Sequence alignment for CL0343

PF00129

HLAH_HUMAN/25-203RSHSMRYFYTTMSRPGAGEPRFISVGYVDDTQFVRFDSDDASPREEPRAPWMEREG.PKYWDRNTQICKAQAQTERENLR
ZA2G_HUMAN/26-201GRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDR..KSQPMGLWRQVEG.MEDWKQDSQLQKAREDIFMETLK
HA10_MOUSE/25-203GSHSMRYFETSVSRPGLGEPRFIIVGYVDDTQFVRFDSDAETPRMEPRAPWMEQEG.PEYWERETQRAKGNEQSFHVSLR
HA15_MOUSE/21-199SPHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDAENPRMEPRARWIEQEG.PEYWERETWKARDMGRNFRVNLR
1C01_GORGO/25-203GSHSMRYFFTAVAPPGRGEPRFIAVGYVDDTQFVRFDSDAANTRGEPRAPWVEQEG.PEYWDRETQKYKRQAQTDRVSLR
HA13_MOUSE/25-203GPHSLRYFETVVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRDEPRVRWMEQEG.PEYWERETQIAKGNEQSFRVDLR
1A01_GORGO/25-203GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEG.PEYWDRNTRNVKAHSQTDRVDLG
HA1D_MOUSE/22-200GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEG.PEYWEEQTQRAKSDEQWFRVSLR
FCGRN_RAT/25-198PRLPLMYHLAAVSDLSTGLPSFWATGWLGAQQYLTYNNLRQ..EADPCGAWIWENQVSWYWEKETTDLKSKEQLFLEAIR
HA12_MOUSE/25-203GSHSLRYFVTAVSRPGFGEPRYMEVGYVDNTEFVRFDSDAENPRYEPRARWIEQEG.PEYWERETRRAKGNEQSFRVDLR
HA1F_CHICK/23-198ELHTLRYIQTAMTDPGPGQPWFVTVGYVDGELFVHYNSTAR..RYVPRTEWIAAKADQQYWDGQTQIGQGNEQIDRENLG
HA17_MOUSE/22-200GQHSLQYFHTAVSRPGLGEPWFISVGYVDDTQFVRFDSDAENPRMEPRARWMEQEG.PEYWERETQIAKGHEQSFRGSLR
HA11_RAT/25-203GSHSLRYFHTAVSRPGLGEPRFISVGYVDDTQFVRYDSDAENPRYEPRARWMEREG.PEYWEEQTLVAKGQELDYRVSLR
HA11_MOUSE/25-203GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEG.PEYWERETQKAKGQEQWFRVSLR
HA1A_BOVIN/22-200GSHSLRYFSTAVSRPGLGEPRYLEVGYVDDTQFVQFDSDAPNPRMEPRARWVEQEG.PEYWDRNTRNAKGNAQSFRVNLN
HLAG_HUMAN/25-203GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEG.PEYWEEETRNTKAHAQTDRMNLQ
HA1A_RABIT/25-203GSHSMRYFYTSVSRPGLGEPRFIIVGYVDDTQFVRFDSDAASPRMEQRAPWMGQVE.PEYWDQQTQIAKDTAQTFRVNLN
HLAE_HUMAN/22-200GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEG.SEYWDRETRSARDTAQIFRVNLR
1A02_PANTR/25-203GSHSMKYFYTAVSRPGRGEPRFISVGYVDDTQFVWFDSDAASPREEPRAPWIEQEG.PEYWDRETQISKTNAQTYRESLR
HA1T_MOUSE/27-205GSHSLRYFYTALSRPAISEPWYIAVGYLDDTQFVRFNSSGETATYKLSAPWVEQEG.PEYWARETEIVTSNAQFFRENLQ
1C28_PANTR/22-200GSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEG.PQYWERTTGYAKANAQTDRVALR
HA1B_BOVIN/28-206GSHSLRYFYTGVSRPGLGEPRFIAVGYVDDTQFVRFDSDAPNPREEPRVPWMEQEG.PEYWDRNTRIYKDTAQIFRVDLN
HA19_CANFA/25-204GSHSLRYFYTSVSRPGAGDPRFIAVGYVDDTQFVRFDSDAATGRMEPRAPWVEQEG.PEYWDRQTRTIKETARTFRVDLD
HA12_RAT/25-203GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTEFVRFDSDAENPRMEPRARWMEREG.PEYWEQQTRIAKEWEQIYRVDLR
1A01_SAGOE/25-203GSHSMRYFETSVSRPGRGEPRYISVGYVDDTQFVRFDSDAASPRMEPRAPWMEQEG.PEYWEEETRKGKADAQTFRVDLQ

PF14586

RAE1C_MOUSE/31-204DAHSLRCNLTIKAPTPADPLWYEAKCLVDEILILHLSNINK----------TMTSGDPGETANATEVGECLTQPVNDLCQ
RAE1E_MOUSE/31-202DAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINK----------TMTSGDPGKMANAT..GKCLTQPLNDLCQ
RAE1D_MOUSE/31-200DAHSLRCNLTIKAPTPAD....EVKCFVGEILILHLSNINK----------TMTSGDPGETANATEVGECLTQPLKDLCQ

PF00969

DRB3_HUMAN/42-116-----------------------SECHF.---------------------------------------------------
DRB4_HUMAN/42-116-----------------------CECHF.---------------------------------------------------
Q31369_DANRE/31-106-----------------------LECIYS---------------------------------------------------
Q30765_MACRG/42-116-----------------------SECDF.---------------------------------------------------
Q31292_9MURI/7-79-----------------------GQCYY.---------------------------------------------------
Q31590_SALSA/27-102-----------------------RQCRYS---------------------------------------------------
HB2D_CANFA/42-116-----------------------SECYF.---------------------------------------------------
O02908_MUSMA/9-83-----------------------YECYF.---------------------------------------------------
Q31341_AGEPH/16-90-----------------------GECYF.---------------------------------------------------
O02896_MOUSE/9-83-----------------------SECHF.---------------------------------------------------
Q31375_CYPCA/31-106-----------------------TKCIHS---------------------------------------------------
O19211_CAPHI/8-82-----------------------KECHF.---------------------------------------------------
HB2A_RAT/8-82-----------------------GLCYY.---------------------------------------------------
Q31320_APHCE/16-90-----------------------YDCQF.---------------------------------------------------
Q31459_MORSA/28-103-----------------------NRCVFN---------------------------------------------------
DOB_HUMAN/39-113-----------------------ADCYF.---------------------------------------------------
O19274_SAGOE/6-78-----------------------HNCYA.---------------------------------------------------
Q06742_XENLA/41-115-----------------------SQCYY.---------------------------------------------------
Q31589_SALSA/41-115-----------------------TQCRYS---------------------------------------------------
Q31391_CARME/16-90-----------------------SECHY.---------------------------------------------------
Q30539_LORTA/8-82-----------------------AECHF.---------------------------------------------------
Q30812_SHEEP/4-78-----------------------SECHF.---------------------------------------------------
DQB2_HUMAN/45-118-----------------------GMCYF.---------------------------------------------------
P79456_BOVIN/5-79-----------------------CLCYF.---------------------------------------------------
O19236_DELLE/5-79-----------------------SECRF.---------------------------------------------------
P79966_CAPAE/4-78-----------------------SECHF.---------------------------------------------------
DPB1_HUMAN/42-114-----------------------QECYA.---------------------------------------------------
Q95399_BOVIN/8-82-----------------------GMCYF.---------------------------------------------------
Q31314_APHCE/16-90-----------------------YDCQF.---------------------------------------------------
O19364_FELCA/5-79-----------------------SECHF.---------------------------------------------------
Q08609_CYPFR/25-100-----------------------DRCNFN---------------------------------------------------
Q30854_OTOGA/8-82-----------------------SECRF.---------------------------------------------------
HB2L_CHICK/8-82-----------------------VECHF.---------------------------------------------------
O02712_MACMU/5-79-----------------------GLCYF.---------------------------------------------------
Q31354_DANRE/29-104-----------------------QQCFYS---------------------------------------------------
Q31392_CARME/16-90-----------------------SECHF.---------------------------------------------------
Q30461_HORSE/4-78-----------------------FECHF.---------------------------------------------------
P79455_BOVIN/5-78-----------------------YQCYF.---------------------------------------------------
Q31376_CYPCA/25-100-----------------------NKCIHS---------------------------------------------------
HB2D_RAT/40-114-----------------------GECHF.---------------------------------------------------
O19246_CANFA/5-79-----------------------AECYF.---------------------------------------------------
Q5Y7D3_HUMAN/45-119-----------------------GMCYF.---------------------------------------------------
O19500_CHICK/8-82-----------------------FECQF.---------------------------------------------------
Q30540_LORTA/8-82-----------------------AECHF.---------------------------------------------------
Q31463_MORSA/28-103-----------------------DRCVFN---------------------------------------------------
Q31244_MUSSA/8-81-----------------------AECHY.---------------------------------------------------
Q31315_APHCE/16-90-----------------------SECQF.---------------------------------------------------
O19396_FELCA/5-79-----------------------AECHF.---------------------------------------------------
Q08607_CYPFR/25-100-----------------------ARCDFN---------------------------------------------------
Q31487_ONCMY/30-105-----------------------RQCRYS---------------------------------------------------
Q31140_MOUSE/8-80-----------------------SACYF.---------------------------------------------------
Q30554_MACAR/5-79-----------------------GLCYF.---------------------------------------------------
P70238_MOUSE/27-106-----------------------STCVLD---------------------------------------------------
O02879_MUSCR/9-83-----------------------GECHF.---------------------------------------------------
Q31316_APHCE/16-90-----------------------FECHF.---------------------------------------------------
P79442_BOVIN/5-79-----------------------GLCYF.---------------------------------------------------
Q31431_9PASE/37-110-----------------------SECHF.---------------------------------------------------
Q30661_MACMU/6-80-----------------------FECHF.---------------------------------------------------
O19495_CHICK/8-82-----------------------SECQF.---------------------------------------------------
Q06743_XENLA/41-115-----------------------GQCYY.---------------------------------------------------
Q31136_MOUSE/8-80-----------------------GECYC.---------------------------------------------------
O19279_MACMU/6-80-----------------------SECQI.---------------------------------------------------
HB2C_PIG/45-119-----------------------GECYF.---------------------------------------------------
Q30513_GALMO/8-81-----------------------HECHF.---------------------------------------------------
HB2A_MOUSE/40-114-----------------------GECYF.---------------------------------------------------
O18945_BOSIN/5-79-----------------------RECHF.---------------------------------------------------
Q30764_MACRG/42-116-----------------------AECYF.---------------------------------------------------
Q5Y7F1_HUMAN/45-119-----------------------GLCYF.---------------------------------------------------
HB21_SPAEH/42-114-----------------------QECHL.---------------------------------------------------
Q31334_AULHA/8-83-----------------------NRCNFN---------------------------------------------------
Q08608_AULHA/24-99-----------------------DRCQFN---------------------------------------------------
O19494_CHICK/8-82-----------------------FECHY.---------------------------------------------------
HB21_MOUSE/40-114-----------------------SECHF.---------------------------------------------------
O19229_DAMDA/5-79-----------------------SECHF.---------------------------------------------------
Q30262_BOVIN/26-105-----------------------STCVLD---------------------------------------------------
O02877_MUSCO/9-83-----------------------HECHF.---------------------------------------------------
Q06745_XENLA/42-116-----------------------AQCYF.---------------------------------------------------
2B17_HUMAN/42-116-----------------------YKCHF.---------------------------------------------------
Q31377_CYPCA/25-100-----------------------FDCVYS---------------------------------------------------
Q31339_AGEPH/16-90-----------------------FECYF.---------------------------------------------------
O19382_FELCA/5-79-----------------------AECHF.---------------------------------------------------
O19220_RANTA/5-79-----------------------CECHF.---------------------------------------------------
O19231_DELLE/5-79-----------------------GECRF.---------------------------------------------------
O19493_CHICK/8-82-----------------------AECHY.---------------------------------------------------
Q30827_SHEEP/39-113-----------------------ADCYF.---------------------------------------------------
O19291_MACMU/6-80-----------------------AECHF.---------------------------------------------------
Q30858_OTOGA/8-82-----------------------AECHH.---------------------------------------------------
Q30282_BOVIN/5-79-----------------------SECHF.---------------------------------------------------
Q30763_MACRG/27-101-----------------------SECHF.---------------------------------------------------
Q31253_RAT/9-88-----------------------STCLLD---------------------------------------------------
DMB_HUMAN/27-106-----------------------STCLLD---------------------------------------------------
Q31270_RAT/21-95-----------------------FECHF.---------------------------------------------------
Q31311_APHCE/16-90-----------------------AECHF.---------------------------------------------------
O19288_MACMU/6-80-----------------------SECHF.---------------------------------------------------
Q30694_MACMU/5-79-----------------------GMCYF.---------------------------------------------------
Q30338_CHLAE/5-79-----------------------GMCYF.---------------------------------------------------
Q29783_HUMAN/8-82-----------------------GMCYF.---------------------------------------------------
Q31514_POERE/27-102-----------------------DRCVFS---------------------------------------------------
Q30217_HUMAN/8-82-----------------------HECYF.---------------------------------------------------
O35424_MOUSE/39-113-----------------------ADCYF.---------------------------------------------------
O19492_CHICK/8-82-----------------------AECHY.---------------------------------------------------
HB2P_RABIT/43-113-----------------------YECYA.---------------------------------------------------
O19378_FELCA/5-79-----------------------FECHF.---------------------------------------------------
P79597_XENLA/33-107-----------------------AQCYF.---------------------------------------------------
P79466_BOVIN/8-82-----------------------GECRF.---------------------------------------------------
P79447_BOVIN/5-79-----------------------GLCYF.---------------------------------------------------
Q31462_MORSA/28-103-----------------------DRCVFN---------------------------------------------------
Q31432_9PASE/37-111-----------------------LECHF.---------------------------------------------------
Q08611_CYPFR/23-98-----------------------SRCDFN---------------------------------------------------
O19298_9PRIM/6-79-----------------------AECHF.---------------------------------------------------
O19287_MACMU/6-80-----------------------HECRF.---------------------------------------------------
O02909_MUSPL/9-83-----------------------SECHF.---------------------------------------------------
O19253_CANFA/6-79-----------------------FECHF.---------------------------------------------------
Q31358_DANRE/26-101-----------------------TKCIFQ---------------------------------------------------
Q08606_AULHA/25-100-----------------------DRCQFN---------------------------------------------------
O19491_CHICK/8-82-----------------------AECHY.---------------------------------------------------
Q29922_HUMAN/8-82-----------------------AMCYF.---------------------------------------------------
O19218_MONDO/42-116-----------------------SECYF.---------------------------------------------------
Q30458_HORSE/41-115-----------------------GQCYF.---------------------------------------------------
Q31390_CARME/16-90-----------------------SECYY.---------------------------------------------------
Q30856_OTOGA/8-82-----------------------SECHR.---------------------------------------------------

PF00993

DPA1_HUMAN/35-115-----------------------DHVSTY.AA------------------------------------------------
O02872_RABIT/41-124-----------------------NHTFLH.TV------------------------------------------------
Q8MGS1_DANRE/1-83-----------------------DYHKYG.LI------------------------------------------------
Q8MGR1_DANRE/2-82-----------------------EHEAIQ.FQ------------------------------------------------
Q31362_DANRE/31-108-----------------------EDIVMDGC.------------------------------------------------
Q9XSK9_CANFA/1-82-----------------------DHVAYYGIN------------------------------------------------
Q30457_HORSE/29-110-----------------------DHFASYGIN------------------------------------------------
Q31625_DANRE/21-100-----------------------EHRDVD...------------------------------------------------
Q8MGR4_DANRE/19-101-----------------------EFVREE.FE------------------------------------------------
Q9XR28_ICTPU/21-102-----------------------KHHDIK.VI------------------------------------------------
Q9MXY9_RABIT/2-83-----------------------DHVGSYGME------------------------------------------------
Q8WM48_XENLA/3-84-----------------------VDYFDYGAL------------------------------------------------
O19197_BOSIN/28-109-----------------------DHIGTYGAD------------------------------------------------
O19310_BOVIN/1-82-----------------------DHVGSYGTE------------------------------------------------
Q9MX27_ONCMY/21-101-----------------------LHTDIY.IN------------------------------------------------
DOA_HUMAN/29-110-----------------------DHMGSYGPA------------------------------------------------
Q31064_PIG/39-119-----------------------NHVIIQ.AE------------------------------------------------
O19704_HUMAN/6-86-----------------------DHVASYGVN------------------------------------------------
Q8WLP3_SALSA/19-100-----------------------KVLHID.LV------------------------------------------------
O19318_BOVIN/1-82-----------------------DHIGAYGIN------------------------------------------------
Q30762_MACRG/27-108-----------------------DHVGIYGTG------------------------------------------------
Q9XRW8_RATFU/1-81-----------------------DHVGSYGID------------------------------------------------
Q31396_GINCI/24-105-----------------------LYDFTQ.VY------------------------------------------------
O19195_BOSIN/28-108-----------------------DHVGTYGTD------------------------------------------------
Q9MX25_ONCMY/21-101-----------------------LHIDLA...------------------------------------------------
Q31150_MOUSE/29-110-----------------------DHMGSYGPA------------------------------------------------
Q8SP47_CAVPO/29-109-----------------------DHVSTF.AA------------------------------------------------
Q31469_MORSA/24-102-----------------------EDIAID...------------------------------------------------
Q8HWL3_SIGHI/30-111-----------------------DHVGIYGMT------------------------------------------------
Q9BEA4_PIG/41-124-----------------------NHTFQY.TM------------------------------------------------
Q31287_RAT/29-109-----------------------EHVATY.DI------------------------------------------------
Q8MGS6_DANRE/2-82-----------------------EHEVNQ.IQ------------------------------------------------
Q31247_PERLE/1-82-----------------------DHVGAYGLN------------------------------------------------
Q95521_RABIT/1-82-----------------------DHVGAYAIN------------------------------------------------
Q8K2X0_MOUSE/30-111-----------------------DHVGFYGIV------------------------------------------------
Q8WM44_XENLA/3-84-----------------------VDYFDYGTE------------------------------------------------
Q30181_HUMAN/20-100-----------------------DHVSTY.AR------------------------------------------------
Q8WM45_XENLA/4-84-----------------------DYFDFG.TE------------------------------------------------
Q8MGX3_PIG/29-110-----------------------DHVASYGLN------------------------------------------------
Q31359_DANRE/21-100-----------------------EHRDFD...------------------------------------------------
O98262_BOVIN/29-110-----------------------DHVGIYGIS------------------------------------------------
HA2P_RABIT/1-81-----------------------EHVSVF.VI------------------------------------------------
Q9MXF8_AOTNA/29-110-----------------------DHVAAYGIT------------------------------------------------
Q31468_MORSA/20-100-----------------------DDLHED.FR------------------------------------------------
HA2B_RAT/30-111-----------------------DHVGSYGIT------------------------------------------------
Q31465_MORSA/24-103-----------------------EDFHIGGC.------------------------------------------------
Q07455_SHEEP/29-110-----------------------DHIGTYGVN------------------------------------------------
Q30306_BOVIN/1-82-----------------------DHVGTYGTN------------------------------------------------
O97981_PIG/29-110-----------------------DHMGSYGPA------------------------------------------------
DQA2_HUMAN/29-110-----------------------DHVASYGVN------------------------------------------------
O19760_HUMAN/29-110-----------------------DHVASCGVN------------------------------------------------

PF00129

HLAH_HUMAN/25-203IALRYYNQSEGGSHTMQVMYGCDV-----GPDGPFLRGYEQHAYDGKDY---IALNEDLRSWTAADMAA-----QITKRK
ZA2G_HUMAN/26-201DIVEYYNDS.NGSHVLQGRFGCEI-----ENNR.SSGAFWKYYYDGKDY---IEFNKEIPAWVPFDPAA-----QITKQK
HA10_MOUSE/25-203TLLGYYNQSESGSHTIQWMYGCKV-----GSDGRFLRGYLQYAYDGRDY---IALNEDLKTWTAADVAA-----IITRRK
HA15_MOUSE/21-199TLLGYYNQSNDESHTLQWMYGCDV-----GPDGRLLRGYCQEAYDGQDY---ISLNEDLRSWTANDIAS-----QISKHK
1C01_GORGO/25-203KLRGYYNQSEDGSHTFQRMYGCDV-----GPDGRLQRGYDQLAYDGKDY---IALNEDLRSWTAADTAA-----QITQRK
HA13_MOUSE/25-203TLLRYYNQSEGGSHTIQRLSGCDV-----GSDWRLLRGYEQFAYDGCDY---IALNEDLKTWTAADMAA-----LITKHK
1A01_GORGO/25-203TLRGYYNQSEDGSHTIQRMYGCDV-----GSDGRFLRGYQQDAYDGKDY---IALNEDLRSWTAADMAA-----EITKRK
HA1D_MOUSE/22-200TAQRYYNQSKGGSHTFQRMFGCDV-----GSDWRLLRGYQQFAYDGRDY---IALNEDLKTWTAADTAA-----LITRRK
FCGRN_RAT/25-198TLENQIN....GTFTLQGLLGCEL-----APDN.SSLPTAVFALNGEEF---MRFNPRTGNWSGEWPET-----DIVGNL
HA12_MOUSE/25-203TALRYYNQSAGGSHTLQWMAGCDV-----ESDGRLLRGYWQFAYDGCDY---IALNEDLKTWTAADMAA-----QITRRK
HA1F_CHICK/23-198ILQRRYNQT.GGSHTVQWMYGCDI-----LEGG.PIRGYYQMAYDGRDF---TAFDKGTMTFTAAVPEA-----VPTKRK
HA17_MOUSE/22-200TAQSYYNQSKGGSHTLQWMYGCDM-----GSDGRLLRGYLQFAYEGRDY---IALNEDLKTWTAVDMAA-----QITRRK
HA11_RAT/25-203NLLSYYNQSEGGSHTIQRMYGCDV-----GSDGSLLRGYEQHAYDGRDY---IALNEDLKTWAVADFAA-----WITRSK
HA11_MOUSE/25-203NLLGYYNQSAGGSHTLQQMSGCDL-----GSDWRLLRGYLQFAYEGRDY---IALNEDLKTWTAADMAA-----QITRRK
HA1A_BOVIN/22-200TLRGYYNQSEAGSHTLQWMSGCDV-----GPDGALRRGFMQYGYDGRDY---LALNEDLRSWTAGETEA-----QITKRK
HLAG_HUMAN/25-203TLRGYYNQSEASSHTLQWMIGCDL-----GSDGRLLRGYEQYAYDGKDY---LALNEDLRSWTAADTAA-----QISKRK
HA1A_RABIT/25-203TALRYYNQSAAGSHTFQTMFGCEV-----WADGRFFHGYRQYAYDGADY---IALNEDLRSWTAADTAA-----QNTQRK
HLAE_HUMAN/22-200TLRGYYNQSEAGSHTLQWMHGCEL-----GPDRRFLRGYEQFAYDGKDY---LTLNEDLRSWTAVDTAA-----QISEQK
1A02_PANTR/25-203NLRGYYNQSEAGSHIIQRMYGCDM-----GPDGRLLRGYEQYAYDGKDY---IALNQDLSSWTAADTAA-----QITQRK
HA1T_MOUSE/27-205TMLDYYNLSQNGSHTIQVMYGCEV-----EFFGSLFRAYEQHGYDGPDY---IALNEDLKTWTAADTAA-----EITRSK
1C28_PANTR/22-200NLLRRYNQSEAGSHTLQGMNGCDM-----GPDGRLLRGYHQHAYDGKDY---ISLNEDLRSWTAADTVA-----QITQRF
HA1B_BOVIN/28-206TLRGYYNQSETGSHNIQAMYGCDV-----GPDGRLLRGFWQFGYDGRDY---IALNEELRSWTAADTAA-----QITKRK
HA19_CANFA/25-204TLRGYYNQSEAGSHTRQTMYGCDL-----GPDGRLLRGYSQDAYDGADY---IALNEDLRSWTAADTAA-----QITQRK
HA12_RAT/25-203TLRGYYNQSEGGSHTIQEMYGCDV-----GSDGSLLRGYRQDAYDGRDY---IALNEDLKTWTAADFAA-----QITRNK
1A01_SAGOE/25-203TLLGYYNQSEAGSHTIQWMYGCDL-----GPDGRLLRGYDQHAYDGKDY---IALNEDLRSWTATDVAA-----QITQRK

PF14586

RAE1C_MOUSE/31-204KLRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYF---FTFYTENMSWRSANDES-----GVIMNK
RAE1E_MOUSE/31-202ELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYF---FTFYTENMSWRSANDES-----GVIMNK
RAE1D_MOUSE/31-200KLRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYF---FTFYTEIMSWRSANDES-----GVIMNK

PF00969

DRB3_HUMAN/42-116-----------------------------FNGTERVRYLDRYFHNQEEF...LRFDSDVGEYRAVTELG.....RPVAES
DRB4_HUMAN/42-116-----------------------------LNGTERVWNLIRYIYNQEEY...ARYNSDLGEYQAVTELG.....RPDAEY
Q31369_DANRE/31-106-----------------------------TSDYSDMVLLESGSFNKVVD...VQYNSTVGKYVGYTEQG.....VIFARN
Q30765_MACRG/42-116-----------------------------VNGTQHVRFMDRYIYNREEN...VRFDSDVGEYVALTELG.....RPDAEY
Q31292_9MURI/7-79-----------------------------TTGTLRIRVVIRYIYNREEY...VRYDSDVGEYRALTQLG.....RPDAEY
Q31590_SALSA/27-102-----------------------------SKDLQGIEFIDSYVFNKAEY...IRFNSTVGKFVGYTELG.....VKNAEA
HB2D_CANFA/42-116-----------------------------TNGTERVRFVERYIHNREEF...VRFDSDVGEFRAVTELG.....RPVAES
O02908_MUSMA/9-83-----------------------------YNGTQRVRLLVRYIYNREEF...ARFDSDLGEHRAVTELG.....RPDAEY
Q31341_AGEPH/16-90-----------------------------INGTEKVRYVIRLIYNREQV...LMFDSDVGHYVGFTPYG.....EMWAKQ
O02896_MOUSE/9-83-----------------------------NNGTQHVRFLERFIYNREEN...LRFDIDVGEYRAVTDLG.....RPDAEN
Q31375_CYPCA/31-106-----------------------------SRDFSDMVYIDNYIFNKDVY...IQFNSTVGEYVGYTALG.....VYNAER
O19211_CAPHI/8-82-----------------------------SNGTERVRFLDRYFHNGEEY...VRYDSDRGEFRAVAELG.....RPEAEY
HB2A_RAT/8-82-----------------------------TNGTQRIRSVDRRFYNQEEF...LRYDSDVGEFRALTELG.....RSWADD
Q31320_APHCE/16-90-----------------------------INGTEKVRLVQRDFYNRLQY...LMYDSDVVHYVGFTPLG.....EKVARV
Q31459_MORSA/28-103-----------------------------STDPKNIEYIYSHYYNKLEI...ARFSSSVGEYVGYTEFG.....VKQAKY
DOB_HUMAN/39-113-----------------------------TNGTEKVQFVVRFIFNLEEY...VRFDSDVGMFVALTKLG.....QPDAEQ
O19274_SAGOE/6-78-----------------------------FKGTQHL..LERHIYNQEEF...VRFDSDLGEYRAVTELG.....LPAAEH
Q06742_XENLA/41-115-----------------------------RNGTDNVRYLEGYANNQEEY...AYFDSDVGEYKAKNDFG.....EVQAKY
Q31589_SALSA/41-115-----------------------------SKDLQGIELITSYVFNQAEN...IRFNSTVGKFVGYTEHG.....VKNAEA
Q31391_CARME/16-90-----------------------------TNGTEKVRFAERYIYNRQTY...AMFDSHVGHYVGFTPFG.....EKVARN
Q30539_LORTA/8-82-----------------------------HNGTQRVRLLARYFHNREEY...VRFDSDVGEFRAVTELG.....RPVAES
Q30812_SHEEP/4-78-----------------------------FNGTERVRLLERYFHNGEEF...ARFDSDWGEFRAVTELG.....RPAAEQ
DQB2_HUMAN/45-118-----------------------------TNGTERVRGVARYIYNREEY...GRFDSDVGEFQAVTELG.....R.SIED
P79456_BOVIN/5-79-----------------------------TNGTERVQYVTRHIYNQEEF...MRFDSEVGEYRAVTPLG.....RRQTEY
O19236_DELLE/5-79-----------------------------SNGTERVQLVDRYIYNGEEY...VRYDSDVGEYRAETELG.....RRTAEY
P79966_CAPAE/4-78-----------------------------FNGTERVRFLDRYFYNGEEY...VRFDNDWGEFRAVAELG.....RQTAKY
DPB1_HUMAN/42-114-----------------------------FNGTQRF..LERYIYNREEF...ARFDSDVGEFRAVTELG.....RPAAEY
Q95399_BOVIN/8-82-----------------------------TNGTEHVRLVARQIYNKEEI...LHFDSDLGEFVAVTELG.....RVCAEI
Q31314_APHCE/16-90-----------------------------INGTERVRFVDAYFYNRQQF...AMFDSDVGHYVGFTPFG.....EKQARY
O19364_FELCA/5-79-----------------------------TNGTEQVRLLERHFYNGEEF...VRFDNEVGEFRAVTELG.....RPTAKY
Q08609_CYPFR/25-100-----------------------------STELQDIEFIRSYYFRKVEF...TRFDSSVGKYVGYTEYG.....VRNAEE
Q30854_OTOGA/8-82-----------------------------FNWTEQVRFLGRHVYNQEEF...LLFHSDVGKGVAVTALG.....RTEEES
HB2L_CHICK/8-82-----------------------------LNGTERVRFLVRHVYNRQQY...VHFDSDVGLFVADTVLG.....EPSAKL
O02712_MACMU/5-79-----------------------------INGTERVRGVTRHIYNREEY...VRFDSDWGEHRAVTPLG.....RSWAEY
Q31354_DANRE/29-104-----------------------------TSDYSDMVYLASYSFNKVVD...TQFNSSVGKFVGYTEQG.....LIFAEN
Q31392_CARME/16-90-----------------------------TNGTEKVRFVERHIYNREPF...VMFDSDVGHYVGFTPYG.....EYNAKR
Q30461_HORSE/4-78-----------------------------SNGTQRVLYLHRLFYNGKEY...VRFDSDLGEYRALTELG.....RRSAEY
P79455_BOVIN/5-78-----------------------------TNGTERVRSVKKQIYNRQEH...VRFDSDVNEFRAVSPLG.....QRDAEY
Q31376_CYPCA/25-100-----------------------------SRDFSDMVFVDNYIFNKDVH...IQFNSTVGEFVGYTALG.....VHNAEL
HB2D_RAT/40-114-----------------------------YNGTQRVRFLARYIYNREEY...TRFDSDVGEFRAVTELG.....RPSAEY
O19246_CANFA/5-79-----------------------------TNGTERVRLLTKYIYNREEH...VRFDSDVGEYRAVTELG.....RPSAEY
Q5Y7D3_HUMAN/45-119-----------------------------TNGTERVRLVSRSIYNREEI...VRFDSDVGEFRAVTLLG.....LPAAEY
O19500_CHICK/8-82-----------------------------LNGTERVRYLDRQIYNRQQF...SHFDSDVGKYVADTPLD.....EYQVEI
Q30540_LORTA/8-82-----------------------------YNGTQRVRYLDRYFYNRQEY...VRFDSDVGEYRAVTELG.....RPDAEY
Q31463_MORSA/28-103-----------------------------STDPRNIEYINSYYYNKLEY...ARFSSSEGEFVGYTELG.....VKNAER
Q31244_MUSSA/8-81-----------------------------FNGKERVWSVTRFIYNQEEF...VRFNTDFGKFLAVTELG.....RPIAEY
Q31315_APHCE/16-90-----------------------------TNGTEKVRYIRRHFYNRLQY...TMYNSDVAHFVGFTPLG.....EKVARY
O19396_FELCA/5-79-----------------------------TNGTERVRYLERHYHNGEEN...LRFDSEVGEYRAVTELG.....RPDAKY
Q08607_CYPFR/25-100-----------------------------STELKDITYISSVYYNMMEV...VRFDSSVGEFVGYTKLG.....VKNADR
Q31487_ONCMY/30-105-----------------------------SKDLHGIEFIDSYVFNKAEH...VRFNSTVGRYVGYTEHG.....LKNAEA
Q31140_MOUSE/8-80-----------------------------TNGTQRIRLVSRNIYNREEF...MRFDSDVGEFRAVTELG.....RPDVEY
Q30554_MACAR/5-79-----------------------------TNGTERVRHVTRYIYNREEF...LRFDSAVGEYRAVTPQG.....RSDAEH
P70238_MOUSE/27-106-----------------------------DAGTPQD.FTYCVSFNKDLL...ACWDPDVGKIVPCEFGVLSRLAEIISMI
O02879_MUSCR/9-83-----------------------------YNGTQRVRLLVRFIYNREEY...VRFDSEVGEFRAVTELG.....RPEAEY
Q31316_APHCE/16-90-----------------------------INGTERVRLVVRLFYNRLQY...AMFDSDVGHYVGFTPYG.....EKVARY
P79442_BOVIN/5-79-----------------------------TNGTERVRSVNRYIYNQEEY...VRFDSDWDEYRALTPLG.....RPDAEY
Q31431_9PASE/37-110-----------------------------TNSTEKVRLVDRYIYNRLQF...VMFDSDVGEHVGFT.LG.....EKWAQG
Q30661_MACMU/6-80-----------------------------FNGTELMLYLIRYFHNQEEY...VRYDSDVGEYRAVTELG.....RPVAEN
O19495_CHICK/8-82-----------------------------LNGTERVRFLERQIYNRQQY...AHFDSDVGKYVADTPLG.....ERPSEY
Q06743_XENLA/41-115-----------------------------RNGTDNVRLLVRYISNQEEF...VYFDSEVGFFIAKNEWG.....KPDADN
Q31136_MOUSE/8-80-----------------------------TNGTQRMRLVARYIYNREEY...PRFDSDVGGYRAVTEPG.....RHSAEY
O19279_MACMU/6-80-----------------------------FNGREPVRYLNRYIHKREEN...LRFHSDVGEFQAVTELE.....RPVAQN
HB2C_PIG/45-119-----------------------------YNGTQRVRGVARYIYNQEEH...LRFDSDVGEFRAVTPLG.....RPEADS
Q30513_GALMO/8-81-----------------------------FNGTERVRYLVRFFYNREEY...VRFDNDVGEFQAVTELG.....RPEAEY
HB2A_MOUSE/40-114-----------------------------TNGTQRIRYVTRYIYNREEY...VRYDSDVGEHRAVTELG.....RPDAEY
O18945_BOSIN/5-79-----------------------------FNGTERVRFLDRCYTNGEET...VRFDSDWGEFRAVTELG.....RPDAEY
Q30764_MACRG/42-116-----------------------------TNGSERVRFVVRDIYNGEEF...ARFDSDVGVYVPVTELG.....RPDAEY
Q5Y7F1_HUMAN/45-119-----------------------------TNGTERVRGVTRHIYNREEY...VRFDSDVGVYRAVTPQG.....RPVAEY
HB21_SPAEH/42-114-----------------------------THGRYRY..VERYIYNQEEY...VRFDSDVGVFRAVTELG.....RSWADD
Q31334_AULHA/8-83-----------------------------STELKDIEYIVSYYFNKIEY...TRFDSSVGHYVGYTEYG.....VKNAEY
Q08608_AULHA/24-99-----------------------------STELKDIEYIYSQYYNKLEI...YRFSSSVGKFVGYTEYG.....VKQAKY
O19494_CHICK/8-82-----------------------------LNGTERVRYLQRYIYNRQQL...VHFDSDVGKFVADTPLG.....EPQAEY
HB21_MOUSE/40-114-----------------------------YNGTQRVRLLERYFYNLEEN...LRFDSDVGEFHAVTELG.....RPDAEN
O19229_DAMDA/5-79-----------------------------SNGTQRVGYLDRYFYNGEET...LRFDSDVGEFRAVTELG.....RPDAEL
Q30262_BOVIN/26-105-----------------------------DDGDPKD.FSYCISFNKDLL...TCWDPLQASMIPREFGVLNGLARYLSQF
O02877_MUSCO/9-83-----------------------------YNGTQRVRFLDRYFYNREEY...VRFNSEVGEFRAVTELG.....RHSAEY
Q06745_XENLA/42-116-----------------------------RNGTDNVRFLARYINNQEEY...AYFDSDVGSFIAKNDFG.....RVQADY
2B17_HUMAN/42-116-----------------------------FNGTERVQFLERLFYNQEEF...VRFDSDVGEYRAVTELG.....RPVAES
Q31377_CYPCA/25-100-----------------------------ASDYSDMVYLLSYSFNQGLD...AQFNSSVGKFVGYTEKG.....MKDAEY
Q31339_AGEPH/16-90-----------------------------INGTEKVRYLQKYIYNREPI...VRFDSDVGHYVGFTPYG.....EMTAKS
O19382_FELCA/5-79-----------------------------TNGTERVRFLARYFYNREEL...ARFDSEVGEFRAVTELG.....RPDAKH
O19220_RANTA/5-79-----------------------------SNGTQGVQFLQRYIYNREEF...VRFDSDVGEFRAVTELG.....RKSAEG
O19231_DELLE/5-79-----------------------------SNGTERVRLVTRHIYNGEEF...MRYDSDVGECRAVTELG.....RRTAES
O19493_CHICK/8-82-----------------------------LNGTERARFLERHIYNRQQF...MHFDSDVGKYVADTPLG.....ERQAEI
Q30827_SHEEP/39-113-----------------------------TNGTEKVRFVVRFIFNLEEY...ARFDSDLGMFVALTELG.....KPDAEL
O19291_MACMU/6-80-----------------------------FNGTERVRFLERHFYNQEEY...VRYDSDVGEYRAVTELG.....RRSAEY
Q30858_OTOGA/8-82-----------------------------FNGTERVRYLDRYIYNQEEY...VRFDSDVGEYRAVTELG.....RPIADK
Q30282_BOVIN/5-79-----------------------------FNGTERVRYLDRYFHNGEEF...VRFDSDWGEYRAVTELG.....RRVAEQ
Q30763_MACRG/27-101-----------------------------ENGTQHVRFMDRYFYNRQEA...LRFDSDVGEYVAVSELG.....RLQAEL
Q31253_RAT/9-88-----------------------------DEGTPMD.FTYCISFNKDLL...ACWDPEEGQIVPCEYGVLFKLAEFISNI
DMB_HUMAN/27-106-----------------------------DAGTPKD.FTYCISFNKDLL...TCWDPEENKMAPCEFGVLNSLANVLSQH
Q31270_RAT/21-95-----------------------------YNGTQRVRLLARLIYNREEY...ARFDSDVGEYRAVTELG.....RPSAEY
Q31311_APHCE/16-90-----------------------------INGTERVRLVERYIYNRLEY...AMYDSDVVHFVGFTPYG.....EKQARY
O19288_MACMU/6-80-----------------------------FNGTERVRFLDRYFHNQEEL...VRFDSDVGEFRTVSELG.....RPEAQS
Q30694_MACMU/5-79-----------------------------INGTEHVHHVNRYIYNREEF...VGFDSYLGVYRPVTPLG.....RSWAEY
Q30338_CHLAE/5-79-----------------------------TNGTERVWSVDRYIYNREEY...VRFDSDVGLYLPVTPLG.....RSSAEY
Q29783_HUMAN/8-82-----------------------------TNGTERVRLVSRSIYNREEI...VRFDSDVGEFRRGDAAG.....AACRRV
Q31514_POERE/27-102-----------------------------SPELKDIQFIRSYCYNKLEF...IRFDSNLGKYVGYTELG.....VKNAER
Q30217_HUMAN/8-82-----------------------------CNGTERMRFVQRLVHTGRSMRASIGTSESSGRWRSWS..G.....E.ESRN
O35424_MOUSE/39-113-----------------------------TNGTEKVHLLVRFIFNLEEY...LHFDSDLGMFVALTELG.....EPDADQ
O19492_CHICK/8-82-----------------------------LNGTERVRFLDRQIYNRQQL...MHFDSDVGKFVADTPLG.....EPQAEY
HB2P_RABIT/43-113-----------------------------SNGTQRL..LDRCAYNREEF...VRFDSDIGEFRAVSELG.....RQVAES
O19378_FELCA/5-79-----------------------------TNGTERVRYLVRFFYNREEL...ARFDSEVGEFRAVSELG.....RPDAKY
P79597_XENLA/33-107-----------------------------RNGTDNVRLLWRHYYNLEET...DYFDSDVGLFIAKTELG.....KPSADY
P79466_BOVIN/8-82-----------------------------SNGLERMRFFARYIYNTQED...VHFDSDVGEFTALTELG.....RLDAEY
P79447_BOVIN/5-79-----------------------------TNGTQRVRLVTRYIYNREEF...ARFDSDVNEFRAVTPLG.....RPDAEY
Q31462_MORSA/28-103-----------------------------STDLKDIKYIRSEYYNKLEI...ARFSSSVGEFVGYTELG.....LRWAKY
Q31432_9PASE/37-111-----------------------------TNGTEKVRFVDRYIYNREQF...VMFDSDVGEFVGVQPLG.....EKNAKR
Q08611_CYPFR/23-98-----------------------------STELKDIQFIRSYYYNMMEV...VRFDSSVGEYVGYTDFG.....VKQAKY
O19298_9PRIM/6-79-----------------------------FNGTERVRFLHRDIYNQEED...ALFDSDVGEYRVVTELG.....RPDAEY
O19287_MACMU/6-80-----------------------------FNGTERVRYLERHFYNQEEF...LHFDSDLGEFRAVTELG.....RPDAQY
O02909_MUSPL/9-83-----------------------------YNGTQLVRFLDRYIHNREEY...ARFDSDVGEYHAVTELG.....RPTAEY
O19253_CANFA/6-79-----------------------------TNGTERVRLLVRDIYNREEH...VRFDSDVGEYRAVTELG.....RPDAES
Q31358_DANRE/26-101-----------------------------LQDLSDIGVHDNYIFNKDVY...IRFNSTLGYFVGYTEHG.....VYNAQL
Q08606_AULHA/25-100-----------------------------STELKDIEYIRSVYYNKLEI...FRFSSSLGKFVGYTEYG.....VKQADY
O19491_CHICK/8-82-----------------------------LNGTERVRYLVRYVYNRQEY...AHFDSDVGKHVADTALG.....EPQAEY
Q29922_HUMAN/8-82-----------------------------TNGTERVRYVTRYIYNREEY...ARFDSDVEVYRAVTPLG.....PPDAEY
O19218_MONDO/42-116-----------------------------INGTDQVRLIERYIYNREEY...VRFDSNVGVYEAVTELG.....RGIAEH
Q30458_HORSE/41-115-----------------------------TNGTERVRLVTRYIYNREEY...VRFDSDVGEYRALTELG.....RPTAEY
Q31390_CARME/16-90-----------------------------TNGTEKVRFVERHIYNRQTF...VVFDSDVGHYVGFTPYE.....EYNAKR
Q30856_OTOGA/8-82-----------------------------FNGTERVRYLDRYFYNQEEL...VRFDSDVGEFRAVTELG.....RPSAEY

PF00993

DPA1_HUMAN/35-115-----------------------------FVQTHRPTGEFMFEFDEDEM-----FYVDLDKKETVWH-------LEEFGQ
O02872_RABIT/41-124-----------------------------FCQMGNPSEGLFEAYDSDLL-----FSFDFSQRTRVPR-------LPEFAD
Q8MGS1_DANRE/1-83-----------------------------GACGDADQEDFIVQFDDEQL-----AHVDFKEQKDVIT-------LPEFAD
Q8MGR1_DANRE/2-82-----------------------------VC..SNTEQEFFIGYDGEEI-----WHADFAQKRGVDT-------SPKFAD
Q31362_DANRE/31-108-----------------------------....SDTEKEYISVLDGEEM-----YHTDFSGKRGEMT-------LPDFAD
Q9XSK9_CANFA/1-82-----------------------------VYQSYGPSGQYTHEFDGDEE-----FYVDLEKKETVWR-------LPVFST
Q30457_HORSE/29-110-----------------------------VYQSYGDFGQYTHEFDGDEE-----FHVDLEKKETIVR-------LPVFSE
Q31625_DANRE/21-100-----------------------------FFGCSDTEKEYLQGFDGEEL-----YHSDFIRKVGVVT-------APDFAD
Q8MGR4_DANRE/19-101-----------------------------IYVCSDTESEAMVGADGEEL-----WHADFKQKTGIIT-------LPDFAD
Q9XR28_ICTPU/21-102-----------------------------AC..SDTDKEYVLGIDKEEV-----YYADFVKQLIVKA-------LPPFAD
Q9MXY9_RABIT/2-83-----------------------------LYQYYGPSGQYTHEFDGDEQ-----FYVDLDKKETVWR-------LPEFSK
Q8WM48_XENLA/3-84-----------------------------FYQTYGPSGEYLNDYNGNEL-----FHVDLESKSVVWT-------LPGLEK
O19197_BOSIN/28-109-----------------------------FYQSHGPSGQYIHEFDGDEL-----FYVDLGKKETVWQ-------LPMFGE
O19310_BOVIN/1-82-----------------------------IYQSHGPSGQYTQEFDGDEL-----FYVDLGKKETVWR-------LPMFSQ
Q9MX27_ONCMY/21-101-----------------------------GC..SDSDGVDMYGLDGEEL-----WYADFNKKEGVVA-------LPPFAD
DOA_HUMAN/29-110-----------------------------FYQSYGASGQFTHEFDEEQL-----FSVDLKKSEAVWR-------LPEFGD
Q31064_PIG/39-119-----------------------------FYLSPDKSGEFMFDFDGDEI-----FHVDMEKRETVWR-------LEEFGH
O19704_HUMAN/6-86-----------------------------LYQSYGPSGQFTHEFDGDEE-----FYVDLERKETVWK-------LPLFHR
Q8WLP3_SALSA/19-100-----------------------------ITGCSDSDGLDMYGLDGEEM-----WYADFNKQEGVVA-------LPPFAD
O19318_BOVIN/1-82-----------------------------VYHSYGPSGYYTHEFDGDEE-----FYVDLEKRETVWR-------LPVFSK
Q30762_MACRG/27-108-----------------------------VYQSYESSGQYTQEFDEDEL-----FYVDLQKKETVWR-------LPEFSH
Q9XRW8_RATFU/1-81-----------------------------MYQYYESRGQYTFEFDGDEL-----FYVDLDKKETIWR-------IPKFGQ
Q31396_GINCI/24-105-----------------------------FVQQRSPEKHFDVMEDGDEI-----FYMDFNLKKEVAR-------IPEFAH
O19195_BOSIN/28-108-----------------------------FYQSHGPSGQYIHQFDGDEE-----FYVDLEKEEAVWR-------LPMFDK
Q9MX25_ONCMY/21-101-----------------------------ITGCSDSDGVDMYGLDGEEL-----WYADFNKKEGVMA-------LPPFAD
Q31150_MOUSE/29-110-----------------------------FYQSYDASGQFTHEFDGEQI-----FSVDLKNEEVVWR-------LPEFGD
Q8SP47_CAVPO/29-109-----------------------------FVQTQRPSGEYMFELDEDEM-----FYVDLDKKQTVWH-------LPEFGQ
Q31469_MORSA/24-102-----------------------------..ACSDSDGEKMYGLDGEEV-----WYADFINKKGVEP-------QPSFID
Q8HWL3_SIGHI/30-111-----------------------------MYQSHKPNGQYIFEFDGDEL-----FYVDSDKKETVWR-------IPEFGE
Q9BEA4_PIG/41-124-----------------------------YCQDGNPEVGLSEVYDGDQL-----FSFNFSQNIRVPR-------LPEFAD
Q31287_RAT/29-109-----------------------------FVQTQHPSGECMYAFDGDEQ-----FYVDLDREETVWD-------LPEFSK
Q8MGS6_DANRE/2-82-----------------------------VC..SNTEQEFFIGYDGEEI-----WHADIAHRRGVKT-------TPSFAQ
Q31247_PERLE/1-82-----------------------------FYQSYGPKGQYTHEFDGDEL-----FYVDLDKKETIWR-------IPEFGQ
Q95521_RABIT/1-82-----------------------------VCQSYGPSGQYTHEFDGDEQ-----FYVDLDKKETIWR-------LPEFSR
Q8K2X0_MOUSE/30-111-----------------------------VYQSPGDIGQYTHEFDGDEW-----FYVDLDKKETVWM-------LPEFGQ
Q8WM44_XENLA/3-84-----------------------------YYQTYGPSGEYLMDYNGNEL-----LHVDLESKSVVWT-------LPGLDK
Q30181_HUMAN/20-100-----------------------------FVQTHRPSGEYMFEFDEEEQ-----FYVNLDEKEMVWP-------LPEFIH
Q8WM45_XENLA/4-84-----------------------------YYQTYGPSGEYLFDYEGNEM-----FHVDLESKSVVWT-------LPGLEK
Q8MGX3_PIG/29-110-----------------------------VYQSYGSSGYYTHEFDGDEQ-----FYVDLEKKETVWK-------LPLFSK
Q31359_DANRE/21-100-----------------------------FTGCSDTEKDDLTGFDGEEE-----YHTDFIRKEGVMT-------LPDFAD
O98262_BOVIN/29-110-----------------------------IYQSYGPSGQYTHEFDGDEQ-----FYVDLEKKETAWQ-------LPLFSR
HA2P_RABIT/1-81-----------------------------FAQTHEPSGECMFEFDEDEV-----FHVDLDKKQAIWY-------LPEFGR
Q9MXF8_AOTNA/29-110-----------------------------LYQSYGPSGQYTHEFDGDEE-----FYVDLGRKETVWR-------LPVFSK
Q31468_MORSA/20-100-----------------------------IAGCSDSDGEEMYGLDGEEV-----WYADFINKKGVEP-------QPSFID
HA2B_RAT/30-111-----------------------------VYQYHESKGQYTHEFDGDER-----FYVDLDKKETIWR-------IPEFGQ
Q31465_MORSA/24-103-----------------------------....SDSDGEDMIALDGEEV-----WVADFINKKGVEP-------QPSFID
Q07455_SHEEP/29-110-----------------------------VYQTYGPSGYFTHEFDGDEQ-----FYVDLEKRETVWR-------LPMFSK
Q30306_BOVIN/1-82-----------------------------VYQTYGTSGQFTFEFDGDEL-----FYVDLGKKETVWR-------LSEFSN
O97981_PIG/29-110-----------------------------FYQSYDGSGQFTYDFDGEQL-----FSVDLKKREAVWR-------LPEFSN
DQA2_HUMAN/29-110-----------------------------FYQSHGPSGQYTHEFDGDEE-----FYVDLETKETVWQ-------LPMFSK
O19760_HUMAN/29-110-----------------------------LYQFYGPSGQYTHEFDGDEE-----FYVDLERKETAWR-------WPEFSK

PF00129

HLAH_HUMAN/25-203WEAARRAEQ.RRVYLEGEFVEWLRRYLENGKETL---
ZA2G_HUMAN/26-201WEAEPVYVQRAKAYLEEECPATLRKYLKYSKNIL---
HA10_MOUSE/25-203WEQAGAAEY.YRAYLEAECVEWLLRYLELGKETL---
HA15_MOUSE/21-199SEAVDEAHQ.QRAYLQGPCVEWLHRYLRLGNETL---
1C01_GORGO/25-203WEAARWAER.QRAYLEGLCVEWLRRYLENGKETL---
HA13_MOUSE/25-203WEQAGAAER.DRAYLEGTCVEWLRRYLELGNATL---
1A01_GORGO/25-203WEAAHFAEQ.LRAYLEGTCVEWLRRHLENGKETL---
HA1D_MOUSE/22-200WEQAGDAEY.YRAYLEGECVEWLRRYLELGNETL---
FCGRN_RAT/25-198WMKQPEAARKESEFLLTSCPERLLGHLERGRQNL---
HA12_MOUSE/25-203WEQAGAAER.DRAYLEGECVEWLRRYLKNGNATL---
HA1F_CHICK/23-198WEEESEPER.WKNYLEETCVEWLRRYVEYGKAEL---
HA17_MOUSE/22-200WEQAGIAEK.DQAYLEGTCMQSLRRYLQLGKETL---
HA11_RAT/25-203WQRNGAAER.SRAYLEGTCVEWLLRYLERGKETL---
HA11_MOUSE/25-203WEQSGAAEH.YKAYLEGECVEWLHRYLKNGNATL---
HA1A_BOVIN/22-200WEAAGYAEV.QRNYLEGECVEWLRRYLENGKDTL---
HLAG_HUMAN/25-203CEAANVAEQ.RRAYLEGTCVEWLHRYLENGKEML---
HA1A_RABIT/25-203WEAAGEAER.HRAYLERECVEWLRRYLEMGKETL---
HLAE_HUMAN/22-200SNDASEAEH.QRAYLEDTCVEWLHKYLEKGKETL---
1A02_PANTR/25-203WEAARWAEQ.LRAYLEGTCVEWLRRYLENGKETL---
HA1T_MOUSE/27-205WEQAGYTEL.RRTYLEGPCKDSLLRYLENRKKTQ---
1C28_PANTR/22-200YEAEEYAEE.FRTYLEGECLELLRRYLENGKETL---
HA1B_BOVIN/28-206WEAAGAAET.WRNYLEGECVEWLRRYLENGKDTL---
HA19_CANFA/25-204WEAAGVAELQWRNYLETTCVEWLRRYLEMGKETL---
HA12_RAT/25-203WERARYAER.LRAYLEGTCVEWLSRYLELGKETL---
1A01_SAGOE/25-203WEAANEAER.TRAYLEGTCVEWLHRYLENGKETL---

PF14586

RAE1C_MOUSE/31-204WNDDGDLVQ-RLKYFIPECRQKIDEFLKQSKEK----
RAE1E_MOUSE/31-202WKDDGDLVQ-QLKYFIPQCRQKIDEFLKQSKEK----
RAE1D_MOUSE/31-200WKDDGEFVK-QLKFLIHGCSQKMDEFLKQSKEK----

PF00969

DRB3_HUMAN/42-116WNSQKDLLEQKRGRVDNYCRHNYGVGE----------
DRB4_HUMAN/42-116WNSQKDLLERRRAEVDTYCRYNYGVVE----------
Q31369_DANRE/31-106FNKNQAYLQQRKAEVESFCRHNAQISD----------
Q30765_MACRG/42-116WNSQKELLDLRRAAVDWFCRVCYEISE----------
Q31292_9MURI/7-79YN..KQYLEQTRAQVDTVCRHNYEETE----------
Q31590_SALSA/27-102WNSDAAVLAVERGELERYCKHNADLHY----------
HB2D_CANFA/42-116WNGQKEILEQERATVDTYCRHNYGVIE----------
O02908_MUSMA/9-83WNNQKELLERRRAEVDTVCRHNYETSN----------
Q31341_AGEPH/16-90LNSDPADMEYRRSEVDRYCRHNYEVFR----------
O02896_MOUSE/9-83WNSQPEILEDARASVDTYCRHNYEISD----------
Q31375_CYPCA/31-106FNKDPNILQQERAQVERYCKHNAELYQ----------
O19211_CAPHI/8-82WNSQKEILEQKRAEADTVCRHDYGVIE----------
HB2A_RAT/8-82WNSQKEILEQKRAEMDTVCRYNYEETE----------
Q31320_APHCE/16-90WNSDPDFMEQRRAEVDTVCRDNYGVYT----------
Q31459_MORSA/28-103WNSDPSELARRSAQKETVCQHNINIDY----------
DOB_HUMAN/39-113WNSRLDLLERSRQAVDGVCRHNYRLGA----------
O19274_SAGOE/6-78LNSQKDFMEQKRAEVDTVCRHNYELNE----------
Q06742_XENLA/41-115WNSQKDLLDQKRAVVDTVCRYNYQLYK----------
Q31589_SALSA/41-115WN.KGPELAGELGVLERYCKFNAPIDY----------
Q31391_CARME/16-90WNSSPEWMEDRRPVVDTACRHNYEVSR----------
Q30539_LORTA/8-82WNSRKDVLEEARAAVDTYCRHNYQISD----------
Q30812_SHEEP/4-78WNSQKNILEQKRAEVNTVCRHNYGVFE----------
DQB2_HUMAN/45-118WNNYKDFLEQERAAVDKVCRHNYEAEL----------
P79456_BOVIN/5-79FNSQKDELERVRAEADTVCRHNYQAEL----------
O19236_DELLE/5-79WNSQKDLLEQNRAALDTYCRHNYGVVE----------
P79966_CAPAE/4-78WNSQKELLERRRTEVDTFCRHNYGVFE----------
DPB1_HUMAN/42-114WNSQKDILEEKRAVPDRMCRHNYELGG----------
Q95399_BOVIN/8-82WNTQKDLLAEFRAYVDTLCRHNYKETA----------
Q31314_APHCE/16-90WNSDPVIMEDMRASVDTYCRYNYGVFA----------
O19364_FELCA/5-79WNEQKDHLEQERTAVDRICRHNYGVGE----------
Q08609_CYPFR/25-100WNKDKGNLAAMNAQKGTYCLHNIGVWN----------
Q30854_OTOGA/8-82WNRRKELLELKRGQVDNYCRHKYRIGR----------
HB2L_CHICK/8-82FNSQPDVLEKNRAAVEMLCNYNYEIVA----------
O02712_MACMU/5-79WNNQKDFLETTRASVDTVCRHNYQSEL----------
Q31354_DANRE/29-104FNKDQAYLHQLKAQVDTFCRHNAQIWD----------
Q31392_CARME/16-90LNSDPDILEYKRTAVDRYCRHNYEVSR----------
Q30461_HORSE/4-78WNGQQDILEQKRAEVDTVCRHNYGVSE----------
P79455_BOVIN/5-78FNSH.DFLKQTRAEVDTVCRHNYQLEL----------
Q31376_CYPCA/25-100WNKDTTGLQQERAQVDSFCKHNAQIRQ----------
HB2D_RAT/40-114YNKQKEYMEQLRATVDTACKHDYEISE----------
O19246_CANFA/5-79WNPQKDEMDRVRAELDTVCRHNYGLEE----------
Q5Y7D3_HUMAN/45-119WNSQKDILERKRAAVDRVCRHNYQLEL----------
O19500_CHICK/8-82WNSDAEFLENRMNEVDRYCRHNYGDVE----------
Q30540_LORTA/8-82WNSLKDLMERKRTAVDWFCRVSYQIPD----------
Q31463_MORSA/28-103FNKDPSYLAQRRAEKERYCLTNINIDY----------
Q31244_MUSSA/8-81LNTQKDMLDNYRASVDRC.RNNYDLVD----------
Q31315_APHCE/16-90WNRDPDFMEQRRTAADWYCRHNYGVMT----------
O19396_FELCA/5-79WNGLKDYMEEKRTAVDRYCRHNYGVFD----------
Q08607_CYPFR/25-100FNKDQGRLAAMRAQKGTYCLHNIGNWN----------
Q31487_ONCMY/30-105WNSDAGILGQEQAELERYCKPSAAIDY----------
Q31140_MOUSE/8-80WN..KQYLEQKRAAVDTVCRHNYEGPE----------
Q30554_MACAR/5-79WNSQKDVLESTRAELDTVCMHNYEVTY----------
P70238_MOUSE/27-106LNEQESLIQRLQNGLQDCATHTQPFWD----------
O02879_MUSCR/9-83LNSQPEILEERRAEVDTFCRHNYEISD----------
Q31316_APHCE/16-90RNSDPALMEQRRAAVDTYCRHNYEVST----------
P79442_BOVIN/5-79WNSQKDILERTRAEADTVCRNNYQVDA----------
Q31431_9PASE/37-110LNSDPELMEERRGGVDTYCRHNYQVDA----------
Q30661_MACMU/6-80WNSQKDLLEQRRAEVDTYCRHNYGVGE----------
O19495_CHICK/8-82WNSNAEILEYKRGQVDRYCRHNYGDFE----------
Q06743_XENLA/41-115WNSQKETVERYRAEVDTVCRHNYQSVK----------
Q31136_MOUSE/8-80YN..KQYLERTRAELDTACRHNYEETE----------
O19279_MACMU/6-80WNSQKGILEEKRDKVDTYCRYNYRVFE----------
HB2C_PIG/45-119WNSQKDVLEQMRAEVDRVCKHNYQIEE----------
Q30513_GALMO/8-81WNSQKDLLEKVRAEVD.ICRHNYGVVE----------
HB2A_MOUSE/40-114WNSQPEILERTRAELDTVCRHNYEGPE----------
O18945_BOSIN/5-79WNSQKDFLEERRAEVDRVCRHNYGVVE----------
Q30764_MACRG/42-116WNSQEEILEKERAYVDTLCRHNYEAAK----------
Q5Y7F1_HUMAN/45-119WNSQKEVLEGARASVDRVCRHNYEVAY----------
HB21_SPAEH/42-114FNSRKEALEQKRAAPDTGCRHNHELNQ----------
Q31334_AULHA/8-83WNNLPGELARWRAAKETYCQHNIGNWY----------
Q08608_AULHA/24-99FNDQPAVVAQRRAAKETYCQHNIGIWY----------
O19494_CHICK/8-82WNSNAELLENIMNIADGSCRHNYGILE----------
HB21_MOUSE/40-114WNSQPEFLEQKRAEVDTVCRHNYEISD----------
O19229_DAMDA/5-79WNSQKDFMEQKRAEVDTVCRHNYGVAE----------
Q30262_BOVIN/26-105LNNNSYLIQRLSNGLQNCAAHTQPFWS----------
O02877_MUSCO/9-83WNSQPEILEDARTAVDTYCKHNYEISD----------
Q06745_XENLA/42-116WNSQKEILDQHRAEVDTLCRYNYQSDK----------
2B17_HUMAN/42-116WNSQKDILEDRRGQVDTVCRHNYGVGE----------
Q31377_CYPCA/25-100WNNNPAELQQRRAEVDTYCRHNAQILD----------
Q31339_AGEPH/16-90WNSDPGEMEYRRSLVDTFCRHNYEGIR----------
O19382_FELCA/5-79WNGQKDFMEQTRTAVDWLCRHNYGVFD----------
O19220_RANTA/5-79WNSRKEILEESRAAVDTYCRHNYGVGE----------
O19231_DELLE/5-79LNSQKDFLERRRAEVDTVCRHNYGVVE----------
O19493_CHICK/8-82WNSNAEILEDEMNAVDTFCRHNYGVGE----------
Q30827_SHEEP/39-113WNNRPDILARSRASVDMLCRRNYKLGA----------
O19291_MACMU/6-80FNSQKGYLEQARAAVDTYCRHNYRIGE----------
Q30858_OTOGA/8-82LNSQKDYMEQRRAQVDTFCRHNYEISE----------
Q30282_BOVIN/5-79LNGQKDTLERERAYVDTYCRHNYGVVE----------
Q30763_MACRG/27-101WNKREEILEDARAAVDTLCRHNYEILE----------
Q31253_RAT/9-88LNKEEGLIQRLKNGLQDCSTHTQPFWN----------
DMB_HUMAN/27-106LNQKDTLMQRLRNGLQNCATHTQPFWG----------
Q31270_RAT/21-95RNKQKEFMERRRAAVDTYCRHNYEIFD----------
Q31311_APHCE/16-90RNSLPDFMENTRTAVDWYCRNNYEVST----------
O19288_MACMU/6-80WNSRKDLLEQRRAEVDTYCRHNYGVFE----------
Q30694_MACMU/5-79WNSQKDILERTRAVVDTVCRHNYQSEL----------
Q30338_CHLAE/5-79MNSQKEALESKRAELDTVCIHNYQLEL----------
Q29783_HUMAN/8-82LEQPEGHPGEETGGGGQGVQTQLPVGA----------
Q31514_POERE/27-102WNKDTSLIAAMKAQRETYCLNNVGNDY----------
Q30217_HUMAN/8-82ANSQKNLLGCLRGLLDTYCRHNYGVFE----------
O35424_MOUSE/39-113WNKRLDLLETSRAAVNMVCRQKYKLGA----------
O19492_CHICK/8-82WNSDAEFMEIKRNEVDTFCRHNYGVNE----------
HB2P_RABIT/43-113WN..LEYLQQARAEVDRVCRHNYELFQ----------
O19378_FELCA/5-79LNEQKDFMEGKRAEVDTVCRHNYGVGE----------
P79597_XENLA/33-107WNSQKETLEQKRAAVDTVCRHNYPFDK----------
P79466_BOVIN/8-82WNQQKDFMEQMRAKVDTLCRPNYQGIG----------
P79447_BOVIN/5-79WNSQKDILEQRRAEVDRVCRHNYQLDA----------
Q31462_MORSA/28-103WNNNPSYLAQMRGEKERYCQHNIGNWY----------
Q31432_9PASE/37-111RNSNPERMEYKRGLVDTYCRHNYRIVT----------
Q08611_CYPFR/23-98FNSQPANLAAMRAQKGTYCQHNIGIDY----------
O19298_9PRIM/6-79WNSQKDILERMRATVDTC.RYDYDIIE----------
O19287_MACMU/6-80LNSQKDLLEDRRAGVDTYCRHNYGVFE----------
O02909_MUSPL/9-83FNSQKEVLEHKRAHVDTYCRHNYEISD----------
O19253_CANFA/6-79WNRQKELLEQRRAEVDTVCRHNYGVI.----------
Q31358_DANRE/26-101WKQRYQLLEQERAHEDRFCKYNAEIDY----------
Q08606_AULHA/25-100RNNDKAILSSMKAQKETYCHNNIGVDY----------
O19491_CHICK/8-82WNSNAEILENRMNEVDTYCRHNYGDVE----------
Q29922_HUMAN/8-82WNSQKEVLERTRAELDTVCRHNYQLEL----------
O19218_MONDO/42-116LNSQKERLDYLLAAVDTYCRHNYEISE----------
Q30458_HORSE/41-115WNGQKDVLEQTRAELDRVCRYNYQLEV----------
Q31390_CARME/16-90LNSDTQWMEYKRAVVDTVCRHNYPIFT----------
Q30856_OTOGA/8-82WNSRKEVLEDERAAVDTFCRHNYEISE----------

PF00993

DPA1_HUMAN/35-115AFSFE...AQGGLANIAILNNNLNTLIQRSNHTQATN
O02872_RABIT/41-124WAQDQSDISDILFDRWFCQQLVQNVGPHLDGKIPVSR
Q8MGS1_DANRE/1-83QAVLPP.IYVDAKRAEFNCKAYLAVLREVYASSPEVL
Q8MGR1_DANRE/2-82DVTFPG.FYERAIQYISGCKSNLLVFIKSFKNPPPEM
Q31362_DANRE/31-108PFTYPG.TYEQSLADYETCKHNLDVAAKAYKS.PLEK
Q9XSK9_CANFA/1-82FRSFD...PQGALRNLAIAKQNLNILTKSSNQTAATN
Q30457_HORSE/29-110FTSFD...PQGALQNIATAKHNLDILIKRSNSTAATN
Q31625_DANRE/21-100PMSYPG.FYENSVAQMEVCKQDLATDIKAYNS.PEEQ
Q8MGR4_DANRE/19-101RIGFPG.FYEISVDSIAGCKRNLANNIRGFKSPPPAM
Q9XR28_ICTPU/21-102TLNPPETAYQSAGAEIDICKTNLGVYRTEFKDTPTPQ
Q9MXY9_RABIT/2-83FTSFD...PQGGLREIATAKYNLNNLMKRTNSTAAVN
Q8WM48_XENLA/3-84YASFD...PQAALQNINVAKYNLDGYKKSPNSTAATS
O19197_BOSIN/28-109LTSFE...AQDALNEIAKAKHTLDVLTKRSNFTPVIN
O19310_BOVIN/1-82FAGFD...PQAALSEIATAKHNLDVLTKRSNFTPVIN
Q9MX27_ONCMY/21-101QISFPG.YYEQAVGNQRTCKGDLGVDIKAYKNPPETI
DOA_HUMAN/29-110FARFD...PQGGLAGIAAIKAHLDILVERSNRSRAIN
Q31064_PIG/39-119FASFE...AQGALANIAVDKANLEILIKRSNNTPNTN
O19704_HUMAN/6-86L.RFD...PQFALTNIAVLKHNLNILIKRSNSTAATN
Q8WLP3_SALSA/19-100PFTFPG.FYEQAVGNQGVCKGNLAKCIKAYKN.PEEK
O19318_BOVIN/1-82FASFD...PQGALRNIAVGKRTLEVMIRRSNSTAATN
Q30762_MACRG/27-108FSSFD...PQGGLREKATCKYNLDILIKRSNRSRAIS
Q9XRW8_RATFU/1-81QTSFD...PQHGLQDIATLKYNLEILMK.SNSTPATN
Q31396_GINCI/24-105LYMQGG..EAAISANIAIVKNNLKVDMNLSAGTPEPK
O19195_BOSIN/28-108L.RFH...PQGALRNIAIAKHNLDVLTKLYNFTPVIN
Q9MX25_ONCMY/21-101QMTFPG.FYEQAVGNLGICKANLAVAIKASKNPPEAI
Q31150_MOUSE/29-110FAHSD...FQSGLMSISMIKAHLDILVERSNRTRAVS
Q8SP47_CAVPO/29-109AFTFD...AQGGLTNIAILRENLNGAIKAFNHTQAPN
Q31469_MORSA/24-102HITYPG.GYESAVAQQQICRQNLKVALQAYKNPPLQL
Q8HWL3_SIGHI/30-111LTSFD...PQGGLQDIATVKHNLEILTKRSNSTPATN
Q9BEA4_PIG/41-124WAHQIEDTPAIFFDKGFCREMIEKVGPLFEGKIPVSR
Q31287_RAT/29-109VYAFD...AQEALPYIDSLKNNLRALIQRYNVTQDPS
Q8MGS6_DANRE/2-82YAVIPD.IYERALAFLDFCKYDLHAYIKYFNNPPPEM
Q31247_PERLE/1-82LTSFD...PQGGLQDIATAKQGLDILIKRSNFTPATN
Q95521_RABIT/1-82FTSFD...PQGALGNIATARYNLDLLIKDSNSTAAIN
Q8K2X0_MOUSE/30-111LTSFD...PQGGLQNIATGKHNLGGWTKRSNFTPATN
Q8WM44_XENLA/3-84WESFD...PQGGLQEINVDKFNLDIVMKRANFTAATN
Q30181_HUMAN/20-100TFDFG...AQRGIAGIVMARKHLNTRIXWSKQTWATN
Q8WM45_XENLA/4-84YTSFD...PQGGLQNINVDKFNLDIMMKVSNFTAATN
Q8MGX3_PIG/29-110FTSFD...PQGALRNIAVGKLTLNILTKRSNNTAAVN
Q31359_DANRE/21-100PYSYPG.GYEAGVANMEICKQNLATDIKAYNS.PEEQ
O98262_BOVIN/29-110MLSFD...PQLALRNIAIMKLHVDFLTKFSNSTAATN
HA2P_RABIT/1-81MFSVE...AQGGLANIAAAKSNLNACIQHSNHTQAPN
Q9MXF8_AOTNA/29-110FTSFD...PQGALTETATGKYNLDILIKQSNSTAASN
Q31468_MORSA/20-100HTSYVEGTYEQAVANQQICRQNLGLALKAVKD...PQ
HA2B_RAT/30-111LISFD...PQGALRNIAIIKHNLEILMKRSNSTPAVN
Q31465_MORSA/24-103PFNYQEGVYEQAVANQQICRQNLEVERKAYKDLPLTL
Q07455_SHEEP/29-110FGDFD...PQFALRNIRTLKHNLELIIQRSNSTAATN
Q30306_BOVIN/1-82ITKFE...VQSALRNIVMSKRNLDILIKNSSFTPATS
O97981_PIG/29-110FADFD...PQNGLRGIALIRAHLDVLVERSNHTRATN
DQA2_HUMAN/29-110FISFD...PQSALRNMAVGKHTLEFMMRQSNSTAATN
O19760_HUMAN/29-110FGGFD...PQGALRNMAVAKHNLNIMIKCYNSTAATN

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window