Sequence alignment for CL0347

PF00335

TET11_ARATH/4-262.VSNFM---VGLANTLVM---LVG---------ASAIG.Y------S...........IY-M------F...........
TSN16_HUMAN/10-243SL.KKL---LSLLNGFVA---VSG---------IILVG.L------G...........IG-G------KCGG.......A
Q16LT3_AEDAE/14-239CV.KYM---IFVINFMFL---LTA---------ILIVT.V------G...........SA-I------GTIF.......G
H3DJN8_TETNG/8-231..SKTV---LLFLSLVFW---AAG---------AALAY.V------G...........AY-V------IKSY.......D
Q9V3X2_DROME/9-261CV.KYL---MVLINILFW---LIG---------LTIVV.T------S...........VW-M------LTDP.......T
TSN5_HUMAN/14-261CI.KYF---IFGFNVIFW---FLG---------ITFLG.I------G...........LW-A------WNEK.......G
Q6Z6K0_ORYSJ/3-259.VSNNI---TACVTLMAL---ICA---------VPVIA.S------G...........VW-F------A...........
Q29D35_DROPS/9-259CA.KYL---LCIFNFIFF---VLG---------TIIFG.V------G...........LW-L------AVDK.......H
Q7Q1S3_ANOGA/9-239FI.KYL---LFLFNFFFA---ITG---------VIIMA.V------G...........LT-V------QGAY.......H
TET15_ARATH/53-313LVNILA---AGVLPIFTF---VLS---------LTLLG.Y------A...........VW-L------L...........
Q292W4_DROPS/7-217MV.KYI---LFIFNLLCS---ICG---------ILLIV.F------G...........GL-L------FSNI.......H
H3CCQ2_TETNG/10-245.T.KYF---LFLLNFIFF---LCG---------AVIVG.F------G...........LW-L------LLDN.......Q
Q9VMJ6_DROME/18-261CL.KYL---LFASNVILW---LSA---------LLVLS.V------G...........IW-A------WSEK.......G
TSN6_BOVIN/16-237CF.KSV---LLIYTFIFW---ITG---------VILLA.V------G...........IW-G------KVSL.......E
Q06AT4_PIG/10-257CF.QSL---LVFGNVIIG---MCG---------IALTA.E------C...........IF-F------VSDQ.......Y
Q16GP3_AEDAE/9-261IA.KTL---LSVFNFVFF---VLG---------SIVLG.V------G...........IW-L------VADK.......S
TET13_ARATH/15-272IVQNMS---FPFNTIFLI---SSA---------IFLVT.A------A...........FW-F------VAVM.......T
M9PDV2_DROME/8-255CI.RRT---FCWLNIILW---LCS---------CAFLG.A------G...........LW-L------RLSY.......A
Q24FE3_TETTS/5-263.LLKKS---VIITNSLLL---LVG---------LFFII.Y------P...........AI-L------YQQY.......A
A2BIP5_DANRE/16-252FL.KFS---LNVYSMLFS---LLG---------LCVLC.I------G...........VY-A------EVER.......Q
Q4DD38_TRYCC/89-308SLFGYA---LIFINFTFI---MAS---------MLLVM.S------G...........I.-.------............
TSN8_BOVIN/7-235CI.KCS---MFIFNFVFW---LCG---------AIILS.V------A...........IS-I------RAGK.......I
TSN10_HUMAN/75-319CV.KYL---IFLSNFPFS---LLG---------LLALA.I------G...........LW-G------L...........
Q176T5_AEDAE/20-244TI.KYL---LFVFNLIFA---VSG---------LVLLI.A------G...........II-V------LLDV.......N
TET5_ARATH/4-245.MSNTV---IGFLNILTL---ISS---------IVLLG.S------A...........LW-M------G...........
A2EZ30_TRIVA/7-219.LARTI---IGLVNLIIL---IV.---------......M------A...........VI-L------YFSW.......D
A1Z8K7_DROME/8-233LI.KYV---LFAFNVLFA---ISG---------LGILI.A------G...........AV-V------LADV.......N
Q16HX5_AEDAE/9-218TI.KYV---LFVFNLLCS---LCG---------IALVV.I------G...........GV-S------LAKI.......A
Q6Z8Q8_ORYSJ/5-259.LSNNV---IGALNLVTL---LLS---------APILS.G------G...........IW-M------A...........
F1Q6P4_DANRE/9-244.T.KYF---LFLFNFIFF---IFG---------ATIMG.F------G...........LW-I------LLDN.......Q
A0BP70_PARTE/7-282CL.KFS---VQFQAWVIL---IVG---------VSSLI.G------T...........IV-I------NVDQ.......R
Q16J92_AEDAE/9-260II.KYL---VILVNLLFW---LIG---------FAIVL.L------A...........IW-M------LTDP.......T
CD81_MOUSE/9-229CI.KYL---LFVFNFVFW---LAG---------GVILG.V------A...........LW-L------RHDP.......Q
Q16LT4_AEDAE/34-246IV.KYS---VLVLTGMCL---ILE---------VIQIV.L------GAGAGNIFADFHIF-L------DDNF.......H
H3DF34_TETNG/10-245.T.KYF---LFLFNLLFF---VFG---------GLIMG.F------G...........LW-V------LLEN.......Q
H3CSH9_TETNG/9-237..SKTV---LVFLNMIFW---AAA---------GILCY.V------G...........AY-V------FITY.......D
Q86D97_SCHMA/7-231CL.RVI---LVVFNFLVV---LIG---------LSVLG.F------S...........VY-I------YLEP.......E
A1Z6T8_DROME/7-220LL.RYV---LCVISGICA---LGG---------CLLIW.Y------G...........AW-L------LDSL.......S
Q3UGA5_MOUSE/74-317CV.KYL---IFLSNFLFS---LPS---------LLALA.A------G...........LW-G------L...........
Q29IZ2_DROPS/18-232CV.KYT---LFCFNIVAW---MIA---------TALFA.L------T...........VW-L------RAEPG.....FN
A8X5P0_CAEBR/7-223CI.KLL---FFIINFFIC---IFG---------ALICG.F------S...........LW-A------NLDK.......E
Q16HS1_AEDAE/9-225TL.RCT---LILLNMLCF---LSG---------LSLAI.V------G...........AV-M------HTKL.......A
Q4S5B5_TETNG/8-230CI.KYM---LFLFNLFFW---LGG---------CGLLG.V------G...........LW-L------SVSQ.......G
Q24C18_TETTS/14-278CI.QIY---ISWTSYINL---LIS---------IAALA.F------G...........AY-E------GIRK.......K
G7NV03_MACFA/6-238FI.KTI---MILFNLLIF---LCG---------AALLA.V------G...........IW-V------SIDG.......A
TSPA_DICDI/14-223LL.KVP---LIILNIILW---ILG---------LVLVI.V------G...........GI-C------VSFL.......S
TSN33_MOUSE/21-264LV.KYL---LFFFNMLFW---VIS---------MVMVA.V------G...........VY-A------RLMK.......H
A0CWV3_PARTE/4-272.FVKKV---VGFGAFLII---LIG---------LALLG.F------G...........VY-V------LYKQ.......V
TET6_ARATH/4-244.FSNTV---IGVLNLLTL---LAS---------IPIIG.T------A...........LY-K------A...........
Q9W4X6_DROME/42-295CV.KYM---IFLLNFVFW---LFG---------GLLLG.I------G...........VY-A------FRDKWEDANGSV
F6ZCC3_XENTR/20-287......---LWILNWVSV---VTG---------LIIFS.L------G...........LF-L------KIEI.......K
CD63_MOUSE/9-231CV.KFL---LYVLLLAFC---ACA---------VGLIA.I------G...........VA-V------QVVL.......K
TSN8_HUMAN/7-234CI.KYS---MFTFNFLFW---LCG---------ILILA.L------A...........IW-V------RVSN.......D
Q7K2V7_DROME/7-219MF.KYL---LYLLNLVFV---AGG---------ILLIV.V------G...........SI-M------LSTM.......G
H3D1H6_TETNG/11-249...RLG---LLAFSCLFW---AAG---------LALFT.L------G...........VW-A------QISL.......A
TSN14_HUMAN/14-261WY.KYL---LFSYNIIFW---LAG---------VVFLG.V------G...........LW-A------WSEK.......G
TSPE_DICDI/16-219.LVRGP---FIILNSIIF---SLS---------FILLCST------G...........II-I------YYLN.......E
TSN32_HUMAN/9-223.VAKCQ---MLVTCFFIL---LLG---------LSVAT..------..............-.------............
B4I8V1_DROSE/9-225CF.KYL---VYSYVVLLA---LTG---------AAQIF.L------G...........TS-L------LWGH.......S
Q16TV5_AEDAE/8-254CI.RRT---FCSFNVLIW---LCG---------SCFLA.I------G...........VW-L------RFAA.......P
Q7PTA7_ANOGA/9-220TI.KYL---LFIFNLLCS---LCG---------IALIV.I------G...........AV-S------LVKL.......E
TSPD_DICDI/11-223YL.KVP---LIILNVILW---LLG---------LVLVI.I------G...........GI-C------VGFF.......S
F1R4A1_DANRE/13-252.V.KYT---LFVCCYVFW---VFS---------AGLIA.V------G...........IY-A------KIAK.......E
Q9NB13_DROME/7-221IV.NFI---LYIVNIVFL---IVG---------ILLIV.L------G...........SI-M------LSDL.......S
Q292V6_DROPS/9-211PW.KYA---LFATCILIT---ACT---------VLFFS.C------G...........VV-T------WGSA.......A
Q6YWS4_ORYSJ/4-277.FSNGV---LGALSFAAL---LAS---------VPLIG.A------G...........AY-L------L...........
Q4D693_TRYCC/53-286.YHRFS---TACFSAFLI---LLG---------VAMSA.V------I...........AI-G------GSKS.......K
TSPB_DICDI/14-223YL.KVP---LIAFNTILW---VLG---------LVLVI.I------G...........SI-G------VSFF.......S
A0EF92_PARTE/7-263CL.KCI---VEFEAILIL---IAG---------LGSFG.F------T...........IY-L------QIEF.......N
TET9_ARATH/4-258.FSNSL---VGILNFFVF---LLS---------VPILS.T------G...........IW-L------S...........
Q5I0R1_XENTR/7-227CL.KYS---MFAFNFLFW---LCG---------CVILG.V------S...........IW-V------RVSK.......S
Q7SXT2_DANRE/16-243CL.KTF---LISYSLIFW---FTG---------VILLA.V------G...........VW-G------KVNL.......E
Q9XVI4_CAEEL/8-223IV.KYL---LFLANLVLW---VGG---------LSLII.V------G...........SI-L------QLKF.......D
A2DRK6_TRIVA/7-225.MAVAL---IGVINLVIL---VV.---------......M------G...........VV-A------YFCL.......D
Q22RT6_TETTS/8-279LRLTEK---LCYANLVTG---LVG---------II....T------G...........IV-L------LGVN.......S
A2DY51_TRIVA/7-217CL.RWV---IIIINILIV---IAA---------VIACA.V------V...........YT-R------IGKT.......S
L9JBT3_TUPCH/21-370LV.KYL---LFFFNMLFW---VIS---------MVMVA.V------G...........VY-A------RLMK.......H
Q6Z5Z9_ORYSJ/5-263.CSNAV---FAAINVVTL---LLG---------AAVLA.A------G...........IY-Y------GAPH.......R
Q6NYK2_DANRE/15-289KL.AQG---LWMLSWLAT---VGG---------AITFT.L------G...........CF-L------KTEL.......R
Q75IM5_ORYSJ/6-249.FSNVM---IGYLNLATL---LAS---------IPVIG.A------G...........LW-M------A...........
H3DMZ9_TETNG/7-217CV.KYL---LFFFNLLFW---ISG---------CIILG.V------S...........IY-V------KVTK.......D
CD37_RAT/10-270LI.KYF---LFVFNLFFF---VLG---------GLIFC.F------G...........TW-I------LIDK.......T
Q7JZW7_DROME/7-210CL.QWT---SVVFSTLTL---IVG---------VLAAL.A------G...........VY-E------LDKF.......N
A8XFB8_CAEBR/15-256.LVKFS---YIVTALISI---LFS---------ISCIC.Y------G...........IW-L------LARR.......S
Q7QJ21_ANOGA/9-222CF.KYL---VYAYVILIS---ICG---------GAQLV.I------G...........AF-L------LWTH.......K
TET2_ARATH/3-256.LANNL---TAILNLLAL---LCS---------IPITA.S------G...........IW-L------A...........
Q7JZW3_DROME/8-216.V.KHV---LLLLNFVFS---VLG---------LALIA.F------G...........IF-F------LISA.......A
Q19983_CAEEL/7-277AL.RIV---TFLFNFAFW---LSG---------VVVFG.L------G...........IW-L------LFDP.......A
B3DL95_XENTR/8-226CI.KIT---MFIFNLIFW---LGG---------CGILG.V------G...........VW-L------AVTQ.......G
Q9FVY6_ORYSJ/5-257.TSAFV---IRWINFFTM---ILA---------LLVVG.F------G...........FW-M------S...........
ROM1_BOVIN/16-292RL.AQG---LWLLSWLLV---LVG---------GLTLL.C------S...........GH-L------LVQL.......W
Q5ZII8_CHICK/15-247CL.KYL---LFIFNFFFW---LAG---------GAVMA.V------G...........AW-T------LAKK.......S
Q22495_CAEEL/37-297CV.KYS---VFSFNVIFF---LLG---------FGLLL.F------G...........VW-A------QIEK.......N
Q6DHQ4_DANRE/8-230AL.RYG---MVFFNLLFW---LCG---------CGILG.V------G...........VW-L------SITQ.......G
Q7K527_DROME/7-208TI.KYS---LFLFNALWA---ILG---------ILVLI.F------G...........GL-G------WGAM.......P
TSN15_MOUSE/19-259WL.KFS---LIIYSTVFW---LIG---------GLVLS.V------G...........IY-A------EAER.......Q
Q67WQ6_ORYSJ/4-259.CSNGL---LGLLNAGVL---VLA---------VVVLG.G------G...........IW-L------S...........
G4LW70_SCHMA/10-212CL.KSC---VFVLNIICL---LCS---------LVLIG.A------G...........AY-V------EVKF.......S
Q16HS3_AEDAE/6-221TV.KTS---LIVLNMICL---LCG---------LWLTI.V------G...........LV-M------MYKY.......S
Q29JV1_DROPS/14-246CA.KYM---LIIVSFMFA---LTA---------ILLIM.V------G...........TT-I------QTIF.......G
Q9VID1_DROME/8-228CV.KYL---TFFCNLLFA---LTG---------LLIFL.V------G...........GM-V------QLNY.......A
H9KCQ4_APIME/8-222.I.KYL---LFIFNFVFA---VCG---------LGILT.L------G...........VL-I------HLQI.......L
Q7JWV7_DROME/7-218FV.KYV---LFIFNILFV---ICG---------ILLIT.F------G...........SI-M------VSTI.......K
O44582_CAEEL/29-290CL.KWL---VFLLNSIVF---LVG---------VGILA.L------G...........VY-L------FIKD.......F
C4Q3U8_SCHMA/12-223CL.KYS---MFVFCLIAW---VLG---------LITFI.V------G...........IV-A------RVNG.......S
Q17441_CAEEL/23-259CCSKCQ---LFI.SYLLV---IVG---------ILFLA.L------A...........IW-L------YIFR.......G
CD82_HUMAN/8-256VT.KYF---LFLFNLIFF---ILG---------AVILG.F------G...........VW-I------LADK.......S
TSN12_HUMAN/9-248CL.RCL---LYALNLLFW---LMS---------ISVLA.V------S...........AW-M------RDYL.......N
Q4D6X7_TRYCC/23-265.FFRAL---LMGMNILLT---AGA---------VAGLA.V------G...........LL-E------RSTM.......E
Q7T376_DANRE/6-213CL.KYI---MCVVNFIFF---ICG---------AAIFG.M------G...........IY-L------MT.........F
TSN11_BOVIN/15-248YL.KYL---LFIFNFFFW---VGG---------AAVMA.V------G...........VW-T------LVEK.......S
Q6P2T9_DANRE/9-230CV.KYL---LFFFNFIFW---LCG---------LALIV.L------G...........IL-V------HVSL.......H
A8WRV5_CAEBR/9-230CI.KYF---FWLINLLFF---VLG---------AVIVG.L------S...........IW-M------LVDK.......N
Q24C21_TETTS/14-285CL.QVY---ISWTSYINL---VIS---------IAALA.F------G...........IY-I------GVKN.......K
Q245V1_TETTS/9-274TL.RRI---TEISACIMC---ILG---------VFAII.F------G...........GV-L------LGQN.......K
Q7KJ73_DROME/8-218.V.KYI---LFIFNTIVS---VIG---------ILGIV.Y------G...........VL-I------LKSI.......G
M4EKP0_BRARP/8-252.....A---VITTNAILA---LIG---------LATLC.F------S...........VY-L------F...........
Q1HRC5_AEDAE/13-234CV.KYS---MFVSNFIIF---IGG---------AIVFG.L------G...........VW-T------VVDK.......N
A1Z6U7_DROME/7-216TI.KYT---GLLSNLLYM---LLG---------IGVMSGA------G...........LG-L------QMAE.......P
H2VAF3_TAKRU/20-284......---VWFMYWFAV---LAG---------VLVFS.M------G...........LF-F------KIEL.......R
Q16LT5_AEDAE/17-240WI.KFF---LFMTNVMFV---FVG---------ILVIS.T------G...........AA-V------RSVY.......S
Q29JV0_DROPS/10-238AV.KYT---LFGFNLIFL---ITG---------IILIA.V------G...........AG-V------GSVY.......T
A0BI34_PARTE/7-267CL.KCF---VQLEGWLTF---VIG---------ILAIV.A------A...........II-V------TVIQ.......K
Q7K010_DROME/6-211SV.KLI---VYALDVLCT---LLA---------LVLIS.F------G...........IY-V------AVSY.......N

PF04103

FCERB_HUMAN/60-204FL-GVT...QILTAMICL---CFG---------..TVVCS------V-----------LD-I------SHIE-------.
FCERB_MOUSE/52-195FL-GAT...QILVGLICL---CFG---------..TIVCS------V-----------LY-V------SDFD-------.
T176B_HUMAN/66-229AL-GVT...QILLGVVSC---VLG---------..VCLSL------G-----------PW-T------....-------.
A6H741_BOVIN/62-223AL-GVT...QLLLGAISC---ALG---------..GLLYL------G-----------PW-I------....-------.
T176B_MOUSE/60-224SL-GVT...QILLGLVSC---ALG---------..VCLYF------G-----------PW-T------....-------.
T176B_RAT/60-224SL-GVT...QILLGLVSC---VLG---------..VCLYF------G-----------PW-T------....-------.
T176A_RAT/63-223AS-WVV...QIVLGILSV---VLG---------..GILYI------C-----------HY-L------....-------.
T176A_HUMAN/56-214AS-WVM...QIVLGILSA---VLG---------..GFFYI------R-----------DY-T------....-------.
T176A_BOVIN/63-220TS-WVM...QIVLGLLSG---VLG---------..GFLYI------F-----------SS-T------....-------.
Q4TAI3_TETNG/57-208LL-GTL...HILAGLLNI---LLS---------..VILCA------G-----------GR-Y------P...-------.
A7SQ32_NEMVE/7-164LL-GIISSFHLVFGVFSV---VLG---------..IVTFK------V-----------AP-Y------....-------.
Q95PZ5_CAEEL/94-253RL-CLV...ELMLAVVIL---GGG---------..IWCYR------D-----------TS-D------....-------.
Q9GYM6_CAEEL/45-206AL-ANV...HVFLGIIMI---VLS---------GLADYAS------T-----------RI-N------....-------.
Q1LVQ8_DANRE/42-197LV-ALL...QLLLGIAVA---AVA---------..FLMLA------I-----------SS-S------....-------.
H3D3M7_TETNG/37-190.V-ALL...QLLLGVAVT---VVA---------..FLMLA------I-----------SP-S------....-------.
Q3TRE0_MOUSE/29-182.L-ALL...QLALGIAVT---VLG---------..FLMAS------I-----------SP-S------....-------.
A7S4D6_NEMVE/20-179GF-GVV...QVILGLSLT---GLS---------..FAAFA------L-----------SE-S------....-------.
Q0V9M1_XENTR/36-200SL-GVS...QMVLGCLIV---AVS---------..FAALA------L-----------TT-S------....-------.
F6PJ14_XENTR/5-167SL-GLL...QLILGCCTV---ALS---------..FGALS------L-----------SK-S------....-------.
F189B_MOUSE/36-196TL-GLA...QVLLGILVI---TFS---------..MVASS------V-----------TT-T------....-------.
Q5BLA7_DANRE/16-153VL-GIL...QVACAGLCV---VCG---------..FMDAV------F-----------RK-S------....-------.
F7AIP4_XENTR/16-154VL-GIL...QIACAGISI---VSG---------..FMDGA------F-----------RR-E------....-------.
Q08BU9_DANRE/43-180SI-GVV...LSMMGVGLF---LFG---------..IPMTV------H-----------TD-I------....-------.
F1RAY4_DANRE/49-184.I-GVV...LVMMGVCLF---MFG---------..IPMTT------P-----------KD-M------....-------.
F7ESV6_XENTR/53-198VL-GVI...QLFTGITQI---AAG---------..IVLCI------A-----------MA-S------R...-------.
H3C9F3_TETNG/67-212AL-GVV...QIMVGLVCV---AFA---------.....LR------A-----------AF-S------....-------.
MS4A3_MOUSE/27-172AL-GAI...QILNGILIL---ALG---------..IFLVC------L-----------QH-V------SHHF-------R
MS4A3_HUMAN/50-196VL-GAI...QILNAAMIL---ALG---------..VFLGS------L-----------QY-P------YHFQ-------K
M4A4A_HUMAN/65-207VL-GVV...QILTALMSL---SMG---------..ITMMC------M-----------AS-N------TYG.-------.
M4A6C_MOUSE/47-207VI-VAI...QIMCAVTVL---ALG---------..IILAS------V-----------PP-V------PYFN-------.
M4A6B_MOUSE/47-204VM-AAI...QIMCAVMVL---SLG---------..IILAS------V-----------PS-N------LHFT-------.
M4A6D_MOUSE/47-207VM-AAI...QIMCAVMVL---SLG---------..IILAS------V-----------PS-N------LHFT-------.
MS4A7_HUMAN/47-207VL-GTV...QILCCLLIS---SLG---------..AILVF------A-----------PY-P------SHFN-------.
F6RP33_BOVIN/48-208VL-GII...QILCFLVIS---SLG---------..VILVS------V-----------PN-S------SQLS-------.
Q99N04_MOUSE/47-204VL-GTI...QLLCALILA---SFG---------..GILVS------A-----------SY-F------NP..-------.
MS4A5_HUMAN/49-189IL-GTI...QILFGIMTF---SFG---------..VIFLF------T-----------LL-K------PYP.-------.
Q810P8_MOUSE/49-189IL-GTT...QILFGIMNF---SFG---------..VIFLF------T-----------LV-N------PYP.-------.
Q2KII2_BOVIN/49-189IL-GAV...QILLGAMNF---SFG---------..TVLLF------T-----------LE-D------PYP.-------.
Q3LRP2_CALJA/51-216VL-GAV...QIMNGLFHI---ALG---------..GLLMI------P-----------AG-V------Y...-------.
CD20_MOUSE/44-210AL-GAV...QIMNGLFHI---TLG---------..GLLMI------P-----------TG-V------F...-------.
CD20_CANFA/51-216TL-GAV...QIMNGLFHI---ALG---------..SLLMI------H-----------TD-V------C...-------.
W5PU80_SHEEP/51-216AL-GAV...QIMNGLFHI---ALG---------..SLMLI------H-----------AD-V------Y...-------.
M3VZQ9_FELCA/52-215.L-GAV...QIMNGLFHM---ALG---------..GLLMI------H-----------ME-V------Y...-------.

PF13273

D7UXS6_LISGR/3-100--QRKA---EFIMTIIGASLAILG....IL...FMGIMLA...L..L-----------.G.I......G.T.........
C2RQC7_BACCE/10-90--KRTP---EFVLGLIGG...ILG....II...ISIILIV...VAFN-----------.I.ME...GVD.Y.........
C3AKH5_BACMY/2-83--KRTP---EFILGLIGG...IFG....VI...GSFIILM...I..A-----------.I.T......A.MDGY......
Q2B2X7_9BACI/2-86--KRTA---EFVLGLVGG...IIG....IL...LSFIGFV...I..A-----------.F.V......A.AAS.......
A0A031KR27_ENTFC/3-104--KRKT---EFILILISG...ITG....IL...CSLLALM...G..G-----------.M.F......L.S.........
C7DIS7_MICA2/29-132--PPTA---AFVLLLIGG...III....ML...FGFVAVL...G..A-----------.S.L......I.S.........
D7DCC0_STAHD/4-91--KPKA---AFILGLIAG...ILG....LL...FGIVVLV...A..S-----------.S.I......L.A.........
A0B9F9_METTP/2-84--SRNA---ELALGIVGG...LFG....IL...TGIIVMF...I..G-----------.G.I......G.GAVGA....E
Q12UE5_METBU/2-98--SKKT---ETIFGIAGG...SIG....VI...IAAVIFY...V..A-----------.I.INIWPGGG.TMMY......
B9DJA4_STACT/148-230--NRVA---EMVLGIMGS...VFG....II...AGIFGLL...L..G-----------.G.I......S.SSLGE....A
C4WAZ9_STAWA/11-93--NRVA---EMILGIMGS...IFG....ML...GGLFAIM...V..G-----------.S.I......G.NEFEA....S
Q4L9M4_STAHJ/13-95--NRII---EMILGITGS...IFG....II...GGLIALI...L..T-----------.N.Y......D.KSY.......
A5UKZ4_METS3/8-83--SRIF---ELIVGGLGA...LVS....LV...SSSFILL...I..G-----------.S.F......G.F.........
A5N2M2_CLOK5/4-86--KKTV---ELVLGLIGG...ILG....II...AGIYSMN...I..G-----------.G.L......A.SVFHV....D
F0K6E7_CLOAE/4-86--KRTV---EFVLGLIGG...IFG....II...SGIGAVG...L..G-----------.G.L......G.SAVGA....S
A9VVN7_BACWK/2-84--KRTI---EFVLGLIGG...ILG....IL...CALIALF...I..G-----------.G.L......S.SALDS....D
B3ZH23_BACCE/2-84--KRTT---EFVLGLIGG...IFG....II...CAFIALM...I..G-----------.G.M......G.AAFEA....E
C3BEA6_BACMY/2-84--KRTT---EFVLGLIGG...IFG....IL...CAFLVIF...F..G-----------.G.L......G.SAFEA....D
Q4V1S6_BACCZ/2-84--KRTI---EFVLGLIGG...ILG....IL...CAVLVLF...F..G-----------.G.F......G.TAIDV....D
D4FV71_BACNB/2-84--KRTT---EFVLGLIGG...IFG....FI...GAFLALI...V..G-----------.G.L......D.ASFNS....S
C2VWU6_BACCE/24-113--KNKL---EFILGLIGG...ILG....IL...FSSFAIF...I..G-----------.F.IS...DLG.PIMDSTTGEI
C2U6N9_BACCE/2-85--KRTG---EDVIGLIGT...LLG....LL...CSLVILF...L..G-----------.R.L......A.Y.........
A5UL06_METS3/42-117--SRTL---ELVLGIIGA...IFG....LL...GGVFAIM...L..S-----------.S.F......GGT.........
O26620_METTH/8-82--SRTL---ELVLGVIGG...IFG....LL...GGLFAIV...F..S-----------.V.F......G.P.........
C8JWL3_LISMN/13-93--GRTV---EFCLGLCGG...IFG....VL...AATTLLG...F..T-----------.I.PD...IDD.P.........
D7V0U0_LISGR/3-121--KRTG---EVTLATIGL...ILG....AI..LQGLFSLV...S..S-----------.W.V......G.NITQ......
A0A024I3A1_LISMN/3-121--KRTG---EIVLAIIGL...VLS....LL...AQAFIAI...I..G-----------.L.LMISGSKG.KEG.......
D3KN98_LISMN/3-121--KRTG---EIVLAIIGL...ILS....VL...AQAFIAV...I..G-----------.I.LM...MSG.SKGK.....E
E3YXI7_LISIO/3-121--KRTG---EIVLAIIGL...IFS....VL...MQAAIAV...I..G-----------.L.LLVNGSKG.KE........
D3ULL7_LISSS/3-121--KRTG---EVVLAVTGL...VIS....VL...MQAAIAT...I..G-----------.L.LMVNGAKG.K.........
A8FJ46_BACP2/3-107--RRKG---EKIMGIISI...VLN....VI..GVGFGALI...L...-----------.S.L......G.P.........
B4AK11_BACPU/3-107--SRKG---EKIMGIISI...VLN....AI..GVGFGALIL.SV..G-----------PS.F......Y.N.........
C2H7S4_ENTFC/2-107--KRKW---ELLLGMIGG...SLS....LI..FFGGLAVT...L..S-----------.N.M......S.A.........
C9ATK3_ENTFC/2-107--KRKW---ELLLGMIGG...SLS....LI..FFGGLAVT...L..S-----------.N.M......S.A.........
E6TU87_BACCJ/2-115--KRTG---EIVLGVIGA...IGY....AFFTVAGFFFLW...L..Q-----------.N.Q......D.EF........
B9CUN6_STACP/3-110--KRTV---EKVLSWIGN...ILH....LL..YLGFIALM...V..S-----------.M.M......G.NKD.......
C5QNE2_9STAP/3-110--KRTG---EKVLSWIGN...ILH....LL..YLGFIVLM...V..S-----------.M.M......G.NKD.......
C2LZ67_STAHO/18-125--KRTG---EHVLTWIGV...AIQ....AL...VAIMFLM...I..K-----------.P.F.....IG.N.........
Q4L9F8_STAHJ/19-126--KRTV---EHILTWLGV...VLQ....AL...AAIMFLV...L..K-----------.PLM......G.NSN.......
C4WCX0_STAWA/2-110--KRTI---ERILAWLGI...ITQ....LF...I.LLGLG...I..G-----------.T.MFG..GTS...........
Q4A0V3_STAS1/2-109--KRTI---ERVLTWIGI...VLQ....IL..GVVLMAVL...I..P-----------.M.M......G.NGE.......
C5QZN6_STAEP/3-109--QRKG---ELILSWIGN...GLH....LL...YVFLIGI...F..F-----------.I.M......T.QT........
D3QGJ5_STALH/3-111--KRTV---ETVLTWSGI...ILH....AV...YFFILLL...M..S-----------.L.I.....FT.N.........
D3QGJ6_STALH/3-111--KRTG---EKVLTWIGF...ILH....TL...YVIFLVL...I..Q-----------.M.M......V.SD........
Q4A0E9_STAS1/2-112--KRTA---EKILIWIGI...ILQ....FI...LIFLMAI...V..A-----------.P.F......F.N.........
C5NV51_9BACL/5-120--KRTV---EKVLAWIAN...IIL....IV...ITGFLAY...G..S-----------.F.F......K.I.........
C5NWK3_9BACL/5-118--SRKI---EKILAWIAN...VIM....II...VTGLMSLGAFS..G-----------.Q.L......E.T.........
H7FJC6_STASA/2-102--NRKP---ERIMAWIAN...GLS....IL...FLLLMVL..VF..S-----------.F.M......N.VPEFK....E
Q8ERL5_OCEIH/2-100--NRSV---ERILSTIAV...CVDAGFAIF...LGIFALI...I..N-----------.V.NL...REG.T.........
A7A3G5_BIFAD/15-115--ARKA---ERVLMTIAA...AYN....VI...MASITLF..MF..T-----------.S.WFK..GQA...........

PF00335

TET11_ARATH/4-262VHQG----VTDCESAIRIP.................LLTT...GLILFLVS...........................LL
TSN16_HUMAN/10-243SLTN----VLGLSSAY....................LLHV...GNLCLVMGCI.......................TVLL
Q16LT3_AEDAE/14-239DFEY----FIDSHFFSPAH................LMVAI...GIIMIFVS...........................IF
H3DJN8_TETNG/8-231NFDS----FIQDRYTLIPAA...............IIICI...SVVMFIFG...........................LV
Q9V3X2_DROME/9-261FMLS----MTQNYNHYHIAL..............YVFLAI...GILITLGA...........................FF
TSN5_HUMAN/14-261VLSN----ISSITDLGGFDPV.............WLFLVV...GGVMFILG...........................FA
Q6Z6K0_ORYSJ/3-259.SAQ----GEECARLARWP.................VAIL...GGLILLAA...........................LA
Q29D35_DROPS/9-259SLIA----LLKLVESERIEQFTQTQV...IEQLAYVLIVI...GAVMFFMS...........................FL
Q7Q1S3_ANOGA/9-239NFRD----ILDAKFFSIPT................FLVVI...GSFIFVIA...........................FF
TET15_ARATH/53-313.YMR----SYDCEDILGLPRVQT........LASVGLLAV.......FVVS...........................NA
Q292W4_DROPS/7-217NIDD----FAEALRTQQVPI...............TMIVL...GTVILLIS...........................WF
H3CCQ2_TETNG/10-245SFIV----VLSDSTAVKTAC..............YILIGV...GAFSMLLG...........................FL
Q9VMJ6_DROME/18-261MFRN----IARLHFIALDPA..............FVLIIL...GGVTFLLG...........................FM
TSN6_BOVIN/16-237NYFS----LLNEKATNVPF................VLIGT...GTVIILLG...........................TF
Q06AT4_PIG/10-257SLYP----LLEATDNDDIYGA............AWIGIFV...GICLFCLS...........................VL
Q16GP3_AEDAE/9-261SFIA----LLKMVESDQLEHFTQPAV...IEQLAYFLIAI...GAIMFFLS...........................FL
TET13_ARATH/15-272LHYR----TDECNRFVTTP.................GIFI...SFSLLAMS...........................LT
M9PDV2_DROME/8-255GYAT----LLPQHAGLSADT...............IFMGI...GGTGFVVS...........................FF
Q24FE3_TETTS/5-263YTTY----TNNLFSGI....................LIFGIVLGVFLILWT...........................LF
A2BIP5_DANRE/16-252KNRT----LEGVFLAPAVV.................LILL...GLVMFTVS...........................VI
Q4DD38_TRYCC/89-308.VAR----QNAAVRLCEPCG..............QIAMSALVFGIILCLFT...........................IL
TSN8_BOVIN/7-235GQEI----LAPGDADLNLFIA............VNILIFV...GAVIMILG...........................FL
TSN10_HUMAN/75-319....----..........AVKGSLGSDLGGPLPTDPMLGLALGGLVVSAAS...........................LA
Q176T5_AEDAE/20-244DYQH----FVEDKLMAPPV................VLIVV...GTFVFLVA...........................SL
TET5_ARATH/4-245..RS----KTTCEHFLQKP.................LLIL...GLAILILS...........................VA
A2EZ30_TRIVA/7-219QIKQ----IKIDEIKSSKK................VLIFVIVVVAIIAITC...........................II
A1Z8K7_DROME/8-233EFNH----FVEGRVLAPPI................VLIVT...GLIIFLIA...........................SL
Q16HX5_AEDAE/9-218DLQD----ISDEHSIVAPSI...............LFIVL...GSVVFVIA...........................FF
Q6Z8Q8_ORYSJ/5-259TRGD----GGECDRHLSSP.................AIAL...GAVLMAVS...........................LA
F1Q6P4_DANRE/9-244SLIA----VLQESSVILKVVS.............YILIGV...GSFSMLLG...........................FL
A0BP70_PARTE/7-282QYLD----YLDEFTNSKPSD..............GILIALYIFSSILILFG...........................IC
Q16J92_AEDAE/9-260FLIS----MTQNENNYFIGL..............YILLVV...GGLMLSVA...........................FL
CD81_MOUSE/9-229TTSL----LYLELGNKPAPNTFY........VGIYILIAV...GAVMMFVG...........................FL
Q16LT4_AEDAE/34-246SLTD----F...........................ILAV...GIIMLLIV...........................LF
H3DF34_TETNG/10-245SFIA----VLQESSDTVKVAS.............YILIGV...GSLSMALG...........................FF
H3CSH9_TETNG/9-237DYDH----FFEDVYTFIPAV...............TIIGV...GALLFIIG...........................LI
Q86D97_SCHMA/7-231AQDI----ILASGQQHAVQIM............LYALMGI...GGITLVIA...........................LF
A1Z6T8_DROME/7-220EEQR----MLGMDHGEDLAA..............VLCVLL...GTVIVVAS...........................IF
Q3UGA5_MOUSE/74-317....----..........TVKRSQGIGWGGPVPTDPMLMLVLGGLVVSVVS...........................LS
Q29IZ2_DROPS/18-232DWLR----ILEAQSFYIGVY...............VLIGV...SIIMMAVS...........................FL
A8X5P0_CAEBR/7-223FGTH----LGDFVRQIDGIDVKLINEIAEYQASLWILVAV...GALLFIVG...........................FF
Q16HS1_AEDAE/9-225AITN----LTHRDNLLTSQ.................SLLAMGLGVIIFAVS...........................FF
Q4S5B5_TETNG/8-230SFAT----LSPSFPSLSAAN...............LIITL...GSIVMVTG...........................FL
Q24C18_TETTS/14-278DLWS----KSSFDWNKAL..................VFLLVVGSILLFFTS...........................IA
G7NV03_MACFA/6-238SFLK----IFGPLSSSAMQFVN..........VGYFLIAA...GAVVFALG...........................FL
TSPA_DICDI/14-223NFKD----FTKASDAKSALSNLTT.......SIPAGVLVI...GILFVIFT...........................VV
TSN33_MOUSE/21-264AEAA----LACLAVDPAIL.................LIVV...GVLMFLLT...........................FC
A0CWV3_PARTE/4-272GLNY----ADLYFNTASWLKTL..........SEYGLLIL...GAVILITG...........................IA
TET6_ARATH/4-244..RS----STTCENFLQTP.................LLVI...GFIILIVS...........................LA
Q9W4X6_DROME/42-295RLEN----FYDVFLNISLV.................MILA...GTVIFLVS...........................FS
F6ZCC3_XENTR/20-287KRSE----LMV.SGNMHTVP..............NMLIAV...GVIACVIN...........................FF
CD63_MOUSE/9-231QAIT----HETTAGSLLPV................VIIAV...GAFLFLVA...........................FV
TSN8_HUMAN/7-234SQAI----FGSEDVGSSSYVA............VDILIAV...GAIIMILG...........................FL
Q7K2V7_DROME/7-219NFTA----FDGGVNTQTIPI...............CIIVI...GSVTFVVA...........................FF
H3D1H6_TETNG/11-249DYMT----LSANAYPNAPS................ILLAT...GAAVTAWG...........................FL
TSN14_HUMAN/14-261VLSD----LTKVTRMHGIDPV.............VLVLMV...GVVMFTLG...........................FA
TSPE_DICDI/16-219YYLV----KDLTI.......................PLGSFILSAYMVITT...........................IV
TSN32_HUMAN/9-223....----............................MVTLTYFGAHFAVIRRASLEKNPYQAVHQWAFSAGLSLVGLLTL
B4I8V1_DROSE/9-225VYYG----IVQNKLWAPAA................ILLCL...GPVTFILC...........................WM
Q16TV5_AEDAE/8-254GYAT----LLPDHAALSADC...............LFMTI...GVISFVIA...........................FF
Q7PTA7_ANOGA/9-220ELRE----ISDEYNIVAPSI...............LLIVF...GSVVFVIS...........................FF
TSPD_DICDI/11-223RFKE----LQEVGGVSESIKSISV.......SLPAGVLSI...GIFFMVLT...........................VA
F1R4A1_DANRE/13-252S..D----VVDTLMADPAL................LLIVV...GSLMFTIT...........................FL
Q9NB13_DROME/7-221RFDV----AGSGTDPNTIPI...............CVTVL...GGLIFVVS...........................FF
Q292V6_DROPS/9-211SIFG----SYTTA.......................LI.....GAAVFGVA...........................FL
Q6YWS4_ORYSJ/4-277.DHP----ASECQRLVRVP.................AVAL...GSAALLLS...........................LM
Q4D693_TRYCC/53-286ELNF----CHDCKTL.....................ILFLLVPGIFFVVMG...........................IV
TSPB_DICDI/14-223NFKD----FTKVSKASAALSNLTT.......GAPAGVLVI...GIFFVILT...........................VI
A0EF92_PARTE/7-263LAKE----DDETNKGQGI..................LVAFWIFSSSMILNG...........................II
TET9_ARATH/4-258.LKA----TTQCERFLDKP.................MIAL...GVFLMIIA...........................IA
Q5I0R1_XENTR/7-227VQQE----LNIDGGSLLSAV..............DLMIAV...GAIIMVLG...........................FF
Q7SXT2_DANRE/16-243FDLL----VNSEHGTNAPY................VLIGT...GAVIIIFG...........................LF
Q9XVI4_CAEEL/8-223NVLD----ILGDERLATPI................LLLVI...GSLCTLLG...........................FL
A2DRK6_TRIVA/7-225IIKQ----VTISEVKSSKT.................FLFSAAVIGVIALTC...........................II
Q22RT6_TETTS/8-279DYKD----FGESYNIYKASY..............TLLILV...GVFFAILG...........................LL
A2DY51_TRIVA/7-217GTTE----YYKLFKDSTALY...............PFFAILAVCAAVCIIG...........................VF
L9JBT3_TUPCH/21-370AEAA----LACLAVDPAIL.................LIVV...GVLMFLLT...........................FC
Q6Z5Z9_ORYSJ/5-263GGGG----VTECERFLRAP.................ALAL...GGAIVAVS...........................LA
Q6NYK2_DANRE/15-289RRGE----VMD.NTDIHCVP..............NTLMIV...GLASMGGN...........................YF
Q75IM5_ORYSJ/6-249.KGS----TATCSSMLQTP.................LLVI...GFVVLLVS...........................LA
H3DMZ9_TETNG/7-217TLGI----PMDSLPGVDL..................MIAI...GVIIMVLG...........................FL
CD37_RAT/10-270SFVS----FVGLSFVPLQTWS.............KVLSVS...GVLTMALA...........................LL
Q7JZW7_DROME/7-210EGSA----EHTEK.......................FVQLGMAGALI...............................LA
A8XFB8_CAEBR/15-256QYAE----LVSPSLYVDV.........................GRILVIIS...........................IL
Q7QJ21_ANOGA/9-222QYAP----IVKNQFWEPFA................VLIGL...GIISQALC...........................YL
TET2_ARATH/3-256.SKP----DNECVNLLRWP.................VVVL...GVLILVVS...........................AT
Q7JZW3_DROME/8-216ENAV----SIGKNVAGGL..................IIAL...GVVILIIA...........................IF
Q19983_CAEEL/7-277ASDF----FALHSTHPGAFRYV...........GWFLVGA...GAIIILVG...........................YF
B3DL95_XENTR/8-226KFAT----LSVSFPSLSAAS...............LFMVT...GSIIMVVG...........................FI
Q9FVY6_ORYSJ/5-257..TH----NDECRRSLTIP.................VMGL...GGVIFLIS...........................LV
ROM1_BOVIN/16-292HLGT----FLAPSCPFSALP..............QVALAA...SAVALGTG...........................LV
Q5ZII8_CHICK/15-247DYIS----LLSSSTYSATAY...............ILVVA...GVVVMVTG...........................IL
Q22495_CAEEL/37-297TFVN----MLSKASKLYLDPT.............WPLLIV...GFLTFIIG...........................FS
Q6DHQ4_DANRE/8-230NFAT----LSSSLPSLSAAN...............LLIAA...GTVVMVIG...........................CL
Q7K527_DROME/7-208DAYA----IG..........................ILIL...GGTILVIS...........................LF
TSN15_MOUSE/19-259KYKT----LESAFLAPAII.................LILL...GVVMFIVS...........................FI
Q67WQ6_ORYSJ/4-259NRAA----TTDCERFMERP.................VVAL...GVLLLALS...........................LA
G4LW70_SCHMA/10-212QYGD----NLHKVWQAAPI................AIIVV...GVIILIVS...........................FL
Q16HS3_AEDAE/6-221DLIH----LTGRDTVLASAT..............KLTVVL...GWAIAATG...........................FY
Q29JV1_DROPS/14-246DFSV----FIDGHFASPPA................LLIAI...GFILIAVA...........................AL
Q9VID1_DROME/8-228HYSN----FVSDHVWTAPI................ILMIV...GAAVAVIC...........................FL
H9KCQ4_APIME/8-222GVSK----QIETGLAFPSI................TLIVL...GSIIFVIS...........................FF
Q7JWV7_DROME/7-218DFSG----VGETFTANSVAI...............IILVL...GCVVFLVA...........................FM
O44582_CAEEL/29-290REVK----LVDIILNP....................AILISIFGFSICVVS...........................FF
C4Q3U8_SCHMA/12-223FGIL----DAHIPAVHAGAN...............LLIAV...GFFIMIMG...........................FL
Q17441_CAEEL/23-259DLIP----LIQSHFYVKCI.................YLAV...GCGVFNV............................II
CD82_HUMAN/8-256SFIS----VLQTSSSSLRMGA.............YVFIGV...GAVTMLMG...........................FL
TSN12_HUMAN/9-248NVLT----LTAETRVEEAVILTYF......PVVHPVMIAV...CCFLIIVG...........................ML
Q4D6X7_TRYCC/23-265KTLK----NLCQSCHAI...................FIAYISVFSGLLLFS...........................LL
Q7T376_DANRE/6-213SRLS----LLPSLQAMSIAN...............TLFIT...GIIITCVS...........................FL
TSN11_BOVIN/15-248GYLG----VLASSTFAASAY...............ILIFA...GALVMVTG...........................FL
Q6P2T9_DANRE/9-230NTAI----LQGASGSPMV..................LIVV...GVIIFFIS...........................FF
A8WRV5_CAEBR/9-230SLTT----VASTVKVDLSQVLNQVNIQ.QINTFLYVALVI...GGALLILG...........................FF
Q24C21_TETTS/14-285SVWS----NSSFDWNKTL..................IALLIAGSVFLLLAS...........................IA
Q245V1_TETTS/9-274KVTS----DSANFIAAS...................FGIMLGLGFILLLVG...........................AL
Q7KJ73_DROME/8-218VVEV----NGQVGFPIQALMP.............IILISL...GSIVVFIS...........................FL
M4EKP0_BRARP/8-252.IEG----PSQCQRFIQNP.................LIVT...ATLLFFIS...........................SL
Q1HRC5_AEDAE/13-234FINE----LLGTNLFSGAVY...............VLIAT...SALVCLLS...........................FF
A1Z6U7_DROME/7-216NTPE----HTY.........................FVKSLVLGGSICMIV...........................MF
H2VAF3_TAKRU/20-284KRSE----LMD.NNESHFLP..............NLLILM...GLIACGMN...........................VF
Q16LT5_AEDAE/17-240DFTA----FVDEQFYSPAC................MFVVV...GVITVAIA...........................TF
Q29JV0_DROPS/10-238GYEL----FLAGKFFSIPT................FLIVI...GAFIIVIT...........................FF
A0BI34_PARTE/7-267SFDD----AIKDLGITDINTS.............AIIVPFWIFAAVVIFFA...........................IS
Q7K010_DROME/6-211LNEI----GQLTAYG.....................YVGL...GAAALLVV...........................LW

PF04103

FCERB_HUMAN/60-204GDIF----SSFKAGYPFWG------------------------AIFFSISG---------------------------ML
FCERB_MOUSE/52-195EEVL----LLYKLGYPFWG------------------------AVLFVLSG---------------------------FL
T176B_HUMAN/66-229....----VLSASGCAFWA------------------------GSVVIAAG---------------------------AG
A6H741_BOVIN/62-223....----QLRASGCALWA------------------------GFVAIAAG---------------------------VG
T176B_MOUSE/60-224....----ELCAFGCAFWS------------------------GSVAILAG---------------------------VG
T176B_RAT/60-224....----ELCASGCAFWS------------------------GSVAILAG---------------------------VG
T176A_RAT/63-223....----AMNTQGAPFWT------------------------GIVAMLAG---------------------------AV
T176A_HUMAN/56-214....----LLVTSGAAIWT------------------------GAVAVLAG---------------------------AA
T176A_BOVIN/63-220....----TLRNSGAPIWT------------------------GAVAVLAG---------------------------AV
Q4TAI3_TETNG/57-208...W----PIRESYFPFWI------------------------GGMYILIG---------------------------AM
A7SQ32_NEMVE/7-164....----FYGVFGMGIWL------------------------GAWMLITG---------------------------VA
Q95PZ5_CAEEL/94-253....----.YCPYYSAIWT------------------------SAIYIINA---------------------------IV
Q9GYM6_CAEEL/45-206....----TIRLHGLEEIC------------------------SFYFVLVG---------------------------LV
Q1LVQ8_DANRE/42-197....----.LLARETPHWA------------------------GIIMCVVS---------------------------LL
H3D3M7_TETNG/37-190....----.LLARETPHWA------------------------GIILCLVS---------------------------VL
Q3TRE0_MOUSE/29-182....----.LLVRDTPFWA------------------------GIIVCVVA---------------------------YL
A7S4D6_NEMVE/20-179....----DRIRNACPYWA------------------------GFTVFFSG---------------------------GV
Q0V9M1_XENTR/36-200....----ARVRHSCPFWA------------------------GFSVLLSG---------------------------LI
F6PJ14_XENTR/5-167....----PQIRSSCPFWA------------------------GSSVILSG---------------------------IV
F189B_MOUSE/36-196....----ESIKRSCPSWA------------------------GFSLAFSG---------------------------LV
Q5BLA7_DANRE/16-153...T----TLSETRAPLWA------------------------GLIMAAPG---------------------------VL
F7AIP4_XENTR/16-154...S----TLGRTRAPLWA------------------------GLIMTIPG---------------------------VL
Q08BU9_DANRE/43-180...M----TSADVFSPFWL------------------------GILFCVCG---------------------------VL
F1RAY4_DANRE/49-184....----.MTDQFSPFWL------------------------GVLFCICG---------------------------LV
F7ESV6_XENTR/53-198..YH----VISGSGVPFWT------------------------GVMYMISG---------------------------AL
H3C9F3_TETNG/67-212....----PLLVLHAALGL------------------------AVAFVVSG---------------------------SL
MS4A3_MOUSE/27-172HFFF----FTFYTGYPLWG------------------------AVFFISSG---------------------------SL
MS4A3_HUMAN/50-196HFFF----FTFYTGYPIWG------------------------AVFFCSSG---------------------------TL
M4A4A_HUMAN/65-207.SNP----ISVYIGYTIWG------------------------SVMFIISG---------------------------SL
M4A6C_MOUSE/47-207SVFS----VLLKSGYPFIG------------------------ALFFIASG---------------------------IL
M4A6B_MOUSE/47-204SVFS----VLLKSGYPFIG------------------------ALFFIVSG---------------------------IL
M4A6D_MOUSE/47-207SVFS----ILLESGYPFVG------------------------ALFFAISG---------------------------IL
MS4A7_HUMAN/47-207PAIS----TTLMSGYPFLG------------------------ALCFGITG---------------------------SL
F6RP33_BOVIN/48-208PAIS----SILMTGYPFLG------------------------ALCFAITG---------------------------TV
Q99N04_MOUSE/47-204.EVS----TTLISGYLFIG------------------------SLCFAIAG---------------------------IL
MS4A5_HUMAN/49-189.RFP----FIFLSGYPFWG------------------------SVLFINSG---------------------------AF
Q810P8_MOUSE/49-189.RFP----FIFISGYPFWG------------------------SVLFINSG---------------------------AF
Q2KII2_BOVIN/49-189.RFP----FIFISGYPFWS------------------------SILFVNSG---------------------------AF
Q3LRP2_CALJA/51-216..AP----ICVTVWYPLWG------------------------GIMYIISG---------------------------SL
CD20_MOUSE/44-210..AP----ICLSVWYPLWG------------------------GIMYIISG---------------------------SL
CD20_CANFA/51-216..AP----ICITMWYPLWG------------------------GIMFIISG---------------------------SL
W5PU80_SHEEP/51-216..MP----ICVTLWYPLWG------------------------GIVHIISG---------------------------SL
M3VZQ9_FELCA/52-215..AP----ICMTVWYPLWG------------------------GIMYIISG---------------------------SL

PF13273

D7UXS6_LISGR/3-100...S....INTDALTSDDV.....................---.IGLTVGG---------------------------GI
C2RQC7_BACCE/10-90...E....L...............................---........---------------------------..
C3AKH5_BACMY/2-83IDYK....L...............................---........---------------------------..
Q2B2X7_9BACI/2-86DDQQAAGII...............................---........---------------------------..
A0A031KR27_ENTFC/3-104...S....IDSTTLNTTELTS.................KD---IDMLVNLS---------------------------GN
C7DIS7_MICA2/29-132...S....LPTNAAVSGAPIIN...............ATE---QAQLQASS---------------------------GA
D7DCC0_STAHD/4-91...T....IFIGF...........................---......GG---------------------------PL
A0B9F9_METTP/2-84GAET....V...............................---........---------------------------..
Q12UE5_METBU/2-98GTSE....VFGISD..........................---......PF---------------------------VV
B9DJA4_STACT/148-230DGGS....I...............................---........---------------------------..
C4WAZ9_STAWA/11-93DSGQ....V...............................---........---------------------------..
Q4L9M4_STAHJ/13-95.GSELVGLM...............................---........---------------------------..
A5UKZ4_METS3/8-83..GA....T...............................---........---------------------------..
A5N2M2_CLOK5/4-86RAVT....V...............................---........---------------------------..
F0K6E7_CLOAE/4-86GSTT....V...............................---........---------------------------..
A9VVN7_BACWK/2-84GANT....I...............................---........---------------------------..
B3ZH23_BACCE/2-84GADS....I...............................---........---------------------------..
C3BEA6_BACMY/2-84GANQ....L...............................---........---------------------------..
Q4V1S6_BACCZ/2-84GADQ....I...............................---........---------------------------..
D4FV71_BACNB/2-84GTSD....I...............................---........---------------------------..
C2VWU6_BACCE/24-113PTNT....T...............................---........---------------------------..
C2U6N9_BACCE/2-85...E....MGELE...........................---......GA---------------------------EK
A5UL06_METS3/42-117...E....I...............................---........---------------------------..
O26620_METTH/8-82...E....L...............................---........---------------------------..
C8JWL3_LISMN/13-93...D....F...............................---........---------------------------..
D7V0U0_LISGR/3-121SNAE....SSDFAARYESALRDANVSPS....DAPDVHTV---ITGLHTFG---------------------------TW
A0A024I3A1_LISMN/3-121.LTT....FYNNYYKTMTEWEIPKK..........EVPDP---DRVLDFVQ---------------------------TL
D3KN98_LISMN/3-121GLTT....FYNNYYKTMTEWEIP..............KKE---IPDPDRVL---------------------------DF
E3YXI7_LISIO/3-121.GLT....TYYNNYYQTVTEWEI.............PKDE---IPDPDRIF---------------------------DF
D3ULL7_LISSS/3-121..EG....LATYYNNYYQTLTEMEIP.......KNDIPDP---DRVFDFVH---------------------------ML
A8FJ46_BACP2/3-107...S....FYDQINEVLQEEGET..............LPI---ETLEASVN---------------------------SF
B4AK11_BACPU/3-107...E....INEVLQEEGETLP..................I---ETLQASVN---------------------------AF
C2H7S4_ENTFC/2-107..SE....FKKSYQSLAVDHPA................LS---LENTFELL---------------------------QD
C9ATK3_ENTFC/2-107..SE....FKKSYQSLAVDHPTL..............SLE---NTFELLQD---------------------------MT
E6TU87_BACCJ/2-115.MGE....LSAELQADDELSAAEV...........DAVLG---FLDGGFLS---------------------------SS
B9CUN6_STACP/3-110FKHE....MIHNTQDSNQGVSS...............DQL---NQSYGMLS---------------------------SM
C5QNE2_9STAP/3-110FKDE....MINSSQSSNPNVSS...............DQL---NQYYGMLS---------------------------SM
C2LZ67_STAHO/18-125..AD....FKEQIINETQKQGNEV...........SITEI---NNGMDALG---------------------------GL
Q4L9F8_STAHJ/19-126FKDQ....MISESQKQGNSVST...............SEL---NQGIDVLG---------------------------SF
C4WCX0_STAWA/2-110...E....VQKEIKRQAKEQAASNP..........AVDSS---SHMSELLP---------------------------SI
Q4A0V3_STAS1/2-109VKEA....FISQMMQEDSSFTY...............EDG---NTIFSTFS---------------------------GL
C5QZN6_STAEP/3-109..SD....FKNGMIQGFIEENPGE............YDLA---YQTYNIML---------------------------GL
D3QGJ5_STALH/3-111..DD....FKKFMIMKEIQRPDENV..........TLSEA---VMSVNVLS---------------------------TL
D3QGJ6_STALH/3-111..SD....FKEQLANELQKNPDSNV..........SRDQT---IEAVNSVA---------------------------TN
Q4A0E9_STAS1/2-112...D....VSVKNELIEVINQSNIYNQ......NASQMDP---ANIVDLVS---------------------------NL
C5NV51_9BACL/5-120...S....LLKDNQEFLNLFKKELAKNPNGANLNGVNLSA---EQLLDYTI---------------------------QG
C5NWK3_9BACL/5-118...A....LRQPELEQMLHNLLQDPAM.....KSLMASTR---MDIVTLLA---------------------------TG
H7FJC6_STASA/2-102AFHQ....MNQQQGLEM.......................---..SMETFK---------------------------TS
Q8ERL5_OCEIH/2-100...S....VIPHEDLPM.......................---..IFSIFL---------------------------HL
A7A3G5_BIFAD/15-115........YDLLEHNGLLK.....................---.TDYSAVD---------------------------NA

PF00335

TET11_ARATH/4-262G...VIG.SCFKE----N....LAM-VSYL...IIL..FGGIVA---L................M------IFSIFLFFV
TSN16_HUMAN/10-243GCAGWYG.ATKES----R....GTL-LFCI...LSM..VIVLIM---E................V------TAATVVLLF
Q16LT3_AEDAE/14-239G...CFG.AIKES----T....AMI-NIYG...VLL..AIVFIL---E................V------AAAISAFAL
H3DJN8_TETNG/8-231G...CCA.TIRES----K....VGL-GFFF...LII..MLIFAA---E................V------AALVFGFIY
Q9V3X2_DROME/9-261G...CCG.VCRES----Q....CLL-VSFF...CVI..LIVMVA---Q................I------AAGAWAFHN
TSN5_HUMAN/14-261G...CIG.ALREN----T....FLL-KFFS...VFL..GIIFFL---E................L------TAGVLAFVF
Q6Z6K0_ORYSJ/3-259G...FVG.AYWNR----R....RLL-AFYL...FAM..ASLIAL---L................I------ALLVFAFAV
Q29D35_DROPS/9-259G...YLG.AMRES----R....CLL-STYA...TFL..ILLLVA---G................I------VAGGLAAFY
Q7Q1S3_ANOGA/9-239G...CCG.AYKEN----Y....CMT-LTFS...VLL..ILIFIL---E................L------AAGISGYVL
TET15_ARATH/53-313A.......LFLRR----KFPMPALV-VMVV...VLL..LMLFIG---L.................------.........
Q292W4_DROPS/7-217G...CCG.AIRES----Y....CMS-MTYS...ILL..FVLMIG---Q................L------ALVIYMWLQ
H3CCQ2_TETNG/10-245G...CLG.AIYEV----R....CLL-GLYF...ACL..LLILLA---Q................I------TAGTLIYFQ
Q9VMJ6_DROME/18-261G...SVG.ALREN----T....CLL-GAYA...IFL..SVLLIA---E................I------GFCAVAFVL
TSN6_BOVIN/16-237G...CFA.TCRAS----A....WML-KLYA...MFL..TLIFLV---E................L------VAAIIGFVF
Q06AT4_PIG/10-257G...IVG.IMKSN----R....KIL-LVYF...ILM..FIVYGF---E................V------ASCITAATQ
Q16GP3_AEDAE/9-261G...YCG.AIRES----Q....CLL-TTYG...LFL..IVILIL---E................V------TACGLAAAY
TET13_ARATH/15-272G...FYA.AYFKS----D....CLF-RIHF...FIF..FLWMFV---V................V------SKAIFVIFL
M9PDV2_DROME/8-255G...CCG.AWVQS----R....CLL-VLYF...MLI..VMLFMS---E................F------LVGSIAFLF
Q24FE3_TETTS/5-263G...VLA.AQKNN----T....MIQ-AAYN...VGI..IMLFLL---S................I------AILAISCIV
A2BIP5_DANRE/16-252G...MVG.SLRDN----K....TLL-HMFL...CVL..CVLLAL---Q................A------IALIIALIF
Q4DD38_TRYCC/89-308G...FMW.IRQRQ----M....MFL-LVYV...GYL..VVLFIA---L................F------ALIIAAAVY
TSN8_BOVIN/7-235G...CCG.AMKEN----Q....FMM-ILFF...VGL..LMILLL---Q................V------AAGIVATTR
TSN10_HUMAN/75-319G...CLG.ALCEN----T....CLL-RGFS...GGI..LAFLVL---E................A------VAGALVVAL
Q176T5_AEDAE/20-244G...CYG.AIKES----P....KLL-NAFA...VFL..LIVLLI---E................V------AVAIAAVAF
TET5_ARATH/4-245G...LVG.ACCDV----A....WVL-WVYL...FFM..VFIIVA---L................M------GLTLFGFIV
A2EZ30_TRIVA/7-219G...FFL.LCCDS----K....CFR-MTYA...ILY..FIIVIA---E................I------VLVYFTV..
A1Z8K7_DROME/8-233G...CFG.AIKES----P....TLL-ITFA...VLL..AVIFIV---E................L------AVGIAASVF
Q16HX5_AEDAE/9-218G...CCG.AIRES----Y....CMT-STYG...FFL..MVLIIA---Q................I------VVAALVFIY
Q6Z8Q8_ORYSJ/5-259G...LVG.ACCRV----T....WLL-WVYL...LAM..FALIVA---L................L------GFTAFAFAV
F1Q6P4_DANRE/9-244G...CLG.AIYEI----R....CLL-GLYF...TCL..LLILLA---Q................V------AVSILIYFQ
A0BP70_PARTE/7-282G...IVG.GWKRI----G....TLL-FCFN...IGN..FILAIA---F................L------GLAILGFSL
Q16J92_AEDAE/9-260G...CCG.AFKES----Q....CML-FSFF...SCL..LIVLVA---E................I------AAGAWAYHN
CD81_MOUSE/9-229G...CYG.AIQES----Q....CLL-GTFF...TCL..VILFAC---E................V------AAGIWGFVN
Q16LT4_AEDAE/34-246G...SVG.IVIEN----M....TII-MIYI...VLF..SIVVVL---E................I------IVAISAYVM
H3DF34_TETNG/10-245G...CIG.AIYEV----R....CLL-GLYF...TFL..LLILIA---Q................V------TAGVLIYFQ
H3CSH9_TETNG/9-237G...CCA.TVRES----C....CGL-TTFV...VIL..LLVFMT---E................V------AVVVLGYVY
Q86D97_SCHMA/7-231G...CCG.AYHES----Q....CLL-GTYF...TIL..IVIFAT---Q................V------TGATLGYLY
A1Z6T8_DROME/7-220G...SVA.VAKDS----R....VLL-ICYA...VLL..VFLLIV---Q................I------VLVSISYAA
Q3UGA5_MOUSE/74-317G...CLG.AFCEN----S....CLL-HWYC...GAV..LFCLAL---E................A------LAGVLMVTL
Q29IZ2_DROPS/18-232G...CLS.ALMEN----T....LAL-FVFI...GTQ..LFGFVA---L................V------AGSAVTMQY
A8X5P0_CAEBR/7-223G...CCG.AGCES----P....VLL-GLFI...FII..VILTAV---E................L------GATIFAMTN
Q16HS1_AEDAE/9-225G...FCG.AAKHS----Y....CMT-VTYV...LML..MTLIVV---Q................I------ALAVLLFA.
Q4S5B5_TETNG/8-230G...CLG.AIKEN----K....CLL-LSFF...IVL..LIILLA---E................L------ILLILFFVY
Q24C18_TETTS/14-278G...IIG.GRKKN----K....CCI-FFFQIFSIAL..SFSFLI---.................V------AFVFLGMTD
G7NV03_MACFA/6-238G...CYG.AQTES----K....CAL-MTFF...FIL..LLIFIA---E................V------AAAVVALVY
TSPA_DICDI/14-223G...CFV.AYKEK----L....VGL-VIYC...AVM..LILLVI---L................I------GVGGKAITL
TSN33_MOUSE/21-264G...CIG.SLREN----I....CLL-QTFS...LCL..TIVFLL---Q................L------AAGILGFVF
A0CWV3_PARTE/4-272G...AKG.SSQKK----TSCRGCLL-LTYQ...IGA..ILFFVL---C................T------GLAIGTLIY
TET6_ARATH/4-244G...FIG.ACFNV----A....WAL-WVYL...VVM..IFLIAT---L................M------GLTLFGLVV
Q9W4X6_DROME/42-295G...CVG.ALREN----T....FLL-KFYS...MCL..LLFFLL---E................M------AIAIVCFVC
F6ZCC3_XENTR/20-287GGKICYD.CSDAN----K.......-..FVRWKLFM..LPYIIC---T................F------FFTFCVFAG
CD63_MOUSE/9-231G...CCG.ACKEN----Y....CLM-ITFA...IFL..SLIMLV---E................V------AVAIAGYVF
TSN8_HUMAN/7-234G...CCG.AIKES----R....CML-LLFF...IGL..LLILLL---Q................V------ATGILGAVF
Q7K2V7_DROME/7-219G...CCG.TIREN----A....CCT-TIYA...ICM..LILFGL---Q................L------ALSIWIFAA
H3D1H6_TETNG/11-249A...CLG.VAANL----P....RLL-RAYG...FFQ..FVTLIA---A................L------AAGLSGLFY
TSN14_HUMAN/14-261G...CVG.ALREN----I....CLL-NFFC...GTI..VLIFFL---E................L------AVAVLAFLF
TSPE_DICDI/16-219G...GIA.IWKKK----L....GLH-LTFM...VFL..VVLIVC---L................V------GVSAKMIVD
TSN32_HUMAN/9-223GAVLSAAATVREA----Q....GLM-AGGF...LCF..SLAFCA---QVQVVFWRLHSPTQVEDA------MLDTYDLVY
B4I8V1_DROSE/9-225G...CQA.TNQRK----R....CLL-GMFA...ALL..VACICV---Q................F------IICGWSLAM
Q16TV5_AEDAE/8-254G...CCG.SWFQS----R....CFL-IIYF...TLV..VLLFLS---E................F------LLGSLAFVF
Q7PTA7_ANOGA/9-220G...CCG.AIRES----Y....CMT-STYS...FFL..ILLVIA---Q................I------VIAVLVFVF
TSPD_DICDI/11-223G...CIV.AYKEK----M....VGL-VFYT...ILM..LVLLVV---L................I------GIGGEALTY
F1R4A1_DANRE/13-252G...CFG.ALRNA----S....LLL-NMFV...AIL..LVVLLL---Q................V------TAAVLGLLF
Q9NB13_DROME/7-221G...CYG.IFRQS----V....CMT-GAYT...SMV..FVLFIL---Q................L------VLTCWVFVN
Q292V6_DROPS/9-211G...VYV.ALKES----YK..YSIL-FMFV...SGL..VIVTMV---A................Y------FFTFAAMKG
Q6YWS4_ORYSJ/4-277A...IAGVTCCRG----A....ALL-WAYA...SAM..FLLIVG---M................F------FVTAFVFVV
Q4D693_TRYCC/53-286G...GVS.AWRET----K....ICS-ALFS...LLL..VIAAFV---V................L------GTGVTVVIA
TSPB_DICDI/14-223G...CFV.AGKEK----L....VGL-VIYT...MLM..LIILVA---L................I------GVGGKALTL
A0EF92_PARTE/7-263G...IFG.GKKKS----A....CLL-LIFN...LVN..IALFLG---F................V------GLTVAGYVR
TET9_ARATH/4-258G...VVG.SCCRV----T....WLL-WSYL...FVM..FFLILI---V................L------CFTIFAFVV
Q5I0R1_XENTR/7-227G...CCG.AIRES----R....CLL-LLFF...IGL..FLILAL---Q................I------TAGVLGAVY
Q7SXT2_DANRE/16-243G...CFA.TCRGS----P....WML-KLYA...MFL..VLVFLA---E................L------VAGISGFIF
Q9XVI4_CAEEL/8-223G...CCG.AIREN----Y....CLT-VSFA...VLL..ALLITC---E................I------AAVIIGYAL
A2DRK6_TRIVA/7-225G...FFMLCCYKN----Q....CFR-TTYA...VLY..FIIVVA---E................C------ALLYFIY..
Q22RT6_TETTS/8-279G...ICA.QRKKR----N....CTM-TIYN...IGV..IVLMIF---I................G------CSLIVMIYT
A2DY51_TRIVA/7-217L.......ICCEN----R....CWA-IFYV...VCL..FLVLIV---E................I------IILICMFLL
L9JBT3_TUPCH/21-370G...CIG.SLREN----I....CLL-QTFS...LCL..TVVFLL---Q................L------AAGVLGFVF
Q6Z5Z9_ORYSJ/5-263G...LAG.ACCRA----T....PLL-WAYL...LLT..GLLILA---A................A------CFGVFALVV
Q6NYK2_DANRE/15-289ASRICQD.ALDAG----R.......-..FPRWKTYM..KPFFGC---S................I------FFTTLMLIS
Q75IM5_ORYSJ/6-249G...FVG.ACFHV----A....WAL-WLYL...LAM..MLLIAF---L................L------GLTAFGFAV
H3DMZ9_TETNG/7-217G...CCG.AIRES----R....CLL-LLFF...IGL..LLIFIL---L................L------AAGIVGAVG
CD37_RAT/10-270G...CVG.ALKEL----R....CLL-GLYF...GML..LLLFAT---Q................I------TLGILISTQ
Q7JZW7_DROME/7-210G...LVG......----.....CLG-AIFGSIKVMVVNLILLLA---L................I------ASHIWKVSH
A8XFB8_CAEBR/15-256SIANYLI......----.....CFY-AIFKEMRCIV..TSCAVA---S................I------VIAVMLIIG
Q7QJ21_ANOGA/9-222G...WTS.TSRKQ----R....CYL-GLFC...AFL..VLFIVI---L................F------LVSGWSVAT
TET2_ARATH/3-256G...FIG.AYKYK----E....TLL-AVYL...CCM..AILIGL---L................L------VVLIFAFVV
Q7JZW3_DROME/8-216G...CLA.AIHEA----P....VRL-LIYV...GAV..VLLILA---Q...............LI------FLGMSSHGT
Q19983_CAEEL/7-277G...CIG.AWKMN----Q....CAL-AFFC...CIL..ILAFFL---E................L------AAAVTLF..
B3DL95_XENTR/8-226G...CLG.AVTEH----R....CLL-LTFF...VIL..LIIFLL---E................M------ISMALFLTY
Q9FVY6_ORYSJ/5-257G...FLG.AWKKI----A....CLL-WTYL...VML..FVVLVA---I................M------VFTVLAFII
ROM1_BOVIN/16-292GSGASRA.SLDAE----Q.......-..YPPWRGVL..GPLLVA---G................T------AGGGGLLVL
Q5ZII8_CHICK/15-247G...CCA.TFKER----R....NLL-RVYF...ILL..LCIFLL---E................I------IAGILAYIY
Q22495_CAEEL/37-297G...CVG.SLREN----T....SFL-TFYS...TLL..GLLLIA---E................F------SAGVFAYAC
Q6DHQ4_DANRE/8-230G...CVG.AVKEN----R....PLL-LSFF...ILL..LLIFLL---E................I------LFIILFFSY
Q7K527_DROME/7-208G...CCG.AVRES----P....RML-WTYA...SLL..LILLLL---I................V------AFIIL....
TSN15_MOUSE/19-259G...VLA.SLRDN----L....CLL-QSFM...YIL..GICLVM---E................L------IGGIVALIF
Q67WQ6_ORYSJ/4-259G...LAG.ALCGA----S....CLL-WLYL...LAL..FLLILA---L................F------VFTVFAFVV
G4LW70_SCHMA/10-212G...CCG.AIKEN----V....CML-YMYA...FFL..VVLLIA---E................L------AAAIVAVVY
Q16HS3_AEDAE/6-221G...IHG.VIRRS----Y....PLM-VLYV...FLL..GVLITF---Q................L------SMAALLIYR
Q29JV1_DROPS/14-246G...AYG.AVKES----V....MVI-NLYG...VCL..FLVFIL---E................V------SAAIAAFVM
Q9VID1_DROME/8-228G...CCG.ALKES----S....CMI-LSFA...LLA..VVIFLF---E................I------GLGLAGYVK
H9KCQ4_APIME/8-222G...CCG.AIRES----H....CMT-ITFA...SFL..LFILLV---Q................I------AVAVYAFIV
Q7JWV7_DROME/7-218G...CCG.AIREN----S....CAL-TSYS...VVM..LVLLVS---Q................L------ALIIYVWVD
O44582_CAEEL/29-290G...FMG.ALRDN----I....FLL-KCFAA.CVFL..SYILVV---A................V------TLVFFTLFY
C4Q3U8_SCHMA/12-223G...CCG.AIRES----Q....CLL-FLFF...AFV..FFCFTL---L................M------AAGLWAVAW
Q17441_CAEEL/23-259G...FLVHSAVSN----R....CAL-VFYL...LML..IFSMIM---E................G------CLIYFTFSY
CD82_HUMAN/8-256G...CIG.AVNEV----R....CLL-GLYF...AFL..LLILIA---Q................V------TAGALFYFN
TSN12_HUMAN/9-248G...YCG.TVKRN----L....LLL-AWYF...GSL..LVIFCV---E................L------ACGVWTY..
Q4D6X7_TRYCC/23-265G...FFA.LCTRN----T....LLR-VLYF...IYL..FVVFLG---A................F------SSSIAYVLV
Q7T376_DANRE/6-213G...FLG.ALKEN----R....CLL-ISFF...ILL..FILMLA---E................L------AAACLMLMY
TSN11_BOVIN/15-248G...FGA.VIRED----R....GCL-SAYF...CLL..LAIFLV---E................L------VAGVLAHVY
Q6P2T9_DANRE/9-230G...CCG.AWKEN----Q....CMV-VTFA...IIL..SLIVIT---E................I------GAGIAGYIF
A8WRV5_CAEBR/9-230G...CCG.SCCES----V....CAI-SIYF...ILV..LILFVI---E................V------VAIVLYFVK
Q24C21_TETTS/14-285G...ICG.GRKQN----K....CCI-FIFQILSIIL..ALFFLV---.................A------GFIFLGLTD
Q245V1_TETTS/9-274G...LLA.WKKRN----N....CLL-GIYI...VCL..CIV...---.................V------ACSAIVFGV
Q7KJ73_DROME/8-218G...CCG.AIRES----V....CMT-MSYA...TFL..LILLIL---Q................L------TFVVLLFTH
M4EKP0_BRARP/8-252G...LIA.ALYDN----Y....III-TVYL...FFL..FLSILL---T................L------IFSIFIFLV
Q1HRC5_AEDAE/13-234G...CIG.AAKEY----K....CML-LTYF...ILI..FLIFVT---M................L------IGGILGYVF
A1Z6U7_DROME/7-216G...CYG.MVANL----L....CVN-LIFT...MFI..LIALAA---EYLQLHHYHSPSLRSPGG------AWQQLELAW
H2VAF3_TAKRU/20-284GGKVCYD.SLDPA----K.......-..FVKWKPML..KNFLVF---C................V------VFNSLLFVT
Q16LT5_AEDAE/17-240G...FIG.TIRES----S....LLI-NIYC...GLL..SVVFLL---E................V------TATLVGVHH
Q29JV0_DROPS/10-238G...CWG.ALKEN----Y....CLV-LSFS...IML..AIIFIL---E................L------SAGISGYVL
A0BI34_PARTE/7-267G...LCG.AKHRS----K....CLL-AIFN...LGN..ICLFLA---F................L------SLSIVAYVI
Q7K010_DROME/6-211G...YLS.AWREN----V....CCT-VTFI...IFL..CLVIIA---Q................F------AVVYLLITQ

PF04103

FCERB_HUMAN/60-204S---.IISERRNA....T----YLV.RGSL---GAN--TASSIA---G----------------G------TGITILIIN
FCERB_MOUSE/52-195S---.IISERKNT....L----YLV.RGSL---GAN--IVSSIA---A----------------G------TGIAMLILN
T176B_HUMAN/66-229A---.IVHEKHPG....K----LAG.YISS---LLT--LAGFAT---A----------------M------AAVVLCVNS
A6H741_BOVIN/62-223A---.IVHEKRRG....K----LSG.CVSG---LLT--LAGIAT---A----------------V------AAVVFCVNS
T176B_MOUSE/60-224T---.IVHEKRQG....K----LSG.QVSC---LLL--LACIAT---A----------------A------AATVLGVNS
T176B_RAT/60-224I---.VIHEMGQG....K----LSG.HISR---LLL--LACSAT---A----------------A------AATVMGVKS
T176A_RAT/63-223A---.FLQKKRGG....T----CWA.LMRI---LLV--LASFCT---A----------------V------AAIVIGSRE
T176A_HUMAN/56-214A---.FIYEKRGG....T----YWA.LLRT---LLT--LAAFST---A----------------I------AALKLWNED
T176A_BOVIN/63-220A---.FIYEKRGG....I----YWA.LLRT---LLA--LAAFST---A----------------T------AATIIGAGR
Q4TAI3_TETNG/57-208C---.VWSERRPS....P----CLV.ILNV---HLN--IVGLAF---A----------------V------AAIVLYSQS
A7SQ32_NEMVE/7-164G---LLTASVPTN....M----CRL.GSFI---GCS--LVGLVT---L----------------F------VCAIIIGLG
Q95PZ5_CAEEL/94-253G---.SAAAKMGA....L----NLY.MAHL---TLS--LVSVMM---C----------------L------ISGGLSARN
Q9GYM6_CAEEL/45-206G---.ICGSASYR....R----GLV.ITYL---VMC--IHSIFI---F----------------V------PAIITVSSF
Q1LVQ8_DANRE/42-197G---.FVLFCITRVPDER----..A.LLQF---VIK--LLYFFL---C----------------T------MGLVMSVVV
H3D3M7_TETNG/37-190G---.FILYCITYL..PD----ERT.SAQF---ICE--VLYFIL---C----------------S------IGLVLSVLV
Q3TRE0_MOUSE/29-182G---.LFMLCVSYQ..VD----ERT.CVQF---SMK--VFYFLL---S----------------A------LGLMVCMLA
A7S4D6_NEMVE/20-179G---.IVAWRHST....I----LSM.GLFT---FFS--AVCVVL---H----------------M------IGTILTGEV
Q0V9M1_XENTR/36-200G---.VVAWKRPL....S----LVI.TFFM---LLS--AVCVML---N----------------L------AGSILSCQN
F6PJ14_XENTR/5-167G---.LTTWKRPM....V----LLV.NLFV---MLS--VVCVLL---N----------------L------AGFILGCQG
F189B_MOUSE/36-196G---.IVSWKRPF....T----LVI.SFFS---LLS--VLCVML---S----------------M------AGSVLSCKN
Q5BLA7_DANRE/16-153A---.LFASQKKN....P----YLV.NVMI---VSS--VVSLFA---V----------------V------IVFVYACVT
F7AIP4_XENTR/16-154A---.LFSSQKKN....P----VLV.NALI---AAS--VFSCFT---T----------------L------IVIVYASLT
Q08BU9_DANRE/43-180Y---.ILSERSPS....K----KII.TASF---ALS--IISTIG---V----------------V------SACMDFIKS
F1RAY4_DANRE/49-184Y---.ILSERNPS....K----KMI.TASL---ALS--IVSTFG---V----------------I------FAVLDISQH
F7ESV6_XENTR/53-198S---.VAASSKPT....L----GKM.KSSM---ALN--IVSCVC---A----------------A------IAVIIYIVI
H3C9F3_TETNG/67-212T---.LAALRRTS....V----SSV.WTAA---LSN--GISALV---G----------------L------VGVAYLGFL
MS4A3_MOUSE/27-172T---.VAAGRNPT....R----MLM.QNSF---GIN--IASTTI---A----------------F------VGTVFLSVH
MS4A3_HUMAN/50-196S---.VVAGIKPT....R----TWI.QNSF---GMN--IASATI---A----------------L------VGTAFLSLN
M4A4A_HUMAN/65-207S---.IAAGIRTT....K----GLV.RGSL---GMN--ITSSVL---A----------------A------SGILINTFS
M4A6C_MOUSE/47-207S---.IITERKST....K----PLV.DASL---TLN--ILSVSF---A----------------F------VGIIIISVS
M4A6B_MOUSE/47-204S---.IVTETKST....K----ILV.DSSL---TLN--ILSVSF---A----------------F------MGIIIISVS
M4A6D_MOUSE/47-207S---.IVTEKKMT....K----PLV.HSSL---ALS--ILSVLS---A----------------L------TGIAILSVS
MS4A7_HUMAN/47-207S---.IISGKQST....K----PFD.LSSL---TSN--AVSSVT---A----------------G------AGLFLLADS
F6RP33_BOVIN/48-208S---.IISGKKSN....K----PFA.INSL---IFS--AVSSVA---A----------------G------VGLILLAGS
Q99N04_MOUSE/47-204S---.IISEKIST....K----PFA.LSSL---ASN--VASSVV---A----------------V------IGLFLFTYC
MS4A5_HUMAN/49-189L---.IAVKRKTT....E----TLI.ILSR---IMN--FLSALG---A----------------I------AGIILLTFG
Q810P8_MOUSE/49-189L---.IALKRKTT....D----TLI.KMSR---AMN--LLSALG---A----------------A------AGIILLIFG
Q2KII2_BOVIN/49-189L---.VALERKTT....E----TLV.TLSR---IMN--SLSAVA---A----------------A------AGIILLIIG
Q3LRP2_CALJA/51-216L---.AATEKNSR....K----SLV.KGKM---IMN--SLSLFA---A----------------I------AGMILSIMD
CD20_MOUSE/44-210L---AAAAEKTSR....K----SLV.KAKV---IMS--SLSLFA---A----------------I------SGIILSIMD
CD20_CANFA/51-216L---.AAADKNPR....K----SLV.KGKM---IMN--SLSLFA---A----------------I------SGIIFLIMD
W5PU80_SHEEP/51-216L---.AAAEKNST....Q----SMASSGRI---IMN--SLSLFA---A----------------I------SGIIFLIMD
M3VZQ9_FELCA/52-215L---.VAAEKNPR....K----TVV.KGKM---IMN--SLSLFA---A----------------I------SGMILLIMD

PF13273

D7UXS6_LISGR/3-100V-------------------------FYFF---LLA--VAACII...G----------------F......IAAFK..MK
C2RQC7_BACCE/10-90.-------------------------LAYY---SII--LTVQIG...L----------------F......ILSCL..VN
C3AKH5_BACMY/2-83.-------------------------LTYY---SIL--LIIQIG...L----------------L......VLACS..VN
Q2B2X7_9BACI/2-86.-------------------------FIVT---LLF--FMIQAG...A----------------L......IVGCL..VN
A0A031KR27_ENTFC/3-104V-------------------------VLFG---GIT--LVFSIM...I----------------F......IIGFL..VR
C7DIS7_MICA2/29-132I-------------------------AAEG---ALG--IVCGIV...I----------------I......IASIM..VH
D7DCC0_STAHD/4-91I-------------------------LIIG---VWW--FIAAIL...I----------------I......IGSLW..IN
A0B9F9_METTP/2-84.-------------------------TVLG---FGA--ILFGII...G----------------I......VGGAL..VT
Q12UE5_METBU/2-98M-------------------------MGFG---TVT--LILGLI...G----------------I......AGGIV..AK
B9DJA4_STACT/148-230.-------------------------FGQA---IGV--IFVCIV...T----------------I......VISCI..IN
C4WAZ9_STAWA/11-93.-------------------------FGLG---VAV--ILTCII...T----------------L......ILSCI..IN
Q4L9M4_STAHJ/13-95.-------------------------TIVA---TSS--IILSAI...T----------------L......TLSCL..IN
A5UKZ4_METS3/8-83.-------------------------SFLG---LIA--TLGSFL...G----------------I......FASIH..VF
A5N2M2_CLOK5/4-86.-------------------------NNFG---IGA--IILSIL...G----------------I......IGALI..VK
F0K6E7_CLOAE/4-86.-------------------------GGLG---IVA--ILFSVL...G----------------I......VGAVF..VR
A9VVN7_BACWK/2-84.-------------------------IALG---WGA--VILSIL...G----------------I......CGAIL..VK
B3ZH23_BACCE/2-84.-------------------------IGLG---WGA--VALSIL...G----------------I......VGCVV..VK
C3BEA6_BACMY/2-84.-------------------------MTQG---WIA--VLLSIL...G----------------I......VGSVI..VK
Q4V1S6_BACCZ/2-84.-------------------------IILG---WGA--VFSSIL...G----------------I......IGSVV..VK
D4FV71_BACNB/2-84.-------------------------IGLG---WGA--IFLSIL...G----------------I......VASVI..IR
C2VWU6_BACCE/24-113.-------------------------MILG---SIS--LIASIL...G----------------I......IGSIL..IK
C2U6N9_BACCE/2-85G-------------------------LTVG---CMG--AFFSIL...G----------------F......FGFIK..AK
A5UL06_METS3/42-117.-------------------------FALG---ISA--LLASIV...G----------------I......VGSVY..VK
O26620_METTH/8-82.-------------------------LYLG---MSA--ILASIL...G----------------I......IGSVY..VR
C8JWL3_LISMN/13-93.-------------------------SYWL---LSI--LLTSIFSISG----------------V......VGSLF..VR
D7V0U0_LISGR/3-121S-------------------------LIIL---IVT--VIISVL...G----------------I.......YFII..GN
A0A024I3A1_LISMN/3-121S-------------------------WTAL---TGG--LITLAL...G----------------IF....GIYYIF..KN
D3KN98_LISMN/3-121V-------------------------QTLS---WTA--LTGGLI...T----------------LVLGGFGIYYIL..KN
E3YXI7_LISIO/3-121V-------------------------HTLS---WTA--LSGGII...T----------------LIVGAAGIYYIM..KN
D3ULL7_LISSS/3-121S-------------------------WTAL---SGG--IITLIL...G----------------V......VGIFYIINN
A8FJ46_BACP2/3-107G-------------------------TQYM---VVS--IIAAVL...S----------------I......VGVIL..LK
B4AK11_BACPU/3-107G-------------------------TQFM---VVS--GIAAVL...S----------------I......VGVIL..LK
C2H7S4_ENTFC/2-107M-------------------------TGLF---AVV--LFISLA...F----------------L......AVALF..LT
C9ATK3_ENTFC/2-107G-------------------------LFAV---VLF--ISLSFL...A----------------V......ALFLT..AK
E6TU87_BACCJ/2-115G-------------------------IFLI---ILS--VVAIVL...G----------------I......VAMVL..LK
B9CUN6_STACP/3-110G-------------------------TWYI---IGF--IVLLIL...A----------------I......IATLL..IS
C5QNE2_9STAP/3-110G-------------------------TGFI---IFL--IALLIL...A----------------I......IGTIL..IS
C2LZ67_STAHO/18-125F-------------------------NFFT---WGA--FIPLIL...A----------------I......IGGIL..IN
Q4L9F8_STAHJ/19-126F-------------------------SFLT---WGA--VISLIL...A----------------I......IGGIL..IS
C4WCX0_STAWA/2-110L-------------------------KVGL---IYG--LVILVI...A----------------L......IATLL..IK
Q4A0V3_STAS1/2-109L-------------------------TTGL---VLG--IILLII...A----------------L......IAVFL..IS
C5QZN6_STAEP/3-109G-------------------------VVLI---IIL--LILLIV...S----------------I......VAAIL..IG
D3QGJ5_STALH/3-111V-------------------------TIQA---IIN--IVILVL...A----------------I......IGVIF..IH
D3QGJ6_STALH/3-111S-------------------------SGWI---MIG--IVILGL...T----------------L......VAAIM..LS
Q4A0E9_STAS1/2-112F-------------------------ILAL---IVV--IVCTVI...A----------------I......IFAIL..TN
C5NV51_9BACL/5-120L-------------------------KMYS---VLL--IVLVVV...A----------------L......LASFL..MK
C5NWK3_9BACL/5-118V-------------------------KIYA---IVA--IVLVVL...A----------------L......IASFT..MR
H7FJC6_STASA/2-102I-------------------------MFQG---VLL--IISTIL...G----------------I......LGTFI..IK
Q8ERL5_OCEIH/2-100L-------------------------WLPA---VMY--FISFIL...G----------------L......IGVLK..LK
A7A3G5_BIFAD/15-115S-------------------------TVVG---IYA--LLVLII...G----------------I......VSFIM..SM

PF00335

TET11_ARATH/4-262TNKGAGRVVSGRGYKEYRTV......DFSTWLN.GFVGGKRWVGI...................RSCLAEANVCDDLSDG
TSN16_HUMAN/10-243FPIVGDVALEHTFVTLRKNY............................................................
Q16LT3_AEDAE/14-239..................QG......QVKEMVR.R........................................TLNES
H3DJN8_TETNG/8-231..................RG......KISKDLD.R........................................SMTEV
Q9V3X2_DROME/9-261..................KD......KLDDIVR.A........................................AVKSS
TSN5_HUMAN/14-261..................KD......WIKDQLY.F........................................FINNN
Q6Z6K0_ORYSJ/3-259TRGSGAYPVLGRAYDEYHLD......GFSMWLR.GYVSDDPARWER.................IKACLVVSDTCKKLARQ
Q29D35_DROPS/9-259..................KE......KVRAESK.N........................................FLQTT
Q7Q1S3_ANOGA/9-239..................RN......DTRELVS.N........................................ALNSS
TET15_ARATH/53-313................................................................................
Q292W4_DROPS/7-217..................KD......KYLVIMG.D........................................VVEKA
H3CCQ2_TETNG/10-245..................KD......ALHEETF.K........................................VIGTV
Q9VMJ6_DROME/18-261..................KDKGWIKDQATEGLK...............................................
TSN6_BOVIN/16-237..................RH......EIKNSLK.N........................................NYEKA
Q06AT4_PIG/10-257..................RDFFTPNLFLKQMLE..........................................RYQNN
Q16GP3_AEDAE/9-261..................KE......SAKTETK.N........................................YLQTT
TET13_ARATH/15-272HKETNPRLFPGTKIYEFRYE......DYSGWVS.RLVIKDDEWYRT..................RRCLVKDNVCNRLN..
M9PDV2_DROME/8-255..................RGG...LGR................................................TLANE
Q24FE3_TETTS/5-263QYEVPSYKNDEKCTQQSILI............................................................
A2BIP5_DANRE/16-252..................EK......TTIKLFQ.N........................................SIREG
Q4DD38_TRYCC/89-308DRDTRVSVMDPSKFLDAWKR............................................................
TSN8_BOVIN/7-235..................KS......KTEQALN.K........................................TLLIN
TSN10_HUMAN/75-319WG........................PLQDSLE.H........................................TLRVA
Q176T5_AEDAE/20-244..................KS......DLQNALQ.S........................................QLEKS
TET5_ARATH/4-245TSHSGGVVVDGRVYKEFKLE......AYHPWLK.TRVVDTNYWVTI..................KTCLLGSVTCSKLA..
A2EZ30_TRIVA/7-219..................KAFPKIIDDTEDWWN...............................................
A1Z8K7_DROME/8-233..................KK......DLEGMVK.N........................................SLQES
Q16HX5_AEDAE/9-218..................VG......DAKAAFK.K........................................GFARL
Q6Z8Q8_ORYSJ/5-259TNRGAGEAVSGRGYREYRLG......DYSTWLR.RHVGSSKNWDKI..................RSCLAGADVCRSLQ..
F1Q6P4_DANRE/9-244..................RD......LLKTEAD.K........................................IVSQV
A0BP70_PARTE/7-282GQSAHWIDIFSDEQCLQSEY.......................................................FTGSA
Q16J92_AEDAE/9-260..................SA......KLDSYVR.S........................................AVKEA
CD81_MOUSE/9-229..................KD......QIAKDVK.Q........................................FYDQA
Q16LT4_AEDAE/34-246..................TH......HVDDMLTIR.........................................MNNA
H3DF34_TETNG/10-245..................RD......RLKHEMS.D........................................IIKDM
H3CSH9_TETNG/9-237..................RA......KVEDEVN.S........................................SIKKV
Q86D97_SCHMA/7-231..................RE......EIMKYVD.D........................................RMREG
A1Z6T8_DROME/7-220SR................D........................................................FLPDS
Q3UGA5_MOUSE/74-317WK........................PLQDSLK.Y........................................TLHAA
Q29IZ2_DROPS/18-232S..........................................................................TINSS
A8X5P0_CAEBR/7-223..................RN......EFVSSIQ.Q........................................VLEKS
Q16HS1_AEDAE/9-225................................................................................
Q4S5B5_TETNG/8-230..................TD......KVSENAR.R........................................DLKEG
Q24C18_TETTS/14-278SHVFDIKD....TNCQSKN.............................................................
G7NV03_MACFA/6-238.............................TTMAEH........................................FLTLL
TSPA_DICDI/14-223HNDDIINEV..GGAWEHVA.............................................................
TSN33_MOUSE/21-264..................SD......KARGKVS.E........................................IINNA
A0CWV3_PARTE/4-272SSDLFGQECTNKDYFKLVDTQIQQAEQIFCSSYCQCYI..................................TEETLNRN
TET6_ARATH/4-244TSQGGGVEVPGRIYKEYRLG......DYHPWLR.ERVRDPEYWNSI..................RSCILSSKTCTKIE..
Q9W4X6_DROME/42-295..................PQ......YMNTFLEKQ........................................FTHKI
F6ZCC3_XENTR/20-287AIMCY..........TTRN.......ELESALY.R........................................GLKDA
CD63_MOUSE/9-231..................RD......QVKSEFN.K........................................SFQQQ
TSN8_HUMAN/7-234..................KS......KSDRIVN.E........................................TLYEN
Q7K2V7_DROME/7-219..................ND......KFLSSMG.K........................................AVDKA
H3D1H6_TETNG/11-249..................RE......DIAGGFR.S........................................GLQRA
TSN14_HUMAN/14-261..................QD......WVRDRFR.E........................................FFESN
TSPE_DICDI/16-219SGNPEKLQHKIENIWYKVGN............................................................
TSN32_HUMAN/9-223EQAM............KGT.............................................................
B4I8V1_DROSE/9-225..................RENLPTSVEI...............................................FIDDS
Q16TV5_AEDAE/8-254..................RGG...IGR................................................MMVHE
Q7PTA7_ANOGA/9-220..................VG......DVTTAIK.K........................................GFERV
TSPD_DICDI/11-223HNADIGIEI..EDNWKNIS.............................................................
F1R4A1_DANRE/13-252..................SE......KVQERTE.Q........................................LMMKA
Q9NB13_DROME/7-221..................RS......AFLGDMS.N........................................LVNLL
Q292V6_DROPS/9-211...........................................................................DLLAH
Q6YWS4_ORYSJ/4-277TNRGVATAVSGTGYGDYRVR......DYSEWLR.ARIEDYETWHRIESCMADAA.VCGGPLAGINPGEFYRLHLPLIQCE
Q4D693_TRYCC/53-286YTQVVSSDDSLALYWERAVS............................................................
TSPB_DICDI/14-223HNDDVVKQI..GNAWEDVS.............................................................
A0EF92_PARTE/7-263AHQINGLDVSTYCSNNPPLQ............................................................
TET9_ARATH/4-258TSKGSGETIQGKAYKEYRLE......AYSDWLQ.RRVNNAKHWNSI..................RSCLYESKFCYNLELV
Q5I0R1_XENTR/7-227..................KP......KIEAQLN.Q........................................TFYKL
Q7SXT2_DANRE/16-243..................RH......EIKAVLK.G........................................AYQKA
Q9XVI4_CAEEL/8-223..................HD......SFRLGIG.N........................................QLQTG
A2DRK6_TRIVA/7-225..................KTYPTLLHDLDTWWD...............................................
Q22RT6_TETTS/8-279KVKLSQFKDDTNCSKQSLMKDLKATYDAGKSLLCSSRCPCDANPISFPAQVYSNFYFANNGVERLDECNNYTHKIDINFS
A2DY51_TRIVA/7-217TNVVMDFAETKWNKGVTDKG............................................................
L9JBT3_TUPCH/21-370..................SD......KARGKVS.E........................................IINNA
Q6Z5Z9_ORYSJ/5-263TNAGAGRAVSGRGFREYHLG......DYSTWLR.RSVEDGGHWARI..................RSCLVDTGVCRSLK..
Q6NYK2_DANRE/15-289IILSY..........IMKG.......SLETSLK.I........................................GLKNG
Q75IM5_ORYSJ/6-249TAGGGGTQVPGRPYREYHTS......DYSSWLQ.KHIQDAKYWRPA..................LACVVGSKACPKIA..
H3DMZ9_TETNG/7-217..................ES......KVQEWVK.D........................................RLEEK
CD37_RAT/10-270..................RV......RLERRVQ.E........................................LVLRT
Q7JZW7_DROME/7-210YNETKQLDATEVYVMDLWMK............................................................
A8XFB8_CAEBR/15-256GLIGLNFRDQLTHYTPLNLKMLTSLRELYGTHD...............................................
Q7QJ21_ANOGA/9-222..................KAHLIVPAEV...............................................AIETS
TET2_ARATH/3-256TRPDGSYRVPGRGYKEYRLE......GFSNWLK.ENVVDSKNWGRL..................RACLADTNVCPKLN..
Q7JZW3_DROME/8-216..................KD.......................................................GISGS
Q19983_CAEEL/7-277..........................HKQEHIK.H........................................YVESS
B3DL95_XENTR/8-226..................TE......QFHNYAQ.E........................................DLKKG
Q9FVY6_ORYSJ/5-257TNTGTGHSVSGVRYKEYRLQ......DYSSWFI.KQLNDTEKWTHL..................RSCLVKSDDCNGLS..
ROM1_BOVIN/16-292ALGLA.........LALPG.......TLDTGLE.E........................................GLGSA
Q5ZII8_CHICK/15-247..................YQ......QLSTELK.E........................................NLKNT
Q22495_CAEEL/37-297..................RD......QLDNYIR.N........................................LLNDV
Q6DHQ4_DANRE/8-230..................QD......QIDLYAQ.N........................................DLKKG
Q7K527_DROME/7-208..........................NPKDVFKKY........................................ALQTV
TSN15_MOUSE/19-259..................RN......QTIDFLN.D........................................NIRRG
Q67WQ6_ORYSJ/4-259TNRGAGWVVSGRGYREYRLG......DYSTWLQ.RRVENSANWAKI..................RSCLQDGKVCEKLG..
G4LW70_SCHMA/10-212..................KD......RIDSEID.A........................................LMTGA
Q16HS3_AEDAE/6-221SNRTPYLEVQRFEMEFDHVL............................................................
Q29JV1_DROPS/14-246..................QS......QVRDMLM.R........................................TMYQS
Q9VID1_DROME/8-228..................HT......GLHQIME.S........................................QFNST
H9KCQ4_APIME/8-222..................VKNDDNFRNISEKYQ.E........................................IFNGY
Q7JWV7_DROME/7-218..................HV......QIQQSLE.K........................................IVQTI
O44582_CAEEL/29-290TDTTEGLSANWLLLYAVKNY............................................................
C4Q3U8_SCHMA/12-223..................SS......KVNHYMY.R........................................YLEEQ
Q17441_CAEEL/23-259HAT.............YEQ........................................................ELNAS
CD82_HUMAN/8-256..................MG......KLKQEMG.G........................................IVTEL
TSN12_HUMAN/9-248..........................EQELMVP.V........................................QWSDM
Q4D6X7_TRYCC/23-265STDRVNL.....QTGWDKA.............................................................
Q7T376_DANRE/6-213..................ES......KIENFIKDDL.....................................VDGLNQS
TSN11_BOVIN/15-248..................YQ......RLSDELK.Q........................................HLTRT
Q6P2T9_DANRE/9-230..................RG......KVNELLD.Q........................................SFNTM
A8WRV5_CAEBR/9-230..................KT......ELQQGLTTI........................................WRDEL
Q24C21_TETTS/14-285SHFTDIKDSTCQDKGSNGTE............................................................
Q245V1_TETTS/9-274SAGAYQIVQDSKDDTNCQKK............................................................
Q7KJ73_DROME/8-218..................RE......EFENAMG.N........................................VIENA
M4EKP0_BRARP/8-252TNSSAGKAFSDKGIGNVKTG......DLQNWIGDHFLQGKNWEGIKRCM...........ADSSICRFRPRDVDFD....
Q1HRC5_AEDAE/13-234..................RE......KVSQTMQ.Q........................................EMHSS
A1Z6U7_DROME/7-216HG..............................................................................
H2VAF3_TAKRU/20-284ALLCF..........VMRF.......PLQFTLA.E........................................GLRNG
Q16LT5_AEDAE/17-240..................RH......EVNGFLA.Q........................................SLNGS
Q29JV0_DROPS/10-238..................RN......DASSLIK.T........................................SLTES
A0BI34_PARTE/7-267GSFFDVSNCSNSSNELQIEN............................................................
Q7K010_DROME/6-211EK.........................................................................TVASN

PF04103

FCERB_HUMAN/60-204--------------------------------------------------------------------------------
FCERB_MOUSE/52-195--------------------------------------------------------------------------------
T176B_HUMAN/66-229--------------------------------------------------------------------------------
A6H741_BOVIN/62-223--------------------------------------------------------------------------------
T176B_MOUSE/60-224--------------------------------------------------------------------------------
T176B_RAT/60-224--------------------------------------------------------------------------------
T176A_RAT/63-223--------------------------------------------------------------------------------
T176A_HUMAN/56-214--------------------------------------------------------------------------------
T176A_BOVIN/63-220--------------------------------------------------------------------------------
Q4TAI3_TETNG/57-208--------------------------------------------------------------------------------
A7SQ32_NEMVE/7-164--------------------------------------------------------------------------------
Q95PZ5_CAEEL/94-253--------------------------------------------------------------------------------
Q9GYM6_CAEEL/45-206--------------------------------------------------------------------------------
Q1LVQ8_DANRE/42-197--------------------------------------------------------------------------------
H3D3M7_TETNG/37-190--------------------------------------------------------------------------------
Q3TRE0_MOUSE/29-182--------------------------------------------------------------------------------
A7S4D6_NEMVE/20-179--------------------------------------------------------------------------------
Q0V9M1_XENTR/36-200--------------------------------------------------------------------------------
F6PJ14_XENTR/5-167--------------------------------------------------------------------------------
F189B_MOUSE/36-196--------------------------------------------------------------------------------
Q5BLA7_DANRE/16-153--------------------------------------------------------------------------------
F7AIP4_XENTR/16-154--------------------------------------------------------------------------------
Q08BU9_DANRE/43-180--------------------------------------------------------------------------------
F1RAY4_DANRE/49-184--------------------------------------------------------------------------------
F7ESV6_XENTR/53-198--------------------------------------------------------------------------------
H3C9F3_TETNG/67-212--------------------------------------------------------------------------------
MS4A3_MOUSE/27-172--------------------------------------------------------------------------------
MS4A3_HUMAN/50-196--------------------------------------------------------------------------------
M4A4A_HUMAN/65-207--------------------------------------------------------------------------------
M4A6C_MOUSE/47-207--------------------------------------------------------------------------------
M4A6B_MOUSE/47-204--------------------------------------------------------------------------------
M4A6D_MOUSE/47-207--------------------------------------------------------------------------------
MS4A7_HUMAN/47-207--------------------------------------------------------------------------------
F6RP33_BOVIN/48-208--------------------------------------------------------------------------------
Q99N04_MOUSE/47-204--------------------------------------------------------------------------------
MS4A5_HUMAN/49-189--------------------------------------------------------------------------------
Q810P8_MOUSE/49-189--------------------------------------------------------------------------------
Q2KII2_BOVIN/49-189--------------------------------------------------------------------------------
Q3LRP2_CALJA/51-216--------------------------------------------------------------------------------
CD20_MOUSE/44-210--------------------------------------------------------------------------------
CD20_CANFA/51-216--------------------------------------------------------------------------------
W5PU80_SHEEP/51-216--------------------------------------------------------------------------------
M3VZQ9_FELCA/52-215--------------------------------------------------------------------------------

PF13273

D7UXS6_LISGR/3-100--------------------------------------------------------------------------------
C2RQC7_BACCE/10-90--------------------------------------------------------------------------------
C3AKH5_BACMY/2-83--------------------------------------------------------------------------------
Q2B2X7_9BACI/2-86--------------------------------------------------------------------------------
A0A031KR27_ENTFC/3-104--------------------------------------------------------------------------------
C7DIS7_MICA2/29-132--------------------------------------------------------------------------------
D7DCC0_STAHD/4-91--------------------------------------------------------------------------------
A0B9F9_METTP/2-84--------------------------------------------------------------------------------
Q12UE5_METBU/2-98--------------------------------------------------------------------------------
B9DJA4_STACT/148-230--------------------------------------------------------------------------------
C4WAZ9_STAWA/11-93--------------------------------------------------------------------------------
Q4L9M4_STAHJ/13-95--------------------------------------------------------------------------------
A5UKZ4_METS3/8-83--------------------------------------------------------------------------------
A5N2M2_CLOK5/4-86--------------------------------------------------------------------------------
F0K6E7_CLOAE/4-86--------------------------------------------------------------------------------
A9VVN7_BACWK/2-84--------------------------------------------------------------------------------
B3ZH23_BACCE/2-84--------------------------------------------------------------------------------
C3BEA6_BACMY/2-84--------------------------------------------------------------------------------
Q4V1S6_BACCZ/2-84--------------------------------------------------------------------------------
D4FV71_BACNB/2-84--------------------------------------------------------------------------------
C2VWU6_BACCE/24-113--------------------------------------------------------------------------------
C2U6N9_BACCE/2-85--------------------------------------------------------------------------------
A5UL06_METS3/42-117--------------------------------------------------------------------------------
O26620_METTH/8-82--------------------------------------------------------------------------------
C8JWL3_LISMN/13-93--------------------------------------------------------------------------------
D7V0U0_LISGR/3-121--------------------------------------------------------------------------------
A0A024I3A1_LISMN/3-121--------------------------------------------------------------------------------
D3KN98_LISMN/3-121--------------------------------------------------------------------------------
E3YXI7_LISIO/3-121--------------------------------------------------------------------------------
D3ULL7_LISSS/3-121--------------------------------------------------------------------------------
A8FJ46_BACP2/3-107--------------------------------------------------------------------------------
B4AK11_BACPU/3-107--------------------------------------------------------------------------------
C2H7S4_ENTFC/2-107--------------------------------------------------------------------------------
C9ATK3_ENTFC/2-107--------------------------------------------------------------------------------
E6TU87_BACCJ/2-115--------------------------------------------------------------------------------
B9CUN6_STACP/3-110--------------------------------------------------------------------------------
C5QNE2_9STAP/3-110--------------------------------------------------------------------------------
C2LZ67_STAHO/18-125--------------------------------------------------------------------------------
Q4L9F8_STAHJ/19-126--------------------------------------------------------------------------------
C4WCX0_STAWA/2-110--------------------------------------------------------------------------------
Q4A0V3_STAS1/2-109--------------------------------------------------------------------------------
C5QZN6_STAEP/3-109--------------------------------------------------------------------------------
D3QGJ5_STALH/3-111--------------------------------------------------------------------------------
D3QGJ6_STALH/3-111--------------------------------------------------------------------------------
Q4A0E9_STAS1/2-112--------------------------------------------------------------------------------
C5NV51_9BACL/5-120--------------------------------------------------------------------------------
C5NWK3_9BACL/5-118--------------------------------------------------------------------------------
H7FJC6_STASA/2-102--------------------------------------------------------------------------------
Q8ERL5_OCEIH/2-100--------------------------------------------------------------------------------
A7A3G5_BIFAD/15-115--------------------------------------------------------------------------------

PF00335

TET11_ARATH/4-262RVSQIADAFY....................................................................HK
TSN16_HUMAN/10-243......RGYNE...............................................................PDDYST
Q16LT3_AEDAE/14-239M.....ASYND...............................................................NANVQQ
H3DJN8_TETNG/8-231F.....NKYDG...............................................................TSAESS
Q9V3X2_DROME/9-261VQEEYGQST.................................................................MSSRTV
TSN5_HUMAN/14-261I.....RAYRD...............................................................DIDLQN
Q6Z6K0_ORYSJ/3-259AGFLTADQFY....................................................................QS
Q29D35_DROPS/9-259I.....TSYSLG............................................................ENVDASTL
Q7Q1S3_ANOGA/9-239M.....KSYGGE.............................................................NAGDITL
TET15_ARATH/53-313.............................................................................AYA
Q292W4_DROPS/7-217W.........E..............................................................RRTRRAD
H3CCQ2_TETNG/10-245L.....DGYPG..............................................................NNSSVMQ
Q9VMJ6_DROME/18-261..........AFIR........................................................HYREDADQQN
TSN6_BOVIN/16-237L.....KQYNA..............................................................TGDYRSD
Q06AT4_PIG/10-257SPPSNDDKWK................................................................NNGVTK
Q16GP3_AEDAE/9-261I.....SKYYSSND.........................................................RNQSDAVTL
TET13_ARATH/15-272HKM.PASEFYQ..............................................................MN.....
M9PDV2_DROME/8-255LRFGIERHYNSSDR........................................................GSLVAPSVAS
Q24FE3_TETTS/5-263.......QLQQLNHKSSLTLCQNDCLCNFKGTQEEADKL.......GINNFNHKDSSPVRVQDCQIFEDFQFENQSENSE
A2BIP5_DANRE/16-252I.....KHYYD...............................................................DLDFKN
Q4DD38_TRYCC/89-308..........GVN...........................................................NTKTGRNH
TSN8_BOVIN/7-235ARLLSSTDEN................................................................ERVFQK
TSN10_HUMAN/75-319I.....AHYQD...............................................................DPDLRF
Q176T5_AEDAE/20-244IS...RR...................................................................NKADMT
TET5_ARATH/4-245LW..TPLDYL....................................................................QK
A2EZ30_TRIVA/7-219..........................................................................ENKGKQ
A1Z8K7_DROME/8-233IK...RS...................................................................NSEDTM
Q16HX5_AEDAE/9-218F.........DE............................................................RDRPQNAE
Q6Z8Q8_ORYSJ/5-259DRNETWAQFV....................................................................AD
F1Q6P4_DANRE/9-244V.....ANYPG..............................................................QNKTAEQ
A0BP70_PARTE/7-282TLNNVYAEAEEVFCKTIYKNAPGCQCYYTGSMTESTSE........SVQFYSSSNSDLPIRIQQCQQYNDYKSDYDEEAE
Q16J92_AEDAE/9-260VQDEYSV...................................................................VATRTT
CD81_MOUSE/9-229LQQAVMDDD.................................................................ANNAKA
Q16LT4_AEDAE/34-246F.....AQYRY...............................................................DPDVRH
H3DF34_TETNG/10-245I.....VTYTG..............................................................VNRTAEH
H3CSH9_TETNG/9-237F.....DQYNGV.............................................................NSNAQSR
Q86D97_SCHMA/7-231I.....EEYSMLR...........................................................DQRENPVP
A1Z6T8_DROME/7-220LRQGLDDLWDL...............................................................QHEGNS
Q3UGA5_MOUSE/74-317I.....IHYWD...............................................................DPDLHF
Q29IZ2_DROPS/18-232LQPLLNVSLRRFVS.........................................................TSEYTYSNY
A8X5P0_CAEBR/7-223S.....S...................................................................APELRK
Q16HS1_AEDAE/9-225..........GVDQNRHDYLEWF......................................DEYFDHNISVSKASSVVDP
Q4S5B5_TETNG/8-230LALYTTDN..................................................................NAGLKD
Q24C18_TETTS/14-278......DIFKYSQEAYDQANELFCSEQCPCKVTDEDVKEYL...EDTDYIIDNVNGKTKVQDCDDFKKYFSDSDVNDSVD
G7NV03_MACFA/6-238VVPAIKKDYGS...............................................................QKDFTQ
TSPA_DICDI/14-223..........................................................................NGTKNS
TSN33_MOUSE/21-264I.....VHYRD...............................................................DLDLQN
A0CWV3_PARTE/4-272QTAFAGKNYTT...............................................................DKNVEQ
TET6_ARATH/4-244SW..TTLDYF....................................................................QR
Q9W4X6_DROME/42-295I.....HSYRD...............................................................DPDLQN
F6ZCC3_XENTR/20-287L.....KNYKDTD..........................................................IPGRCFLKS
CD63_MOUSE/9-231M.....QNYLK...............................................................DNKTAT
TSN8_HUMAN/7-234TKLLSATGES................................................................EKQFQE
Q7K2V7_DROME/7-219W.........DE.............................................................NNAAQGY
H3D1H6_TETNG/11-249V.....AGYTE...............................................................DEGRAD
TSN14_HUMAN/14-261I.....KSYRD...............................................................DIDLQN
TSPE_DICDI/16-219..........YQH...........................................................HSKHYHHG
TSN32_HUMAN/9-223..........................................................................SHVRRQ
B4I8V1_DROSE/9-225FVEFLDKFSRT...............................................................KVDNLH
Q16TV5_AEDAE/8-254LKYGIEKHYNVSDR........................................................GGIFAPSVAS
Q7PTA7_ANOGA/9-220F.........EN............................................................RDNPVNAD
TSPD_DICDI/11-223..........................................................................YSNQSV
F1R4A1_DANRE/13-252I.....VRYRD...............................................................DQDLEN
Q9NB13_DROME/7-221W.........................................................................DSHDYT
Q292V6_DROPS/9-211FDERVRQLFEE...............................................................KTHSND
Q6YWS4_ORYSJ/4-277LNTTVVSDYL.....................................................................C
Q4D693_TRYCC/53-286............................................................................NTPS
TSPB_DICDI/14-223..........................................................................NGPKNS
A0EF92_PARTE/7-263.........QTWDLGQNLLCSAECQCYIEDPTNLPTA...........YFNHTTNSSAANRVQDCSSFDNWDSSRRSQAK
TET9_ARATH/4-258TANHTVSDFY....................................................................KE
Q5I0R1_XENTR/7-227LPL.SGQ...................................................................DESFKT
Q7SXT2_DANRE/16-243E.....SNY.................................................................MGKDDE
Q9XVI4_CAEEL/8-223M.....VRYHE...............................................................SRGVES
A2DRK6_TRIVA/7-225..........................................................................KNKGSV
Q22RT6_TETTS/8-279YDYNNYNDY.................................................................LRNLVN
A2DY51_TRIVA/7-217..........................................................................MENVTR
L9JBT3_TUPCH/21-370I.....VHYRD...............................................................DLDLQN
Q6Z5Z9_ORYSJ/5-263SNQ.TLDEFV....................................................................NS
Q6NYK2_DANRE/15-289I.....RFYKDTD..........................................................IPGRCFQKQ
Q75IM5_ORYSJ/6-249NW..SPMDYL....................................................................QH
H3DMZ9_TETNG/7-217FSPLSSK...................................................................PESVQQ
CD37_RAT/10-270I.....QSYRTN............................................................PDETAAEE
Q7JZW7_DROME/7-210..........................................................................ELVHHG
A8XFB8_CAEBR/15-256..........................................................................MKGITE
Q7QJ21_ANOGA/9-222FTEFLAKDN.................................................................TNDQTH
TET2_ARATH/3-256QEFITADQFFS...................................................................SS
Q7JZW3_DROME/8-216INEGFDRLWES...............................................................ERNQTG
Q19983_CAEEL/7-277MYDTIRNRYSS...............................................................ETAFKD
B3DL95_XENTR/8-226LQLYNTTG..................................................................NLGLTN
Q9FVY6_ORYSJ/5-257RRYKTLKQYK....................................................................LA
ROM1_BOVIN/16-292L.....VHYKDTE..........................................................VPGRCQAKR
Q5ZII8_CHICK/15-247M....TEKYRKE.............................................................GEERVTS
Q22495_CAEEL/37-297V.....VGYRD...............................................................DPDLQL
Q6DHQ4_DANRE/8-230LQLFGTEG..................................................................NIGLTN
Q7K527_DROME/7-208E.....NQWEL...............................................................EQTKPG
TSN15_MOUSE/19-259I.....ENYYD...............................................................DLDFKN
Q67WQ6_ORYSJ/4-259ARRETMDQFV....................................................................GS
G4LW70_SCHMA/10-212LD...KP...................................................................TKEITE
Q16HS3_AEDAE/6-221..........R...............................................................TGISSE
Q29JV1_DROPS/14-246M.....ANYET...............................................................DPYVES
Q9VID1_DROME/8-228M.....QHYKE...............................................................RADYRD
H9KCQ4_APIME/8-222F.........L...............................................................NSESKD
Q7JWV7_DROME/7-218W.........D..............................................................QRKTDAL
O44582_CAEEL/29-290..........H..............................................................TNRNLAE
C4Q3U8_SCHMA/12-223V.....IRYRET............................................................EPENESTK
Q17441_CAEEL/23-259LPNDILNNYNL...............................................................DPNIAK
CD82_HUMAN/8-256I.....RDYNSS.............................................................REDSLQD
TSN12_HUMAN/9-248V.....TLKARMTNY.......................................................GLPRYRWLTH
Q4D6X7_TRYCC/23-265..........................................................................AVSNAE
Q7T376_DANRE/6-213IK..NRK...................................................................QHNTTD
TSN11_BOVIN/15-248L....AENYRQP.............................................................GAAEITA
Q6P2T9_DANRE/9-230I.....AGYNK...............................................................TEEYRT
A8WRV5_CAEBR/9-230V.....SKYNN...............................................................NQQIHQ
Q24C21_TETTS/14-285.......IFYYGQEAYNSAFSLFCTQRCPCKVTNTEVKSYITKNYIQMVPFMQDNGSVKVQDCQDYKTVFSNSDVKNQAN
Q245V1_TETTS/9-274D....FLIYSRKVYEKAQTVFCSKDCMCQVKQSYLNPNTISSWNWSETQGKVKSQDCPTFNQSIDFTIPSDIGNLSDLTK
Q7KJ73_DROME/8-218W.........NS.............................................................EHTYKGG
M4EKP0_BRARP/8-252..............................................................................AK
Q1HRC5_AEDAE/13-234M.....TFYGAY.............................................................GKRSITQ
A1Z6U7_DROME/7-216..........................................................................LDRDPE
H2VAF3_TAKRU/20-284M.....KYYKDTD..........................................................TPGRCYMKR
Q16LT5_AEDAE/17-240L.....QRYPW...............................................................NSHIQK
Q29JV0_DROPS/10-238L.....KDYNTF.............................................................TQSPTTA
A0BI34_PARTE/7-267..........LYKMSESTLCKSSCECYYSEKMTKEVE...........LAVKSYSATDKTKPTRVQDCPGFDSKYKTQAA
Q7K010_DROME/6-211LANALEATWEE...............................................................ELNSPG

PF04103

FCERB_HUMAN/60-204--------------------------------------------------------------------------LKKSLA
FCERB_MOUSE/52-195--------------------------------------------------------------------------LTNNFA
T176B_HUMAN/66-229--------------------------------------------------------------------------FIWQTE
A6H741_BOVIN/62-223--------------------------------------------------------------------------FIWQYD
T176B_MOUSE/60-224--------------------------------------------------------------------------LIRQTS
T176B_RAT/60-224--------------------------------------------------------------------------LIWQTS
T176A_RAT/63-223--------------------------------------------------------------------------FNNYWY
T176A_HUMAN/56-214--------------------------------------------------------------------------FRYGYS
T176A_BOVIN/63-220--------------------------------------------------------------------------FYEYHF
Q4TAI3_TETNG/57-208--------------------------------------------------------------------------LADLYI
A7SQ32_NEMVE/7-164--------------------------------------------------------------------------VLQHFK
Q95PZ5_CAEEL/94-253--------------------------------------------------------------------------WALVGT
Q9GYM6_CAEEL/45-206--------------------------------------------------------------------------DIHFYQ
Q1LVQ8_DANRE/42-197--------------------------------------------------------------------------IAFQCY
H3D3M7_TETNG/37-190--------------------------------------------------------------------------VAFAGH
Q3TRE0_MOUSE/29-182--------------------------------------------------------------------------VAFAAH
A7S4D6_NEMVE/20-179--------------------------------------------------------------------------GGLLKS
Q0V9M1_XENTR/36-200--------------------------------------------------------------------------AQLVSS
F6PJ14_XENTR/5-167--------------------------------------------------------------------------AQFVSS
F189B_MOUSE/36-196--------------------------------------------------------------------------AQLARD
Q5BLA7_DANRE/16-153--------------------------------------------------------------------------LSYGEE
F7AIP4_XENTR/16-154--------------------------------------------------------------------------LGYGED
Q08BU9_DANRE/43-180--------------------------------------------------------------------------MVIIER
F1RAY4_DANRE/49-184--------------------------------------------------------------------------ISHNRW
F7ESV6_XENTR/53-198--------------------------------------------------------------------------ILDIHY
H3C9F3_TETNG/67-212--------------------------------------------------------------------------MASYRP
MS4A3_MOUSE/27-172--------------------------------------------------------------------------LAFNTQ
MS4A3_HUMAN/50-196--------------------------------------------------------------------------IAVNIQ
M4A4A_HUMAN/65-207--------------------------------------------------------------------------LAFYSF
M4A6C_MOUSE/47-207--------------------------------------------------------------------------LAGLHP
M4A6B_MOUSE/47-204--------------------------------------------------------------------------LAGLHP
M4A6D_MOUSE/47-207--------------------------------------------------------------------------LAALEP
MS4A7_HUMAN/47-207--------------------------------------------------------------------------MVALRT
F6RP33_BOVIN/48-208--------------------------------------------------------------------------LVALRT
Q99N04_MOUSE/47-204--------------------------------------------------------------------------LIALGS
MS4A5_HUMAN/49-189--------------------------------------------------------------------------FILDQN
Q810P8_MOUSE/49-189--------------------------------------------------------------------------FLLDGE
Q2KII2_BOVIN/49-189--------------------------------------------------------------------------FLIDRD
Q3LRP2_CALJA/51-216--------------------------------------------------------------------------ILNIKL
CD20_MOUSE/44-210--------------------------------------------------------------------------ILNMTL
CD20_CANFA/51-216--------------------------------------------------------------------------IFNITI
W5PU80_SHEEP/51-216--------------------------------------------------------------------------IFNMTI
M3VZQ9_FELCA/52-215--------------------------------------------------------------------------IFNIAI

PF13273

D7UXS6_LISGR/3-100--------------------------------------------------------------------------N....G
C2RQC7_BACCE/10-90--------------------------------------------------------------------------K...VN
C3AKH5_BACMY/2-83--------------------------------------------------------------------------K...VN
Q2B2X7_9BACI/2-86--------------------------------------------------------------------------R...MN
A0A031KR27_ENTFC/3-104--------------------------------------------------------------------------K....N
C7DIS7_MICA2/29-132--------------------------------------------------------------------------R....Q
D7DCC0_STAHD/4-91--------------------------------------------------------------------------SGIPSK
A0B9F9_METTP/2-84--------------------------------------------------------------------------H....N
Q12UE5_METBU/2-98--------------------------------------------------------------------------T....D
B9DJA4_STACT/148-230--------------------------------------------------------------------------K....N
C4WAZ9_STAWA/11-93--------------------------------------------------------------------------K....K
Q4L9M4_STAHJ/13-95--------------------------------------------------------------------------K....R
A5UKZ4_METS3/8-83--------------------------------------------------------------------------K....D
A5N2M2_CLOK5/4-86--------------------------------------------------------------------------N....K
F0K6E7_CLOAE/4-86--------------------------------------------------------------------------T....K
A9VVN7_BACWK/2-84--------------------------------------------------------------------------T....K
B3ZH23_BACCE/2-84--------------------------------------------------------------------------K....N
C3BEA6_BACMY/2-84--------------------------------------------------------------------------G....K
Q4V1S6_BACCZ/2-84--------------------------------------------------------------------------S....K
D4FV71_BACNB/2-84--------------------------------------------------------------------------K....K
C2VWU6_BACCE/24-113--------------------------------------------------------------------------T....K
C2U6N9_BACCE/2-85--------------------------------------------------------------------------G....A
A5UL06_METS3/42-117--------------------------------------------------------------------------N....N
O26620_METTH/8-82--------------------------------------------------------------------------N....N
C8JWL3_LISMN/13-93--------------------------------------------------------------------------K....H
D7V0U0_LISGR/3-121--------------------------------------------------------------------------K....K
A0A024I3A1_LISMN/3-121--------------------------------------------------------------------------K....K
D3KN98_LISMN/3-121--------------------------------------------------------------------------K....K
E3YXI7_LISIO/3-121--------------------------------------------------------------------------K....N
D3ULL7_LISSS/3-121--------------------------------------------------------------------------K....K
A8FJ46_BACP2/3-107--------------------------------------------------------------------------TD..RR
B4AK11_BACPU/3-107--------------------------------------------------------------------------TD..RR
C2H7S4_ENTFC/2-107--------------------------------------------------------------------------A....K
C9ATK3_ENTFC/2-107--------------------------------------------------------------------------G....K
E6TU87_BACCJ/2-115--------------------------------------------------------------------------GN..NK
B9CUN6_STACP/3-110--------------------------------------------------------------------------K....K
C5QNE2_9STAP/3-110--------------------------------------------------------------------------K....K
C2LZ67_STAHO/18-125--------------------------------------------------------------------------K....K
Q4L9F8_STAHJ/19-126--------------------------------------------------------------------------K....K
C4WCX0_STAWA/2-110--------------------------------------------------------------------------K....K
Q4A0V3_STAS1/2-109--------------------------------------------------------------------------K....K
C5QZN6_STAEP/3-109--------------------------------------------------------------------------K....N
D3QGJ5_STALH/3-111--------------------------------------------------------------------------R....R
D3QGJ6_STALH/3-111--------------------------------------------------------------------------K....H
Q4A0E9_STAS1/2-112--------------------------------------------------------------------------K....L
C5NV51_9BACL/5-120--------------------------------------------------------------------------K.....
C5NWK3_9BACL/5-118--------------------------------------------------------------------------A....R
H7FJC6_STASA/2-102--------------------------------------------------------------------------G....N
Q8ERL5_OCEIH/2-100--------------------------------------------------------------------------V....N
A7A3G5_BIFAD/15-115--------------------------------------------------------------------------RC.LAP

PF00335

TET11_ARATH/4-262N--LSPIQ.......................S................................................
TSN16_HUMAN/10-243Q--WNLVM....................EK.L................................................
Q16LT3_AEDAE/14-239S--VDFMQ....................RV.L................................................
H3DJN8_TETNG/8-231A--ADYLQ....................TQ.L................................................
Q9V3X2_DROME/9-261T--FDTLQ....................KN.L................................................
TSN5_HUMAN/14-261L--IDFTQ....................EY.W................................................
Q6Z6K0_ORYSJ/3-259R--LSPLQ.......................S................................................
Q29D35_DROPS/9-259M--WNQLM....................GN.F................................................
Q7Q1S3_ANOGA/9-239V--WDEIQ....................VD.F................................................
TET15_ARATH/53-313G--VNEMQ....................SRRFPATRMWFKLKIMDDHVTWNNIKSCVYD.....................
Q292W4_DROPS/7-217Y--MDAIQ....................IS.M................................................
H3CCQ2_TETNG/10-245A--WDFIQ....................RT.M................................................
Q9VMJ6_DROME/18-261L--IDWIQ....................EDWL................................................
TSN6_BOVIN/16-237A--VDKIQ....................SM.L................................................
Q06AT4_PIG/10-257T--WDRLM....................LQDY................................................
Q16GP3_AEDAE/9-261M--WNYLM....................SE.M................................................
TET13_ARATH/15-272.--LTPIQ....................S...................................................
M9PDV2_DROME/8-255I--WDSVQ....................QS.F................................................
Q24FE3_TETTS/5-263V--LKFLE....................EL.F................................................
A2BIP5_DANRE/16-252I--LDYVQ....................EK.F................................................
Q4DD38_TRYCC/89-308D--ICLLQ....................ER.F................................................
TSN8_BOVIN/7-235A--FSELQ....................EE.L................................................
TSN10_HUMAN/75-319L--LDQVQ....................LG.L................................................
Q176T5_AEDAE/20-244A--WNSVH....................KK.M................................................
TET5_ARATH/4-245D--LSPLQ.......................S................................................
A2EZ30_TRIVA/7-219S--VKDIE....................SD.L................................................
A1Z8K7_DROME/8-233A--WDNIQ....................QK.L................................................
Q16HX5_AEDAE/9-218L--IDTIQ....................AN.L................................................
Q6Z8Q8_ORYSJ/5-259D--LSPVQ.......................S................................................
F1Q6P4_DANRE/9-244A--WDYLQ....................RT.M................................................
A0BP70_PARTE/7-282Y--LKSIE....................EQ.F................................................
Q16J92_AEDAE/9-260T--MDSIQ....................KY.F................................................
CD81_MOUSE/9-229V--VKTFH....................ET.L................................................
Q16LT4_AEDAE/34-246S--INDMQ....................RT.L................................................
H3DF34_TETNG/10-245T--WDYIQ....................KT.M................................................
H3CSH9_TETNG/9-237A--IDYVQ....................RQ.L................................................
Q86D97_SCHMA/7-231F--MDSIQ....................RM.L................................................
A1Z6T8_DROME/7-220T--LNTYE....................EW.L................................................
Q3UGA5_MOUSE/74-317L--LDQVQ....................LG.L................................................
Q29IZ2_DROPS/18-232V--LTMIQ....................EN.I................................................
A8X5P0_CAEBR/7-223N--IKPIQ....................NM.L................................................
Q16HS1_AEDAE/9-225V--IDYLQ....................TT.Y................................................
Q4S5B5_TETNG/8-230A--WNTIQ....................AE.W................................................
Q24C18_TETTS/14-278W--VESLE....................DT.F................................................
G7NV03_MACFA/6-238V--WNTTM....................TE.L................................................
TSPA_DICDI/14-223T--LTRLE....................NF.L................................................
TSN33_MOUSE/21-264L--IDFGQ....................KK.F................................................
A0CWV3_PARTE/4-272K--IEKIQECPGYEVNAYSAAVSLLGTAEQLL................................................
TET6_ARATH/4-244D--MTSVQ.......................S................................................
Q9W4X6_DROME/42-295F--IDFAQ....................QE.F................................................
F6ZCC3_XENTR/20-287T--IDLLQ....................IE.F................................................
CD63_MOUSE/9-231I--LDKLQ....................KE.N................................................
TSN8_HUMAN/7-234A--IIVFQ....................EE.F................................................
Q7K2V7_DROME/7-219P--MDALQ....................LA.F................................................
H3D1H6_TETNG/11-249A--LDSLQ....................RA.L................................................
TSN14_HUMAN/14-261L--IDSLQ....................KA.N................................................
TSPE_DICDI/16-219I--IEIIE....................KH.H................................................
TSN32_HUMAN/9-223E--LAAIQ....................DV.F................................................
B4I8V1_DROSE/9-225L--WNRMQ....................SQ.L................................................
Q16TV5_AEDAE/8-254I--WDKVQ....................VE.L................................................
Q7PTA7_ANOGA/9-220L--VNSIQ....................QN.L................................................
TSPD_DICDI/11-223V--IKKLE....................QF.F................................................
F1R4A1_DANRE/13-252V--IDFVQ....................KK.F................................................
Q9NB13_DROME/7-221A--MGVLE....................ET.F................................................
Q292V6_DROPS/9-211K--MQPIH....................SL.F................................................
Q6YWS4_ORYSJ/4-277D--VTTVQ.......................S................................................
Q4D693_TRYCC/53-286R--ICDLQ....................CW.L................................................
TSPB_DICDI/14-223T--ILKLE....................NF.L................................................
A0EF92_PARTE/7-263L--FKSLE....................KK.Y................................................
TET9_ARATH/4-258D--LTAFE.......................S................................................
Q5I0R1_XENTR/7-227S--FENIQ....................KE.S................................................
Q7SXT2_DANRE/16-243D--LDRIQ....................RT.L................................................
Q9XVI4_CAEEL/8-223A--WDKTH....................QL.F................................................
A2DRK6_TRIVA/7-225E--VKKVE....................SS.L................................................
Q22RT6_TETTS/8-279L--LRTAE....................ES.F................................................
A2DY51_TRIVA/7-217N--IEIL........................L................................................
L9JBT3_TUPCH/21-370L--IDFGQ....................KK.MVPNAKKEAPAPPKAEAKAEALKAKKAALKGVHSHKKKKIHTSPIFRRP
Q6Z5Z9_ORYSJ/5-263N--LSPLQ.......................S................................................
Q6NYK2_DANRE/15-289T--IDRLQ....................ME.F................................................
Q75IM5_ORYSJ/6-249D--LTPIQ.......................S................................................
H3DMZ9_TETNG/7-217D--FEKLQ....................RE.L................................................
CD37_RAT/10-270S--WDYAQ....................FQ.L................................................
Q7JZW7_DROME/7-210A--MQDLQ....................QE.Y................................................
A8XFB8_CAEBR/15-256S--WDALQ....................SN.F................................................
Q7QJ21_ANOGA/9-222I--WNRLQ....................RD.F................................................
TET2_ARATH/3-256K--ITPLQ.......................S................................................
Q7JZW3_DROME/8-216A--LSYYE....................SW.L................................................
Q19983_CAEEL/7-277A--FDTVQ....................EK.F................................................
B3DL95_XENTR/8-226A--WDIVQ....................TE.F................................................
Q9FVY6_ORYSJ/5-257D--LTPME.......................S................................................
ROM1_BOVIN/16-292L--LDELQ....................LR.H................................................
Q5ZII8_CHICK/15-247A--VDKLQ....................QE.F................................................
Q22495_CAEEL/37-297L--IDSMQ....................ET.W................................................
Q6DHQ4_DANRE/8-230A--WSIVQ....................TD.F................................................
Q7K527_DROME/7-208S--MDIIQ....................KT.Y................................................
TSN15_MOUSE/19-259I--MDFVQ....................KK.F................................................
Q67WQ6_ORYSJ/4-259N--LSPIQ.......................S................................................
G4LW70_SCHMA/10-212F--MNLIQ....................SS.F................................................
Q16HS3_AEDAE/6-221R--IYQFQ....................AD.H................................................
Q29JV1_DROPS/14-246G--VDFMQ....................SG.L................................................
Q9VID1_DROME/8-228A--WTLLQ....................TE.L................................................
H9KCQ4_APIME/8-222F--IDFIQ....................KN.L................................................
Q7JWV7_DROME/7-218L--MDTLQ....................RS.F................................................
O44582_CAEEL/29-290I--MDALQ....................EN.L................................................
C4Q3U8_SCHMA/12-223L--MDFIQ....................KK.F................................................
Q17441_CAEEL/23-259A--VNYLQ....................RD.S................................................
CD82_HUMAN/8-256A--WDYVQ....................AQ.V................................................
TSN12_HUMAN/9-248A--WNFFQ....................RE.F................................................
Q4D6X7_TRYCC/23-265G--MCSLE....................LQ.F................................................
Q7T376_DANRE/6-213D--WDKVQ....................ET.F................................................
TSN11_BOVIN/15-248S--VDRLQ....................QD.F................................................
Q6P2T9_DANRE/9-230T--LDSIQ....................KQ.L................................................
A8WRV5_CAEBR/9-230A--LDQLQ....................SS.L................................................
Q24C21_TETTS/14-285W--LQSLE....................DS.F................................................
Q245V1_TETTS/9-274L--LGYVE....................TS.F................................................
Q7KJ73_DROME/8-218V--FDTIQ....................KS.L................................................
M4EKP0_BRARP/8-252H--LSHVK.......................F................................................
Q1HRC5_AEDAE/13-234A--WDMTQ....................ER.L................................................
A1Z6U7_DROME/7-216L--MHQYE....................AS.Q................................................
H2VAF3_TAKRU/20-284T--LDLMQ....................IE.F................................................
Q16LT5_AEDAE/17-240S--VDFMQ....................IE.L................................................
Q29JV0_DROPS/10-238L--WDDVQ....................HD.F................................................
A0BI34_PARTE/7-267A--LQLME....................EK.W................................................
Q7K010_DROME/6-211A--MSLYQ....................NW.F................................................

PF04103

FCERB_HUMAN/60-204Y--IHI..--------------------..--------------------------------------------------
FCERB_MOUSE/52-195Y--MNN..--------------------..--------------------------------------------------
T176B_HUMAN/66-229P--FLYID--------------------TV--------------------------------------------------
A6H741_BOVIN/62-223G--FYDIS--------------------SV--------------------------------------------------
T176B_MOUSE/60-224V--PYYVE--------------------IF--------------------------------------------------
T176B_RAT/60-224A--SYYFE--------------------IS--------------------------------------------------
T176A_RAT/63-223Y--LRDDV--------------------CK--------------------------------------------------
T176A_HUMAN/56-214Y--YNSAC--------------------RI--------------------------------------------------
T176A_BOVIN/63-220I--FYKGI--------------------CN--------------------------------------------------
Q4TAI3_TETNG/57-208R--WICER--------------------DY--------------------------------------------------
A7SQ32_NEMVE/7-164F--ESSIN--------------------RE--------------------------------------------------
Q95PZ5_CAEEL/94-253Y--HHPRI--------------------DR--------------------------------------------------
Q9GYM6_CAEEL/45-206H--ECWGE--------------------CD--------------------------------------------------
Q1LVQ8_DANRE/42-197H--YTLTN--------------------SF--------------------------------------------------
H3D3M7_TETNG/37-190H--YSQAS--------------------GF--------------------------------------------------
Q3TRE0_MOUSE/29-182H--YSLLA--------------------QF--------------------------------------------------
A7S4D6_NEMVE/20-179V--LECQF--------------------SE--------------------------------------------------
Q0V9M1_XENTR/36-200L--EGCQL--------------------IN--------------------------------------------------
F6PJ14_XENTR/5-167V--PSCQL--------------------VE--------------------------------------------------
F189B_MOUSE/36-196F--RECSM--------------------EG--------------------------------------------------
Q5BLA7_DANRE/16-153D--DEI..--------------------..--------------------------------------------------
F7AIP4_XENTR/16-154D--DDI..--------------------..--------------------------------------------------
Q08BU9_DANRE/43-180Q--DEY..--------------------..--------------------------------------------------
F1RAY4_DANRE/49-184M--VWF..--------------------..--------------------------------------------------
F7ESV6_XENTR/53-198Y--RAH..--------------------..--------------------------------------------------
H3C9F3_TETNG/67-212A--KLFCD--------------------DA--------------------------------------------------
MS4A3_MOUSE/27-172A--FKG..--------------------..--------------------------------------------------
MS4A3_HUMAN/50-196S--LRS..--------------------..--------------------------------------------------
M4A4A_HUMAN/65-207H--HPY..--------------------..--------------------------------------------------
M4A6C_MOUSE/47-207A--SEQCK--------------------QS--------------------------------------------------
M4A6B_MOUSE/47-204A--SEQCL--------------------QS--------------------------------------------------
M4A6D_MOUSE/47-207A--LQQCK--------------------LA--------------------------------------------------
MS4A7_HUMAN/47-207A--SQHCG--------------------SE--------------------------------------------------
F6RP33_BOVIN/48-208A--SQQCD--------------------SG--------------------------------------------------
Q99N04_MOUSE/47-204A--FPHCN--------------------SE--------------------------------------------------
MS4A5_HUMAN/49-189Y--ICG..--------------------..--------------------------------------------------
Q810P8_MOUSE/49-189F--ICG..--------------------..--------------------------------------------------
Q2KII2_BOVIN/49-189F--LCG..--------------------..--------------------------------------------------
Q3LRP2_CALJA/51-216S--HFLKM--------------------ES--------------------------------------------------
CD20_MOUSE/44-210S--HFLKM--------------------RR--------------------------------------------------
CD20_CANFA/51-216S--HFFKM--------------------EN--------------------------------------------------
W5PU80_SHEEP/51-216S--HFFKM--------------------EN--------------------------------------------------
M3VZQ9_FELCA/52-215S--HFFKM--------------------EN--------------------------------------------------

PF13273

D7UXS6_LISGR/3-100Q..N...I------------------------------------------------------------------------
C2RQC7_BACCE/10-90N..K...V------------------------------------------------------------------------
C3AKH5_BACMY/2-83N..I...A------------------------------------------------------------------------
Q2B2X7_9BACI/2-86H..K...L------------------------------------------------------------------------
A0A031KR27_ENTFC/3-104Q..KT.VV------------------------------------------------------------------------
C7DIS7_MICA2/29-132SKIK...T------------------------------------------------------------------------
D7DCC0_STAHD/4-91V..R...R------------------------------------------------------------------------
A0B9F9_METTP/2-84H..R...A------------------------------------------------------------------------
Q12UE5_METBU/2-98K..K...K------------------------------------------------------------------------
B9DJA4_STACT/148-230R..I...A------------------------------------------------------------------------
C4WAZ9_STAWA/11-93R..V...L------------------------------------------------------------------------
Q4L9M4_STAHJ/13-95R..V...L------------------------------------------------------------------------
A5UKZ4_METS3/8-83S..D...V------------------------------------------------------------------------
A5N2M2_CLOK5/4-86T..K...L------------------------------------------------------------------------
F0K6E7_CLOAE/4-86G..K...L------------------------------------------------------------------------
A9VVN7_BACWK/2-84A..K...I------------------------------------------------------------------------
B3ZH23_BACCE/2-84A..K...V------------------------------------------------------------------------
C3BEA6_BACMY/2-84V..K...I------------------------------------------------------------------------
Q4V1S6_BACCZ/2-84S..G...I------------------------------------------------------------------------
D4FV71_BACNB/2-84A..K...L------------------------------------------------------------------------
C2VWU6_BACCE/24-113R..T...L------------------------------------------------------------------------
C2U6N9_BACCE/2-85C..K...E------------------------------------------------------------------------
A5UL06_METS3/42-117A..K...T------------------------------------------------------------------------
O26620_METTH/8-82P..R...R------------------------------------------------------------------------
C8JWL3_LISMN/13-93H..L...L------------------------------------------------------------------------
D7V0U0_LISGR/3-121P..V...L------------------------------------------------------------------------
A0A024I3A1_LISMN/3-121P..V...F------------------------------------------------------------------------
D3KN98_LISMN/3-121P..A...F------------------------------------------------------------------------
E3YXI7_LISIO/3-121P..I...L------------------------------------------------------------------------
D3ULL7_LISSS/3-121P..V...L------------------------------------------------------------------------
A8FJ46_BACP2/3-107A..V...I------------------------------------------------------------------------
B4AK11_BACPU/3-107A..V...I------------------------------------------------------------------------
C2H7S4_ENTFC/2-107G..KYLTT------------------------------------------------------------------------
C9ATK3_ENTFC/2-107Y..L..TT------------------------------------------------------------------------
E6TU87_BACCJ/2-115P..K...V------------------------------------------------------------------------
B9CUN6_STACP/3-110S..K...I------------------------------------------------------------------------
C5QNE2_9STAP/3-110P..K...V------------------------------------------------------------------------
C2LZ67_STAHO/18-125P..K...L------------------------------------------------------------------------
Q4L9F8_STAHJ/19-126P..K...I------------------------------------------------------------------------
C4WCX0_STAWA/2-110A..K...L------------------------------------------------------------------------
Q4A0V3_STAS1/2-109P..K...V------------------------------------------------------------------------
C5QZN6_STAEP/3-109A..K...V------------------------------------------------------------------------
D3QGJ5_STALH/3-111T..N...V------------------------------------------------------------------------
D3QGJ6_STALH/3-111P..T...I------------------------------------------------------------------------
Q4A0E9_STAS1/2-112S..K...F------------------------------------------------------------------------
C5NV51_9BACL/5-120R..I...L------------------------------------------------------------------------
C5NWK3_9BACL/5-118...F...I------------------------------------------------------------------------
H7FJC6_STASA/2-102R..V...L------------------------------------------------------------------------
Q8ERL5_OCEIH/2-100S..K...L------------------------------------------------------------------------
A7A3G5_BIFAD/15-115G..T...T------------------------------------------------------------------------

PF00335

TET11_ARATH/4-262..........................................................GC.......CKP..........
TSN16_HUMAN/10-243..........................................................KC.......CGV....NNYTDF
Q16LT3_AEDAE/14-239..........................................................EC.......CGV....DSYEDW
H3DJN8_TETNG/8-231..........................................................MC.......CGV....YNYTSW
Q9V3X2_DROME/9-261..........................................................KC.......CGA....DGPGDW
TSN5_HUMAN/14-261..........................................................QC.......CGA....FGADDW
Q6Z6K0_ORYSJ/3-259..........................................................GC.......CKP..........
Q29D35_DROPS/9-259..........................................................GC.......CGI....TDYHDF
Q7Q1S3_ANOGA/9-239..........................................................DC.......CGV....YNSSDW
TET15_ARATH/53-313...............................KGACNDLIYGSPNEKPYNRRKMPPIKNGC.......CMP..........
Q292W4_DROPS/7-217..........................................................EC.......CGR....TNFSDY
H3CCQ2_TETNG/10-245..........................................................EC.......CGW....TSQQDW
Q9VMJ6_DROME/18-261..........................................................QC.......CGI....DGPKDW
TSN6_BOVIN/16-237..........................................................HC.......CGV....TNYRDW
Q06AT4_PIG/10-257...........................................................C.......CGV....NGPSDW
Q16GP3_AEDAE/9-261..........................................................HC.......CGV....DDYRDF
TET13_ARATH/15-272..........................................................GC.......CKP..........
M9PDV2_DROME/8-255..........................................................EC.......CGV....SSYEDW
Q24FE3_TETTS/5-263..........................................................GC.......SGF..........
A2BIP5_DANRE/16-252..........................................................SC.......CGG....DEYKDW
Q4DD38_TRYCC/89-308..........................................................NCSGFRDGCCVAGVCYDAID..
TSN8_BOVIN/7-235..........................................................KC.......CGL...VNGASDW
TSN10_HUMAN/75-319..........................................................RC.......CGA....ASYQDW
Q176T5_AEDAE/20-244..........................................................MC.......CGI....EGPKNW
TET5_ARATH/4-245..........................................................GC.......CKP..........
A2EZ30_TRIVA/7-219..........................................................EC.......CGFKTAYNAAEMA
A1Z8K7_DROME/8-233..........................................................MC.......CGV....DSPADW
Q16HX5_AEDAE/9-218..........................................................EC.......CGN....KNRFDW
Q6Z8Q8_ORYSJ/5-259..........................................................GC.......CKP..........
F1Q6P4_DANRE/9-244..........................................................QC.......CGW....NGRMDW
A0BP70_PARTE/7-282..........................................................SC.......SGW..........
Q16J92_AEDAE/9-260..........................................................HC.......CGA....EGPNDW
CD81_MOUSE/9-229..........................................................NC.......CGS....NALTTL
Q16LT4_AEDAE/34-246..........................................................QC.......CGF....HRYTDW
H3DF34_TETNG/10-245..........................................................KC.......CGW....TGPGNW
H3CSH9_TETNG/9-237..........................................................QC.......CGI....HNYSDW
Q86D97_SCHMA/7-231..........................................................RC.......CGV....NGYEDY
A1Z6T8_DROME/7-220..........................................................HC.......CGR....NSAEDY
Q3UGA5_MOUSE/74-317..........................................................QC.......CGA....VSYQDW
Q29IZ2_DROPS/18-232..........................................................GC.......CGA....TGPWDY
A8X5P0_CAEBR/7-223..........................................................HC.......CGA....TSQTQY
Q16HS1_AEDAE/9-225..........................................................GC.......CGK....ISFLDW
Q4S5B5_TETNG/8-230..........................................................RC.......CGV....TGHRDW
Q24C18_TETTS/14-278..........................................................DC.......TGM..........
G7NV03_MACFA/6-238..........................................................KC.......CGF....TNYTDF
TSPA_DICDI/14-223..........................................................KC.......CKWSNVSIDSSDL
TSN33_MOUSE/21-264..........................................................SC.......CGG....ISYRDW
A0CWV3_PARTE/4-272..........................................................NC.......AGW..........
TET6_ARATH/4-244..........................................................GC.......CKP..........
Q9W4X6_DROME/42-295..........................................................KC.......CGLS..NSGYQDW
F6ZCC3_XENTR/20-287..........................................................HC.......CGN....NGFRDW
CD63_MOUSE/9-231..........................................................NC.......CGA....SNYTDW
TSN8_HUMAN/7-234..........................................................KC.......CGL...VNGAADW
Q7K2V7_DROME/7-219..........................................................SC.......CGN....TGYQQY
H3D1H6_TETNG/11-249..........................................................DC.......CGA....EGWRDW
TSN14_HUMAN/14-261..........................................................QC.......CGA....YGPEDW
TSPE_DICDI/16-219..........................................................RC.......CGWSKEIEGNY..
TSN32_HUMAN/9-223..........................................................LC.......CGK..........
B4I8V1_DROSE/9-225..........................................................QC.......CGV....DGPLDY
Q16TV5_AEDAE/8-254..........................................................QC.......CGV....SSYEDW
Q7PTA7_ANOGA/9-220..........................................................QC.......CGK....RSFLDY
TSPD_DICDI/11-223..........................................................EC.......C............
F1R4A1_DANRE/13-252..........................................................KC.......CGV....DSYLDW
Q9NB13_DROME/7-221..........................................................GC.......CGD....TSYTNY
Q292V6_DROPS/9-211..........................................................RC.......CGL....EGPQDY
Q6YWS4_ORYSJ/4-277..........................................................GC.......CKP..........
Q4D693_TRYCC/53-286..........................................................HCSGFASTHCCV..........
TSPB_DICDI/14-223..........................................................KC.......CYWNSTSSRN...
A0EF92_PARTE/7-263..........................................................DC.......SGW..........
TET9_ARATH/4-258..........................................................GC.......CKP..........
Q5I0R1_XENTR/7-227..........................................................QC.......CGL...VNGYTDW
Q7SXT2_DANRE/16-243..........................................................QC.......CGE....ENYTSW
Q9XVI4_CAEEL/8-223..........................................................EC.......CGV....TNSSDW
A2DRK6_TRIVA/7-225..........................................................EC.......CGFIKEYNETEMM
Q22RT6_TETTS/8-279..........................................................NC.......SGF..........
A2DY51_TRIVA/7-217..........................................................EC.......CSF....NQ....
L9JBT3_TUPCH/21-370KTLWLRKRPKHPGKSAPRRNKLDHSAVIKFPLTAQSAMKKIEDNNTLVFVMDVKATSTSC.......CGG....ISYKDW
Q6Z5Z9_ORYSJ/5-263..........................................................GC.......CKP..........
Q6NYK2_DANRE/15-289..........................................................HC.......CGN....TDYRDW
Q75IM5_ORYSJ/6-249..........................................................GC.......CKP..........
H3DMZ9_TETNG/7-217..........................................................KC.......CGL....KGPSDW
CD37_RAT/10-270..........................................................RC.......CGW....QSPRDW
Q7JZW7_DROME/7-210..........................................................EC.......CGD....KGFSDY
A8XFB8_CAEBR/15-256..........................................................KC.......CGV....NGTDDA
Q7QJ21_ANOGA/9-222..........................................................RC.......CGY....NGIHDY
TET2_ARATH/3-256..........................................................GC.......CKP..........
Q7JZW3_DROME/8-216..........................................................QC.......CGV....NSSEDY
Q19983_CAEEL/7-277..........................................................EC.......CGV....KTYTDW
B3DL95_XENTR/8-226..........................................................RC.......CGV....KNATDW
Q9FVY6_ORYSJ/5-257..........................................................GC.......CRP..........
ROM1_BOVIN/16-292..........................................................HC.......CGR....HGYKDW
Q5ZII8_CHICK/15-247..........................................................KC.......CGS....NNYTDW
Q22495_CAEEL/37-297..........................................................MC.......CGI....NGADDW
Q6DHQ4_DANRE/8-230..........................................................RC.......CGV....TNHTDW
Q7K527_DROME/7-208..........................................................YC.......CGR....DSAQDY
TSN15_MOUSE/19-259..........................................................KC.......CGG....EDYRDW
Q67WQ6_ORYSJ/4-259..........................................................GC.......CKP..........
G4LW70_SCHMA/10-212..........................................................HC.......CGA....KGPNDY
Q16HS3_AEDAE/6-221..........................................................GC.......CGK....RSFRDW
Q29JV1_DROPS/14-246..........................................................EC.......CGV....NKPEDW
Q9VID1_DROME/8-228..........................................................DC.......CGI....NGPNDW
H9KCQ4_APIME/8-222..........................................................QC.......CGV....HSLSDY
Q7JWV7_DROME/7-218..........................................................KC.......CGL....NGFADY
O44582_CAEEL/29-290..........................................................EC.......CGVSSIAQGYRDW
C4Q3U8_SCHMA/12-223..........................................................GC.......CGV....TSAADY
Q17441_CAEEL/23-259..........................................................KC.......CGS....NAFNDW
CD82_HUMAN/8-256..........................................................KC.......CGW....VSFYNW
TSN12_HUMAN/9-248..........................................................KC.......CGV....VYFTDW
Q4D6X7_TRYCC/23-265..........................................................HC.......SGW....KELCNT
Q7T376_DANRE/6-213..........................................................GC.......CGI....QNATDW
TSN11_BOVIN/15-248..........................................................KC.......CGS....NSSADW
Q6P2T9_DANRE/9-230..........................................................KC.......CGG....NSSSDW
A8WRV5_CAEBR/9-230..........................................................QC.......CGA....SGCSDY
Q24C21_TETTS/14-285..........................................................DC.......TGM..........
Q245V1_TETTS/9-274..........................................................DC.......SGF..........
Q7KJ73_DROME/8-218..........................................................HC.......CGS....SSALDY
M4EKP0_BRARP/8-252..........................................................GC.......CRP..........
Q1HRC5_AEDAE/13-234..........................................................KC.......CGV....KHYNDW
A1Z6U7_DROME/7-216..........................................................HC.......CGY....NGADDY
H2VAF3_TAKRU/20-284..........................................................RC.......CGN....DNYRDW
Q16LT5_AEDAE/17-240..........................................................EC.......CGV....NNYQDW
Q29JV0_DROPS/10-238..........................................................NC.......CGV....SDYKDW
A0BI34_PARTE/7-267..........................................................QC.......SGW..........
Q7K010_DROME/6-211..........................................................QC.......CGR....GSPQDY

PF04103

FCERB_HUMAN/60-204----------------------------------------------------------..-------...----------
FCERB_MOUSE/52-195----------------------------------------------------------..-------...----------
T176B_HUMAN/66-229----------------------------------------------------------CD-------RSD----------
A6H741_BOVIN/62-223----------------------------------------------------------CD-------SLV----------
T176B_MOUSE/60-224----------------------------------------------------------ST-------CNP----------
T176B_RAT/60-224----------------------------------------------------------ST-------CDS----------
T176A_RAT/63-223----------------------------------------------------------SD-------TSY----------
T176A_HUMAN/56-214----------------------------------------------------------SS-------SS.----------
T176A_BOVIN/63-220----------------------------------------------------------VS-------PS.----------
Q4TAI3_TETNG/57-208----------------------------------------------------------..-------...----------
A7SQ32_NEMVE/7-164----------------------------------------------------------YY-------...----------
Q95PZ5_CAEEL/94-253----------------------------------------------------------DE-------AFC----------
Q9GYM6_CAEEL/45-206----------------------------------------------------------WH-------LLA----------
Q1LVQ8_DANRE/42-197----------------------------------------------------------SC-------...----------
H3D3M7_TETNG/37-190----------------------------------------------------------SC-------...----------
Q3TRE0_MOUSE/29-182----------------------------------------------------------TC-------...----------
A7S4D6_NEMVE/20-179----------------------------------------------------------VD-------QSC----------
Q0V9M1_XENTR/36-200----------------------------------------------------------FN-------SDG----------
F6PJ14_XENTR/5-167----------------------------------------------------------MN-------EGK----------
F189B_MOUSE/36-196----------------------------------------------------------KV-------CVC----------
Q5BLA7_DANRE/16-153----------------------------------------------------------..-------...----------
F7AIP4_XENTR/16-154----------------------------------------------------------..-------...----------
Q08BU9_DANRE/43-180----------------------------------------------------------..-------...----------
F1RAY4_DANRE/49-184----------------------------------------------------------..-------...----------
F7ESV6_XENTR/53-198----------------------------------------------------------..-------...----------
H3C9F3_TETNG/67-212----------------------------------------------------------..-------...----------
MS4A3_MOUSE/27-172----------------------------------------------------------..-------...----------
MS4A3_HUMAN/50-196----------------------------------------------------------..-------...----------
M4A4A_HUMAN/65-207----------------------------------------------------------..-------...----------
M4A6C_MOUSE/47-207----------------------------------------------------------KE-------L..----------
M4A6B_MOUSE/47-204----------------------------------------------------------K.-------...----------
M4A6D_MOUSE/47-207----------------------------------------------------------FT-------Q..----------
MS4A7_HUMAN/47-207----------------------------------------------------------MD-------Y..----------
F6RP33_BOVIN/48-208----------------------------------------------------------RD-------Y..----------
Q99N04_MOUSE/47-204----------------------------------------------------------KK-------F..----------
MS4A5_HUMAN/49-189----------------------------------------------------------..-------...----------
Q810P8_MOUSE/49-189----------------------------------------------------------..-------...----------
Q2KII2_BOVIN/49-189----------------------------------------------------------..-------...----------
Q3LRP2_CALJA/51-216----------------------------------------------------------LN-------LIR----------
CD20_MOUSE/44-210----------------------------------------------------------LE-------LIQ----------
CD20_CANFA/51-216----------------------------------------------------------LN-------LIK----------
W5PU80_SHEEP/51-216----------------------------------------------------------LN-------LIK----------
M3VZQ9_FELCA/52-215----------------------------------------------------------LN-------LLK----------

PF13273

D7UXS6_LISGR/3-100-------------------------------------------------------------------KGW----------
C2RQC7_BACCE/10-90-------------------------------------------------------------------YGV----------
C3AKH5_BACMY/2-83-------------------------------------------------------------------YGL----------
Q2B2X7_9BACI/2-86-------------------------------------------------------------------FGG----------
A0A031KR27_ENTFC/3-104-------------------------------------------------------------------YGI----------
C7DIS7_MICA2/29-132-------------------------------------------------------------------WSI----------
D7DCC0_STAHD/4-91-------------------------------------------------------------------GGI----------
A0B9F9_METTP/2-84-------------------------------------------------------------------GGA----------
Q12UE5_METBU/2-98-------------------------------------------------------------------GGK----------
B9DJA4_STACT/148-230-------------------------------------------------------------------MGV----------
C4WAZ9_STAWA/11-93-------------------------------------------------------------------MGV----------
Q4L9M4_STAHJ/13-95-------------------------------------------------------------------IGI----------
A5UKZ4_METS3/8-83-------------------------------------------------------------------GGF----------
A5N2M2_CLOK5/4-86-------------------------------------------------------------------GGI----------
F0K6E7_CLOAE/4-86-------------------------------------------------------------------GGA----------
A9VVN7_BACWK/2-84-------------------------------------------------------------------GGT----------
B3ZH23_BACCE/2-84-------------------------------------------------------------------GGI----------
C3BEA6_BACMY/2-84-------------------------------------------------------------------GGA----------
Q4V1S6_BACCZ/2-84-------------------------------------------------------------------GGA----------
D4FV71_BACNB/2-84-------------------------------------------------------------------GGI----------
C2VWU6_BACCE/24-113-------------------------------------------------------------------GSL----------
C2U6N9_BACCE/2-85-------------------------------------------------------------------AGF----------
A5UL06_METS3/42-117-------------------------------------------------------------------GGI----------
O26620_METTH/8-82-------------------------------------------------------------------GGA----------
C8JWL3_LISMN/13-93-------------------------------------------------------------------GGV----------
D7V0U0_LISGR/3-121-------------------------------------------------------------------AGI----------
A0A024I3A1_LISMN/3-121-------------------------------------------------------------------AGY----------
D3KN98_LISMN/3-121-------------------------------------------------------------------AGY----------
E3YXI7_LISIO/3-121-------------------------------------------------------------------AGF----------
D3ULL7_LISSS/3-121-------------------------------------------------------------------SGF----------
A8FJ46_BACP2/3-107-------------------------------------------------------------------SGV----------
B4AK11_BACPU/3-107-------------------------------------------------------------------SGV----------
C2H7S4_ENTFC/2-107-------------------------------------------------------------------ATG----------
C9ATK3_ENTFC/2-107-------------------------------------------------------------------ATG----------
E6TU87_BACCJ/2-115-------------------------------------------------------------------SGL----------
B9CUN6_STACP/3-110-------------------------------------------------------------------AGI----------
C5QNE2_9STAP/3-110-------------------------------------------------------------------AGI----------
C2LZ67_STAHO/18-125-------------------------------------------------------------------AGI----------
Q4L9F8_STAHJ/19-126-------------------------------------------------------------------AGI----------
C4WCX0_STAWA/2-110-------------------------------------------------------------------AGV----------
Q4A0V3_STAS1/2-109-------------------------------------------------------------------AGV----------
C5QZN6_STAEP/3-109-------------------------------------------------------------------SGI----------
D3QGJ5_STALH/3-111-------------------------------------------------------------------SAI----------
D3QGJ6_STALH/3-111-------------------------------------------------------------------SAI----------
Q4A0E9_STAS1/2-112-------------------------------------------------------------------VGI----------
C5NV51_9BACL/5-120-------------------------------------------------------------------SGI----------
C5NWK3_9BACL/5-118-------------------------------------------------------------------SGI----------
H7FJC6_STASA/2-102-------------------------------------------------------------------AAC----------
Q8ERL5_OCEIH/2-100-------------------------------------------------------------------SGI----------
A7A3G5_BIFAD/15-115-------------------------------------------------------------------SRW----------

PF00335

TET11_ARATH/4-262.............................................PSD.........CNFEFRNATFW............
TSN16_HUMAN/10-243SGSSFEMTT................................GHTYPRS.........CCK....................
Q16LT3_AEDAE/14-239TFFFKNSPNATE..........................GTNSFVVPES.........CCPPSTL................
H3DJN8_TETNG/8-231IGTPWYSSH................................NNTVPLS.........CCKNATGCS..............
Q9V3X2_DROME/9-261ATSRFNNVDRTNIVEI..................AVSSMNVFYNIPES.........CCKDNL.................
TSN5_HUMAN/14-261NLNIYFNCTDSNA.........................SRERCGVPFS.........CCTKDPAE...............
Q6Z6K0_ORYSJ/3-259.............................................PAV.........CGYNYVSPTV.............
Q29D35_DROPS/9-259DASPAWKENK..............................GNRTIPEA.........CCVLKD.................
Q7Q1S3_ANOGA/9-239GRANAVKFN................................ETFLPMT.........CCRQQTGAVGY............
TET15_ARATH/53-313.............................................PET.........CNMDAINATFWYRRKDEGPPSSM
Q292W4_DROPS/7-217SFQGYF.......................................PPS.........C......................
H3CCQ2_TETNG/10-245SGNMIIKNSS...............................MLLFPCS.........CQNIST.................
Q9VMJ6_DROME/18-261DSNNYFNCSSIAI........................GSREACGVPFS.........CCRRRPQEVIKNKQC....GYDV
TSN6_BOVIN/16-237KDTNYYSE..................................KGFPES.........C......................
Q06AT4_PIG/10-257QKYTSAFRTENN...........................DADYPWPRQ.........CCVMNKLKEPL............
Q16GP3_AEDAE/9-261NLSDKWNESK..............................GNRLIPEA.........CCMQT..................
TET13_ARATH/15-272.............................................PLS.........CGLNYEKPNN.............
M9PDV2_DROME/8-255YDIQSWPGR.................................RWVPES.........CCRTLYDQRQ.............
Q24FE3_TETTS/5-263.........................................................C......................
A2BIP5_DANRE/16-252EVNQYHLCDGKS...........................PLACGVPYT.........CCIRQSVG...............
Q4DD38_TRYCC/89-308.............................................PPEWVDA.VCPLC......................
TSN8_BOVIN/7-235GSNFQH......................................YYRT.........CE.....................
TSN10_HUMAN/75-319QQNLYFNCSSPG...........................VQACSLPAS.........CCIDPREDG..............
Q176T5_AEDAE/20-244YDNNNKT.....................................MPAS.........CCKPDLIDPDTND.........C
TET5_ARATH/4-245.............................................PTS.........CVYNT..................
A2EZ30_TRIVA/7-219N........................................................CGYQQN.................
A1Z8K7_DROME/8-233RTLSANK....................................TLPGS.........CCQPQYIDSTVGH.........C
Q16HX5_AEDAE/9-218GINI.........................................PQS.........C......................
Q6Z8Q8_ORYSJ/5-259.............................................PTS.........CNFTYGGGTR.............
F1Q6P4_DANRE/9-244DENHIIKNNT...............................VPLYPCS.........CHNYSI.................
A0BP70_PARTE/7-282.........................................................C......................
Q16J92_AEDAE/9-260QSSVYNNADRSSIVNI..................AISKLNVAYKVPES.........CCVEGLSAAECN...........
CD81_MOUSE/9-229TTTILRNSLCPS...........................GGNILTPLL................................
Q16LT4_AEDAE/34-246FEFNEDR.....................................IPSS.........C......................
H3DF34_TETNG/10-245SNNLLIKNSS...............................QNLYPCS.........CRNESL.................
H3CSH9_TETNG/9-237QYTHWYEESK...............................NNSVPIS.........CCKY...................
Q86D97_SCHMA/7-231RESI.........................................PIA.........CCDH...................
A1Z6T8_DROME/7-220LHLEKM......................................PPPS.........C......................
Q3UGA5_MOUSE/74-317QQNLYFNCSSPG...........................VQACSLPAS.........CCINPQEDG..............
Q29IZ2_DROPS/18-232LDLHQP......................................LPSS.........C......................
A8X5P0_CAEBR/7-223LYVKDGLC..................................GPKPIA.........Y......................
Q16HS1_AEDAE/9-225GNKL.........................................PDS.........C......................
Q4S5B5_TETNG/8-230YAALHDN....................................LVPDS.........C......................
Q24C18_TETTS/14-278.........................................................C......................
G7NV03_MACFA/6-238EDSPYVREN.................................NAFPPF.........CCNNVTNTVNE............
TSPA_DICDI/14-223.........................................................C......................
TSN33_MOUSE/21-264SQNMYFNCSEDNP.........................SRERCSVPYS.........CCLPTPNQ...............
A0CWV3_PARTE/4-272.........................................................C......................
TET6_ARATH/4-244.............................................PTA.........CTYEA..................
Q9W4X6_DROME/42-295SKNEYFNCSSPS...........................VEKCGVPYS.........CCINATDIS..............
F6ZCC3_XENTR/20-287FEIQWISARYLDMGSKEVVD..........RFKSNVDGKYLLDGVPFS.........CCNPNSPR...............
CD63_MOUSE/9-231ENIPGMAK..................................DRVPDS.........CCIN...................
TSN8_HUMAN/7-234GNNFQH......................................YPEL.........CA.....................
Q7K2V7_DROME/7-219ETV..........................................PSS.........C......................
H3D1H6_TETNG/11-249LNSDWAVQHTTFQT......................SENGSSVSLPDS.........CCVRRK.................
TSN14_HUMAN/14-261DLNVYFNCSGASY.........................SREKCGVPFS.........CCVPDPAQ...............
TSPE_DICDI/16-219.........................................................C......................
TSN32_HUMAN/9-223.....K......................................SPFSRLGSTEADLC......................
B4I8V1_DROSE/9-225RRLSL........................................PWS.........C......................
Q16TV5_AEDAE/8-254YDISAWPGE.................................RWVPRS.........CCRPRYNSL..............
Q7PTA7_ANOGA/9-220GVASF........................................PQS.........C......................
TSPD_DICDI/11-223.........................................................CFDE...................
F1R4A1_DANRE/13-252SKNMYFNSSEHNP.........................SLEAYGVPFS.........CCIRQKNE...............
Q9NB13_DROME/7-221NNIGLS......................................VPGT.........C......................
Q292V6_DROPS/9-211LGEENGA.....................................LPAS.........C......................
Q6YWS4_ORYSJ/4-277.............................................PVY.........CGYERVNETF.............
Q4D693_TRYCC/53-286.....SNVTAERLPDVSPCYL.........LAEDGVTTLDPNTLQPVSWPSLTCAPRC......................
TSPB_DICDI/14-223.............................................PLL.........C......................
A0EF92_PARTE/7-263.........................................................C......................
TET9_ARATH/4-258.............................................SND.........CDFTYITST..............
Q5I0R1_XENTR/7-227GANI.........................................PAS.........CIC....................
Q7SXT2_DANRE/16-243ANTTYFEK..................................EGIPKS.........CCNVT..................
Q9XVI4_CAEEL/8-223LTFTTI.......................................PDS.........CCIEEIEG...............
A2DRK6_TRIVA/7-225N........................................................CGYTSNSSS..............
Q22RT6_TETTS/8-279.........................................................C......................
A2DY51_TRIVA/7-217.............................................PTVSE....TVRC......................
L9JBT3_TUPCH/21-370SLNMYFNCSEDNP.........................SRERCSVPYS.........CCLPTPNQ...............
Q6Z5Z9_ORYSJ/5-263.............................................PTA.........CNFTYQNETY.............
Q6NYK2_DANRE/15-289FEVQWISNRYLDFSSKEVKD..........RIRSNVDGRYLVDGVPFS.........CCNPSSPR...............
Q75IM5_ORYSJ/6-249.............................................PTA.........CAYSGG.................
H3DMZ9_TETNG/7-217TKI..........................................PDS.........C......................
CD37_RAT/10-270NKAQMLKANGS.............................EELFVPCS.........CYNSTATNDSSGFDK....LFLS
Q7JZW7_DROME/7-210TSLNMK......................................VPRS.........C......................
A8XFB8_CAEBR/15-256QIWKTSKWYMHQ..........................KAPKSLIPES.........CCI....................
Q7QJ21_ANOGA/9-222KKNKQMG.....................................FPWS.........C......................
TET2_ARATH/3-256.............................................PTA.........CGYNFVNPT..............
Q7JZW3_DROME/8-216WIIHHG......................................IPSS.........C......................
Q19983_CAEEL/7-277LSARWDAEPSTQLEVNEEDAGRI....EHGIGAFGGNKGTGYGRVPSS.........CCNEHGKL...............
B3DL95_XENTR/8-226LESKGS......................................VPHT.........C......................
Q9FVY6_ORYSJ/5-257.............................................PAE.........CGYPAVNASY.............
ROM1_BOVIN/16-292FGIQWVSNRYLDPNDPDVVD..........RIQSNVEGLYLIDGVPFS.........CCNPHSPR...............
Q5ZII8_CHICK/15-247ADSMWIKSPEA.............................SGRKVPDS.........CCKT...................
Q22495_CAEEL/37-297DRNTYFSIEAREV........................ASPEAGGVPFS.........CCINSSKLEFKNYF......CGH
Q6DHQ4_DANRE/8-230FQVYNTS....................................RVPDS.........C......................
Q7K527_DROME/7-208LDIKFWNN...................................TVPSS.........C......................
TSN15_MOUSE/19-259SKNQYHDCSAPG...........................PLACGVPYT.........CCIRNTTD...............
Q67WQ6_ORYSJ/4-259.............................................PTG.........CNFAYVSETV.............
G4LW70_SCHMA/10-212LGNV.........................................PAS.........C......................
Q16HS3_AEDAE/6-221LNDDGS......................................IPTS.........C......................
Q29JV1_DROPS/14-246KDYFSPNKNETL..........................DTDDVVVPNS.........CC.....................
Q9VID1_DROME/8-228ETVYRNS....................................TLPAA.........C......................
H9KCQ4_APIME/8-222NDKPI........................................PAS.........C......................
Q7JWV7_DROME/7-218GITY.........................................PAS.........CCDSPSNG...............
O44582_CAEEL/29-290NMSYQFNCTNSNP.........................QPEKCGVPFS.........CCRKSVISEAAGSS.......NP
C4Q3U8_SCHMA/12-223GTRSP........................................PKS.........C......................
Q17441_CAEEL/23-259PKPEVEDHYLPYAK......................TVVQRVQYIPDS.........CCK....................
CD82_HUMAN/8-256TDNAELMNRP...............................EVTYPCS.........CEVKGEEDNSL............
TSN12_HUMAN/9-248LEMTEMD....................................WPPDS.........CCV....................
Q4D6X7_TRYCC/23-265SNVEFMNPLIRKGNQLSLREGALGDVNTAEMLPHTSNNNSDSKIICPT.........C......................
Q7T376_DANRE/6-213QGFV.........................................PQS.........C......................
TSN11_BOVIN/15-248LQSSYILSPEA.............................EGRRVPDS.........CCKT...................
Q6P2T9_DANRE/9-230VNFSADHI...................................SVPDS.........CCKNV..................
A8WRV5_CAEBR/9-230MVYGAF.......................................PTS.........CQC....................
Q24C21_TETTS/14-285.........................................................C......................
Q245V1_TETTS/9-274.........................................................C......................
Q7KJ73_DROME/8-218IGKGDL......................................VPPS.........C......................
M4EKP0_BRARP/8-252.............................................PVE.........CGFEAKNATW.............
Q1HRC5_AEDAE/13-234RGSI.........................................PQS.........CCQ....................
A1Z6U7_DROME/7-216KRLHLL......................................VPAS.........C......................
H2VAF3_TAKRU/20-284FEIQWVSNRYLDFSSKEVKD..........RIGSNVDGQYLMDGVPFS.........CCNPSSPR...............
Q16LT5_AEDAE/17-240EDVFAVVDLDNG...........................DLEAELPAS.........CCREYL.................
Q29JV0_DROPS/10-238AVTYPNA....................................SLPIS.........CCTIPVGAAGTF..........S
A0BI34_PARTE/7-267.........................................................C......................
Q7K010_DROME/6-211IVNERL......................................PPET.........C......................

PF04103

FCERB_HUMAN/60-204--------------------------------------------------------------------------------
FCERB_MOUSE/52-195--------------------------------------------------------------------------------
T176B_HUMAN/66-229--------------------------------------------------------------------------------
A6H741_BOVIN/62-223--------------------------------------------------------------------------------
T176B_MOUSE/60-224--------------------------------------------------------------------------------
T176B_RAT/60-224--------------------------------------------------------------------------------
T176A_RAT/63-223--------------------------------------------------------------------------------
T176A_HUMAN/56-214--------------------------------------------------------------------------------
T176A_BOVIN/63-220--------------------------------------------------------------------------------
Q4TAI3_TETNG/57-208--------------------------------------------------------------------------------
A7SQ32_NEMVE/7-164--------------------------------------------------------------------------------
Q95PZ5_CAEEL/94-253--------------------------------------------------------------------------------
Q9GYM6_CAEEL/45-206--------------------------------------------------------------------------------
Q1LVQ8_DANRE/42-197--------------------------------------------------------------------------------
H3D3M7_TETNG/37-190--------------------------------------------------------------------------------
Q3TRE0_MOUSE/29-182--------------------------------------------------------------------------------
A7S4D6_NEMVE/20-179--------------------------------------------------------------------------------
Q0V9M1_XENTR/36-200--------------------------------------------------------------------------------
F6PJ14_XENTR/5-167--------------------------------------------------------------------------------
F189B_MOUSE/36-196--------------------------------------------------------------------------------
Q5BLA7_DANRE/16-153--------------------------------------------------------------------------------
F7AIP4_XENTR/16-154--------------------------------------------------------------------------------
Q08BU9_DANRE/43-180--------------------------------------------------------------------------------
F1RAY4_DANRE/49-184--------------------------------------------------------------------------------
F7ESV6_XENTR/53-198--------------------------------------------------------------------------------
H3C9F3_TETNG/67-212--------------------------------------------------------------------------------
MS4A3_MOUSE/27-172--------------------------------------------------------------------------------
MS4A3_HUMAN/50-196--------------------------------------------------------------------------------
M4A4A_HUMAN/65-207--------------------------------------------------------------------------------
M4A6C_MOUSE/47-207--------------------------------------------------------------------------------
M4A6B_MOUSE/47-204--------------------------------------------------------------------------------
M4A6D_MOUSE/47-207--------------------------------------------------------------------------------
MS4A7_HUMAN/47-207--------------------------------------------------------------------------------
F6RP33_BOVIN/48-208--------------------------------------------------------------------------------
Q99N04_MOUSE/47-204--------------------------------------------------------------------------------
MS4A5_HUMAN/49-189--------------------------------------------------------------------------------
Q810P8_MOUSE/49-189--------------------------------------------------------------------------------
Q2KII2_BOVIN/49-189--------------------------------------------------------------------------------
Q3LRP2_CALJA/51-216--------------------------------------------------------------------------------
CD20_MOUSE/44-210--------------------------------------------------------------------------------
CD20_CANFA/51-216--------------------------------------------------------------------------------
W5PU80_SHEEP/51-216--------------------------------------------------------------------------------
M3VZQ9_FELCA/52-215--------------------------------------------------------------------------------

PF13273

D7UXS6_LISGR/3-100--------------------------------------------------------------------------------
C2RQC7_BACCE/10-90--------------------------------------------------------------------------------
C3AKH5_BACMY/2-83--------------------------------------------------------------------------------
Q2B2X7_9BACI/2-86--------------------------------------------------------------------------------
A0A031KR27_ENTFC/3-104--------------------------------------------------------------------------------
C7DIS7_MICA2/29-132--------------------------------------------------------------------------------
D7DCC0_STAHD/4-91--------------------------------------------------------------------------------
A0B9F9_METTP/2-84--------------------------------------------------------------------------------
Q12UE5_METBU/2-98--------------------------------------------------------------------------------
B9DJA4_STACT/148-230--------------------------------------------------------------------------------
C4WAZ9_STAWA/11-93--------------------------------------------------------------------------------
Q4L9M4_STAHJ/13-95--------------------------------------------------------------------------------
A5UKZ4_METS3/8-83--------------------------------------------------------------------------------
A5N2M2_CLOK5/4-86--------------------------------------------------------------------------------
F0K6E7_CLOAE/4-86--------------------------------------------------------------------------------
A9VVN7_BACWK/2-84--------------------------------------------------------------------------------
B3ZH23_BACCE/2-84--------------------------------------------------------------------------------
C3BEA6_BACMY/2-84--------------------------------------------------------------------------------
Q4V1S6_BACCZ/2-84--------------------------------------------------------------------------------
D4FV71_BACNB/2-84--------------------------------------------------------------------------------
C2VWU6_BACCE/24-113--------------------------------------------------------------------------------
C2U6N9_BACCE/2-85--------------------------------------------------------------------------------
A5UL06_METS3/42-117--------------------------------------------------------------------------------
O26620_METTH/8-82--------------------------------------------------------------------------------
C8JWL3_LISMN/13-93--------------------------------------------------------------------------------
D7V0U0_LISGR/3-121--------------------------------------------------------------------------------
A0A024I3A1_LISMN/3-121--------------------------------------------------------------------------------
D3KN98_LISMN/3-121--------------------------------------------------------------------------------
E3YXI7_LISIO/3-121--------------------------------------------------------------------------------
D3ULL7_LISSS/3-121--------------------------------------------------------------------------------
A8FJ46_BACP2/3-107--------------------------------------------------------------------------------
B4AK11_BACPU/3-107--------------------------------------------------------------------------------
C2H7S4_ENTFC/2-107--------------------------------------------------------------------------------
C9ATK3_ENTFC/2-107--------------------------------------------------------------------------------
E6TU87_BACCJ/2-115--------------------------------------------------------------------------------
B9CUN6_STACP/3-110--------------------------------------------------------------------------------
C5QNE2_9STAP/3-110--------------------------------------------------------------------------------
C2LZ67_STAHO/18-125--------------------------------------------------------------------------------
Q4L9F8_STAHJ/19-126--------------------------------------------------------------------------------
C4WCX0_STAWA/2-110--------------------------------------------------------------------------------
Q4A0V3_STAS1/2-109--------------------------------------------------------------------------------
C5QZN6_STAEP/3-109--------------------------------------------------------------------------------
D3QGJ5_STALH/3-111--------------------------------------------------------------------------------
D3QGJ6_STALH/3-111--------------------------------------------------------------------------------
Q4A0E9_STAS1/2-112--------------------------------------------------------------------------------
C5NV51_9BACL/5-120--------------------------------------------------------------------------------
C5NWK3_9BACL/5-118--------------------------------------------------------------------------------
H7FJC6_STASA/2-102--------------------------------------------------------------------------------
Q8ERL5_OCEIH/2-100--------------------------------------------------------------------------------
A7A3G5_BIFAD/15-115--------------------------------------------------------------------------------

PF00335

TET11_ARATH/4-262IPPSKNETAVAENGDCGTWSNVQTELCFNCNACKAGV...LANIR..EKWRNLLVFNICLLILL.I.......TVYSCGC
TSN16_HUMAN/10-243.........SIGSVSCDGRDVSPNVIH..QKGCFHKL...LKITK..TQ...SFTLSGSSLGAA.VIQRWGSRYVAQAGL
Q16LT3_AEDAE/14-239.....KESCIPY.................EYGCMDRL...QWVVA..QS...AALIATGAITVS.FVQI....LGSVCAF
H3DJN8_TETNG/8-231..GRLDQLDLLN.................LQGCETEL...DRLFQ..GV...LGYALLVILGFA.IIKF....FGMLSVC
Q9V3X2_DROME/9-261.....KDNECELSRRLKFGGPLNNAIY..QQGCVDKL...IEIIY..EN...WVTIFAVTAAVI.LLEL....LSLTFAL
TSN5_HUMAN/14-261...DVINTQCGYDARQKPEVDQQIVIY..TKGCVPQF...EKWLQ..DN...LTIVAGIFIGIA.LLQI....FGICLAQ
Q6Z6K0_ORYSJ/3-259..WAGPAARPAADADCGAWGNDPSQLCYECESCRAGL...LAALR..AQWHRANVALVVATVAL.V.......FLYLVGC
Q29D35_DROPS/9-259.....VAALVPRDEDCVTNPSDSNSFY..KKGCYEVF...TEWLI..GQ...RELIIIV.IGVG.IVHL....ILIILAF
Q7Q1S3_ANOGA/9-239VACPDPTSATLR.................KTGCIDSF...GDFIK..AH...AVSLGAAGIALA.VIQF....FGILFAC
TET15_ARATH/53-313NLMYGDEMMVGRISDCQLWRNDWSILCYDCRSCKFGF...IRSVR..RK...WWQLGIFLIVIS..ILLLMSHLLIFLAT
Q292W4_DROPS/7-217...........C...KDTNNCRPDTVY..RRGCKAAF...VEFWD..RN...SDIIKYAGLVIA.AIEF....VGFVFAC
H3CCQ2_TETNG/10-245......AAGNASDSGFCEAPTPDWPVY..EAGCAASV...ERWVL..TN...IGVVLGICVGVA.VIEL....LGMVLSI
Q9VMJ6_DROME/18-261RKEGYPVDRNIH.................ERGCLRAG...EDWLE.......AHLISVAIGCVA.........LLVLQGM
TSN6_BOVIN/16-237...........CKLEDCSPQRDADKVN..NEGCFIMV...MTIIE..SE...MGVVAGISFGVA.CFQL....IGIFLAY
Q06AT4_PIG/10-257.NLEACKLGVPG..............YYHNQGCYELI...SGPMN..RHAWGVAWFGFAILCWT.........FWVLLGT
Q16GP3_AEDAE/9-261......SLFELLDKNCPVSPSESNSYY..KKGCYNAL...IDWIM..YN...RNLVIIVAIGVG.LVQL....LAIFLSF
TET13_ARATH/15-272..WTVSRYYNNLEVDCKRWNNSADTLCFDCDSCKAVI...IADVH..NTSFSITV.NIIHIIFS.L.......CIGMTGW
M9PDV2_DROME/8-255..VLTEGSGDGMMRPDCGRSENPSLWW..DKGCAHSL...QSWFT..GQ...LNVVGAVGLGIA.FVQL....FGLITSM
Q24FE3_TETTS/5-263...........SQNSYYLFSDLNDGIP..NGDCKVHV...INFVE..DNIIAIVISSSFITVLL.L.......VSLIFNI
A2BIP5_DANRE/16-252...EVVNTLCGYKTLHQQREALDGVIH..VRGCIHAV...NLWMG..DN...IGATIGICCAVG.LPQL....LGILLSC
Q4DD38_TRYCC/89-308......................PSFPPMSPVVCTDVV...YSTVR..KNLSGFLVISIFSMVLV.V.......VGILFAL
TSN8_BOVIN/7-235.........CPSESDSSCTKYSGKTIY..KQSCFASI...SQMFS..KR...LFIVLALAFGLA.AIEV....LGLIFSI
TSN10_HUMAN/75-319...ASVNDQCGFGVLRLDADAAQRVVY..LEGCGPPL...RRWLR..AN...LAASGGYAIAVV.LLQG....AELLLAA
Q176T5_AEDAE/20-244KNAPPLFMDRYY.................QDGCLMKL...KEHFD..KN...AVVLIAVGFVIA.AFQL....LGVIFAC
TET5_ARATH/4-245......DTVIQQDPDCYRWNNAATVLCYDCDTCRAGV...LETVR..RDWHKLSLVNVIVVIFL.I.......AVYCVGC
A2EZ30_TRIVA/7-219......NTSNSTDNNITDTNSTENNTTGNVQTCYNKI...DENLN..KSKKGLKIARIVVIVVQ.A.......LLLIYSI
A1Z8K7_DROME/8-233LESPALGKDKYF.................QVGCVGKL...KDRIE..KN...AIILIGVGIGIA.FIQI....LGIVLAC
Q16HX5_AEDAE/9-218...........C.....RTGTAPGCVF.FVEGCQSRI...GEFID..TA...GDVLGWVSLGVA.AVEL....VGLIAAC
Q6Z8Q8_ORYSJ/5-259..WGKTARLSSADPDCDEWSNDADEVCYGCRSCKAGV...VAALK..RDWKRVAIVNVVFLAFI.V.......VVYSVGC
F1Q6P4_DANRE/9-244......QAPIVPDNGFCQASSSDWPIY..QTGCLEHV...GSWLF..TN...YGIILGICLGVA.VIEL....LGMILSM
A0BP70_PARTE/7-282...........FPSSIYIFSDVNAGTP..KDHCYGAI...TGYAK..DICVYIGAVAVSVCFIM.I.......LCITCVL
Q16J92_AEDAE/9-260NARTKGLITSII..........KDDIY..SDGCMEKL...VNEIK..KN...IKSVYIIGACVI.GVEI....LALFFAL
CD81_MOUSE/9-229.............................QQDCHQKI...DELFS..GK...LYLIGIAAIVVA.VIMI....FEMILSM
Q16LT4_AEDAE/34-246................FASLEEGSTPF..QQGCFNRM...SQVIS..YV...VNLMASGTTIII.IFQV....ICIVSAV
H3DF34_TETNG/10-245......PGSDIRPVGLCEHLSTDLPVY..ETGCITNV...EKWLL..EN...CGVILGICAVVA.VIEL....LGMILSM
H3CSH9_TETNG/9-237.......SVGSC....TGSLTHPGDLY..QEGCEALV...VKKLR..EI...MMYVIWTALTFA.AIQI....LGMLCAC
Q86D97_SCHMA/7-231.......HVSTC....LNALLSPEEVY..KEGCKDKY...KVMLK..DK...LVIIFLATVSIA.AFEI....FCLLFSM
A1Z6T8_DROME/7-220................CLNRDCTKHLNLFMTGCEVKF...KEYVG..AK...TANFHSLSWFLV.IFEF....AGSVTTC
Q3UGA5_MOUSE/74-317...AVVNTQCGFGALGLDQNVAGQVVF..LQGCWPAL...QEWLR..GN...TGAIGDCAVAVV.MIQG....TELLLAA
Q29IZ2_DROPS/18-232..................RDTVSGNAF..FNGCVDEL...TWFFE..GK...TGWIVALAMTLA.MLNV....ICGTMSF
A8X5P0_CAEBR/7-223.............................PDNCFDRI...SHMVQ..SW...GESIVVVAFILL.AIEL....FAILFSC
Q16HS1_AEDAE/9-225................CADGQRGPNCVPFKEGCERML...EGYIR..QTGKIIGWILMWLTVFE.F.......IALTLAC
Q4S5B5_TETNG/8-230..........CQLPFQGCGRNSSNTFW..TRGCYEKV...EAWLD..EN...KHLLGTIAMCVL.VIQL....LGMAFSM
Q24C18_TETTS/14-278...........TKPLNIYFFSNINRGIPDTETCRVKF...QNFVS..SYGKVAYVVGFVVGSYL.L.......VNAILAF
G7NV03_MACFA/6-238.TCTKEKADNQK.................VEGCFQQL...LYDIR..TN...AVTVGGVAAGIG.GLEL....AAMIVSM
TSPA_DICDI/14-223...................PKDGDKIKYEGHYCGEAL...SDQFS..SK...IYAVGAAGLAIG.IIEL....VAILFSL
TSN33_MOUSE/21-264...AVINTMCGQGMQALDYLEASKVIY..TNGCIDKL...VNWIH..SN...LFLLGGVALGLA.IPQL....VGILLSQ
A0CWV3_PARTE/4-272............TPAPYYIFSDINDDSFNGESCFIET...KHFVE..SS...GKTLGYVLLGLG.IYFG....INVLFVL
TET6_ARATH/4-244.......GVVDGGGDCFRWNNGVEMLCYECDACKAGV...LEEIR..LDWRKLSVVNILVLVLL.I.......AVYAAGC
Q9W4X6_DROME/42-295..SGLVNIMCGYGVQNAPVPEATKLIW..TSGCIEIV...RVWAE..HN...LYVIAGNALGIA.LIQL....LVIYLAK
F6ZCC3_XENTR/20-287...PCIQYQITNNTAHYNYDYLTEELNIWIRGCREAL...LEYYD..DL...MQSIGLTVLLIW.LFE.....LSVLTGV
CD63_MOUSE/9-231........ITVG....CGNDFKESTIH..TQGCVETI...AIWLR..KN...ILLVAAAALGIA.FVEV....LGIIFSC
TSN8_HUMAN/7-234..........CLDKQRPCQSYNGKQVY..KETCISFI...KDFLA..KN...LIIVIGISFGLA.VIEI....LGLVFSM
Q7K2V7_DROME/7-219...........C.GYKDRTKVCEAEIYSQRPGCRQEF...VDFWA..SN...TDLIRWSSLIIA.LFEL....GIFIMSC
H3D1H6_TETNG/11-249......GCKNRPLMSDDNEGVAAAGIH..PHGCFRKV...FSLVN..DN...VFHIAAAVLGLA.FTQI....GGIALAC
TSN14_HUMAN/14-261...KVVNTQCGYDVRIQLKSKWDESIF..TKGCIQAL...ESWLP..RN...IYIVAGVFIAIS.LLQI....FGIFLAR
TSPE_DICDI/16-219....................VHFNRRESGHGYCAPYV...EKSVE..SILKYLGYYGIVLSVIELI.......LLILSGF
TSN32_HUMAN/9-223.......................QGEEAAREDCLQGI...RSFLR..THQQVASSLTSIGLALT.V.......SALLFSS
B4I8V1_DROSE/9-225...........CSRPEHAYESACDTHY..KRGCLAVV...SEQIR..NR...LLITAFGAAIIA.IFQS....LGIFCAV
Q16TV5_AEDAE/8-254...MMEGSGDDLHSVDCRKAGDPSLLW..DKSCGQIL...QMWFV..QR...LHVVGTVGLVIA.FLQL....FGLISSM
Q7PTA7_ANOGA/9-220...........C....SSGGTAPLCVP.FASGCLSRL...SEFLD..SA...GNIVAWVSLGVA.AVEL....VGLISAC
TSPD_DICDI/11-223.......SDLKLNCTALCPQDDQKNILYNGTFCYDVI...FGAVN..SK...LYLVGSAGVAIG.VIEL....VSLMFAL
F1R4A1_DANRE/13-252...TVFNSMCGYETQKMKKSLAGRLIY..TSGCLDEM...VWWGQ..QN...LLLVGGMTLVLL.CLEI....CMMSLAS
Q9NB13_DROME/7-221...........CGYLDRQATCNTPSVYQSRPGCSAKF...EEFWN..DN...MDIIRWSGLGLC.IFDL....VVFLIAG
Q292V6_DROPS/9-211................CFAFDCSNPTNVFQQGCATKA...NENLK..MQ...ADITYYCCMAII.ALEF....MGILTAY
Q6YWS4_ORYSJ/4-277.WIAPARGLDAADVDCLEWSNDQAVLCFRCNACKASA...LDTVR..RNWRAVAVLNVAVLAIL.M.......LAYSLAC
Q4D693_TRYCC/53-286.....................NSSNIY..NATCKEPL...QEFFM...NLFPLTTGGLFALGLV.........FLGFASL
TSPB_DICDI/14-223...................PKDSKGIPKYTDTCDSVI...SSKIS..SN...LYLVGAAAVSIG.VIEF....ICMLFAL
A0EF92_PARTE/7-263...........TPFSLQIFYDINHKFDESNNQCLLSS...QQQIY..DTLKLIGDISAGAVVIM.G.......LMVIFTF
TET9_ARATH/4-258..TWNKTSGTHKNSDCQLWDNEKHKLCYNCKACKAGF...LDNLK..AAWKRVAIVNIIFLVLL.V.......VVYAMGC
Q5I0R1_XENTR/7-227.........PTTSRTNNCIYFAGKNYY..KETCLGVI...SDFFK..NH...LVIIIGIAFGLA.AVEI....FGLVFSM
Q7SXT2_DANRE/16-243......ASVNCTSAELKDLKKADSVVY..HQGCFSLM...STTME..AN...LGIIAGISFGIA.FFQV....IGIFLAC
Q9XVI4_CAEEL/8-223...CARENAPLF.................EPGCIHSV...EQWVL..KN...GAMVGGICAVLA.AIQL....VGVCFAC
A2DRK6_TRIVA/7-225...TDTNSSENKTANAETNTTETNSTDSTIETCYNKV...NDKLT..KSKKGLMIAGIGIAAVQ.I.......ILLIYSL
Q22RT6_TETTS/8-279...........STNSYYVFRNINDGTPSAGKDCKEEF...LNFIS..KNIIIAIVITSILVVYMLI.......VTYLSLS
A2DY51_TRIVA/7-217...........LADTSSPYNKETDVAKASTTGCYDAI...KGKVK..KN...MYGLAAAAIVII.VFELALIVISCMYAC
L9JBT3_TUPCH/21-370...AVINTMCGQGMQALDYLEASKVIY..TNGCIDKL...VNWIH..SN...LFLLGGVALGLA.IPQL....VGILLSQ
Q6Z5Z9_ORYSJ/5-263.WIKPPTPSNYSDPDCNSWSNDQSELCYGCQSCKAGV...LGNLR..SSWKKIAFVNAAFVALL.L.......VVYSLGC
Q6NYK2_DANRE/15-289...PCIQYKITNDSAHYNYEHETEELNLFIHGCREAL...VNYFM..GL...MNTIGAVVLSVF.LIQ.....CSVLSSV
Q75IM5_ORYSJ/6-249......VAVGAQDEDCFRWNNAAGILCYGCESCRAGV...MEKVR..EDWHKISVLNVMVLVVL.I.......CICACGC
H3DMZ9_TETNG/7-217..........RC..NTTEPDCPSSKIY..QSNCIDKT...AEWMK..SN...LEVVLGVAFGIA.ILLI....FGMVMAM
CD37_RAT/10-270QLSRLGPRAKLRQTADICALPAKAHIY..REGCARSL...QKWLH..NN...IISIVGICLGVG.LLEL....GFMTLSI
Q7JZW7_DROME/7-210................FHTKDGIHALYPYGEGCMAAVKRAYLQIYRYEKWVHCGLIGYEVVGII.........LGITLCC
A8XFB8_CAEBR/15-256........PSEIDRCRSNPFDSGSPAPYYTNTCYEPL...QNDLLHVMNVASWLCITNAIVQI..........IPSVASC
Q7QJ21_ANOGA/9-222..................YDPIDTKVF..NTGCMHVF...VKSIE..MN...MIRVAVVAVASA.LIQS....LGIFCAI
TET2_ARATH/3-256..LWLNPTNMAADADCYLWSNDQSQLCYNCNSCKAGL...LGNLR..KEWRKANLILIITVVVL.I.......WVYVIAC
Q7JZW3_DROME/8-216.............CPESKCMDTPSRVF..KTGCKAAF...VKYLD..DK...LLVFKIVCWLLV.IGEA....VGAVFGW
Q19983_CAEEL/7-277....SYPNNCGRSFSQAPLNTYAQFIN..TRGCADAV...YESVS..SS...LSLIVGVCVVLC.IVQL....LGIVLSM
B3DL95_XENTR/8-226...........CVEHSPACKSNPKLWW..EEACYNKV...RNWVE..SN...IRSVGIFGICIL.VVQV....FGLIFSM
Q9FVY6_ORYSJ/5-257..FDLSYHPVSTNVDCKLYKNARSVLCYDCDSCKAGV...AQYMK..TEWRVVAIFNVILFVIL.S.......FVYFVAC
ROM1_BOVIN/16-292...PCLQSQLSDPHAHPLFDPRQPNLNLWSQGCHEVL...LGHLQ..GL...ASTLGNMLAVTF.LLQ.....TLVLLGL
Q5ZII8_CHICK/15-247........ITVL....CGRRDHPSNIY.KENGCITKL...ENFIQ..EH...LKIIGIVGISIA.CVQI....FGMIFTC
Q22495_CAEEL/37-297GVRLKPESHMAAHLAAQRVMAHTASIY..TEGCLPKL...QLWLN..NN...MLLVAVSMVIIA.IIQV....LGICFAQ
Q6DHQ4_DANRE/8-230..........CLEYSDNCGLENPGTWW..TAPCYERV...KGWLQ..EN...LVALWIFALCTA.LTQI....LGLVFSM
Q7K527_DROME/7-208...........C...KDDSCVNPLNLY..VRGCLIKV...EEAFA..DE...ATTLGYLEWGLL.GFNA....VILLLAI
TSN15_MOUSE/19-259....VVNTMCGYKTIDKERLNAQNIIH..VRGCTNAV...LIWFM..DN...YTIMAGLLLGIL.LPQF....LGVLLTL
Q67WQ6_ORYSJ/4-259.WTKPSGFNSTDDPDCTTWSNDQTALCYDCQSCKAGV...LANLK..NDWKKIATVNIIFLIFL.I.......IVYSVGC
G4LW70_SCHMA/10-212....................KEENLTY..TEGCVSVF...GAFLK..RN...LVIVACVAFGVC.FFQL....LSIVIAC
Q16HS3_AEDAE/6-221................CIEGSNDHSCRSFAEGCVQIL...ERYVSHITKGLGIGLLILAAIDFA..........ALLFAS
Q29JV1_DROPS/14-246..........GGLAQDINDASQVTCLDTFDYGCFRKM...NFIIS..QS...AMLIATGATTVA.FVQL....LGVLCAF
Q9VID1_DROME/8-228...........CSVINLSEAKECTNTHATQHGCLQKL...LEILD..SK...TLILASVVLGVA.GIQM....LTILFAC
H9KCQ4_APIME/8-222...........C.NSPENNTCSISNSY..TNGCVEAL...KDTVK..LA...GTVFGSVAIAIA.IVEL....IGIIFAL
Q7JWV7_DROME/7-218...TCALTQVMT.................RSSCLKAV...DSFWD..TN...VSIIKYAGLGVT.AVEL....VAFIFAC
O44582_CAEEL/29-290LLPAMRSLECWQNALTKRPGDLEHDIY..TRGCLQPL...RTLFE..SHAVHVGAFVALLIVPV.C.......ISVCLTN
C4Q3U8_SCHMA/12-223....................TVTKSIQSYSRGCHEVL...VEACR..SN...LSVICGVGISFA.LILI....SGMVFSM
Q17441_CAEEL/23-259.........STHQRKGCALSDSPNNIF..YRGCLPFL...KEEVY..NNLNFLFTVTAASLVLH.F.......ANLIFGC
CD82_HUMAN/8-256.SVRKGFCEAPGNRTQSGNHPEDWPVY..QEGCMEKV...QAWLQ..EN...LGIILGVGVGVA.IIEL....LGMVLSI
TSN12_HUMAN/9-248........REFPGCSKQAHQEDLSDLY..QEGCGKKM...YSFLRGTKQ...LQVLRFLGISIG.VTQI....LAMILTI
Q4D6X7_TRYCC/23-265..................SEEDQKEINGYNVTCESVV...MGKIK..EHLKEVLPIGLSITSIA.L.......LGMIVTC
Q7T376_DANRE/6-213.....................NISGTSNWHKGCFKLL...ENSFE..SN...LLSTGIGVIVVC.IIEV....LGMCFSM
TSN11_BOVIN/15-248........VVAR....CGQRAHPSNIYKVEGGCISKL...EQFLA..DH...LLLMGAVGIGVA.CLQI....CGMILTC
Q6P2T9_DANRE/9-230.......TKNCG....IGAMTKPTVIY..LEGCQPIL...ETRIK..EN...ILWIAVGALVIG.FVQI....TGIVLAC
A8WRV5_CAEBR/9-230........ATLS.................QQGCATLF...WNAFQ..TN...LIYVAFVGIIVL.FVEA....LAMIFSC
Q24C21_TETTS/14-285...........KKPANIYFFSDINNGIPDNDTCKEKF...QDFVQ..SYGRVAYIVGLIVGAYL.L.......INAILAF
Q245V1_TETTS/9-274...........SKQPIYYFSNSYKGQP..TKDCKLEL...LNFLD..TSLLSLANGGLAVLIIS.I.......IGCVCSC
Q7KJ73_DROME/8-218...........C....SGSCLIPTNYY...PGCRGKF...VELMT..TG...SDNAKYVGIGLI.GIEL....IGFIFAC
M4EKP0_BRARP/8-252.WTVPATSTAEIKGDCKTWSNTQSELCYACESCKVGV...YKGIR..KRWRILLVFNLLLILLV.V.......LLYSCGC
Q1HRC5_AEDAE/13-234........KTFTDYKPCQDHPTPENIY..IQGCLDIT...SNLIR..DN...AAFIGASGIIVA.ILLI....FGMIFSC
A1Z6U7_DROME/7-216..............YQAAVNDTAQQIY..PSGCLETLNRSQRYIQHRDKLYMWAIVGLEIFILL.........QTVALSV
H2VAF3_TAKRU/20-284...PCIQLQMTNNSAHYSYDHYTEELNVWRRGCREAL...LSYYG..GM...MTSIGVLVLLVT.ILE.....FGVTVGL
Q16LT5_AEDAE/17-240.....DGECVPF.................NTGCFQKM...YALLRHCSK.....TVFSGLLLVA.GVQI....SAALFAF
Q29JV0_DROPS/10-238CFNNFTSEGVRH.................TYGCLDGF...SNYIA..SH...AVSLGAAGVVIA.VLQF....FGVIFAC
A0BI34_PARTE/7-267...........TPYPIQQFNDVNSNVKNHNYPCYKGM...IEYFQ..NMFTTTGSILFSLAALF.G.......VMVILTC
Q7K010_DROME/6-211..............FRNHDKSKPENLI..HTGCRVEF...ENYWQ..HLTKIFNILALVLIGFE.L.......LLSVISC

PF04103

FCERB_HUMAN/60-204-------................HSCQKFFETKCFMA----------SF...STEIVVMMLFLT-ILGL----GSAVSLT
FCERB_MOUSE/52-195-------.................CKNVTEDDGCFVA----------SF...TTELVLMMLFLT-ILAF----CSAVLFT
T176B_HUMAN/66-229-------PV.FPTTGYRWMRRSQENQWQKEECRAYMQ----------MLRKLFTAIRALFLAVC-VLKV----IVSLVSL
A6H741_BOVIN/62-223-------P...VTPTSWYQRRSSYSSWEEENCRRYMQ----------MLMDLFLGIRALLLAIC-ALQV----TVSLASL
T176B_MOUSE/60-224-------LQSSMDPGYGTVRYSDDSDWKTERCREYLN----------MMMNLFLAFCIMLTVVC-ILEI----VVSVASL
T176B_RAT/60-224-------LQPSIVDRFRSVRFTDDSDWRTERCREYLR----------MMMNLFLAFCILFTVIC-ILKI----VVSVASL
T176A_RAT/63-223-------....RWSTMPSITPVPEEANRIGLCKYYTS----------MLKTLLISLQAMLLGVW-VLLL----LASLIPV
T176A_HUMAN/56-214-------.....DWNTPAPTQSPEEVRRLHLCTSFMD----------MLKALFRTLQAMLLGVW-ILLL----LASLTPL
T176A_BOVIN/63-220-------......WRPTGAPTLSPDLERLQQCTAYVN----------MLKALFISINAMLLGVW-VLLL----LASLLPL
Q4TAI3_TETNG/57-208-------..........YSTESPWQKLFEEKCREKML----------LTEWLLRCIIILLIILS-VMEL----CVSVSSA
A7SQ32_NEMVE/7-164-------........IAKGPNYHKEYSRPQEHFDERN----------QNGENGVGIYGTLLALI-VMDV----IVNLVTM
Q95PZ5_CAEEL/94-253-------....LLGTHDTSRISYIFSHMDKYDFAKCL----------WQLKVGVAVNSVQFVIA-AIEV----FLNILSA
Q9GYM6_CAEEL/45-206-------.....TSFPSNSKCQIMCGDHVDDAMRRRM----------TRLGTDYRLDAGLIAAA-ILEF----LLSIATC
Q1LVQ8_DANRE/42-197-------.......REMREDCICTLDPEDPIARMFVF----------SAVSDCSDITSTLPMYY-LLQV----LLNLAQA
H3D3M7_TETNG/37-190-------.......GPARGDCVCTLSQEDPIARTFTY----------EGVGDCQAITGTLTLYF-LVQI----VLNLAQA
Q3TRE0_MOUSE/29-182-------.......ETSLDSCQCKLPSSEPLSRAFVY----------RDVTDCTSVTGTFKLFL-IIQM----VLNLVCG
A7S4D6_NEMVE/20-179-------.....ICCDSIMTCKQSVPSYKFEGVDDCD----------ILTGLLKELMYGLCVLN-IFGS----LVCFIAT
Q0V9M1_XENTR/36-200-------VCVCCEMQHQTSGCSNPGETLKLNPLQECS----------AVRLTLKDLLFSVCALN-IIST----IVCALAT
F6PJ14_XENTR/5-167-------VC.VCCEEIYANKCLERENFLKLFPVQSCN----------AVHLLLKKVFFALCALN-ALTT----TVCLVAA
F189B_MOUSE/36-196-------....CPPIPLHRPCPEWGQELKVALNSTCD----------EARGALKNLLFSVCGLT-ICAA----IICTLSA
Q5BLA7_DANRE/16-153-------................FHAHPVPEVRFVLS----------RM...VKGANCTLLVAC-TGSL----LFSSLIA
F7AIP4_XENTR/16-154-------...............FSSPPHVIHARFILG----------KL...VQGANIAMLIAS-VSSL----CVALCIA
Q08BU9_DANRE/43-180-------................THNNITEDDYVYLR----------QH...YSAVVAMECVFL-CHGL----IGGVLLI
F1RAY4_DANRE/49-184-------...............HRAHNMTETELLYMT----------QH...YSAVETMGCVFL-CHSL----IGGVLLI
F7ESV6_XENTR/53-198-------..........QAMCVCYELNSTCKGSFYPQ----------TV...ITGMVAVLFILT-IVEL----CVSLSTS
H3C9F3_TETNG/67-212-------..........TWGDVTPTDTERRDCLWKIS----------LLDVSEYGSLGVLLVLL-VLQV----CVSITVS
MS4A3_MOUSE/27-172-------................CQSSPSPDVCISLG----------SS...SDGLVSLMLILT-LLEL----SVTISIS
MS4A3_HUMAN/50-196-------...............CHSSSESPDLCNYMG----------SI...SNGMVSLLLILT-LLEL----CVTISTI
M4A4A_HUMAN/65-207-------................CNYYGNSNNCHGTM----------SI...LMGLDGMVLLLS-VLEF----CIAVSLS
M4A6C_MOUSE/47-207-------.......SLIEHDYYQPFYNSDRSECAVTK----------SI...LTGALSVMLIIS-VLEL----GLALLSA
M4A6B_MOUSE/47-204-------........ELRPTEYHYYQFLDRNECFAAK----------SV...LAGVFSLMLIST-MLEL----GLAVLTA
M4A6D_MOUSE/47-207-------.......LDTTQDAYHFFSPEPLNSCFVAK----------AA...LTGVFSLMLISS-VLEL----GLAVLTA
MS4A7_HUMAN/47-207-------.......LSSLPYSEYYYPIYEIKDCLLTS----------VS...LTGVLVVMLIFT-VLEL----LLAAYSS
F6RP33_BOVIN/48-208-------.......LSSMPYSTYYYSIYDVKDCLLTS----------VD...LTGVLLVMLNFT-VLEL----LAAAYAS
Q99N04_MOUSE/47-204-------.......LSLLSYLKSHHWKNEDKNCYLAY----------VG...AMSALGMMLLFT-VLEV----FLAGYSS
MS4A5_HUMAN/49-189-------..................YSHQNSQCKAVT----------VL...FLGILITLMTFS-IIEL----FISLPFS
Q810P8_MOUSE/49-189-------..................YSPDGMQCGVIT----------IL...FIGILVMLMIFS-IVEL----FISLFSS
Q2KII2_BOVIN/49-189-------..................YSGEVSECHAVT----------TL...FIGILIMLMAFS-IIEF----LISLSFS
Q3LRP2_CALJA/51-216-------A..YTPTINIYNCEPVTPSEKNSPSTQYCY----------SIQTLFLGILSVMLIFA-FFQE----LVIAGIV
CD20_MOUSE/44-210-------T..SKPYVDIYDCEPSNSSEKNSPSTQYCN----------SIQSVFLGILSAMLISA-FFQK----LVTAGIV
CD20_CANFA/51-216-------A..PMPYVDIHNCDPANPSEKNSLSIQYCG----------SIRSVFLGVFAVMLIFA-FFQK----LVTAGIV
W5PU80_SHEEP/51-216-------T..QMPYININNCERANPDENNSQSMEYCA----------RIRFVFLSNFAVMMIFA-FLQK----LVTAGTV
M3VZQ9_FELCA/52-215-------SP.KPYIDIHTCQPESKPSEKNSLSIKYCD----------SIRSVFLSIFAVMVVFT-LFQK----LVTAGIV

PF13273

D7UXS6_LISGR/3-100----------------------------------------------------SITLIVVGGLCF----------------
C2RQC7_BACCE/10-90----------------------------------------------------CMIVIPIVMLFM----------------
C3AKH5_BACMY/2-83----------------------------------------------------CMILLPLVTLVM----------------
Q2B2X7_9BACI/2-86----------------------------------------------------LMIAFGVLSFPI----------------
A0A031KR27_ENTFC/3-104----------------------------------------------------SLLILSIIPFFL----------------
C7DIS7_MICA2/29-132----------------------------------------------------VALVFSLVSIFG----------------
D7DCC0_STAHD/4-91----------------------------------------------------LVLVFSILSLPN----------------
A0B9F9_METTP/2-84----------------------------------------------------LMLLSGILGFVT----------------
Q12UE5_METBU/2-98----------------------------------------------------LMLASGILGIAL----------------
B9DJA4_STACT/148-230----------------------------------------------------ILIIGGLLNFIL----------------
C4WAZ9_STAWA/11-93----------------------------------------------------LLVIGGLLNFIF----------------
Q4L9M4_STAHJ/13-95----------------------------------------------------ILIVAAIIHIYL----------------
A5UKZ4_METS3/8-83----------------------------------------------------LFIVSAILVLLG----------------
A5N2M2_CLOK5/4-86----------------------------------------------------FMIIAALGGLVC----------------
F0K6E7_CLOAE/4-86----------------------------------------------------FMIIAAIGGFIC----------------
A9VVN7_BACWK/2-84----------------------------------------------------MLAISAIGGLIC----------------
B3ZH23_BACCE/2-84----------------------------------------------------MMTVAAIGGFIC----------------
C3BEA6_BACMY/2-84----------------------------------------------------MMTVAAIGGFIC----------------
Q4V1S6_BACCZ/2-84----------------------------------------------------FMLIAAIIGFLC----------------
D4FV71_BACNB/2-84----------------------------------------------------LLLISGIGGLIC----------------
C2VWU6_BACCE/24-113----------------------------------------------------IMIISAIVGFLC----------------
C2U6N9_BACCE/2-85----------------------------------------------------LMIVSAIGLFVC----------------
A5UL06_METS3/42-117----------------------------------------------------ILIISAIWLLIS----------------
O26620_METTH/8-82----------------------------------------------------VLIISAVWLLIS----------------
C8JWL3_LISMN/13-93----------------------------------------------------LMLGAAIGGVLS----------------
D7V0U0_LISGR/3-121----------------------------------------------------LFLVAAIVVLLA----------------
A0A024I3A1_LISMN/3-121----------------------------------------------------LFLAAGVVSLLS----------------
D3KN98_LISMN/3-121----------------------------------------------------LFLAAGIVSLLS----------------
E3YXI7_LISIO/3-121----------------------------------------------------LFLAAGIVSLLS----------------
D3ULL7_LISSS/3-121----------------------------------------------------LFLAAGIVSLLC----------------
A8FJ46_BACP2/3-107----------------------------------------------------LFLVSAVTLLIG----------------
B4AK11_BACPU/3-107----------------------------------------------------LFLVSAVTLLIG----------------
C2H7S4_ENTFC/2-107----------------------------------------------------LYFITGVILLVG----------------
C9ATK3_ENTFC/2-107----------------------------------------------------LYFITGVILLVG----------------
E6TU87_BACCJ/2-115----------------------------------------------------LFIITSVVAAIA----------------
B9CUN6_STACP/3-110----------------------------------------------------ILLIVGVIALLT----------------
C5QNE2_9STAP/3-110----------------------------------------------------LLIIAGIIGIFT----------------
C2LZ67_STAHO/18-125----------------------------------------------------LLIIAGILAIAT----------------
Q4L9F8_STAHJ/19-126----------------------------------------------------LLIIAGLIALMS----------------
C4WCX0_STAWA/2-110----------------------------------------------------LLIIAAVLSLVI----------------
Q4A0V3_STAS1/2-109----------------------------------------------------LLIIAGVISFLG----------------
C5QZN6_STAEP/3-109----------------------------------------------------LLVITGIIGLFL----------------
D3QGJ5_STALH/3-111----------------------------------------------------LLIIAAALCLLN----------------
D3QGJ6_STALH/3-111----------------------------------------------------LLIIAVVLSVFN----------------
Q4A0E9_STAS1/2-112----------------------------------------------------IFILLGLVTVLT----------------
C5NV51_9BACL/5-120----------------------------------------------------LFLLLAIVVAVG----------------
C5NWK3_9BACL/5-118----------------------------------------------------LFLIAAALVGLM----------------
H7FJC6_STASA/2-102----------------------------------------------------VFIIAAITSIFS----------------
Q8ERL5_OCEIH/2-100----------------------------------------------------MFVSASCMTGVF----------------
A7A3G5_BIFAD/15-115----------------------------------------------------VIIWLAIVVVFS----------------

PF00335

TET11_ARATH/4-262CARRNN
TSN16_HUMAN/10-243EL....
Q16LT3_AEDAE/14-239MLARTI
H3DJN8_TETNG/8-231VISCK.
Q9V3X2_DROME/9-261SLCCAV
TSN5_HUMAN/14-261NLVSDI
Q6Z6K0_ORYSJ/3-259SAYKNA
Q29D35_DROPS/9-259SLCKAF
Q7Q1S3_ANOGA/9-239YLAKQI
TET15_ARATH/53-313FWE...
Q292W4_DROPS/7-217CLANSI
H3CCQ2_TETNG/10-245CLCKNI
Q9VMJ6_DROME/18-261ELSKII
TSN6_BOVIN/16-237CLSRAI
Q06AT4_PIG/10-257MFYWSR
Q16GP3_AEDAE/9-261CLCKSI
TET13_ARATH/15-272FAWLRI
M9PDV2_DROME/8-255LLFCT.
Q24FE3_TETTS/5-263LFYLEL
A2BIP5_DANRE/16-252V.....
Q4DD38_TRYCC/89-308LSRSAN
TSN8_BOVIN/7-235VLYCQM
TSN10_HUMAN/75-319RLLGAL
Q176T5_AEDAE/20-244WLSAAI
TET5_ARATH/4-245CAFKNA
A2EZ30_TRIVA/7-219WYGCCY
A1Z8K7_DROME/8-233YLANSI
Q16HX5_AEDAE/9-218CLANGI
Q6Z8Q8_ORYSJ/5-259CAFKNS
F1Q6P4_DANRE/9-244GLCKS.
A0BP70_PARTE/7-282CLCFHP
Q16J92_AEDAE/9-260FLCCAI
CD81_MOUSE/9-229VLCCG.
Q16LT4_AEDAE/34-246VFLIKL
H3DF34_TETNG/10-245FLCKS.
H3CSH9_TETNG/9-237VVLCRR
Q86D97_SCHMA/7-231VMCCTI
A1Z6T8_DROME/7-220YLVDSI
Q3UGA5_MOUSE/74-317CLLRA.
Q29IZ2_DROPS/18-232VLVQAV
A8X5P0_CAEBR/7-223ILCRSS
Q16HS1_AEDAE/9-225CLANGI
Q4S5B5_TETNG/8-230TLYQQI
Q24C18_TETTS/14-278CLCCRD
G7NV03_MACFA/6-238YLYCN.
TSPA_DICDI/14-223FLIIRI
TSN33_MOUSE/21-264VLVNQI
A0CWV3_PARTE/4-272LICCHS
TET6_ARATH/4-244CAFHNT
Q9W4X6_DROME/42-295TLEGQI
F6ZCC3_XENTR/20-287RYLQ..
CD63_MOUSE/9-231CLVKSI
TSN8_HUMAN/7-234VLYCQI
Q7K2V7_DROME/7-219CLASAM
H3D1H6_TETNG/11-249LLAK..
TSN14_HUMAN/14-261TLISDI
TSPE_DICDI/16-219FLLKTN
TSN32_HUMAN/9-223FLWFAI
B4I8V1_DROSE/9-225HLT...
Q16TV5_AEDAE/8-254LLFCTV
Q7PTA7_ANOGA/9-220CLANAI
TSPD_DICDI/11-223FLIVRL
F1R4A1_DANRE/13-252VQLC..
Q9NB13_DROME/7-221ALTNCM
Q292V6_DROPS/9-211YMGRAR
Q6YWS4_ORYSJ/4-277CSVRDR
Q4D693_TRYCC/53-286AVYRIT
TSPB_DICDI/14-223FLIIRI
A0EF92_PARTE/7-263CLCCHP
TET9_ARATH/4-258CAFRNN
Q5I0R1_XENTR/7-227ILYCQI
Q7SXT2_DANRE/16-243CLSRYI
Q9XVI4_CAEEL/8-223CLSKSI
A2DRK6_TRIVA/7-225WFGCCY
Q22RT6_TETTS/8-279TMLSDE
A2DY51_TRIVA/7-217CYI...
L9JBT3_TUPCH/21-370ILVNQI
Q6Z5Z9_ORYSJ/5-263CALRNN
Q6NYK2_DANRE/15-289RLLQTS
Q75IM5_ORYSJ/6-249CAFRNA
H3DMZ9_TETNG/7-217MLYCQI
CD37_RAT/10-270FLCRNL
Q7JZW7_DROME/7-210QL....
A8XFB8_CAEBR/15-256WYSKLI
Q7QJ21_ANOGA/9-222QLTMLL
TET2_ARATH/3-256SAFRNA
Q7JZW3_DROME/8-216LLYSS.
Q19983_CAEEL/7-277TLCCCK
B3DL95_XENTR/8-226LMYCQ.
Q9FVY6_ORYSJ/5-257CARRNT
ROM1_BOVIN/16-292RYLQTA
Q5ZII8_CHICK/15-247CLYRSL
Q22495_CAEEL/37-297NLKSDI
Q6DHQ4_DANRE/8-230TIFCHT
Q7K527_DROME/7-208ILAIHY
TSN15_MOUSE/19-259LYITRV
Q67WQ6_ORYSJ/4-259CAFRNN
G4LW70_SCHMA/10-212CLGRQI
Q16HS3_AEDAE/6-221CFVHGI
Q29JV1_DROPS/14-246MLAKTL
Q9VID1_DROME/8-228CLYRSF
H9KCQ4_APIME/8-222CLANSI
Q7JWV7_DROME/7-218CLANQT
O44582_CAEEL/29-290ILAKQV
C4Q3U8_SCHMA/12-223MLCCAI
Q17441_CAEEL/23-259CTCFRS
CD82_HUMAN/8-256CLCRHV
TSN12_HUMAN/9-248TLLWAL
Q4D6X7_TRYCC/23-265LIQHET
Q7T376_DANRE/6-213TLFCHI
TSN11_BOVIN/15-248GLHRRL
Q6P2T9_DANRE/9-230ILSRAI
A8WRV5_CAEBR/9-230IIINAV
Q24C21_TETTS/14-285CLCCRK
Q245V1_TETTS/9-274SLICHK
Q7KJ73_DROME/8-218CLANN.
M4EKP0_BRARP/8-252CVKK..
Q1HRC5_AEDAE/13-234SLFRMI
A1Z6U7_DROME/7-216LLFRLR
H2VAF3_TAKRU/20-284Q.....
Q16LT5_AEDAE/17-240ILGKRI
Q29JV0_DROPS/10-238YIAREI
A0BI34_PARTE/7-267CLCCHP
Q7K010_DROME/6-211RLCNSI

PF04103

FCERB_HUMAN/60-204ICGA--
FCERB_MOUSE/52-195IYRI--
T176B_HUMAN/66-229GVGL--
A6H741_BOVIN/62-223GVGL--
T176B_MOUSE/60-224GLSL--
T176B_RAT/60-224GLSL--
T176A_RAT/63-223CVYL--
T176A_HUMAN/56-214WLYC--
T176A_BOVIN/63-220CLCC--
Q4TAI3_TETNG/57-208VLGI--
A7SQ32_NEMVE/7-164AVCK--
Q95PZ5_CAEEL/94-253ILCM--
Q9GYM6_CAEEL/45-206VVAS--
Q1LVQ8_DANRE/42-197IVCL--
H3D3M7_TETNG/37-190LVC.--
Q3TRE0_MOUSE/29-182LVC.--
A7S4D6_NEMVE/20-179ILGC--
Q0V9M1_XENTR/36-200AMCC--
F6PJ14_XENTR/5-167ALR.--
F189B_MOUSE/36-196IVCC--
Q5BLA7_DANRE/16-153YIGC--
F7AIP4_XENTR/16-154YMGC--
Q08BU9_DANRE/43-180IMTC--
F1RAY4_DANRE/49-184IMTC--
F7ESV6_XENTR/53-198IFAC--
H3C9F3_TETNG/67-212VFS.--
MS4A3_MOUSE/27-172AMWC--
MS4A3_HUMAN/50-196AMWC--
M4A4A_HUMAN/65-207AFGC--
M4A6C_MOUSE/47-207MLWL--
M4A6B_MOUSE/47-204MLWW--
M4A6D_MOUSE/47-207TLWW--
MS4A7_HUMAN/47-207VFWW--
F6RP33_BOVIN/48-208VFWW--
Q99N04_MOUSE/47-204IFWW--
MS4A5_HUMAN/49-189ILGC--
Q810P8_MOUSE/49-189VLGC--
Q2KII2_BOVIN/49-189VMRG--
Q3LRP2_CALJA/51-216ENEW--
CD20_MOUSE/44-210ENEW--
CD20_CANFA/51-216ENEW--
W5PU80_SHEEP/51-216ENE.--
M3VZQ9_FELCA/52-215EN..--

PF13273

D7UXS6_LISGR/3-100------
C2RQC7_BACCE/10-90------
C3AKH5_BACMY/2-83------
Q2B2X7_9BACI/2-86------
A0A031KR27_ENTFC/3-104------
C7DIS7_MICA2/29-132------
D7DCC0_STAHD/4-91------
A0B9F9_METTP/2-84------
Q12UE5_METBU/2-98------
B9DJA4_STACT/148-230------
C4WAZ9_STAWA/11-93------
Q4L9M4_STAHJ/13-95------
A5UKZ4_METS3/8-83------
A5N2M2_CLOK5/4-86------
F0K6E7_CLOAE/4-86------
A9VVN7_BACWK/2-84------
B3ZH23_BACCE/2-84------
C3BEA6_BACMY/2-84------
Q4V1S6_BACCZ/2-84------
D4FV71_BACNB/2-84------
C2VWU6_BACCE/24-113------
C2U6N9_BACCE/2-85------
A5UL06_METS3/42-117------
O26620_METTH/8-82------
C8JWL3_LISMN/13-93------
D7V0U0_LISGR/3-121------
A0A024I3A1_LISMN/3-121------
D3KN98_LISMN/3-121------
E3YXI7_LISIO/3-121------
D3ULL7_LISSS/3-121------
A8FJ46_BACP2/3-107------
B4AK11_BACPU/3-107------
C2H7S4_ENTFC/2-107------
C9ATK3_ENTFC/2-107------
E6TU87_BACCJ/2-115------
B9CUN6_STACP/3-110------
C5QNE2_9STAP/3-110------
C2LZ67_STAHO/18-125------
Q4L9F8_STAHJ/19-126------
C4WCX0_STAWA/2-110------
Q4A0V3_STAS1/2-109------
C5QZN6_STAEP/3-109------
D3QGJ5_STALH/3-111------
D3QGJ6_STALH/3-111------
Q4A0E9_STAS1/2-112------
C5NV51_9BACL/5-120------
C5NWK3_9BACL/5-118------
H7FJC6_STASA/2-102------
Q8ERL5_OCEIH/2-100------
A7A3G5_BIFAD/15-115------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window