Sequence alignment for CL0341

PF02866

LDH_BACSU/148-317TTLDSARF--------RFM...........LSE...YFGA.APQNV...HAHIIGEHGDTELPVWSHANVGGVPVSELVE
MDHM_MOUSE/170-334TTLDIVRA--------NTF...........VAE...LKGL.DPARV...NVPVIGGHAG..........KTIIPLISQCT
MDHC_MOUSE/156-331TRLDHNRA--------KSQ...........IAL...KLGVTADDVK...NVIIWGNHSSTQYPDVNHAKVKLQGKEVGVY
DHL2_LACCO/149-310TLLDTARM--------QRA...........VGE...AFDL.DPRSV...SGYNLGEHGNSQFVAWSTVRVMGQPI...VT
LDH1_LACLA/148-317TSLDTARF--------RQA...........LAE...KVDV.DARSI...HAYIMGEHGDSEFAVWSHANVAGVKLEQWFQ
MDHC_YEAST/179-370TKLDIVRA--------STF...........LREINIESGL.TPRVNSMPDVPVIGGHSG..........ETIIPLFSQSN
MDHP_YEAST/146-337TNLDLVRA--------ETFLVDYLMLKNPKIGQ...EQDK.TTMHR...KVTVIGGHSG..........ETIIPI..ITD
LDH_MYCHY/146-315TVLDTARL--------QFA...........IAK...RAKV.SPNSV...QAYVMGEHGDSSFVAYSNIKIAGECFCAYSK
MDH_PHOPR/147-310TTLDIIRS--------ETF...........VAE...LKGK.TPSDI...QVPVIGGHSG..........VTILPLLSQVE
LDH_LACPE/149-317TSLDSSRL--------RVA...........LGK...QFNV.DPRSV...DAYIMGEHGDSEFAAYSTATIGTRPVRDVAK
MDHC_ECHGR/156-331TRLDHNRA--------IYQ...........VAA...KAGVPNTCVK...NVCIWGNHSNKQFPDLSHAVVTKDGKQHPAK
LDHP_BACPS/149-318TILDTGRF--------RFL...........LGE...YFDI.APANV...HAYIIGEHGDTELPVWSHADIGGISITELIK
LDH_THEMA/142-311TVLDTARL--------RTL...........IAQ...HCGF.SPRSV...HVYVIGEHGDSEVPVWSGAMIGGIPLQNMCQ
MDHP_MAIZE/241-413TRLDENRA--------KCQ...........LAL...KAGVFYDKVS...NVTIWGNHSTTQVPDFLNAKID..GR..PVK
MDHG_CITLA/190-354TMLDVVRA--------NTF...........VAE...VLGL.DPRDV...DVPVVGGHAG..........VTILPLLSQVK
MDHM_CITLA/180-344TTLDVVRA--------KTF...........YAG...KANV.PVAEV...NVPVIGGHAG..........ITILPLFSQAT
MDHM_YEAST/165-331TTLDSIRA--------ARF...........ISE...VENT.DPTQE...RVNVIGGHSG..........ITIIPLISQTN
MDH_ECOLI/147-310TTLDIIRS--------NTF...........VAE...LKGK.QPGEV...EVPVIGGHSG..........VTILPLLSQVP
MDH_THETH/156-325TRLDHNRA--------KAQ...........LAK...KTGTGVDRIR...RMTVWGNHSSTMFPDLFHAEVD..GR...PA

PF11975

CHBF_ECOLI/192-415DDLSIDLFGLNHMVFIKDVLIN.GKSRFAELLDGVASGQLKASSVK---N..IFDLPFSEGLIRSLN.......LLPCSY
MALH_FUSMR/189-416KDMDIMYYGLNHFGWWKSVRDKQGNDLMPKLREHVSQYGYVVPKGD---NQ.HTEASWNDTFAKAKDVLALDPTTLPNTY
GLVA_BACSU/191-417KEMKVRYYGLNHFGWWTSIQDQEGNDLMPKLKEHVSQYGY.IPKTE---AE.AVEASWNDTFAKARDVQAADPDTLPNTY
LICH_BACSU/191-412DRVEVQFAGLNHMVFGLDVFLD.GVSVKEQVIEAMGD.PKNAMTMK---N..ISGAEWEPDFLKALN.......VIPCGY
AGLA_THEMA/192-451EKVDWQVAGVNHGIWLNRFRYN.GGNAYPLLDKWIEEKSKDWKPEN---PFNDQLSPAAIDMYRFYGVMPIGDTVRNSSW
AGAL_ECOLI/192-421ATLRYRCAGINHMAFYLELERKTADGSYVNLYPELLAAYEAGQAPK---PN.IHGNTRCQNIVRYEMFKKLG.YFVTESS
LPLD_BACSU/199-425EDIRVNVLGINHFTWITKASYR.HIDLLPIFREFSAHYGESGYELE---G.....ECWRDSVFCSAHRVAFD..LFETYG
AGAL_BACSU/188-404DGIEERIAGINHMAWLLEVKK...DG..TDLYPEIKRRAKEKQK..---.......TKHHDMVRFELMDKFG.YYVTESS

PF02866

LDH_BACSU/148-317KNDAYK.---QEELDQI--------------------------------------------VDDVKNAAYHIIEKK...G
MDHM_MOUSE/170-334PKVDFP.---QDQLATL--------------------------------------------TGRIQEAGTEVVKAKAGAG
MDHC_MOUSE/156-331EALKDD.---SWLKGEF--------------------------------------------ITTVQQRGAAVIKARK..L
DHL2_LACCO/149-310L.ADAG.---DIDLAAI--------------------------------------------EEEARKGGFTVLNGK...G
LDH1_LACLA/148-317ENDYLN.---EAEIVEL--------------------------------------------FESVRDAAYSIIAKK...G
MDHC_YEAST/179-370FLSRLN.---EDQLKYL--------------------------------------------IHRVQYGGDEVVKAKNGKG
MDHP_YEAST/146-337KSLVFQL---DKQYEHF--------------------------------------------IHRVQFGGDEIVKAKQGAG
LDH_MYCHY/146-315LTGIDS.---SNYEKEL--------------------------------------------EYPVSRRAYEIINRK...R
MDH_PHOPR/147-310G.VEFS.---DEEIKAL--------------------------------------------TPRIQNAGTEVVEAKAGGG
LDH_LACPE/149-317EQGVSD.---D.DLAKL--------------------------------------------EDGVRNKAYDIINLK...G
MDHC_ECHGR/156-331ELINDE.---KWVKEVF--------------------------------------------IPCVQNRGAAVIGLRK..L
LDHP_BACPS/149-318RNPEYT.---MKDLDEL--------------------------------------------FINVRDAAYQIIEKK...G
LDH_THEMA/142-311ICQKCD.---SKILENF--------------------------------------------AEKTKRAAYEIIERK...G
MDHP_MAIZE/241-413EVIKDT.---KWLEEEF--------------------------------------------TLTVQKRGGVLIQKWG..R
MDHG_CITLA/190-354PPSSFT.---QEEISYL--------------------------------------------TDRIQNGGTEVVEAKAGAG
MDHM_CITLA/180-344PRANLS.---DDTIVAL--------------------------------------------TKRTQDGGTEVVEAKAGKG
MDHM_YEAST/165-331H.KLMS.---DDKRHEL--------------------------------------------IHRIQFGGDEVVKAKNGAG
MDH_ECOLI/147-310G.VSFT.---EQEVADL--------------------------------------------TKRIQNAGTEVVEAKAGGG
MDH_THETH/156-325LELVDM.---EWYEKVF--------------------------------------------IPTVAQRGAAIIQARG..A

PF11975

CHBF_ECOLI/192-415LLYYFKQ...KEMLAIEMGEYYKG........GARA.QVVQKVEKQLF...............ELYKNPELKVKPKELEQ
MALH_FUSMR/189-416LKYYLFP...DYVVEHSNKEY............TRANEVMDGREKFVFGE...........CEKVVKNQSSEGCALHIDE
GLVA_BACSU/191-417LQYYLFP...DDMVKKSNPNH............TRANEVMEGREAFIFSQ...........CDMITREQSSENSEIKIDD
LICH_BACSU/191-412HRYYFKT...KEMLEHELEASQTE........GTRA.EVVQKVEKELF...............ELYKDPNLAIKPPQLEK
AGLA_THEMA/192-451RYHRDLETKKKWYGEPWGGADSEIGWKWYQDTLGKVTEITKKVAKFIKENPSVRLSDLGSVLGKDLSEKQFVLEVEKILD
AGAL_ECOLI/192-421EHFAEYT...PWFIKPGREDL...........IERYKVPLDEYPKRCVEQ...........LANWHKELEEYKKASRIDI
LPLD_BACSU/199-425AIPAAGD...RHLAEFLPGPYLKQ........PEVWKFHLTPISFRKQDR...........AEKRQETERLIVQQRGVAE
AGAL_BACSU/188-404EHNAEYH...PYFIKRNYPEL...........ISELQIPLDEYPRRCVKQ...........IENWEKMRDDIVNNKNLTH

PF02866

LDH_BACSU/148-317ATYYGVAMSLAR....ITKAILHNE......NSILTVSTYLDGQ.YGADD....................VYIGVPAVVN
MDHM_MOUSE/170-334SATLSMAYAGAR....FVFSLVDAM......NGK..EGVVECSF.VQSKETE.................CTYFSTPLLLG
MDHC_MOUSE/156-331SSAMSAAKAIAD....HIRDIWFGTP....EGEFVSMGVISDGNSYGVPDD...................LLYSFPVVIK
DHL2_LACCO/149-310YTSYGVATSAIR....IAKAVMADA......HAELVVSNRRDDM.....G....................MYLSYPAIIG
LDH1_LACLA/148-317ATFYGVAVALAR....ITKAILDDE......HAVLPVSVFQDGQ.YGVSD....................CYLGQPAVVG
MDHC_YEAST/179-370SATLSMAHAGYKCVVQFVSLLLGNI......EQI..HGTY...Y.VPLKDANNFPIAPGADQLLPLVDGADYFAIPLTIT
MDHP_YEAST/146-337SATLSMAFAGAK....FAEEVLRSFHNEKPETESLSAFVYLPGLKNGKKAQQLVG...........DNSIEYFSLPIVLR
LDH_MYCHY/146-315ATFYGIGAAIAK....IVSNIIKDT......KNIMIAGANLRGE.YGFHG....................VNIGVPVVLG
MDH_PHOPR/147-310SATLSMGQAAYR....FGLSLVRAL......QGE..QGIVECAY.VEGDGKH.................ARFFAQPVLLG
LDH_LACPE/149-317ATFYGIGTALMR....ISKAILRDE......NAVLPVGAYMDGQ.YGLND....................IYIGTPAIIG
MDHC_ECHGR/156-331SRAASAAKAIVD....QMRDWWFGTK....EGEWVSMSVYSTGDHYGAPKD...................IYFSFPVTIK
LDHP_BACPS/149-318ATFYGIAMGLAR....ITKAILNNE......NSVLTVSTYLDGE.YGTED....................VYMGVPAVVN
LDH_THEMA/142-311ATHYAIALAVAD....IVESIFFDE......KRVLTLSVYLEDY.LGVKD...................LCIS.VPVTLG
MDHP_MAIZE/241-413SSAASTAVSIVD....AIRSLVTPTP....EGDWFSTGVYTTGNPYGIAED...................IVFSMPCRSK
MDHG_CITLA/190-354SATLSMAYAAVK....FADACLRGL......RGD..AGVIECAF.VSSQVTE.................LPFFASKVRLG
MDHM_CITLA/180-344SATLSMAYAGAL....FADACLKGL......NGV..PDVVECSF.VQSTVTE.................LPFFASKVKLG
MDHM_YEAST/165-331SATLSMAHAGAK....FANAVLSGF......KGE..RDVIEPSF.VDSPLFKS..............EGIEFFASPVTLG
MDH_ECOLI/147-310SATLSMGQAAAR....FGLSLVRAL......QGE..QGVVECAY.VEGDGQY.................ARFFSQPLLLG
MDH_THETH/156-325SSAASAANAAIE....HIRDWALGTP....EGDWVSMAVPSQGE.YGIPEG...................IVYSFPVTAK

PF11975

CHBF_ECOLI/192-415RGGAYYSDAACE----VINAIYNDK------QAEHYVNIPHHGQIDNIPAD-------------------WAVEMTCKLG
MALH_FUSMR/189-416H.ASYIVDLARA----IA...FNTK------EKMLLI.VENNGAIVNFDST-------------------AMVEIPCIVG
GLVA_BACSU/191-417H.ASYIVDLARA----IA...YNTG------ERMLLI.VENNGAIANFDPT-------------------AMVEVPCIVG
LICH_BACSU/191-412RGGAYYSDAACN----LISSIYNDK------HDIQPVNTINNGAIASIPDD-------------------SAVEVNCVMT
AGLA_THEMA/192-451P.ERKSGEQHIP----FIDALLNDN------KARFVVNIPNKGIIHGIDDD-------------------VVVEVPALVD
AGAL_ECOLI/192-421KPSREYASTIMN----AI...WTGE------PSVIYGNVRNDGLIDNLPQG-------------------CCVEVACLVD
LPLD_BACSU/199-425KASGEEGVNIIA----AL...LGLG------ELVTNVNMPNQGQVLNLPIQ-------------------AIVETNAFIT
AGAL_BACSU/188-404ERSKEYGSRIIE----AM...ETNE------PFTFGGNVLNTGLITNLPSK-------------------AVVEVTCVAD

PF02866

LDH_BACSU/148-317RGG.....IAGI.TE.LN.-LNEKEKEQFL.HSAGVLKNILKPHFAEQ------
MDHM_MOUSE/170-334KKG.....LEKN.LGIGK.-ITPFEEKMIA.EAIPELKASIKKGEDFV------
MDHC_MOUSE/156-331.NK.....TWKF.VEGLP.-INDFSREKMD.LTAKELTEEKETAFEFL------
DHL2_LACCO/149-310RDG.....VLAE.TT.LD.-LTTDEQEKLL.QSRDYIQQRFDEIVDTL------
LDH1_LACLA/148-317AEG.....VVNP.IH.IP.-LNDAEMQKME.ASGAQLKAIIDEAFAKE------
MDHC_YEAST/179-370TKG.....VSYVDYDIVNR-MNDMERNQMLPICVSQLKKNIDKGLEFV------
MDHP_YEAST/146-337.NGSVVSIDTSV.LE..K.-LSPREEQLVN.TAVKELRKNIEKGKSFI------
LDH_MYCHY/146-315ANG.....IEKI.IE.IS.-LNDKEKEKFA.KSVAIIDKIYQDAIKNI------
MDH_PHOPR/147-310KDG.....VEEV.IDYGK.-LSTFEQEALN.NMLDTLTSDITLGEEFA------
LDH_LACPE/149-317GTG.....LKQI.IE.SP.-LSADELKKMQ.DSAATLKKVLNDGLAEL------
MDHC_ECHGR/156-331.DG.....HYKV.VDGLS.-MDEWSRSLFN.LSADELVDEREVALASF------
LDHP_BACPS/149-318RNG.....IREI.VE.LT.-LNEQERQQFK.HSANVLKEILAPNFKEQ------
LDH_THEMA/142-311KHG.....VERI.LE.LN.-LNEEELEAFR.KSASILKNAINEITAEE------
MDHP_MAIZE/241-413GDG.....DYEL.ASDVL.-MDDFLWERIK.KSEAELLAEKKCVAHLT------
MDHG_CITLA/190-354RNG.....IEEV.YSLGP.-LNEYERIGLE.KAKKELAGSIEKGVSFI------
MDHM_CITLA/180-344KNG.....VESV.LDLGP.-LSDFEKEGLE.KLKPELKASIEKGIQFA------
MDHM_YEAST/165-331PDG.....IEKI.HPIGE.-LSSEEEEMLQ.KCKETLKKNIEKGVNFV------
MDH_ECOLI/147-310KNG.....VEER.KSIGT.-LSAFEQNALE.GMLDTLKKDIALGEEFV------
MDH_THETH/156-325.DG.....AYRV.VEGLE.-INEFARKRME.ITAQELLDEMEQVKALG------

PF11975

CHBF_ECOLI/192-415RDGATPHPRITHFDDKVMG.LIHTIKGFEIAASNAALSGEFNDVLLALNLSPLV
MALH_FUSMR/189-416SNGPEP.LVVGRIPQFQKG.MMEQQVTVEKLTVEAWIEGSYQKLWQAITMSKTV
GLVA_BACSU/191-417SNGPEP.ITVGTIPQFQKG.LMEQQVSVEKLTVEAWAEKSFQKLWQALILSKTV
LICH_BACSU/191-412KTGPKP.IAVGDLPVSVRG.LVQQIKSFERVAAEAAVTGDYQTALLAMTINPLV
AGLA_THEMA/192-451KNGIHPEKIEPPLPDRVVKYYLRPRIMRMEMALEAFLTGDIRIIKELLYRDPRT
AGAL_ECOLI/192-421ANGIQP.TKVGTLPSHLAA.LMQTNINVQTLLTEAILTENRDRVYHAAMMDPHT
LPLD_BACSU/199-425RNRVQP.ILSGALPKGVEM.LAARHISNQEAVADAGLTKDTGLAFQAFLNDPLV
AGAL_BACSU/188-404RKKITP.CFAGELPEQLAA.LNRTNINTQLMTIEAAVTRKKEAVYQAAMLDPHT

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window