Sequence alignment for CL0340

PF00359

Q7NAI8_MYCGA/13-156-------------------------E.INKPEFVFI.NL.KQK...NRDDILKEL...ATRAVKLN.........LATNQ
A8ZTY0_DESOH/13-165-------------------------L.ITEERVVFL.DE.T.....TRIPAIRQL...VRHACRLV.........PGMKK
A9A064_DESOH/690-832-------------------------R.FIEEGLVLD.LD.RRV...GVEELFRQI...ADALAPR..........LATPP
B9M6K3_GEODF/75-216-------------------------Q.VLKAGGTHH.DI.QGK...TKDEVLKNI...ISLLKFPP.........QADRD
Q67LZ9_SYMTH/478-621-------------------------E.LLTAETIAL.DV.DAQ...NWEEAIRAG...GDLLVRAG.........LAEPR
Q2NRA9_SODGM/6-147-------------------------T.WLNESHIQYVN..AVD...DWQAALVAR.....PLLNDG.........TITAD
Q184X0_PEPD6/5-149-------------------------E.ILTEESIIL.DL.KST...TKEGIIQEL...VDKLYDTG.........SITLK
Q5WDU8_BACSK/528-672-------------------------S.FL...QSVR....LVA....VDELLAGIRVYCDILEEEG.........ALSEA
Q182H5_PEPD6/4-148-------------------------N.IFNKEYVFL.NV.DAK...SKVEVLKFI...SKKAKDLN.........LAEDE
A1R8K7_ARTAT/11-156-------------------------E.LTTPDTVIL.EL.VAQ...DKIDAAAQL...AERLHAAG.........RISNL
ULAC_MYCPN/9-152-------------------------V.LKQHHTVRL.HQ.TAQ...DWKQAIQLC...IHPLIAAK.........LVQPA
Q4A583_MYCS5/11-153-------------------------L.ILNY.SIAL.NQ.EAN...SWEEAIKAA...TDLLVKAN.........AVSNL
Q5HKT2_STAEQ/502-646-------------------------M.VFDKSLIEI.TK.EPM...TRDQAIDRL...LTKLCHRH.........YITNI
Q2S4A8_SALRD/11-155-------------------------Q.LLDPEHVRI.GL.AEP...SKTAVIDAL...VDVLTGHG.........AISRL
A8FIW8_BACP2/499-638-------------------------R.YVSPALTFF.QQ.DLQ...SREEVLQFF...VNVLKEQD.........RIP..
Q6LNN0_PHOPR/116-260-------------------------F.SFSVQSISTVDAAT.....PKPKVIASL...VDRLNQQ..........KVSTG
Q8EL16_OCEIH/2-145-------------------------K.QLRKNHISI.LT.EAK...DWRAAIELS...GQLLVHSG.........AVTEQ
A8AYR4_STRGC/491-627-------------------------H.LIQKKLFYR.KD.HVA...DGEEAIEYL...CNELIKEG.........LAD..
Q182Q6_PEPD6/1-146-------------------------M.VLQEKYIFI.DK.DLK...SKEEVLNFI...ADSAYILG.........ITTNK
Q0BV42_GRABC/17-156-------------------------TAPRAMVRVGAAPA.......DKQQAIEEV...AQLLAAAG.........HVDPA
A7MI94_CROS8/5-151-------------------------G.VTSPNLILL.DK.EWN...TRESILENL...SMLLYQEG.........KVSDQ
A6LWC3_CLOB8/859-995-------------------------N.VIDEELIKV.NN.DRF...TKSDLIDEM...CSLLISKG.........RVS..
Q18CC4_PEPD6/843-977-------------------------D.LIHKEDIFV.DL.QVK...SKEEVLKYM...SKKLREKG.........YVT..
Q2IH73_ANADE/5-148-------------------------E.FLRSDAVIA.SL.SGQ...AAPAVLAEL...VRPLAASQ..........KVDG
Q8EMS7_OCEIH/509-648-------------------------Q.YLHESNIFL.NL.EAS...SKQDVLEHM...TAHVIENE.........FVD..
PTM3C_BUCBP/496-638-------------------------F.SLTKENIFL.GQ.IAS...SKEEVIRFI...GRQLVNQG.........YVKEE
Q18CC6_PEPD6/5-151-------------------------K.IISSNLIFK.NI.EVS...NNEDALKFL...GQRLFDEQ.........YVKES
Q5WC05_BACSK/4-151-------------------------A.LLDRDLILL.NQ.TCQ...TVEEVLETI...AAPMQAKQ.........FAKET
Q8EVW2_MYCPE/497-641-------------------------L.VLKRDFINIFDE.KNL...SWEKAIKLC...TDSLIKSK.........RINVN
Q4A9C7_MYCHJ/1-144-------------------------MELFNEKMTKFCKIK......NWNQAVHEG...VRILVENK.........KATYD
Q32AP6_SHIDS/4-150-------------------------I.HFQENYIQR.LP.AGL...SVEQIIRQL...AQPLVAAE.........LVVPD
Q185K0_PEPD6/5-152-------------------------N.FVSDKVIDL.KM.DCK...TKEDFFKEI...HNKVFDLG.........FVKEE
Q6AGN9_LEIXX/4-147-------------------------P.PLPASAVTV.GA.HAA...DWREAVELA...GAALARSG.........ATQPG
Q182P4_PEPD6/499-638-------------------------E.LINAERVNIIKNVR.....DWKEAIKIA...SKPLLEDN.........SIEEL
A6TVY0_ALKMQ/551-695-------------------------E.VLDNLFLETYYVE......DIEELIHIV...SAMLVKEK.........VGQDK
Q8Y9X0_LISMO/1-146-------------------------M.IVSEEQLFL.NQ.HLS...TKEEVLAFI...ADKAAEIG.........ITTNS
Q182H6_PEPD6/492-629-------------------------S.NMFDEKAFF.SI.KAS...TKEEVIISL...SNKLKERD.........FIE..
Q034E9_LACC3/8-156-------------------------H.FFSDRVITF.DQ.TFS...DRNTALKAV...ADQLLKAG.........AVVPT
Q182Q4_PEPD6/501-641-------------------------N.FFDKNLFIV.NP.KIK...DKDEIIKLM...CNKLTQSE.........IVF..
Q21FU2_SACD2/5-146-------------------------T.ILTLDCTRS.KI.VGG...SKKRVLEQL...AQIFSHSV.........EDLSE
Q185F4_PEPD6/828-963-------------------------R.MLDEDLVIF.EP.DIY...FKKDLLEYV...CSILINKE.........YVEKD
Q8KEQ6_CHLTE/8-150-------------------------A.LENGRLVELPDN.......DKSDALQFL...A.TILEA..........VPSIP
A6LWY3_CLOB8/491-629-------------------------S.YFSKEFFNI.TE.E.D...NYEHLIRKM...AEDLEKKG.........YGK..
Q7P1H2_CHRVO/6-149-------------------------D.ICRCGDILL.DV.DIP...DKRQLFEYA...ARQLGQRH..........ALNA
Q6ABT3_PROAC/3-150-------------------------V.LLNTDLISV.NI.EAP...DRNQVLTVM...ADKLNGVR.........VAKEG
Q7UR99_RHOBA/81-225-------------------------E.ICPVELVSN.PF.VAR...TRGSVIRNM...CELASRTG.........MLWDA
Q9K679_BACHD/543-687-------------------------S.HFQLIQVER....GIS....IEEGIERI...CRSLEKKG.........ILTNG
Q03UQ5_LEUMM/6-152-------------------------Y.FHDNDLVRIYDETPQ....DWREALRIA...SENLKEKE.........IITDA
Q8EUZ2_MYCPE/5-149-------------------------E.FFKKDLVVT.NK.SFK...DKKEALSFF...ANLLVEKK.........YAKNS
A6VLW2_ACTSZ/4-146-------------------------S.IISEQLIIL.DL.DAD...NKNTIIEAI...SQLAFEHG.........YISDL
Q8RD66_THETN/6-153-------------------------E.FFHKELIVT.NL.QAN...NKEEVFEVL...FNKLLENG.........YVKES
A4T061_POLSQ/6-149-------------------------N.LFTPDCIAL.DS.PAK...NRADAFAAA...GELFAKQT..........GIDA
Q97EZ7_CLOAB/6-158-------------------------SNLFKEDLIFI..E.DAK...DSNEIFKKI...GQRLIQKG.........LVKDN
Q184X2_PEPD6/4-146-------------------------K.ILRSDCIVL.DK.QLQ...TKKDVINYM...ANHLYHGN.........YINNK
Q6A5M7_PROAC/6-151-------------------------D.LLDERSIDL.SL.SSG...DKDDAIERM...VDLVDASG.........ALLDR
Q7MFX9_VIBVY/113-253-------------------------P.PAEVKWHYA....KAHTELTKFECLKGL...AQ...............LIYPV
PTMA_MYCPN/1-142-------------------------M.KLLKNNIYI.NV.YLK...NKQEIFEFV...FKKFKEDG.........AVLDS
Q3Y1G3_ENTFC/2-144-------------------------I.QLPAEKILL.DQ.SYQ...NWKEALTEI...GQWMTQQG.........GIKPA
Q5WCM9_BACSK/543-683-------------------------S.FIKPDSITF.AP.EAP...SWEEALSLA...AQPLLDQG.........KIEQR
Q74LQ8_LACJO/57-210-------------------------S.LFDPQAVFV..T.DLT...DRNEIFKTV...SQKLYDLG.........YVKED
Q03GK2_PEDPA/486-624-------------------------S.FFDERFFKI.NR.NLK...DKENVINYI...SDVFYEEN.........ITK..
Q04H54_OENOB/1-147-------------------------M.YFDKRVILF.DQ.VFP...NQISVLKTL...TRFLEEKN.........CVKSS
Q4KAL7_PSEF5/81-224-------------------------R.YLQVEDILL.AV.NVT...NKQRLFEQV...GQHLQETR..........QLPA
Q3B1Z0_PELLD/5-149-------------------------S.LLSEKYIAL.NL.VLE...TKEQVIEKM...LSIVLEHP.........GVRDI
Q65DG1_BACLD/502-641-------------------------T.YTRKELVFL.RE.SLS...SREDVLRFL...CGKVTQSG.........LAD..
Q2NS54_SODGM/1-147-------------------------M.MFSEKRVFVVDQ.PV....SREQLLTRL...ADSLLADG.........LVKDS
Q0S1N2_RHOSR/13-157-------------------------Q.IISEDLISL.DTDLGA...SKEDVISAL...SRRLADAG.........RATEA
Q8Y5C8_LISMO/10-155-------------------------K.VISPALVNL.DL.QAT...SKLEVIEEL...TDLLVETG.........AVADK
A6LX09_CLOB8/570-713-------------------------E.IINDKYIKL.NE.EAE...NWKDAIVKG...GQILKRNS.........CINDS
B0RET0_CLAMS/9-145-------------------------..LLADGSIRL.DA.HAD...DRESAIRQA...GEALVAAG.........AVEPG
B7VRL7_VIBSL/6-149-------------------------..LTNKSLVNL.QT.TFS...SREEAIYAL...ADQLDQQG.........KLHNK
E3FEW0_STIAD/125-265-------------------------S.LLTPERLVL.QL.SCA...NLDDALDVA...AGRLAPAC.........PGMGA
G1UB79_HAEDU/6-165-------------------------E.FLTKENIRQ.GV.IVS...SKKRALELI...GKIVADSLNNTPDGSTAENICA
O51369_BORBU/5-148-------------------------..FLKKDLVFV.LP.EVN...SKEDVIDFL...IEKINDKG.........YIDNK
O51574_BORBU/4-146-------------------------..LFSKNLIVL.NY.NAT...SKEDVIRKM...ASMFNENG.........YLNDM
PTFA_ECOLI/4-144-------------------------...LTASCIDL.NI.QGN...GAYSVLKQL...ATIALQNG.........FITDS
PTFX2_ECOLI/689-829-------------------------..LVTAECITL.ES.DWR...SKEEVLKGM...TDNLLLAG.........RCRYP
Q0WB68_YERPE/12-154-------------------------..VLNIESTKS.SV.HCS...SKKRALEII...SELAAKQ..........LNLPS
Q2G143_STAA8/5-145-------------------------..ILSTTRIIV.KE.QVN...DWTEAITIA...SQPLLQEQ.........IIEQG
Q2G239_STAA8/5-148-------------------------E.LLTKDTIAM.DL.MAN...DKNGVIDEL...VNQLDKAG.........KLSDV
Q2G2B8_STAA8/552-684-------------------------.......HVKR.MH.HVE...NIDEAIAKA...SDVLVANH.........FIDIK
Q4A9J6_MYCHJ/2-145-------------------------E.IFKRNFVFL.KQ.NLN...SKSEVFEFI...ASKAYKLK.........IAENK
Q5NFF6_FRATT/6-147-------------------------..LIDKKNIIL.NL.NIE...SKKRLIEFF...ANRIADTY.........PDVSE
Q6MSD4_MYCMS/4-148-------------------------E.IFNINHVFT.DV.IAN...SKKQAFEII...ALKFYLLG.........FTTDK
Q6MTK9_MYCMS/1-146-------------------------M.LFKKELVTYIDT.KIT...SWQQAIQVA...NELLVKNH.........YVDDD
Q7CJ97_YERPE/5-145-------------------------..LLTSDVIQV.VS.QAK...DWRDAIAIS...CQPLIDNG.........AVEAR
Q7CQH7_SALTY/3-141-------------------------...NDVKWVQA.QR.HAS...DWRHALDIA...VRPLITFG.........AAAPC
Q87HZ3_VIBPA/4-140-------------------------...LNKNDITL.SQ.SAA...DKFAAIKNI...AQSLTDKG.........LVEQG
Q8DQP6_STRR6/21-170-------------------------..FFDKNLVFC..L.EAD...NQEQLFDQV...ATLLEERE.........IVTPT
Q8F8C5_LEPIN/7-155-------------------------..LLQPETVIF.NL.ESG...SKEEVISRL...LQKAIDTH.........QIDTH
Q8RCS1_THETN/4-143-------------------------E.ILNEKNILL.NL.PSE...SKIEAIERV...GNLLVENG.........YVEKE
Q8RHS2_FUSNN/6-153-------------------------..YLNPDYIFP.CL.EVE...SKEEIIRTI...VDKVAEDN.........KMVSE
Q8Y3N8_LISMO/8-146-------------------------.....LEDIEV.NL.KAE...DWREAIQMS...ARLLLERG.........AIKES
Q8Y410_LISMO/540-679-------------------------..LLEVTRITR.KK.SVK...DWHEAIYHA...ALPLLSAG.........VVEPA
Q8Y411_LISMO/6-150-------------------------..FLKKGMVWV.QS.DIE...KQEDLFQMV...AESGKSEG.........YVTDD
Q8Y5G5_LISMO/6-151-------------------------..LFQKELTLI.NS.RYE...SQAELFEYT...SKILEKEQ.........YVEPT
Q8Y8M4_LISMO/529-668-------------------------...FTEEAIVM.EE.TCP...TWRQAIKLG...TKRMEQLK.........VIEPS
Q8Y9A2_LISMO/532-669-------------------------..LIGIDAIQI.TS.ESL...TWQTAIQRA...TKLLSDNH.........FVLPA
Q8Y9U4_LISMO/6-148-------------------------..ILTKELVVF.DL.EAT...TKETAIEEM...AEMLDERG.........ILADK
Q8YA62_LISMO/481-618-------------------------..FFKKELFFP.KQ.NFK...SKEETITFL...CEQLTAFD.........YCAPD
Q9A1N7_STRP1/7-147-------------------------..FIDNNSIRL.GL.SAD...TWQEAVRLA...VQPLIDSK.........AVTSA
Q9KMS5_VIBCH/6-152-------------------------S.LIENNSIQL.QA.KAN...NWREAIKIG...TDMLIASG.........AITPA
Q9KR27_VIBCH/5-142-------------------------..LTNIHLIKG.NL.QAN...SKNEVFAEL...AQMLLENN.........RISNK
R5ZLN6_9ACTN/7-151-------------------------..LFTPELVFF.DW.ECA...TPDEVFARL...EGELAPRG.........YIASG

PF07565

S4A8_HUMAN/145-404DVEDGGERWSKPYVATLSLHSLFELRSCLINGTVLL-DM-HAN---SIEEISDLI---LDQQELSS---------DLNDS
S4A5_HUMAN/141-408KVEEGGERWSKPHVSTLSLHSLFELRTCLQTGTVLL-DL-DSG---SLPQIIDDV---IEKQIEDG---------LLRPE
Q29N79_DROPS/170-438DVEEGGNRWSKPHVATLSLHSLFELRRLLVNGTVML-DM-EAP---NLEVMADLV---CDQMVSAG---------TLPPG
Q2LZ95_DROPS/294-628DVEEGSDRWGKPHVASLSFHSLLNLRRCLETGVVLL-DL-NEK---DLPAVAYRV---VEQMVIED---------LIDIN
Q7PT77_ANOGA/85-347NLEEEADRWGRPHVAALSFHSLLNLRHCLETGVVLM-SL-EAN---DLSIVAHRV---VEQMVARE---------LIHED
B3A2_HUMAN/352-620DVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLL-DL-DQQ---TLPGVAHQV---VEQMVISD---------QIKAE
B3AT_MOUSE/100-342ENLREDGVWGRPHLSYLTFWSLLELQKVFSKGTFLL-GL-AET---SLAGVANHL---LDCFIYED---------QIRPQ
B3AT_HUMAN/86-329ENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLL-DL-QET---SLAGVANQL---LDRFIFED---------QIRPQ
B3AT_CHICK/89-336ESMEPGGAWG.SHLPLLTYHSLLELHRAFAKGVVLL-DV-AAN---SLAAVAHVL---LDQLIYEG---------QLKPQ
Q17LT4_AEDAE/264-527DVEEGADRWGRPHVASLSFHSLLNLRRCLETGVVLM-DL-EEK---DLPSVAYRI---VEQMVIDE---------LIHED
Q9TUQ0_BOVIN/21-268ENLGKDGIWGRPHLPYLNFWSLLELQKAFAKGTVLL-DL-PGK---SLAEVANQL---LDRFTFEG---------QIQPD
Q1A708_STRPU/152-465DVDVDADRWSKPHVATLPLHSLFELRTCLINGTVCL-DM-EAD---NIVQIADLV---LDKLIMSE---------QLDES
B3A3_RABIT/351-620DVEEETERWGKPHVASLSFRSLLELRRTIAHGAALL-DL-EQT---TLPGIAHLV---VETMIVSD---------QIRPE
F1QP97_DANRE/354-625DVEEETERWGKPHVASLSFRSLLELRKTISHGAVLL-DL-DQK---TLPGIAHQV---VEQMIISD---------QIRAH
F6UUF5_HORSE/106-345....EDGAWGRPHLSYLNFWSLLDLQRAFAKGSVLL-DL-SET---SLAGVAENL---LDRFIYDG---------LIRPQ
G5EC65_CAEEL/67-345DVEQGGNRWSKPHVATLSLHSLFQLRSCIMNGHFMN-DL-AET---DIPSIFNAV---IENLEKSG---------DLPSE
H3DGF3_TETNG/144-400DVEDGGERWSKPYVATLSLHSLFELRSCIFNGTVLL-DM-RAN---TIEEIADMV---LDHREIYS---------PLGNE

PF00359

Q7NAI8_MYCGA/13-156D.......ELYQAFLARE--------------------------------------------------------------
A8ZTY0_DESOH/13-165N.......ILEAAVMERE--------------------------------------------------------------
A9A064_DESOH/690-832D.......RLYALLVARE--------------------------------------------------------------
B9M6K3_GEODF/75-216........YILQVLMARE--------------------------------------------------------------
Q67LZ9_SYMTH/478-621.........YVDAMVRTA--------------------------------------------------------------
Q2NRA9_SODGM/6-147.........YVANIIKQR--------------------------------------------------------------
Q184X0_PEPD6/5-149S.......KFIKALKHRE--------------------------------------------------------------
Q5WDU8_BACSK/528-672K.......QVYDALLARE--------------------------------------------------------------
Q182H5_PEPD6/4-148S.......LVYEGLMARE--------------------------------------------------------------
A1R8K7_ARTAT/11-156Q.......GFLEQVHSRE--------------------------------------------------------------
ULAC_MYCPN/9-152.........YFDDILKSV--------------------------------------------------------------
Q4A583_MYCS5/11-153.........YYKKIIEST--------------------------------------------------------------
Q5HKT2_STAEQ/502-646E.......EVRTAILKRE--------------------------------------------------------------
Q2S4A8_SALRD/11-155D.......DVRAAIFARE--------------------------------------------------------------
A8FIW8_BACP2/499-638E.......EFEQLLLERE--------------------------------------------------------------
Q6LNN0_PHOPR/116-260TK.....KQLVECFMARE--------------------------------------------------------------
Q8EL16_OCEIH/2-145.........YVESMIASV--------------------------------------------------------------
A8AYR4_STRGC/491-627E.......DYKANVIKRE--------------------------------------------------------------
Q182Q6_PEPD6/1-146E.......ALLKDLLKRE--------------------------------------------------------------
Q0BV42_GRABC/17-156.........YTESMLKRE--------------------------------------------------------------
A7MI94_CROS8/5-151A.......AFLRAVWERE--------------------------------------------------------------
A6LWC3_CLOB8/859-995E.......NFTMSVYKRE--------------------------------------------------------------
Q18CC4_PEPD6/843-977K.......NFYKKVVERD--------------------------------------------------------------
Q2IH73_ANADE/5-148Q.......RLVETLLDRE--------------------------------------------------------------
Q8EMS7_OCEIH/509-648T.......DLLDSIYERE--------------------------------------------------------------
PTM3C_BUCBP/496-638.........YIEAMLERE--------------------------------------------------------------
Q18CC6_PEPD6/5-151.........YIQAVVARE--------------------------------------------------------------
Q5WC05_BACSK/4-151.........YADGLKERE--------------------------------------------------------------
Q8EVW2_MYCPE/497-641.........YIKAIINNI--------------------------------------------------------------
Q4A9C7_MYCHJ/1-144.........LEKAIMEQT--------------------------------------------------------------
Q32AP6_SHIDS/4-150.........FADHVLKRE--------------------------------------------------------------
Q185K0_PEPD6/5-152.........FGEKILSRE--------------------------------------------------------------
Q6AGN9_LEIXX/4-147.........YTARMVQVI--------------------------------------------------------------
Q182P4_PEPD6/499-638.........YIENMIKSV--------------------------------------------------------------
A6TVY0_ALKMQ/551-695.........LTQDLLSRE--------------------------------------------------------------
Q8Y9X0_LISMO/1-146A.......QVERDLWARE--------------------------------------------------------------
Q182H6_PEPD6/492-629E.......SSIKSIIDRE--------------------------------------------------------------
Q034E9_LACC3/8-156.........FEKAIIARE--------------------------------------------------------------
Q182Q4_PEPD6/501-641P.......SFAESVFYRE--------------------------------------------------------------
Q21FU2_SACD2/5-146D.......SLFQSLIGRE--------------------------------------------------------------
Q185F4_PEPD6/828-963.........YLDSVLHRE--------------------------------------------------------------
Q8KEQ6_CHLTE/8-150AG.....SNIVEIVLEHE--------------------------------------------------------------
A6LWY3_CLOB8/491-629E.......GYADLVMERE--------------------------------------------------------------
Q7P1H2_CHRVO/6-149P.......ALQAALQQRE--------------------------------------------------------------
Q6ABT3_PROAC/3-150.........FLDALLKRE--------------------------------------------------------------
Q7UR99_RHOBA/81-225P.......AMAEAVATRE--------------------------------------------------------------
Q9K679_BACHD/543-687G.......GVAQALIERE--------------------------------------------------------------
Q03UQ5_LEUMM/6-152.........YINEIIKNV--------------------------------------------------------------
Q8EUZ2_MYCPE/5-149E.......TVLNKALERE--------------------------------------------------------------
A6VLW2_ACTSZ/4-146G.......QFIETVKQRE--------------------------------------------------------------
Q8RD66_THETN/6-153.........FLEGIMTRE--------------------------------------------------------------
A4T061_POLSQ/6-149N.......AVVSFLNARE--------------------------------------------------------------
Q97EZ7_CLOAB/6-158.........FIDGIIERE--------------------------------------------------------------
Q184X2_PEPD6/4-146E.......KFIADINKRE--------------------------------------------------------------
Q6A5M7_PROAC/6-151D.......VLIKAVRARE--------------------------------------------------------------
Q7MFX9_VIBVY/113-253SP.....DELILAFIKRE--------------------------------------------------------------
PTMA_MYCPN/1-142.........FLPAIVERD--------------------------------------------------------------
Q3Y1G3_ENTFC/2-144.........YIQSMIERQ--------------------------------------------------------------
Q5WCM9_BACSK/543-683.........YVEALMSNK--------------------------------------------------------------
Q74LQ8_LACJO/57-210.........FLGDIIERE--------------------------------------------------------------
Q03GK2_PEDPA/486-624K.......DYREDLFERE--------------------------------------------------------------
Q04H54_OENOB/1-147.........YQQAIINRE--------------------------------------------------------------
Q4KAL7_PSEF5/81-224D.......WVAASLWRRE--------------------------------------------------------------
Q3B1Z0_PELLD/5-149D.......RLRADVLKRE--------------------------------------------------------------
Q65DG1_BACLD/502-641A.......GLEASVFERE--------------------------------------------------------------
Q2NS54_SODGM/1-147.........FLGGVLARE--------------------------------------------------------------
Q0S1N2_RHOSR/13-157D.......ALRDAALARE--------------------------------------------------------------
Q8Y5C8_LISMO/10-155D.......AFIADVLYRE--------------------------------------------------------------
A6LX09_CLOB8/570-713.........YIDAMINNV--------------------------------------------------------------
B0RET0_CLAMS/9-145.........YVEAMVERE--------------------------------------------------------------
B7VRL7_VIBSL/6-149Q.......EYLDAVFARE--------------------------------------------------------------
E3FEW0_STIAD/125-265G.......ELAARLRQRE--------------------------------------------------------------
G1UB79_HAEDU/6-165I.......ECFSQLFKRE--------------------------------------------------------------
O51369_BORBU/5-148K.......EFLQGILDRE--------------------------------------------------------------
O51574_BORBU/4-146E.......AFIKEIKKRE--------------------------------------------------------------
PTFA_ECOLI/4-144H.......QFLQTLLLRE--------------------------------------------------------------
PTFX2_ECOLI/689-829R.......KLEADLWARE--------------------------------------------------------------
Q0WB68_YERPE/12-154Q.......VVFDAVLTRE--------------------------------------------------------------
Q2G143_STAA8/5-145.........YVQAMIDSV--------------------------------------------------------------
Q2G239_STAA8/5-148A.......SFKEAIHNRE--------------------------------------------------------------
Q2G2B8_STAA8/552-684.........YIHEMQQVF--------------------------------------------------------------
Q4A9J6_MYCHJ/2-145E.......EIIKDLEFRE--------------------------------------------------------------
Q5NFF6_FRATT/6-147D.......LVLKNIYKRE--------------------------------------------------------------
Q6MSD4_MYCMS/4-148N.......KALKGLKKRE--------------------------------------------------------------
Q6MTK9_MYCMS/1-146.........FSKEIIELT--------------------------------------------------------------
Q7CJ97_YERPE/5-145.........YVEAIYRSH--------------------------------------------------------------
Q7CQH7_SALTY/3-141.........YLDGIIENT--------------------------------------------------------------
Q87HZ3_VIBPA/4-140.........YVEGMLNRE--------------------------------------------------------------
Q8DQP6_STRR6/21-170.........YREALITRE--------------------------------------------------------------
Q8F8C5_LEPIN/7-155QIDTENKEEILESLLARE--------------------------------------------------------------
Q8RCS1_THETN/4-143.........YIEGMKKRE--------------------------------------------------------------
Q8RHS2_FUSNN/6-153QK.....YEIIKNILKRE--------------------------------------------------------------
Q8Y3N8_LISMO/8-146.........YIDGMIQSV--------------------------------------------------------------
Q8Y410_LISMO/540-679.........YVEEMKRQY--------------------------------------------------------------
Q8Y411_LISMO/6-150.........FLTRLTDRE--------------------------------------------------------------
Q8Y5G5_LISMO/6-151.........FREAVTSRE--------------------------------------------------------------
Q8Y8M4_LISMO/529-668.........YHEKIIHNL--------------------------------------------------------------
Q8Y9A2_LISMO/532-669.........YAENIKQIQ--------------------------------------------------------------
Q8Y9U4_LISMO/6-148A.......TYVQAVLERE--------------------------------------------------------------
Q8YA62_LISMO/481-618.........YVAKVFERE--------------------------------------------------------------
Q9A1N7_STRP1/7-147.........YYDAIIAST--------------------------------------------------------------
Q9KMS5_VIBCH/6-152.........YHEAIIASV--------------------------------------------------------------
Q9KR27_VIBCH/5-142E.......DFLNDIEIRE--------------------------------------------------------------
R5ZLN6_9ACTN/7-151.........WLDAVRTRE--------------------------------------------------------------

PF07565

S4A8_HUMAN/145-404MRVKVREALLKKHHHQNE........KKRNNLIPIVRSFAEVGKKQSDPHL...........................MD
S4A5_HUMAN/141-408LRERVSYVLLRRHRHQTK..............KPIHRSLADIGKSVSTTNRSPARS.................PGAGPSL
Q29N79_DROPS/170-438VKDKVKDALLRRHRHQHE........YAKKTRLPIIRSLADMRNHSSSKKKKSNSKN...............LRPTQNLP
Q2LZ95_DROPS/294-628DKPSVMRSLLLRHRHVNE.........HQGVLPFTKRKYNSYTSLQFLWM..............................
Q7PT77_ANOGA/85-347DKPVIARALLLRHRHVNE.......NTHGGIFYGSRRRLSSFTSIRSVKN..............................
B3A2_HUMAN/352-620DRANVLRALLLKHSHPSD.......EKDFS..FPRNISAGSLGSLLGHHH.............................G
B3AT_MOUSE/100-342DREELLRALLLKRSHAED.......LGNLEGVKPAVLTRSG.......................................
B3AT_HUMAN/86-329DREELLRALLLKHSHAGE.......LEALGGVKPAVLTRSG.......................................
B3AT_CHICK/89-336HRDDVLRALLLRHKHPSE........AESVWTLPAAQLQCSDGEQKD.................................
Q17LT4_AEDAE/264-527DKPTIMRALLLRHRHVNE.......HSHGGFHFGPKRKYSSYSSLQSV................................
Q9TUQ0_BOVIN/21-268DQDNLLRVLLLKHSHASD.......MEALGGVKPVVVTHSG.......................................
Q1A708_STRPU/152-465KREQVREALLRKHHHQSHKK...HRDKRGSSLLPMIRSLTDIGRSLSQGGAHNTSMEQQAAAQSGIQTSHGSSPNIQNSQ
B3A3_RABIT/351-620DRASVLRTLLLKHCHPND........DKDCGSFPRNPSSSSVNSVLGNHH..............................
F1QP97_DANRE/354-625DRANVLRALLLKHSHPSD........GKEHSLFNRNISATSLGSLISHYHS...........................TN
F6UUF5_HORSE/106-345YREDLLRVLLLKHSHARD.......LKELDGVKPTVLTPSG.......................................
G5EC65_CAEEL/67-345NREELREILLRKHVHQYEQAKKNGAGGEKGGFLSTVRSISDIGKSFSHGKNL..........................SK
H3DGF3_TETNG/144-400VRKKVRATLLKQHHHQNQ........KKLANRLPIVRSIADMGRRASELH.............................L

PF00359

Q7NAI8_MYCGA/13-156K..ESSTAL....P........DL.........F----------------------------------------------
A8ZTY0_DESOH/13-165R..IVTTGI....G........LG.........V----------------------------------------------
A9A064_DESOH/690-832K..ESSTAI....T........QG.........L----------------------------------------------
B9M6K3_GEODF/75-216A..LGTTAI....G........DG.........I----------------------------------------------
Q67LZ9_SYMTH/478-621R..EYGPYI....VL......GPG.........F----------------------------------------------
Q2NRA9_SODGM/6-147Q..AVCPYF....VI......APR.........I----------------------------------------------
Q184X0_PEPD6/5-149K..IGSTSI....G........YQ.........M----------------------------------------------
Q5WDU8_BACSK/528-672R..LGGIGI...PG........TG.........L----------------------------------------------
Q182H5_PEPD6/4-148E..QFTTNL....G........ES.........I----------------------------------------------
A1R8K7_ARTAT/11-156H..QLATGL....P........GG.........I----------------------------------------------
ULAC_MYCPN/9-152A..QYGPYF....II......AEN.........V----------------------------------------------
Q4A583_MYCS5/11-153K..EFGPYY....VI......ADN.........F----------------------------------------------
Q5HKT2_STAEQ/502-646A..ESTTAI....G........MN.........V----------------------------------------------
Q2S4A8_SALRD/11-155E..KMSTGV....G........KG.........L----------------------------------------------
A8FIW8_BACP2/499-638Q..VSPTSF....G........HL.........V----------------------------------------------
Q6LNN0_PHOPR/116-260K..VSATVM....G........QQ.........I----------------------------------------------
Q8EL16_OCEIH/2-145E..DNGPYI....VI......APG.........I----------------------------------------------
A8AYR4_STRGC/491-627R..ISATSF....V........QG.........F----------------------------------------------
Q182Q6_PEPD6/1-146N..EFPTGI....K........DG.........F----------------------------------------------
Q0BV42_GRABC/17-156N..VANTWL....G........HG.........V----------------------------------------------
A7MI94_CROS8/5-151N..ISETGF....E........QG.........I----------------------------------------------
A6LWC3_CLOB8/859-995M..LGGTLF....E........GT.........F----------------------------------------------
Q18CC4_PEPD6/843-977N..LFPTEL....S........DE.........I----------------------------------------------
Q2IH73_ANADE/5-148K..LGSTGI....G........EG.........V----------------------------------------------
Q8EMS7_OCEIH/509-648K..IAPTAF....G........NL.........V----------------------------------------------
PTM3C_BUCBP/496-638K..MMSTWL....G........ES.........I----------------------------------------------
Q18CC6_PEPD6/5-151K..KYATGL...PTE......IYG.........V----------------------------------------------
Q5WC05_BACSK/4-151Q..SFATGI...PTE......PFG.........V----------------------------------------------
Q8EVW2_MYCPE/497-641N..KYNSVI....TL......SNK.........I----------------------------------------------
Q4A9C7_MYCHJ/1-144A..KYGAYY....VL......EEG.........V----------------------------------------------
Q32AP6_SHIDS/4-150A..TYPTGL...PTE......PPC.........I----------------------------------------------
Q185K0_PEPD6/5-152N..VFPTGL...NLG......DYG.........V----------------------------------------------
Q6AGN9_LEIXX/4-147E..EFGAYI....VI......APG.........L----------------------------------------------
Q182P4_PEPD6/499-638E..KYGPYI....VL......ADR.........F----------------------------------------------
A6TVY0_ALKMQ/551-695K..KGGTLI...SG........KG.........F----------------------------------------------
Q8Y9X0_LISMO/1-146K..EYATAV....Q........QL.........I----------------------------------------------
Q182H6_PEPD6/492-629N..ISSTEI....G........NL.........V----------------------------------------------
Q034E9_LACC3/8-156Q..TYPTGLQLNDG........IG.........V----------------------------------------------
Q182Q4_PEPD6/501-641S..LSSTNI....D........DF.........L----------------------------------------------
Q21FU2_SACD2/5-146R..LGSTGI....G........DG.........I----------------------------------------------
Q185F4_PEPD6/828-963E..MLPTYS.............KG........AI----------------------------------------------
Q8KEQ6_CHLTE/8-150K..NSNTSL....G........FG.........W----------------------------------------------
A6LWY3_CLOB8/491-629A..FISTIY....L........NG.........V----------------------------------------------
Q7P1H2_CHRVO/6-149A..TGSTAL....G........HG.........L----------------------------------------------
Q6ABT3_PROAC/3-150E..IYPTGL....PI......SCG.........V----------------------------------------------
Q7UR99_RHOBA/81-225K..LHPTAL....D........CG.........V----------------------------------------------
Q9K679_BACHD/543-687R..AGGVAI...PN........TS.........L----------------------------------------------
Q03UQ5_LEUMM/6-152E..VNGAYI....VI......VPG.........V----------------------------------------------
Q8EUZ2_MYCPE/5-149S..QFSTGI....G........NG.........L----------------------------------------------
A6VLW2_ACTSZ/4-146E..QFSTAI....G........YG.........I----------------------------------------------
Q8RD66_THETN/6-153K..NFPTGL...LLN......GNN.........V----------------------------------------------
A4T061_POLSQ/6-149E..LGSTAL....G........AG.........V----------------------------------------------
Q97EZ7_CLOAB/6-158K..KYPTGM....D.........LSVIEGQEYNV----------------------------------------------
Q184X2_PEPD6/4-146K..ESSTNM....G........NL.........I----------------------------------------------
Q6A5M7_PROAC/6-151E..AGTTGL....G........DG.........I----------------------------------------------
Q7MFX9_VIBVY/113-253E..RSSTCV....A........PG.........I----------------------------------------------
PTMA_MYCPN/1-142K..AASVAI....G........NY.........L----------------------------------------------
Q3Y1G3_ENTFC/2-144E..KASVYI....G........NF.........V----------------------------------------------
Q5WCM9_BACSK/543-683E...RDPYI....II......GPY.........I----------------------------------------------
Q74LQ8_LACJO/57-210D..KYPTGI....S.........MRPLSRELPDV----------------------------------------------
Q03GK2_PEDPA/486-624R..MSSTAF.............GK.........I----------------------------------------------
Q04H54_OENOB/1-147S..QFPTGL...NTT......TVG.........V----------------------------------------------
Q4KAL7_PSEF5/81-224L..AASTAI....G........EG.........V----------------------------------------------
Q3B1Z0_PELLD/5-149Q..EMSTGI....G........KK.........I----------------------------------------------
Q65DG1_BACLD/502-641A..VAPTCF....G........NL.........V----------------------------------------------
Q2NS54_SODGM/1-147K..EYPTGI...DME......THA.........I----------------------------------------------
Q0S1N2_RHOSR/13-157S..QSATGL....P........GG.........I----------------------------------------------
Q8Y5C8_LISMO/10-155E..EGKTGL....G........EG.........V----------------------------------------------
A6LX09_CLOB8/570-713E..KLGSYI....VI......LPG.........I----------------------------------------------
B0RET0_CLAMS/9-145R..SVSTFV....G........EG.........V----------------------------------------------
B7VRL7_VIBSL/6-149E..QGPTAL....G........EG.........L----------------------------------------------
E3FEW0_STIAD/125-265E..DVSSAV....G........NG.........V----------------------------------------------
G1UB79_HAEDU/6-165K..LGSTSI....N........GG.........I----------------------------------------------
O51369_BORBU/5-148K..IGDTSW....E........NG.........V----------------------------------------------
O51574_BORBU/4-146E..TNGTGI....E........EH.........I----------------------------------------------
PTFA_ECOLI/4-144K..MHSTGF....G........SG.........V----------------------------------------------
PTFX2_ECOLI/689-829A..VFSTGL....G........FS.........F----------------------------------------------
Q0WB68_YERPE/12-154R..MGSTGI....G........SG.........I----------------------------------------------
Q2G143_STAA8/5-145N..ELGPYI....VI......APE.........I----------------------------------------------
Q2G239_STAA8/5-148S..QSTTGI....G........EG.........I----------------------------------------------
Q2G2B8_STAA8/552-684D..DSYMVI....M........QN.........I----------------------------------------------
Q4A9J6_MYCHJ/2-145S..QISTGL....E........AG.........F----------------------------------------------
Q5NFF6_FRATT/6-147R..IGNTYI....G........KN.........I----------------------------------------------
Q6MSD4_MYCMS/4-148K..EGSTGF....N........DG.........I----------------------------------------------
Q6MTK9_MYCMS/1-146N..KIGPYY....II......ASQ.........I----------------------------------------------
Q7CJ97_YERPE/5-145E..AIGPYYV..VG........PG.........I----------------------------------------------
Q7CQH7_SALTY/3-141L..KWGPYY....LI......APG.........I----------------------------------------------
Q87HZ3_VIBPA/4-140N..QNSTFL....G........NG.........I----------------------------------------------
Q8DQP6_STRR6/21-170K..SFPTGL....DMEFLGKDLPN.........V----------------------------------------------
Q8F8C5_LEPIN/7-155K..SMSTGI....G........SG.........V----------------------------------------------
Q8RCS1_THETN/4-143E..DITTYI....G........NG.........V----------------------------------------------
Q8RHS2_FUSNN/6-153E..EISTCI....G........SG.........I----------------------------------------------
Q8Y3N8_LISMO/8-146E..NNGPYI....VI......AKH.........I----------------------------------------------
Q8Y410_LISMO/540-679PAPIMNIIL....R........NT.........I----------------------------------------------
Q8Y411_LISMO/6-150Q..TFPTGL....KL.....DGYG.........V----------------------------------------------
Q8Y5G5_LISMO/6-151V..VFPTGL....E.......MNGI.......KI----------------------------------------------
Q8Y8M4_LISMO/529-668K..VYGPYM....VI......APG.........V----------------------------------------------
Q8Y9A2_LISMO/532-669E..ELGFYS....VK......DEE.........F----------------------------------------------
Q8Y9U4_LISMO/6-148A..HSTTGI....G........NN.........I----------------------------------------------
Q8YA62_LISMO/481-618Q..LSSTCY....G........NY.........Y----------------------------------------------
Q9A1N7_STRP1/7-147E..KYGPYY....VL......MPG.........M----------------------------------------------
Q9KMS5_VIBCH/6-152E..QLGPYI....CI......APN.........L----------------------------------------------
Q9KR27_VIBCH/5-142R..LSVTSM.............DG.........I----------------------------------------------
R5ZLN6_9ACTN/7-151D..AYPTGL....AM.....PAAN.........I----------------------------------------------

PF07565

S4A8_HUMAN/145-404K--HGQTVSPQSVPTTNLEVKNGVNCEHS...................................................
S4A5_HUMAN/141-408H--HSTEDLRMRQSANYGRLCHAQSRSMNDI.................................................
Q29N79_DROPS/170-438V--ITEDMVKSPSSQSMARPSSGTELN.....................................................
Q2LZ95_DROPS/294-628G--ADAQQQSLQQQQTRNLAKARRSICVTSSAPPAAAAAATTLNVGSPAGIASSIDHRRHSTMSYLGNLSGGTDDKKIKI
Q7PT77_ANOGA/85-347D--SRKPRIIPVVEINGH.GGQSEMRLNINDESY..............................................
B3A2_HUMAN/352-620Q--GAESDPHVTEPLMGGVPETRLE..VERERELPP............................................
B3AT_MOUSE/100-342G--ASEPLLPHQPSLETQLYCGQAEGG.....................................................
B3AT_HUMAN/86-329D--PSQPLLPQHSSLETQLFCEQGDGG.....................................................
B3AT_CHICK/89-336A--DERALLRDQRAVEMRELHGAGQSP.....................................................
Q17LT4_AEDAE/264-527D--DKKPRIVPSSEINGH..GHGETKINMHEETY..............................................
Q9TUQ0_BOVIN/21-268D--PSEPLLPQHPSLETELFCEQGEGS.....................................................
Q1A708_STRPU/152-465T--SPSSLMVKGNSGDLGKSETSGSLPKVSSHHSLKKRL.........................................
B3A3_RABIT/351-620A--TPSHGPDGAVPTMADDLGEPAPLWPHDPDAKE.............................................
F1QP97_DANRE/354-625H--IGAPELPATDPLIGGLRNFESRSS.VDYVEKNEK...........................................
F6UUF5_HORSE/106-345G--TLQPLLPEHPSLETQLFCAQGEGD.....................................................
G5EC65_CAEEL/67-345I--EEKPEGPVTSQTAGAPSGSSNQLTLPTVESV..............................................
H3DGF3_TETNG/144-400D--KSDQMTSSQSQLAGPEGKAEASKENS...................................................

PF00359

Q7NAI8_MYCGA/13-156-----------------------------------------GIPHAR.......TA.T....VK.......QP..AL.LF
A8ZTY0_DESOH/13-165-----------------------------------------AIPHAR.......LA.G....IS.......DF..FI.IL
A9A064_DESOH/690-832-----------------------------------------AIPHIV.......ID.G....SR.......TF..AI.LL
B9M6K3_GEODF/75-216-----------------------------------------AIPHVRN....PILL.H....VN.......AA..MI.TL
Q67LZ9_SYMTH/478-621-----------------------------------------ALPHAR.......PG.D...GVL.......RL..GM.SL
Q2NRA9_SODGM/6-147-----------------------------------------AMPHARP....EEG.......AN.......KL..GL.SL
Q184X0_PEPD6/5-149-----------------------------------------AMPHGK.......TK.Y....VK.......KA..SV.VI
Q5WDU8_BACSK/528-672-----------------------------------------ALFHTR.......LN.E....IK.......RP..VF.VF
Q182H5_PEPD6/4-148-----------------------------------------AIPHTK.......ND.A....IE.......NP..AV.VV
A1R8K7_ARTAT/11-156-----------------------------------------GLPHAR.......SE.F....VDR.....ISI..AV.GV
ULAC_MYCPN/9-152-----------------------------------------AMPHAQ.......NN.G...TVQ.......QN..CF.SL
Q4A583_MYCS5/11-153-----------------------------------------AMPHAK.......SE.SD..YVF.......DT..AF.SL
Q5HKT2_STAEQ/502-646-----------------------------------------AIPHAK.......SH.A....VK.......RP..IV.AV
Q2S4A8_SALRD/11-155-----------------------------------------GLPHAK.......TP.A....AS.......NT..VA.AF
A8FIW8_BACP2/499-638-----------------------------------------AIPHPIK....PA........TD.......DT..FC.AI
Q6LNN0_PHOPR/116-260-----------------------------------------ALPHIM..........HE..SIT.......LP..GM.AV
Q8EL16_OCEIH/2-145-----------------------------------------AIAHAR.......PN.E...SVK.......EN..AL.AL
A8AYR4_STRGC/491-627-----------------------------------------AVPHAIE....IS........TS.......ES..CI.AT
Q182Q6_PEPD6/1-146-----------------------------------------AIPHTK.......SV.N....VK.......EA..SI.LY
Q0BV42_GRABC/17-156-----------------------------------------VIPHGMV....DDRA.M....VR.......TD..GI.AV
A7MI94_CROS8/5-151-----------------------------------------AIPHGK.......SP.V....VK.......QP..AF.AA
A6LWC3_CLOB8/859-995-----------------------------------------GIPHGLS....EF........VE.......KS..SI.AI
Q18CC4_PEPD6/843-977-----------------------------------------AIPHTDG....ID........VI.......RP..AI.SI
Q2IH73_ANADE/5-148-----------------------------------------AIPHGK.......VP.G....LP.......GL..MA.SF
Q8EMS7_OCEIH/509-648-----------------------------------------AIPHPLT....PK........SD.......QT..FI.SI
PTM3C_BUCBP/496-638-----------------------------------------ALPHGTI....QSKD.F....IL.......NT..GI.IF
Q18CC6_PEPD6/5-151-----------------------------------------AIPHTD..........IV..HVN.......EP..GI.AI
Q5WC05_BACSK/4-151-----------------------------------------AIPHTD..........AS..YVL.......ES..KI.GL
Q8EVW2_MYCPE/497-641-----------------------------------------AMPHAS.......YL.D...GVN.......KL..SF.TF
Q4A9C7_MYCHJ/1-144-----------------------------------------ALLHAP......VGD.Y....CL.......EV..GT.SI
Q32AP6_SHIDS/4-150-----------------------------------------AIPHTD..........HK..HVR.......HN..AI.AV
Q185K0_PEPD6/5-152-----------------------------------------AIPHTD..........AE..YIK.......EQ..FI.SV
Q6AGN9_LEIXX/4-147-----------------------------------------ALAHAR.......PG.L...DVN.......AD..GL.AV
Q182P4_PEPD6/499-638-----------------------------------------ALPHAS.......SKEG....VN.......KL..AM.SL
A6TVY0_ALKMQ/551-695-----------------------------------------SLLHCR.......TS.S....VE.......KL..YF.GA
Q8Y9X0_LISMO/1-146-----------------------------------------AIPHAK.......TE.A....IL.......EA..KL.LF
Q182H6_PEPD6/492-629-----------------------------------------AIPHTIV....KG........DK.......KS..II.GV
Q034E9_LACC3/8-156-----------------------------------------AIPHTD..........AD..QVI.......HD..QI.GF
Q182Q4_PEPD6/501-641-----------------------------------------AIPHPME....LS........SI.......RT..KI.CI
Q21FU2_SACD2/5-146-----------------------------------------AIPHCR.......FA.T....GG.......ET..FC.AC
Q185F4_PEPD6/828-963-----------------------------------------GVPHGD.......SS.T....VN.......ST..RF.VF
Q8KEQ6_CHLTE/8-150-----------------------------------------ACPHARVNFDGDLCC.A....IG.......WSPAGI.DY
A6LWY3_CLOB8/491-629-----------------------------------------CIPHPIE....TD........AL.......RN..VI.SV
Q7P1H2_CHRVO/6-149-----------------------------------------ALPHAR.......VE.G....LA.......GA..RA.LF
Q6ABT3_PROAC/3-150-----------------------------------------AIPHTD..........PQ..YVT.......RD..AL.AV
Q7UR99_RHOBA/81-225-----------------------------------------ALLHPR.......RPQTS..ILA.......ES..VL.AM
Q9K679_BACHD/543-687-----------------------------------------ALFHTR.......SR.D....VT.......IP..YF.AM
Q03UQ5_LEUMM/6-152-----------------------------------------VMPHALA.....TGP.G....VL.......GT..GI.GF
Q8EUZ2_MYCPE/5-149-----------------------------------------AIPHIR..........DD..VMN.......KS..VI.LF
A6VLW2_ACTSZ/4-146-----------------------------------------GMPHGK.......SN.T....VL.......SP..FI.SF
Q8RD66_THETN/6-153-----------------------------------------AIPHTD..........PE..HVL.......KP..AI.AV
A4T061_POLSQ/6-149-----------------------------------------AIPHGR.......VK.G....LK.......QP..AA.AF
Q97EZ7_CLOAB/6-158-----------------------------------------AIPHTE..........RE..YCL.......SK..RI.VF
Q184X2_PEPD6/4-146-----------------------------------------AIPHAK.......SN.V....VN.......QP..VM.MY
Q6A5M7_PROAC/6-151-----------------------------------------AIPHGK.......CD.G....VD.......RP..AL.AF
Q7MFX9_VIBVY/113-253-----------------------------------------AIPHVM.......FE.G....IE.......HI..AV.AV
PTMA_MYCPN/1-142-----------------------------------------FLPHPV.......YDEIA..NIQ.......KE..KM.VF
Q3Y1G3_ENTFC/2-144-----------------------------------------ALPHGTD.....KDE.E....VV.......EE..GI.YL
Q5WCM9_BACSK/543-683-----------------------------------------AIPHAS.......PE.E...GAI.......EA..GM.SL
Q74LQ8_LACJO/57-210-----------------------------------------AVPHTE..........GD..YVS.......AQ..LI.VP
Q03GK2_PEDPA/486-624-----------------------------------------AIPHSLE....MK........AL.......NT..KG.FI
Q04H54_OENOB/1-147-----------------------------------------AIPHTD..........AK..YVN.......ET..QI.AF
Q4KAL7_PSEF5/81-224-----------------------------------------AVPHAR.......LA.E....LD.......RI..HA.LY
Q3B1Z0_PELLD/5-149-----------------------------------------ALPHAK.......TG.A....VT.......HP..VL.AI
Q65DG1_BACLD/502-641-----------------------------------------AIPHPMT....PK........TA.......ST..FW.AV
Q2NS54_SODGM/1-147-----------------------------------------AIPHIE.......YE.H....VN.......HT..GF.AV
Q0S1N2_RHOSR/13-157-----------------------------------------AIPHCR.......SE.A....VV.......AA..SL.GF
Q8Y5C8_LISMO/10-155-----------------------------------------AIPHGK.......ST.S....VT.......ST..SI.AV
A6LX09_CLOB8/570-713-----------------------------------------AMPHAR.......PE.D...GVY.......KI..GF.SI
B0RET0_CLAMS/9-145-----------------------------------------AVPHGT.......LA.AGRDLVR.......AD..AI.SL
B7VRL7_VIBSL/6-149-----------------------------------------AVPHGK.......TD.A....VK.......EA..GF.AV
E3FEW0_STIAD/125-265-----------------------------------------AVPRVF..........Q....TE.......RP..ALATL
G1UB79_HAEDU/6-165-----------------------------------------ALPHAK.......LP.A....STDSMLTFTTP..IS.VF
O51369_BORBU/5-148-----------------------------------------AIPHFI.......GD.V....VK.......TS..FI.SL
O51574_BORBU/4-146-----------------------------------------AMPHAK.......GN.F....IK.......KH..GI.AI
PTFA_ECOLI/4-144-----------------------------------------AVPHGK.......SA.C....VK.......QP..FV.LF
PTFX2_ECOLI/689-829-----------------------------------------AIPHSK.......SE.H....IE.......QS..TI.SV
Q0WB68_YERPE/12-154-----------------------------------------AIPHGK.......LE.E...DTL.......RA..VG.VF
Q2G143_STAA8/5-145-----------------------------------------AIAHAR.......PN.N...DVH.......QV..GL.SL
Q2G239_STAA8/5-148-----------------------------------------AIPHAK.......VA.A....VK.......SP..AI.AF
Q2G2B8_STAA8/552-684-----------------------------------------AIPHAY.......SE.K...HVH.......KT..AM.SM
Q4A9J6_MYCHJ/2-145-----------------------------------------AIPHAQ.......SQ.A....VL.......TP..SL.FF
Q5NFF6_FRATT/6-147-----------------------------------------YIPHCR.......VE.N....LM.......TT..RL.II
Q6MSD4_MYCMS/4-148-----------------------------------------AIPHAK.......IK.E....IT.......KP..GV.FV
Q6MTK9_MYCMS/1-146-----------------------------------------ALLHLT.......PK.EK.WKDK.......NN..AI.SL
Q7CJ97_YERPE/5-145-----------------------------------------AMPHAR.......PE.D...GVN.......RL..SL.AL
Q7CQH7_SALTY/3-141-----------------------------------------ALPHAR.......PE.Q...GAN.......HN..QI.SV
Q87HZ3_VIBPA/4-140-----------------------------------------AIPHGT.......TD.TR.SMVK.......TT..GV.AV
Q8DQP6_STRR6/21-170-----------------------------------------AIPHTD.......IV.H....NL.......AE..KV.VV
Q8F8C5_LEPIN/7-155-----------------------------------------AIPHCS.......VN.L....VD.......EL..KC.VM
Q8RCS1_THETN/4-143-----------------------------------------AIPHGV.......SE.YV.KYIK.......KS..GI.VI
Q8RHS2_FUSNN/6-153-----------------------------------------FLPHTR.......MI.D....FS.......DF..II.AV
Q8Y3N8_LISMO/8-146-----------------------------------------ALAHTR.......PE.F...GVI.......HG..GL.TF
Q8Y410_LISMO/540-679-----------------------------------------AIPHAE.......TE.K...GVN.......SL..GM.SL
Q8Y411_LISMO/6-150-----------------------------------------ALPHTD.......PE.C....VT.......EQ..FI.AV
Q8Y5G5_LISMO/6-151-----------------------------------------AIPHTD.......TI.Y....VK.......RP..FV.LV
Q8Y8M4_LISMO/529-668-----------------------------------------VIAHAG......ASD.G....VL.......MD..GI.GV
Q8Y9A2_LISMO/532-669-----------------------------------------ALFHGN......DSQ.L....VQ.......MN..SM.AL
Q8Y9U4_LISMO/6-148-----------------------------------------AIPHGK.......SE.S....VT.......KS..AI.VF
Q8YA62_LISMO/481-618-----------------------------------------AIPHAI.......QR.S....AK.......KN..AV.AV
Q9A1N7_STRP1/7-147-----------------------------------------AMPHAE.......AG.L...GVN.......RN..AF.AL
Q9KMS5_VIBCH/6-152-----------------------------------------ALPHAR.......PE.N...GVL.......RT..AF.AL
Q9KR27_VIBCH/5-142-----------------------------------------AYPHSK.......SK.A....VT.......KP..AI.AV
R5ZLN6_9ACTN/7-151-----------------------------------------AIPHTD.......PG.F....VA.......KP..YI.AV

PF07565

S4A8_HUMAN/145-404............................PVDLSKVDLHFMKKIPTGAEASNVLVGEVD---ILD-------RP--IV-AF
S4A5_HUMAN/141-408..........................SLTPNTDQRKNKFMKKIPKDSEASNVLVGEVD---FLD-------QP--FI-AF
Q29N79_DROPS/170-438.............................DQQHKGNTHFMRKIPPGAEASNILVGEVD---FLE-------RT--LS-CF
Q2LZ95_DROPS/294-628MPAADIGGSKRSNELKIDMKDDMYSSSQEDLKKLQNDTILRRIPAGAEATTVLVGAVE---FLD-------QP--TI-AF
Q7PT77_ANOGA/85-347.......................TSSQEDI....KMCTILKRIPEGAEATTVLVGAVD---FLE-------QP--TI-AF
B3A2_HUMAN/352-620.....................PAPPAGITRSKSKHELKLLEKIPENAEATVVLVGCVE---FLS-------RP--TM-AF
B3AT_MOUSE/100-342..............................SEGPSTSGTL.KIPPDSETTLVLVGRAN---FLE-------KP--VL-GF
B3AT_HUMAN/86-329..............................TEGHSPSGILEKIPPDSEATLVLVGRAD---FLE-------QP--VL-GF
B3AT_CHICK/89-336..............................SRAQLGPQLHQQLPEDTEATLVLVACAA---FLE-------QP--LL-AL
Q17LT4_AEDAE/264-527.......................TSSQEDIKMRTQKESILKRIPEGAEATTVLVGSVD---FLE-------QP--TI-AF
Q9TUQ0_BOVIN/21-268..............................TRGHAPE.ILGKSPQDWEATLVLVGCAR---FLK-------RP--VL-GF
Q1A708_STRPU/152-465.................SEARLSIPHNLAGHSLSARHSFMRKIPQGAEASNVLIGEVD---FLS-------RP--II-AF
B3A3_RABIT/351-620.....................RPLHMPGGDGHRGKSLKLLEKIPEDAEATVVLVGCVP---FLE-------QP--AA-AF
F1QP97_DANRE/354-625....................DSPQFFGLHKTKSKHELKLLEKIPEDAEATVVLVGCVD---FLD-------QP--TM-AF
F6UUF5_HORSE/106-345..............................TEESSPSGILEKISPDSEAALVLVGRIS---FLE-------KP--VL-GF
G5EC65_CAEEL/67-345.......................PKDISSEESSKGNLHFLKKLPAGVEASNVLIGEVD---FLT-------RH--IC-CF
H3DGF3_TETNG/144-400............................FVDFSKIDLHFMKKIPVGAEACNVLVGELD---FLN-------RP--VV-AF

PF00359

Q7NAI8_MYCGA/13-156AKL.HQ.AV.EW...D....EE..KKQVQYLFVILVP-QDASN..........THLE.IISNVAKL.I..MDKNA.....
A8ZTY0_DESOH/13-165GIA.TS.PI.AW...H...AAD..GRPVTIIFLVCGP-EAGAGDLREKSRLAEVYLR.IIARLMLL.I..KDEKY.....
A9A064_DESOH/690-832ARC.RQ.GV.RF...S.....D.AAPMVHAVFVLAGT-RDERN..........FHLQ.ALSAIAQI.V..QNPNF.....
B9M6K3_GEODF/75-216CFL.TN.PI.DF...K...AID..NKPVDTIFLLISP-TVKV............HLH.LLSKLAYI.L..RDQRF.....
Q67LZ9_SYMTH/478-621VRL.RK.PV.PFGHPD........NDPVRLVVCLGAI-DNET............HLK.ALMELSEL.L..ANPQS.....
Q2NRA9_SODGM/6-147LKL.RD.SV.SF...G....SQ.ENDPVDVIVMFAAP-DKNS............HVE.LISTLAEF.L..SDDNV.....
Q184X0_PEPD6/5-149GKS.KK.GV.DW...P...SID..GLPVKVIIMFAMP-QSGGN..........EDMI.LISKIAYI.L..GGKNI.....
Q5WDU8_BACSK/528-672LDL.KT.EA.QV...A..SMAD.GNERIKRAILMLAP-EALAE..........QELA.FMSFVSILLI..GSDDE.....
Q182H5_PEPD6/4-148LKF.NE.DV.VW...N...EGE..DK.VKLAISLLMP-GKSKEN.........IHLK.LLSSLSRK.L..INKEF.....
A1R8K7_ARTAT/11-156TKF.GH.AL.DF...G...ATD...GPATLVLLIATP-ASSFS..........DHLE.VLATLARS.L..SKESF.....
ULAC_MYCPN/9-152VTL.KE.PV.YFD.ND........PRPVRLLIGLAAT-SAAI............HTTEALPQIAAL.V..EDTQV.....
Q4A583_MYCS5/11-153VTF.KN.AI.SF..DE........NKKVKVMIYFASL-NGEI............HTKIAIPQIVAI.F..ENHEN.....
Q5HKT2_STAEQ/502-646LNH.KA.GV.EW...E...SLD..ESNPQLIFLIAVP-NDNND..........THLK.LLQRLSRT.L..MKDNT.....
Q2S4A8_SALRD/11-155ATT.DE.PV.DF...G...AVD..DVPVQILLLLVGP-EEHKS..........QHVK.ILGRISRL.V..SREPL.....
A8FIW8_BACP2/499-638CTL.KK.PV.LW...G..ENR......VQVVCLLSIQ-KTYQK...........ELQSLYQFLVRL.T..ERKEV.....
Q6LNN0_PHOPR/116-260LSS.NA.GI.EW.........GSNRGPVTQMIAMVLP-KPPQR..........PVVM.AFAHFSQC.L..LNDDF.....
Q8EL16_OCEIH/2-145AIF.KE.PV.AFHSKE........NDPVDLVFSFSAK-GDES............HLK.MIEQLSMF.L..MEEEQ.....
A8AYR4_STRGC/491-627LTL.DK.PV.QW...G..NFE......VRLVILLAIR-GEDNQ...........LMSIFFDWLSNL.V..MDPQK.....
Q182Q6_PEPD6/1-146IKT.TN.EL.EW...KTLDDSK.....VRYVFSLLAP-HKNEGN.........IHLK.TLSKLATC.L..MEDDF.....
Q0BV42_GRABC/17-156LQV.PQ.GV.VW...N.......PGQIAHLVVGIAAR-SDA.............HIA.ILRRLTRL.L..QDEER.....
A7MI94_CROS8/5-151VRL.TQ.PVDDW...P...TIE.GEEKVSLVFLLAVP-LGDDD..........GHLR.LLSTLSLA.L..MDEDN.....
A6LWC3_CLOB8/859-995FKL.NN.PI.LW...DYNC.M......VDVVIMLALK-ENDG...............KVVRQLFDT.L..SKTEV.....
Q18CC4_PEPD6/843-977AIL.KK.PI.VW...S..KSK......VKIILLLAVD-QK..............CFN.PLSTLLSF.I..ETDEF.....
Q2IH73_ANADE/5-148GRS.AG.GV.DF...R...AID..GKPTHLFFALFAP-ENSAG..........THLK.ALARISRI.F..KNPAF.....
Q8EMS7_OCEIH/509-648ATL.RE.PI.IW...S..DKT......VQFICLLSVK-RNSQE...........DLQSLYETLGKI.I..DRPSI.....
PTM3C_BUCBP/496-638CQF.PN.GI.LF...GDDPED......IAHLVIGVAA-RNNE............HIP.VVSNITNI.L..DNNDV.....
Q18CC6_PEPD6/5-151GIL.NK.PV.KF...IMMGTDD.TEIDVKVVFMLAVK-EPQE............QLQ.LLEKLMTI.F..QDKNI.....
Q5WC05_BACSK/4-151LTL.KE.PV.SF...GVMGSEN.DQIDVKVVLLLGLA-DGSA............HLK.ALQTIVER.I..QDAHF.....
Q8EVW2_MYCPE/497-641NIF.KH.PV.VF...P....GK.SKFNISLIIILAPE-DNEK............HIK.PLFELVDI.L..KQEEN.....
Q4A9C7_MYCHJ/1-144LVL.DE.MI.TF...N....NQ.KNKKAKIIITLSAP-NSND............HIA.LIQEFGLF.F..GNSDF.....
Q32AP6_SHIDS/4-150GIL.PE.PV.EF...ADMGGDP.DPVPVRVIFLLALS-ESNK............QLN.ALGWIMEM.I..QDTPF.....
Q185K0_PEPD6/5-152CTF.NE.PV.VF...SSMEDQD.EKVPVNLAFVLGLN-QPHS............QLS.VLTELMGI.M..QNKEL.....
Q6AGN9_LEIXX/4-147VTL.AE.PV.AFGHPH........NDPVSVIIGLAVS-TPDA............HVT.SVAELANV.F..NDPDS.....
Q182P4_PEPD6/499-638LIV.ED.EV............DLLGKPVNIFMVLAAV-DNTT............HIR.ALASLSEM.M..YEEEN.....
A6TVY0_ALKMQ/551-695VRL.IK.PIYYL...N...SRG.EEEAIDLVIVMIAP-ENSKQ..........AYLE.VISEVSKMII..DKPNF.....
Q8Y9X0_LISMO/1-146IRL.VE.PI.DW...E...SKE..GFKAQAIFAILVP-ASEASQ.........QHLK.ILSSVAVN.L..LEEAF.....
Q182H6_PEPD6/492-629GIL.EN.PI.IW...D..KQE......VQLVFMVFFN-TKEKH...........NFS.IFKYLYNF.I..KDEGG.....
Q034E9_LACC3/8-156VSL.KT.PV.EF...RQMASAT.DVVSVNYLFVLALK-TAHQ............QLD.MLQKLMEL.F..ADDAE.....
Q182Q4_PEPD6/501-641SIL.DE.PI.YW...SE.DST......VKLIMMLAIN-KDDYI...........KINSIYDILLKI.I..HDNDI.....
Q21FU2_SACD2/5-146ITL.EE.PV.DF...D...SID..NKPVDVIFAMVVP-EDANS..........EHLA.TLASLAEK.L..QKPEF.....
Q185F4_PEPD6/828-963VKL.KN.PI.DW...G........VGNVNFIFMPVFQ-ANDKE...............IVKNVLEI.L..KDAEF.....
Q8KEQ6_CHLTE/8-150GIA.GE.PL..................VRLVVMFFVP-ENQRN..........TYLK.EVSTLARV.L..KSNPE.....
A6LWY3_CLOB8/491-629SIL.KK.PF.IW...L..EKE......VRIIFMICLK-KEQVE...........VYKDITKKLYQL.M..REPKY.....
Q7P1H2_CHRVO/6-149IGL.KR.GL.DF...G...APD..QEAVRGALVLLLP-RDTRA..........PHLQ.LLAEIARI.F..AERPF.....
Q6ABT3_PROAC/3-150TTL.HT.PV.LF...GQMGGSEEDEVPVSVVILMALS-NADD............HLN.MLQNIVKS.I..QDDNL.....
Q7UR99_RHOBA/81-225GIC.PT.PV.AF...S.....D.TGQLTDIFFLICSY-DDSS............HLR.ILAKLSRI.V..SDEAF.....
Q9K679_BACHD/543-687YEW.GT.PS.LR...K..GMDN.SLILVERVVLMLAP-QDLEE..........VRLE.YLSHLSTLII..ESEET.....
Q03UQ5_LEUMM/6-152AKF.SE.MV.SF...E...EGN.PEKQGKLFFTLAAK-NEEQ............HLE.NIQNLMAL.L..MTDGM.....
Q8EUZ2_MYCPE/5-149ANI.K..PV.NW...E...SLD..NLPVEKVFFIAMS-SKEGEN.........SHMD.VIANLSKL.F..MNQEF.....
A6VLW2_ACTSZ/4-146ARL.KI.PF.YW...D...E....EELVKYVFLIGVP-EADVV..........LHLK.FISQLSKK.L..LDDDY.....
Q8RD66_THETN/6-153ATL.SK.PV.VF...KNMANPQ.EDVNVNIVFMIALN-AAHS............QVE.LLQRLVEM.I..QNENL.....
A4T061_POLSQ/6-149IRL.KD.PI.EF...A...APD..GESVSTFIFLLVP-EKATQ..........QHLE.ILSFIAQL.L..SDSEA.....
Q97EZ7_CLOAB/6-158VKL.KK.EV.EF...KNMIAPE.DTLKVRYLFMIINN-ENDA............QTN.ILANIMDF.I..TNKEN.....
Q184X2_PEPD6/4-146LRT.DR.EI......T...DND..GQKLRSFFMIAVP-ES.GSD.........EHLK.IISKLATY.L..MEENF.....
Q6A5M7_PROAC/6-151ARS.DE.GV.RW...G...APD..GSLASLVFLIAVP-EAAAGN.........EHLR.ILASLARS.L..VKADF.....
Q7MFX9_VIBVY/113-253IKN.DE.SM.DW...A.....S.KMGDVHLAIALVMP-SKPNR..........EQII.AATNLTRNLL..CDQMV.....
PTMA_MYCPN/1-142IGL.KD.VI.NI...D........GQPIKFICGLALK-GEH.............QMD.ALQSLAIA.F..SDPEE.....
Q3Y1G3_ENTFC/2-144VQV.PD.GV.DF...G...TKE.EPKIATLLFVVALK-KEH.............QLA.VLQDLAFF.C..SDIDQ.....
Q5WCM9_BACSK/543-683LHL.RK.PV.LF..SD........GEWVHVMVVIAAI-DKHQ............HIR.ALRQLIKL.A..GSKEA.....
Q74LQ8_LACJO/57-210IAL.RN.SA.TF...NNMVNPS.EALEVKFLFLILNN-DPDM............HST.ILAKIMDF.LAGTSVDD.....
Q03GK2_PEDPA/486-624YIN.PH.GI.TW...G..ANK......VYLVFALAVK-KQDSK...........MFRNIFDRLSDV.M..TEGKN.....
Q04H54_OENOB/1-147MSL.SK.PV.EF...KQMGDNA..KVEAKFIFMLALD-NPHK............QPQ.MLQRLMAL.F..QNEKA.....
Q4KAL7_PSEF5/81-224LRP.QT.AM.AF...A...APD..QQPVSDILVLLVP-APADQ..........QHLD.LLADTARL.F..TNPRF.....
Q3B1Z0_PELLD/5-149ATL.KE.DI.NF...D...AID..GEPVEIIFLLATP-EDMLA..........EHLK.LLGRITRL.A..GRADV.....
Q65DG1_BACLD/502-641CTL.QK.PI.VW...E..NKR......VQFVCLLCVE-KDNTA...........NLQEMYKFLGRV.L..DDRAI.....
Q2NS54_SODGM/1-147AIN.RA.GV.EF...HRTDDPA.LRVKPAIVVLMAID-PTCE............KVA.IVQSLFAL.L..ADVDA.....
Q0S1N2_RHOSR/13-157ARL.AP.KV.DF...G...APD...GPADLVFLIAAP-EGAGA..........EHMK.LLSSLARA.L..VRPAF.....
Q8Y5C8_LISMO/10-155GRT.KN.LV.EW...E...SLD..DKPVNIIILFAVK-NSDATT.........THIK.LLQKVAIL.L..ADDEV.....
A6LX09_CLOB8/570-713MTL.KY.PI.KFGNLE........NDPVKVIITMSVI-DNKS............HMK.DLKELMKI.I..EQDDF.....
B0RET0_CLAMS/9-145LRL.PD.GV.DW...D........GHDVRIVIGIAAT-GGG.............HIA.LLSRLAEI.L..LDPVR.....
B7VRL7_VIBSL/6-149ATL.KE.DM.KW...K...GLD.EDEDVNLIFLIAIP-NAEAGS.........THMH.LLTALTTT.L..VDDDV.....
E3FEW0_STIAD/125-265VTL.AR.PL.QV...E...TPD..GLPLRLVVALMGP-ERGRS...........SLM.QLAHVARL....ANQGL.....
G1UB79_HAEDU/6-165LQL.EN.GI.DY...E...ASD..NKEVDLIYAIMLP-SDCCD..........KYKD.DLPALAEK.L..SDKSL.....
O51369_BORBU/5-148LYI.KGSGV.KW...S....EE..NPPVNLIFLICMS-KKQQGN.........EHLK.AIAFIAKL.F..EDDAF.....
O51574_BORBU/4-146LRVVGN.GF.DF...N...SSD..QKLSKLFFMMALP-EETPSN.........AHIK.AISYLSNT.F..SNNLL.....
PTFA_ECOLI/4-144ARK.AQ.AI.DW...K...ASD..GEDVNCWICLGVP-QSGEE..........DQVK.IIGTLCRK.I..IHKEF.....
PTFX2_ECOLI/689-829ARL.QA.PV.RW...G........DDEAQFIIMLTLN-KHAAGD.........QHMR.IFSRLARR.I..MHEEF.....
Q0WB68_YERPE/12-154IRL.EQ.PI.AF...D...AID..NQPVDLLFALLVP-ADQCK..........THLH.TLSLVAKR.L..ADKTV.....
Q2G143_STAA8/5-145LKL.NQ.HV.AF...C.....D.EDHYASLIFVLSAI-DNHS............HLS.VLQNLATV.L..GDNQT.....
Q2G239_STAA8/5-148GKS.KA.GV.DY...Q...SLD..MQPAHLFFMIAAP-EGGAQ..........THLD.ALAKLSGI.L..MDENV.....
Q2G2B8_STAA8/552-684LIL.QE.PI.YM...S.....D..GTAIHIIVPIAAV-DKVT............HLR.ALLQLRDV.A..QDNDA.....
Q4A9J6_MYCHJ/2-145ISL.EN.GI.EW...E...NFD..KTKAKYLFCILLP-KKGFAT.........RQVE.LLAKIASI.I..LDPEI.....
Q5NFF6_FRATT/6-147VTL.KN.SY..Y...D....DS.VNDDIKIAVGVFFP-DNIST..........IHME.LLKQLALY.L..KQDKT.....
Q6MSD4_MYCMS/4-148FKF.KN.GV.EW...D...SID..NSLVTIAIALAIP-ENDSAN.........DHLK.ILSSIARK.L..VDDDF.....
Q6MTK9_MYCMS/1-146TVF.KY.PI.IF...K...QEQ..RYHVKYCLSLFAK-DNHS............HID.LLQKFAIL.F..NNKDF.....
Q7CJ97_YERPE/5-145TVI.TE.GV.TF...N...AEG..NDPVKLLIVLAAT-DSNS............HIE.AISQLAQL.F..DTASD.....
Q7CQH7_SALTY/3-141TTL.ST.PV.AF...G...NAD..CDPIWLLLCASAT-DAEA............HIR.TIQRISQW.L..DSPES.....
Q87HZ3_VIBPA/4-140HHF.PK.GV.DW...G.....D..GNKVFVAIGIAAK-SDE.............HLG.ILKQLTKV.L..GADGV.....
Q8DQP6_STRR6/21-170VRL.EK.PV.TF...HNMIAPD.KEVEVSLLFFIINN-SSSS............QTN.ILAQLMDF.F..TGNGH.....
Q8F8C5_LEPIN/7-155GLN.PN.GI.DF...D...SID..HQPVHIFILLIVP-KTKFQ..........EHIK.TLAQIAKA.L..NVKED.....
Q8RCS1_THETN/4-143AQY.PD.GV.DF...G.....D..GNRAYIVIGIAGK-GDE.............HLN.ILSKIALT.C..QYEEN.....
Q8RHS2_FUSNN/6-153ATV.KN.KL.EA...EI.GGTN.QTDDIKVVFLIISD-VLKNK..........NLLK.AMSAISKIAL..KNPEI.....
Q8Y3N8_LISMO/8-146ATL.AD.GV.AF...G....SD.MFDPVKLIITLAAT-DSES............HLE.VLSELAEV.L..MDEEK.....
Q8Y410_LISMO/540-679LYL.EE.GL.PL...E.....G..GKELHFIVVIAAI-DKNA............HFT.ALLQLMEL.S..ENKKE.....
Q8Y411_LISMO/6-150ITV.KD.GI.PF...KLMEDAG.QTVEANLIFVLGLN-EPHS............QLA.VLQQLMGT.I..QDKDN.....
Q8Y5G5_LISMO/6-151NKL.ST.PI.PF...VQMGTVD.KWIDVEVIFMLGIK-NPQD............QVP.LLSSIMEK.F..MEADF.....
Q8Y8M4_LISMO/529-668TII.ED.GI.MF...F...DRY..EEPVHVIFTLALK-TKEA............HL..IVEQLMKL.A..LNEEK.....
Q8Y9A2_LISMO/532-669LIN.EQ.PV.MF...G........EKQAKVIFILASK-DKKE............QIP.AIITLTKM.T..YQTDF.....
Q8Y9U4_LISMO/6-148ART.KE.MI.EW...E...SLD..DEPVNMIFLLAIT-DSDKTD.........GHLK.ILAEIATK.L..MDDDI.....
Q8YA62_LISMO/481-618CSL.DK.PI.DW...G........GNRVKLVLLLTMK-EERDN...........SFEELFGQLVTI.L..NERSF.....
Q9A1N7_STRP1/7-147ITL.TK.PV.TF...S.....D..GKEVSVLLTLAAT-DPSI............HTTVAIPQIVAL.F..ELDNA.....
Q9KMS5_VIBCH/6-152VTL.QE.PI.YF...E...G.E..DEPVDVLITLAGS-SSDE............HME.GLMEVTQV.L..DDENSATGVD
Q9KR27_VIBCH/5-142GVK.HE.GI.EY...G...DEE..GIKPTVFFMIASP-DNGAD..........HHIY.VLQELFGK.F...SEEF.....
R5ZLN6_9ACTN/7-151VKP.AA.PV.TF...NAMAGMG.APVPAQIVINLGIA-EPGG............QVE.ALQALMNI.F..MDADA.....

PF07565

S4A8_HUMAN/145-404VRL-SP-AVL..---..LSGLTEVPIPTRFLFILLGP.VGKGQ-----------QYHEIGRSMATI-M--TDEIF-----
S4A5_HUMAN/141-408VRL-IQ-SAM..---..LGGVTEVPVPTRFLFILLGP.SGRAK-----------SYNEIGRAIATL-M--VDDLF-----
Q29N79_DROPS/170-438IRL-SQ-AAL..---..MGDLTEVPVPTRFIFILLGP.PGSQS-----------NFHEIGRAMATL-M--SDEIF-----
Q2LZ95_DROPS/294-628VRL-SE-GVM..---..MPTLTEVPVPVRFMFVLLGP.RNFDL-----------DYHEVGRSISTL-M--ANEHF-----
Q7PT77_ANOGA/85-347VRL-AE-GIP..---..MPSITEVPIPVRFLFLLLGP.QKTDL-----------DYHEVGRSIATL-M--SNEHF-----
B3A2_HUMAN/352-620VRL-RE-AVE..---..LDAVLEVPVPVRFLFLLLGP.SSANM-----------DYHEIGRSISTL-M--SDKQF-----
B3AT_MOUSE/100-342VRL-KE-AVP..---..LEDLV.LPEPVGFLLVLLGP.EAPHV-----------DYTQLGRAAATL-M--TERVF-----
B3AT_HUMAN/86-329VRL-QE-AAE..---..LEAV.ELPVPIRFLFVLLGP.EAPHI-----------DYTQLGRAAATL-M--SERVF-----
B3AT_CHICK/89-336VRL-GA-PCP..---...DAVLAVPLPVRFVLTVLGP.DSPRL-----------SYHEIRRAAATV-M--ADRVF-----
Q17LT4_AEDAE/264-527VRL-AE-GIP..---..MPSITEVPIPVRFLFILLGP.KTAEL-----------DYHEVGRSIATL-M--SNEHF-----
Q9TUQ0_BOVIN/21-268VRL-KE-PMEPE---PKPEGSEEPAVPVRFLIVLLGP.EGPNI-----------NYTQLGRAAATL-M--SERVF-----
Q1A708_STRPU/152-465VRL-QS-AVS..---..LGDPTEVPIPRRFLFILLGPQSGETK-----------RYHEIGRCVATI-M--SDKVF-----
B3A3_RABIT/351-620VRL-SE-AVL..---..LESVLEVPVPVRFLFVMLGP.SHIST-----------DYHELGRSIATL-M--SDKLF-----
F1QP97_DANRE/354-625VRL-KE-AVL..---..LESVLEVPIPVRFLFVLLGP.PSANI-----------DYHQIGRSISTL-M--SDKHF-----
F6UUF5_HORSE/106-345VRL-RE-AVE..---..LEATVEPSVPVRFLLVLLGP.EAPHT-----------DYTQLGRAAATL-M--SERVF-----
G5EC65_CAEEL/67-345IRL-KN-ANQ..---..LGDLTEVPVPTRFIFLLLGP.TGHGQ-----------QYREIGRAIATL-M--ADEIF-----
H3DGF3_TETNG/144-400VRL-SP-AVL..---..LSGLAEVPIATRFLFILLGP.TGRGP-----------QYHEIGRSMATL-M--TDEVF-----

PF00359

Q7NAI8_MYCGA/13-156NQKLI.S.SNNPDEISK.LIVSY---------------
A8ZTY0_DESOH/13-165RTALV.R.AQRATEVVD.LVRHF---------------
A9A064_DESOH/690-832ERLWL.R.AKNAQALRE.VVLRA---------------
B9M6K3_GEODF/75-216KAVLQ.R.QGPQSEI....IAAV---------------
Q67LZ9_SYMTH/478-621VEALH.T.AADVAEVLR.LIRSV---------------
Q2NRA9_SODGM/6-147MDKVF.K.AQSQPELSK.IVNDF---------------
Q184X0_PEPD6/5-149GERLL.N.AHTKKEILD.IFYEV---------------
Q5WDU8_BACSK/528-672TALFY...QGREREITQ.FLEQK---------------
Q182H5_PEPD6/4-148KDSLL.K.SDNVEEISN.SINEA---------------
A1R8K7_ARTAT/11-156RESLR.R.AHDPEVISE.LINSS---------------
ULAC_MYCPN/9-152VKDLL.D.CCDETSLFA.VIDRV---------------
Q4A583_MYCS5/11-153VKKIA.N.FQSKEKLIE.FLKSL---------------
Q5HKT2_STAEQ/502-646RDELI.H.AQSRDEIFN.ILKEI---------------
Q2S4A8_SALRD/11-155RERLL.D.AETPEAVIK.TLREG---------------
A8FIW8_BACP2/499-638VDQLI.K.AASFEELTA.ALQVL---------------
Q6LNN0_PHOPR/116-260CEALT.T.AKTPAVIHA.IILNA---------------
Q8EL16_OCEIH/2-145VNALR.N.ASTIEEAYQ.IISKG---------------
A8AYR4_STRGC/491-627LSALL.K.ARDQKDFI....ENI---------------
Q182Q6_PEPD6/1-146TSEVK.N.ASDASHLVK.YITNK---------------
Q0BV42_GRABC/17-156LKTLF...QTGDAALLQAALSED---------------
A7MI94_CROS8/5-151VSALK.A.APTVDAFLA.LLDAH---------------
A6LWC3_CLOB8/859-995ANKLR.K.SNSPKEISD.ILLKI---------------
Q18CC4_PEPD6/843-977.KKIK.N.IKDRDFIRE.MILDG---------------
Q2IH73_ANADE/5-148REAIM.K.APGSAEIYR.LIEAE---------------
Q8EMS7_OCEIH/509-648IQKLV.K.AKDKNAFIE.IIEQV---------------
PTM3C_BUCBP/496-638IKSLS.I.TKNIDDVLY.LFSRK---------------
Q18CC6_PEPD6/5-151LNNIV.D.LS.EESVSD.LLNSK---------------
Q5WC05_BACSK/4-151VKKLA.S.VQEKDEALA.LLDAS---------------
Q8EVW2_MYCPE/497-641VNRLL.K.MKDTNEIYQ.FILEG---------------
Q4A9C7_MYCHJ/1-144KKEIY.A.SRTIKEFYQ.IIKKY---------------
Q32AP6_SHIDS/4-150MQALL...AMETTEIHT.VILNK---------------
Q185K0_PEPD6/5-152VDKLM.S.STDKEEVLK.TLKSL---------------
Q6AGN9_LEIXX/4-147IPALA.D.ASGVAEVQR.ILALS---------------
Q182P4_PEPD6/499-638VKLII...NGDKSSILE.LINKQ---------------
A6TVY0_ALKMQ/551-695LVLLR...GNAKEEAYL.EISNC---------------
Q8Y9X0_LISMO/1-146QEQIL.T.IKTEHELMD.YLKDN---------------
Q182H6_PEPD6/492-629VRGII.K.ICDFNKLM..ALIGN---------------
Q034E9_LACC3/8-156MTAFR.K.IKTADDFIH.FMTEQ---------------
Q182Q4_PEPD6/501-641RDSIS.N.CNDFDNFLS.IIKSI---------------
Q21FU2_SACD2/5-146VKGLR.N.ATSDAQLFN....AA---------------
Q185F4_PEPD6/828-963MNNAN.K.CFDKDAFRR.IIFDK---------------
Q8KEQ6_CHLTE/8-150FQNLE.P.IGDLDQVRN.TLLDM---------------
A6LWY3_CLOB8/491-629LERVI.R.VKSFEELMA.VMKEM---------------
Q7P1H2_CHRVO/6-149RAELA.A.CRLPEQVDR.LFQRW---------------
Q6ABT3_PROAC/3-150MQTIR.S.ATKPEEVVS.IVRPL---------------
Q7UR99_RHOBA/81-225LEGVR.A.SDTPADAWA.ILNEA---------------
Q9K679_BACHD/543-687MRLFE...RASEQAVFA.RIYES---------------
Q03UQ5_LEUMM/6-152IEALS.N.IETLDDFNQ.VMNHF---------------
Q8EUZ2_MYCPE/5-149VDKLA.K.VNSYDSLIK.LINEY---------------
A6VLW2_ACTSZ/4-146RNALA.D.FETTKQVEA.HLSQI---------------
Q8RD66_THETN/6-153LEEIL.K.AKGGDEVVK.IIESY---------------
A4T061_POLSQ/6-149RGALS.S.ATDPVKVCE.LLQHW---------------
Q97EZ7_CLOAB/6-158MDKLN.K.TDNEEEIFE.FITDK---------------
Q184X2_PEPD6/4-146LKHLL.S.AETPYEILS.IFNNK---------------
Q6A5M7_PROAC/6-151RNQLL.A.ASTPQEVRE.VLAGI---------------
Q7MFX9_VIBVY/113-253ERLLL...TRSGVDLQA.LLMYA---------------
PTMA_MYCPN/1-142VEKLVKDKDLTQDKVLE.FLAKH---------------
Q3Y1G3_ENTFC/2-144VMALS.D.AETIEEVQM.IFEHG---------------
Q5WCM9_BACSK/543-683RERLI.A.AKTETEIME.LVSFY---------------
Q74LQ8_LACJO/57-210LNELF.N.SDSNEEIYD.FLENN---------------
Q03GK2_PEDPA/486-624IATLV.Q.STSYDDFLN.KLKSM---------------
Q04H54_OENOB/1-147MKKLE.T.IKDEKDFIE.IMKKE---------------
Q4KAL7_PSEF5/81-224RQALL.R.CTAPMQVKQ.LFDHW---------------
Q3B1Z0_PELLD/5-149REKIC.R.AESSTEVLE.MFREE---------------
Q65DG1_BACLD/502-641VRELL.K.CKTYGEFMS.VFKKS---------------
Q2NS54_SODGM/1-147VNKIS...EYSPAEIAK.TFFQA---------------
Q0S1N2_RHOSR/13-157VGALR.D.AKTPAEIVT.LVNDV---------------
Q8Y5C8_LISMO/10-155IGQFQ.T.VQTKEDFIK.LLAKN---------------
A6LX09_CLOB8/570-713IDKMS.R.TNSVEEVLR.IFNLS---------------
B0RET0_CLAMS/9-145AEQLR.G.ATEPATVRS.LL...---------------
B7VRL7_VIBSL/6-149REAVL.K.ATTAEEIFA.LLD..---------------
E3FEW0_STIAD/125-265ADQLA.G.AQHPHEVFQ.RLQT.---------------
G1UB79_HAEDU/6-165AKQLR.A.ATSSEEIWQ.YLEY.---------------
O51369_BORBU/5-148QNALR.G.FVTTDDIYY.YIEN.---------------
O51574_BORBU/4-146RHELM.S.TNNEDRFLE.II...---------------
PTFA_ECOLI/4-144IHQLQ...QGDTDQVLA.LLNQ.---------------
PTFX2_ECOLI/689-829RNALV.N.AASADAIAS.LLQH.---------------
Q0WB68_YERPE/12-154CRRLR.S.AQSDDELYQ.IITE.---------------
Q2G143_STAA8/5-145VQQLL.T.ATNAQDIKN.ILKE.---------------
Q2G239_STAA8/5-148REKLL.H.ASSPEEVLA.IIDE.---------------
Q2G2B8_STAA8/552-684IKRII.Q.SRKNSDVNE.ILKN.---------------
Q4A9J6_MYCHJ/2-145SKVLT...SDDPDFVFK.NLEK.---------------
Q5NFF6_FRATT/6-147QQYFQ.Q.AENSEDLYN.LIIN.---------------
Q6MSD4_MYCMS/4-148RKDLN.K.ANNVDQLYQ.LISK.---------------
Q6MTK9_MYCMS/1-146INELE.K.VNNTQDILI.VLQK.---------------
Q7CJ97_YERPE/5-145VQALL.N.AKTPQDILS.VIA..---------------
Q7CQH7_SALTY/3-141VAMLQ.D.APNDAALFA.QL...---------------
Q87HZ3_VIBPA/4-140EERLR.D.AKSEEDIIA.LLH..---------------
Q8DQP6_STRR6/21-170LEDLS.K.ISEPEKLYA.YIAE.---------------
Q8F8C5_LEPIN/7-155REKLI.R.SGSFEEIQK.AFS..---------------
Q8RCS1_THETN/4-143VEKLK.K.AKTPQEIIE.ILEK.---------------
Q8RHS2_FUSNN/6-153IEKIK.M.ATHEKQILE.LLS..---------------
Q8Y3N8_LISMO/8-146VTRLI.E.ANSSQAFYD.ELTK.---------------
Q8Y410_LISMO/540-679LKKLA.D.AANTEEMHQ.IIKN.---------------
Q8Y411_LISMO/6-150VAALL.R.AKDEDEVKQ.ILE..---------------
Q8Y5G5_LISMO/6-151VEQIK.E.INDSNTLCD.FLKK.---------------
Q8Y8M4_LISMO/529-668MQKIK.M.ASSKRDIYH.YVKS.---------------
Q8Y9A2_LISMO/532-669ISKLE.Q.AKNPIDADR.IIK..---------------
Q8Y9U4_LISMO/6-148VESLK.N.TRDKEEVIR.ILN..---------------
Q8YA62_LISMO/481-618VKKLA.K.QEDFQQFIE.LCEQ.---------------
Q9A1N7_STRP1/7-147IERLV.A.CQSPKEVLE.MVEE.---------------
Q9KMS5_VIBCH/6-152LDKLR.R.CRDKQQVYA.VIDQ.---------------
Q9KR27_VIBCH/5-142IEDIH.N.AKNEHQILN.I....---------------
R5ZLN6_9ACTN/7-151AADVL.G.QTTSQGMVD.AIR..---------------

PF07565

S4A8_HUMAN/145-404HDVAY-K-AKERDDLLA-GIDEFLDQVTVLPPGEWDPS
S4A5_HUMAN/141-408SDVAY-K-ARNREDLIA-GIDEFLDEVIVLPPGEWDPN
Q29N79_DROPS/170-438HEVAY-R-ARKREHLLA-GVDEFLDAVTVLPPGEWDPT
Q2LZ95_DROPS/294-628HAIAY-K-ADDRKDLLS-AINEFLDDSIVLPPGNWDRH
Q7PT77_ANOGA/85-347HDIAY-T-ADDREELLS-AIDDFLEDSIVLPPSKWERQ
B3A2_HUMAN/352-620HEAAY-L-ADEREDLLT-AINAFLDCSVVLPPSEVQGE
B3AT_MOUSE/100-342RITAS-M-AHNREELLR-SLESFLDCSLVLPPTDAPSE
B3AT_HUMAN/86-329RIDAY-M-AQSRGELLH-SLEGFLDCSLVLPPTDAPSE
B3AT_CHICK/89-336RRDAY-L-CGGRAELLG-GLQGFLEASIVLPPQEVPSE
Q17LT4_AEDAE/264-527HDIAY-R-ADDRKDLLS-AINEFLDDSIVLPPGKWERQ
Q9TUQ0_BOVIN/21-268WNDAY-L-AQSKETLVQ-SLEGFLDCSLVLPPLDAPSE
Q1A708_STRPU/152-465HDVAY-K-AKSTKDLLA-GIDEFIDSVTVLPPGAWDPN
B3A3_RABIT/351-620HEAAY-Q-ADDRQDLLG-AISEFLDGSIVIPPSEVEGR
F1QP97_DANRE/354-625HEAAY-L-ADGRQDLLT-AINSFLDCSIVLPPSEV...
F6UUF5_HORSE/106-345LNEAN-T-AQSKEELVR-SLEGFLDCSLVLPPLDAPS.
G5EC65_CAEEL/67-345HDVAY-G-ARDVDDLLD-GIDEFLDQVTVLPPGEWDPN
H3DGF3_TETNG/144-400HDVAY-K-AKDRNDLIA-GIDEFLDQVTVLPPGEWDP.

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window