Sequence alignment for CL0343

PF00129

HLAH_HUMAN/25-203RSHSMRYFYTTMSRPGAGEPRF----------------------ISVGYVDDTQFVRFDSDDASPREEPRAPWMEREG.P
ZA2G_HUMAN/26-201GRYSLTYIYTGLSKHVEDVPAF----------------------QALGSLNDLQFFRYNSKDR..KSQPMGLWRQVEG.M
HA10_MOUSE/25-203GSHSMRYFETSVSRPGLGEPRF----------------------IIVGYVDDTQFVRFDSDAETPRMEPRAPWMEQEG.P
HA15_MOUSE/21-199SPHSLRYFTTAVSRPGLGEPRF----------------------IIVGYVDDTQFVRFDSDAENPRMEPRARWIEQEG.P
1C01_GORGO/25-203GSHSMRYFFTAVAPPGRGEPRF----------------------IAVGYVDDTQFVRFDSDAANTRGEPRAPWVEQEG.P
FCGRN_RAT/25-198PRLPLMYHLAAVSDLSTGLPSF----------------------WATGWLGAQQYLTYNNLRQ..EADPCGAWIWENQVS
HA12_MOUSE/25-203GSHSLRYFVTAVSRPGFGEPRY----------------------MEVGYVDNTEFVRFDSDAENPRYEPRARWIEQEG.P
HA1F_CHICK/23-198ELHTLRYIQTAMTDPGPGQPWF----------------------VTVGYVDGELFVHYNSTAR..RYVPRTEWIAAKADQ
HA17_MOUSE/22-200GQHSLQYFHTAVSRPGLGEPWF----------------------ISVGYVDDTQFVRFDSDAENPRMEPRARWMEQEG.P
HA11_RAT/25-203GSHSLRYFHTAVSRPGLGEPRF----------------------ISVGYVDDTQFVRYDSDAENPRYEPRARWMEREG.P
HA1A_BOVIN/22-200GSHSLRYFSTAVSRPGLGEPRY----------------------LEVGYVDDTQFVQFDSDAPNPRMEPRARWVEQEG.P
HLAG_HUMAN/25-203GSHSMRYFSAAVSRPGRGEPRF----------------------IAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEG.P
HA1A_RABIT/25-203GSHSMRYFYTSVSRPGLGEPRF----------------------IIVGYVDDTQFVRFDSDAASPRMEQRAPWMGQVE.P
HLAE_HUMAN/22-200GSHSLKYFHTSVSRPGRGEPRF----------------------ISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEG.S
HA1T_MOUSE/27-205GSHSLRYFYTALSRPAISEPWY----------------------IAVGYLDDTQFVRFNSSGETATYKLSAPWVEQEG.P
1C28_PANTR/22-200GSHSLRYFSTAVSRPGRGEPRY----------------------IAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEG.P
HA19_CANFA/25-204GSHSLRYFYTSVSRPGAGDPRF----------------------IAVGYVDDTQFVRFDSDAATGRMEPRAPWVEQEG.P

PF16497

G7NW87_MACFA/1-198MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSNWTRTDGLAWLGELQTHSWSNDSD--TIRSLKPWSQGTFSD
F6RUT0_HORSE/1-198MRCLLFLLLWGLPQIRRTSEVPQRNFPFRCLQISSFLNRSWARTDALAWLGELQPYVWKNDSD--TIRFLKPWSQGTFSD
L7N1C3_MYOLU/1-197MECWPVLLLWGLPQMWASPEAPQSSARLLFLQISPFANSSWTRTDGSFWLGALQTHSWSNGLD--.IHFLRPWSQGKLSD
F6QYN3_HORSE/1-198MLFLQLHLLAVLLPGGDNKDDFQEPVSFQIIQISSFYNGSWVQNLGSGWLDELQTHGWESSSG--TIIFLWPWSKGNYSN
CD1D1_MOUSE/1-200MRYLPWLLLWAFLQVWGQSEAQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSA--TISFTKPWSQGKLSN
F7DC15_HORSE/1-198MLFLQLPCLAVLLQGGDNKDDFQEPISFQIIQISSFYNRSWVQNLSSGWLGELQTHSCESKSG--TIIFLWPWSKGNFSN
CD1D_SHEEP/1-198MGCLLFLVLLEFQKIWGSFEAPQTSFPFRFLQISSFANHSWTRTDGLMWLGELQPYTWRNESS--TIRFLKHWSQGTFSD
I3MFM6_SPETR/1-196MGCMWFLLLWVLPQAWGSSEGR..SVLFRCLQISSFTNSSWMRTDALAWLGELQTHSWSNASD--TISFVKPWAQGTFSS
G1PVC0_MYOLU/1-198MLFLQIPLLAVLLAAGDNEDAFQEEISFKMIHSSSFYNDSWVKIRYSAWLGDLQTHGWDINSG--RIIFLRPWSKGNLGK
L7N1K8_MYOLU/1-198MLFLQIPLLAVLLAAVDNEDAFQEEISFKIIQSISFYNRSWVKSQNSAWLGDLKTHGWDNNSG--RIIFLRPWSKGNLSK
H0WFT3_OTOGA/1-199MRRLLLLQLWALLRVWGGPEGPQRSISFRCLQISSFSNSSQVRTDGSAWLGELQTHSWVDSSD--AFRFLKPWSQSGFSD
F7BW69_HORSE/1-198MLFLQFALLVVLLPGGDSKDDFQEPTSFRVIYSSSFYNPSRVQALGSAWLGELQTHGWENHTG--SFIFLRPWSKGNFSS
G1QBJ7_MYOLU/1-198MLFLQITFLAVLLAAGDNEDAFQEQISFHMIHISSFYNHSWTQNWGSGWLGELQILGWNSNSY--SVIFLRPWSKGNFSN
M3YN29_MUSPF/1-198MLFLQLVLLVVFLPDGDSEDAVQEPISFQITLTVSFYNRSWTQSLGSAWLDEIQTHGWDNKTG--AFIFLWPWSKGNWSN
F1PZ60_CANFA/1-198MLFLQLVLLVVLLPEGDSEDASQEPVSFQVILTTSFYNSSWTQNLASAWLDELQTHSWDSDSG--TFLFLWPWAKGKLSK
G1L1W7_AILME/2-199MLFLQLVSFVVLLPGGDSEDAFQEPISLRIILTSSFYNRSRTQNLASAWLDELQTHGWDSKTG--AFIFLWPWSRGNLSN
G3HKH3_CRIGR/1-198MRYLTCLLLWVFPRVWGQWEDQLKNYPLRCLQISSFPNSSSFRTDGLAWLGDVQTHSWRNAS.--TVSFLKPWSHGKLSD
G1LFS0_AILME/1-198MLFLQLALLAVLLPGGDGDDDFQEPIYFRVIRTSFLYNRSGTQNLGSIWLDELQTHAWDNKTH--TFTFLWPWSQGNLSN
A0ZPR3_PIG/1-198MLFLQLPLLLVLLPGGDSEEGFQEPISFQIIWISSFYNRSWEEEVCSAWLGELQTHRREGKSD--IVIYRQPWSKGNFSR

PF14586

RAE1C_MOUSE/31-204DAHSLRCNLTIKAPTPADPLWY----------------------EAKCLVDEILILHLSNINK--TMTSGDPGETANA-T

PF00969

DRB3_HUMAN/42-116--------------------------------------------------------------------------------
DRB4_HUMAN/42-116--------------------------------------------------------------------------------
HB2D_CANFA/42-116--------------------------------------------------------------------------------
HB2A_RAT/8-82--------------------------------------------------------------------------------
DOB_HUMAN/39-113--------------------------------------------------------------------------------
DQB2_HUMAN/45-118--------------------------------------------------------------------------------
DPB1_HUMAN/42-114--------------------------------------------------------------------------------
HB2L_CHICK/8-82--------------------------------------------------------------------------------
HB2D_RAT/40-114--------------------------------------------------------------------------------
HB2C_PIG/45-119--------------------------------------------------------------------------------
HB2A_MOUSE/40-114--------------------------------------------------------------------------------
HB21_MOUSE/40-114--------------------------------------------------------------------------------
DMB_HUMAN/27-106--------------------------------------------------------------------------------
O35424_MOUSE/39-113--------------------------------------------------------------------------------
HB2P_RABIT/43-113--------------------------------------------------------------------------------
F1N610_BOVIN/47-117--------------------------------------------------------------------------------
F1NSZ6_CHICK/40-113--------------------------------------------------------------------------------
M3WAZ6_FELCA/46-118--------------------------------------------------------------------------------
M3XET4_FELCA/43-114--------------------------------------------------------------------------------
Q1MTC8_DANRE/29-104--------------------------------------------------------------------------------
Q31099_MOUSE/27-106--------------------------------------------------------------------------------
Q3UUV9_MOUSE/43-114--------------------------------------------------------------------------------
Q58DW7_BOVIN/27-105--------------------------------------------------------------------------------
Q6MGA7_RAT/27-106--------------------------------------------------------------------------------
Q70IB5_BOVIN/44-114--------------------------------------------------------------------------------
W5PC43_SHEEP/40-111--------------------------------------------------------------------------------
W5Q266_SHEEP/32-102--------------------------------------------------------------------------------

PF00993

M4AFZ0_XIPMA/29-105--------------------------------------------------------------------------------
W5Q1M3_SHEEP/29-109--------------------------------------------------------------------------------
M3Y3I6_MUSPF/29-109--------------------------------------------------------------------------------
G3HQS4_CRIGR/268-348--------------------------------------------------------------------------------
G3TMW3_LOXAF/41-120--------------------------------------------------------------------------------
G3U806_LOXAF/37-114--------------------------------------------------------------------------------
F6ZD60_MONDO/30-109--------------------------------------------------------------------------------
W5LNP0_ASTMX/24-103--------------------------------------------------------------------------------
G1P5L8_MYOLU/30-110--------------------------------------------------------------------------------
I3JKK1_ORENI/22-99--------------------------------------------------------------------------------
F1ML44_BOVIN/29-109--------------------------------------------------------------------------------
L5KYV0_PTEAL/29-109--------------------------------------------------------------------------------
M3XS77_MUSPF/41-118--------------------------------------------------------------------------------
G1R500_NOMLE/35-114--------------------------------------------------------------------------------
F6ZJJ9_HORSE/29-109--------------------------------------------------------------------------------
H3CJ64_TETNG/21-97--------------------------------------------------------------------------------
W5Q2C6_SHEEP/29-109--------------------------------------------------------------------------------
G1Q9G7_MYOLU/3-83--------------------------------------------------------------------------------
G3HQS6_CRIGR/42-118--------------------------------------------------------------------------------
H2RPE2_TAKRU/21-98--------------------------------------------------------------------------------
K7GRZ3_PIG/40-117--------------------------------------------------------------------------------
G1L546_AILME/42-114--------------------------------------------------------------------------------
F1R0K2_DANRE/21-100--------------------------------------------------------------------------------
H2ZYC5_LATCH/4-83--------------------------------------------------------------------------------
G3UHX0_LOXAF/29-109--------------------------------------------------------------------------------
Q8WM94_DANRE/21-100--------------------------------------------------------------------------------
G1L6J1_AILME/29-108--------------------------------------------------------------------------------
G5BB02_HETGA/33-112--------------------------------------------------------------------------------
M9MM93_DANRE/19-98--------------------------------------------------------------------------------
W5KCR1_ASTMX/22-100--------------------------------------------------------------------------------
F7I518_CALJA/33-113--------------------------------------------------------------------------------
H0VMA0_CAVPO/42-122--------------------------------------------------------------------------------
HA2B_MOUSE/30-110--------------------------------------------------------------------------------
L7N114_MYOLU/30-110--------------------------------------------------------------------------------
F1QYA3_DANRE/34-109--------------------------------------------------------------------------------
I3MR31_SPETR/27-107--------------------------------------------------------------------------------
G1Q5X0_MYOLU/29-109--------------------------------------------------------------------------------
Q31621_MOUSE/41-118--------------------------------------------------------------------------------
G5BB05_HETGA/92-169--------------------------------------------------------------------------------
H0WUA6_OTOGA/41-120--------------------------------------------------------------------------------
G1QAF8_MYOLU/29-109--------------------------------------------------------------------------------
I3JGI5_ORENI/21-97--------------------------------------------------------------------------------
M3YH02_MUSPF/31-104--------------------------------------------------------------------------------
H2RBA7_PANTR/29-109--------------------------------------------------------------------------------
I3MDX2_SPETR/29-109--------------------------------------------------------------------------------
G1PGE2_MYOLU/3-83--------------------------------------------------------------------------------
K7EUP3_PONAB/29-109--------------------------------------------------------------------------------
F7D2J1_XENTR/22-100--------------------------------------------------------------------------------
O97981_PIG/29-109--------------------------------------------------------------------------------
H2SD42_TAKRU/21-100--------------------------------------------------------------------------------
A7X5M6_ORNAN/29-108--------------------------------------------------------------------------------
F1QNN0_DANRE/21-100--------------------------------------------------------------------------------
W5MK71_LEPOC/36-116--------------------------------------------------------------------------------
G5C3I9_HETGA/21-100--------------------------------------------------------------------------------
I3N7K0_SPETR/29-108--------------------------------------------------------------------------------
G3RX38_GORGO/29-109--------------------------------------------------------------------------------
Q1MTC7_DANRE/24-99--------------------------------------------------------------------------------
U3IBP5_ANAPL/29-109--------------------------------------------------------------------------------
H2MYR3_ORYLA/31-108--------------------------------------------------------------------------------
G3HQS4_CRIGR/2-76--------------------------------------------------------------------------------
L8Y815_TUPCH/29-108--------------------------------------------------------------------------------
G1QA26_MYOLU/29-109--------------------------------------------------------------------------------
G1QBV7_MYOLU/2-82--------------------------------------------------------------------------------
H0WYE3_OTOGA/29-109--------------------------------------------------------------------------------
I3KVG1_ORENI/87-164--------------------------------------------------------------------------------
HA22_MOUSE/29-108--------------------------------------------------------------------------------
G3UHG4_LOXAF/2-80--------------------------------------------------------------------------------
HA2P_RABIT/1-80--------------------------------------------------------------------------------
G3N551_GASAC/29-106--------------------------------------------------------------------------------
G1PA08_MYOLU/2-81--------------------------------------------------------------------------------
F6YG75_HORSE/29-109--------------------------------------------------------------------------------
I3M2H3_SPETR/44-123--------------------------------------------------------------------------------
I3J7S9_ORENI/22-99--------------------------------------------------------------------------------
F7GQ21_MACMU/12-91--------------------------------------------------------------------------------
W5PDP1_SHEEP/41-118--------------------------------------------------------------------------------
M4A196_XIPMA/24-103--------------------------------------------------------------------------------
L8Y3F3_TUPCH/29-108--------------------------------------------------------------------------------
F6S093_HUMAN/8-85--------------------------------------------------------------------------------
F6T370_MONDO/29-109--------------------------------------------------------------------------------
H3CDM2_TETNG/24-100--------------------------------------------------------------------------------
Q6MGB1_RAT/29-108--------------------------------------------------------------------------------
H0UYJ7_CAVPO/26-105--------------------------------------------------------------------------------
H2L2T1_ORYLA/33-107--------------------------------------------------------------------------------
G3N564_GASAC/37-113--------------------------------------------------------------------------------
G7P2R3_MACFA/2-81--------------------------------------------------------------------------------
HA2B_RAT/30-110--------------------------------------------------------------------------------
I3KVG9_ORENI/22-100--------------------------------------------------------------------------------
F7D2Z8_MONDO/30-109--------------------------------------------------------------------------------
H0VR34_CAVPO/30-110--------------------------------------------------------------------------------
W5MKC8_LEPOC/19-99--------------------------------------------------------------------------------
I3MD72_SPETR/41-118--------------------------------------------------------------------------------
I3JXB4_ORENI/27-101--------------------------------------------------------------------------------
I3KVH2_ORENI/22-100--------------------------------------------------------------------------------
H2MXB6_ORYLA/21-98--------------------------------------------------------------------------------
L8YBX0_TUPCH/29-108--------------------------------------------------------------------------------
G5BB12_HETGA/29-109--------------------------------------------------------------------------------
H2ZTM7_LATCH/28-104--------------------------------------------------------------------------------
H2V674_TAKRU/23-96--------------------------------------------------------------------------------
G3UJA6_LOXAF/27-103--------------------------------------------------------------------------------

PF00129

HLAH_HUMAN/25-203KYWDRNTQICKAQAQTERENLRIALRYYNQSEGGSHTMQVMYGCDVGPD----GPFLRGYE-QHAYDGKDYIALNEDLRS
ZA2G_HUMAN/26-201EDWKQDSQLQKAREDIFMETLKDIVEYYNDS.NGSHVLQGRFGCEIENN----R.SSGAFW-KYYYDGKDYIEFNKEIPA
HA10_MOUSE/25-203EYWERETQRAKGNEQSFHVSLRTLLGYYNQSESGSHTIQWMYGCKVGSD----GRFLRGYL-QYAYDGRDYIALNEDLKT
HA15_MOUSE/21-199EYWERETWKARDMGRNFRVNLRTLLGYYNQSNDESHTLQWMYGCDVGPD----GRLLRGYC-QEAYDGQDYISLNEDLRS
1C01_GORGO/25-203EYWDRETQKYKRQAQTDRVSLRKLRGYYNQSEDGSHTFQRMYGCDVGPD----GRLQRGYD-QLAYDGKDYIALNEDLRS
FCGRN_RAT/25-198WYWEKETTDLKSKEQLFLEAIRTLENQIN....GTFTLQGLLGCELAPD----N.SSLPTA-VFALNGEEFMRFNPRTGN
HA12_MOUSE/25-203EYWERETRRAKGNEQSFRVDLRTALRYYNQSAGGSHTLQWMAGCDVESD----GRLLRGYW-QFAYDGCDYIALNEDLKT
HA1F_CHICK/23-198QYWDGQTQIGQGNEQIDRENLGILQRRYNQT.GGSHTVQWMYGCDILEG----G.PIRGYY-QMAYDGRDFTAFDKGTMT
HA17_MOUSE/22-200EYWERETQIAKGHEQSFRGSLRTAQSYYNQSKGGSHTLQWMYGCDMGSD----GRLLRGYL-QFAYEGRDYIALNEDLKT
HA11_RAT/25-203EYWEEQTLVAKGQELDYRVSLRNLLSYYNQSEGGSHTIQRMYGCDVGSD----GSLLRGYE-QHAYDGRDYIALNEDLKT
HA1A_BOVIN/22-200EYWDRNTRNAKGNAQSFRVNLNTLRGYYNQSEAGSHTLQWMSGCDVGPD----GALRRGFM-QYGYDGRDYLALNEDLRS
HLAG_HUMAN/25-203EYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSD----GRLLRGYE-QYAYDGKDYLALNEDLRS
HA1A_RABIT/25-203EYWDQQTQIAKDTAQTFRVNLNTALRYYNQSAAGSHTFQTMFGCEVWAD----GRFFHGYR-QYAYDGADYIALNEDLRS
HLAE_HUMAN/22-200EYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPD----RRFLRGYE-QFAYDGKDYLTLNEDLRS
HA1T_MOUSE/27-205EYWARETEIVTSNAQFFRENLQTMLDYYNLSQNGSHTIQVMYGCEVEFF----GSLFRAYE-QHGYDGPDYIALNEDLKT
1C28_PANTR/22-200QYWERTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPD----GRLLRGYH-QHAYDGKDYISLNEDLRS
HA19_CANFA/25-204EYWDRQTRTIKETARTFRVDLDTLRGYYNQSEAGSHTRQTMYGCDLGPD----GRLLRGYS-QDAYDGADYIALNEDLRS

PF16497

G7NW87_MACFA/1-198QQWEALQRVFRVYRSSFTRDVKEFAKML..RLAYPMELQVSAGCEVHP.----GNASHNFF-HVAFQGSDILSFQGT--S
F6RUT0_HORSE/1-198QQCEELQHLFRVYRSSVTRDIQEFAKML..HIAYPLEVQVSAGCEVHP.----GNTSESFL-YAAFQGRDILSFQGT--S
L7N1C3_MYOLU/1-197HQWEQLQQVFWVYRSSFNREIREFAKML..HLDYPFVVQVSAGCEVHP.----GSPLKSFF-HSAFQGSDILSFQET--S
F6QYN3_HORSE/1-198EEWMELEKLFRMSSIGIPQMFHNLASQW..QLEYPFEVQITAGCELHF.----GEISVGFM-RGAYQGSDFMSFQNN--S
CD1D1_MOUSE/1-200QQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYP.----GNASESFL-HVAFQGKYVVRFWGT--S
F7DC15_HORSE/1-198EEIMELEKLFHMFSAGFLQAFHEHASQW..QLEYPFQVQTAGGCELHF.----GKASISFM-RVAYQGSDFLSFQNN--S
CD1D_SHEEP/1-198QQWEQLQHTFQVYRSSFTRDIREFVKML..PGDYPFEIQISGGCELLP.----RNISESFL-RAALQEKDVLSFQGM--S
I3MFM6_SPETR/1-196QQWIHLQNTFRVFRSSFIRDIQEFAKML..SLEYPTELQLSGGCEVHP.----GNDSEHFL-HVAHQGEHILSFQGT--A
G1PVC0_MYOLU/1-198EEIKELEEFFRAFSIEMPHELHRHASEW..KFKYPFEIQIRMGCELHP.----GGAIVDFY-GFAYQGSELLHFQNN--S
L7N1K8_MYOLU/1-198KELKELEEYSHKFSTEMPNKFHRHANQW..QLKYPFEIQITRGCELHP.----GGPTVAFY-RYAYQGSEVMHFQNN--S
H0WFT3_OTOGA/1-199QQWERLQHIFRVYRISFTREVQKFVKKL..QVAYPVEIQLSAGCEVRPG----NASSANFL-HVAFQGSDFLSFQGT--S
F7BW69_HORSE/1-198EELTEIEKLFRTFSIEFNQIFHNHASQW..QLAYPFQVQLAMGCELHI.----GEASVGFA-RIAYQGSDLISIQNN--S
G1QBJ7_MYOLU/1-198KEITEMEKFFRRLHIELPPLIRKHASEW..KFEYPFEVQMTGGCELHP.----REGKVVFL-QYAYQGSELLTFQNN--S
M3YN29_MUSPF/1-198VELIKLEKLLYAYFIGLRQVFQDHVRHW..HLEYPFQIQLAEGCELHF.----GEASVGFV-KFAYQGADLTSFQNT--T
F1PZ60_CANFA/1-198EELIERERTFHTFSIRFPLIFQDSVSDW..QLEYPFQVQMAEGCGLYF.----GKPSVGFM-QIAYQGSDLVSFQNK--S
G1L1W7_AILME/2-199EEVIRAEEAFYSNSIGLPLCFHDHFSEW..QLEYPFQVQLTGGCELHF.----GEPSVGFI-RIAYEGSDLVSFQNM--S
G3HKH3_CRIGR/1-198QQWQTLEHILQVYRTSFTRDIQELVKML.PIIHYPIEMQVSAGCEVHS.----GNTSENFF-NVASQGQHILSFQGT--S
G1LFS0_AILME/1-198EEVVTGENLFYSNTILVNQDFREHVSKW..QLEYPFQLQMVIGCELHV.----GKPSVGFM-RIAYQGSDLISFQNV--S
A0ZPR3_PIG/1-198EDLMESEHILRMFFVRFVQAFFNHASQW..KLEYPFDVQIAGGCDLYH.----GETSVGFV-RIAYQGSDFASFQKN--S

PF14586

RAE1C_MOUSE/31-204EVGECLTQPVNDLCQKLRDKVSNTKVDTHKTNGYPH-LQVTMIYPQSQ-----GQTPSATW-EFNISDSYFFTFYTENMS

PF00969

DRB3_HUMAN/42-116-----------------------------------------SECHF.FN----GTERVRYLDRYFHNQEEFLRFDSDVGE
DRB4_HUMAN/42-116-----------------------------------------CECHF.LN----GTERVWNLIRYIYNQEEYARYNSDLGE
HB2D_CANFA/42-116-----------------------------------------SECYF.TN----GTERVRFVERYIHNREEFVRFDSDVGE
HB2A_RAT/8-82-----------------------------------------GLCYY.TN----GTQRIRSVDRRFYNQEEFLRYDSDVGE
DOB_HUMAN/39-113-----------------------------------------ADCYF.TN----GTEKVQFVVRFIFNLEEYVRFDSDVGM
DQB2_HUMAN/45-118-----------------------------------------GMCYF.TN----GTERVRGVARYIYNREEYGRFDSDVGE
DPB1_HUMAN/42-114-----------------------------------------QECYA.FN----GTQRF..LERYIYNREEFARFDSDVGE
HB2L_CHICK/8-82-----------------------------------------VECHF.LN----GTERVRFLVRHVYNRQQYVHFDSDVGL
HB2D_RAT/40-114-----------------------------------------GECHF.YN----GTQRVRFLARYIYNREEYTRFDSDVGE
HB2C_PIG/45-119-----------------------------------------GECYF.YN----GTQRVRGVARYIYNQEEHLRFDSDVGE
HB2A_MOUSE/40-114-----------------------------------------GECYF.TN----GTQRIRYVTRYIYNREEYVRYDSDVGE
HB21_MOUSE/40-114-----------------------------------------SECHF.YN----GTQRVRLLERYFYNLEENLRFDSDVGE
DMB_HUMAN/27-106-----------------------------------------STCLLDDA----GTPKD.FTYCISFNKDLLTCWDPEENK
O35424_MOUSE/39-113-----------------------------------------ADCYF.TN----GTEKVHLLVRFIFNLEEYLHFDSDLGM
HB2P_RABIT/43-113-----------------------------------------YECYA.SN----GTQRL..LDRCAYNREEFVRFDSDIGE
F1N610_BOVIN/47-117-----------------------------------------..CYF.TN----GTERVRYVTRYIYNQEEYVRFDSDWDE
F1NSZ6_CHICK/40-113-----------------------------------------.ECHY.LN----GTERVRYLVRYVYNRQEYAHFDSDVGK
M3WAZ6_FELCA/46-118-----------------------------------------.ECHF.TN----GTERVRYLERHYHNGEENLRFDSEVGE
M3XET4_FELCA/43-114-----------------------------------------.ECHY.PN----GTERVRYLVRFFYNREELARFDNEVGE
Q1MTC8_DANRE/29-104-----------------------------------------QQCFYSTS----DYSDMVYLASYSFNKVVDTQFNSSVGK
Q31099_MOUSE/27-106-----------------------------------------STCVLNDA----GTPQD.FTYCVSFNKDLLACWDPDVGK
Q3UUV9_MOUSE/43-114-----------------------------------------.ECHY.FN----GKERVWSVTRFIYNQEEFARFNSDFGK
Q58DW7_BOVIN/27-105-----------------------------------------STCVLDDD----GDPKD.FSYCISFNKDLLTCWDPLQAS
Q6MGA7_RAT/27-106-----------------------------------------STCLLDDE----GTPMD.FTYCISFNKDLLACWDPEEGQ
Q70IB5_BOVIN/44-114-----------------------------------------.MCYF.TN----GTEHVRLVARQIYNKEEILHFDSDLGE
W5PC43_SHEEP/40-111-----------------------------------------.DCYF.TN----GTEKVRFVVRFIFNLEEYARFDSDLGM
W5Q266_SHEEP/32-102-----------------------------------------.ECRF.SN----GLQRMRFFARYIYNTKEDVHFDSDVGE

PF00993

M4AFZ0_XIPMA/29-105------------------------------------..DSFR.VIGCSD....TD..GLDMMTLDGEEVWHADFIHETGV
W5Q1M3_SHEEP/29-109------------------------------------DHIAAYGINVYHS....YGPSGYYTHEFDGDEEFYVDLEKRETV
M3Y3I6_MUSPF/29-109------------------------------------DHAASYGINVYQS....YGPSAQYTHEFDGDEEFYVDLEKKETV
G3HQS4_CRIGR/268-348------------------------------------DHMGSYGPAFYQS....YDASGQFTHEFDGEQIFSVDLKNGEVV
G3TMW3_LOXAF/41-120------------------------------------DHVSTF.AMFTQT....HVPSGEYMFEFDEDEMFSVNLDKKETV
G3U806_LOXAF/37-114------------------------------------NHTFLH.TMYCQN....GTPSLGLSEAYDEDQLFSFDFSQNSRV
F6ZD60_MONDO/30-109------------------------------------NHVIIQ.AEFAQT....SNPEGEFMFDFDGDEIFHVDMDKRETV
W5LNP0_ASTMX/24-103------------------------------------.HEYYV.FDWCSE....TD..GGVVWMIDGEEEYHADFKDGRGV
G1P5L8_MYOLU/30-110------------------------------------DHVGNFGPCFSQS....YGSSGQYTFEFDGEEIFYVDQNKRETV
I3JKK1_ORENI/22-99------------------------------------.HTDIH.VIGCSD....FN..GEVMFGLDREELWYADFEKQMGV
F1ML44_BOVIN/29-109------------------------------------DHVGSYGTEIYQS....HGPSGQYTQEFDGDELFYVDLGKKETV
L5KYV0_PTEAL/29-109------------------------------------DHVASYGINVYQS....YGPSGQYTHEFDGDEEFYVNLEKQETV
M3XS77_MUSPF/41-118------------------------------------NHTFQH.TMYCQN....WNPSIGLSEAYDGDQLFSFDFSQNTRV
G1R500_NOMLE/35-114------------------------------------DHVSTY.AAFVQT....HRPTGEFMFEFDEDEQFYVDLDKKETV
F6ZJJ9_HORSE/29-109------------------------------------DHIGSYGITMYES....SGPSGQYNFEFDGDETFYVDLEKKETI
H3CJ64_TETNG/21-97------------------------------------..EDIR.IVGCSD....FD..GEYMHGLDGEELWYADFRRGEGV
W5Q2C6_SHEEP/29-109------------------------------------DHVGSYGISIYQS....YGPSGQYTHEFDGDEQFYVDLEKKETV
G1Q9G7_MYOLU/3-83------------------------------------DHIIACGISVSQS....YGPSGQYTFEFDGDEIFYVDPKKKKTV
G3HQS6_CRIGR/42-118------------------------------------NHTFRH.TVFCQD....GNPSIGLSESYDEDQLF.YDFSQNTRV
H2RPE2_TAKRU/21-98------------------------------------..KDIR.ITGCSD....LD..GEDMFGLDSEELWYADFSKGEGV
K7GRZ3_PIG/40-117------------------------------------NHTFQY.TMYCQD....GNPEVGLSEVYDGDQLFSFNFSQNIRV
G1L546_AILME/42-114------------------------------------.......CLVVQT....HRPSGEYMFEFDGDEQFYVDLDK.ETV
F1R0K2_DANRE/21-100------------------------------------VREELE.IYVCSD....SE..SEAMVGADGEELWHADFKQKTGI
H2ZYC5_LATCH/4-83------------------------------------EHTLSQ.TGFCQT....GHPNGDYNFMLDNEEAFSVDLEEKETV
G3UHX0_LOXAF/29-109------------------------------------DHVGCYGTTIYQS....YGPGGQYTQEFDGDELFYVNLEKKETV
Q8WM94_DANRE/21-100------------------------------------VHEDFA.IRGCSD....TE..KEDTYGMDEEELWHADFNQKKGV
G1L6J1_AILME/29-108------------------------------------DHVIIQ.AEFYMT....PDPSGEYMFDFDGDEIFHVDLEKKETV
G5BB02_HETGA/33-112------------------------------------DHVSTY.AIFAQT....HSPSGEYMFEFDEDEQFYVDLDKKETI
M9MM93_DANRE/19-98------------------------------------YHKYGL.IGACGD....AD.QEDFIVQFDDEQLAHVDFKEQKDV
W5KCR1_ASTMX/22-100------------------------------------..KDIF.LTICSE....TF..GEQIYGLDGEEKWHADFNLQEGV
F7I518_CALJA/33-113------------------------------------DHVASYGVNLYQS....YGPSGQFTHEFDGDEEFYVDLGKKETV
H0VMA0_CAVPO/42-122------------------------------------DHVSTY.AEFVQR....SRPSGEFIFDIDEDEMFYVDLDSRQTV
HA2B_MOUSE/30-110------------------------------------DHVGTYGISVYQS....PGDIGQYTFEFDGDELFYVDLDKKETV
L7N114_MYOLU/30-110------------------------------------DHVRAYGINVYPY....YGSSGQYTHESDGDEEFYVDLDKKETV
F1QYA3_DANRE/34-109------------------------------------....FM.FNGCSD....TE..KEALYGSEGEEMWHSDFKLKQGV
I3MR31_SPETR/27-107------------------------------------DHVGTYGRNIYQT....YGDYGQFTYEFDGDELFYVDLEKKETV
G1Q5X0_MYOLU/29-109------------------------------------DHVGAYGIHVYQS....YGPSGQYTHEFDGDEEFYVDLDKEETV
Q31621_MOUSE/41-118------------------------------------NHTFRH.TLFCQD....GIPNIGLSETYDEDELFSFDFSQNTRV
G5BB05_HETGA/92-169------------------------------------NHTFRH.TVFCQE....GTPSIGLSESYDEDLLFSFDFSKNTRV
H0WUA6_OTOGA/41-120------------------------------------DHVSTY.FEFVQT....HRPSGEYMFEFDEDEMFYVDLDKKETV
G1QAF8_MYOLU/29-109------------------------------------DHIAAYGVCFSQS....YSPSGQYTHEFDGDEEFYVDLEKRETV
I3JGI5_ORENI/21-97------------------------------------LHEDIH.IVGCSE....SN..GEVMFGLDGEELWYADFENKIGV
M3YH02_MUSPF/31-104------------------------------------.......VEVYQS....YGPSGQSTQEFDGDEEFYVDLEKKETV
H2RBA7_PANTR/29-109------------------------------------DHVASYGVNFYQS....HGPSGQYTHEFDGDEEFYVDLETKETV
I3MDX2_SPETR/29-109------------------------------------DHVANYGINLYQS....YGPSGQYTHEFDGDEEFYVDLQKKQTV
G1PGE2_MYOLU/3-83------------------------------------DHVGAYGINVYQS....YGPSGQYTHEFDGDEEFYVDLDKKETV
K7EUP3_PONAB/29-109------------------------------------DHVGSYGPAFYQS....YGASGQFTHEFDGEQLFSVDLKKSEAV
F7D2J1_XENTR/22-100------------------------------------..YFDYSALFYQT....RRPTGEYLFDYNGNELFHVDLDSKSVV
O97981_PIG/29-109------------------------------------DHMGSYGPAFYQS....YDGSGQFTYDFDGEQLFSVDLKKREAV
H2SD42_TAKRU/21-100------------------------------------.HEDIR.ILGCSD....LD..GEFMYGLDSEEVWYADFSKGEGV
A7X5M6_ORNAN/29-108------------------------------------EHRIIQ.AEFSQT....HSPTGEFMFEFDGDEIFHVDLDRKETV
F1QNN0_DANRE/21-100------------------------------------EHEVNQ.IQVCSN....TE..QEFFIGYDGEEIWHADIAHRRGV
W5MK71_LEPOC/36-116------------------------------------.HTYEV.AYFCQS....ENRKGSRNEVFDDDEMFHIDPDRKVDE
G5C3I9_HETGA/21-100------------------------------------EHKIIQ.AEFYLS....PDETGEFMFDFDGDEIFHVDVKKEQTV
I3N7K0_SPETR/29-108------------------------------------DHVGTYGTNIYQT....YGDYGQFTYEFDKDELFYLDMGKKETV
G3RX38_GORGO/29-109------------------------------------DHVASCGVNLYQS....YGPSGQFTHEFDGDEQFYVDLERKETA
Q1MTC7_DANRE/24-99------------------------------------...DFG.FVGCSD....ME..KEFLFGFDGEELFHLDFIRKEGV
U3IBP5_ANAPL/29-109------------------------------------.HVLMQ.TEFYQRDETRNKEGGQFMFDFDGDEIFHVDLEKSETI
H2MYR3_ORYLA/31-108------------------------------------.HEDFQ.ITGCSD....YD..EEFMVNLDGEEIVYTDFKKGTEV
G3HQS4_CRIGR/2-76------------------------------------.....Y.DIFAQT....QKPSGDCVYEFDGDELFYVDLDREETV
L8Y815_TUPCH/29-108------------------------------------DHVSTY.LTFTQT....HRPSGEFMFQFDGDEMFYVDQDKRETI
G1QA26_MYOLU/29-109------------------------------------DHVAAYGASFYQS....YGPSGQYTFEFDGDEMFYVDLEKKETV
G1QBV7_MYOLU/2-82------------------------------------DHVGTYGTNVYQT....YGASGQFTYEFDGDELFYVDLKTRETV
H0WYE3_OTOGA/29-109------------------------------------DHVGIYGLNVYQS....YGSSGQYTQEFDGDEMFYVDLERKETV
I3KVG1_ORENI/87-164------------------------------------.HEDIG.IVGCSD....SD..GEDMYGLDGEEVRYADFKKQEDI
HA22_MOUSE/29-108------------------------------------EHTIIQ.AEFYLL....PDKRGEFMFDFDGDEIFHVDIEKSETI
G3UHG4_LOXAF/2-80------------------------------------EHVTTH.TELYLS....PNQSGEFMLDFDGDEIFHVNMEKKETA
HA2P_RABIT/1-80------------------------------------EHVSVF.VIFAQT....HEPSGECMFEFDEDEVFHVDLDKKQAI
G3N551_GASAC/29-106------------------------------------...DIA.IVGCSD....SD..GEEMYGLDGEEVWYADFKHGKGV
G1PA08_MYOLU/2-81------------------------------------DHVSTY.AEFVQT....HSPSGEYMFQFDGDEQFYVDLDKKETV
F6YG75_HORSE/29-109------------------------------------DHFASYGTVIYES....YGDFGQYTHEFDGDEEFHVDLEKKETV
I3M2H3_SPETR/44-123------------------------------------DHVISF.AMFAQT....NAPTGEFMYEFDEDEMFYVDRDKKETI
I3J7S9_ORENI/22-99------------------------------------.HSDIA.VGGCSE....SD..EENMYGLDGEELAYTDFNKKEEI
F7GQ21_MACMU/12-91------------------------------------DHLASYGVNFYQS....YGLSGQYSHEFDGDEQFYVDLGRKETV
W5PDP1_SHEEP/41-118------------------------------------NHTLLH.TVYCQD....WSPSVGLSEAYDGDQLFSFDFSQNIRV
M4A196_XIPMA/24-103------------------------------------.HEDLA.IVGCSD....SD..GEMMYALDGEELWYADFKKGKGV
L8Y3F3_TUPCH/29-108------------------------------------DHVSTY.LAFTQT....HRPSGEYMSQLDGDEVFYVDQDKRETI
F6S093_HUMAN/8-85------------------------------------NHTFLH.TVYCQD....GSPSVGLSEAYDEDQLFFFDFSQNTRV
F6T370_MONDO/29-109------------------------------------DHVGTFGTTVYHS....YGPSGQNTNDFDEDELFYVDLKKKETV
H3CDM2_TETNG/24-100------------------------------------...DVH.IRGCSD....FD..GEDMYGLDGEERWYADFKRGEGV
Q6MGB1_RAT/29-108------------------------------------EHVATY.DIFVQT....QHPSGECMYAFDGDEQFYVDLDREETV
H0UYJ7_CAVPO/26-105------------------------------------DHVSRY.AEFVQT....QTPSGEYMFELDEDEQFYVDLDKRQTV
H2L2T1_ORYLA/33-107------------------------------------..EDFG.ILGCSD....YD..QEYMYALDGEEKWYADYKKETGV
G3N564_GASAC/37-113------------------------------------...DIR.VLGCSD....SD..GENMFGLDGEEVWYADFKHGKGV
G7P2R3_MACFA/2-81------------------------------------DHVASYGVNLYQS....YGFSGQYSHEFDGDEQFYVDLERKETV
HA2B_RAT/30-110------------------------------------DHVGSYGITVYQY....HESKGQYTHEFDGDERFYVDLDKKETI
I3KVG9_ORENI/22-100------------------------------------.HSDIA.INGCSD....SD..GEFMYGLDGEEKWYADFNKHTGV
F7D2Z8_MONDO/30-109------------------------------------DHVGTYGTTMAQS....YGPSGQYTMECDEDEIFYVDQQKKETV
H0VR34_CAVPO/30-110------------------------------------DHVAAYGINVYQS....YGSSGYYTHEFDGDELYYVDLEKRQTV
W5MKC8_LEPOC/19-99------------------------------------.HIDIN.VIGCKS....DDPVAQDEAQLDGDEMFYADFDKKEMI
I3MD72_SPETR/41-118------------------------------------NHTFRH.TVFCQD....GSPSIGLTETYDEDLLFSFDFSRNTRV
I3JXB4_ORENI/27-101------------------------------------.....H.INGCSD....FD..AEDMYGLDGEEVAYADFNNHTEV
I3KVH2_ORENI/22-100------------------------------------.HSDIA.IGGCSE....SD..GENMYGLDGEEIAYADFNKQEFI
H2MXB6_ORYLA/21-98------------------------------------.HEDLA.ITGCSD....SD..GEDMYALDGEEVWYADFKKQTGV
L8YBX0_TUPCH/29-108------------------------------------DHVSIY.LMFAQT....QRPSGEYMFQIDGDEQFYVDQDKKETI
G5BB12_HETGA/29-109------------------------------------DHVASYGVNVYQS....YGPSGQYTHEFDGDEQFYVDLKKKETI
H2ZTM7_LATCH/28-104------------------------------------EHTLFQ.IDFCQT....GHPNGDYNFLFDEDEAFSVDLEEKEAV
H2V674_TAKRU/23-96------------------------------------...DIG.IVGCSD....LD..GEFMYGLDSEELWYADFSKGEGV
G3UJA6_LOXAF/27-103------------------------------------EHVTIQ.AEFYLS......PSAEFMLDFDGDEFFYVNMEQKETV

PF00129

HLAH_HUMAN/25-203-WTAA---DMA-----AQITKRKWEAARRAEQ.RRVYLEGEFVEWLRRYLENGKETL--
ZA2G_HUMAN/26-201-WVPF---DPA-----AQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNIL--
HA10_MOUSE/25-203-WTAA---DVA-----AIITRRKWEQAGAAEY.YRAYLEAECVEWLLRYLELGKETL--
HA15_MOUSE/21-199-WTAN---DIA-----SQISKHKSEAVDEAHQ.QRAYLQGPCVEWLHRYLRLGNETL--
1C01_GORGO/25-203-WTAA---DTA-----AQITQRKWEAARWAER.QRAYLEGLCVEWLRRYLENGKETL--
FCGRN_RAT/25-198-WSGE---WPE-----TDIVGNLWMKQPEAARKESEFLLTSCPERLLGHLERGRQNL--
HA12_MOUSE/25-203-WTAA---DMA-----AQITRRKWEQAGAAER.DRAYLEGECVEWLRRYLKNGNATL--
HA1F_CHICK/23-198-FTAA---VPE-----AVPTKRKWEEESEPER.WKNYLEETCVEWLRRYVEYGKAEL--
HA17_MOUSE/22-200-WTAV---DMA-----AQITRRKWEQAGIAEK.DQAYLEGTCMQSLRRYLQLGKETL--
HA11_RAT/25-203-WAVA---DFA-----AWITRSKWQRNGAAER.SRAYLEGTCVEWLLRYLERGKETL--
HA1A_BOVIN/22-200-WTAG---ETE-----AQITKRKWEAAGYAEV.QRNYLEGECVEWLRRYLENGKDTL--
HLAG_HUMAN/25-203-WTAA---DTA-----AQISKRKCEAANVAEQ.RRAYLEGTCVEWLHRYLENGKEML--
HA1A_RABIT/25-203-WTAA---DTA-----AQNTQRKWEAAGEAER.HRAYLERECVEWLRRYLEMGKETL--
HLAE_HUMAN/22-200-WTAV---DTA-----AQISEQKSNDASEAEH.QRAYLEDTCVEWLHKYLEKGKETL--
HA1T_MOUSE/27-205-WTAA---DTA-----AEITRSKWEQAGYTEL.RRTYLEGPCKDSLLRYLENRKKTQ--
1C28_PANTR/22-200-WTAA---DTV-----AQITQRFYEAEEYAEE.FRTYLEGECLELLRRYLENGKETL--
HA19_CANFA/25-204-WTAA---DTA-----AQITQRKWEAAGVAELQWRNYLETTCVEWLRRYLEMGKETL--

PF16497

G7NW87_MACFA/1-198-WEPA---QEAP--LWVNLAIQVLNQDKWTKETVQWLLNDTCPQFVSGLLESGKSE---
F6RUT0_HORSE/1-198-WVPA---PDTP--QWVARVIEVLNDDQGTREMVQSLLNDTCPQFVRGLLETGKSE---
L7N1C3_MYOLU/1-197-WVPA---PDAP--HGTEMISNVLNKDQYIKDTLEWLLNDICPQLVTGLLEAGQQD---
F6QYN3_HORSE/1-198-WLPS---PDGG--SRAQHACELYNGDKVGLEITDRFLSDTCPRLLLSLLDAGKAD---
CD1D1_MOUSE/1-200-WQTV---PGAP--SWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSD---
F7DC15_HORSE/1-198-WLPS---PKGG--NRAQHVCQLFNWDQITLEIIQRLLSDTCPRFLLGLLDAGKSD---
CD1D_SHEEP/1-198-WVSA---PDAP--PWSQVVCKVLNEDQGTKETVHWLLHDICPELVKGLMQTGKSE---
I3MFM6_SPETR/1-196-WEPA---PQAP--QWVDLVIKVLNQNQGTKETVQWLLNDICPQFVNGLLETGKSE---
G1PVC0_MYOLU/1-198-WLPS---PKGG--TRAQDMCRRFNQYLVVKNVVQRILSDTCPRFLLSIPEAGKAD---
L7N1K8_MYOLU/1-198-WLPS---PKGG--TRAQDMCKLYNQYVVITNIVQRILSDTCPRFLLSILDAGKAD---
H0WFT3_OTOGA/1-199-WEPA---PQVP--DWGNWVIGELNKDQGTRETVQWLLSDICPQLAGALLEAGASE---
F7BW69_HORSE/1-198-WLPS---PKGG--SRAQQVSGRFNLNKVFLETWHRLLTDTCPRFLLGLLDAGKAD---
G1QBJ7_MYOLU/1-198-WLPS---SKGG--TRAQEVCRLFNQRHVVNIIIQRLLRDTCPRFLLGLFDAGKAD---
M3YN29_MUSPF/1-198-WWPS---PKGG--SRAQEVCKRFNQYHVLNEEIHTFFSDTCPKFLLGLLDAGKAD---
F1PZ60_CANFA/1-198-WWPS---PKGG--RRAQQVCKLLNQYHVVNLRIHSHISDFCPHYLLGLLDAGKAD---
G1L1W7_AILME/2-199-WWPS---PEGG--SRAQQVCRLFNQDHEDNELMHKLITDHCPRYLSSLLDAGKAD---
G3HKH3_CRIGR/1-198-FQKA---PDAP--PWTELAIKVLNTDQGTRETIQQLLNDTCPQVLYGLLEAGKAE---
G1LFS0_AILME/1-198-WWPS---PKGG--SRAQQVCRLFNQYHEDNELIQALIIDYCPRYLSSLLDAGKAD---
A0ZPR3_PIG/1-198-WLPS---PKGG--TRAQLVCKLFNLYQGTLEIIHKLLSDTCPRFVLGLLDAGKAD---

PF14586

RAE1C_MOUSE/31-204-WRSA---NDE-----SGVIMNKWNDDGDLVQRLKYFIPE-CRQKIDEFLKQSKEK---

PF00969

DRB3_HUMAN/42-116-YRAV---TELG.....RPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGE---------
DRB4_HUMAN/42-116-YQAV---TELG.....RPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVE---------
HB2D_CANFA/42-116-FRAV---TELG.....RPVAESWNGQKEILEQERATVDTYCRHNYGVIE---------
HB2A_RAT/8-82-FRAL---TELG.....RSWADDWNSQKEILEQKRAEMDTVCRYNYEETE---------
DOB_HUMAN/39-113-FVAL---TKLG.....QPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGA---------
DQB2_HUMAN/45-118-FQAV---TELG.....R.SIEDWNNYKDFLEQERAAVDKVCRHNYEAEL---------
DPB1_HUMAN/42-114-FRAV---TELG.....RPAAEYWNSQKDILEEKRAVPDRMCRHNYELGG---------
HB2L_CHICK/8-82-FVAD---TVLG.....EPSAKLFNSQPDVLEKNRAAVEMLCNYNYEIVA---------
HB2D_RAT/40-114-FRAV---TELG.....RPSAEYYNKQKEYMEQLRATVDTACKHDYEISE---------
HB2C_PIG/45-119-FRAV---TPLG.....RPEADSWNSQKDVLEQMRAEVDRVCKHNYQIEE---------
HB2A_MOUSE/40-114-HRAV---TELG.....RPDAEYWNSQPEILERTRAELDTVCRHNYEGPE---------
HB21_MOUSE/40-114-FHAV---TELG.....RPDAENWNSQPEFLEQKRAEVDTVCRHNYEISD---------
DMB_HUMAN/27-106-MAPC---EFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWG---------
O35424_MOUSE/39-113-FVAL---TELG.....EPDADQWNKRLDLLETSRAAVNMVCRQKYKLGA---------
HB2P_RABIT/43-113-FRAV---SELG.....RQVAESWN..LEYLQQARAEVDRVCRHNYELFQ---------
F1N610_BOVIN/47-117-YRAL---TPLG.....RPAAEYWNSQKDILEQTRAEADTVCRHNYQA..---------
F1NSZ6_CHICK/40-113-HVAD---TPLG.....EPQAEYWNSNAEILENRMNEVDTYCRHNYGVVE---------
M3WAZ6_FELCA/46-118-YRAV---TELG.....RPDAKYWNGLKDYMEETRTAVDWFCRHNYGVF.---------
M3XET4_FELCA/43-114-FRAV---SELG.....RPDAKYWNGQKDFMERKHAEVDTVCRHNYGV..---------
Q1MTC8_DANRE/29-104-FVGY---TEQG.....LIFAENFNKDQAYLHQLKAQVDTFCRHNAQIWD---------
Q31099_MOUSE/27-106-IVPC---EFGVLSRLAEIISNILNEQESLIHRLQNGLQDCATHTQPFWD---------
Q3UUV9_MOUSE/43-114-FLAV---TELG.....RPIVEYLNTQKDMLDNYRASVDR.CRNNYDLV.---------
Q58DW7_BOVIN/27-105-MIPR---EFGVLNGLARYLSQFLNNNSYLIQRLSNGLQNCAAHTQPFW.---------
Q6MGA7_RAT/27-106-IVPC---EYGVLFKLAEFISNILNKEEGLIQRLKNGLQDCSTHTQPFWN---------
Q70IB5_BOVIN/44-114-FVAV---TELG.....RVCAEIWNTQKDLLAEFRAYVDTLCRHNYK...---------
W5PC43_SHEEP/40-111-FVAL---TELG.....KPDAELWNNRPDILARSRASVDMLCRRNYKL..---------
W5Q266_SHEEP/32-102-FTAL---TELG.....RPDAEYWNQQKDFMEQMRAKVDTVCRSNYQ...---------

PF00993

M4AFZ0_XIPMA/29-105.DTLP...DFVS--.HPSF.SGLYEQSVGQQQL........CKNNLKIIRTGLKDIPD.
W5Q1M3_SHEEP/29-109.WHLP...VFSQ--FRS.FDP...QGALRNMAS........GKQTLEIMIQRSNSTAAT
M3Y3I6_MUSPF/29-109.WQLP...MFQT--LGS.FDP...QGALRNLAV........SKQNLNILTKRSNYTAAT
G3HQS4_CRIGR/268-348.WRLP...EFGD--TQY.SNF...QSGLASIAM........IRAHLDILVERSNRTRAI
G3TMW3_LOXAF/41-120.WHLP...EFGK--AIY.FDA...EAGLSYMAR........MESNLKYGIQHLNYTQAT
G3U806_LOXAF/37-114.PRLP...EFAD--WAKD......QGDVSAISF........DKEFCQSMIQDIGPQFDG
F6ZD60_MONDO/30-109.WRLT...DFSN--FAS.FEA...QGALANLAV........DKANLEIMMKRSNNTPDT
W5LNP0_ASTMX/24-103.VSLP...KFAT--LNYTIIPAAYEHSIQELQI........CRYNLKYSVFWYNFPAE.
G1P5L8_MYOLU/30-110.WRLP...GLSE--FGG.FDP...QGGLRNIAT........MNHNLDIMIKHSNYTAAI
I3JKK1_ORENI/22-99.SPQP...SFID--.PISFGAGAYKTAVSNLNT........CRQNLQITREGIKDFP..
F1ML44_BOVIN/29-109.WRLP...MFSQ--FAG.FDP...QAALSEIAT........AKHNLDVLTKRSNFTPVI
L5KYV0_PTEAL/29-109.WRLP...EFGE--FTS.FDP...QGALRNIAI........GKHNLDIMIKRSNSTAAP
M3XS77_MUSPF/41-118.PRLP...EFAD--WAQK......PGDTSTIFF........DKTFCQSMIQEIGPHLEG
G1R500_NOMLE/35-114.WHLE...EFGR--AFS.FEA...QGGLANIAI........LNNNLNIMIQRSNHTQAA
F6ZJJ9_HORSE/29-109.WRLP...EFSK--FSS.FDP...QGALETIAI........IKEHLDVMMKRSNSTPAT
H3CJ64_TETNG/21-97.YAQP...DFID--.PIKY.EGFYSTAVAVLQI........CKFNLGIFRKGYKDMPR.
W5Q2C6_SHEEP/29-109.WQLP...LFSR--MLS.FDP...QGALRNIAV........MKLHVDFLTKFSNSTAAT
G1Q9G7_MYOLU/3-83.WRLP...GLSE--FGG.FDP...QSGLRNMAV........VNHTLDILIKSSNSTAAP
G3HQS6_CRIGR/42-118.PRLP...DFAD--WAQE......QGDASAISF........DKEFCNMLIQEIGPQLEG
H2RPE2_TAKRU/21-98.DGTP...PFID--.PVRF.EGFYSTAVTNLQI........CKSNMDVVRKGNKDMPPE
K7GRZ3_PIG/40-117.PRLP...EFAD--WAHQ......IEDTPAIFF........DKGFCREMIEKVGPLFEG
G1L546_AILME/42-114.WQLP...EFIH--AFD.FDA...WRRVADIVT........ARKDLNILIQGSNHTRAT
F1R0K2_DANRE/21-100.ITLP...DFAD--.RIGF.PGFYEISVDSIAG........CRRNLANNIRGFKSPPPA
H2ZYC5_LATCH/4-83.WRLP...QFKD--LAQ.VQA...ARALENMQV........CKTNLDIIKKAVNKTLAD
G3UHX0_LOXAF/29-109.WRLP...MFSK--FAG.FDP...QGGLRNIAV........LKHNLDILIKLSNSTAAT
Q8WM94_DANRE/21-100.ETLP...DFGD--.PMTF.PGFYEGSEGEMAV........CKSNLALRIKGFKSPPPE
G1L6J1_AILME/29-108.WRLE...EFGR--FAS.FEA...QGALANIAV........DKANLDIMIKRSNHTPNT
G5BB02_HETGA/33-112.WHLP...EFGR--AFS.FDA...QGGLTNIAI........ANSNLNILIKRTNRTQAP
M9MM93_DANRE/19-98.ITLP...EFAG--..........QAVLPPIYVDAKRAEFNCKAYLAVLREVYASSPE.
W5KCR1_ASTMX/22-100.MTLP...QFAD--.PASYGEGAYEGALSQVEN........CKSNLGIIKKVYNNPAEP
F7I518_CALJA/33-113.WRLP...VFST--FTS.FDP...QGALTNIAT........MKPGLDILIKRSNCTAAT
H0VMA0_CAVPO/42-122.WRLL...EFGQ--ALSPLDA...QAALTNIAI........LRNNLNIMIQRSNHTQAP
HA2B_MOUSE/30-110.WMLP...EFGQ--LAS.FDP...QGGLQNIAV........VKHNLGVLTKRSNSTPAT
L7N114_MYOLU/30-110.WQLP...MFSE--FRN.FDP...QVALRNMAI........ANYTLGILIKSSNSTAAP
F1QYA3_DANRE/34-109.ATLP...EFAD--.PLSF.PGAYEESVADQEV........CKQNLATSIKAYNSPPEE
I3MR31_SPETR/27-107.WRQP...EFSN--FAT.FEI...Q.GLRNLVV.......VKKKNLDTLIKDSNFTPAT
G1Q5X0_MYOLU/29-109.WRLP...MFSE--VTN.FDP...QAGLREVAT........ARYNLDLLIRRSNSTAAI
Q31621_MOUSE/41-118.PRLP...DFAE--WAQG......QGDASAIAF........DKSFCEMLMREVSPKLEG
G5BB05_HETGA/92-169.PRLP...DFAD--WAQD......QSDAPAIAF........DKQFCEMMVQQLDPVLDG
H0WUA6_OTOGA/41-120.WHLP...LFAQ--AFS.FEA...QGGLANIAI........MKDNLNIMIRHSNHSQDT
G1QAF8_MYOLU/29-109.WQLP...MFSE--VRG.FDP...QSGLTTVAT........ARYNLDLLIKSSNSTAAI
I3JGI5_ORENI/21-97.SPQP...SFVD--.PISFGDGAYETAVINLYI........CKTNMQVSQEGMKD....
M3YH02_MUSPF/31-104.WRLP...VFST--FAS.YDP...QGSLGNLAI........AKQNLNILTKSSNYTAAT
H2RBA7_PANTR/29-109.WQLP...MFSK--FIS.FDP...QSALRNMAV........GKHTLEFMIKQSNSTAAT
I3MDX2_SPETR/29-109.WTLP...IFSQ--MRK.FDP...QRALQNINI........LRHNLDILIKCSNSSEAP
G1PGE2_MYOLU/3-83.CWLL...GFSE--FKY.FDI...QTALINMAI........FKYNLDLLIKRSNYTAAP
K7EUP3_PONAB/29-109.WRLP...EFGD--FAR.FDP...QGGLAGIAA........IKAHLDILVERSNRSRAI
F7D2J1_XENTR/22-100.WTLP...GLSE--HES.FDP...QGALQDINV........ARYNLDIGIKRSNSTAAT
O97981_PIG/29-109.WRLP...EFSN--FAD.FDP...QNGLRGIAL........IRAHLDVLVERSNHTRAT
H2SD42_TAKRU/21-100.DINP...PFID--.PITYEEGAYSSAVADLQT........CKTSLDITRKSLKDMPPE
A7X5M6_ORNAN/29-108.WRLA...DFSN--YAS.FEA...QGGLANLAV........DKANMDILIKRSNHTPAT
F1QNN0_DANRE/21-100.KTTP...SFAQ--YAVI..PDIYERALAFLDF........CKYDLHAYIKYFNNPPPE
W5MK71_LEPOC/36-116.PRLP...EFEK--WAW.NDSSLIQGALANLGI........CENHLKGVMKAIPDEPA.
G5C3I9_HETGA/21-100.WRLE...EFGR--YAS.FEA...QGALANLAV........DKANLGIITKRSNNTPDA
I3N7K0_SPETR/29-108.WRQP...EFSN--FIT.IEL...Q.ALRNLVV........VKNILDILIKNSNFTPAT
G3RX38_GORGO/29-109.WRWP...EFSK--FGG.FDP...QGALRNMAV........AKHNLNIMIKRYNSTAAT
Q1MTC7_DANRE/24-99.ATAP...DFAD--.PLSF.PGFYEAGVAQMEV........CKQNLATDIRAYNSPQE.
U3IBP5_ANAPL/29-109.WRLP...IFTT--FTS.FEA...QGALQNIAV........DKQNMEIMMKRSNRSQ..
H2MYR3_ORYLA/31-108.DAQP...SFVG--.HITY.AGGYGATVLELQG........CRNDLEVIRRFTKDLPL.
G3HQS4_CRIGR/2-76.WGLR...EFST--VYG.FDA...QGALPYILS........LKDNLRALIQRHNVTQVP
L8Y815_TUPCH/29-108.WSLE...EFGR--VYS.YEV...QGGLQNLAV........AKGNLNTLMQCSNHTQAS
G1QA26_MYOLU/29-109.WRLP...GLSE--FGG.FDP...QGGLRNMAT........AEYNLDILIKRSNSTAAI
G1QBV7_MYOLU/2-82.WRLP...EFSN--FTK.FET...QNALQNIVV........AKRNLDTLIKDSNFTPAT
H0WYE3_OTOGA/29-109.WRLP...EFST--FAG.FDP...QGGLREIAT........AKHNMETLTKRSNSTAAP
I3KVG1_ORENI/87-164.NSLP...PFAD--.LITC.PGCYEQAVANQQV........CKQNLQTLRKMMKDYPL.
HA22_MOUSE/29-108.WRLE...EFAK--FAS.FEA...QGALANIAV........DKANLDVMKERSNNTPDA
G3UHG4_LOXAF/2-80.WWLK...GFEC--FAS.FEA...QSALANIAV........DKANLDVMMKCFNCTPN.
HA2P_RABIT/1-80.WYLP...EFGR--MFS.VEA...QGGLANIAA........AKSNLNACIQHSNHTQAP
G3N551_GASAC/29-106.RPQP...SFVD--.PIDYREGTYETAVGNQQI........CRNNLKIDLKAFKDFPLE
G1PA08_MYOLU/2-81.WRLP...EFIH--TFD.YDA...RRGIADIVM........ARKNLDTLIQRSNHTRAT
F6YG75_HORSE/29-109.WRLP...EFGE--FAT.FDP...QGGLRNVAT........AKHNLDIWIKRSNSTAAT
I3M2H3_SPETR/44-123.WQLS...EFGR--GLS.FDS...QGGLTNIAI........AKSNLDIMTENSNHTQAA
I3J7S9_ORENI/22-99.YPLP...PFID--.PITYGEDAYESSVAFQKT........CRKNMKQFGEGMKDFP..
F7GQ21_MACMU/12-91.WRLP...IPYR--Y.G.FDP...QFALRNIAV........LTHNLNVLIKRSNSTAAT
W5PDP1_SHEEP/41-118.PRLP...EFAD--WAHQ......HGDTSNIMF........DKGFCRTMIEEIGPQLEG
M4A196_XIPMA/24-103.DPQP...PFVV--.HTSYREGVYEQAVANQQV........CRSNLKVCRSAMKDIPDE
L8Y3F3_TUPCH/29-108.WSLE...EFGH--AFS.FDA...QGALQNFAV........VKSYLNVLTQRSNHTQAS
F6S093_HUMAN/8-85.PRLP...EFAD--WAQE......QGDAPAILF........DKEFCEWMIQQIGPKLDG
F6T370_MONDO/29-109.WRKS...EFCN--FAK.FDP...QGGLRNFAM........MKNILDLLLRESNYTAAT
H3CDM2_TETNG/24-100.YALP...DFVD--.PLKFPEGTYSQAVADQQI........CKINLGISRKGNKDMPR.
Q6MGB1_RAT/29-108.WDLP...EFSK--VYA.FDA...QEALPYIDS........LKNNLRALIQRYNVTQDP
H0UYJ7_CAVPO/26-105.WRLP...EFGQ--AFA.FDA...QGGLANIAI........MRTNLNFAIQDSNHTQAP
H2L2T1_ORYLA/33-107GPQLPLGGHFIN--......PDGYQFAKVYEQV........CRRNLKALKKTTKGL...
G3N564_GASAC/37-113.RPLP...SFVD--.PIEFPGGAYEQAVTDLQI........CRSNLKTHVKGLKDVPL.
G7P2R3_MACFA/2-81.WRLP...VLSQ--F.S.FDA...QFALTNIAV........GKQNLNYLMKQSNSTAAT
HA2B_RAT/30-110.WRIP...EFGQ--LIS.FDP...QGALRNIAI........IKHNLEILMKRSNSTPAV
I3KVG9_ORENI/22-100.DAPP...DFIG--.SFNYQEGAYENAVANQQI........CRANLKVDSKGMKDFPL.
F7D2Z8_MONDO/30-109.WRLP...EFSH--FAG.YDP...QGGLRNIDV........MEHNLDILIKRSNRTRA.
H0VR34_CAVPO/30-110.FWMP...GLKK--VVG.FDP...QGALNNIAI........VKNNLNILTKQSNSTAAT
W5MKC8_LEPOC/19-99.LTLP...AFAD--.SFGVDPGWVQGAIANRQI........CINNLEVAIKAENNPPE.
I3MD72_SPETR/41-118.PRLP...EFAD--WAQD......QRDASAIVF........DKGFCEAMIEKIGPQLEG
I3JXB4_ORENI/27-101.YILP...PFAE--.PMIY.PGAYKQAVTELKV........CRHNLKALRAVMKDYPSN
I3KVH2_ORENI/22-100.YPQP...PFID--.PITV.PGGYESSVAFQHS........CRENMKLFGKGMKDYPPE
H2MXB6_ORYLA/21-98.EPQP...PFVD--.HVSY.PGGYEQAVANQQI........CRSNLKISRIAMKDLPL.
L8YBX0_TUPCH/29-108.WSLE...EFGR--AFS.FEA...QGGLQNIAI........VKGNLNIMMQRSNHTPAS
G5BB12_HETGA/29-109.FWLP...GLNK--VAG.FDP...QGALNNIAI........GKHNLDIITQHSNSTAAT
H2ZTM7_LATCH/28-104.WRLP...QFKD--LTR.YEV...EVAVANMRT........CESNLDIIIKTANES...
H2V674_TAKRU/23-96.YGTP...PFID--.PFR....PTAAAVADLQT........CKYNLDVDRKGNKDMPTE
G3UJA6_LOXAF/27-103.WWLK...EFEH--FAS.FEA...QRVLASIAV........DKVNLDVVMKRSNHTPN.

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window