYSMHPQERVKDQR
Q3JDZ2_NITOC/1-133LRKPSRAAKQRRLEEKRR..........RGEQKQAR
A5KAJ9_PLAVS/67-185VLKPTDREKRESINYKKR..........RSEVKSNR
Q2KZU8_BORA1/1-132ATRPTRASQRRRVQRKVQ..........RGDVKRLR
A4RYN9_OSTLU/133-246DIAELRGDIVK.AEWGQQ..IRNYVLHPYKLVKDVR
A6P081_9FIRM/203-316EWSEERRSQVGTGMRNER..IRTYNF.PQGRLTDHR
Q11R84_CYTH3/218-331AKAAVEGTKKK.IDFGSQ..IRNYVLFPYKLIKDVR
RF1_MARMM/205-317ERAAERKGQIGSGDRSER..IRTYNY.PQGRVSDHR
RF1M_CAEEL/232-345KIVSKRKLQVGSKARAEK..IRTYNF.QHDRVTDHR

PF10213

Q6BHR9_DEBHA/152-275SDIPVDTRHMHAKKAAP............SFPESWK
Q0UNP6_PHANO/225-345EDVPFDFRHHRPK..........KRT...EFPKEWV
Q7QIE1_ANOGA/164-272EATKCEADMEFF.....................DYE
Q5AI30_CANAL/149-276SDIPLSKSHMKILAKKAV....P......SFPEHWK
Q5KKI5_CRYNJ/92-233ADLPIDTRHLLARHRKKR....SRQN...TF..KWA
Q4P1X3_USTMA/101-247DDLPLDLRPFLVRQDKKRHYLRADRPSLKDFPKEWL
YA2F_SCHPO/103-225SHVPLNTGHWKYKKCDK............RMPQEWL
RT35_DANRE/159-267EQEKTRADMEEY.....................EWQ
RT35_HUMAN/146-254EKSKTEADMEEY.....................IWE
Q0VFU1_XENTR/153-261ESEKEESDMEAY.....................VWE
Q16WG3_AEDAE/160-283EDTKTEADMEYYDFQRNVAKVNS......ESILNWG
Q9NEI6_CAEEL/188-296DELKNRTDALK.....................VEFD
Q6C9T8_YARLI/244-376EDVPLDTRHARNKAERIAKRDRYRLA...KFPEEWN
Q0CSW1_ASPTN/191-313ADVPLDLRHHKPK..........IRH...RFPESWV
Q5BBX6_EMENI/190-312ADIPLDLRHHKPKKTL.............QFPKEWI
Q2GTQ2_CHAGB/188-309EDLPLDTRHHKFK..........PKL...KFPRDWY
Q9P5J2_NEUCS/186-307EDIPLDTRHHTFT..........KKI...SFPKEWL
Q750S9_ASHGO/156-283SDVPLDTRHTEARLARKN....KKIP...EFPESWK
Q6CQD0_KLULA/156-283ADVPLDKRHIIARQLRKK....KRGY...EFPEEWK
RT24_YEAST/171-299SDVPLDTRHTIAKSLRKK....KRDY...EFPEHWK
Q6FVM5_CANGA/158-289SDIPLDTRHTIAKNLRKKHSRRLRTI...EFPEEWK

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window