Sequence alignment for CL0342

PF03783

Q3ID64_PSEHT/43-256KNLPKPMGSIPVSVYSF..RDQTG.......QYKPQTNVSSFS-TAVTQ---------------------GANSILIQAL
O67219_AQUAE/42-258ELPKCDRPIGTIVARGF..KCKAAQCAGDRIVFGPNYTVEVSP-KVLGD---------------------GLSDMLVTAL
Q484M1_COLP3/44-233TADQTKYLKRKVAIGRF..TNETT........YGQSFFIDSDN-NRIGK---------------------QAMDILSSKL
F2G3K7_ALTMD/43-253KSLPAPMGQIPVSVYAF..RDQTG.......QYKPSTGASSFS-TAVTQ---------------------GATSILVQTL
Q12QL7_SHEDO/43-252QAKPGPKYAIPVAVYSF..RDQTG.......QYKPQANVSSFS-TAVTQ---------------------GATSMLVQTL
Q2JNZ2_SYNJB/52-260GQAPQPTSRPRIAVLDFDFSSLSN...............PYSF-REASR---------------------GVSDLLVDRL
A1BH58_CHLPD/18-218VSEGLAQEKPRIGVLRF..TNNTY.......A.......TWWR-GGVGT---------------------DLQDMLISEL
Q5QXH2_IDILO/43-251KQRQLPQTRIPVSVYAF..RDQTG.......QYKPQANVSSFS-TAVTQ---------------------GATSMLTQML
A5FHE8_FLAJ1/44-262KDLPKPKEQVVVGVYKF..RDQTG.......QYKPQENGSSFS-TAVTQ---------------------GATSILIKAL
P73111_SYNY3/31-246TLAAQAQGKPTISVPEF..KNDTNM.....SW.......WWWS-GNTSR---------------------ELADALSNEL
Q9A7M6_CAUCR/61-270TVTAFKCKASACSVAPAPGSNTGLGALMSMAQAAQG...LQTF-PNIGD---------------------GLSNALTTAL
Q21E38_SACD2/46-235QATKTLALKRKIAVGRL..SNETS........YGKSLLGSSKN-DVLGE---------------------KVSDMFVQSL
Q5E246_VIBF1/42-258ISLPKPQGKIFVSVYDF..RDQTG.......QYKPQPN.SNFS-TAVPQ---------------------GGTALLTMAL
CSGG_ECOLI/41-255.HLPAPTGKIFVSVYNI..QDETG.......QFKPYPA.SNFS-TAVPQ---------------------SATAMLVTAL
Q084E4_SHEFN/44-251.SLPSPQGSMVAAVYDF..RDQTG.......QYKPIPS.SNFS-TAVPQ---------------------SGTAFLAQAL
Q31MJ4_SYNE7/43-236...AQNQAKRRIAVLDFDFSNVSSP......SV......LSAF-PNVSK---------------------GVSDILVNRL
Q88H89_PSEPK/49-261..MPRPKGRLMAVVYGF..RDQTG.......QYKPTPA.SSFS-TSVTQ---------------------GAASMLMDAL
Q8YRU8_NOSS1/50-248.QSSSPSEKVRIAVLDF..DFSSVSN....PSY......LSLF-PAGSK---------------------GVSDILVNRL

PF13036

Q3SFY9_THIDA/15-198-----------VLGVVA...LLGGCASTG......SPVVGG.N.VQYGD..S..................KAVETVTNEF
A6Q5P2_NITSB/9-203-----------TTAAML...FFSGCA............TSSSQ.VRYINHEKA.................GTSAPASLGL
B3ETR9_AMOA5/12-191-----------LLFLTL...VSTEC..............GS...IKRIS..T..................SQVTDLSGRW
Q6MR79_BDEBA/32-210-----------VALSFL...AMTSCG...........PKAFVK.GQYDD..V..................NRENLLNDQW
Q6AQQ6_DESPS/10-192-----------AIAISL...GLTGC..............VQQK.TVRLQ..AD.................DLGEPMTTGL
B0SJE3_LEPBP/9-179-----------LLVG.....FLFQC..............SS.S.PKRLD..NA.................DDYISDSGGL
A1SWZ0_PSYIN/10-188-----------ALAVTF...ILTAC..............ST.S.VERID..A..................QEQIDLSGAW
E6W062_DESIS/11-189-----------LMTLTL...ILAGC..............SQ.K.VSRID..L..................EETRDLSGNW
LPOB_PROMH/7-192-----------VVAAVF...LLAGCPSM.......LPQQPPAP.VEPVT..PTE..............PTEPPKPIEPPI
Q0JYU2_CUPNH/3-193-----------ACGLAA...LLAGCLATA......PNTAGV.A.AMELD..VS.................RKGPVSGVGL
A5G8H5_GEOUR/11-189-----------LSIAAM...FLAGC..............ATTT.VQYGD..A..................GSAKPIGTDF
Q489B8_COLP3/10-189-----------VALTLT...LVAGCT............NKS.V.VRYGD..A..................TEVETTDISF
A7MFR9_CROS8/11-217-----------LATVAL...ALSGCILPGEQ.KPAPVEEAQ.PGTQQPT..QPVPQPTQP...VPTVPSVPSIPAQPGPI
Q3B6Q7_PELLD/9-191-----------ALAVAV...TMSGC..............AT.S.VQHID..TS.................NDRGKAVMGL
Q098T7_STIAD/8-189-----------SACLAA...SLTACGG.........PRAFT.R.GTYED..P..................NTIEMLSDRF
C9RQT0_FIBSS/10-191-----------CAGLAI....FSGCA...........SDGGKK.VTRLD..T..................NAVTDLSGSW
A0LBE2_MAGMM/8-196-----------FLATGA...LLAGC..............VSNA.VVSTN.....................PNSPSATGNL
A1WFI2_VEREI/13-199-----------ILALAAGTLALSACQGLS......SPTVRFDREVNYGD..A..................KAVELVTNEF
B2KBR6_ELUMP/7-185-----------VLMAAF...IFCAC..............ST.K.VERMD..A..................GTVKDLSGGW
A9EYZ5_SORC5/15-197-----------ALALAS...LPIGCG...........PTYV.R.GNQVE..G..................LDDAAMSTGI
A6VT68_MARMS/21-199-----------TLFMAV...LLTAC..............SG.S.VKRLD..T..................NEDVMLSDRW
Q11SM3_CYTH3/10-189-----------ITALIV...CTSGC..............KR.T.VARVE..P..................DKQIDLSGRW
Q2IJK4_ANADE/8-185-----------IAAAAL....AAACG...........PRAFTR.GAYQD..P..................NTIELLSDQF
A1WY34_HALHL/8-186-----------VLLVVV...ALVGC..............GH.S.VERID..R..................DEEYDLSGRW
C1DFX4_AZOVD/10-225-----------TCVSAI...LLTACSSHNGS.GGDRQAELDAA.IATASSGSGAAVASTS...SGDGPSPEHLAFLENGF
LPOB_PHOLL/7-188-----------VALSVM...FLAGC..............PSLP.PEQPE.....................PPTPVVPVTP
D1B294_SULD5/10-196-----------VLLGTL...LLSGC..............AR.Q.ATYVK..PTD...............VQSNEAVSLGI
Q0VKU2_ALCBS/9-185-----------MLGAAL...VLSGC..............ST...VDYGD..A..................QGRETVNTDF
B0ST18_LEPBP/7-177-----------FLLFSF...FIVSC..............ST.A.TSYTK..P...................ENVKATKQW
Q3IL02_PSEHT/16-195-----------IGLSAL...VLSGCA............NKA.V.VSYGD..A..................QAVETTDINF
D3UIZ9_HELM1/11-192-----------IFALAF...MLAGC..............GP.K.AMEVS.....................PDSKFVTMGL
A4SYG3_POLSQ/19-190-----------.........LLVAC..............SGPQ.VRYGD..A..................KQVETVNADY
LPOB_KLEP7/10-212-----------ITALAI...FLAGCAGLREQPAPVEEAKP............QPQQPAQPQPTVPTVPAVPSVPAQPGPI
B7VH52_VIBTL/9-185-----------.LGLAV...ILGGC..............SN.K.VSYGD..A..................QSVETTTIDF
C5BFM3_EDWI9/9-196-----------IALAAL...LLSGCQGLLQ....RGERPSQ.P.PAPTT.SAK.................PSVVPTPRPP
LPOB_DICD3/7-193-----------IVLMAL...VIAGCTS.........RVPQTEQ.P.......ATIEPA......VPTPSKPQLPPSESQP
E4PGL0_MARAH/14-201-----------.ALASG...FLSGCASKI......ENVQGK.P.SVYED..VS.................TTGSVGGVGI
F2K6Q3_PSEBN/9-189-----------.ALAAL...LVSGCANN.......SPVLGNKN.ISYGD..T..................KAVETVTNEF
M1FI84_9ALTE/9-189-----------.CVSMV...MLAGC..............AT.P.TRYID..PA.................ADDGAVTMTM
O25995_HELPY/13-200-----------VILSAL...LWVGC..............SSEM.ATYQN..VN.................DATKNTTASI
Q0PC46_CAMJE/11-196-----------.LIGAL...LFSGC..............AQ...TAYTD..GKAS.............QVKKGDALTLGL
Q32EW5_SHIDS/10-210-----------ITALAM...FLAGCVGQREP..APVEEVK...........PAPEQPAEPQQPVPTVPSVPTIPQQPGPI
Q5NES4_FRATT/12-191-----------.ASLAL...ALSSC..............GKTT.VAYED..P..................NGVDATSINF
Q6D676_PECAS/7-191-----------VILAAL...VLTGC..............PSRP.PEPTE..PPATIE........PVEPQVPTTPTPPPG
Q8EHZ4_SHEON/13-190-----------VLAAVM...GLAAC..............QS.K.VEYGD..A..................TEVETVNENF
W8U423_YEREN/7-192-----------VALAAL...VLTGC..............MTRP.PVEPT..PTP...............PVTIEPVTPPA

PF04052

TOLB_PELCD/21-131-----------AQVEIR---------------------------A.PGQ---------------------QTIAVANTQL
A5EXH2_DICNV/23-121-----------VVVDVS---------------------------G.AMR---------------------AAQPIAVLPI
Q4FSA5_PSYA2/29-127-----------VILELD---------------------------YEIPV---------------------QQNQVAFVPF
A0L4U9_MAGMM/33-145-----------MMIEVQ---------------------------K.QGL---------------------EPMPIAIPSF
TOLB_SHELP/23-128-----------LDIVIT---------------------------E.GVD---------------------AARPIAVVPF
TOLB_SHEFN/23-128-----------LDIVIT---------------------------E.GVD---------------------AARPIAVVPF
TOLB_SHEDO/23-128-----------LDIVIT---------------------------E.GVD---------------------AARPIAVVPF
TOLB_AERHH/23-127-----------LDIVIT---------------------------G.GID---------------------SARPIAVAPF
TOLB_PSEA6/23-127-----------LEIVIT---------------------------E.GID---------------------SARPIAIVPF
TOLB_IDILO/24-128-----------LEIVIT---------------------------E.GID---------------------TARPIAVVPF
TOLB_PSEHT/24-128-----------LEIVIT---------------------------E.GID---------------------GARPIAIVPF
TOLB_COLP3/24-128-----------LEIVIT---------------------------G.GVD---------------------SARPIAIIPF
TOLB_VIBF1/24-128-----------LELVIT---------------------------E.GID---------------------SARPIGIVPF
A1SSW4_PSYIN/22-127-----------LEILIT---------------------------E.GVN---------------------TARPIAVIPF
TOLB_ACTP2/28-129-----------VVISVD---------------------------E.GVS---------------------MAQPIAVVPF
TOLB_HAEDU/28-129-----------IVISVD---------------------------E.GVS---------------------IAQPIAVVPF
TOLB_ECOLI/23-127-----------VRIVID---------------------------S.GVD---------------------SGRPIGVVPF
TOLB_PHOLL/23-127-----------VRIEIT---------------------------Q.GVD---------------------SARPIGVVPF
TOLB_PASMU/26-129-----------VRIVID---------------------------E.GVD---------------------SARPIAVVPF
TOLB_MANSM/28-129-----------VRIVID---------------------------E.GVD---------------------GARPIAVVPF
TOLB_BLOFL/24-133-----------MKIEIT---------------------------H.GIN---------------------TAHPIAVIPF
TOLB_WIGBR/21-130-----------VDISIN---------------------------K.GID---------------------ISTPIGISSF
TOLB_THICR/23-128-----------LTIQID---------------------------Q.SSD---------------------NAVPIALVPF
TOLB_MARMS/24-128-----------LVIEIT---------------------------S.GAD---------------------QLLPIAVVPF
TOLB_SACD2/39-140-----------LVIEIT---------------------------Q.GAD---------------------NPTPIAVVPF
TOLB_CHRSD/24-125-----------LTIEIT---------------------------K.GSD---------------------QAIPIAIVPM
TOLB_HAHCH/21-126-----------LVIEID---------------------------K.GSR---------------------AAIPVAVVPF
A1U1B4_MARHV/36-139-----------LLIRIT---------------------------E.GAG---------------------SAIPIAVVPF
A4XRS6_PSEMY/23-126-----------DPLVIS---------------------------H.GAD---------------------RATPIAVVPF
C1DRF3_AZOVD/23-126-----------DPLVVT---------------------------S.GTA---------------------RATPIAVVPF
TOLB_ALCBS/30-132-----------LLIKVT---------------------------E.GRV---------------------DAVPIAVVPF
A1WZ69_HALHL/29-133-----------LVIDII---------------------------G.GIE---------------------GATPIAIVPF
TOLB_ALKEH/25-129-----------DIIDVI---------------------------G.GQE---------------------GAMPVAVIPF
TOLB_NITOC/30-133-----------LTIEIT---------------------------G.GTE---------------------AALPIAIVPF
TOLB_XANCP/27-132-----------LTIDIV---------------------------G.GSA---------------------SATPITVVPM
TOLB_METCA/26-127-----------LQVQIS---------------------------Q.GVE---------------------GAIPVAVVPF
A9C288_DELAS/41-141-----------FRVEVT---------------------------G.VGL---------------------TQLPIAIAAF
A1W6N8_ACISJ/43-143-----------FRVEIT---------------------------G.VGL---------------------TQLPIAIAPF
A1TSM5_ACIAC/38-138-----------FRVEIT---------------------------G.VGL---------------------TQLPTAIAPF
A1WGN1_VEREI/17-117-----------FRVEVT---------------------------G.VGL---------------------TQLPIALAPF
TOLB_RHOFT/25-125-----------FRVEVS---------------------------G.VGL---------------------TQLPIAVSAF
TOLB_POLSJ/27-127-----------FRVEVS---------------------------G.VGL---------------------TQLPIAIASF
A2SFG9_METPP/22-122-----------FRVEIS---------------------------G.VGA---------------------TQLPIAVVKF
A4G7Q1_HERAR/25-124-----------LRVEIA---------------------------G.VGA---------------------NQIPIAIAAF
TOLB_RALME/45-145-----------LNVEIT---------------------------G.VGS---------------------NQFPVATANF
TOLB_BURXL/28-128-----------LNVLVT---------------------------G.VGS---------------------TQFPIATANF
TOLB_BURPS/28-128-----------VNVLIT---------------------------G.VGS---------------------TQFPIATANF
TOLB_AZOSB/27-127-----------LSIEIT---------------------------G.AGA---------------------SRFPVIIPVF
TOLB_AROAE/27-127-----------LSIEIT---------------------------G.AGA---------------------TRFPVAIPLF
TOLB_DECAR/27-127-----------LSIEIT---------------------------G.AGA---------------------NRIPVTIVDF
TOLB_NITEU/24-124-----------LNIEIF---------------------------G.GGT---------------------NKIPIAIAPF
TOLB_NITMU/32-133-----------LNIEIF---------------------------G.GGA---------------------NQIPVAIVPF
A4SVI2_POLSQ/34-134-----------MNIEIT---------------------------G.VGQ---------------------SLYPIAVMRF
TOLB_CHRVO/26-128-----------LNIEII---------------------------G.GGA---------------------SRHAISVLPF
TOLB_METFK/28-133-----------LTVEIV---------------------------G.GAA---------------------QQIPIAVVPF
TOLB_THIDA/29-131-----------MEIEVV---------------------------G.GAA---------------------NKIAIAMVPF
TOLB_PARL1/38-141-----------LQIDIT---------------------------Q.GNV---------------------DPLPIAITDF
B0T057_CAUSK/36-138-----------IEVDID---------------------------K.GAV---------------------KPLPVAIPAF
TOLB_MAGSA/31-138-----------VRIDIT---------------------------R.GQM---------------------KPLPIAIPDF
TOLB_RHORT/33-140-----------LVIDIT---------------------------R.GVR---------------------EPMPIAIPVF
TOLB_BRADU/34-141-----------PRLRID---------------------------P.TEF---------------------QPVPIAITNF
TOLB_CHESB/30-133-----------VEIDVN---------------------------R.GVV---------------------EPVPIAITDF
TOLB_RHIEC/30-132-----------VELNIN---------------------------K.GNI---------------------QPLPIAVTDF
TOLB_RHILO/30-133-----------VELNVN---------------------------K.GNV---------------------EPLPIAITDF
A7IJU3_XANP2/44-146-----------PRIDLT---------------------------P.GAF---------------------KPIPIAITDL
Q0ALY5_MARMM/27-134-----------LRVDVT---------------------------Q.GNL---------------------DPMPIAVPDF
E0TDI8_PARBH/29-136-----------PLIDIV---------------------------G.GRT---------------------DPMPVALPAF
Q0C5V5_HYPNA/26-132-----------LQVRVD---------------------------E.GNF---------------------KPTPIAIPDF
B0U7W3_METS4/31-134-----------LNLRVG---------------------------SGGAF---------------------QPMPIAVADF
A5G2K7_ACICJ/55-161-----------DAINVS---------------------------G.AHN---------------------APIPIALPAF
Q0BT48_GRABC/51-150-----------AVIDVD---------------------------R.ART---------------------APIPIAIPSF
TOLB_DINSH/31-138-----------LRIEIT---------------------------E.GVI---------------------EPLPIAVPPF
TOLB_RUEST/28-134-----------LRIEIT---------------------------D.GVI---------------------EPLPFAVPDF
TOLB_RUEPO/26-132-----------LRITID---------------------------E.GII---------------------EPLPYAAPNF
A1AZV4_PARDP/48-153-----------LRIEIT---------------------------D.GVI---------------------EPMPFAIARF
TOLB_ROSDO/30-136-----------LRIEIT---------------------------E.GVI---------------------EPLPFALPVF
TOLB_JANSC/31-137-----------LRLEIT---------------------------E.GVI---------------------EPLPFALPTF
TOLB_SPHWW/23-136-----------LEVDIT---------------------------G.GIA---------------------QPMPIAIPGM
TOLB_RUTMC/20-119-----------LEVTIL---------------------------K.QDE---------------------NAFPIVISDF
TOLB_ACIAD/27-123-----------LHLEIA---------------------------K.APE---------------------QAPKIAIVPF
TOLB_ORITB/37-144-----------SSIKIT---------------------------K.GNC---------------------TQIPIAINFF
TOLB_RICPR/20-127-----------ETINIE---------------------------H.GRV---------------------DPTPIAVNKF
TOLB_COXBU/25-130-----------LDLELT---------------------------K.GVT---------------------AAIPIAIMPF
A0LGA1_SYNFM/45-154-----------FELDLT---------------------------N.PNF---------------------QRIAIAIPDF
B3E270_GEOLS/25-132-----------NYIEVT---------------------------A.AGN---------------------RLLKLAVVPP
A1AU95_PELPD/31-138-----------GYIEIT---------------------------A.PGN---------------------RQLRMAVDVP
A5GDC0_GEOUR/22-129-----------GYLEVT---------------------------A.PGN---------------------RQMQLAVAQP
A7H870_ANADF/28-134-----------PTLTIG---------------------------S.PSF---------------------QPLPIAVAQF
TOLB_ANADE/26-133-----------PTIVVG---------------------------S.PDF---------------------RPLPIAVAAF
TOLB_WOLSU/19-119-----------ATLEVV---------------------------K.KFA---------------------NMPSIIVEDS
TOLB_HELHP/20-117-----------ATLEIV---------------------------K.NTN---------------------KIPYIVVERL
Q2GJ56_ANAPZ/25-129-----------LRLSIT---------------------------K.GNT---------------------GKLSIAFAPL
A7ZC42_CAMC1/20-118-----------.TISVI---------------------------N.QGV---------------------ALPKIALQDA
TOLB_HISS2/28-126-----------VRIVID---------------------------E.GVD---------------------SARPIAIIPF
TOLB_VIBTL/24-127-----------LELVIT---------------------------D.GIN---------------------SARPIAIVPF
TOLB_SHEPW/23-126-----------LDIVIT---------------------------E.GVD---------------------AARPIAVVPF
B9KHU7_ANAMF/28-134-----------.GVDIT---------------------------K.GNT---------------------EKVKISVAPM
C5AV32_METEA/36-138-----------LQLRIG---------------------------S.GAF---------------------QPMPIAVADF
M1FG56_9ALTE/39-140-----------.LIRIT---------------------------E.GVD---------------------SALPIAVVPF
M9X4A4_MANHA/28-124-----------VRISID---------------------------E.GVS---------------------MAQPIAVVPF
TOLB_HAEIN/27-122-----------VRIVID---------------------------E.GVD---------------------GARPIAVVPF
TOLB_MYXXD/22-128-----------.TIEIS---------------------------G.ANF---------------------RPLPVAVPAP
TOLB_BRUA2/35-138-----------VEININ---------------------------K.GVI---------------------EPLPIAITDF
TOLB_RHOS4/31-136-----------LRIQIT---------------------------E.GVI---------------------EPLPFAVPDF
TOLB_NITWN/40-146-----------.RVQIT---------------------------E.GNV---------------------APLPIAIPNF
TOLB_PELUB/22-136-----------.EVDIT---------------------------R.GNL---------------------NPLPVAVSPL
TOLB_PHOPR/24-127-----------LELVIT---------------------------E.GID---------------------SARPIGIIPF
TOLB_VIBVY/24-127-----------LELIIT---------------------------D.GID---------------------SARPIAIVPF
TOLB_BORPE/38-138-----------LRVDIS---------------------------G.TGA---------------------TQYPVAIADF
TOLB_PSESM/25-127-----------.NILVT---------------------------S.GSD---------------------RAAPIAVVPF
TOLB_SHEON/23-127-----------LDIVIT---------------------------E.GVD---------------------AARPIAVMPF
TOLB_XYLFA/27-132-----------LTIDIV---------------------------G.GNT---------------------AATPIAVLPM
V6EXY5_9PROT/28-135-----------VRIDIT---------------------------R.GNM---------------------KPLPIAVPEL
W8U1X0_YEREN/23-122-----------VRIEIT---------------------------Q.GVD---------------------SARPIGVVPF

PF05643

Q1LCD0_RALME/11-212-----------GLGAVT---LFAGCAVP..T.KQIDYS------AYKAS---------------------RPRSIVVLPP
D3V518_XENBS/12-210-----------...LLL---TLTGCVQQ....KPYDYT------ALRES---------------------KPKSILVLPA
Q2SHH4_HAHCH/14-212-----------.SLTVV---LSTGCATQ....QPYDYS------ALLAS---------------------KPRSILVIPP
E0SD08_DICD3/9-210-----------SLMGVL---VLTGCAKP....QPYDYT------SFKQS---------------------KPRTILVLPP
Q887N9_PSESM/11-213-----------SLFAVA---LLSGCVTP...PPTVDYS------AFKES---------------------KPRSILVLPP
A7I3D9_CAMHC/9-212-----------PAFLAL---FFAGCAQP....KVYDYS------ALQSA---------------------KPKSILVLMP
S6BPX5_PSERE/11-212-----------CVALAV---MFAGCAEV....RTIDYS------AFKES---------------------RPRSVVVLPP
X2HCW4_9NEIS/9-212-----------SLAVTT---LLFACSTSHYQPQPHDYS------KFRQS---------------------DPHSILVLLP
Q0K4M2_CUPNH/11-212-----------LLGVAT---LAAGCAAP..T.KNVDYA------AFKES---------------------HPRSIVVLPP
Q6CYP8_PECAS/9-210-----------GLVFAL---VLTGCAKP....VPYDYT------SFKQS---------------------KPKSILVLPP
A9BNZ3_DELAS/11-211-----------ALAMTV---ALTGCATT....APYDYA------ALRAS---------------------KPASILVMPA
D3VLQ9_XENNA/12-210-----------...LLL---ALPGCVQH....KPYDYS------ALRES---------------------KPKSILVLPA
G8MBI9_9BURK/12-216-----------VLSILL---FLSACASS..R.SQPDYT------AFRNS---------------------KPRSILVLPP
V5UBV7_9BURK/13-214-----------..ALAA---AMTGCAVH..QAKPYDYT------AFKES---------------------KPKSILVLPP
Q7CJE6_YERPE/11-209-----------..MMAL---LLTGCATP....VATDYT------DFKQS---------------------KPKSILVLLP
W0LEC8_9ENTR/9-209-----------GAALVL---LLTGCAKK....APYDYA------AFHAS---------------------KPKSILVLPP
A3MYU4_ACTP2/7-208-----------LLSGIL---FLSGCAQQ..QKPSYDYS------ALKES---------------------KPKSILVLLP
A1WBC0_ACISJ/14-214-----------GAAVIL---LLSGCATP....QPYDYS------ALRQA---------------------KPQSILVLPP
Q4KAD7_PSEF5/11-212-----------GLLALS---LLVGCAAP....RSVDYS------AYKQA---------------------RPKSILVLPP
I0HUV3_RUBGI/17-218-----------AALAAA---ALGGCATT....APYDYS------AFKES---------------------RPASMLILPP
M5DUQ1_9GAMM/13-209-----------.LAATA---FVTGCANK....PPYNYE------ALLAA---------------------SPRSIVVIPP
B8F6X7_HAEPS/7-208-----------LLTSLI---LLAGCAKQ..KVDSYDYT------ELKNS---------------------KPKSILVVMP
B4EZI8_PROMH/10-209-----------.VAFAF---VLSGCAEP....VKTDYT------AFKAS---------------------KPKSILVLLP
Q8XS06_RALSO/13-216-----------..GVVA---LMAGCAAP..A.KHVDYA------AFKAS---------------------KPRSIVVLPP
Q7N0C6_PHOLL/9-209-----------SLLAAF---VLTGCSKS....VPYDYT------AFKES---------------------KPKSILVLPA
H2IYH4_RAHAC/9-209-----------GVVLTL---LLTGCAKK....ASYDYT------AFKES---------------------KPRSILVLPP
E6W7V9_PANSA/9-211-----------AVLTAL---LLTGCAPH..K.KPYDYS------AFRAS---------------------KPASILVLPA
D8J254_HERSS/11-214-----------AAMLVL---LATGCATQ..PQKPYDYA------EFKAA---------------------RPASILVLPP
M4XNX8_PSEDE/9-210-----------GLFALA---LLAGCAPQ....KTVDYS------AFKQS---------------------RPKSILVLPP
A8GBK2_SERP5/9-211-----------SIAVTL---LLSGCAKQ....TAYDYA------AFHES---------------------KPKSILVLPP
D8MNT7_ERWBE/9-208-----------AVLAVL---ALTGCAKK....TPYDYT------AFRAS---------------------KPASILVLPA
Q21SI9_RHOFT/14-214-----------..ASFL---VMTGCATK..A.PPFDYT------AYKES---------------------RPRSILILPP
F6AGD6_PSEF1/12-213-----------ALAAIA---LLAGCVTQ....QPYDYS------AFKES---------------------SPASILVLPP
C5AJP0_BURGB/13-221-----------.VALLA---MLAACAGP..V.QRLDYT------AFKRS---------------------QPKSILVLPP
B1Y7Y1_LEPCP/17-218-----------LACAAA---LLAGCATP....PTFDYT------AYRGS---------------------RPQSILVLPP
F4HEQ1_GALAU/9-210-----------ILVTTV---ILSGCATQ....KQYDYS------SFLQS---------------------KPRSILAVMP
B4E8N1_BURCJ/12-217-----------ALSIAA---LLSACAQP..V.QRPDYT------AFKKS---------------------QPRSILVLPP
C1D4H4_LARHH/10-211-----------IVVLSL---LMAACATK..P.VNYDYT------AYKAS---------------------KPKSILVLPP
Q63PN9_BURPS/16-221-----------AASVLA---LLAACAAP..A.KHVDYT------AFKKS---------------------QPRAILLLPP
E5AND7_BURRH/16-220-----------.GAMLA---LLAACAGP..N.QRPDYT------AFKRS---------------------QPRSILVLPP
Y1124_NEIMB/7-208-----------GLAAVL---ALSACQVQ..KAPDFDYT------SFKES---------------------KPASILVVPP

PF05211

F8KS85_HELBC/10-259A......GVSLVLAGCV---MDSGSNAESNGGKPN..QKSASVKKAVGD---------------------.IPLKFYYPV
HPAA_HELPY/13-258KKCLLGASVVALLVGC.---............SPHIIETNE........---------------------.VALKLNYHP
O25234_HELPY/14-271SKMLVALGLSSVLIGCA---MNPSAETKTPNDAKNQVQTHERMKTSSEH---------------------VTPLDFNYPI
K4RMR3_HELHE/10-260S......LAGLLITGCA---MDSGNTSNSNAGNANVPKKHKRVVLNKGD---------------------.TLLNFNYPI
O25166_HELPY/2-249KK.....GSLAIVLGSL---LASGAFYTALADGMPAKQQHN....NTGE---------------------SVELHFHYPI
F8KRD2_HELBC/14-268.......GVSLALSGCA---MDAGTKTSQA.......KKHATFQKNA..---------------------.TPLDFNYPI
E7AAG1_HELFC/14-275.......GISLVLSSCA---KDTGSTATNSQ......KKRAIADKKIKD---------------------STSLNFNYSI

PF03886

Q30ZW7_DESAG/36-191-----------YLLS..-----------------------------------------------------ADDVLPAAVP
Q1LFX2_RALME/21-179-----------YTL...-----------------------------------------------------DPDNTVERAS
A8GCL1_SERP5/25-179-----------YQLP..-----------------------------------------------------ALGSPAQVSG
Q6D463_PECAS/26-181-----------YQLP..-----------------------------------------------------TIADTSTAQT
A4XPV2_PSEMY/32-188-----------YQL...-----------------------------------------------------DSGDAVTPTK
Q5FP36_GLUOX/24-182-----------YTLG..-----------------------------------------------------APAIAQNSGT
Q2YQ49_BRUA2/33-193-----------FNLS..-----------------------------------------------------TPQPMVTVPK
Q8Y1T9_RALSO/34-193-----------HTLS..-----------------------------------------------------LRAAAPAPEA
Q15V64_PSEA6/27-193-----------YLLN..-----------------------------------------------------SDAPLITINN
Q3IC12_PSEHT/29-195-----------YQFE..-----------------------------------------------------QPIVASSRDV
B2JLP5_BURP8/35-193-----------YTLG.I-----------------------------------------------------DAQPTIAVST
Q1LQW2_RALME/27-187-----------YTLA.S-----------------------------------------------------TAAPAATPPT
Q12RG9_SHEDO/35-202-----------YVLT..-----------------------------------------------------SAAPPRLASN
Q2LY73_SYNAS/41-204-----------YTLT.P-----------------------------------------------------LEQQAAKPNP
Q6D6W6_PECAS/27-186-----------HTLL..-----------------------------------------------------APASPVATTA
A5G4U3_GEOUR/34-200-----------YTLA..-----------------------------------------------------PLETRSSQLP
B2JLL6_BURP8/44-202-----------YVIS..-----------------------------------------------------AMPPAAATTI
A1AL18_PELPD/32-193-----------YTLS..-----------------------------------------------------PLGPQAAKPP
A0LKZ6_SYNFM/33-196-----------YLLQ..-----------------------------------------------------SRVPPGMSGA
Q13YJ7_BURXL/36-194-----------YTLG.S-----------------------------------------------------SDAPIATRNA
A5G0A2_ACICJ/27-179-----------LALS..-----------------------------------------------------...PTSGPTF
C1DGP1_AZOVD/26-184-----------YTL...-----------------------------------------------------SAVAVADPAT
A6VZG3_MARMS/30-189-----------YLLM..-----------------------------------------------------DTGLHNTQVQ
Q98M02_RHILO/33-190-----------FELS..-----------------------------------------------------..APSVDAHG
Q2RRJ7_RHORT/36-194-----------YVLGQP-----------------------------------------------------QSVATAAPLG
Q1QVZ8_CHRSD/44-208-----------YTLP.D-----------------------------------------------------DPLSDDRAAA
Q1GM15_RUEST/25-182-----------YLI...-----------------------------------------------------AATPAERVKN
A1B5I4_PARDP/26-183-----------YLID..-----------------------------------------------------PPATGERVAD
Q5LU10_RUEPO/22-179-----------YLLP..-----------------------------------------------------EITGVETYRT
B2JP31_BURP8/35-193-----------YTLS.A-----------------------------------------------------DPSLERSSHP
Q7VVC7_BORPE/29-191-----------YTLQ..-----------------------------------------------------PPGATQAVQA
A0KPP1_AERHH/27-182-----------YSLD..-----------------------------------------------------AEAQQPAAVV
Q2IEA0_ANADE/30-187-----------YAL...-----------------------------------------------------EARAAAPPAG
Q5FRD2_GLUOX/34-193-----------YTL...-----------------------------------------------------APLPGVSQAG
B2JEG5_BURP8/31-189-----------YTL...-----------------------------------------------------SPDSTLESVG
B3EAR4_GEOLS/32-189-----------YTL...-----------------------------------------------------TPLVAEMTIP
Q082L0_SHEFN/33-191-----------FVL...-----------------------------------------------------TTMPSQMVSG
B2JWQ3_BURP8/37-194-----------YKLN..-----------------------------------------------------SVQPPENLDA
B2JKL2_BURP8/40-196-----------YDL...-----------------------------------------------------GPAPTPGSTG
Q7NV00_CHRVO/26-184-----------YGLD..-----------------------------------------------------APAAPQAQAQ
Q0BS49_GRABC/26-184-----------YTLS..-----------------------------------------------------AQESRAPAPE
B2JGI0_BURP8/37-192-----------YTLSAG-----------------------------------------------------DASPDAVRSA
Q3J7M0_NITOC/28-188-----------YSLT..-----------------------------------------------------TPPAGTTPPS
Q87N56_VIBPA/29-189-----------YLLP..-----------------------------------------------------KAETKTSNQM
A7IMU5_XANP2/47-206-----------YNLS..-----------------------------------------------------..APSGFTAG
Q60BV1_METCA/32-192-----------YVLS.A-----------------------------------------------------VQEPARALAG
Q7N608_PHOLL/25-180-----------YQLP..-----------------------------------------------------VVAIASQKSA
Q0BVR3_GRABC/46-207-----------FTL...-----------------------------------------------------....ATVPPA
A4XP77_PSEMY/28-187-----------YLLP..-----------------------------------------------------...AAQLPAQ
Q1MPH9_LAWIP/28-190-----------YVLQ..-----------------------------------------------------PSIKLTQLLT
A9CIT8_AGRFC/35-194-----------FDLS..-----------------------------------------------------VSSAAVTQGP
Q21EW6_SACD2/50-209-----------FSL...-----------------------------------------------------FPAQSVTPIA
Q2KZJ1_BORA1/28-186-----------YTL...-----------------------------------------------------QAPPAATPIK
C1DFS0_AZOVD/30-187-----------YRL...-----------------------------------------------------DSGNPETPER
Q4K7Z6_PSEF5/25-185-----------YTLL..-----------------------------------------------------PPVAEGSSAA
B2FMQ9_STRMK/34-197-----------.TLY..-----------------------------------------------------SPAVQVKADP
B4EE37_BURCJ/32-191-----------YTL...-----------------------------------------------------SPADAAAPLR
F2KBG9_PSEBN/29-184-----------YQL...-----------------------------------------------------DSGTPAQPAQ
Q32HV4_SHIDS/21-175-----------YQLP..-----------------------------------------------------VVQSGTQSTA
Q5ZZ43_LEGPH/74-232-----------YLLT..-----------------------------------------------------PIPPQKNSRN
Q63QZ4_BURPS/39-198-----------YTLDAA-----------------------------------------------------AAAGAAASVS
Q6LI49_PHOPR/28-187-----------YLLP..-----------------------------------------------------TGVQSTTSQI
Q726I0_DESVH/33-194-----------YSLL.A-----------------------------------------------------EAGQRPSAAP
Q87VH7_PSESM/30-185-----------YQL...-----------------------------------------------------DSGEPGQPKQ
Q880H8_PSESM/27-191-----------YTLI..-----------------------------------------------------APMGATGSAA
Q8PCT0_XANCP/37-195-----------......-----------------------------------------------------.PTVRVTPNP
Q92K95_RHIME/41-197-----------.SL...-----------------------------------------------------ASVPAVERPG
Q9HUK2_PSEAE/30-186-----------YQL...-----------------------------------------------------DVGAAAVPKK
Q9KR87_VIBCH/27-185-----------YLLP.N-----------------------------------------------------NPELSEHIQP
W8U487_YEREN/25-179-----------YQLP..-----------------------------------------------------ALSAPAGATS

PF03783

Q3ID64_PSEHT/43-256HES-------DWFTPVEREGLQNILTERKIIRAAQSE.....NPNQADL-PPL--TTAKI--ILEGGII-SYDT--NVKT
O67219_AQUAE/42-258VKT-------GCFRVLERETLQEIKEELEMLG.............VQPK-KAL--KGADF--LLTGSIT-ALEM--KASG
Q484M1_COLP3/44-233FET-------GKFIMLERADLSKIEKELSM...............SGSS-ALK--NAADF--IIVGSIT-EFGR--KE..
F2G3K7_ALTMD/43-253SET-------SWFLPVEREGLQNILTERKIIRADES........NGSEL-PPL--TTARI--IIEGGII-SYDT--NIRT
Q12QL7_SHEDO/43-252LDS-------KWFTPVEREGLQNLLTERKISAKQGSK.........EDM-PGL--SDARL--LLEGGII-SYET--NTST
Q2JNZ2_SYNJB/52-260VRD-------GTFSVIERSRLDAILAEQNLGLSGRLD.....ANTAAQV-GRI--LGVDA--VILGSVT-QFDV--SVRR
A1BH58_CHLPD/18-218AST-------NSFRVLERNELDAVIREQDLGASGRIN.....PGTRSKL-GKI--TGAKY--LVAATVS-AFEH--NTSG
Q5QXH2_IDILO/43-251LES-------GWFLPMERENLQNLLTERKIYNSG..........DNKEL-PPL--SEARL--LLEGGII-SYDT--NVST
A5FHE8_FLAJ1/44-262EDS-------KWFIPIERENIGNLLQERNLIRATRQEYVKNANPNEPQL-TPL--LYAGV--LLEGGIV-SYDS--NIIT
P73111_SYNY3/31-246TST-------GNFQVVERQNLGSVLSEQELAELGLTR.....PETSAQR-GQL--TGAQY--IVLGRVT-AYEE--GVSS
Q9A7M6_CAUCR/61-270KTT-------GCFKVMAREDFEDLRREAEA...............AGIT-LKS--ASADY--LVTGAIT-SLAV--GAKT
Q21E38_SACD2/46-235ANS-------GNYLIFERPDLELLENEARL...............TGET-VNL--IGVDT--LVIGSLT-QFGR--NT..
Q5E246_VIBF1/42-258LDS-------EWFYPLERQGLQNLLTERKIIRAAQKKQE.SISNHGSTL-PSL--LSANV--MIEGGIV-AYDS--NIKT
CSGG_ECOLI/41-255KDS-------RWFIPLERQGLQNLLNERKIIRAAQENGTVAIN.NRIPL-QSL--TAANI--MVEGSII-GYES--NVKS
Q084E4_SHEFN/44-251NDS-------AWFVPVEREGLQNLLTERKIVRAGLNG.......DASKL-PQL--NSAQI--LMEGGIV-AYDT--NIKT
Q31MJ4_SYNE7/43-236VKD-------GTYTLIERSRIDAVLNEQNLGASGRID.....PSTAAQI-GKI--LGVDA--VIIGSVT-RLDL--QTRQ
Q88H89_PSEPK/49-261SAS-------GWFVVLEREGLQNLLTERKIIRASQKKPD.VAENIMGEL-PPL--QAANL--MLEGGII-AYDT--NVRS
Q8YRU8_NOSS1/50-248VKS-------GNFVVVERSQLEAILREQDLGDSGRVD.....ASTAAKI-GRI--LGVEA--VVIGSVT-QFDV--QQRR

PF13036

Q3SFY9_THIDA/15-198GST........DLQTIAESMTRSLLQSQVI.....AR--------GGR.-.PL..VTVAD..VKNKTSE.YIDT..RSVT
A6Q5P2_NITSB/9-203DYE........DINTAAQKLINSMLKSPYLDKLYRIK--------MRKE-GKPLILMISD..FTNDTTQ.RLDI..DQIV
B3ETR9_AMOA5/12-191NDT........DARLVAEEMTQDVIKRPWRPSFISIY--------QRQ.-.PI..LVVGD..ILNKSHE.HIDA..EPFI
Q6MR79_BDEBA/32-210SET........DMQKAVQDLVASLMTSPSI......N--------GAKK-MPV..VMVTG..LQNKTSE.HIDT..QSIM
Q6AQQ6_DESPS/10-192SNR........DFEIAANHTIQSMLGSGAV...APVN--------GKK.-.NI..LVISH..ILNDTMQ.RIDT..DQLI
B0SJE3_LEPBP/9-179TSQ........ELVKAAEKLAGQI......GEYFKEN--------PHEE-GVF..VAHFP..TRNDTSE.QIQT..ELFD
A1SWZ0_PSYIN/10-188NDT........DSQLVAREMIDDSLSRPWIVQFVTQT--------GKD.-.PA..VIVGS..VKNLSHE.HINT..NTFV
E6W062_DESIS/11-189NDT........DSRLVSREMVGDVLSQRWLPNFVESN--------NRQ.-.PT..VIVGS..MRNLSHE.HINM..RTFI
LPOB_PROMH/7-192EVV........PTPPKITSINWNAAIQPLIREMSVTD--------DLAT-GKL..LVVDN..VKNNSGG.NIQA..VNAT
Q0JYU2_CUPNH/3-193DGH........DIVAMADQMMRDILAQPRF..APGKD--------GKRP-RIA..LDSAN..FINDSSQ.PLDR..QLIV
A5G8H5_GEOUR/11-189GSS........DLQQIAEAMVDSLITFPPVAEQTSQR--------R...-.PV..LSVDK..VKNKTMQ.HIDT..ESVT
Q489B8_COLP3/10-189GST........DLQKVAGDMTDSLLVSPVVGTLTANT--------R...-.PI..MFVES..IKNKTSE.HIDT..ESIT
A7MFR9_CROS8/11-217EHQPE....NATPEPKARTYDWNSAMAPMVGKMLQAD--------GVNA-GSV..LLVDS..VNNRTNG.SMQT..GPAT
Q3B6Q7_PELLD/9-191DYR........DFQTAAAEAVGSMLQSGAL...NKRD--------GGR.-.YV..LVVSR..VINDTMQ.RIDT..DQLV
Q098T7_STIAD/8-189NEN........DLQLIAKKMAESLANTPRFAQATAQP--------L...-.PI..VLVGK..LKNSTSE.HVDM..RSLA
C9RQT0_FIBSS/10-191NDT........DSRLVAEEMINDCLSRPWYNDFASQK--------GSV.-.PT..IVIGK..VRNKSHE.HIRV..ETFI
A0LBE2_MAGMM/8-196DGYESFSITSIDLGYAANKAVQQFLEAPES...IKPG--------GGR.-.YV..IVVDQ..VVNDTLN.NFDI..RRLT
A1WFI2_VEREI/13-199GST........DLQMIAEKMTGGLLETGIFQGR....--------....-.PT..VTIST..VKNKTSE.YIDT..TNVM
B2KBR6_ELUMP/7-185NDT........DSQMVAEEMISDCLSRVWYNRFLTSK--------GKE.-.PT..IIVGT..VNNQSME.HINT..DTFI
A9EYZ5_SORC5/15-197DRR........DIEQLLHENLTSLMASPV.AKAWAHD--------GSR.-.PT..LAIYP..LSNQTSE.HIDSQLQALL
A6VT68_MARMS/21-199NDT........DSRLVAEEMMSDMLTFPWFRDYNFNK--------KGN.-.PT..VIVQS..IRNKTSE.HIPV..DTFI
Q11SM3_CYTH3/10-189NDV........DSKLTAEAMTQQALGEIWLENFVKNN--------DGK.-QPV..VIIGM..VTNKSHE.HIEA..ETFI
Q2IJK4_ANADE/8-185NEN........DLQLIAKKMTGSLLGAPAVQALPGR.--------....-.PV..LVVGR..VRNKTSE.HIDT..ESLA
A1WY34_HALHL/8-186NDQ........DSRLVAEEMIADALDRPWLRDFRREE--------GAR.-.PT..VIVGD..VRNLSHE.HINT..RTFV
C1DFX4_AZOVD/10-225LDQ........DVAAIAARMSDDIPNSPRL....SRP--------GTTQ-NQI..LVDQQ..YIDVQEGATLNK..SAFA
LPOB_PHOLL/7-188SEKPTPPSEKVPEPPKMSAIDWESTVQPLVEQLVKAH--------GLEN-AKL..LLVDT..VKNNTNG.ALQT..MQAT
D1B294_SULD5/10-196DEV........DIEKAVAEAVQSMLKNPYL...MKND--------GRQ.-.YV..VAIST..VINDTMQ.RFDT..DLLT
Q0VKU2_ALCBS/9-185GST........DLQMIASKMVDDMLVFPPIVQMTQSR--------R...-.PV..VFVDR..IKNKTTE.HVDT..ESIT
B0ST18_LEPBP/7-177GVV........EVKETVKSMSHSLSV..YYKTELKT.--------....-.GY..FEWSP..LQNSTSE.HIDT..KLIT
Q3IL02_PSEHT/16-195GST........DLQKVASQMTDSLLSSPVVGTMTANK--------R...-.PV..VFVER..IKNKTSE.HIDT..ESIT
D3UIZ9_HELM1/11-192DYE........NLKKVMQDMIESLMQDPYVQKIKTSN--------P...-.RV..VAISD..IINDTTQ.KIDV..ESLS
A4SYG3_POLSQ/19-190GST........DLQMIAEAMTRSLLQSKAI....SGS--------KDA.-.PI..VTLAD..VKNKTSE.YIDT..RVIT
LPOB_KLEP7/10-212EHQDQ...QSGQPAPRVRHYDWNGAVQPLVGQMLQAS--------GVNA-GSI..LLVDS..VNNRTNG.SLNA..GEAT
B7VH52_VIBTL/9-185GST........DLQTIAGEMVDSMMASGSVSYITRDQ--------R...-.PI..VFVER..IKNKTSE.HIDT..ESIT
C5BFM3_EDWI9/9-196VVTP......VPQPPKMSSLDWQGSFAPLIDQLLSAQ--------GGET-GSI..LLVDG..VQNKTNG.QLGM..ANAS
LPOB_DICD3/7-193LPT........PPKIQVPVLDWSAAVTPLVGQMVKTD--------GIAR-GSI..LLLNK..LKNNTNG.SLQT..AQAT
E4PGL0_MARAH/14-201ESQ........DVVAMTDQMMRDMLANPMLTGR....--------..ST-PPR..IIIDNEYIKNESTS.VINT..NMLT
F2K6Q3_PSEBN/9-189GST........DLQMIAESMTRSLAQSGIL.......--------QGR.-.PV..VQVYD..VKNKTSE.YIDT..REIT
M1FI84_9ALTE/9-189DYR........DFEKAATEAVDDMLASGAV...SKPN--------GER.-.YI..MVVSR..VTNDTMQ.RIDT..DQLT
O25995_HELPY/13-200NST........DLLLTANAMLDSMFSDPNFEQLKGK.--------....-.HL..IEVSD..VINDTTQPNLDM..NLLT
Q0PC46_CAMJE/11-196DRQ........DFESAAETMINSMLSDPAFANI..KP--------GTR.-.KV..IAIGR..VVNDTPQ.RIDT..EKLT
Q32EW5_SHIDS/10-210EHEDQ....TAPPAPHIRHYDWNGAMQPMVSKMLGAD--------GVTA-GSV..LLVDS..VNNRTNG.SLNA..AEAT
Q5NES4_FRATT/12-191SST........YLQAITNKMAEDMLNSPAVKRITAMD--------T...-.PT..LFFSN..IRNETRE.HINT..TMLS
Q6D676_PECAS/7-191ESV........PQLPKIQTLNWEASINPLVAQMLKAD--------GVTP-GSI..LLVDS..VKNNTNG.SLTI..AKAT
Q8EHZ4_SHEON/13-190GST........DLQAIAAKMVDSMMTFPPIVAITANN--------R...-.PI..LFVDS..IKNKTSE.HIDT..ESVT
W8U423_YEREN/7-192IETPPAVDNVPPPPKMQQSIDWAASVEPLVAQMVNSN--------EVAN-GSI..LLLDS..VKNNTNG.ALQM..AQAT

PF04052

TOLB_PELCD/21-131VPL------------------------------------------SGTP-........LP--AIAAELH-------DVMA
A5EXH2_DICNV/23-121Q..------------------------------------------....-.........G--DPGVKME-------FIIA
Q4FSA5_PSYA2/29-127A..------------------------------------------....-..........--.GDSVLS-------PIIV
A0L4U9_MAGMM/33-145ASV------------------------------------------GLNG-HV....EVGD--RFSHQLT-------GLVI
TOLB_SHELP/23-128VWQ------------------------------------------GST.-..........--PMPQQIS-------DVVM
TOLB_SHEFN/23-128VWQ------------------------------------------GQG.-..........--PAPASIS-------DVVA
TOLB_SHEDO/23-128VWE------------------------------------------GPG.-..........--AAPQQIS-------DIVM
TOLB_AERHH/23-127KWE------------------------------------------GNG.-..........--QLPQDIA-------EVVS
TOLB_PSEA6/23-127KWN------------------------------------------GPG.-..........--QMPESLS-------EVVS
TOLB_IDILO/24-128QWK------------------------------------------GEG.-..........--KAPNELT-------DVIA
TOLB_PSEHT/24-128KYQ------------------------------------------GIG.-..........--PIPQKIS-------EVIA
TOLB_COLP3/24-128NWT------------------------------------------GTG.-..........--ERPELLS-------KVIS
TOLB_VIBF1/24-128KWH------------------------------------------GEG.-..........--KLPQDIS-------AIIS
A1SSW4_PSYIN/22-127KWL------------------------------------------GDG.-..........--EKPGNFS-------EIIA
TOLB_ACTP2/28-129KAN------------------------------------------G...-..........--GVPADVG-------QIIA
TOLB_HAEDU/28-129KVN------------------------------------------G...-..........--GVSEDVG-------QVVA
TOLB_ECOLI/23-127QWA------------------------------------------GPG.-..........--AAPEDIG-------GIVA
TOLB_PHOLL/23-127KWT------------------------------------------GAG.-..........--NAPEEIG-------AIVG
TOLB_PASMU/26-129KWN------------------------------------------GPG.-..........--SAPADIA-------DIIA
TOLB_MANSM/28-129KTN------------------------------------------G...-..........--SVPADIA-------EIVT
TOLB_BLOFL/24-133INN------------------------------------------ENIT-H.....ELNN--DNIEDIA-------SIIA
TOLB_WIGBR/21-130EWV------------------------------------------EVN.-........EN--NNYENIS-------KIIS
TOLB_THICR/23-128EWK------------------------------------------GAQ.-.........L--HPPQNIT-------SIVG
TOLB_MARMS/24-128GYE------------------------------------------GVD.-..........--ALPEDIA-------QIVE
TOLB_SACD2/39-140GGN------------------------------------------GGL.-..........--..SENVS-------RIIS
TOLB_CHRSD/24-125ANG------------------------------------------DDL.-..........--..PENVS-------RIVS
TOLB_HAHCH/21-126ANE------------------------------------------SGQ.-..........--PLAEDIG-------QIFT
A1U1B4_MARHV/36-139AES------------------------------------------GSM.-..........--PAGDKVG-------SIVQ
A4XRS6_PSEMY/23-126GWQ------------------------------------------GGS.-..........--VLPEDMS-------QIIG
C1DRF3_AZOVD/23-126GWQ------------------------------------------GGS.-..........--VMSDDMA-------EIVG
TOLB_ALCBS/30-132DGA------------------------------------------KNA.-..........--..EEDVS-------AIVQ
A1WZ69_HALHL/29-133QRA------------------------------------------EGA.-..........--DPETELA-------PIIT
TOLB_ALKEH/25-129AVT------------------------------------------GEI.-.........P--TPDQDIA-------RVIS
TOLB_NITOC/30-133QNE------------------------------------------GST.-..........--.PPENVA-------AVIA
TOLB_XANCP/27-132PYQ------------------------------------------GSG.-.........T--APQTDVS-------AVVS
TOLB_METCA/26-127ANQ------------------------------------------GSL.-..........--..SDSLS-------QIVS
A9C288_DELAS/41-141KGE------------------------------------------GQA.-..........--..PQKIS-------AIIQ
A1W6N8_ACISJ/43-143RGE------------------------------------------PQS.-..........--..PQKIS-------AIVQ
A1TSM5_ACIAC/38-138RGE------------------------------------------AGA.-..........--..PQKIS-------AIVQ
A1WGN1_VEREI/17-117RGQ------------------------------------------AQA.-..........--..PQKMA-------AIVQ
TOLB_RHOFT/25-125RGQ------------------------------------------DSV.-..........--..PQKIA-------AIVQ
TOLB_POLSJ/27-127RGE------------------------------------------VQA.-..........--..PQKIG-------NIVR
A2SFG9_METPP/22-122RDE------------------------------------------EKA.-..........--..PQPVG-------AIVR
A4G7Q1_HERAR/25-124GDE------------------------------------------SIA.-..........--..PHQVS-------AIIK
TOLB_RALME/45-145QGE------------------------------------------AQA.-..........--..PQNLT-------AIIR
TOLB_BURXL/28-128ANE------------------------------------------ANS.-..........--..PQQVS-------TIVR
TOLB_BURPS/28-128VNE------------------------------------------ASL.-..........--..PQQVT-------SVVR
TOLB_AZOSB/27-127ENE------------------------------------------ASL.-..........--..PRSVS-------DIVR
TOLB_AROAE/27-127ENE------------------------------------------GSL.-..........--..PRGIT-------DVVR
TOLB_DECAR/27-127PGD------------------------------------------PTA.-..........--..ARVVT-------ATVR
TOLB_NITEU/24-124NGE------------------------------------------RGL.-..........--..PQSIS-------AIVS
TOLB_NITMU/32-133SGE------------------------------------------EGL.-..........--.GAQSLT-------PVIS
A4SVI2_POLSQ/34-134KDE------------------------------------------NKL.-..........--..PTNIT-------EIIR
TOLB_CHRVO/26-128KDE------------------------------------------GPT.-..........--..QGNLT-------PVIR
TOLB_METFK/28-133AQQ------------------------------------------GVI.-.........P--GQQDTIA-------NVIG
TOLB_THIDA/29-131QTA------------------------------------------AGQ.-..........--.PSPPLT-------QIVA
TOLB_PARL1/38-141VGE------------------------------------------GSV.-..........--..GADMS-------AVIS
B0T057_CAUSK/36-138SGG------------------------------------------G...-..........--.RGADIA-------QVIS
TOLB_MAGSA/31-138AGA------------------------------------------SAQ.-........DN--RMGADIA-------RVVS
TOLB_RHORT/33-140GGT------------------------------------------DAQ.-........SS--AMGRDVV-------GVVS
TOLB_BRADU/34-141LPG------------------------------------------SPS.-........DG--DVGNGVT-------QVIT
TOLB_CHESB/30-133LSA------------------------------------------GGR.-..........--..GAEIS-------AVIA
TOLB_RHIEC/30-132LQG------------------------------------------DM..-..........--..GAQVS-------QVIA
TOLB_RHILO/30-133QGG------------------------------------------DAL.-..........--..GAQIS-------QIVT
A7IJU3_XANP2/44-146LGE------------------------------------------VEI.-..........--..GRNIS-------GVIT
Q0ALY5_MARMM/27-134VGA------------------------------------------SDE.-........AL--RRGADIT-------RVVA
E0TDI8_PARBH/29-136IAT------------------------------------------GEG.-........AE--RVSADLS-------EVIR
Q0C5V5_HYPNA/26-132QVT------------------------------------------GAN.-.........T--EIARQIT-------EVVR
B0U7W3_METS4/31-134AGD------------------------------------------PSL.-..........--..APLVS-------GIVA
A5G2K7_ACICJ/55-161TDA------------------------------------------SGN.-........TS--DIGAQIT-------QVVT
Q0BT48_GRABC/51-150GGG------------------------------------------SQL.-..........--..AQDMA-------GVIA
TOLB_DINSH/31-138LAE------------------------------------------TPA.-........AS--QFARDIA-------QVVA
TOLB_RUEST/28-134IAD------------------------------------------TPA.-........AA--QYATDIA-------RVIA
TOLB_RUEPO/26-132VPD------------------------------------------SPA.-........AA--EYAAEIA-------RVLA
A1AZV4_PARDP/48-153.HD------------------------------------------EGG.-........AG--EYLAQVQ-------NLIA
TOLB_ROSDO/30-136EAE------------------------------------------TAD.-........AA--DVAAQIT-------QVIA
TOLB_JANSC/31-137LA.------------------------------------------VGG.-........AE--DAAADVS-------RVIA
TOLB_SPHWW/23-136PTP------------------------------------------AVAN-TP...AGDTA--ALGQRVA-------DVVT
TOLB_RUTMC/20-119SVI------------------------------------------GDA.-..........--NQGKIIA-------HVIR
TOLB_ACIAD/27-123...------------------------------------------....-..........--GNDQSIF-------PIVE
TOLB_ORITB/37-144SAK------------------------------------------SNE.-........EH--DLSQNIV-------SIIS
TOLB_RICPR/20-127NAD------------------------------------------SSN.-........ND--LVGRDVV-------KVIS
TOLB_COXBU/25-130AGP------------------------------------------SVL.-.........A--PGDETIP-------QVIK
A0LGA1_SYNFM/45-154KRQ------------------------------------------SSE.-........QT--QLAREMG-------ETLA
B3E270_GEOLS/25-132QPM------------------------------------------GTVI-........RP--ELANETA-------ELHA
A1AU95_PELPD/31-138RSL------------------------------------------EAAS-........SP--EKAREMG-------EVIA
A5GDC0_GEOUR/22-129VSL------------------------------------------FGGP-........SA--DIAKGIS-------EVFS
A7H870_ANADF/28-134QGE------------------------------------------GGD.-..........--ARAAGVT-------EVVR
TOLB_ANADE/26-133QGE------------------------------------------GDA.-.........G--AAATQTA-------EVVR
TOLB_WOLSU/19-119STR------------------------------------------EVE.-.........R--GLTLRVY-------KMLV
TOLB_HELHP/20-117DSE------------------------------------------NAD.-..........--.FGAKVL-------KMLA
Q2GJ56_ANAPZ/25-129HSF------------------------------------------ESNL-........AQ--KIGESCT-------DIIL
A7ZC42_CAMC1/20-118TTA------------------------------------------VSD.-.........A--GFRDKFF-------KIML
TOLB_HISS2/28-126KWN------------------------------------------GSD.-..........--SMPIDVA-------DIIS
TOLB_VIBTL/24-127RWE------------------------------------------GAG.-..........--PLPHDVS-------AVIA
TOLB_SHEPW/23-126VWQ------------------------------------------GTG.-..........--PMPSQIS-------DVVM
B9KHU7_ANAMF/28-134HSS------------------------------------------TNL.-........EK--EIGKSCI-------RVML
C5AV32_METEA/36-138AGD------------------------------------------ASL.-..........--..GTLVA-------SVIT
M1FG56_9ALTE/39-140AES------------------------------------------GAI.-..........--PPGDTLA-------DIVQ
M9X4A4_MANHA/28-124KAS------------------------------------------G...-..........--.VPADVA-------QIIS
TOLB_HAEIN/27-122V..------------------------------------------GSA.-..........--..PEDIS-------KIVA
TOLB_MYXXD/22-128LTQ------------------------------------------NDG.-........AK--ALVAPFD-------SAFS
TOLB_BRUA2/35-138LSA------------------------------------------DQL.-..........--..GSNIT-------SVIA
TOLB_RHOS4/31-136VAE------------------------------------------NAG.-........AS--ELARDMA-------RVIA
TOLB_NITWN/40-146VGG------------------------------------------TPS.-........DN--EVGAGVA-------KVIT
TOLB_PELUB/22-136SID------------------------------------------NKSK-ENFKKILKQE--DLGSEIS-------IVVE
TOLB_PHOPR/24-127TWE------------------------------------------GEG.-..........--KLPTDIS-------SVIA
TOLB_VIBVY/24-127KWQ------------------------------------------GTK.-..........--ALPVDIS-------SVVA
TOLB_BORPE/38-138AVD------------------------------------------DTH.-..........--..GRALA-------EVIR
TOLB_PSESM/25-127GWQ------------------------------------------GGN.-..........--VLPEDMA-------EIIS
TOLB_SHEON/23-127QWQ------------------------------------------GAG.-..........--APPQAIA-------DVVM
TOLB_XYLFA/27-132PYH------------------------------------------DSV.-.........G--APATDVS-------SVVA
V6EXY5_9PROT/28-135FGA------------------------------------------QPA.-........EV--QAGRDIA-------RVVA
W8U1X0_YEREN/23-122KWM------------------------------------------GPG.-..........--TPPEEIG-------AIVG

PF05643

Q1LCD0_RALME/11-212LNE--------SPDINATYAMLAQTTAPLAESGYYVLPVALVDETFRQN-GLTVPGDIHA--VPVAKLR-------EIFG
D3V518_XENBS/12-210VNK--------SVEIQAGGSLISQVTYPLAESGYYVFPVAVVEETFRQN-GVTEAQDVQN--ISYKKLH-------DIFG
Q2SHH4_HAHCH/14-212QNN--------TVEVNAPYIFLSTISAPLAEKGYYVFPVAVIDQFLKDN-GLPTPAEMNS--VPLDKLR-------EHIG
E0SD08_DICD3/9-210LNH--------SPDVKAGTSFLSQVTYPLAESGYYVLPVAVTDETFKQN-GLTTAQDIHA--VSVAKLH-------QIFG
Q887N9_PSESM/11-213VNE--------SPDVKATYSTFAQVTYPLAESGYYVLPVALVDETFRNN-GLTNANDIQA--TSPAKLR-------EIFG
A7I3D9_CAMHC/9-212TNE--------TTEVKGAAAVLANSVAPLSEAGYYVFSPALVNDTFKAN-GVYEADDIAK--ISLDKLR-------DIFG
S6BPX5_PSERE/11-212LNE--------SPDVQATYGLLSQVTVPLAEAGYYVLPVALVDETFRQN-GLTASGDIHQ--VEPAKLR-------EIFG
X2HCW4_9NEIS/9-212TSS--------SVDTKAPYAVLAQTTQPLAESGYYVFPVALVNETFKDN-GLNDGAEIQA--IDINKIR-------QIYN
Q0K4M2_CUPNH/11-212LNN--------SPDVKATYALLSQATQPLAESGYYVLPVALVDETFRQN-GLTIPGDIHA--VAPAKLR-------EIFG
Q6CYP8_PECAS/9-210VNH--------SPDVKASYSLLSQVTYPLAESGYYVLPVAVVDETFKQN-GLSTASDIHA--LSTAKLH-------QIFG
A9BNZ3_DELAS/11-211LNQ--------SPEVNAPAGVLSQITLPLAEAGYYVLPVAVTEEMFRQN-GIVSADDAQE--LPVAKLR-------EIFG
D3VLQ9_XENNA/12-210VNK--------SVEVKAAGSLLSQVTYPLSESGYYVYPVAVVEETFRQN-GMTEAQDIHN--LSYKKLY-------EIFG
G8MBI9_9BURK/12-216IND--------TNDVNATYGMLSQMTMPLAEGGYYVVPVAAMEETFKHN-GLTLPNEIQD--VAPAKLR-------SIFG
V5UBV7_9BURK/13-214LNE--------SPDIDATYSVLSQVTVPLGEAGYYVMPVALVDESFRQN-GLTVAGDIHQ--VSPVKLR-------EIFG
Q7CJE6_YERPE/11-209QNQ--------SPEVDASHGVLSQVTYPLAEAGYYVLPVAVVEETFKQN-GMTNAGDISA--ASPAKLR-------QIFG
W0LEC8_9ENTR/9-209TSQ--------SPDIKASHSVLSTTTLPLAEAGYYVLPVAVVEETFQQN-GLTNANDIRA--VAPQKLY-------QIFG
A3MYU4_ACTP2/7-208VNN--------SVDVKADTSVLARVTYPLAELGYYVYPVALVDEVFKQN-GLTDGNAIRS--ANIKKIY-------DIFG
A1WBC0_ACISJ/14-214LNQ--------TPEVTAPAGVLSRATLPLAESGYYVLPVAVTEETFRNN-GIISAQDAQE--LPVAKLR-------EFFG
Q4KAD7_PSEF5/11-212LNE--------SPDIKATYSMLSQVTFPLAEAGYYVMPIAVVDETFRHN-GLTNPADIHG--LAPAKLN-------EIFG
I0HUV3_RUBGI/17-218LNN--------TNEVKATNGVLAQATQPLAEAGYYVLPVGLVDETFKQN-GLTQAADIQQ--VSTEKLR-------EIFG
M5DUQ1_9GAMM/13-209KND--------TVEVDAPYIYLSTISRPLAEKGYYVFPVAMIDNFMKEN-GLPTPEEMNN--VPLDKIY-------ENIG
B8F6X7_HAEPS/7-208TNS--------SVDAKADTSVLARTSYPLGELGYYVFPVALVDEIFKQN-GLTDGNAIRS--AKTNKIR-------EIFG
B4EZI8_PROMH/10-209KNQ--------TPEVEAAHSFLSQVTYPLAEAGYYVFPVAVVEETFKQN-GLSTGSDIQA--VSPSKLR-------EIFG
Q8XS06_RALSO/13-216LNQ--------SPDVKATYGMLSQVTKPLAEAGYYVLPVALVDETFRQN-GLTTAGDIHG--VPVAKLK-------DIFG
Q7N0C6_PHOLL/9-209VNK--------SLEVKAGHSLISHVTYPLAESGYYVFPVAVVEETFQQN-GVTAAQDVQD--ISYKKLH-------DIFG
H2IYH4_RAHAC/9-209VNH--------SPDVNASHSMLSTVTAPLAEDGFYVFPVAVVEETFKQN-GITGAEDIRA--VSAAKLR-------EIFG
E6W7V9_PANSA/9-211DNK--------APDVNAAHSFTSLVTQPLAEAGYYVFPVAVVEETFQQN-GLTNGHDVQA--VSTKRLH-------DIFH
D8J254_HERSS/11-214VNT--------SSEVIAPYGVLAQATEPLAESGYYVIPVSLAAATFRQN-GLSNPDEIHE--LPAPKLR-------EIFG
M4XNX8_PSEDE/9-210LNE--------SPDVKASYGMLSQITYPLAEAGYYVLPVALVDETFRQN-GVSTPADIHQ--LPAGKLR-------EIFG
A8GBK2_SERP5/9-211VNQ--------SPDVKASHSVLASTTLPLAEAGYYVLPVAVVEETFQQN-GLTNANDIRA--VSIQKLH-------KIFG
D8MNT7_ERWBE/9-208ENR--------TTDINAAHSFASLVTQPLAESGYYVFPVAVVEETFNQN-GLTNATDIRG--VSAAKLR-------SIFN
Q21SI9_RHOFT/14-214VNN--------TPEVQASYSVLSHATRPLAEAGYYVMPVTLVAEAFKEN-GMTQATDMHA--TPVDKLR-------QIFG
F6AGD6_PSEF1/12-213VNK--------SPDIKATYSMYSLITAPLSEAGYYVLPVAVVNETFKQN-GMANAEEIRE--VPPQKLY-------EIFG
C5AJP0_BURGB/13-221VNN--------TNDVKASFGVLSQVTQPLAESGYYVVPVGPMEETFKYN-GLTSPNDIAE--VSPAKLR-------EIFG
B1Y7Y1_LEPCP/17-218VNN--------SPDVNATFSVLSQVTHPLAESGYYVMPVSLVAETFKQN-GVSEPAEMHA--IDRAKLR-------EIFG
F4HEQ1_GALAU/9-210TDS--------TNEVKAAPAVLARSLYPLSEAGYYVFPIALVNETFKHN-GISQAQEIHN--IKLDKLY-------KIFG
B4E8N1_BURCJ/12-217VNE--------TTDVGATYGVLSQMTLPLAESGYYVVPVAVMDETFKQN-GLTNATDIQA--TSPAKLR-------EIFG
C1D4H4_LARHH/10-211VNQ--------SPDVNAGISMLSLVTRPLAEAGYYVMPVALVSETFKQN-GVTVADDAQN--IPFSKLH-------DIFG
Q63PN9_BURPS/16-221QND--------TSDVKATYGLLSQMTRPVAEAGYYVVPVAVMEETFKQN-GLTNAADIQT--VSPAKLR-------DIFG
E5AND7_BURRH/16-220VNE--------TSDVKATYGLLSQMTLPLAEAGYYVVPVAPMEETFKYN-GLTTPTDIQG--VTPAKLR-------DIFG
Y1124_NEIMB/7-208LNE--------SPDVNGTWGVLASTAAPLSEAGYYVFPAAVVEETFKQN-GLTNAADIHA--VRPEKLH-------QIFG

PF05211

F8KS85_HELBC/10-259NIDQESPNHRVVGILAPHVQVSGNL.SPYIDQFQDALVGQIQAIFQKRG-YQVMRF..TSGQVLTPAQK-HQMWSVLDIG
HPAA_HELPY/13-258ASEKVQALDEKILLLRPAFQYSDNIAKEYENKFKNQTALKVEQILQNQG-YKVISVDSSDKDDLSFSQK-KEGYLAVAMN
O25234_HELPY/14-271HIVQAPQNHHVVGILTPRIQVSDNL.KPYIDKFQDALINQIQTIFEKRG-YQVLRF..QDEKALNAQDK-RKIFSVLDLK
K4RMR3_HELHE/10-260NIAQESLTHHTVGIFAPHIQVTDNL.TPYIDQFQDALVNQIAEIFQKRG-YQVVRL..TTEQAMTPEQK-HKMWSVLDMG
O25166_HELPY/2-249KGKQEPKNSHLVVLIEPKIEINKVIPESYQKEFEKSLFLQLSSFLERKG-YSVSQF..KDASEIPQDIK-EKALLVLRMD
F8KRD2_HELBC/14-268DIRQEEANNHTIAILTPHIQADENV.QPYIGQFQNALVKQVQEIFEKKG-YNIIHL..ASAQNLTPEQK-SKIYSIVKIR
E7AAG1_HELFC/14-275DIAQEEPNNHTIAILDPHIQADENV.QPYIQKFQNALIKQVQEIYQKKG-YNIIRL..ASAQNLTPEQK-NNIYTILKIR

PF03886

Q30ZW7_DESAG/36-191QEA----R...AVLWLEKVEIPPYLDRPNIVVRG..D--------AGRI.YLAEFDYWAE--PLRDSIS-------RMLA
Q1LFX2_RALME/21-179TAT----P...IRVVVGPVTIPDLVDRPQIVTRV..S--------ANEV.KVNEFARWAE--PLKSEIS-------QVIA
A8GCL1_SERP5/25-179STT----S...RQLWLEHVSVADYLAQSGVVYQT..N--------DVQY.VIAQNNLWAS--PLDQQLQ-------QTLV
Q6D463_PECAS/26-181AVT----Q..GRPLWVEHVSVADYLVNTGLVYQT..N--------DVQY.VIASNNLWAS--PLDQQLQ-------QALV
A4XPV2_PSEMY/32-188DTG----M....AVLVGPISVADYLRQQHLLQRQ..P--------DGSL.VAAPEARWAS--GLANDID-------QQML
Q5FP36_GLUOX/24-182LPA----S..APVLNVSHVTLPDYLDSQDILIRQ...--------GDQL.DRSPNGRWGS--RLSQGVT-------DLLA
Q2YQ49_BRUA2/33-193RKN----L....QLLIPGPAALKALDSENIVVSS..A--------PGSI.EYLKGAQWGD--RLTNIVQ-------SRLV
Q8Y1T9_RALSO/34-193ARI----Q...RAFRLSGVRVPERLDKPQIVLRT..S--------DSQV.QELEQQRWAA--PFGSELR-------DALS
Q15V64_PSEA6/27-193PEI----E...KVVILDKIQLADYLKRPNLVMQI..Q--------GNKL.YYSDVDLWAE--SLQNGIH-------DTML
Q3IC12_PSEHT/29-195SAT----D...AQLRVQTVVLRGALNNRGIAMKI..D--------HNQI.HAANYHLWGE--SPDSMLT-------VSAQ
B2JLP5_BURP8/35-193ASP----S...FRIDVRPVKVPAAVARSQLVVQI..N--------AAQV.QVLEDDRWVS--SLPDEIR-------AALI
Q1LQW2_RALME/27-187PGT----Q..PIWIEVSPVRVPERLNRTQLVVAD..G--------NAGVVKMLDLSRWSA--PLPDELR-------DALS
Q12RG9_SHEDO/35-202TSL----E...LAIGIGPISIPEYLHFTQLVYQT..Q--------AGYL.HRFDNSYWAE--PLDQGIN-------RILG
Q2LY73_SYNAS/41-204RDE----APPPPSVLIAPVEIPDYLDRPQIVTRD..G--------RNEL.NLAEFDRWAG--SLRENIA-------AVMA
Q6D6W6_PECAS/27-186YTA----P...FFIDVLPVGVPTQIDTSQLVIRQ..G--------DSGA.VVLDNERWLS--PMGEEIR-------TALS
A5G4U3_GEOUR/34-200TGR----S...AIISLGPVFIPDYLDRRQIVTRS..G--------QNEL.IIAEFDRWGG--SLADEIT-------RSLV
B2JLL6_BURP8/44-202SQK----G..WPIIEVKRVQLPDYLDTTDIVERR...--------GNQL.LPRPTGRWSE--RLSVGMT-------RALS
A1AL18_PELPD/32-193ASA----VR.QVSLSIAPVEVPDYLNRPQIVTRS..G--------QNEL.KLAEFDRWAG--SLPDNIA-------AVMA
A0LKZ6_SYNFM/33-196VSP----GADGAVFGIGPVKFPEYLDRPQIVTRT..G--------LNEI.QLAEYHRWAE--PLKDNFA-------RVLT
Q13YJ7_BURXL/36-194ATP----P...LLIEVPPVEVPPQVARTAFVVQT..G--------ANQV.DVLEQTRWAS--LPADEIR-------QALS
A5G0A2_ACICJ/27-179HTR----G...AAIAVAHVLMPPTIDRIYLTTAT..G--------PNTR.AVSRRARWTA--PLAGQAQ-------AILA
C1DGP1_AZOVD/26-184QPR----A...YSVTVDPVGVPEMVDRPQLVLRL..D--------ANRV.SIMEHERWAT--PLQSGIG-------QVVA
A6VZG3_MARMS/30-189VTK----K...ISVQLMPIVVANYLAGNEIVLVT..K--------QGDV.HRSQSNLWAE--SLSPQLT-------RLTQ
Q98M02_RHILO/33-190HSR----K....QILIAQPSALKALDSQNIVIKP..S--------DRSI.QYLKGAQWAD--RLPLIVQ-------ARLA
Q2RRJ7_RHORT/36-194GDR----P....VIEIKPVRVSDYLDTTDLVVRG..P--------DRII..PSQQGRWAE--RLSVGVQ-------RALA
Q1QVZ8_CHRSD/44-208EAV----GDFDGSVWLSPLSLTSYLDDQGIVMQL..D--------DIRI.HQARHHLWAE--PLDSQLM-------RQLR
Q1GM15_RUEST/25-182LSA----R....TVEVQLVSLPSYASASDIVSEG..D--------GGAL.YSQERAQWAD--DPARGMS-------VAIA
A1B5I4_PARDP/26-183RLG----T.....AELKDVSLPEYASGGEVSWQT..G--------DGAV.RSNTKQLWAD--DPQRAFT-------LTLA
Q5LU10_RUEPO/22-179SAR----T.....IQVTRMDLPAYVSDSEITLLG..E--------DGVL.RPTKTGFWAD--EPERALT-------EMLA
B2JP31_BURP8/35-193LQG----T.....VVVGPVTIPELVDRPQLVTRV..S--------GNEV.ALEEFARWGE--PLKSGVA-------AAIA
Q7VVC7_BORPE/29-191GVA----AA.PFMIEILPVNVPAQADQPQLMVRT..G--------DGTV.APLYSERWSA--PLPDEFR-------AALS
A0KPP1_AERHH/27-182AQP----Q...HQLVLKPVSLSGQLDRMSLVYQL..E--------GKEL.HFAEYHRWAG--SLDAQLD-------QLTL
Q2IEA0_ANADE/30-187AIP----V...GAVGLGPVRLPAYLDRPELVTRG..E--------GARV.DVAGDERWAA--PLDGLFV-------AALA
Q5FRD2_GLUOX/34-193GPA----V.....VEIRTPVVSARLDRDTIVKAS..E--------DYQT.KLASGSSWSE--ALPDMLG-------HTLM
B2JEG5_BURP8/31-189APL----S...VAVVVGPVTIPELVDRPQLVTRV..S--------GNEV.RLDEFARWGE--PLKSGVA-------DVIA
B3EAR4_GEOLS/32-189RVT----G...PSIAIASVTLPELIDRPQLVVPD..A--------GTRV.AILESHRWAE--PLKSAIP-------RLLA
Q082L0_SHEFN/33-191SIA----L..EHDIGIGPIDVAEYLHFTQLMYQL..D--------DGSL.QRFANSYWAE--PLEQGIS-------RVMS
B2JWQ3_BURP8/37-194GIP----L....AIVVDYVTIPEVVDRPQLVLGI..N--------PSQT.RVAEAARWSE--PLKVQIA-------NVVA
B2JKL2_BURP8/40-196TMP----A.....IKVLDVTAPATLNTDKLVYRLPYA--------DAQQTAAYANSHWTM--PPAQLLT-------QRLR
Q7NV00_CHRVO/26-184FGK----R.....VLLGPVSLPAALDRPQLVLDM..G--------GGEL.KLQEFDRWSA--PLDRLLA-------QRLS
Q0BS49_GRABC/26-184SIP----A..RQIIGLSRVQVPDYLDTQDIILRH...--------GQEL.HRSSNGRWAT--RLSLGIT-------AAIG
B2JGI0_BURP8/37-192SNP----A...FLIEVPPVDVPPQVAKSQLVVQT..G--------PTQV.QVLEQERWAS--LPGDEIR-------RALS
Q3J7M0_NITOC/28-188EAR----VA.RKALIVNQIYAAEFLQHSGIVYKT..A--------PNRL.SVARQHRWAA--PLTVQLH-------QYIY
Q87N56_VIBPA/29-189SVA----E..RPLLVIRPAQLASYLNDNSIVYRT..S--------DTQI.VQAKRHQWAQ--SISEQIT-------QRVV
A7IMU5_XANP2/47-206GSG----N...GQMVVVAPTALAVLNTDKVMVEP..G--------PGQV.AYLSDAQWSD--TLPALLQ-------ARTI
Q60BV1_METCA/32-192QER----E...IALGVGPVELPEYLDRPQIVTRR..D--------PNEL.QLAEFDKWAE--SLKDGVT-------QVLA
Q7N608_PHOLL/25-180IVQ----H..DRQLWVQRVMLSDYLSSSGVVYQS..S--------DVSY.VSAANHLWAS--PLEQQLQ-------QVLV
Q0BVR3_GRABC/46-207RVY----QG.DWLVELRRVGLPAYLDRPEIVRSS..D--------GYRV.FLASNQRWAE--PLTDMVD-------RVLR
A4XP77_PSEMY/28-187SQR----V..DWALRINSPSSSQLLDGTRIVVLP..E--------PDRV.NTYQGVRWSE--RTPQLLR-------NRLL
Q1MPH9_LAWIP/28-190SKH----DITGPIVAIDTITIPGYLDQPQIFIRE..G--------EATVVQFAELHRWSE--SLAEGIN-------RVLQ
A9CIT8_AGRFC/35-194SLK----S...RQLLIADPTALKALDSENIVVRL..S--------GSEV.QYLGNSQWSD--RLPRMVQ-------SKLV
Q21EW6_SACD2/50-209NKP----Q...LSLGIGPVVLPEYAERAGVVSFT..Q--------GNGL.RVAGYHAWAG--SLNENIA-------RVLA
Q2KZJ1_BORA1/28-186GDA----G...FMVEVLPVAVTPQADQPQIMLRT..G--------TGSI.APLYSDRWSA--PLGDELR-------SALV
C1DFS0_AZOVD/30-187NGP----A.....VLLGPLTLADYLQREDALLVQRHE--------DGHL.STASDARWAG--DLKADVD-------QLLL
Q4K7Z6_PSEF5/25-185RTG----G...PQFEMSTVRIPVQVDQPQLVVRQ..D--------SGTL.AILETQRWSA--PLVDEFH-------DALA
B2FMQ9_STRMK/34-197AWP----QA.SWQLVLAKPSAARMVDSPRINVRP..T--------PSQL.EIYKGASWAQ--PATDMIE-------DTLL
B4EE37_BURCJ/32-191TAP----ANPAFLIEVPSVGVPEQVAKSQLVVQK..N--------AAQV.DVLEQERWAS--PPADEIR-------RALS
F2KBG9_PSEBN/29-184STG----M....AVLLGPVLIADYLQRETLLQRQ..P--------DGSL.QAATDGRWAG--SLSSDID-------QLLL
Q32HV4_SHIDS/21-175SQG----N...RLLWVEQVAVPDYLAGNGVVYQT..S--------DVKY.VIANNNLWAS--PLDQQLR-------NTLV
Q5ZZ43_LEGPH/74-232SYN----H...LQIGVDEVSIPDYMKKPQLMIHQ..T--------AHHL.TLEEFNQWAG--ALDKNIT-------LVLT
Q63QZ4_BURPS/39-198ANP----A...FLIQVPSVDVPEQVAKHQLVVQK..N--------AAQV.DVLEQERWAA--PPADEIR-------RALS
Q6LI49_PHOPR/28-187GSN----Q...PLLVIRPVEMAEHLAGTGLVYQV..S--------DTEV.VQAQQNLWAE--SIGKQLT-------RRIN
Q726I0_DESVH/33-194TEK----T...LSVSVGPVIIPDILKQTRIATSK..G--------DGSY.NLSEYHRWSG--DVDRDIA-------RALA
Q87VH7_PSESM/30-185SSG----L....AVLLGPVSVADYLQRETLLQRQ..P--------DGTL.TASPDGRWAG--NLSSDID-------QLLL
Q880H8_PSESM/27-191ARP----A..PFQFEMLPVIMPVQVDQPPLVVRQ..G--------NGSL.AILDTERWGS--PLGDEFH-------DALT
Q8PCT0_XANCP/37-195AWP----QV.SWQLLVAKPSAARIIDSPRINVRP..T--------PGEL.QVYHGAGWAQ--PATDMLE-------DSVV
Q92K95_RHIME/41-197ATN----R....QLLVPEPTALKTLGSDQIVVRL..S--------RSEL.QYLARAQWGD--SLPRMVQ-------DRLV
Q9HUK2_PSEAE/30-186DGG----A....AVLLGPVQLADYLKRDVMVQRQ..A--------DGIL.SLSTDARWAG--NLETNVS-------QQLL
Q9KR87_VIBCH/27-185KTL----....PLLVVQPVELAAYLDTQGIVYRQ..S--------ETQV.IQARQNQWAQ--RLSPQLT-------QRIT
W8U487_YEREN/25-179SVA----S...RQLWVEHVGVADYLAAAGVVYQT..N--------DVQY.VIASNNLWAS--PLDQQLQ-------QTLV

PF03783

Q3ID64_PSEHT/43-256GGLG........MEYFGIGA......SELYREDAISIYLRAV----DVRTGQVLLSVA--TSKKVLSQEMRAGFF----R
O67219_AQUAE/42-258MGGGGVVVPLPFLGGVGV........KAGKSSAHIALDLRLV----RVRDAEVLLAET--VEGKSDRWKFGVGGG----G
Q484M1_COLP3/44-233..VS..........DVGVFS......RVKRQEANATVNIRII----DVSTGQIIYSEK--GKGIAYSEAGTVL..----.
F2G3K7_ALTMD/43-253GGAG........VEYFGIGA......SELFREDQISIYMRAV----DVRTGQVLVSVS--TSKKVLSQEVRAGLF----R
Q12QL7_SHEDO/43-252GGAG........VEYYGIGA......SEMYREDQVTIYLRAV----DVHTGKVMMSVS--TTKRVLSQEMRAGLF----R
Q2JNZ2_SYNJB/52-260SGGGAPVLTPFGSFPLAVGA......ESVDADANVQLNARLV----STSTAEILAVVE--GKGNASQSDSTVT..----.
A1BH58_CHLPD/18-218GGGG........ISYGGISL......GGKQDKAYMAVDLKVI----DVQTGEIYDART--VEATSKSSGISVGV.----.
Q5QXH2_IDILO/43-251GGIG........AEYFGIGA......SELYREDQVSVYLRAV----DVYSGQVLVSVS--ANKKVFSQELRAGLF----R
A5FHE8_FLAJ1/44-262GGFG........ARYFGAGA......SVKYRQDRVTIYLRMI----STSNGKILKSVY--ISKTILSQAIDESLF----R
P73111_SYNY3/31-246ESGGN.....NFGLNLGLFSIG.NSERQAKQEAYVAIDLRVV----DSSTGEVVYART--VEGRATDTAASSANN----V
Q9A7M6_CAUCR/61-270QSFG............GGFVPLVGAVSRSTKSANISIDVRLV----DVKASEVKASQT--FDVSNERSSWGAGGA----G
Q21E38_SACD2/46-235..TG..........ESGFLS......SSKKQEATATVDLRLV----ETKTGRVFASVT--GTGSSSTETARTM..----.
Q5E246_VIBF1/42-258GGAG........ARYLGIGG......SGQYRADQVTVNIRAV----DVRSGKILTSVT--TSKTILSYEVSAGAF----R
CSGG_ECOLI/41-255GGVG........ARYFGIGA......DTQYQLDQIAVNLRVV----NVSTGEILSSVN--TSKTILSYEVQAGVF----R
Q084E4_SHEFN/44-251GGAG........ARYLGIGV......SGQYRVDSITVNLRAV----DIRTGRLLSSVT--TTKAVISKEITAGVF----K
Q31MJ4_SYNE7/43-236SGGS.........FLFGIGG......NSTDVDAYAQINIRMV----STSTAEILAVAE--GTGNISQSDSRVT..----.
Q88H89_PSEPK/49-261GGEG........ARYLGIDI......SREYRVDQVTVNLRAV----DVRTGQVLANVM--TSKTIYSVGRSAGVF----K
Q8YRU8_NOSS1/50-248SGGG..........FLGFGA......ASTDTDALVKLNIRVV----NTTTAEILFVAE--GNGNESQSDTQVS..----.

PF13036

Q3SFY9_THIDA/15-198DSIR----------------------AQLLKS..GAVRF...----.AVDHDAMQ.AQ--TDELIRQNQTGLYKK----S
A6Q5P2_NITSB/9-203KKIR----------------------IALLNS..GKFIVTT.----AVRAGGVED.RA--TRELRKLRKNKEFNQ----K
B3ETR9_AMOA5/12-191KDIE----------------------RELINA..QSVRI...----.VTHGAFRE.KV--RKERQDQQDTN..ST----E
Q6MR79_BDEBA/32-210DMVR----------------------VELMKS..GKVGF...----..IDKEARQ.DI--ADEYNYQN.SGMVEE----G
Q6AQQ6_DESPS/10-192KKIR----------------------IALLQS..GMVKTTTA----IGLNGAEDR..M--NDAYSQLARSKRINK----R
B0SJE3_LEPBP/9-179NAFV----------------------SKLIKN..........----..KIYTVRTKNR--EQSLNEIQFSLSGLT----S
A1SWZ0_PSYIN/10-188ANME----------------------RELINS..GKVQF...----.VASAVARQ.EV--RAERGDQDLNATAES----R
E6W062_DESIS/11-189SDIQ----------------------RELINS..GRVDF...----.VASAEDRT.DL--REERRDQDLHA..RE----E
LPOB_PROMH/7-192NTII----------------------DSVNSI..SALQT...----..VPYAQMM.SA--RKALGLSGEDSLGLR----S
Q0JYU2_CUPNH/3-193DRLR----------------------VSLNRAAQSRIQF...----..VS.AQTA..L--VERERQAKRSGATDA----G
A5G8H5_GEOUR/11-189DSIR----------------------AKLIKS..GKFRF...----..IDRTTDE.AA--VEEIKTQQESGLVDK----K
Q489B8_COLP3/10-189DSIS----------------------TKLLRS..GKFRF...----..VDMGRVA.AA--RKQLDYQQSSGMVDP----N
A7MFR9_CROS8/11-217EALR----------------------GALANN..GKFTL...----..VSAQQLS.MA--KQQLGLSPQDSLGSR----S
Q3B6Q7_PELLD/9-191KKIR----------------------IDLLQS..GKVVVTT.----AVGPNGPED.RM--AMQTRELRQSEEFNQ----S
Q098T7_STIAD/8-189DKIQ----------------------TALAQT..GRFAL...----..VDQGARL.DI--AEEYEYQQ.SGYVDP----N
C9RQT0_FIBSS/10-191KDIE----------------------RALINS..SKAEF...----.VANSNERA.DL--RDELADQQGNT..TE----E
A0LBE2_MAGMM/8-196AQIK----------------------RKLRQS..NRFRFS..----.NALGADQT.RA--VLDERKLQDSKLFDQ----S
A1WFI2_VEREI/13-199NSIQ----------------------TALVKS..GKVRF...----.ARSINEMQ.QG--VDELQRQNQSGLYRQ----G
B2KBR6_ELUMP/7-185ENMQ----------------------RALINS..GKVNF...----.VASKNERG.EV--RTERLEQDEFA..SE----L
A9EYZ5_SORC5/15-197SDIE----------------------TYLAQA..SLVTV...----..VSVERQQ.QM--VAEVEKQRGGG.FDP----N
A6VT68_MARMS/21-199NDIK----------------------RSLLRA..GKVDF...----.VVSGAERD.DV--RSEREEQELNA..AP----D
Q11SM3_CYTH3/10-189KDLE----------------------KSFIKS..QRVRL...----.VQAGDKRE.EL--RKERADQQTNA..SV----S
Q2IJK4_ANADE/8-185DKVR----------------------VELQRS..GRFAF...----..ADAAARE.QI--AAEYDYQQ.SGMVAK----D
A1WY34_HALHL/8-186NDIQ----------------------RELINS..GQVDF...----.VADADQRE.RI--REERRDQDLHA..SE----E
C1DFX4_AZOVD/10-225LRLL----------------------SELRKSRAGDITYVDK----REASTSSSLSDS--SSKSSSSSSKSGSGS----G
LPOB_PHOLL/7-188DALR----------------------QAISSE..HVFEL...----..IPQNQVQ.NA--RQSLGLSEEDSLGLR----S
D1B294_SULD5/10-196KKIR----------------------IELLQN..GKGKFITT----TAIRAGGPEDAM--SYQVRELRNIKEFNQ----K
Q0VKU2_ALCBS/9-185DTIQ----------------------SKLINS..GKFRF...----..ADMTVVN.RV--REQLDYQSDSGLVDQ----S
B0ST18_LEPBP/7-177NEIL----------------------NQLTKD...KVPF...----..VDTSVRA.DA--TKEIAFGK.TGMVSS----D
Q3IL02_PSEHT/16-195DSIS----------------------TQLLRS..GKFRF...----..VDMTRVE.AI--REQLKFQNEDALVNP----T
D3UIZ9_HELM1/11-192RELT----------------------RAMRKS..GKFKLTMA----MARGGASMD.GM--IQDVRNMRNNKEFNQ----Y
A4SYG3_POLSQ/19-190DKIR----------------------TQLLKS..GQVRF...----.AVSVSEMQ.NQ--TEELKRQNQSGLYKN----S
LPOB_KLEP7/10-212TALR----------------------SALAGN..GKFTL...----..VSAQQLA.VA--KQQLGLSPQDSLGSR----S
B7VH52_VIBTL/9-185DTIS----------------------TKMLNS..GKFRF...----..VDMDRVE.SV--REQLNFQNNDELVNQ----S
C5BFM3_EDWI9/9-196EVLR----------------------SALAGN..PRFQL...----..VSAAQLA.QA--KQSLGLAANDSLGSR----S
LPOB_DICD3/7-193TALY----------------------NALASS..GQFTM...----..VSREQLG.VA--RQSLGLSEEDSLESR----S
E4PGL0_MARAH/14-201DRLR----------------------IELNRAANGRMVF...----..VGRHFSD..M--VQKERDLKRDGAVDG----G
F2K6Q3_PSEBN/9-189TSIK----------------------TQLMKT..GAARF...----.ASDNTAMD.SQ--VDQLKLQNQSGLYKK----S
M1FI84_9ALTE/9-189KKIR----------------------VGLLRS..GKVVTTTA----VGLD.GAED.EM--SARARELRDSEEFDQ----S
O25995_HELPY/13-200TEIA----------------------RQLRLRSNGRFNITRA----SGGSGIAADSRM--VKQREKERESEEYNQ----D
Q0PC46_CAMJE/11-196AKIT----------------------SALRKS..GKFVLTS.----AVAAGGALD.SM--SEDVRELRDNDEFNQ----K
Q32EW5_SHIDS/10-210ETLR----------------------NALANN..GKFTL...----..VSAQQLS.MA--KQQLGLSPQDSLGTR----S
Q5NES4_FRATT/12-191NTAQ----------------------TQIIKS..GLFQV...----..TDMSQIK.NV--REQLGYQANSGMVDQ----A
Q6D676_PECAS/7-191NALY----------------------SALSSG..KAFTL...----..VPREQLA.SA--KQTLGLSVDDSLGSR----S
Q8EHZ4_SHEON/13-190DSIS----------------------NKLLRS..GKFRF...----..IDMTKVD.SV--RKQLDYQNNTGMVDP----S
W8U423_YEREN/7-192SALH----------------------QVLSSN..KKFVL...----..ISPQQLA.VA--KQTLGLSEEDSLGSR----S

PF04052

TOLB_PELCD/21-131ADLE--------------------------------------------LSGLFRQLDP--AAFLDDARRPGLTSS----R
A5EXH2_DICNV/23-121SDLH--------------------------------------------KTGLFQPVAP--EQIRNRPNS....PA----E
Q4FSA5_PSYA2/29-127NDLS--------------------------------------------KTEL..KITS--QNLPQQPRSS..SEL----S
A0L4U9_MAGMM/33-145SDLS--------------------------------------------GSGLFRPLEQ--RGFLQPSDKL..WQQ----G
TOLB_SHELP/23-128SDLT--------------------------------------------RSGTFKPMDE--LGLPQRNLG...SLA----Q
TOLB_SHEFN/23-128SDLS--------------------------------------------RSGTFKTLDV--RALPQSTIS...SVN----G
TOLB_SHEDO/23-128GDLS--------------------------------------------RSGTFKPLDI--RALPQHGIS...SVA----Q
TOLB_AERHH/23-127NDLM--------------------------------------------RSGKFKPLAR--GQMPQTPST....SG----E
TOLB_PSEA6/23-127GDLL--------------------------------------------RSGKFSPIDS--TDMPGQPHN....DN----E
TOLB_IDILO/24-128ADLM--------------------------------------------RSGKFNPIPV--SAMPQRPAA....DD----E
TOLB_PSEHT/24-128ADLM--------------------------------------------RSGKFKPVDV--AQMPQQPSK....DS----D
TOLB_COLP3/24-128DDLL--------------------------------------------RSGKFSPIAI--DRFPQTISD....AK----A
TOLB_VIBF1/24-128SDLQ--------------------------------------------RSGKFSPVAT--NKMPQTPYK....DS----D
A1SSW4_PSYIN/22-127ADLQ--------------------------------------------RSGQFSPLPI--EQMPNTPSK....SL----G
TOLB_ACTP2/28-129DDLR--------------------------------------------NSGKFTPVER--SKLPAQPGS....AA----E
TOLB_HAEDU/28-129DDLR--------------------------------------------NSGKFTPIQR--AKLPSHPAS....VA----E
TOLB_ECOLI/23-127ADLR--------------------------------------------NSGKFNPLDR--ARLPQQPGS....AQ----E
TOLB_PHOLL/23-127ADLR--------------------------------------------NSGKFNPIDI--SRMPQQPTT....TS----E
TOLB_PASMU/26-129ADLR--------------------------------------------HSGKFNPIPV--NRMPQHPTS....VS----E
TOLB_MANSM/28-129ADLR--------------------------------------------NSGKFNPIPV--SQMPQQPAS....AS----E
TOLB_BLOFL/24-133ADLR--------------------------------------------NSGKFNTLPI--AYLPYQPSK....LT----D
TOLB_WIGBR/21-130CDLQ--------------------------------------------NSGKFSPIEI--YKESNKSIE...KQI----K
TOLB_THICR/23-128NDLL--------------------------------------------RSGKFKAVDE--AKLPSRPKT....LD----D
TOLB_MARMS/24-128ADLA--------------------------------------------RSGLFQPIPR--SNMLSMPSK....EA----D
TOLB_SACD2/39-140ADLD--------------------------------------------RSGLFESKSP--ENMLSFPSK....QA----D
TOLB_CHRSD/24-125NDLE--------------------------------------------RSGRFEPLPR--ESLISRPSS....SE----E
TOLB_HAHCH/21-126EDLK--------------------------------------------RSGDIEPLDR--TKMVSIPSK....AE----E
A1U1B4_MARHV/36-139ADLT--------------------------------------------MSGEFRPLEP--SKMLSLPSE....RS----E
A4XRS6_PSEMY/23-126NDLR--------------------------------------------NSGYFEPIPR--QNMISLPTQ....AS----E
C1DRF3_AZOVD/23-126NDLR--------------------------------------------NSGVFEPIPR--QNMISQPTG....PG----E
TOLB_ALCBS/30-132ADLH--------------------------------------------RSGQFKPLPP--QDMLSRPRN....EQ----E
A1WZ69_HALHL/29-133ANLA--------------------------------------------RTGRFDILPE--EDLVDTPGR....ME----D
TOLB_ALKEH/25-129DNLA--------------------------------------------RSGRFEVLPR--EELVARPAG....LD----D
TOLB_NITOC/30-133ADLA--------------------------------------------RSGRFAPLPE--EDLISRPRN....AS----D
TOLB_XANCP/27-132ADLD--------------------------------------------RSGQFRTLPA--AQIVEKPTR....GT----E
TOLB_METCA/26-127ADLQ--------------------------------------------RSGRFRTLAE--SAMQERPTA....PD----Q
A9C288_DELAS/41-141ADLE--------------------------------------------RSGQFRAVDT--AGVQLDE......TS----R
A1W6N8_ACISJ/43-143ADLE--------------------------------------------RSGRFLGVDA--SGVALDE......SS----R
A1TSM5_ACIAC/38-138ADLE--------------------------------------------RSGQFRAVDA--SGPQLDE......NS----R
A1WGN1_VEREI/17-117ADLE--------------------------------------------RSGQFRAVDA--DGAALDE......TT----R
TOLB_RHOFT/25-125ADLE--------------------------------------------RSGQFRGVDT--VGAALDE......GT----R
TOLB_POLSJ/27-127ADLE--------------------------------------------RSGMFRPVDT--AGIVADE......NT----R
A2SFG9_METPP/22-122ADLE--------------------------------------------RSGVFRNLDT--SGVVLDE......GS----Q
A4G7Q1_HERAR/25-124ADLL--------------------------------------------RSGYFKVIDT--GTVLTE.......NS----Q
TOLB_RALME/45-145SDLT--------------------------------------------NSGRFRNVDP--AGATVAE......SA----Q
TOLB_BURXL/28-128QDLQ--------------------------------------------RSGKFTNIDA--GATPVSE......TD----S
TOLB_BURPS/28-128GDLA--------------------------------------------RSGKFSNVDA--GSTPVPE......TA----S
TOLB_AZOSB/27-127ADLE--------------------------------------------RSGLFSLVDI--GPLPLPE......GQ----I
TOLB_AROAE/27-127ADLE--------------------------------------------RSGLFSLVDM--GLVTLPA......TA----V
TOLB_DECAR/27-127ADLE--------------------------------------------RSGLFKLVDN--GTAAFDE......NA----P
TOLB_NITEU/24-124ADLE--------------------------------------------RTGLFKLVDT--LGLTSQE......PE----Q
TOLB_NITMU/32-133ADLQ--------------------------------------------RTGLFKLVDP--GGLRPHE......PV----E
A4SVI2_POLSQ/34-134QDLA--------------------------------------------RSGYFKNTEN--GNATESD......EG----T
TOLB_CHRVO/26-128NDLA--------------------------------------------LSGAFRLIDP--SAVANVPFE....PA----D
TOLB_METFK/28-133ADLR--------------------------------------------RSGLFRVLET--RGVANQPSD....IS----Q
TOLB_THIDA/29-131DDLA--------------------------------------------RSGQFSMTDV--TGAAQPVE.....PS----Q
TOLB_PARL1/38-141NNLE--------------------------------------------RSGLFRPLPK--ASFIEKVSD...INV----Q
B0T057_CAUSK/36-138GNLE--------------------------------------------RSGLFQPLNV--ANVADKLAD...VNV----Q
TOLB_MAGSA/31-138ADLE--------------------------------------------RSGLFKPIDP--KAFIQNAAS...LQA----G
TOLB_RHORT/33-140NDLQ--------------------------------------------GSGLFRVLDP--AAYIQSLPN...LAV----Q
TOLB_BRADU/34-141NNLK--------------------------------------------RSGLFAPIDQ--AAFIERISN...IDV----A
TOLB_CHESB/30-133ADLK--------------------------------------------RSGLFAPIDR--GAFIEKISN...PDV----A
TOLB_RHIEC/30-132ADLQ--------------------------------------------RSGLFAPINK--TAFIEKISN...PDA----A
TOLB_RHILO/30-133ADLK--------------------------------------------RSGLFAPIDK--SAFIEKISN...PDA----A
A7IJU3_XANP2/44-146ADLR--------------------------------------------RSGLFAPIDP--KAFVEQITN...P.D----T
Q0ALY5_MARMM/27-134NDLA--------------------------------------------SSGLFAPVDQ--DAFIEDIAN...IDL----R
E0TDI8_PARBH/29-136DDLA--------------------------------------------SSSLFAPIDP--AAFIQQLQS...VNT----P
Q0C5V5_HYPNA/26-132ADLA--------------------------------------------STGLFDMQNP--ASFIQRDLS...INA----E
B0U7W3_METS4/31-134NNLK--------------------------------------------RSGYFVPIDR--ARFPETPNF....DA----A
A5G2K7_ACICJ/55-161SDLD--------------------------------------------HCGLFSAIDP--TSFVPNSVV....NS----V
Q0BT48_GRABC/51-150ADLE--------------------------------------------RSGLFRIVAP--GAYPQQS......GD----V
TOLB_DINSH/31-138DDLE--------------------------------------------GSGLFRAIPE--NAFISPITS...FDS----P
TOLB_RUEST/28-134QDLV--------------------------------------------GSGLFREIPK--VAYISPYTD...FDA----E
TOLB_RUEPO/26-132ADLT--------------------------------------------GSGLFREIPS--TAYISQVTS...FDA----P
A1AZV4_PARDP/48-153ADLT--------------------------------------------GTGLFREIPA--SAHIARPES...FEA----P
TOLB_ROSDO/30-136ADLT--------------------------------------------GTGLFRQIEP--DAFISTVSS...FAA----P
TOLB_JANSC/31-137ADLR--------------------------------------------GTGLFRQIPP--DAYISQITN...FGA----P
TOLB_SPHWW/23-136NDLK--------------------------------------------NSGLFSPLPK--SALQTVTHP...QVT----A
TOLB_RUTMC/20-119NNFN--------------------------------------------RSGEFSASSV--NYVI.........NN----K
TOLB_ACIAD/27-123NDLN--------------------------------------------RSGRFSSASK--NLPTTASID......----A
TOLB_ORITB/37-144NDLN--------------------------------------------ISKIFAPISS--DLFIETEQG...VAH----I
TOLB_RICPR/20-127NDLK--------------------------------------------ISGLFRPISS--ASFIEEQTG...IKY----K
TOLB_COXBU/25-130NDLQ--------------------------------------------NSGQFRVTGS--GNLDQTAAS....LE----Q
A0LGA1_SYNFM/45-154GDLD--------------------------------------------FSGIFRPLDP--KGFLEDPQTMGLNAP----E
B3E270_GEOLS/25-132FDLT--------------------------------------------MSGLVAAERR--DAAPLVHGL...ALT----P
A1AU95_PELPD/31-138FDMN--------------------------------------------MSGLCLAEIK--EQFNLSGAL...LFA----E
A5GDC0_GEOUR/22-129FDLT--------------------------------------------LAGPFAVMPT--PPAESKSGI...RPG----E
A7H870_ANADF/28-134GDLS--------------------------------------------LSGLFDVLDP--RGFLADPSEG.WAAP----T
TOLB_ANADE/26-133ADLV--------------------------------------------LSGLFDVLDP--RGFLADPAEG.FAAP----S
TOLB_WOLSU/19-119GDLK--------------------------------------------VSSHFNVQEG--GASSF........DM----V
TOLB_HELHP/20-117ADLK--------------------------------------------VSGHFQVYDG--SVNK.........NS----E
Q2GJ56_ANAPZ/25-129KDLN--------------------------------------------NTGLFDARIE--ILDPTS.......DG----A
A7ZC42_CAMC1/20-118GDLK--------------------------------------------VSSDFEVIED--HVPSTY.......EG----T
TOLB_HISS2/28-126ADLR--------------------------------------------NSGKFNPIAV--SKMPQKPTS....AS----E
TOLB_VIBTL/24-127SDLQ--------------------------------------------RSGKFSPVAT--SKMPQTPYS....ET----E
TOLB_SHEPW/23-126SDLA--------------------------------------------RSGTFSPSDE--LSLPQRNIS...TLA----Q
B9KHU7_ANAMF/28-134RDLN--------------------------------------------STGIFDASWK--LPAGGFGTT...SEG----M
C5AV32_METEA/36-138NNLR--------------------------------------------RSGYFTPLEK--GRFPENPSF....DA----A
M1FG56_9ALTE/39-140SDLT--------------------------------------------MSSEFRTLPA--EKMLSLPSQ....RS----E
M9X4A4_MANHA/28-124DDLR--------------------------------------------NSGKFTPLER--SQMPAQPGS....AA----E
TOLB_HAEIN/27-122DDLR--------------------------------------------NSGKFNPIAV--SQMPQRPTS....AA----E
TOLB_MYXXD/22-128FDLT--------------------------------------------ASGILQVLDR--KGFTADAKEG.MAAA----S
TOLB_BRUA2/35-138ADLE--------------------------------------------RSGLFAPIDK--GAFIEKISN...PDA----A
TOLB_RHOS4/31-136SDLS--------------------------------------------GTGLFREIPA--SAHISRVTS...FEA----P
TOLB_NITWN/40-146NNLK--------------------------------------------RSGLFAPIDQ--AAYIEKITN...IDV----P
TOLB_PELUB/22-136NNLR--------------------------------------------QSGLFNPLDK--NAFLQEPDV...ANL----K
TOLB_PHOPR/24-127SDLQ--------------------------------------------RSGKFSPIAT--SKMPQTPDS....EE----Q
TOLB_VIBVY/24-127SDLQ--------------------------------------------RSGKFSPVPT--SKMPQTPYN....ES----E
TOLB_BORPE/38-138ADLT--------------------------------------------RTGQFRLINA--AGSGLNV......DS----Q
TOLB_PSESM/25-127NDLR--------------------------------------------NSGYYAPIPK--QNMISLPTQ....AS----E
TOLB_SHEON/23-127SDLV--------------------------------------------RSGTFKPLDE--LGLPQRGIG...ALA----Q
TOLB_XYLFA/27-132ADLN--------------------------------------------RSGQFRTLPL--GQIIERPTH....GS----E
V6EXY5_9PROT/28-135ADLE--------------------------------------------RSGLFKPIDQ--RAFIQNAAS...LQA----G
W8U1X0_YEREN/23-122ADLR--------------------------------------------NSGKFNPIDA--ARMPQQPST....AA----E

PF05643

Q1LCD0_RALME/11-212ADAA------------------LYVTVSEYGSKYQVLSSVTR----VAASAKLVDLKT--GDALWSGSAAAATDD----S
D3V518_XENBS/12-210ADAA------------------LYLDITQYGTQYLVISSDTR----VSAAARLVDLRS--GKQLWRGTATASSTE----N
Q2SHH4_HAHCH/14-212PDAV------------------LYVTIDDWGQQYQIISSVAV----VSSSWRLIDART--GETLWQGRAYAQQSS----G
E0SD08_DICD3/9-210ADAA------------------LYLDITDYGSKYMVINSETR----VTASARLVDLRN--GKELWKGSATASSSE----Q
Q887N9_PSESM/11-213ADAA------------------LYITVKQYGTSYVVISSQTV----VTVTAKLVDLRT--GTALWTGAASASSEE----G
A7I3D9_CAMHC/9-212ADAI------------------LYLHIDRYGANYKLINSSTE----VGVNATLKDAKT--GATLWQKYFLAVQNS----N
S6BPX5_PSERE/11-212ADAA------------------LYLSVKEYGTSYKLIASETA----VTVGARLVDTKT--GVALWTGSARASSEE----N
X2HCW4_9NEIS/9-212PDAI------------------LYLNVKDYGTKYKVISSVTT----VTVEAKLIDAKN--GSIIWSGEKNITIDS----S
Q0K4M2_CUPNH/11-212ADTA------------------LYITVTDYGPKYQVVSSTTV----VAAEAKLLDLRT--GKTLWTGQASAANNQ----S
Q6CYP8_PECAS/9-210ADAA------------------LYLDVKEYGTSYIVINSETR----VSADARLVDLRT--GKLLWSGSATASSNE----Q
A9BNZ3_DELAS/11-211ADAA------------------LYLNIRNYGTSYAVISSASV----VTLEARLVDLRT--GTQLWDGSATASSAE----G
D3VLQ9_XENNA/12-210ADSA------------------LYLNITEYGTQYRIINSDTR----VSATARLVDLHT--GKALWSGVATASSTE----N
G8MBI9_9BURK/12-216ADAA------------------LYTKITDYGSSYRVIANKTQ----VSAQAKLVDLRS--GETLWNGSATANGSE----T
V5UBV7_9BURK/13-214ADAA------------------LYIKIKQYGTKYMVLDSATV----VTVSADLIDLRN--GAKLWSGAASASNNE----G
Q7CJE6_YERPE/11-209ADAV------------------LYITIVQYGTSYQVITSDTR----VTANAKLVDLKT--GKLLWSGSATASSNE----G
W0LEC8_9ENTR/9-209ADAV------------------LYLDVTQYGTSYLVLNSETR----VAVNAKLVDLRT--GKQLWAGNATASSNE----N
A3MYU4_ACTP2/7-208ADSI------------------LYLNVDKYGTSYKVFDSVTE----VELEGKLIDLKT--GKTLWDGTGRFAEGS----T
A1WBC0_ACISJ/14-214ADAA------------------LYLDVRQYGSVYSIVSSETR----VTLAARLMDLRT--GEQLWSGEATASSAE----N
Q4KAD7_PSEF5/11-212ADAG------------------LYITVKEYGTSYMLISSATV----VTASATLVDLKT--GTTLWTGSARASSEE----G
I0HUV3_RUBGI/17-218ADAA------------------VYLKVTQYGTTYKVLSSDTT----VAVEGRIVDLRS--GRVLWEGKAQASSAE----Q
M5DUQ1_9GAMM/13-209ADAV------------------LYVNINQWGQKYNVVSSKAM----VSVSMKLVDART--GNLLWDGAASAVKEP----G
B8F6X7_HAEPS/7-208ADAI------------------FYVNIEEYGTSYKLIDSVTN----VSLEGKLVDLKT--GKTLWEGAGSFAQGS----S
B4EZI8_PROMH/10-209ADSV------------------LYLDVTQYGTSYQVIASETR----VSASAKLVDLRN--GALLWSGHASASSAE----G
Q8XS06_RALSO/13-216ADAA------------------LYVTITQYGTKYMLIDSVTV----VAADAKLVDLKS--GETLWTGHASASSKE----T
Q7N0C6_PHOLL/9-209ADSA------------------LYLDIEEYGTQYQIINSDTR----VTASAKLVDLRS--GKQLWHGRAMVSSTE----N
H2IYH4_RAHAC/9-209ADAA------------------LYIDITSYGSTYMVVSSETR----VTANAKLVDLRN--GKVLWTGNATASDSE----H
E6W7V9_PANSA/9-211ADSA------------------LYISITDYGTRYLVVDSNTM----VSASARLVDLRT--GKQLWEGSATANDGE----N
D8J254_HERSS/11-214ADAA------------------LYIKITRYGTSYQVVQSETL----VAAEARLVDLRS--GKLLWEGSARASSLE----Q
M4XNX8_PSEDE/9-210ADAG------------------LYVTVTEYGTSYMVLSSASI----VTASARLVDLRS--GTTLWTGTATASSEE----G
A8GBK2_SERP5/9-211ADAV------------------LYLDVTQYGTSYIVINSETR----VTVKARLVDLRN--GKQLWAGSATASSNE----N
D8MNT7_ERWBE/9-208ADAA------------------LYIDITSYGTKYIVVDSVTQ----VTATAKLVDLRT--GTQIWSGLATAANNE----N
Q21SI9_RHOFT/14-214ADAA------------------LYITIGKYGTVYQVISSASV----VSAEAKLVDLKT--GKLLWTGAASASSEE----G
F6AGD6_PSEF1/12-213ADTV------------------LYIDVTEYGSSYKVISSEVA----VAASATLVDLRT--GKELWKGVARASTAE----Q
C5AJP0_BURGB/13-221ADSA------------------LYMTVTRYGTTYQVIDSVTA----VSVSAKLVDLRT--GDVLWTGSQSATDKE----L
B1Y7Y1_LEPCP/17-218ADAA------------------LYLTVTKYGTTYMVFDSAAV----VSASARLVDLKT--GQELWSGSATASSSE----Q
F4HEQ1_GALAU/9-210ADAV------------------LYLDVSEYGVNYQIINSETK----VSVSGKLVDLRT--GKTLWTGSATASSDE----Q
B4E8N1_BURCJ/12-217ADAV------------------LYSKVTQYGSVYQLVDSTTT----VAASAKLVDLKS--GDVLWQGEGRATGKE----V
C1D4H4_LARHH/10-211ADAA------------------LYVSIKKYGASYRIIDSVVE----VFADAKLVDLRS--GTTLWQGSAQASSAE----N
Q63PN9_BURPS/16-221ADAA------------------LYTTVTQYGSVYTVLDSTTV----VSASAKLVDLRT--GDLLWQGSGRATGKE----L
E5AND7_BURRH/16-220ADAA------------------LYTKVKQYGSVYAVLDSKTV----VAASAKLVDLKT--GDVLWQGEGRATGDE----V
Y1124_NEIMB/7-208NDAV------------------LYITVTEYGTSYQILDSVTT----VSAKARLVDSRN--GKELWSGS..ASIRE----G

PF05211

F8KS85_HELBC/10-259GWVGILEDVKMDTKDPSKQDM..DVMVDQ......SSGSVWF----KFFEPETGRIIH--NFGIEVGTEQAITH.----.
HPAA_HELPY/13-258GEIVLRPDPKRTIQKKSEPGLLFSTGLDKMEGVLIPAGFVKV----TILEPMSGESLD--SFTMDLSELD..IQE----K
O25234_HELPY/14-271GWVGILEDLKMNLKDPNNPNL..DTLVDQ......SSGSVWF----NFYEPESNRVVH--DFAVEVGTFQAMT..----.
K4RMR3_HELHE/10-260GWIGILEDVKMDTNDPEKDNV..DVLVDQ......SSGSVWF----KFFEPETGRIIH--NFGVEVGTKQAFTH.----.
O25166_HELPY/2-249GNVAILEDIVEESDALSEEKV.....IDM......SSGYLNL----NFVEPKSEDIIH--SFGIDVSKIKAVIE.----.
F8KRD2_HELBC/14-268GWIGILVDADINTDNPEDTDM..NTTVDQ......SAGAVLF----KFFEPKTGRTTH--NFAINVGAEHAITY.----.
E7AAG1_HELFC/14-275GWVGILEDADINTEHPEDTNM..KSTVDQ......SAGAVLF----KFFEPKTGRTTH--NFAINVGAEQAITHP----H

PF03886

Q30ZW7_DESAG/36-191RKLA----------------------GDTNRAVVTESY..........AAGEDRVKIV..ILRLDAS....TDGD....V
Q1LFX2_RALME/21-179ADLR----------------------TMLGSDQVTVFD..TG....SNAMPAWRVRVD..ILSLDSE....PAVA....V
A8GCL1_SERP5/25-179TNLS----------------------SALPGWVVSSQP.........MSSEQDVLNVT..ISGFHGR....FDGK....A
Q6D463_PECAS/26-181VNLG----------------------HKLPGWIVTTQP.........QGSEQAVLNVS..VTGFHGR....YDGN....V
A4XPV2_PSEMY/32-188RQLA----------------------WRLESQRLALAP..AA....PGFNADAQVMLT..ITRLDSG....PTQP....A
Q5FP36_GLUOX/24-182AHLG----------------------QDWPGYVVTTQP........LAETPALRLAVN..ISRLDLD....SSGQ....G
Q2YQ49_BRUA2/33-193QAYE----------------------NTSAFGGIGRPG........DGLAINYQVLTD..LRMFGIQA.YTSPQT....A
Q8Y1T9_RALSO/34-193AGLA----------------------DALAAVDVGGAT..AP.....AGVPLYRISTD..VQRFDAR....PAQD....V
Q15V64_PSEA6/27-193AWLN----------------------QHAEATRFVAYD..SP....EANLGQEHLILS..VQYFMPT....DQGT....V
Q3IC12_PSEHT/29-195QTLF----------------------NALPNWMVIKGL...PVITELDQQTFYELEYE..IHHFNGD....LQGN....A
B2JLP5_BURP8/35-193AGVS----------------------QQAGAPAAKTLV...P....GEDVPVYEVTVD..IQRFESW....PGSH....V
Q1LQW2_RALME/27-187QQLQ----------------------AKLGAVDIYQQG..LS.....EVEPVYRVTTE..VVRLDAD....PGQR....A
Q12RG9_SHEDO/35-202LNLT----------------------QASPSRQLVQFP..WR....LENRPQYSISIN..ILNLNLM.....EGQ....A
Q2LY73_SYNAS/41-204ENLS----------------------ILLSSDRIFVYP..QV....RGEKTDYLMALR..ILRLDCI....PGDS....V
Q6D6W6_PECAS/27-186VGLT----------------------QRLNTQDVSGLV..RT.....AETPVVRIHLQ..VRRFDSW....PGQF....V
A5G4U3_GEOUR/34-200ANLS----------------------GRLASANISVFS..WQSMPLSIMGTSYRVPVS..ISRFDGI....PGDS....V
B2JLL6_BURP8/44-202ASLA----------------------ARLPRMLVTATT........PVERPARLLLVD..VTAFEWR....ADRQ....V
A1AL18_PELPD/32-193ENLS----------------------LLLASDRVQAAP..RG....RNEKADYTLAMR..ILRLDCV....PGDQ....L
A0LKZ6_SYNFM/33-196ENLA----------------------ALLPANGVVAFP..WP....GSARVRYQVMVE..VTRFDGI....AGRE....A
Q13YJ7_BURXL/36-194QDLT----------------------RQLGAIDVFNTP..HP.....EGAPVYRVSVS..VQRFESW....PGSH....A
A5G0A2_ACICJ/27-179RDLA----------------------RRLPERRVAMPG..DP.....VPRAALLVHVE..VTDFIPH....PG.H....V
C1DGP1_AZOVD/26-184ANLT----------------------RLLGGAWVAAHP..MS....ATTASDYRVTLD..VQRFESA....PGAA....A
A6VZG3_MARMS/30-189QRLE----------------------KALPNITWFGGQ.......RLPSYAIALLNIE..VDDFYAD....LEGM....I
Q98M02_RHILO/33-190ETFQ----------------------RSGSFAGVGKPG........EGLAIDYQVIVE..IRSFEVSV..DGGEH....A
Q2RRJ7_RHORT/36-194ASLG----------------------ARLPGLILTTQP........PIDRPARQLLVD..VSGFEAI....EGGS....V
Q1QVZ8_CHRSD/44-208ERLS----------------------TALPEADILRRGQTAQ.....AASPALHVDLR..VERFQGR....DDGM....A
Q1GM15_RUEST/25-182RGLS----------------------DRTGA.AVAVEP..WP....LNTPADARLDVR..IDQSYAR....ADGL....F
A1B5I4_PARDP/26-183RAIS----------------------D.LSGATVIAEP..WP....LAEPPRRRLEVR..VEKALAQ....ADGL....Y
Q5LU10_RUEPO/22-179AGLD----------------------QALNA.SVAADP..WP....FEGLADIQVAVK..VHRLSGV....PGQA....L
B2JP31_BURP8/35-193GDLA----------------------RLLGSERVSVSS..QT....VAGTESWRVRID..LVQFDSM....PGEA....V
Q7VVC7_BORPE/29-191DTLT----------------------RELGAPDVQVIK...P....ASGTPVWRVQVD..VQRFDLV....AGGP....S
A0KPP1_AERHH/27-182NGLS----------------------SRLPGWVVRQDG........ARKGPVLTISVE....RFQGR....HDGR....A
Q2IEA0_ANADE/30-187EDLR----------------------AAVPAREVVAWP..WR....AGAAPEWAVSVD..VLRFERA....PDGT....A
Q5FRD2_GLUOX/34-193TDLA----------------------QRLPGTTVFAQD..DA....VTTTPAAYVELT..IRNFEAD....SAGH....A
B2JEG5_BURP8/31-189ADLT----------------------RLLGSKQVSVSS..QT....VAGTEACRVRVD..IVQFDSM....PGEA....V
B3EAR4_GEOLS/32-189DNIS----------------------RLMNSDRVSAYP..QH....AANSADYRLFVD..LQRFELT.....GNT....V
Q082L0_SHEFN/33-191INLS----------------------QGDRRRNLVLFP..WR....ANNTPQYSIKIK..VTSLNRD.....GNN....A
B2JWQ3_BURP8/37-194VDMQ----------------------RLFVDAQVSTIP..QA.....TDRPTVRIAIN..VQTFDSA....PGSG....A
B2JKL2_BURP8/40-196NALS----------------------SR..GTVLTGSD........GVSAPVLKVDLDVFEQDFDGQ....SQSH....A
Q7NV00_CHRVO/26-184LGVA----------------------RASGVASVYAYP..QP....GMDGGELRIAVD..VRGLSLK....PGQG....A
Q0BS49_GRABC/26-184DCLA----------------------ARWPDAQIVQGP........QSQSPDSRIQIV..VTRFDVG....EDGQ....A
B2JGI0_BURP8/37-192SSLT----------------------QQLGTIDVYGSP..YP.....ERVPVYRISVN..VQRFESW....PGSR....T
Q3J7M0_NITOC/28-188NRLT----------------------TQLPSIAVYPNT..SS.....APLKAWQLTVE..FNSFHGR....FDGK....A
Q87N56_VIBPA/29-189AELR----------------------QKQSDYWPVEMN..NL....LDQSGESKLQLT..LNKFNGS....YQGN....A
A7IMU5_XANP2/47-206QAFE----------------------NASKLRRVARPG........DGVNADYQLVID..IRTFALRI.TDQGPV....A
Q60BV1_METCA/32-192ENLA----------------------TRLPSRKVVTYP..WK....RSAQVDYQLVVK..VTRFEGS.....GGE....A
Q7N608_PHOLL/25-180AELT----------------------MALPQRLVSAQP........LVNKPD.TLDVT..VTSFHGR....YDGK....V
Q0BVR3_GRABC/46-207QDLS----------------------LRLPGSTVFSES..GA....ISADPTVIVEAD..LQRFESP....GDGS....V
A4XP77_PSEMY/28-187DAFQ----------------------DDGRIQALSNEE........QRLQADLELVSD..LRSFHSEY.RDGIPY....A
Q1MPH9_LAWIP/28-190QAIS----------------------NVLAPINGLAVG..PN....SMIKPDWILTVN..IFQFDGA....PNNE....V
A9CIT8_AGRFC/35-194EAFE----------------------DTGKLGGVGRPG........QGLAIDYQVVSD..IRAFEID...TARNV....A
Q21EW6_SACD2/50-209ADIS----------------------AALKADQIQSFP..WD....TRTRPDNQLRIV..IEQFGGI....RGEN....V
Q2KZJ1_BORA1/28-186DGLT----------------------RDLGALDAGVLR..PP.....LGTPLWRVQTD..VQRFDMS....DKGP....T
C1DFS0_AZOVD/30-187RHLA----------------------WHLDSHRLVPEP..GA....PGFKPDVQVQLN..ITRLDSG....PQQP....A
Q4K7Z6_PSEF5/25-185SQME----------------------QKLGTRNLEGLP..KQ.....PGRPVLSLQTD..VRRFESL....PGRY....A
B2FMQ9_STRMK/34-197RGFE----------------------DSGRIHGVARST........AGIRADYKLSTD..VRRFESDYQGQATPT....V
B4EE37_BURCJ/32-191DDLA----------------------AQLGTIDVANSA..YP.....PGVPVYRISVN..VQRFESW....PGKR....A
F2KBG9_PSEBN/29-184RQVA----------------------GHLDSQRVVLAP..AT....QGFTPDVQVLLS..ITRLDSG....KAQP....A
Q32HV4_SHIDS/21-175ANLS----------------------TQLPGWVVASQP.........LGSAQDTLNVT..VTEFNGR....YDGK....V
Q5ZZ43_LEGPH/74-232TNLS----------------------TLMPGVVVQTSP..WN....NKFHPDYHLQVM..ISQFEID....IHGN....S
Q63QZ4_BURPS/39-198SALT----------------------RRLDTIDVANAA..YP.....ANVPVYRVSVN..VQRFESW....PGRH....A
Q6LI49_PHOPR/28-187QDLR----------------------SKQSQFWTTELT..PA....LSTYNSPRLQVK..IDEFNGH....YSGM....A
Q726I0_DESVH/33-194EHLG----------------------RGLGTEQVFVFP..WD....QAGAPAYRVLAD..VISMGGN....PDGE....A
Q87VH7_PSESM/30-185RQLA----------------------WKLDSQRVVMAP..AV....ANFTPDVQVVLS..ITRLDSG....AKQP....A
Q880H8_PSESM/27-191PQLE----------------------RRFGSRDMAGLP..KN.....GDQPVLSVRTD..VRRFESM....PGHY....A
Q8PCT0_XANCP/37-195RAFE----------------------DSGKIAAVARIG........AGIRSDYKLAID..VRRFESD....YAGQSLPAA
Q92K95_RHIME/41-197QTFD----------------------NT.GRIRVGKPG........QGLAIDYQLITE..LRAFEIST..DGAAT....A
Q9HUK2_PSEAE/30-186RQMS----------------------SELGSSRLALFP..EK....PGFTPQVQVMLT..ISRLDSG....PKQP....A
Q9KR87_VIBCH/27-185NDLR----------------------RKQSRYWPAPLN..AS....SIQQEHWKLQVR..LQRFNGV....YTGN....A
W8U487_YEREN/25-179TNLS----------------------NALPGWLVSSQP.........LDSDQDVLNVS..VTGFHGR....YDGK....A

PF03783

Q3ID64_PSEHT/43-256YV-----SYKRLAEA---EA-------GY------SDNE------------------PMSI---------CV----TQAI
O67219_AQUAE/42-258IF-----.GTTIAGG---WF-------EA------FKNT------------------PMEE---------AT----RDLI
Q484M1_COLP3/44-233..-----.GVGDKAA---YD-------SS------LNDK------------------VIDV---------AI----TDLA
F2G3K7_ALTMD/43-253YV-----SLKRLLEA---ET-------GY------TTNE------------------PMFE---------CV----KQSI
Q12QL7_SHEDO/43-252YT-----SLNRLAEA---EF-------GF------TTNE------------------PVQF---------CV----LQAI
Q2JNZ2_SYNJB/52-260..-----.VAGFGGG---SA-------TS------NEEK------------------LLVL---------AS----QQAV
A1BH58_CHLPD/18-218..-----.YRGGFGG---HL-------NQ------YKDT------------------PVGK---------AI----RACV
Q5QXH2_IDILO/43-251YV-----SLNRLAEF---EG-------GY------STNE------------------PVQL---------SV----KQAM
A5FHE8_FLAJ1/44-262YV-----NFKRLLEV---ET-------GY------TTNE------------------PVHM---------AV----TEAI
P73111_SYNY3/31-246NI-----LGIVNTGQ---DN-------QS------TSRA------------------PVGK---------AL----RAGL
Q9A7M6_CAUCR/61-270WG-----.GSGALFG---AA-------SS------TQSP------------------ELDS---------VA----NESV
Q21E38_SACD2/46-235..-----.GFGSVAG---YD-------GS------INDQ------------------AIGA---------AV----NAAV
Q5E246_VIBF1/42-258FV-----DYKELLEV---EL-------GY------TNNE------------------PVNI---------AL----MSAI
CSGG_ECOLI/41-255FI-----DYQRLLEG---EV-------GY------TSNE------------------PVML---------CL----MSAI
Q084E4_SHEFN/44-251FI-----DAQELLES---EV-------GY------TSNE------------------PVSL---------CI----AAAI
Q31MJ4_SYNE7/43-236..-----.VLGIGGG---SQ-------TF------NPEK------------------LVFI---------AT----EQAI
Q88H89_PSEPK/49-261FI-----EFKKLLEA---EV-------GY------TTNE------------------PAQL---------CV----LSAI
Q8YRU8_NOSS1/50-248..-----.VLGIGGG---SS-------TS------NEGK------------------LLTK---------AT----EKAI

PF13036

Q3SFY9_THIDA/15-198AT-----KKIGRMQG---AD-------YR------LEGN------------------ITSI..VK..RSSSV----KDVY
A6Q5P2_NITSB/9-203TI-----AKEGTIIA---PD-------LS------LSGK------------------IIQR.TTP..LPNGE----QRVD
B3ETR9_AMOA5/12-191VQ-----KKLGRELG---AD-------FM------LFGT------------------INAI..VDTKAEGKH----RVVF
Q6MR79_BDEBA/32-210TK-----KGPGGQIG---AD-------FI------INGR------------------LDSI..VQ..EVGKD----KSVY
Q6AQQ6_DESPS/10-192TL-----QKQS.LTA---PN-------MS------LSGK------------------IIQR.NQR..VDGGR----QLIE
B0SJE3_LEPBP/9-179NR-----LSIGKLKS---PN-------FF------VRCD------------------INEN..MF..TSNGE----KIVE
A1SWZ0_PSYIN/10-188NV-----AR..QEYG---AD-------FM------MQGQ------------------INTI..ID..MEGKT----QVRY
E6W062_DESIS/11-189TR-----SRMGQEIG---AD-------YM------LSGT------------------INTI..ID..VEGRT----QVKY
LPOB_PROMH/7-192AA-----IGLARYLQ---AD-------YI------LFST------------------VDGK......KDN..----....
Q0JYU2_CUPNH/3-193TL-----GLTRARIG---AD-------YS------LSGR------------------IGSLDSRS..AATGM----VQRY
A5G8H5_GEOUR/11-189TA-----VEFGRQIG---AE-------FL------LTAN------------------FAEI..VQ..KAGSV----TDVY
Q489B8_COLP3/10-189KA-----MQFGKQVG---AQ-------YM------LYGN------------------LASI..VK..SNKDQ----SDVY
A7MFR9_CROS8/11-217KA-----IGIARNVG---AQ-------YV------LYAN------------------ASGN..VN.......----...A
Q3B6Q7_PELLD/9-191TV-----AGKGRMIA---PE-------LS------LSGK------------------ILQR.NIR..VSSGT----QQVE
Q098T7_STIAD/8-189AA-----KGPGQQVS---VD-------FI------MTGD------------------LASI..IQ..EVGND----KLVY
C9RQT0_FIBSS/10-191TT-----KDAGMEIG---AD-------LM------LTGT------------------INSI..ID..QEGGE----QVVF
A0LBE2_MAGMM/8-196TV-----AQDGTLAA---PD-------LY------LTGK------------------IVVA..TTRSADGDR----QQLN
A1WFI2_VEREI/13-199ST-----AKMGQMTA---AK-------YS------MEGE------------------LTSI..VK..QSSAT----KDVY
B2KBR6_ELUMP/7-185TR-----KAFGREVG---AD-------FM------LSGV------------------LNSI..VD..QEGKR----SVVY
A9EYZ5_SORC5/15-197HI-----AEYNRQLG---AK-------YY------LTGK------------------VFTA..DE..RTEDE----RRVQ
A6VT68_MARMS/21-199TV-----AKFGLEQG---AG-------FA------LSGS------------------INSI..VD..SNGDQ----RVSF
Q11SM3_CYTH3/10-189TM-----KKFGLEIG---AD-------FI------MQGS------------------INSI..VD..AYKKD----KVVY
Q2IJK4_ANADE/8-185TA-----KGPGAQVG---AD-------YV------LTGQ------------------IASI..VQ..EVGAD----KVVY
A1WY34_HALHL/8-186TR-----KAMGEELG---AD-------YM------LLGS------------------VNSI..ID..QEGRR----QVRY
C1DFX4_AZOVD/10-225SG-----RRSGGQGG---AA-------YR------LECT------------------VTVL......APTKE----QPSV
LPOB_PHOLL/7-188KA-----IGLARYLN---AE-------YV------LYSI------------------VSGN..SD.......----...K
D1B294_SULD5/10-196TI-----AAEGQIIA---PD-------YS------LSGK------------------VIQR.DTK..IGSGD----KRVD
Q0VKU2_ALCBS/9-185TA-----AAMGRQIG---AE-------FM------MYGN------------------FSSI..VK..RDGST----KDVY
B0ST18_LEPBP/7-177SR-----LAVGKFKS---PS-------HQ------IKGE------------------INEV..VN..YESGN----KIQY
Q3IL02_PSEHT/16-195TA-----VAFGKQIG---AQ-------YM------LYGN------------------LSSI..VK..SNADK----SDVY
D3UIZ9_HELM1/11-192TT-----TEEGTLVA---PT-------LS------LSGR------------------IGQS..VH..RMGET----KKVD
A4SYG3_POLSQ/19-190TI-----SKTGNMQG---AQ-------YR------IEGS------------------IASI..VK..TNKDV----KDVY
LPOB_KLEP7/10-212KA-----MGIARNVG---AQ-------YV------LYSN------------------ATGN..VN.......----...A
B7VH52_VIBTL/9-185SA-----IQFGKMVG---AQ-------YM------LYGN------------------LSSI..VK..KAGSD----EDVY
C5BFM3_EDWI9/9-196KA-----IGLARQVS---AQ-------YV------LYTT------------------VSGN..VQ.......----...A
LPOB_DICD3/7-193KA-----VGLARYVG---AQ-------YV------LYAD------------------ASGD..VK.......----...S
E4PGL0_MARAH/14-201TI-----RQTAAQAG---AD-------FR------LGGR------------------ISSLDAID..RNTGT----QSRY
F2K6Q3_PSEBN/9-189TV-----AKTGNMIA---AK-------YR------LEGS------------------ISSI..VK..RSSDY----KDVF
M1FI84_9ALTE/9-189GV-----QRKGTLKA---PD-------LS------LSGK------------------ILQR..NH..TAGKE----QQVE
O25995_HELPY/13-200TT-----VEKGTLKA---AD-------LS------LSGK------------------VSSI.AAS..ISSSR----QRLD
Q0PC46_CAMJE/11-196TI-----AKKGTLVS---PD-------FS------LAGK------------------IRQD.NVK..LSNGK----TQVE
Q32EW5_SHIDS/10-210KA-----IGIARNVG---AH-------YV------LYSS------------------ASGN..VN.......----...A
Q5NES4_FRATT/12-191TA-----TKIGQHIG---AR-------YM------VYGS------------------IQDIDNTN..VDGDK----RSKF
Q6D676_PECAS/7-191KA-----IGLARYVS---AQ-------YV------LYSD------------------VSGD..VK.......----...S
Q8EHZ4_SHEON/13-190TA-----IKFGRQIG---AQ-------YM------LYGN------------------LSSI..VK..QDGST----KDVY
W8U423_YEREN/7-192KA-----IGLARYVS---AQ-------YV------LYSD------------------VSGD..VK.......----...S

PF04052

TOLB_PELCD/21-131VD-----FNQWALLG---AE-------IL------IKGG------------------YQ.L---------QG----ER..
A5EXH2_DICNV/23-121ID-----YAEFSGLG---AS-------YV------ALGR------------------TLDA---------NG----SS..
Q4FSA5_PSYA2/29-127GT-----LPVWQSMG---IP-------YL------VVGS------------------TRSS---------RG----K...
A0L4U9_MAGMM/33-145PD-----FRKWRLVG---AD-------AV------VQGA------------------ITYR---------..----GS.R
TOLB_SHELP/23-128MD-----LKAWSNVA---AE-------AV------VMGT------------------VKPY---------GP----DQ..
TOLB_SHEFN/23-128FT-----AQNWANVE---AE-------AL------VVGT------------------VKPY---------GA----DQ..
TOLB_SHEDO/23-128FA-----AASWGKVG---AE-------AV------VMGS------------------IKPY---------GV----DQ..
TOLB_AERHH/23-127IN-----FAPWASQG---VE-------AV------VVGS------------------IAAV---------GD----GT..
TOLB_PSEA6/23-127LD-----YSAWAATG---VE-------AI------LVGS------------------VTPE---------GP----DR..
TOLB_IDILO/24-128ID-----YSAWAKMG---VE-------AI------LVGS------------------IEPY---------SV----DR..
TOLB_PSEHT/24-128IN-----YASWVNKG---VE-------AI------LVGE------------------VEQQ---------SN----GR..
TOLB_COLP3/24-128ID-----YSAWANLG---AE-------AV------LLGN------------------INEV---------AP----GR..
TOLB_VIBF1/24-128IN-----YEAWTKMG---VD-------AI------VTGE------------------VKLN---------AQ----GK..
A1SSW4_PSYIN/22-127LD-----YALWHKMG---IE-------AL------LMGE------------------VSPS---------PE----AG.K
TOLB_ACTP2/28-129VN-----SQQWTDIG---VD-------SV------VVGQ------------------VTPT---------GG----G...
TOLB_HAEDU/28-129IN-----SQQWTDIG---VD-------VV------VVGQ------------------ITPA---------NN----G...
TOLB_ECOLI/23-127VQ-----PAAWSALG---ID-------AV------VVGQ------------------VTPN---------PD----GS..
TOLB_PHOLL/23-127VT-----PAAWSALG---ID-------AV------VVGQ------------------IQPS---------AD----GG..
TOLB_PASMU/26-129VN-----PEAWAALG---ID-------AV------VVGH------------------VTPA---------NG----S...
TOLB_MANSM/28-129VT-----PDAWAALG---VD-------AI------VVGQ------------------VTAT---------GN----G...
TOLB_BLOFL/24-133II-----PTFWEKLG---IN-------TV------VLGA------------------INIK---------NE----N...
TOLB_WIGBR/21-130NN-----SINLNKLN---IN-------TI------LTGK------------------ISLN---------Y.----NG.E
TOLB_THICR/23-128ID-----FYQWKQLG---VD-------NL------LMGR------------------IT.E---------EA----NG.T
TOLB_MARMS/24-128VF-----YRDWRLLK---SD-------YV------VIGA------------------IK.K---------LP----NN.Q
TOLB_SACD2/39-140IF-----YRDWRILG---TD-------YL------VIGD------------------IQ.R---------SE----SG..
TOLB_CHRSD/24-125VH-----YQDWQQLD---SD-------YL------VVGK------------------ID.N---------QG----GE..
TOLB_HAHCH/21-126IY-----FRDWGLLG---QR-------YL------LVGG------------------VQYD---------AP----SQ.V
A1U1B4_MARHV/36-139VY-----FRDWRMLG---QR-------YV------LVGQ------------------LT.R---------NG----DR..
A4XRS6_PSEMY/23-126VI-----YRDWKALG---AQ-------YV------LVGN------------------IV.P---------NG----GR..
C1DRF3_AZOVD/23-126II-----YRDWNALG---AQ-------YV------LVGN------------------IV.P---------AG----GR..
TOLB_ALCBS/30-132MI-----YRDFKVLG---TE-------YV------ITGS------------------MKRQ---------ET----GG..
A1WZ69_HALHL/29-133VR-----FSTWRAQG---VD-------HL------VVGG------------------ID.D---------AG----DG.R
TOLB_ALKEH/25-129TR-----FSAWRALG---MD-------YL------VTGR------------------ME.M---------DG----HR..
TOLB_NITOC/30-133IQ-----FQDWRRLG---SE-------GL------VIGK------------------VI.S---------LG----AD.R
TOLB_XANCP/27-132VQ-----FQTWRTLK---QN-------YI------VVGR------------------VM.D---------AG----EG.A
TOLB_METCA/26-127VQ-----QAAWQALG---QD-------FV------VVGQ------------------IR.P---------SG----DG..
A9C288_DELAS/41-141PD-----VAMWRQKS---AD-------SL------AVGS------------------IT.R---------LA----DG.R
A1W6N8_ACISJ/43-143PD-----LSLWRQRK---AD-------AL------TSGS------------------IT.R---------LA----DG.R
A1TSM5_ACIAC/38-138PD-----VALWKQKG---AD-------SL------TTGS------------------IT.R---------LP----DG.R
A1WGN1_VEREI/17-117PD-----LALWRKKN---AD-------SL------LAGS------------------VA.L---------SS----NG.R
TOLB_RHOFT/25-125PD-----VALWRQKG---AD-------SL------VTGS------------------VS.R---------LA----DG.R
TOLB_POLSJ/27-127PD-----LAIWRQKG---AD-------AM------VTGS------------------VS.P---------LA----DG.R
A2SFG9_METPP/22-122PA-----MSDWRGRS---AD-------AL------VGGS------------------VT.R---------LA----DG.R
A4G7Q1_HERAR/25-124VN-----LADWKSRG---AD-------AL------VVGS------------------VS.R---------LP----DG.R
TOLB_RALME/45-145VD-----LGSWKAKG---AD-------AF------VAGS------------------VT.P---------TS----NG.Q
TOLB_BURXL/28-128VD-----LGSWKAKG---AN-------AF------VSGS------------------VN.R---------LP----NG.Q
TOLB_BURPS/28-128VD-----FGAWKAKG---AN-------AF------VAGS------------------VN.R---------EP----NG.Q
TOLB_AZOSB/27-127PD-----LGSLRSRG---AD-------AA------LAAS------------------VF.P---------QG----DG.R
TOLB_AROAE/27-127PD-----LAGVRARG---AD-------AV------LAGS------------------LY.P---------QA----DG.R
TOLB_DECAR/27-127VN-----HAEWKGKG---AD-------AL------AAGS------------------IA.R---------ST----DG.R
TOLB_NITEU/24-124IR-----YIDWQGRG---AS-------AL------VVGS------------------IS.P---------LP----DG.R
TOLB_NITMU/32-133VS-----FPDWINRG---AS-------AL------AIGT------------------AI.P---------VS----GG.Q
A4SVI2_POLSQ/34-134PN-----YKSWAARG---AD-------AL------VVGS------------------VV.Q---------TG----NG.Q
TOLB_CHRVO/26-128IR-----YPLWQAAG---AQ-------SL------AIGK------------------VE.S---------AG----GG.Q
TOLB_METFK/28-133VN-----YQDWAAIQ---AQ-------AL------TIGN------------------IETL---------PG----NR..
TOLB_THIDA/29-131VD-----YAAWRTKG---AE-------AM------VIGQ------------------VV.A---------LG----GG.R
TOLB_PARL1/38-141PR-----FGDWRVIN---SQ-------AL------VTGQ------------------TR.M---------EA----DG.R
B0T057_CAUSK/36-138PR-----FPDWQATG---AQ-------AL------INGQ------------------VT.V---------GA----DG.V
TOLB_MAGSA/31-138PR-----FPDWKAIN---AE-------AL------VSGK------------------IE.S---------GA----DG.R
TOLB_RHORT/33-140PQ-----FADWRAIN---AQ-------AL------VQGE------------------VQ.P---------QG----DG.R
TOLB_BRADU/34-141PQ-----FQNWKTIN---AQ-------AL------VTGR------------------MT.R---------QP----DG.R
TOLB_CHESB/30-133PR-----FEDWKVIN---AQ-------AI------VTGR------------------VT.E---------EP----GG.R
TOLB_RHIEC/30-132PR-----FEDWKVIN---AQ-------AL------VTGR------------------VT.Q---------EA----DG.R
TOLB_RHILO/30-133PR-----FDDWKVIN---AQ-------AL------VTGS------------------VS.K---------EA----DG.R
A7IJU3_XANP2/44-146PR-----FQDWRVIN---AQ-------AL------LTGR------------------VT.R---------QA----DG.R
Q0ALY5_MARMM/27-134PR-----FSDWRVIN---AD-------AL------LVGS------------------VT.I---------QE----DG.R
E0TDI8_PARBH/29-136PR-----FADWRAID---AR-------VL------LVGE------------------VT.A---------LS----GG.R
Q0C5V5_HYPNA/26-132PR-----FADWKIIR---TD-------AL------VVGA------------------FE.E---------LP----DG.K
B0U7W3_METS4/31-134PN-----FAAWKEAG---AQ-------GL------VTGR------------------VT.R---------DA----SG.G
A5G2K7_ACICJ/55-161PV-----WNNWSILG---AQ-------AL------VTGQ------------------VT.S---------PG----AG.Q
Q0BT48_GRABC/51-150PN-----FQSWGAIG---AQ-------AL------VTGN------------------VS..---------.G----SGGS
TOLB_DINSH/31-138VQ-----YADWKAIN---AQ-------AL------VTGS------------------VS.V---------AS----DG.R
TOLB_RUEST/28-134VN-----FTDWKAIN---AQ-------AL------IAGA------------------VS.L---------SG----.D.R
TOLB_RUEPO/26-132VQ-----FADWKAIN---AQ-------AL------ITGA------------------VS.V---------SG----.N.R
A1AZV4_PARDP/48-153VS-----YEDWKAIN---AQ-------AL------ITGS------------------VK.V---------QG----.G.K
TOLB_ROSDO/30-136IQ-----YADWKAIN---AQ-------AL------ITGA------------------VA.V---------QG----.N.Q
TOLB_JANSC/31-137VA-----YPDWQAIN---AQ-------AL------ITGQ------------------VE.A---------RA----DG.Q
TOLB_SPHWW/23-136PD-----YMFWTQSG---AQ-------AL------IQGF------------------VQ.A---------NG----DG.S
TOLB_RUTMC/20-119PN-----FDKWKAKK---IE-------AI------VLGK------------------LEKI---------SK----KV..
TOLB_ACIAD/27-123IQ-----ASAWQAAG---IP-------YV------VVGN------------------LK.P---------AA----NN.A
TOLB_ORITB/37-144PL-----FTAWSQIN---AN-------IL------INGE------------------IT.K---------ID----ST.D
TOLB_RICPR/20-127PL-----FAAWRQIN---AS-------LL------VNGE------------------VK.T---------LE----NG.K
TOLB_COXBU/25-130ID-----YSYWRKQK---VN-------AL------VVGA------------------INPL---------GM----RR..
A0LGA1_SYNFM/45-154IK-----FPDWRRLG---AD-------YM------VRGN------------------YLVQ---------GG----T...
B3E270_GEOLS/25-132VD-----FVPWLSAG---YD-------LL------IRGE------------------YELR---------GQ----E...
A1AU95_PELPD/31-138AD-----FNSWLKGG---YD-------LL------VRGE------------------YSVK---------GD----D...
A5GDC0_GEOUR/22-129FD-----FAPWQAAG---AN-------LL------VKSG------------------YTVS---------AD----S...
A7H870_ANADF/28-134IR-----FARWSDVG---AE-------GL------VKAR------------------MRQA---------GD----E...
TOLB_ANADE/26-133IR-----FARWADVG---AD-------GL------AKAR------------------VRRG---------PG----G...
TOLB_WOLSU/19-119MD-----YGAYRQKK---VD-------LV------AKVK------------------AGRE---------GS----G...
TOLB_HELHP/20-117VA-----YKDYADKK---ID-------LL------AQIK------------------VSKS---------SN----S...
Q2GJ56_ANAPZ/25-129AY-----SNVWRELK---HD-------IL------LTGN------------------VQ.E---------LS----HG.R
A7ZC42_CAMC1/20-118AA-----TNTMSDKG---VE-------LI------FRYA------------------LEGS---------MG----SP..
TOLB_HISS2/28-126VI-----SDVWSSLG---ID-------AV------VVGQ------------------VT.P---------NE----KG..
TOLB_VIBTL/24-127VN-----FDAWTNLG---VD-------SL------LTGS------------------IT.K---------NA----EG.Q
TOLB_SHEPW/23-126FD-----AKAWMAQP---AE-------AV------VMGS------------------IKPY---------GA----DK..
B9KHU7_ANAMF/28-134PD-----SNAWTSVA---KD-------VL------VTGS------------------IK.E---------FA----QG.R
C5AV32_METEA/36-138PN-----FEAWKGAG---VQ-------AL------VTGR------------------VG.R---------DA----SG.R
M1FG56_9ALTE/39-140VH-----FRDWRLLG---QR-------YV------LVGQ------------------LT.R---------QG----DR..
M9X4A4_MANHA/28-124VV-----ADQWSAIG---ID-------NI------VVGQ------------------VS.S---------TG----GG..
TOLB_HAEIN/27-122VN-----PEAWSNIG---ID-------AI------VIGQ------------------VV.P---------SG----NG..
TOLB_MYXXD/22-128IN-----FSRWADVG---AE-------AL------VKVS------------------LA.Q---------DG----GV..
TOLB_BRUA2/35-138PR-----FEDWKVIN---AQ-------AL------VTGR------------------IT.K---------QP----DG.R
TOLB_RHOS4/31-136VA-----YGDWKAIN---AQ-------AL------ITGS------------------VS.A---------SG----DR..
TOLB_NITWN/40-146PQ-----FANWKTIN---AQ-------AL------VTGR------------------MT.R---------QG----DG.R
TOLB_PELUB/22-136PR-----FEDWNLIK---AQ-------AL------VTGK------------------VT.F---------VD----EK..
TOLB_PHOPR/24-127ID-----YRAWTAMG---VD-------AL------VTGK------------------VT.K---------NA----EG.N
TOLB_VIBVY/24-127IN-----FDAWTNLG---VD-------TL------LTGS------------------VT.Q---------NE----KG.E
TOLB_BORPE/38-138VA-----HDDWRAKG---AD-------FL------AYGS------------------IT.R---------GP----DG.R
TOLB_PSESM/25-127VI-----FRDWKALG---AQ-------YV------MVGN------------------IT.P---------AG----GR..
TOLB_SHEON/23-127FD-----ANAWTNVS---AE-------AL------VVGS------------------VKPY---------GA----DQ..
TOLB_XYLFA/27-132IR-----FPTWQALK---QD-------YI------VVGR------------------VL.D---------AR----QG.T
V6EXY5_9PROT/28-135PR-----FADWRQIN---AE-------AL------VSGK------------------IE.V---------SG----DG.D
W8U1X0_YEREN/23-122VT-----PAAWTALG---ID-------AV------VVGQ------------------VQ.P---------SA----DG.S

PF05643

Q1LCD0_RALME/11-212GN.....AGGGLVGA---..-------.L------IAAA------------------VAQV--INHT.VDRS----YGVA
D3V518_XENBS/12-210DN.Y...SSGGLVGM---..-------.L------VSAA------------------ISQI--ANTI.TDRG----HDIA
Q2SHH4_HAHCH/14-212DG.....GGNGLAGM---..-------.L------VAAV------------------VEQV--VNSV.SDKT----PELS
E0SD08_DICD3/9-210QS.N...SNGGIVGL---..-------.L------VQAA------------------VTQI--ANTI.TDKG----HDIA
Q887N9_PSESM/11-213GN.N...SGGGLVGM---..-------.L------ITAA------------------VKQI--INSA.TDAG----DPIA
A7I3D9_CAMHC/9-212DS.....SSGGLGGL---LA-------NV------IIAA------------------IAQV--ANDV.GDAA----YDLS
S6BPX5_PSERE/11-212NQ.....NSGGLVGM---..-------.L------VAAA------------------VKQI--ISSVQEDAA----YPIA
X2HCW4_9NEIS/9-212NN.....SNNDIFSL---..-------.M------VNAV------------------ITQI--SNKV.SDKA----YIVA
Q0K4M2_CUPNH/11-212GN.....AGGGLIGA---..-------.L------IGTA------------------IAHA--ISSV.SDAA----YGVA
Q6CYP8_PECAS/9-210QS.N...SNGGIIGI---..-------.L------VQAA------------------VSQI--ADTI.SDKG----HDIA
A9BNZ3_DELAS/11-211QS.....SGGGLVGI---..-------.L------VTAL------------------LNQI--LDTM.NDRS----VQIA
D3VLQ9_XENNA/12-210DN.H...DAGGLVGM---..-------.L------ISAA------------------ISQI--SNTV.MDKS----HDIA
G8MBI9_9BURK/12-216GF.NVS.VGGGLVSA---..-------.L------VQTA------------------VSQA--VNVA.TDKS----WDVA
V5UBV7_9BURK/13-214GN.N...SGGGLIGM---..-------.L------ITAA------------------VKQI--VNSV.SNAG----YTVA
Q7CJE6_YERPE/11-209NN.....SSGGVIGL---..-------.L------VQAA------------------VSQI--ANTI.TDKS----HDVA
W0LEC8_9ENTR/9-209NN.....SSGGLLGM---..-------.L------ISAA------------------ITQI--VDTI.SDKG----FDIG
A3MYU4_ACTP2/7-208HS.....NDGALVA.---..-------.L------VKAA------------------VSQV--VDTT.KDKG----YEVS
A1WBC0_ACISJ/14-214KR.....SSGGLVGM---..-------.L------VSAL------------------IDQI--VETL.SDRS----VQIA
Q4KAD7_PSEF5/11-212NN.G...NNGGLVGM---..-------.L------ITAA------------------VKQI--INTS.TDAG----HPIA
I0HUV3_RUBGI/17-218NS.S...NQAGLIGV---..-------.L------VEAV------------------VKQI--VHTV.SDSS----FQYA
M5DUQ1_9GAMM/13-209S......SGGGLVGM---..-------.L------VSAV------------------ANQI--VGSI.SDAT----PQLA
B8F6X7_HAEPS/7-208NS.....NDGLLVM.---..-------.L------VKAA------------------VSQI--MDTS.KDKG----YQIA
B4EZI8_PROMH/10-209DT.....ASNGLVGM---..-------.L------VSAV------------------VTQI--VDTI.ADKS----HEIA
Q8XS06_RALSO/13-216GN.SVDVNAGGIIGV---..-------.L------VSAA------------------VKQI--VNTA.IDSG----YSVA
Q7N0C6_PHOLL/9-209QS.....NSNNLVGM---..-------.L------VSAV------------------VSQI--ANTI.MDKG----HEIA
H2IYH4_RAHAC/9-209DN.....NNGGIIGM---..-------.L------VQAA------------------VKQI--SSTI.SDKG----HDIA
E6W7V9_PANSA/9-211GN.N...NSGGIIGI---..-------.L------VSAA------------------VKQI--ANNV.TDKA----HTVA
D8J254_HERSS/11-214QQ.Q...NSNGLIGM---..-------.L------VSAV------------------INQI--VNTT.SDAS----YKMA
M4XNX8_PSEDE/9-210SQ.....NSGGLVGM---..-------.L------ISAA------------------VKQI--ISSAQEDAS----YPIA
A8GBK2_SERP5/9-211NN.N...SGGGLLSM---..-------.V------ISAA------------------IAQI--ADTI.SDKG----FDVG
D8MNT7_ERWBE/9-208NN......NQGLVGM---..-------.L------VAAA------------------VKQI--VNNV.SDEA----HTVA
Q21SI9_RHOFT/14-214RS.Q...QQGGLAGL---..-------.L------ITAI------------------IKQV--MATA.LDQS----HQVA
F6AGD6_PSEF1/12-213QQ.N...SGGGLAGI---..-------.L------ITAL------------------VNQV--MNSL.NDRG----HEIA
C5AJP0_BURGB/13-221GGMQGGVQGGGMVGL---FV-------NL------AQAA------------------VKQI--AKTV.TDES----VDVA
B1Y7Y1_LEPCP/17-218NN.N...NQGGLVGL---..-------.L------VTAV------------------VKQI--MHSV.VDSS----HPVA
F4HEQ1_GALAU/9-210NN.N...NSSGLIAA---..-------.L------VVAA------------------VKQI--TNTI.RDDG----FNIA
B4E8N1_BURCJ/12-217GN.NMSVNAFGIVGA---..-------.L------VQAA------------------VKQV--AHSL.TDEA----HDVA
C1D4H4_LARHH/10-211QN.N...SGGSLIGM---..-------.L------VNAA------------------INQI--VHNL.ADHG----HDIA
Q63PN9_BURPS/16-221GS.NVDFSGFGLIAT---..-------.L------AQAA------------------VKQI--AHTL.SDDA----VDVA
E5AND7_BURRH/16-220GT.NVNVGAFGLIGI---..-------.L------AQAA------------------IKQI--AHTL.SDDS----VDVA
Y1124_NEIMB/7-208SN.N...SNSGLLGA---..-------.L------VSAV------------------VNQI--ANSL.TDRG----YQVS

PF05211

F8KS85_HELBC/10-259.TYTYQATDSGGFAG---AN-------TI------SHTE................LEKNNDNAIRKILNQMY----VIVM
HPAA_HELPY/13-258FLKTTHSSHSGGLV.---ST-------MV------KGTD...................NSNDAIKSALNKIF----ANIM
O25234_HELPY/14-271..YTYKHNNSGGLNS---SN-------SI------IHEY................LEKNKEDAIHKILNRMY----AVVM
K4RMR3_HELHE/10-260.RYTYQTTNSGGVAG---PK-------VV------SHTE................LEKNNDEAIRKILNEMY----PLVM
O25166_HELPY/2-249.RVELRRTNSGGFVP---KT-------FV------HRIK.................ETDHDQAIRKIMNQAY----HKVM
F8KRD2_HELBC/14-268.SYFQEATSSDSFAG---AN-------SV------SRGATSLDSFDEANAVGGR.VDKNHHDAIQTILSKAY----GVVV
E7AAG1_HELFC/14-275LSYFQQA.NSDSFAG---AN-------SI------SRGATSLDSFDEASLDSRNHTDSNHDNAIHTILNQVY----GVVI

PF03886

Q30ZW7_DESAG/36-191TM-----EAMWRLDS...GG.......AD......TGEW------------------HY.FVNRLSAQQN.N....YSGY
Q1LFX2_RALME/21-179SM-----DALWTIQP...PG.......KQ.P....AIAG------------------RS..VVREAVASD.G....FDAI
A8GCL1_SERP5/25-179II-----RGEWVLNH............QG......NLTK------------------RP.FSLELKQGED.G....YDAL
Q6D463_PECAS/26-181VV-----RGEWMLTY............QG......KVLK------------------RP.FSVLLPQTED.G....YDAL
A4XPV2_PSEMY/32-188IL-----EAQWRLLD...RN.......GQ......LRDS------------------RL.IRMEEAHGGP......LAEQ
Q5FP36_GLUOX/24-182AL-----TADWALIP...SD.......EH.Q....PIQR------------------SR.GSFTAQGTVT.T....DSGK
Q2YQ49_BRUA2/33-193VV-----EMAVRLLS..DKT.......GE......VRAT------------------RV.FRTAIPVTGT.S....NAAY
Q8Y1T9_RALSO/34-193SA-----LVTWRVSRDAAAP.......DS......ALTC------------------QA..TLTEPAGRE......VDAV
Q15V64_PSEA6/27-193IS-----SGQFWRTG...NGRTDAGKNGK......SVST------------------NS.FSFTSPLTQK.G....YSHS
Q3IC12_PSEHT/29-195DI-----SGLWRLYYTHPET.......GR.R....LLSL------------------HN.FANVTQLDGD.G....YDAL
B2JLP5_BURP8/35-193LV-----DGVWTVSR...ST.......SA.D....TLTC------------------HS..VVSEPVSG..G....YQAV
Q1LQW2_RALME/27-187SA-----SIAWTVRR..LPD.......GK......VLGG------------------RT..EAELPAPGQ......VDGV
Q12RG9_SHEDO/35-202SL-----QAVWTLKDLSSTTKAIPASPQK......DGQG------------------QH.FQASVPAEQS......ATGL
Q2LY73_SYNAS/41-204LL-----KAQWTIFA....G.......QD.R...GGVTH------------------MA..AFTERLADG.S....YEAL
Q6D6W6_PECAS/27-186TF-----EADWSLSA....I.......EG.ED.RARLLC------------------RS..QFTEQATG..G....DIAM
A5G4U3_GEOUR/34-200VL-----SARWGVFA....K.......KE.TTDESLLVK------------------EA..AITEKVDGQ.S....YDAM
B2JLL6_BURP8/44-202VL-----VARSTIMD...GA.......KR.E....ILRI------------------QQ.VSLTEETDGE.S....DSAI
A1AL18_PELPD/32-193SM-----RVQWTLSA...AD.......GT......CVAA------------------RV.STCMEKLKDS.R....YDTL
A0LKZ6_SYNFM/33-196RL-----DAQWTIVD...VA.......AN.T....TVTT------------------KK.TGIARPVASP.G....HESL
Q13YJ7_BURXL/36-194LI-----DAVWSVRP....L.......YS.Q...TVLTC------------------RS..VVSETVAS..G....YDAL
A5G0A2_ACICJ/27-179EL-----AADWRGVR...AG.......KA......VAAG------------------RV..RIAERCGG..G....AAAE
C1DGP1_AZOVD/26-184DL-----DVLWTIRS...AR.......GA.L....VKAG------------------RS..TLSEPPGGA.G....TEAL
A6VZG3_MARMS/30-189HI-----SGRWQVIS...AT.......GE......LSAS------------------NT.FEVQRKLKSD.G....YSTM
Q98M02_RHILO/33-190EV-----DLFVRLLN..DRN.......GE......VRAS------------------KS.FTASAPVSGS.G....NPAY
Q2RRJ7_RHORT/36-194IL-----TARWTIAD...GA.......SR.Q....SVVS------------------NG.AQVTVPLTTA.G....DAGV
Q1QVZ8_CHRSD/44-208VV-----GGDWRIRD...AQ.......DR......TLSR------------------ES.FAIERPLDSD.G....YPAL
Q1GM15_RUEST/25-182EL-----SGQYAVSS...PD.......GR.V....REFV------------------KR.FHIETPVTES.G....PAAA
A1B5I4_PARDP/26-183RL-----TGRYFVSD..EGA.......GG......ANQA------------------RS.FDISVPLADQ.N....PAAI
Q5LU10_RUEPO/22-179AF-----SGQYFLTS...PA.......HG.H....LERA------------------RR.FSYAVPMSGE.T....IPAF
B2JP31_BURP8/35-193AI-----DARWTVHA...AG.......RT.T....LLTG------------------RS..TVREPVAGA.G....YDAL
Q7VVC7_BORPE/29-191LL-----DATWRVRPV.NLV.......AP.A.....LVC------------------RT..RVDVPAGGERD....TAAL
A0KPP1_AERHH/27-182VL-----SGRWRLLT...EE.......GT......VLRD------------------VP.FQQVRVLPAD.G....YGTL
Q2IEA0_ANADE/30-187VL-----EARWALRR....G.......TE.V....VERG------------------VT..RTRERPRAT.G....TAAS
Q5FRD2_GLUOX/34-193LV-----TGMLSVHP...AGK....MIGP.V....MTTP------------------VV.WQSPEPVAS..S....TAKL
B2JEG5_BURP8/31-189AV-----DALWTVRV...AG.......RT.T....LLTG------------------RS..TVREPVQGT.D....EAAL
B3EAR4_GEOLS/32-189VV-----DALWEIRS...AK.......DT.R....PVTG------------------RS..KMVETIGSA.D....YEAV
Q082L0_SHEFN/33-191RL-----NANWELTNNSLHQ...............TLAK------------------QN..FIAVTNAGS.T....AAEL
B2JWQ3_BURP8/37-194ML-----VVGWSILT...PD.......SK.R....VLNG------------------RS.LVIRRVNVG..G....YDAL
B2JKL2_BURP8/40-196SV-----TARATLLV...GG..........K....VAGQ------------------RT.FIARAPASSA.D....AAGG
Q7NV00_CHRVO/26-184AL-----EAAWQLQN...AA.......DG......RILA------------------RGGFSRSQPVASD.Q....PGAL
Q0BS49_GRABC/26-184LL-----EAGWTITR...IG.......SK.H....PPER------------------DR.TVITASGPVK.T....DDDI
B2JGI0_BURP8/37-192LI-----DAVWSVRA...VR.......TQ.A....VLTC------------------RS..VVSEPVSG..S....YDAI
Q3J7M0_NITOC/28-188VV-----AGSWRLRN...GN.......GD......VVAQ------------------SS.FKQDTPLAED.G....YEAL
Q87N56_VIBPA/29-189EI-----EGEWLLID...AS.......GN......VVRS------------------SQ.VKILMPLQDE.G....YDAL
A7IMU5_XANP2/47-206VV-----ELSAKLIG...TQ.......SG.R....ILAA------------------QV.FKAAVPAAST.A....GPVA
Q60BV1_METCA/32-192VL-----SVRWSVSS...GD.......GKTE....LLVR------------------ES..RYAEPAAGT.D....YRAT
Q7N608_PHOLL/25-180IL-----QGYWTLTH............QG......SVVK------------------QP.FNLELKQEED.G....YDDL
Q0BVR3_GRABC/46-207LL-----LAQFAIRS...SR.......SH.T....ALMA------------------QP.VRISHSTAGG.GSATETASL
A4XP77_PSEMY/28-187LI-----RLEVNLVD...AR.......DQ.R....ILAS------------------RR.FSISQQASDT.S....VPAV
Q1MPH9_LAWIP/28-190IL-----DAIWTLSS............ST......HKIS------------------HTGRFTKKLMTGP.S....ITDM
A9CIT8_AGRFC/35-194NI-----EISVKLLN...DR.......NG.T....VKAQ------------------EV.FRASARVSGS.G....NANF
Q21EW6_SACD2/50-209KL-----VARWHQLD...LK.......NK.T....DAKS------------------GI.VRLSVNLNDD.A....METY
Q2KZJ1_BORA1/28-186VL-----DVTWRVRPV.SLK.......GG......ALLC------------------RT..VVTMPVGAE.D....VASL
C1DFS0_AZOVD/30-187VL-----EAQWRLLD...RR.......GH......LSES------------------RL.IRLQEPHQGS......SADQ
Q4K7Z6_PSEF5/25-185LI-----DVVWSLRQ....R.......GE.GGPARSLTC------------------SS..QIRQPAGV..E....LNSL
B2FMQ9_STRMK/34-197VI-----EVNAKLIH...VA.......DQ.R....VVAD------------------RT.FRQAQPVGST.D....VPAV
B4EE37_BURCJ/32-191AV-----DAVWSVRS...LA.......TQ.A....VMTC------------------RT..SVAEPVAD..G....YDAL
F2KBG9_PSEBN/29-184VL-----DAQWRLID...RR.......GK......VREN------------------RI.VHLQEQHAGT......TAAQ
Q32HV4_SHIDS/21-175IV-----SGEWLLNH....Q.......G.......QLIK------------------RP.FRLEGVQTQD.G....YDEM
Q5ZZ43_LEGPH/74-232IL-----RAEYLIYR...KE.......EL.I....YKGN------------------AY.YHIKVPLIS.......IETL
Q63QZ4_BURPS/39-198AL-----AAVWSVRA...LP.......SQ.A....VMTC------------------RT..DVVEPVPA..G....YDAL
Q6LI49_PHOPR/28-187KI-----SGEWMLVK...SD.......GD......LNGV------------------YP.FQFQVPLQEE.G....YDAQ
Q726I0_DESVH/33-194TL-----HVRWTVVP...RS.......GA.A...EPVTR------------------RT..DLSEKCPGP.D....HADW
Q87VH7_PSESM/30-185VL-----DAQWRLLD...RK.......GH......VRDS------------------RL.VHLEQVHAGS......SADQ
Q880H8_PSESM/27-191LI-----DVVWTLGL...RDAGATAGSKR.Q....SLTC------------------SS..VIREQAAE..G....MENL
Q8PCT0_XANCP/37-195TI-----ELNAKLLH...SS.......DQ.R....VVAS------------------RT.FTVARPSSST.D....TAAV
Q92K95_RHIME/41-197VV-----EIFAKILD...DR.......NG.T....VRKQ------------------QA.FRAVVPVRGA.G....NPAF
Q9HUK2_PSEAE/30-186VI-----EARWRLLD...QK.......GD......LKDS------------------RV.FHEEEQHQG..S....IGDQ
Q9KR87_VIBCH/27-185EV-----AGNWELLN...PK.......GE......SMLN------------------QE.FSFQVPLKDT.G....YPAL
W8U487_YEREN/25-179II-----RGVWILKH....Q.......G.......QLIK------------------QP.FDLELKQSED.G....YDAL

PF03783

Q3ID64_PSEHT/43-256EKALTDLI-TK-GI--DKGLWAKKA--
O67219_AQUAE/42-258YHAVKLIV-A.-QV--RDLPPEKGS--
Q484M1_COLP3/44-233SNIVENML-G.-KA--WRSYVLSYD--
F2G3K7_ALTMD/43-253EKAVTELV-LQ-GM--ERGVWRAKA--
Q12QL7_SHEDO/43-252ELAVSEMI-DK-GI--SQGFWKPIN--
Q2JNZ2_SYNJB/52-260EQIAQQLA-G.-FA--GRLAAQPRS--
A1BH58_CHLPD/18-218IEIAEYLE-C.-SL--VEGKNSGCM--
Q5QXH2_IDILO/43-251ERALVELI-EK-GL--EMGYWRAES--
A5FHE8_FLAJ1/44-262EKAVESLV-LE-GL--QDNIWEADA--
P73111_SYNY3/31-246VEITDYLS-C.-VM--VEQDNCIQE--
Q9A7M6_CAUCR/61-270IQAANYIV-T.-QV--AGSAAIPPV--
Q21E38_SACD2/46-235EKLNKIML-E.-KT--WSADVLAVE--
Q5E246_VIBF1/42-258DSAVIHLI-VK-GV--QQGLWRPAN--
CSGG_ECOLI/41-255ETGVIFLI-ND-GI--DRGLWDLQ.--
Q084E4_SHEFN/44-251ESAVVHMI-AD-GI--WKRAWNL..--
Q31MJ4_SYNE7/43-236DQVAKEVI-N.-AS--EKL......--
Q88H89_PSEPK/49-261EAAVGHLL-AQ-GI--ERRLWQV..--
Q8YRU8_NOSS1/50-248DQVITELN-T.-KS--TNLAALP..--

PF13036

Q3SFY9_THIDA/15-198YKFSLVLV-DI-ES--GVLEWADEKEI
A6Q5P2_NITSB/9-203YYIQMSLT-DV-TS--GLAFWEGEEVI
B3ETR9_AMOA5/12-191YQVNLELA-DL-AT--NEIVWIGDKKI
Q6MR79_BDEBA/32-210YKLTLNLT-NL-KS--SMITWSDQKQI
Q6AQQ6_DESPS/10-192YYFQLTLT-DL-SD--GLGVWEGETPI
B0SJE3_LEPBP/9-179QSINIELV-EV-ET--TIAVWSEKVSY
A1SWZ0_PSYIN/10-188YQVNLELI-SI-KD--NRKVWVGEKKI
E6W062_DESIS/11-189YQVDLSLT-DL-ES--NRIVWIGQKKI
LPOB_PROMH/7-192RVISMQLM-SV-AS--GEILWSGRHKV
Q0JYU2_CUPNH/3-193MQISFELV-EV-ES--GELVWSNIYEF
A5G8H5_GEOUR/11-189YKFTMNLK-NL-KT--GILEWSDEKEI
Q489B8_COLP3/10-189YKFTLRLM-DL-ES--GLVEWADETEI
A7MFR9_CROS8/11-217PTLQMQLM-LV-QT--GEIIWSGKGAV
Q3B6Q7_PELLD/9-191YYFQLTLT-DI-NT--GLAFWEGESFI
Q098T7_STIAD/8-189YKMTAKLN-NV-RT--GLIEWTDEKQI
C9RQT0_FIBSS/10-191YQVDMELT-DI-QS--HRKVWLGDKKI
A0LBE2_MAGMM/8-196YAFMLEVV-DK-VR--GYVLFDSYVEI
A1WFI2_VEREI/13-199YKFTLKLF-DV-QE--GTIEWQDEKEI
B2KBR6_ELUMP/7-185YQVNLKLI-NI-ET--NQIVWNGEKKI
A9EYZ5_SORC5/15-197YFMFMQLI-EV-AT--SAVAWQNRAAF
A6VT68_MARMS/21-199YQVDLKLI-DM-TT--NREVWNGQKKI
Q11SM3_CYTH3/10-189YQIDLELT-NL-QT--NEVVWIGDKKI
Q2IJK4_ANADE/8-185YKMTMQLT-DL-RT--GLITWTDEKEL
A1WY34_HALHL/8-186YQVDMELI-SL-AD--NRKVWIGNKEI
C1DFX4_AZOVD/10-225QRYAFQIV-DT-RT--NSPIWMGDFDI
LPOB_PHOLL/7-188RDIVMQLM-LV-KT--GEILWSGHGDV
D1B294_SULD5/10-196YSFQLTMT-DI-KT--GLALWEGETKV
Q0VKU2_ALCBS/9-185YKFTLKLL-NI-QT--GIIEWANEKEI
B0ST18_LEPBP/7-177ITVTLFLV-SL-ET--NQIVWSEQTNF
Q3IL02_PSEHT/16-195YKFTMRLM-DM-ES--GLVEWADETEI
D3UIZ9_HELM1/11-192YYILLTLT-DI-KT--GVVIWDNQQEV
A4SYG3_POLSQ/19-190YVFNLNLI-NN-ES--GLIEWADEKEI
LPOB_KLEP7/10-212PELKMQLM-LV-QT--GEIIWSGKGAV
B7VH52_VIBTL/9-185YKMTMRLM-DL-ES--GLIEWADETEI
C5BFM3_EDWI9/9-196PRLAMQLM-LV-QS--GEIIWSGKGSV
LPOB_DICD3/7-193PELSMQLM-LV-QT--GEIVWSGNGTV
E4PGL0_MARAH/14-201SQVTFEMV-DL-EL--GTIVWSGLYE.
F2K6Q3_PSEBN/9-189YKFSLQLI-DV-ES--GLAEWMDEKEI
M1FI84_9ALTE/9-189YYIQLSLT-DL-VT--GLATWEAETPI
O25995_HELPY/13-200YDFTLSLT-NR-KT--GEEVWSDVKPI
Q0PC46_CAMJE/11-196YFFLLRLT-DL-TS--GLVYWEDEQTI
Q32EW5_SHIDS/10-210PTLQMQLM-LV-QT--GEIIWSGKGAV
Q5NES4_FRATT/12-191FLATLKMM-DL-KT--GLVVWQDDKQI
Q6D676_PECAS/7-191PQIDMQLM-LV-QT--GEIVWSGNGAV
Q8EHZ4_SHEON/13-190YKMTMRLM-DL-ET--GLIEWSDEKEI
W8U423_YEREN/7-192PTIEMQLM-QA-QT--GEIIWSGNGPV

PF04052

TOLB_PELCD/21-131LLVDFRLY-DV-VH..RRLL-------
A5EXH2_DICNV/23-121..AQFVLT-QV-AN..KKVI-------
Q4FSA5_PSYA2/29-127VVTDYEVI-EV-KT..GRVI-------
A0L4U9_MAGMM/33-145IQVDFFLH-DI-SR..GTLI-------
TOLB_SHELP/23-128YLVNFELI-DL-VK..AQMQ-------
TOLB_SHEFN/23-128YLVSFELI-DL-VK..AQLQ-------
TOLB_SHEDO/23-128FLVNFELI-DL-VR..AQSQ-------
TOLB_AERHH/23-127YKINFELV-DV-LK..GQLA-------
TOLB_PSEA6/23-127YRVNFTLV-DA-IR..GQIT-------
TOLB_IDILO/24-128YMVKFEVI-DV-LR..GQIT-------
TOLB_PSEHT/24-128YLVRYELV-DV-IR..GQIT-------
TOLB_COLP3/24-128YQVSYQLV-DV-IR..GQIT-------
TOLB_VIBF1/24-128YEVTYKLI-DV-VR..GQLT-------
A1SSW4_PSYIN/22-127YIVTYELV-DV-VA..GNAN-------
TOLB_ACTP2/28-129YNVAYQLV-DT-LS..NPAT-------
TOLB_HAEDU/28-129YNVAYQLV-DT-LS..NPAV-------
TOLB_ECOLI/23-127YNVAYQLV-DT-GG..APGT-------
TOLB_PHOLL/23-127FLISYQLV-DT-AS..APGT-------
TOLB_PASMU/26-129FNIAYQLV-DT-IG..ATGT-------
TOLB_MANSM/28-129YNIAYQLV-DT-VG..ASGG-------
TOLB_BLOFL/24-133YVISYQLI-DT-SN..NPAL-------
TOLB_WIGBR/21-130YLISYKLI-DL-VNYPGKIL-------
TOLB_THICR/23-128YQIEMRFV-DL-LR..KEQV-------
TOLB_MARMS/24-128YRIGFELL-NV-LS..QKPV-------
TOLB_SACD2/39-140YVAEYGLY-DV-LQ..QKKM-------
TOLB_CHRSD/24-125YRIQYELL-NV-NG..QNRM-------
TOLB_HAHCH/21-126YKVRYELY-NV-QS..QQRV-------
A1U1B4_MARHV/36-139IQARYELF-DV-NQ..EKRI-------
A4XRS6_PSEMY/23-126LQVQYALF-NV-NT..EQQV-------
C1DRF3_AZOVD/23-126LQVQYALM-NV-AT..EQQV-------
TOLB_ALCBS/30-132YEVGYALF-DV-AR..QKKL-------
A1WZ69_HALHL/29-133YEVRFEVL-DA-FQ..GQRT-------
TOLB_ALKEH/25-129VSVTFELL-DV-FR..GNRI-------
TOLB_NITOC/30-133YEVRFQLF-DI-YK..EEQL-------
TOLB_XANCP/27-132YRVEYELF-DV-AK..GERL-------
TOLB_METCA/26-127YEADFHVV-DV-IR..GTLV-------
A9C288_DELAS/41-141YDVRFRLW-DV-VK..GQDL-------
A1W6N8_ACISJ/43-143FDVRFRLW-DV-VK..AQDL-------
A1TSM5_ACIAC/38-138YDVRFRLW-ET-VR..GEDK-------
A1WGN1_VEREI/17-117FDVRFRLW-DV-VK..GQDL-------
TOLB_RHOFT/25-125YDVRFRLW-DV-VR..GQDL-------
TOLB_POLSJ/27-127FDVRLRLW-DI-VR..GQDL-------
A2SFG9_METPP/22-122FDVRYRLW-DV-VK..GRDL-------
A4G7Q1_HERAR/25-124FDVKYRLF-DT-IK..QAQL-------
TOLB_RALME/45-145YEVRFRLY-DT-AK..GQSL-------
TOLB_BURXL/28-128YEVRFKLY-DT-VK..GESL-------
TOLB_BURPS/28-128YKVNFILY-DT-VK..QQSL-------
TOLB_AZOSB/27-127YEIRFRLF-DT-QK..QTEL-------
TOLB_AROAE/27-127YDVRFRLF-DT-QK..QTEL-------
TOLB_DECAR/27-127MEARFRLY-DT-QK..GVSL-------
TOLB_NITEU/24-124IDVRFRLL-DV-VK..QTQL-------
TOLB_NITMU/32-133ISIRVRLL-DV-AR..QAEL-------
A4SVI2_POLSQ/34-134FDIHYKLF-DI-RK..SQGL-------
TOLB_CHRVO/26-128IKISFRLM-DA-SQ..RKQL-------
TOLB_METFK/28-133LKVSFRLL-DV-YK..QSQL-------
TOLB_THIDA/29-131FEVRFRLL-DV-VK..GTQL-------
TOLB_PARL1/38-141LRVEFRLW-DV-LG..EQQL-------
B0T057_CAUSK/36-138LRVDFRLW-DT-FS..QQQL-------
TOLB_MAGSA/31-138VRVEFRLW-DV-FN..EAYM-------
TOLB_RHORT/33-140LRVAFRLW-DV-FS..GQQV-------
TOLB_BRADU/34-141LKAEFRLW-DV-VS..GQQL-------
TOLB_CHESB/30-133LKAEFRLW-DT-FA..GQQL-------
TOLB_RHIEC/30-132LRAEFRLW-DT-FA..GQQM-------
TOLB_RHILO/30-133IRAQYRLW-DT-FA..GQQM-------
A7IJU3_XANP2/44-146FQVVFRLW-DV-FA..GQQL-------
Q0ALY5_MARMM/27-134LVVGFRLW-DT-RL..EEQL-------
E0TDI8_PARBH/29-136IQVAARLW-DV-GA..SKQL-------
Q0C5V5_HYPNA/26-132LAVSFRLW-DV-YG..GELM-------
B0U7W3_METS4/31-134VKAEFRLW-DV-LS..GQQM-------
A5G2K7_ACICJ/55-161IRVEYRLW-GI-SQ..QKQL-------
Q0BT48_GRABC/51-150VRVEFRLW-DV-LP..QQQI-------
TOLB_DINSH/31-138LVVKFRLF-DV-FS..DAPL-------
TOLB_RUEST/28-134ITVRFRGY-DV-FA..GQEL-------
TOLB_RUEPO/26-132LTVRFRLW-DV-FA..GAEL-------
A1AZV4_PARDP/48-153VVVKFRLF-DV-FA..GQPL-------
TOLB_ROSDO/30-136LNVKFRLY-DV-FS..GAEM-------
TOLB_JANSC/31-137LVVRFRLF-DV-FS..QAPL-------
TOLB_SPHWW/23-136LTVGCYLY-DV-LA..RTEL-------
TOLB_RUTMC/20-119FNVEIELL-DV-FS..KKIL-------
TOLB_ACIAD/27-123FEVHYQLY-DV-QK..QQYL-------
TOLB_ORITB/37-144FKVTFVIW-DV-FS..AKEI-------
TOLB_RICPR/20-127LKISFILW-DT-FL..EKQL-------
TOLB_COXBU/25-130YRVAFTLI-NV-FD..SNNR-------
A0LGA1_SYNFM/45-154VKIEARLF-DV-AA..GRPV-------
B3E270_GEOLS/25-132LTLEFRLY-DV-VA..KKLL-------
A1AU95_PELPD/31-138LTVEFRLF-DL-AN..RKMM-------
A5GDC0_GEOUR/22-129LTIEFRLY-DV-AR..GKEL-------
A7H870_ANADF/28-134LEAELHLY-EV-RA..GREV-------
TOLB_ANADE/26-133LEGELHLY-EV-RA..GREV-------
TOLB_WOLSU/19-119ILAELRLY-DV-NS..GDSV-------
TOLB_HELHP/20-117LTGTISLY-DI-NT..SKRI-------
Q2GJ56_ANAPZ/25-129MGIKLFVW-DV-AA..EKKL-------
A7ZC42_CAMC1/20-118LTLRVKLI-DA-KT..A...-------
TOLB_HISS2/28-126YSIAYQLV-DT-I.......-------
TOLB_VIBTL/24-127YVVNYQLI-DI-VR..GQL.-------
TOLB_SHEPW/23-126YLVSFQLI-DL-VK..AQ..-------
B9KHU7_ANAMF/28-134VKVKLFIW-DV-AS..GRQL-------
C5AV32_METEA/36-138LTVAFRLW-DV-AS..GQQI-------
M1FG56_9ALTE/39-140LEARYELF-DV-NR..EER.-------
M9X4A4_MANHA/28-124YNVAYQLI-DT-LG......-------
TOLB_HAEIN/27-122YSITYQLI-DT-VG......-------
TOLB_MYXXD/22-128LRGELRLF-NV-GT..GRE.-------
TOLB_BRUA2/35-138LKAEFRLW-DT-FG..GQQM-------
TOLB_RHOS4/31-136VVVKFRLY-DV-FS..DQP.-------
TOLB_NITWN/40-146LKAEFRLW-DV-AT..GQQL-------
TOLB_PELUB/22-136LRVEFRLW-DV-LA..GKEM-------
TOLB_PHOPR/24-127YVVNYQLV-DV-VR..GQL.-------
TOLB_VIBVY/24-127YVINYQLV-DV-VR..GQL.-------
TOLB_BORPE/38-138YDVRYRLA-DT-VK..KGQL-------
TOLB_PSESM/25-127LQIQYALF-NV-AT..EQQV-------
TOLB_SHEON/23-127FLVSFELI-DL-VK..AQN.-------
TOLB_XYLFA/27-132YRVEYELF-DV-RN..GKRM-------
V6EXY5_9PROT/28-135LMIEFRLW-DV-FS..ETQM-------
W8U1X0_YEREN/23-122YVVSYQLV-DT-S.......-------

PF05643

Q1LCD0_RALME/11-212GAASDRLL-SA.GQ--PTGILYGPR--
D3V518_XENBS/12-210GIASHRLL-SA.GQ--YGRLLYGPR--
Q2SHH4_HAHCH/14-212ANANYRTI-NS..P--GNGLLPGPY--
E0SD08_DICD3/9-210GITSVRLL-TA.GG--PSSLLYGPR--
Q887N9_PSESM/11-213GIASNRLL-TA.GR--PAGLLYGPR--
A7I3D9_CAMHC/9-212GPAMFSLL-GQ.NC--NDCLLYGPK--
S6BPX5_PSERE/11-212GLAAGRLL-LP.RQ--PAGILHGPR--
X2HCW4_9NEIS/9-212GAVDTGLL-SA.EE--TNGILFGP.--
Q0K4M2_CUPNH/11-212GRTSQQLL-SA.GT--PGGILYGPR--
Q6CYP8_PECAS/9-210GVTSARLL-AA.GH--ARGMLYGPR--
A9BNZ3_DELAS/11-211SIANQRLL-SP.MA--QRGLLPGPR--
D3VLQ9_XENNA/12-210GITSNRLL-SA.GG--NGHLLYGPR--
G8MBI9_9BURK/12-216GLTRQRLL-AT.GA--PNGLLYGPR--
V5UBV7_9BURK/13-214GTANARLL-SA.GH--PNGLLYGPR--
Q7CJE6_YERPE/11-209GITSARML-SA.GT--PNGLLYGPR--
W0LEC8_9ENTR/9-209AITNTRLL-SA.GQ--DGGILYGPR--
A3MYU4_ACTP2/7-208ASAMSSLV-HV.GK--NGGLLVGPR--
A1WBC0_ACISJ/14-214EVANGRLL-YA.GR--PGGLLHGPR--
Q4KAD7_PSEF5/11-212GITSQRLL-SA.GQ--RTGLLYGPR--
I0HUV3_RUBGI/17-218GTADARLL-TP.HK--PNGLLYGPR--
M5DUQ1_9GAMM/13-209RTANQTVL-NT..P--NQGLLNGP.--
B8F6X7_HAEPS/7-208APATSNLV-HL.GK--NGGLLIGPK--
B4EZI8_PROMH/10-209GVASVRLL-SA.GH--ANGILYGPR--
Q8XS06_RALSO/13-216GATSARLL-SA.GP--HGGLLYGPR--
Q7N0C6_PHOLL/9-209GITSNRLL-TA.GG--SRSLLYGPR--
H2IYH4_RAHAC/9-209GLTSYRLL-SA.SQ--TDGLLYGPR--
E6W7V9_PANSA/9-211GVTSVRLL-AQ.NE--DGGLLAGPR--
D8J254_HERSS/11-214GIASQRLL-RA.GN--PNGLLHGPR--
M4XNX8_PSEDE/9-210GITGARLL-SA.GH--NGGLLYGPR--
A8GBK2_SERP5/9-211AIANTRLL-SANGQ--NGAILYGPR--
D8MNT7_ERWBE/9-208SVTSARLL-SA.ND--NGGILKGPR--
Q21SI9_RHOFT/14-214GVATTRLL-SA.GT--ANGMLYGPR--
F6AGD6_PSEF1/12-213GITSSRLL-SS.NA--VNGILPGPR--
C5AJP0_BURGB/13-221GLTNAKLL-SA.GS--PNGLLYGPR--
B1Y7Y1_LEPCP/17-218GIASQRLL-SA.GR--PNGMLYGPH--
F4HEQ1_GALAU/9-210AIADNKLL-AT.GN--NGNILYGPY--
B4E8N1_BURCJ/12-217GLTSTRLL-SA.GP--PNGLLYGPR--
C1D4H4_LARHH/10-211AITSNRLL-SY.GP--PGGLLYGP.--
Q63PN9_BURPS/16-221GLTSGRML-SA.GQ--PNGLLYGPR--
E5AND7_BURRH/16-220NLASRRLL-SA.GP--PSGLLYGPR--
Y1124_NEIMB/7-208KTAAYNLL-SP.YS--HNGILKGPR--

PF05211

F8KS85_HELBC/10-259KRMVEELT-SENIDRYRDAIEKIK.NK
HPAA_HELPY/13-258QEIDKKLT-QKNLESYQKDAKELKGKR
O25234_HELPY/14-271KKAVTELT-KENIDKYREAIDRMKGFK
K4RMR3_HELHE/10-260KKLVQELT-STNINRYRQAIEQIK..K
O25166_HELPY/2-249VHITKELS-KKHMEHYEKVSSEMKKRK
F8KRD2_HELBC/14-268KKIVSWVQ-NADLKQYRKAIDQIR...
E7AAG1_HELFC/14-275KKLIDWVE-GADLKQYRRAIDQIR...

PF03886

Q30ZW7_DESAG/36-191VQAHSRLL.AL-LA--EDIA-------
Q1LFX2_RALME/21-179IAAHNRAL.AS-VS--RDIA-------
A8GCL1_SERP5/25-179VRTLAQGW.QQ-EA--QDIA-------
Q6D463_PECAS/26-181VRTLAQGW.QQ-VS--QSIA-------
A4XPV2_PSEMY/32-188VKAQSALL.QR-LA--AELA-------
Q5FP36_GLUOX/24-182VALTRTLV.EQ-LA--ARIA-------
Q2YQ49_BRUA2/33-193VKALDKAF.DQ-TV--NEIV-------
Q8Y1T9_RALSO/34-193VTATQGVV.RQ-WS--QRIA-------
Q15V64_PSEA6/27-193VALLAEQL.SQ-LS--SQIV-------
Q3IC12_PSEHT/29-195VATLEKTW.QE-IN--LAVA-------
B2JLP5_BURP8/35-193AGGHRRAM.SV-VA--AQIA-------
Q1LQW2_RALME/27-187VNAYRQIV.AA-TA--ADIA-------
Q12RG9_SHEDO/35-202VMAYSQLL.QL-LS--EQIN-------
Q2LY73_SYNAS/41-204AAAVSSTL.AQ-AS--REIA-------
Q6D6W6_PECAS/27-186LQAQQQVI.TR-LA--EQIA-------
A5G4U3_GEOUR/34-200VAAMQRAL.DR-LG--KEMG-------
B2JLL6_BURP8/44-202VAAMARAV.AD-LA--DQLA-------
A1AL18_PELPD/32-193VAAVSSAL.GQ-VS--REIA-------
A0LKZ6_SYNFM/33-196VAAQNEAL.GE-FG--AEIA-------
Q13YJ7_BURXL/36-194VAGHRLAL.DQ-VA--AKIA-------
A5G0A2_ACICJ/27-179AHAMSVAL.GR-LA--DRIA-------
C1DGP1_AZOVD/26-184VAAHDRAL.AA-LS--RDIA-------
A6VZG3_MARMS/30-189VQTLSASWFDQ-VI--GPMA-------
Q98M02_RHILO/33-190IKALDSAF.GD-AA--KQIV-------
Q2RRJ7_RHORT/36-194VQAMSKAV.DE-LA--GHIA-------
Q1QVZ8_CHRSD/44-208VRALGGAW.DT-LG--ERLA-------
Q1GM15_RUEST/25-182ARALSAAL.AE-LS--RQVA-------
A1B5I4_PARDP/26-183ARAQSQAI.AQ-LA--RQIA-------
Q5LU10_RUEPO/22-179AAAQTEAL.RL-LV--NDIA-------
B2JP31_BURP8/35-193VAAHSRAL.AT-VS--RDIA-------
Q7VVC7_BORPE/29-191VQAQQRGT.AL-LA--RTIA-------
A0KPP1_AERHH/27-182VSELGAGW.QQ-LL--DQIA-------
Q2IEA0_ANADE/30-187VEALSDCV.GG-LA--SEIA-------
Q5FRD2_GLUOX/34-193TAALSQGV.AS-IA--DQAA-------
B2JEG5_BURP8/31-189VAAHSRAL.AA-VS--REIA-------
B3EAR4_GEOLS/32-189VAGYSRAV.AA-LS--KEMV-------
Q082L0_SHEFN/33-191VSAYSNLL.TQ-LA--KEIE-------
B2JWQ3_BURP8/37-194VDAQSQAL.AA-VC--VDMA-------
B2JKL2_BURP8/40-196ARALAAAS.DE-LV--AQIS-------
Q7NV00_CHRVO/26-184LAGLQTLL.DG-LA--ADIA-------
Q0BS49_GRABC/26-184ARMMRSML.LQ-LA--DRIV-------
B2JGI0_BURP8/37-192ADGHRRAV...-..--QQIS-------
Q3J7M0_NITOC/28-188VAALSKGL.AR-VT--DSIA-------
Q87N56_VIBPA/29-189VDALSAGL.NQ-LT--DDMA-------
A7IMU5_XANP2/47-206TAALDSAQ.EQ-VL--VQMV-------
Q60BV1_METCA/32-192VAAMNRAL.AR-FS--RDVA-------
Q7N608_PHOLL/25-180VRTLAKGW.SQ-LV--QAIA-------
Q0BVR3_GRABC/46-207VAALSATL.AE-MA--DAMA-------
A4XP77_PSEMY/28-187IAAFGQAG.DQ-LS--RELV-------
Q1MPH9_LAWIP/28-190VITEGILL.EQ-LG--TFVG-------
A9CIT8_AGRFC/35-194VKALDQAF.AA-AT--REIV-------
Q21EW6_SACD2/50-209IAGLNELI.NS-FA--VALA-------
Q2KZJ1_BORA1/28-186VTAQQQAV.AL-LA--RTIA-------
C1DFS0_AZOVD/30-187VRAQSLVL.QR-LA--ERLA-------
Q4K7Z6_PSEF5/25-185VQAHQQAI.AQ-LA--GQVA-------
B2FMQ9_STRMK/34-197TAAFERGL.QQ-LA--QDVV-------
B4EE37_BURCJ/32-191VAGHRRAL.DV-IA--SQAA-------
F2KBG9_PSEBN/29-184VQAQGVLL.QR-LA--EQL.-------
Q32HV4_SHIDS/21-175VKVLASVW.SQ-EA--ASIA-------
Q5ZZ43_LEGPH/74-232VQSMNTNL.TH-LT--EEIA-------
Q63QZ4_BURPS/39-198VAGHRQAI.GA-LA--DQIA-------
Q6LI49_PHOPR/28-187VKALSEGI.NR-LT--TQIA-------
Q726I0_DESVH/33-194VAAQQRNV.EH-LA--AAIA-------
Q87VH7_PSESM/30-185VKAQGMLL.QR-LA--DQV.-------
Q880H8_PSESM/27-191ILAHQKAV.AT-LA--EKI.-------
Q8PCT0_XANCP/37-195AAAFEQAL.TQ-VT--TEL.-------
Q92K95_RHIME/41-197VAALDAAF.AR-VA--ADIV-------
Q9HUK2_PSEAE/30-186IRAQSDLL.KR-LA--AQLA-------
Q9KR87_VIBCH/27-185VEALSAGV.DQ-LS--TQI.-------
W8U487_YEREN/25-179IRTLAEGW.QQ-EA--KVMA-------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window