Sequence alignment for CL0347

PF00335

TSN15_MOUSE/19-259WLKFS....LI.IYS..TV---FWLIG.GLVLS......VG--IYA..................................
Q29BB1_DROPS/7-204CSKNA....LI.ALN..IL---YVMIG.FLLIG......VG--VYA...RA.............................
TSPC_DICDI/14-226YLKVP....II.GLN..AI---LWLLG.LVLIV......VG--SVC...ISFFSNFKEF....................T
TSN33_MOUSE/21-264LVKYL....LF.FFN..ML---FWVIS.MVMVA......VG--VYARLMKHA............................
Q9VMJ6_DROME/18-261CLKYL....LF.ASN..VI---LWLSA.LLVLS......VG--IWA...WSEKGM.........................
Q7QJ21_ANOGA/9-222CFKYL....VY.AYV..IL---ISICG.GAQLV......IG--AFL...LWTHK..........................
Q7Q8G1_ANOGA/14-231CVKYM....IF.VIS..IT---FAVVA.AMLLS......MA--VAI...GNLFDD.........................
Q84WF6_ARATH/4-245MSNTV....IG.FLN..IL---TLISS.IVLLG......SA--LWM..................................
TSPE_DICDI/16-219LVRGP....FI.ILN..SI---IFSLSFILLCS......TG--III..................................
Q16LT3_AEDAE/14-239CVKYM....IF.VIN..FM---FLLTA.ILIVT......VG--SAI...GTIFGD.........................
Q5C164_SCHJA/7-207CLQCL....LI.IFN..SG---VFICG.IGLIV......VG--ALGLHSTVN............................
Q8SU08_ENCCU/10-189TFKVL....FF.FIQ..AL---GFISG.IGVLI......VG--TTI..................................
Q9W4X6_DROME/42-295CVKYM....IF.LLN..FV---FWLFG.GLLLG......IG--VYAFRDKW.............................
Q9NB13_DROME/7-221IVNFI....LY.IVN..IV---FLIVG.ILLIV......LG--SIM...LSDLSR.........................
Q6DCP2_XENLA/9-233CVKFL....MF.FFN..FV---FWVCG.IALIA......IG--IYV...QIQLNH.........................
Q6GLY9_XENLA/10-290KTRRGKLAQILWILN..WV---SVLTG.LIIFS......LG--LFL..K...............................
Q8SY17_DROME/7-219MVKYI....LF.IFN..TI---VSVIG.ILGIV......YG--VLI...LKSIGVV........................
Q1EC46_DROME/7-202MIRYL....AF.LFN..FL---CAVLG.IATIV........--.....................................
TSPD_DICDI/11-224YLKVP....LI.ILN..VI---LWLLG.LVLVI......IG--GICVGFFSRF...........................
A2FKF6_TRIVA/7-185CTLFI....IS.FIATGFI---VATSA.LCLYV........--.....................................
A2DWZ1_TRIVA/7-204MARTI....IG.IVN..LV---VLVI..IAIVA......FV--CRS..................................
Q4DD38_TRYCC/86-309VLQSLFGYALI.FIN..FT---FIMAS.MLLVM......SG--I....................................
TSN16_HUMAN/10-243SLKKL....LS.LLN..GF---VAVSG.IILVG......LG--IGG...KCGGASL........................
Q5KAR0_CRYNJ/191-384RFKWV....LF.LAN..SV---LFIYG.MATLV......CA--ILV..................................
TSN32_HUMAN/9-229VAKCQ....ML.VTC..FF---ILLLG.LSVATMVTLTYFG--AHFAVIR..............................
Q9V3X2_DROME/9-261CVKYL....MV.LIN..IL---FWLIG.LTIVV......TS--VWM...LTDPTF.........................
TSPB_DICDI/14-224YLKVP....LI.AFN..TI---LWVLG.LVLVI......IG--SIGVSFFSNF...........................
Q9VID1_DROME/8-228CVKYL....TF.FCN..LL---FALTG.LLIFL......VG--GMV...QLNYAH.........................
Q64HX8_ONCMY/9-234CVKYL....LF.FFN..FI---FWLCG.LALVV......LG--VLV...QVALHS.........................
Q29IZ2_DROPS/18-232CVKYT....LF.CFN..IV---AWMIA.TALFA......LT--VWLRAEP..............................
Q1HRC5_AEDAE/13-234CVKYS....MF.VSN..FI---IFIGG.AIVFG......LG--VWT...VVDKNF.........................
TS31A_XENLA/8-198CSKNA....LC.ALN..VV---YMLVG.LLLIG......VA--AWG..................................
Q17441_CAEEL/23-259CCSKC....QL.FIS..YL---LVIVG.ILFLA......LA--IWL...YIFRGD.........................
Q5DG31_SCHJA/16-308YLKNT....LV.AHQ..IL---YLLLM.AILVG......LA--CWLLIWT..............................
Q2TCS3_BRABE/7-240CIRTT....LI.VLN..VI---FWIIG.ALFLC......AG--LTF...RFEYYR.........................
Q2TCS2_BRABE/9-231CVKYL....LF.FFN..FL---FWVAG.LFLVG......VG--IWI...RVDDNALKF......................
Q9ZUN5_ARATH/3-256LANNL....TA.ILN..LL---ALLCS.IPITA......SG--IWL..................................
TSPA_DICDI/14-224LLKVP....LI.ILN..II---LWILG.LVLVI......VG--GICVSFLSNF...........................
IM23_SCHMA/10-212CLKSC....VF.VLN..II---CLLCS.LVLIG......AG--AYVEVKFSQ............................
Q29JV0_DROPS/10-238AVKYT....LF.GFN..LI---FLITG.IILIA......VG--AGV...GSVYTG.........................
Q6GP84_XENLA/8-227CIKIT....MF.IFN..LI---FWLGG.CGILG......VG--VWL...AVTQGK.........................
Q5DB78_SCHJA/24-277WVKYS....LC.LAN..FI---FLTIG.TVFLV......FG--AIA....FI............................
A0BI34_PARTE/7-267CLKCF....VQ.LEG..WL---TFVIGILAIVA......AI--IVTVIQK..............................
Q5GM22_TAESO/9-219FLKFL....VF.FFN..AI---VFIGG.GVIAA......FG--IYL...LVET...........................
Q9XVI4_CAEEL/8-223IVKYL....LF.LAN..LV---LWVGG.LSLII......VG--SIL...QLKFDN.........................
A2G3J8_TRIVA/7-186FTLFL....IS.FLSIGVI---VAGAS.FTIYF........--.....................................
A2EZ33_TRIVA/7-201LARTI....IG.LVN..MI---VLIV..MIVII......CF--SWD..................................
Q5DH84_SCHJA/4-271TVRRV....FH.ILNLICV---FILLSAFICFV......VL--FWTKAAVKIVEPTLR......................
Q60D82_BRAOL/4-254LSNAA....VI.TTN..AI---LALIG.LATLC......FS--VYL..................................
Q4RYD3_TETNG/10-300LKKRVKLAQTVWFMY..WF---AVLAG.VLVFS......MG--LFF..K...............................
Q24C21_TETTS/14-285CLQVY....IS.WTS..YI---NLVIS.IAALA......FG--IYIG.V...............................
A2DI21_TRIVA/15-204VFGIG....FA.IIN..GI---QSIAV.MILCA......VA--VHY..................................
Q6GNW4_XENLA/9-244VTKYF....LF.LFN..LL---FFILG.AVILG......FG--IWI...LVDKTSF........................
Q4SU90_TETNG/14-272CLQTV....LL.LYS..FV---FWVTG.AVLLS......VG--LWW...KFMLGP.........................
Q2TCR9_BRABE/6-237TIKYF....LF.AFN..FL---CWIAG.LGLFA......IG--IWL...RVDPALA........................
Q7T376_DANRE/6-213CLKYI....MC.VVN..FI---FFICG.AAIFG......MG--IYL..................................
Q7JZW7_DROME/7-210CLQWT....SV.VFS..TL---TLIVGVLAALA........--.....................................
Q4PLY6_IXOSC/9-219FVKYL....LF.AFN..AI---FVLCG.IALIA......VG--GVV...LAALNP.........................
Q2TCS4_BRABE/9-233IIKIL....LF.IFN..FV---FWVTG.AVLLG......VG--IWL...RVDQDVS........................
A1Z8K7_DROME/8-233LIKYV....LF.AFN..VL---FAISG.LGILI......AG--AVV...LADVNE.........................
A1Z6U3_DROME/7-206CVKCF....LN.TLN..TL---NALSG.LSLIA......IA--TLA..................................
Q5DH43_SCHJA/12-223CLKYS....MF.VFC..LV---AWILG.LITFI......VG--IVA...RVNGSF.........................
TSN12_HUMAN/9-249CLRCL....LY.ALN..LL---FWLMS.ISVLA......VS--AWMRDYLNNV...........................
Q7Q1S3_ANOGA/9-239FIKYL....LF.LFN..FF---FAITG.VIIMA......VG--LTV...QGAYHN.........................
Q5PQ10_XENLA/8-231SSRLC....LR.ILT..LL---FWVGA.GCLLY......AG--CCN...IKTYR..........................
O44582_CAEEL/29-290CLKWL....VF.LLN..SI---VFLVG.VGILA......LG--VYL..................................
Q06AT4_PIG/10-258CFQSL....LV.FGN..VI---IGMCG.IALTA......EC--IFFVSDQ..............................
Q6DDY1_XENLA/6-239FIKVM....MI.LFN..VF---IFLGG.GTLLG......VG--IWV...SVDSNSFLK......................
Q9UAI4_DROME/9-228CFKYL....VY.SYV..VL---LALTG.AAQIF......LG--TSL...LWGHS..........................
Q503H8_DANRE/10-204CVKYL....LF.VFN..FI---FWLSG.SLVLA......VG--LWL...RFDPDTTS.......................
Q5BL96_DANRE/12-254AVKYT....LF.VCC..YV---FWVFS.AGLIA......VG--IYA...KIAK...........................
Q292V6_DROPS/9-211PWKYA....LF.ATC..IL---ITACT.VLFFS......CG--VVT..................................
Q16TV5_AEDAE/8-254CIRRT....FC.SFN..VL---IWLCG.SCFLA......IG--VWL...RFAAPG.........................
Q7K527_DROME/7-213TIKYS....LF.LFN..AL---WAILG.ILVLI......FG--GLG..................................
A8WRV5_CAEBR/9-230CIKYF....FW.LIN..LL---FFVLG.AVIVG......LS--IWM...LVDKNSLTT......................
Q5ZII8_CHICK/15-247CLKYL....LF.IFN..FF---FWLAG.GAVMA......VG--AWT...LAKKSD.........................
TSN14_HUMAN/14-261WYKYL....LF.SYN..II---FWLAG.VVFLG......VG--LWA...WSEKGV.........................
Q2TCR8_BRABE/9-244CIKYL....LF.AFN..LI---FWITG.LAMIG......VG--ATV...KIAFGD.........................
Q2TCS8_BRABE/8-228CIKYL....LF.AFN..LL---FWLAG.AGMVG......VG--IYV...MVAYGVSN.......................
Q86FE8_SCHJA/7-285ILKFL....LF.FIN..FI---LLVFG.IASVA......IS--SWVIVNDEGFIET........................
A1Z6U7_DROME/7-216TIKYT....GL.LSN..LL---YMLLGIGVMSG......AG--LGL..................................
Q6GQE5_XENLA/9-221CIKYL....LF.AFN..FI---FWLAG.TAVLA......IG--LWL...RFDSQTKA.......................
Q9U2K6_CAEEL/7-216LARIF....LF.FLN..LA---QTLVG.FTVIA......LT--LWIRFDKGFESEIRT.....................N
Q8MS10_DROME/8-256CIRRT....FC.WLN..II---LWLCS.CAFLG......AG--LWL...RLSYAG.........................
Q29JV1_DROPS/14-246CAKYM....LI.IVS..FM---FALTA.ILLIM......VG--TTI...QTIFGD.........................
Q6Z5Z9_ORYSJ/5-263CSNAV....FA.AIN..VV---TLLLG.AAVLA......AG--IYY..................................
Q4RSA5_TETNG/8-245VTKYF....LF.LFN..LL---FFVFG.GLIMG......FG--LWV...LLENQSF........................
Q6NYK2_DANRE/10-290FQKRVKLAQGLWMLS..WL---ATVGG.AITFT......LG--CFL..K...............................
Q6DDY2_XENLA/8-252GMVTF....IV.FGN..IV---ILLSG.LALFA......ET--IWATTDP..............................
Q0V996_XENTR/6-236FLKTM....MF.VFN..GI---IFLGG.VAVLG......IG--VWV...KVDGGSFLQ.....................I
Q5DDB8_SCHJA/7-215FWIRS....FI.LCN..CI---FIIFN.ILILG......VS--TKS..................................
Q4T8J0_TETNG/8-244ATKYF....LF.LLN..FI---FFLCG.AVIVG......FG--LWL...LLDNQSF........................
CD63_MOUSE/9-231CVKFL....LY.VLL..LA---FCACA.VGLIA......IG--VAV...QVVLKQ.........................
Q6P0W1_DANRE/7-218ISKCF....LV.LFN..II---YGLLG.FSLVS......LG--LWLRFGA..............................
TSP1_CAEEL/7-221IIRSV....LF.FLD..LA---MLLAA.LALIA......VG--FWMGYDSSFDTDLKNV....................I
Q1L9G8_DANRE/9-220CIKYL....LF.IFN..FI---FWLAG.TGVLA......VG--LWL...RFDAKTKE.......................
Q16J92_AEDAE/9-260IIKYL....VI.LVN..LL---FWLIG.FAIVL......LA--IWM...LTDPTF.........................
Q29D35_DROPS/9-259CAKYL....LC.IFN..FI---FFVLG.TIIFG......VG--LWL...AVDKHSLIALLK................LVE
Q3ZLC3_OREMO/6-225CVKYL....LF.FFN..LL---FWLSG.CLILA......VS--IYL...RVSKGGNQI......................
Q75IM5_ORYSJ/6-249FSNVM....IG.YLN..LA---TLLAS.IPVIG......AG--LWM..................................
Q16LT5_AEDAE/17-240WIKFF....LF.MTN..VM---FVFVG.ILVIS......TG--AAVRSVYSDF...........................
A2G0G6_TRIVA/19-208FMTKG....FI.AFS..VL---QFIAI.TILCS......IS--INK..................................
Q5DGI2_SCHJA/10-219CLQFL....LI.TFN..IL---VFACG.IALIV......IG--SLSQVAVNN............................
Q7JWV7_DROME/7-218FVKYV....LF.IFN..IL---FVICG.ILLIT......FG--SIMVSTIKDF...........................
Q9FVY6_ORYSJ/5-257TSAFV....IR.WIN..FF---TMILA.LLVVG......FG--FWM..................................
A2AGS8_MOUSE/8-247CMKYL....MF.VFN..FF---VFLGG.ACLLG......VG--IWV...LVDPTGF........................
Q6INJ9_XENLA/8-187CSKNS....LC.VLN..LL---YIMVS.LLLIG......VA--AWG..................................
CD53_MOUSE/8-210LLKYV....LF.IFN..LL---FWVCG.CCILG......FG--IYF...LVQNT..........................
A8X5P0_CAEBR/7-223CIKLL....FF.IIN..FF---ICIFG.ALICG......FS--LWA...NLDKEFGTH.....................L
Q86FA1_SCHJA/5-268VLRLT....LL.LIN..SL---VGLSA.LILAS......FG--AILVWGKDTITKELNDVIG..............PMLN
A1Z6U8_DROME/7-209ALKVS....SF.VLD..FL---CCVLAALTIAA........--.....................................
TSN6_BOVIN/16-237CFKSV....LL.IYT..FI---FWITG.VILLA......VG--IWG...KVSLEN.........................
Q6Z6K0_ORYSJ/3-259VSNNI....TA.CVT..LM---ALICA.VPVIA......SG--VWF..................................
Q4SM43_TETNG/8-236TSKTV....LV.FLN..MI---FWAAA.GILCY......VG--AYVFITYDDY...........................
Q0QBV5_HELTB/11-271CSKYL....LI.VFN..II---FFLVG.IALLA......VG--IWV...IVQPYQIE.......................
Q5DFJ8_SCHJA/7-215YCRRL....FI.SFN..VL---FIIFS.IVLLA......LG--IEQ..Q...............................
Q6DHQ4_DANRE/8-230ALRYG....MV.FFN..LL---FWLCG.CGILG......VG--VWL...SITQGN.........................
Q245V1_TETTS/9-275TLRRI....TE.ISA..CI---MCILGVFAIIF......GG--VLL..................................
Q5DHJ8_SCHJA/10-217LWKKI....YI.VVN..SL---FIVFS.LIMLA......IG--ATA..................................
Q24FE3_TETTS/5-264LLKKS....VI.ITN..SL---LLLVG.LFFII......YP--AIL..................................
Q4T2B0_TETNG/10-333KAEREKLAEVLWLLN..GV---SVLTG.ALLLG......LG--VFL..K...............................
Q2TCS0_BRABE/9-233IIKIL....LF.IFN..FI---FWIIG.IAILA......IG--IWL...RVDANIS........................
Q6Z8Q8_ORYSJ/5-259LSNNV....IG.ALN..LV---TLLLS.APILS......GG--IWM..................................
Q6W8Q0_BRABE/9-238CVKSL....LI.LFN..FM---FWLLG.VGLVA......VG--ASI...IGDGKIVH.......................
Q0V9E6_XENTR/12-237CLKAG....LL.FII..LL---FWVTG.VALIC......LG--ATVQLRLTD............................
TSN8_BOVIN/7-235CIKCS....MF.IFN..FV---FWLCG.AIILS......VA--ISI...RAGKIGQE.......................
Q4D693_TRYCC/53-289YHRFS....TA.CFSAFLI---LLGVAMSAVIA........--.....................................
Q5I0R1_XENTR/7-227CLKYS....MF.AFN..FL---FWLCG.CVILG......VS--IWV...RVSKSV.........................
Q24FE4_TETTS/5-254FQN.........IST..AL---LFLLG.VFWIV......FA--SLT..................................
Q9M0B7_ARATH/4-258FSNSL....VG.ILN..FF---VFLLS.VPILS......TG--IWL..................................
A0BP70_PARTE/7-282CLKFS....VQ.FQA..WV---ILIVGVSSLIG......TI--VINVDQR..............................
Q7K010_DROME/6-211SVKLI....VY.ALD..VL---CTLLA.LVLIS......FG--IYV..................................
Q67WQ6_ORYSJ/4-259CSNGL....LG.LLN..AG---VLVLA.VVVLG......GG--IWL..................................
TSN1_MACFA/6-239FIKTI....MI.LFN..LL---IFLCG.AALLA......VG--IWV...SIDGASFLK.....................I
Q19983_CAEEL/7-278ALRIV....TF.LFN..FA---FWLSG.VVVFG......LG--IWL...LFD............................
TSN2_MOUSE/10-214CIKYL....LL.GFN..LL---FWLAG.SAVIA......FG--LWF...RFGGTMKD.......................
O44420_SCHJA/9-217FWTKL....FF.LLN..SL---FGIFG.IVLLA......FG--IKG..................................
A8XY10_CAEBR/57-274WAKYG....IF.TAN..IV---FMVVG.GLLLA......MG--IWL...RTDSRFRNFISE................RYR
ROM1_BOVIN/11-293LQPRIRLAQGLWLLS..WL---LVLVGGLTLLC......SG--HLL..V...............................
Q3UFS7_MOUSE/74-318CVKYL....IF.LSN..FL---FSLPS.LLALA......AG--LWG..L...............................
Q2TCS6_BRABE/12-229CLKYL....LF.LFN..LI---FWIAG.MGLIG......VG--IWV...LVDTGTYN.......................
Q9SI56_ARATH/15-273IVQNM....SF.PFN..TI---FLISSAIFLVT......AA--FWF..................................
Q9NB09_MANSE/12-245CIKYM....LL.CIT..AI---FVLTS.ALIIS......VG--TTI...YAIYHD.........................
Q1HQ39_BOMMO/7-211LVKYV....LF.FAN..LA---FALAG.LALLG......LG--LAV...HLQFAD.........................
Q16HS1_AEDAE/9-225TLRCT....LI.LLN..ML---CFLSG.LSLAI......VG--AVMHTKLAAI...........................
TSN5_HUMAN/14-261CIKYF....IF.GFN..VI---FWFLG.ITFLG......IG--LWA...WNEKGVL........................
TSN10_HUMAN/75-319CVKYL....IF.LSN..FP---FSLLG.LLALA......IG--LWG..L...............................
A2ECP6_TRIVA/7-193ALSLA....V..CLN..LV---ASFWAIIAFFA......AQ--RII..................................
A2FGU0_TRIVA/7-203FSKYF....LA.ALN..LI---WFIGLIVIGVL......MG--VFW..................................
Q7EZC8_ORYSJ/6-199FFEWV....LK.LLN..LV---VMVVG.LAMMG......YG--AYLLVAWLQLLPSPPPLPPAPAVAPGGGGGGEMVRLG
Q2TCS7_BRABE/7-197CSKNA....LA.ALN..IL---YILVA.FIMIG......VA--AYG..................................
Q6P2T9_DANRE/9-230CVKYL....LF.FFN..FI---FWLCG.LALIV......LG--ILV...HVSLHN.........................
Q6P7J5_XENLA/7-233TSKTF....LF.LVS..LI---FLAAS.VGLAY......VG--ISTIVTYKQY...........................
Q7K2V7_DROME/7-219MFKYL....LY.LLN..LV---FVAGG.ILLIV......VG--SIMLSTMGNF...........................
Q7PTA7_ANOGA/9-220TIKYL....LF.IFN..LL---CSLCG.IALIV......IG--AVSLVKLEEL...........................
Q9C5W7_ARATH/6-190CLECL....LK.LLN..FL---LAVAG.LGMIG......YG--IYLFVEYKRVTDNSVTFDLT...........NGDQSY
Q5D928_SCHJA/7-215FWRKL....FI.ILN..SL---LLVFS.IVLIA......LG--SDT..................................
A2G7G6_TRIVA/7-186FTLFI....IS.FLSIGII---VAASA.ACVVF........--.....................................
Q9NB12_DROME/7-217TVKHV....LL.LLN..FV---FSVLG.LALIA......FG--IFF..................................
Q53GA9_HUMAN/7-234CIKYS....MF.TFN..FL---FWLCG.ILILA......LA--IWV...RVSNDSQA.......................
Q16LT4_AEDAE/34-247IVKYS....VL.VLT..GM---CLILE.VIQIV......LG--AGA..G...............................
O96962_SUBDO/13-238CLRFT....LI.FWN..IF---VLLIG.VAALA......VG--IWQ...VVEND..........................
A1Z6T8_DROME/7-220LLRYV....LC.VIS..GI---CALGG.CLLIW......YG--AWLLDS...............................
A2GDR3_TRIVA/7-201CARTV....IG.IVN..FI---VLLI..LGLCV......FI--GWA..................................
CD37_RAT/10-270LIKYF....LF.VFN..LF---FFVLG.GLIFC......FG--TWI...LIDKTSF........................
Q4SA96_TETNG/3-245LLRLG....LL.AFS..CL---FWAAG.LALFT......LG--VWA...QISLA..........................
A2EZ30_TRIVA/7-219LARTI....IG.LVN..LI---ILIV..MAVIL......YF--SWD..................................
Q176T5_AEDAE/20-244TIKYL....LF.VFN..LI---FAVSG.LVLLI......AG--IIV...LLDVND.........................
LBM_DROME/7-199SVKIA....SI.VLNAVLG---FLAAGAIGWIA........--.....................................
Q6QSX5_ORNMO/7-221CVKYV....LI.ACN..LL---VWILG.LAVLS......IG--IWI...RSDPDFW........................
Q6YWS4_ORYSJ/4-277FSNGV....LG.ALS..FA---ALLAS.VPLIG......AG--AYL..................................
Q5DHT1_SCHJA/5-217FTKVSLTNTLI.LFN..CL---FIIFS.MIVLT......FG--VIP..Q...............................
A0CWV3_PARTE/4-273FVKKV....VG.FGA..FL---IILIG.LALLG......FG--VYVLYKQV.............................
Q9NB10_MANSE/9-232CVKYL....LF.CFN..LL---FAITG.LIILI......VG--IKA...QINSWP.........................
A2DY51_TRIVA/7-217CLRWV....II.IIN..IL---IVIAAVIACAV......VY--TRIGKTS..............................
Q8LAM6_ARATH/4-263VSNFV....VG.LAN..TL---VMLVG.ASAIG......YS--IYM..................................
Q9C7C1_ARATH/4-244FSNTV....IG.VLN..LL---TLLAS.IPIIG......TA--LYK..................................
Q8AV92_PETMA/9-221CVKYL....LF.VFN..FV---FWLAG.GAVLG......IA--LWL...RFDSQTKD.......................
Q4RL59_TETNG/34-259ISKTV....LL.FLS..LV---FWAAG.AALAY......VG--AYVIKSYDNF...........................
Q16HX5_AEDAE/9-218TIKYV....LF.VFN..LL---CSLCG.IALVV......IG--GVSLAKIADL...........................
Q9FJN3_ARATH/7-267LVNIL....AAGVLP..IF---TFVLS.LTLLG......YA--VWL..................................
Q7JYY8_DROME/7-209FLKAV....LI.VLN..VL---LSLIG.VTLIA......LS--VYE..................................
TSN11_BOVIN/15-248YLKYL....LF.IFN..FF---FWVGG.AAVMA......VG--VWT...LVEKSG.........................
Q86D97_SCHMA/7-231CLRVI....LV.VFN..FL---VVLIG.LSVLG......FS--VYI....YL............................
Q4S5B5_TETNG/8-230CIKYM....LF.LFN..LF---FWLGG.CGLLG......VG--LWL...SVSQGS.........................
Q5XGS2_XENLA/8-220VLKYL....MF.AFN..FL---FWVTG.CSIIA......IG--IYF...VVNNI..........................
Q24C18_TETTS/14-278CIQIY....IS.WTS..YI---NLLIS.IAALA......FG--AYEG.I...............................
TSN31_MOUSE/8-196CSRNA....LC.ALN..VV---YMLVG.FLLIG......VA--AWG..................................
Q568F4_DANRE/16-258FLKFS....LN.VYS..ML---FSLLG.LYVLC......IG--VYAEVERQK............................
Q22495_CAEEL/37-297CVKYS....VF.SFN..VI---FFLLG.FGLLL......FG--VWA...QIEKNTF........................
Q4RGV0_TETNG/6-216CVKYL....LF.FFN..LL---FWISG.CIILG......VS--IYV...KVTKDTLGI......................
A2D8F2_TRIVA/5-200CSKLV....LF.IIT..LI---TIGAITAATIS......AT--VLI..................................
Q2F647_BOMMO/7-228FVKYV....LF.FFN..LV---VALLG.LLLVG......IG--VAF...LMNWTM.........................
Q22RT6_TETTS/6-279TNLRL....TE.KLC..YA---NLVTG.LVGII......TG--IVLL.G...............................
A8XFB8_CAEBR/15-256LVKFS....YI.VTA..LI---SILFS.ISCIC......YG--IWL..................................
Q3UWG5_MOUSE/9-230CIKYL....LF.VFN..FV---FWLAG.GVILG......VA--LWL...RHDPQTTSLL....................Y
Q16GP3_AEDAE/9-261IAKTL....LS.VFN..FV---FFVLG.SIVLG......VG--IWL...VADKSSFIALLK................MVE
Q6P3H3_DANRE/8-245ATKYF....LF.LFN..FI---FFIFG.ATIMG......FG--LWI...LLDNQSL........................
Q7SXT2_DANRE/16-243CLKTF....LI.SYS..LI---FWFTG.VILLA......VG--VWG...KVNLE..........................
Q86FE6_SCHJA/8-220CVRVL....MI.VFN..IL---FTMIG.MVVLA......SA--LYF....YISTF.........................
Q4S5Y2_TETNG/9-225LVKFL....VF.FFN..FL---FWLCG.LALIV......VG--ILV...QISLHN.........................
Q8AV91_PETMA/9-216CMKCV....LV.VFN..FI---FWLVG.CALLS......IS--LWL...RFDQNTKD.......................
Q292W4_DROPS/7-217MVKYI....LF.IFN..LL---CSICG.ILLIV......FG--GLLFSNIHNI...........................
Q7JWP5_DROME/7-206VLKGF....AL.FWD..II---LALFG.LVVIG......LG--VHI..I...............................
A2DRK6_TRIVA/7-225MAVAL....IG.VIN..LV---ILVV..MGVVA......YF--CLD..................................
A0EF92_PARTE/7-263CLKCI....VE.FEA..IL---ILIAG.LGSFG......FT--IYL..................................
Q4D6X7_TRYCC/23-265FFRAL....LM.GMN...I---LLTAGAVAGLA......VG--LL...................................
Q9NB07_APIME/7-222MIKYL....LF.IFN..FV---FAVCG.LGILT......LG--VLI....HLQIL.........................
CD82_HUMAN/8-256VTKYF....LF.LFN..LI---FFILG.AVILG......FG--VWI...LADKSSF........................
Q86FC1_SCHJA/3-271CIRPA....VLIIIN..IV---FITFG.LILFT......GG--ITVVHFQGENIEKISDLIHI............LLQKI
RDS1_XENLA/10-290FQRRVKLAQTLWLLS..WL---SVLVG.CLTFG......MG--IFL..K...............................
Q16HS3_AEDAE/6-221TVKTS....LI.VLN..MI---CLLCG.LWLTI......VG--LVMMYKYSDL...........................

PF04103

Q7QF09_ANOGA/191-317------------VLG--LI...QLLLS-VTLAA------LG..GLV----------------------------------
T176B_HUMAN/66-229------------ALG--VT...QILLG-VVSCV------LG..VCL----------------------------------
M4A14_HUMAN/44-221------------VLG--AT...QILLA-LIIVG------FG..TIF----------------------------------
M4A10_HUMAN/59-193------------ELG--AF...HITIA-LLHLV------FG..GYL----------------------------------
Q3UAR5_MOUSE/47-204------------VLG--TI...QLLCA-LILAS------FG..GIL----------------------------------
Q4RID0_TETNG/40-178------------YLG--LC...HMGLG-AMVLA------FS..FTS----------------------------------
MS4A5_HUMAN/49-189------------ILG--TI...QILFG-IMTFS------FG..VIF----------------------------------
Q3LRP2_CALJA/51-216------------VLG--AV...QIMNG-LFHIA------LG..GLL----------------------------------
A7S4D6_NEMVE/20-179------------GFG--VV...QVILG-LSLTG------LS..FAA----------------------------------
Q16GM4_AEDAE/220-341------------VLG--VL...QLIFS-VTLAA------LG..GLV----------------------------------
MS4A3_MOUSE/27-172------------ALG--AI...QILNG-ILILA------LG..IFL----------------------------------
CD20_MOUSE/44-210------------ALG--AV...QIMNG-LFHIT------LG..GLL----------------------------------
Q3TPB3_MOUSE/27-182------------LLA--LL...QLALG-IAVTV------LG..FLM----------------------------------
A5WUV1_DANRE/56-184------------ALG--TV...QIMIG-VVTLL------LE..IVC----------------------------------
A5WUU6_DANRE/48-180------------ALG--TV...QIIIG-LLILL------LE..IVF----------------------------------
Q0V9M1_XENTR/36-200------------SLG--VS...QMVLG-CLIVA------VS..FAA----------------------------------
FCERB_HUMAN/60-204------------FLG--VT...QILTA-MICLC------FG..TVV----------------------------------
M4A13_MOUSE/15-152------------VLG--VI...QIMIG-IYHVL------MWYFLLL----------------------------------
A2BIL3_DANRE/61-221------------SLG--LL...QLVLG-CSMVA------LS..FGA----------------------------------
Q810P8_MOUSE/49-189------------ILG--TT...QILFG-IMNFS------FG..VIF----------------------------------
T176A_RAT/63-223------------ASW--VV...QIVLG-ILSVV------LG..GIL----------------------------------
Q4RKB8_TETNG/40-175------------CLG--VT...QLMLG-LMVMS------YS..IPL----------------------------------
Q4SW16_TETNG/67-213------------ALG--VV...QIMVG-LVCVA------FA.....----------------------------------
M4A6C_MOUSE/47-207------------VIV--AI...QIMCA-VTVLA------LG..IIL----------------------------------
Q5U4S5_XENLA/37-192------------LIA--LL...QLSLG-VSVTV------LS..FIM----------------------------------
T176B_MOUSE/60-224------------SLG--VT...QILLG-LVSCA------LG..VCL----------------------------------
M4A6B_MOUSE/47-204------------VMA--AI...QIMCA-VMVLS------LG..IIL----------------------------------
A2RRW5_DANRE/53-183------------ALG--AV...QIIIG-LWTFL------LG..IVS----------------------------------
Q5R1M8_FELCA/51-217------------PLG--AV...QIMNG-LFHMA------LG..GLL----------------------------------
Q4RKB7_TETNG/24-169------------SAA--VV...TILLG-LFQVL------LS..ALL----------------------------------
M4A8A_MOUSE/87-225------------VLG--AI...QILIG-LVHIG------LG..SIM----------------------------------
Q95PZ5_CAEEL/94-253------------RLC--LV...ELMLA-VVILG------GG..IWC----------------------------------
Q1LVQ8_DANRE/42-197------------LVA--LL...QLLLG-IAVAA------VA..FLM----------------------------------
Q17QX1_BOVIN/51-216------------ALG--AV...QIMNG-LFHIA------LG..SLM----------------------------------
A5WUV2_DANRE/56-191------------ALG--TV...QIMIG-VLTFL------LG..ILC----------------------------------
Q29RT3_BOVIN/44-181------------VLG--AS...QVLLA-LIIAG------IG..AIF----------------------------------
Q58DM5_BOVIN/48-208------------VLG--II...QILCF-LVISS------LG..VIL----------------------------------
A3KNL7_DANRE/59-198------------ALG--TV...QIMIG-LFTLL------LG..IAS----------------------------------
Q8MJ38_PIG/60-203------------FLG--VT...QILVG-LICLY------FG..TIV----------------------------------
M4A15_MOUSE/76-198------------ALG--TV...QILIG-LIHLG------FG..SVL----------------------------------
A5PMI8_DANRE/61-210------------ALG--TV...QIMTG-VIVFL------FG..IVL----------------------------------
A6H741_BOVIN/62-223------------ALG--VT...QLLLG-AISCA------LG..GLL----------------------------------
Q4JF27_HUMAN/46-188------------VLG--VV...QILTA-LMSLS------MG..ITM----------------------------------
Q5BLB6_DANRE/53-183------------ALG--TV...QIMIG-VVTFL------FG..IVS----------------------------------
Q5M796_XENTR/47-192------------VLG--VI...QLFTG-ITQIA------AG..IVL----------------------------------
M4A6D_MOUSE/47-207------------VMA--AI...QIMCA-VMVLS------LG..IIL----------------------------------
Q4SZQ8_TETNG/34-173------------ALG--IT...QIVLS-AFQIV------CV..SVF----------------------------------
Q4TAI3_TETNG/57-208------------LLG--TL...HILAG-LLNIL------LS..VIL----------------------------------
Q567H8_DANRE/59-196------------ALG--TV...QIIIG-LLTFM------LG..IVS----------------------------------
MS4A3_HUMAN/50-196------------VLG--AI...QILNA-AMILA------LG..VFL----------------------------------
A7E2J6_DANRE/50-185------------ALG--TV...QIMIG-VLTLL------FG..IAS----------------------------------
FCERB_MOUSE/52-195------------FLG--AT...QILVG-LICLC------FG..TIV----------------------------------
Q4S7F2_TETNG/34-189------------VVA--LL...QLLLG-VAVTV------VA..FLM----------------------------------
Q08BU9_DANRE/43-180------------SIG--VV...LSMMG-VGLFL------FG..IPM----------------------------------
Q5BLA7_DANRE/16-153------------VLG--IL...QVACA-GLCVV------CG..FMD----------------------------------
MS4A7_HUMAN/47-207------------VLG--TV...QILCC-LLISS------LG..AIL----------------------------------
T176A_HUMAN/56-214------------ASW--VM...QIVLG-ILSAV------LG..GFF----------------------------------
Q0P3U8_DANRE/59-198------------TLV--NV...QIMIG-VLTFL------FG..IVL----------------------------------
Q80WF0_RAT/44-182------------LLG--AI...QILLS-LVIIG------LG..VIV----------------------------------
M4A10_MOUSE/56-190------------KLG--GF...HIAIA-FAHLA------FG..GYL----------------------------------
CD20_CANFA/51-216------------TLG--AV...QIMNG-LFHIA------LG..SLL----------------------------------
M4A12_HUMAN/90-225------------ALG--VI...QIMVG-LMHIG------FG..IVL----------------------------------
Q9EQY9_MOUSE/43-171------------VLG--VV...QVMIA-LINLS------FG..III----------------------------------
A7SQ32_NEMVE/7-164------------LLG--IISSFHLVFG-VFSVV------LG..IVT----------------------------------
M4A8B_HUMAN/71-207------------TLG--AI...QIIIG-LAHIG------LG..SIM----------------------------------
M4A4D_MOUSE/43-170------------VLG--AI...QVMIA-FINFS------LG..III----------------------------------
A3KNQ4_DANRE/48-184------------SIG--VV...LVMMG-VCLFM------FG..IPM----------------------------------
Q9GYM6_CAEEL/45-206------------ALA--NV...HVFLG-IIMIV------LSGLADY----------------------------------
A5PM84_DANRE/63-199------------ALG--TV...QIMIG-VIVFL------LG..TVL----------------------------------
Q3T128_BOVIN/66-204------------ALG--AT...QILIG-LIHLG------LG..SVM----------------------------------
A0JMW7_XENLA/42-205------------SLG--LL...QLILG-CCTVA------LS..FGA----------------------------------
Q9ES61_MOUSE/43-171------------VLG--VL...QVMIA-IINLS------LG..III----------------------------------
Q28GK5_XENTR/3-141------------VLG--IL...QIACA-GISIV------SG..FMD----------------------------------
F189B_MOUSE/36-196------------TLG--LA...QVLLG-ILVIT------FS..MVA----------------------------------
T176B_RAT/60-224------------SLG--VT...QILLG-LVSCV------LG..VCL----------------------------------
Q2KII2_BOVIN/49-189------------ILG--AV...QILLG-AMNFS------FG..TVL----------------------------------
Q1LX35_DANRE/59-175------------LCG--VI...QIFSA-VSCIF------CT..LSY----------------------------------
M4A18_BOVIN/154-273------------TLG--AI...QILIG-LTHIF------TA..INP----------------------------------
Q567A9_DANRE/32-162------------ALG--AV...QIMIG-AWTLL------LG..IVT----------------------------------
T176A_BOVIN/63-220------------TSW--VM...QIVLG-LLSGV------LG..GFL----------------------------------

PF13273

D7UXS6_LISGR/3-100QRKAE------------FI---MTIIG-ASLAI------LG---------------------------------------
C2RQC7_BACCE/10-90KRTPE------------FV---LGLIG-G...I------LG---------------------------------------
C3AKH5_BACMY/2-83KRTPE------------FI---LGLIG-G...I------FG---------------------------------------
Q2B2X7_9BACI/2-86KRTAE------------FV---LGLVG-G...I------IG---------------------------------------
C9B7Y0_ENTFC/3-104KRKTE------------FI---LILIS-G...I------TG---------------------------------------
C7DIS7_9EURY/29-132PPTAA------------FV---LLLIG-G...I------II---------------------------------------
D7DCC0_STAHD/4-91KPKAA------------FI---LGLIA-G...I------LG---------------------------------------
A0B9F9_METTP/2-84SRNAE------------LA---LGIVG-G...L------FG---------------------------------------
Q12UE5_METBU/2-98SKKTE------------TI---FGIAG-G...S------IG---------------------------------------
B9DJA4_STACT/148-230NRVAE------------MV---LGIMG-S...V------FG---------------------------------------
C4WAZ9_STAWA/11-93NRVAE------------MI---LGIMG-S...I------FG---------------------------------------
Q4L9M4_STAHJ/13-95NRIIE------------MI---LGITG-S...I------FG---------------------------------------
A5UKZ4_METS3/8-83SRIFE------------LI---VGGLG-A...L------VS---------------------------------------
A5N2M2_CLOK5/4-86KKTVE------------LV---LGLIG-G...I------LG---------------------------------------
Q97LL2_CLOAB/4-86KRTVE------------FV---LGLIG-G...I------FG---------------------------------------
A9VVN7_BACWK/2-84KRTIE------------FV---LGLIG-G...I------LG---------------------------------------
B3ZH23_BACCE/2-84KRTTE------------FV---LGLIG-G...I------FG---------------------------------------
C3BEA6_BACMY/2-84KRTTE------------FV---LGLIG-G...I------FG---------------------------------------
Q4V1S6_BACCZ/2-84KRTIE------------FV---LGLIG-G...I------LG---------------------------------------
D4FV71_BACNA/2-84KRTTE------------FV---LGLIG-G...I------FG---------------------------------------
C2VWU6_BACCE/24-113KNKLE------------FI---LGLIG-G...I------LG---------------------------------------
C2U6N9_BACCE/2-85KRTGE------------DV---IGLIG-T...L------LG---------------------------------------
A5UL06_METS3/42-117SRTLE------------LV---LGIIG-A...I------FG---------------------------------------
O26620_METTH/8-82SRTLE------------LV---LGVIG-G...I------FG---------------------------------------
C8JWL3_LISMN/13-93GRTVE------------FC---LGLCG-G...I------FG---------------------------------------
D7V0U0_LISGR/3-121KRTGE------------VT---LATIG-L...I------LG---------------------------------------
C8JTX3_LISMN/3-121KRTGE------------IV---LAIIG-L...V------LS---------------------------------------
D3KN98_LISMN/3-121KRTGE------------IV---LAIIG-L...I------LS---------------------------------------
Q92D69_LISIN/3-121KRTGE------------IV---LAIIG-L...I------FS---------------------------------------
D3ULL7_LISSS/3-121KRTGE------------VV---LAVTG-L...V------IS---------------------------------------
A8FJ46_BACP2/3-107RRKGE------------KI---MGIIS-I...V------LN---------------------------------------
B4AK11_BACPU/3-107SRKGE------------KI---MGIIS-I...V------LN---------------------------------------
C2H7S4_ENTFC/2-107KRKWE------------LL---LGMIG-G...S------LS---------------------------------------
C9ATK3_ENTFC/2-107KRKWE------------LL---LGMIG-G...S------LS---------------------------------------
E6TU87_BACCJ/2-115KRTGE------------IV---LGVIG-A...I------GY---------------------------------------
B9CUN6_STACP/3-110KRTVE------------KV---LSWIG-N...I------LH---------------------------------------
C5QNE2_STAEP/3-110KRTGE------------KV---LSWIG-N...I------LH---------------------------------------
C2LZ67_STAHO/18-125KRTGE------------HV---LTWIG-V...A------IQ---------------------------------------
Q4L9F8_STAHJ/19-126KRTVE------------HI---LTWLG-V...V------LQ---------------------------------------
C4WCX0_STAWA/2-110KRTIE------------RI---LAWLG-I...I------TQ---------------------------------------
Q4A0V3_STAS1/2-109KRTIE------------RV---LTWIG-I...V------LQ---------------------------------------
C5QZN6_STAEP/3-109QRKGE------------LI---LSWIG-N...G------LH---------------------------------------
D3QGJ5_STALH/3-111KRTVE------------TV---LTWSG-I...I------LH---------------------------------------
D3QGJ6_STALH/3-111KRTGE------------KV---LTWIG-F...I------LH---------------------------------------
Q4A0E9_STAS1/2-112KRTAE------------KI---LIWIG-I...I------LQ---------------------------------------
C5NV51_9BACL/5-120KRTVE------------KV---LAWIA-N...I------IL---------------------------------------
C5NWK3_9BACL/5-118SRKIE------------KI---LAWIA-N...V------IM---------------------------------------
Q49WN0_STAS1/2-102NRKPE------------RI---MAWIA-N...G------LS---------------------------------------
Q8ERL5_OCEIH/2-100NRSVE------------RI---LSTIA-V...C------VD---------------------------------------
A7A3G5_BIFAD/15-115ARKAE------------RV---LMTIA-A...A------YN---------------------------------------

PF00335

TSN15_MOUSE/19-259........EAERQKY.KTLESAFLAPAIILIL---L--G-V-VM.FIV.S-------------------FIG-V.LA.SL
Q29BB1_DROPS/7-204.......ASIVTNLP.IV........GGILA.---C--G-V-IL.ICI.S-------------------MLG-L.AG.AV
TSPC_DICDI/14-226KESGYKNALSNLTTS.AP........TGVLV.---I--G-I-FF.ILL.T-------------------LVG-C.FV.AY
TSN33_MOUSE/21-264.....EAALACLAVD.PA........ILLIV.---V--G-V-LM.FLL.T-------------------FCG-C.IG.SL
Q9VMJ6_DROME/18-261...FRNIARLHFIAL.DP........AFVLII---L--G-G-VT.FLL.G-------------------FMG-S.VG.AL
Q7QJ21_ANOGA/9-222...QYAPIVKNQFWE.PF........AVLIG.---L--G-I-IS.QAL.C-------------------YLG-W.TS.TS
Q7Q8G1_ANOGA/14-231...FQNFIDSHFFVP..P........NLLIA.---I--G-I-IL.LVI.A-------------------LFG-C.VG.AL
Q84WF6_ARATH/4-245...........GRSK.TTCE...HFLQKPLLI---L--G-L-AI.LIL.S-------------------VAG-L.VG.AC
TSPE_DICDI/16-219...........YYLN.EYYLVKDLTIPLGSFI---L--S-A-YM.VIT.T-------------------IVG-G.IA.IW
Q16LT3_AEDAE/14-239...FEYFIDSHFFSP..A........HLMVA.---I--G-I-IM.IFV.S-------------------IFG-C.FG.AI
Q5C164_SCHJA/7-207.....HWKEIDPPLQ.SL........IIFIIA---I--G-C-FL.FVL.G-------------------ALG-M.FG.AC
Q8SU08_ENCCU/10-189...........YATA.HEILQIPTKMLMLSYV---L--G-I-LE.VLS.A-------------------VLG-Y.TA.LA
Q9W4X6_DROME/42-295.......EDANGSVRLENFYDVFLNISLVMIL---A--G-T-VI.FLV.S-------------------FSG-C.VG.AL
Q9NB13_DROME/7-221...FDVAGSGTDPNT.IP........ICVTV.---L--G-G-LI.FVV.S-------------------FFG-C.YG.IF
Q6DCP2_XENLA/9-233...TLIMKNATSSGT..P........IAIIV.---V--G-L-VI.FLI.A-------------------FFG-C.CG.AL
Q6GLY9_XENLA/10-290........IEIRKRSELMVSGGMHTVPNMLIA---V--G-V-IA.CVI.N-------------------FFG-GKIC.YD
Q8SY17_DROME/7-219..EVNGQVGFPIQAL.MP........IILIS.---L--G-S-IV.DFI.S-------------------FLG-C.CG.AI
Q1EC46_DROME/7-202........VNVIAID.QIAPKDQLILGLYIA.---V--G-S-IV.FLL.S-------------------FFG-C.FG.AI
TSPD_DICDI/11-224.....KELQEVGGVS.ESIKSISVSLPAGVLS---I--G-I-FF.MVL.T-------------------VAG-C.IV.AY
A2FKF6_TRIVA/7-185........INKNDLSSIAPTKTFLISSIVVFG---V--S-V-FI.LAF.S-------------------IYA-S.IS.KR
A2DWZ1_TRIVA/7-204........AIKSINI.DQIKAFSKTTYFLFAV---L--G-V-VI...LGC-------------------LIG-FSLI.CF
Q4DD38_TRYCC/86-309........VARQNAA.VRLCEPCGQIAMSALV---F--G-I-IL.CLF.T-------------------ILG-F.MW.IR
TSN16_HUMAN/10-243..TNVLGLSSAYLLH.VG........NLCLV.---M--G-C-IT.VLL.G-------------------CAG-W.YG.AT
Q5KAR0_CRYNJ/191-384........WLNIFYQ.SDVIRVGNRTELIIST---V--A-A-SM.ITFTS-------------------LLG-F.AG.IF
TSN32_HUMAN/9-229........RASLEKN.PYQAVHQWAFSAGLSL---V--G-L-...LTLGA-------------------VLS-A.AA.TV
Q9V3X2_DROME/9-261..MLSMTQNYNHYHI.AL........YVFLA.---I--G-I-LI.TLG.A-------------------FFG-C.CG.VC
TSPB_DICDI/14-224.....KDFTKVSKAS.AALSNLTTGAPAGVLV---I--G-I-FF.VIL.T-------------------VIG-C.FV.AG
Q9VID1_DROME/8-228...YSNFVSDHVWTA..P........IILMI.---V--G-A-AV.AVI.C-------------------FLG-C.CG.AL
Q64HX8_ONCMY/9-234...TVVINNVSASSA..P........LVLIV.---V--G-V-IV.FFI.A-------------------FFG-C.CG.AW
Q29IZ2_DROPS/18-232........GFNDWLR.ILEAQSFYIGVYVLIG---V--S-I-IM.MAV.S-------------------FLG-C.LS.AL
Q1HRC5_AEDAE/13-234...INELLGTNLFSG.AV........YVLIA.---T--S-A-LV.CLL.S-------------------FFG-C.IG.AA
TS31A_XENLA/8-198........KGFGIVS.SIH.....IIGGVIA.---I--G-V-FL.LLI.A-------------------IIG-L.IG.AV
Q17441_CAEEL/23-259...LIPLIQSHFYVK.CI........YLAVG.---C--G-V-FN.VII.G-------------------FL.-..VH.SA
Q5DG31_SCHJA/16-308.......VQFNEFET.IM........KTYYFS---S--G-K-LI.LLLSS-------------------IVG-..AGVAV
Q2TCS3_BRABE/7-240..MIRAYPISDEMYI.PV........FCLMA.---M--G-A-YL.MII.T-------------------FCG-C.CG.AA
Q2TCS2_BRABE/9-231LHNLDNLDETVVYAG..C........YAFIG.---V--G-A-VA.LVV.G-------------------FFG-C.CG.AV
Q9ZUN5_ARATH/3-256........A..SKPD.NECV...NLLRWPVVV---L--G-V-LI.LVV.S-------------------ATG-F.IG.AY
TSPA_DICDI/14-224.....KDFTKASDAK.SALSNLTTSIPAGVLV---I--G-I-LF.VIF.T-------------------VVG-C.FV.AY
IM23_SCHMA/10-212.....YGDNLHKVWQ.AA........PIAIIV---V--G-V-II.LIV.S-------------------FLG-C.CG.AI
Q29JV0_DROPS/10-238...YELFLAGKFFSI..P........TFLIV.---I--G-A-FI.IVI.T-------------------FFG-C.WG.AL
Q6GP84_XENLA/8-227...FATLSVSFPSLS.AA........SLFMV.---T--G-S-II.MVV.G-------------------FIG-C.LG.AV
Q5DB78_SCHJA/24-277.....ESGGIPWKSN.ITALQWLFNLTVICTG---V--G-I-IT.LFV.S-------------------LAG-F.IG.SL
A0BI34_PARTE/7-267........SFDDAIKDLGITDINTSAIIVPFW---I--F-A-AV.VIFFA-------------------ISG-L.CG.AK
Q5GM22_TAESO/9-219.....KKSGGTVSLV.LP........AFITA.---F--G-L-LL.FLI.G-------------------FLG-C.FG.AC
Q9XVI4_CAEEL/8-223...VLDILGDERLAT..P........ILLLV.---I--G-S-LC.TLL.G-------------------FLG-C.CG.AI
A2G3J8_TRIVA/7-186........IVHYKIKEITDNNTILIYIIIILV---A--S-A-FI.LVF.A-------------------IYA-S.IA.NA
A2EZ33_TRIVA/7-201........QIKKINI.DEVHSSKNVLIFVIV.---V--I-A-FI.ALT.C-------------------IIG-FFMF.CY
Q5DH84_SCHJA/4-271KMRIKLNDNVIDDIN.RILRTFIRPVTLPLMA---I--S-L-VF.ICI.Y-------------------LFG-V.LI.AF
Q60D82_BRAOL/4-254........FIEGPSQ...CQ...RFIQNPLIV---T--A-T-LI.FFI.S-------------------SLG-L.IA.AL
Q4RYD3_TETNG/10-300........IELRKRSELMDNNESHFLPNLLIL---L--G-L-VA.CGM.N-------------------VFG-GKIC.YD
Q24C21_TETTS/14-285........KNKSVWS.NSSFDWNKTLIALLI.---A--G-S-VF.LLLAS-------------------IAG-I.CG.GR
A2DI21_TRIVA/15-204........FGKTNIS.SFLPVDMISLFISVII---L--G-F-II.IVV..-------------------..G-W.VA.AV
Q6GNW4_XENLA/9-244.ISVLQTSSWYLRTG..S........YILIA.---V--G-G-CT.MVM.G-------------------FLG-C.LG.AV
Q4SU90_TETNG/14-272...YMLLI.SNSPSN.GP........LVLAG.---T--G-G-AI.VLF.G-------------------LFG-C.FA.TC
Q2TCR9_BRABE/6-237..PVVTLQLGWFYSA.V.........YVIII.---V--G-V-VT.IAI.G-------------------FLG-C.CG.AM
Q7T376_DANRE/6-213........MTFSRLSLLPSLQAMSIANTLFI.---T--G-I-II.TCV.S-------------------FLG-F.LG.AL
Q7JZW7_DROME/7-210........GVYELDK.FNEGSAEHTEKFVQLG---M--A-G-AL.ILA.G-------------------LVG-C.LG.AI
Q4PLY6_IXOSC/9-219...QKSFYE.GYLGA..P........VAIII.---L--G-V-FV.FVL.A-------------------FLG-C.CG.AI
Q2TCS4_BRABE/9-233.KFVSGDLNMTWFYT.AC........YVMIA.---A--G-A-IT.MVT.G-------------------FLG-C.CG.AM
A1Z8K7_DROME/8-233...FNHFVEGRVLAP..P........IVLIV.---T--G-L-II.FLI.A-------------------SLG-C.FG.AI
A1Z6U3_DROME/7-206........LSKAPIA.Y.........ILFLYG---L--G-G-II.FVS.A-------------------VLG-C.CG.IC
Q5DH43_SCHJA/12-223...GILDAHIPAVHA.GA........NLLIA.---V--G-F-FI.MLM.G-------------------FLG-C.CG.AI
TSN12_HUMAN/9-249....LTLTAETRVEE.AVILTYFPVVHPVMIA---V--C-C-FL.IIV.G-------------------MLG-Y.CG.TV
Q7Q1S3_ANOGA/9-239...FRDILDAKFFSI..P........TFLVV.---I--G-S-FI.FVI.A-------------------FFG-C.CG.AY
Q5PQ10_XENLA/8-231...SYQSFFNDRYIL.IP........SCLAV.---T--G-T-FF.LVFNG-------------------LLG-C.CI.SK
O44582_CAEEL/29-290........FIKDFRE.VKLVDIILNPAILISI---F--G-F-SI.CVV.S-------------------FFG-F.MG.AL
Q06AT4_PIG/10-258.......YSLYPLLE.ATDNDDIYGAAWIGIF---V--G-I-CL.FCL.S-------------------VLG-I.VG.IM
Q6DDY1_XENLA/6-239IFETVSANAALQFVN.VG........YFLIA.---I--G-A-LL.VLL.G-------------------FLG-C.CG.AQ
Q9UAI4_DROME/9-228...VYYGIVQNKLWA.PA........AILLC.---L--G-T-VT.FIL.C-------------------WMG-C.QA.TN
Q503H8_DANRE/10-204.LLSENDAPENFFIA..V........YILIG.---A--G-G-IM.MIV.G-------------------FFG-C.FG.AV
Q5BL96_DANRE/12-254.....ESDVVDTLMA.DP........ALLLIV---V--G-S-LM.FTI.T-------------------FLG-C.FG.AL
Q292V6_DROPS/9-211........WGSAASI.FG........SYTTAL---I--G-A-AV.FGV.A-------------------FLG-VYVALKE
Q16TV5_AEDAE/8-254...YATLLPDHAALS.AD........CLFMT.---I--G-V-IS.FVI.A-------------------FFG-C.CG.SW
Q7K527_DROME/7-213........WGAMPDA.YA........IGILI.---L--G-G-TI.LVI.S-------------------LFG-C.CG.AV
A8WRV5_CAEBR/9-230VASTVKVDLSQVLNQ.VNIQQINTFLYVALV.---I--G-G-AL.LIL.G-------------------FFG-C.CG.SC
Q5ZII8_CHICK/15-247...YISLLSSSTYSA.TA........YILVV.---A--G-V-VV.MVT.G-------------------ILG-C.CA.TF
TSN14_HUMAN/14-261...LSDLTKVTRMHGIDP........VVLVLM---V--G-V-VM.FTL.G-------------------FAG-C.VG.AL
Q2TCR8_BRABE/9-244...YFDFTGNAFASA..P........VFLII.---L--G-V-FV.SII.G-------------------FLG-C.CG.AI
Q2TCS8_BRABE/8-228VFQLLNLSELLLRGG..G........IALIV.---V--G-V-IT.MIV.G-------------------FLG-C.CG.AI
Q86FE8_SCHJA/7-285.VQFFWSDNANGLEI.FQGTALLRYFGYAVIF---I--G-S-VT.IPI.T-------------------LVE-F.CG.LA
A1Z6U7_DROME/7-216............QMA.EPNTPEHTYFVKSLV.---L--G-G-SI.CMI.V-------------------MFG-C.YG.MV
Q6GQE5_XENLA/9-221.LFESDQNPEKFYIG..V........YILIG.---A--G-A-LM.MLV.G-------------------FLG-C.CG.AI
Q9U2K6_CAEEL/7-216ILRDNDPEPLAGVKS.DIRTGIIVSFWIIIG.---F--A-I-AN.VII.G-------------------FVG-V.IG.AV
Q8MS10_DROME/8-256...YATLLPQHAGLS.AD........TIFMG.---I--G-G-TG.FVV.S-------------------FFG-C.CG.AW
Q29JV1_DROPS/14-246...FSVFIDGHFASP..P........ALLIA.---I--G-F-IL.IAV.A-------------------ALG-A.YG.AV
Q6Z5Z9_ORYSJ/5-263........GAPHRGG.GGVTECERFLRAPALA---L--G-G-AI.VAV.S-------------------LAG-L.AG.AC
Q4RSA5_TETNG/8-245.IAVLQESSDTVKVA..S........YILIG.---V--G-S-LS.MAL.G-------------------FFG-C.IG.AI
Q6NYK2_DANRE/10-290........TELRRRGEVMDNTDIHCVPNTLMI---V--G-L-AS.MGG.N-------------------YFA-SRIC.QD
Q6DDY2_XENLA/8-252.......YKVYPILG.VTGKDDVFAGGWIAIF---C--G-F-SF.FIL.G-------------------VFG-I.LA.VQ
Q0V996_XENTR/6-236LGSAAPQLMQVVNVG...........YLCIA.---V--G-G-FL.ILM.G-------------------FLG-C.CG.AV
Q5DDB8_SCHJA/7-215........IKDLIEYSTVLNGSTPTIYTIAII---L--A-C-ID.AIT.A-------------------VVG-I.LG.FW
Q4T8J0_TETNG/8-244.IVVLSDSTAV.KTA..C........YILIG.---V--G-A-FS.MLL.G-------------------FLG-C.LG.AI
CD63_MOUSE/9-231...AITHETTAGSLL..P........VVIIA.---V--G-A-FL.FLV.A-------------------FVG-C.CG.AC
Q6P0W1_DANRE/7-218........ETRGFFD.IDLNTSQFNIGVMVLM---V--S-G-AL.MLLVS-------------------VIG-N.CG.VC
TSP1_CAEEL/7-221YKYDDPKSLADAKFN.IRVWLIVVFWSIIGLS---L--G-A-VV.T...A-------------------VLG-M.ISSVW
Q1L9G8_DANRE/9-220.FFTAENGQTVFLTG..V........YILIV.---A--G-A-VM.MVV.G-------------------FLG-C.CG.AI
Q16J92_AEDAE/9-260..LISMTQNENNYFI.GL........YILLV.---V--G-G-LM.LSV.A-------------------FLG-C.CG.AF
Q29D35_DROPS/9-259SERIEQFTQTQVIEQ.LA........YVLIV.---I--G-A-VM.FFM.S-------------------FLG-Y.LG.AM
Q3ZLC3_OREMO/6-225TDQYFPAV..................NLMIA.---I--G-A-II.MVL.G-------------------FLG-C.CG.AY
Q75IM5_ORYSJ/6-249........A..KGST.ATCS...SMLQTPLLV---I--G-F-VV.LLV.S-------------------LAG-F.VG.AC
Q16LT5_AEDAE/17-240.....TAFVDEQFYS.PA........CMFVV.---V--G-V-IT.VAI.A-------------------TFG-F.IG.TI
A2G0G6_TRIVA/19-208........VAKTNIT.SFFPVDLETLFIAIIF---L--A-V-IL.LVV..-------------------..G-W.SS.AR
Q5DGI2_SCHJA/10-219.....YSTGIDSNIK.GL........VIFIII---L--G-C-FL.FLL.G-------------------FLG-F.CG.AC
Q7JWV7_DROME/7-218....SGVGETFTANS.VA........IIILV.---L--G-C-VV.FLV.A-------------------FMG-C.CG.AI
Q9FVY6_ORYSJ/5-257........S..THND...ECR..RSLTIPVMG---L--G-G-VI.FLI.S-------------------LVG-F.LG.AW
A2AGS8_MOUSE/8-247..REIVATNPLLTTG..A........YIVLA.---M--G-G-LL.FLL.G-------------------FLG-C.CG.AV
Q6INJ9_XENLA/8-187........IGFGLIS.SLR.....VVGVAVA.---V--G-I-LL.FLI.A-------------------LVG-L.IG.AI
CD53_MOUSE/8-210...YGVLFRNLPFLT.LG........NILVI.---V--G-S-II.MVV.A-------------------FLG-C.MG.SI
A8X5P0_CAEBR/7-223GDFVRQIDGIDVKLI.NEIAEYQASLWILVA.---V--G-A-LL.FIV.G-------------------FFG-C.CG.AG
Q86FA1_SCHJA/5-268KMYGEEVARDFTDLA.STILEFTSPFGLLLFI---L--G-L-VA.LAI.C-------------------LFG-F.CG.TS
A1Z6U8_DROME/7-209........CSYALIA.FSHSVAIRVPSILGIV---L--G-G-LL.FFS.T-------------------IFG-C.IA.AL
TSN6_BOVIN/16-237...YFSLL.NEKATN.VP........FVLIG.---T--G-T-VI.ILL.G-------------------TFG-C.FA.TC
Q6Z6K0_ORYSJ/3-259........A..SAQG.EECA...RLARWPVAI---L--G-G-LI.LLA.A-------------------LAG-F.VG.AY
Q4SM43_TETNG/8-236.....DHFFEDVYTF.IP........AVTIIG---V--G-A-LL.FII.G-------------------LIG-C.CA.TV
Q0QBV5_HELTB/11-271.ILEILDNPLIQ..N.SA........YLIIA.---L--G-S-FI.IIV.S-------------------GLG-C.CG.AC
Q5DFJ8_SCHJA/7-215........ITLNQFN.VILQESKPSIYMFACI---S--G-G-LG.VLS.A-------------------CIG-I.FG.LS
Q6DHQ4_DANRE/8-230...FATLSSSLPSLS.AA........NLLIA.---A--G-T-VV.MVI.G-------------------CLG-C.VG.AV
Q245V1_TETTS/9-275........GQNKKVT.SDSANFIAASFGIMLG---L--G-F-IL.LLV.G-------------------ALG-L.LA.WK
Q5DHJ8_SCHJA/10-217........LDTLLKYDTIIQITPPAIYGTVIF---T--S-I-LG.IIT.A-------------------IIG-F.IG.LW
Q24FE3_TETTS/5-264........YQQYAYT.TYTNNLFSGILIFGIV---L--G-V-FL.ILW.T-------------------LFG-V.LA.AQ
Q4T2B0_TETNG/10-333........VELQRWQEVMSEQGLLYVPHMLIS---T--G-L-AA.CCI.N-------------------FLG-GKIC.LD
Q2TCS0_BRABE/9-233.KVVAGEIDLGFFYT.AC........YVLIV.---A--G-A-FT.MVV.G-------------------FLG-C.WG.AV
Q6Z8Q8_ORYSJ/5-259........A..TRGD.GGECD..RHLSSPAIA---L--G-A-VL.MAV.S-------------------LAG-L.VG.AC
Q6W8Q0_BRABE/9-238.ALSLTEFDQQLLTS.TC........NAMIA.---V--G-V-IA.ILI.G-------------------FLG-C.AG.AA
Q0V9E6_XENTR/12-237.....ISVVLSETSS.GA........PLVLTV---T--G-I-II.FIM.S-------------------GFG-A.IS.VL
TSN8_BOVIN/7-235.ILAPGDADLNLFIA..V........NILIF.---V--G-A-VI.MIL.G-------------------FLG-C.CG.AM
Q4D693_TRYCC/53-289........IGGSKSK.ELNFCHDCKTLILFLL---V--P-G-IF.FVVMG-------------------IVG-G.VS.AW
Q5I0R1_XENTR/7-227..QQELNIDGGSLLS.AV........DLMIA.---V--G-A-II.MVL.G-------------------FFG-C.CG.AI
Q24FE4_TETTS/5-254........YVKYTSI.TNADTYFQFALIICMA---F--G-S-LL.TIW.S-------------------ILG-M.IA.TF
Q9M0B7_ARATH/4-258...........SLKA.TTQCE..RFLDKPMIA---L--G-V-FL.MII.A-------------------IAG-V.VG.SC
A0BP70_PARTE/7-282........QYLDYLD.EFTNSKPSDGILIALY---I--F-S-SI.LILFG-------------------ICG-I.VG.GW
Q7K010_DROME/6-211............AVS.YNLNEIGQLTAYGYVG---L--G-A-AA.LLV.V-------------------LWG-Y.LS.AW
Q67WQ6_ORYSJ/4-259........S..NRAA.TTDCE..RFMERPVVA---L--G-V-LL.LAL.S-------------------LAG-L.AG.AL
TSN1_MACFA/6-239FGPLSSSAMQFVNVG...........YFLIA.---A--G-A-VV.FAL.G-------------------FLG-C.YG.AQ
Q19983_CAEEL/7-278.....PAASDFFALH.STHPGAFRYVGWFLVG---A--G-A-II.ILV.G-------------------YFG-C.IG.AW
TSN2_MOUSE/10-214.LSSEDKSPEYFYVG..L........YVLVG.---A--G-A-LM.MTV.G-------------------FFG-C.CG.AM
O44420_SCHJA/9-217........YDILVKFNIILQGTIPVIFPITIF---L--G-C-FL.LLS.T-------------------LIG-F.IG.LW
A8XY10_CAEBR/57-274QAVENAFWEAPTLFA.FS........YIIIV.---M--G-A-VM.IVV.A-------------------MLG-C.CG.IT
ROM1_BOVIN/11-293........QLWHLGTFLAPSCPFSALPQVALA---A--S-A-VA.LGT.G-------------------LVG-SGAS.RA
Q3UFS7_MOUSE/74-318........TVKRSQG.IGWGGPVPTDPMLMLV---L--G-G-LV.VSVVS-------------------LSG-C.LG.AF
Q2TCS6_BRABE/12-229VMKLAEVSTLTLYVG..G........YVLIG.---A--G-V-IT.MIV.G-------------------FLG-C.FG.AM
Q9SI56_ARATH/15-273........VAVMTLH.YRTDECNRFVTTPGIF---I--S-F-SL.LAM.S-------------------LTG-F.YA.AY
Q9NB09_MANSE/12-245...VSFFLEDHFFSP..A........TFVIV.---I--G-V-IM.LFV.S-------------------LFG-C.IG.AL
Q1HQ39_BOMMO/7-211...IETVLSETSFRV.AP........VACMI.---V--G-G-IA.FII.A-------------------FFG-C.CG.AI
Q16HS1_AEDAE/9-225....TNLTHRDNLLT.SQ........SLLAMG---L--G-V-II.FAV.S-------------------FFG-F.CG.AA
TSN5_HUMAN/14-261..SNISSITDLGGFD.PV........WLFLV.---V--G-G-VM.FIL.G-------------------FAG-C.IG.AL
TSN10_HUMAN/75-319........AVKGSLG.SDLGGPLPTDPMLGLA---L--G-G-LV.VSAAS-------------------LAG-C.LG.AL
A2ECP6_TRIVA/7-193........AANGISG.ISSFYEGSLSYCTIIY---I--G-S-VIIITVFL-------------------FVK-R.LW.SL
A2FGU0_TRIVA/7-203........KKIDLNS.YLKLIGYKYVPFLLIV---V--T-I-IV.MVFAV-------------------IFG-F.CF.FC
Q7EZC8_ORYSJ/6-199RPLLLLLDVSSLPDG.TAERLSAAWFIYAFIG---V--G-V-IL.FIT.S-------------------IFG-C.AG.A.
Q2TCS7_BRABE/7-197........RAMAMVT.SVS.....LIGGIIA.---S--G-V-FL.LFI.A-------------------IIG-L.VG.AV
Q6P2T9_DANRE/9-230...TAILQ..GASGS..P........MVLIV.---V--G-V-II.FFI.S-------------------FFG-C.CG.AW
Q6P7J5_XENLA/7-233.....ENLLGNMYVM.LP........SVIILA---I--A-V-IM.FFI.A-------------------ILG-C.CS.TT
Q7K2V7_DROME/7-219....TAFDGGVNTQT.IP........ICIIV.---I--G-S-VT.FVV.A-------------------FFG-C.CG.TI
Q7PTA7_ANOGA/9-220....REISDEYNIVA.PS........ILLIV.---F--G-S-VV.FVI.S-------------------FFG-C.CG.AI
Q9C5W7_ARATH/6-190VSFGRPILMAVSLSSNIFDNLPKAWFIYLFIG---I--G-V-AL.FVI.S-------------------CCG-C.VG.TC
Q5D928_SCHJA/7-215........IYNLRKYNTILHVSPPEIIPTVIF---T--G-C-LG.TIA.C-------------------LLG-F.TG.LF
A2G7G6_TRIVA/7-186........INKAKIKQISNNDTILIYLIIILC---A--S-A-FI.LAF.A-------------------IYA-S.IS.KS
Q9NB12_DROME/7-217........LISAAEN.AVSIGKNAAGGLIIA.---L--G-V-VI.LII.A-------------------IFG-C.LA.AI
Q53GA9_HUMAN/7-234.IFGSEDVGSSSYVA..V........DILIA.---V--G-A-II.MIL.G-------------------FLG-C.CG.AI
Q16LT4_AEDAE/34-247........NIFADFH.IFLDDNFHSLTDFILA---V--G-I-IM.LLI.V-------------------LFG-S.VG.IV
O96962_SUBDO/13-238...NYSEVTGSDTAA.AG........AVSIV.---G--G-I-IA.IGV.A-------------------LLG-I.IG.AI
A1Z6T8_DROME/7-220........LSEEQRM.LGMDHGEDLAAVLCVL---L--G-T-VI.VVA.S-------------------IFG-S.VA.VA
A2GDR3_TRIVA/7-201........AIKKNNL.DTLGKAKTGVIMMIV.---V--F-V-FV.AIV.C-------------------ILG-FLII.CF
CD37_RAT/10-270.VSFVGLSFVPLQTW..S........KVLSV.---S--G-V-LT.MAL.A-------------------LLG-C.VG.AL
Q4SA96_TETNG/3-245...DYMTLSANAYPN.AP........SILLA.---T--G-A-AV.TAW.G-------------------FLA-C.LG.VA
A2EZ30_TRIVA/7-219........QIKQIKI.DEIKSSKKVLIFVIV.---V--V-A-II.AIT.C-------------------IIG-FFLL.CC
Q176T5_AEDAE/20-244...YQHFVEDKLMAP..P........VVLIV.---V--G-T-FV.FLV.A-------------------SLG-C.YG.AI
LBM_DROME/7-199........YNADTET.EE........FVIAAY---I--A-C-SL.ILVFA-------------------LLG-I.FA.AI
Q6QSX5_ORNMO/7-221.IYQDNLPLSNYYDA..C........YIIMA.---A--G-V-LL.LIL.G-------------------FMG-C.CA.AA
Q6YWS4_ORYSJ/4-277........L..DHPA.SECQ...RLVRVPAVA---L--G-S-AA.LLL.S-------------------LMA-I.AGVTC
Q5DHT1_SCHJA/5-217........IYLLKFA.NILHGVRPSIFPIVCF---T--G-S-FV.IIV.A-------------------CVG-I.IG.LM
A0CWV3_PARTE/4-273.......GLNYADLYFNTASWLKTLSEYGLLI---L--G-A-VI.LIT.G-------------------IAG-A.KG.SS
Q9NB10_MANSE/9-232...YIDLTDENFYTS.GP........VVLII.---V--G-I-IV.FIV.A-------------------FFG-C.CG.AV
A2DY51_TRIVA/7-217........GTTEYYK.LFKDSTALYPFFAILA---V--C-A-AV.....C-------------------IIG-V.FL.IC
Q8LAM6_ARATH/4-263........F..VHQG.VTDCE..SAIRIPLLT---T--G-L-IL.FLV.S-------------------LLG-V.IG.SC
Q9C7C1_ARATH/4-244...........ARSS.TTCE...NFLQTPLLV---I--G-F-II.LIV.S-------------------LAG-F.IG.AC
Q8AV92_PETMA/9-221.IFDLEGSPSTFYTG..V........YVLMG.---A--G-A-LM.MLI.G-------------------FLG-C.CG.AI
Q4RL59_TETNG/34-259.....DSFIQDRYTL.IP........AAIIIC---I--S-V-VM.FIF.G-------------------LVG-C.CA.TI
Q16HX5_AEDAE/9-218....QDISDEHSIVA.PS........ILFIV.---L--G-S-VV.FVI.A-------------------FFG-C.CG.AI
Q9FJN3_ARATH/7-267.............LY.MRSYDCEDILGLPRVQ---T--L-A-SVGLLAVF-------------------VVS-N.AALFL
Q7JYY8_DROME/7-209............LNS.STPGTFEHIAIVVQIF---V--G-T-FV.VLT.S-------------------FLG-C.FA.TA
TSN11_BOVIN/15-248...YLGVLASSTFAA.SA........YILIF.---A--G-A-LV.MVT.G-------------------FLG-F.GA.VI
Q86D97_SCHMA/7-231.....EPEAQDIILA.SGQQHAVQIMLYALMG---I--G-G-IT.LVI.A-------------------LFG-C.CG.AY
Q4S5B5_TETNG/8-230...FATLSPSFPSLS.AA........NLIIT.---L--G-S-IV.MVT.G-------------------FLG-C.LG.AI
Q5XGS2_XENLA/8-220...YGDLLTNNPSLT.VG........NSFIA.---I--G-I-II.MVF.G-------------------FLG-C.MG.AI
Q24C18_TETTS/14-278........RKKDLWS.KSSFDWNKALVFLLV.---V--G-S-IL.LFFTS-------------------IAG-I.IG.GR
TSN31_MOUSE/8-196........KGLGVVS.SIH.....IIGGVIA.---V--G-V-FL.LLI.A-------------------VAG-L.VG.AA
Q568F4_DANRE/16-258.....NRTLEGVFLA.PA........VVLIL.---L--G-L-VM.FTV.S-------------------VIG-M.VG.SL
Q22495_CAEEL/37-297..VNMLSKASKLYLD.PT........WPLLI.---V--G-F-LT.FII.G-------------------FSG-C.VG.SL
Q4RGV0_TETNG/6-216PMDSLPGV..................DLMIA.---I--G-V-II.MVL.G-------------------FLG-C.CG.AI
A2D8F2_TRIVA/5-200...........YKYK.IPQISGDKTLAAILI.---V--A-D-VI.FIFAF-------------------VFD-V.VA.SF
Q2F647_BOMMO/7-228...VKDLLKTHLAVG..P........WIFIV.---V--G-A-VM.FVI.A-------------------FLG-C.CG.AI
Q22RT6_TETTS/6-279........VNSDYKDFGESYNIYKASYTLLIL---V--G-V-FF.AIL.G-------------------LLG-I.CA.QR
A8XFB8_CAEBR/15-256.............LA.RRSQYAELVSPSLYVD---V--G-R-IL.VII.S-------------------ILS-I.AN.YL
Q3UWG5_MOUSE/9-230LELGNKPAPNTFYLG..I........YILIA.---V--G-A-VM.MFV.G-------------------FLG-C.YG.AI
Q16GP3_AEDAE/9-261SDQLEHFTQPAVIEQ.LA........YFLIA.---I--G-A-IM.FFL.S-------------------FLG-Y.CG.AI
Q6P3H3_DANRE/8-245.IAVLQESSVILKVV..S........YILIG.---V--G-S-FS.MLL.G-------------------FLG-C.LG.AI
Q7SXT2_DANRE/16-243...FDLLVNSEHGTN.AP........YVLIG.---T--G-A-VI.IIF.G-------------------LFG-C.FA.TC
Q86FE6_SCHJA/8-220...GVRGAEQHNILA.YT........YIVIAV---I--G-A-LS.FVL.G-------------------ILG-C.CG.SY
Q4S5Y2_TETNG/9-225...TFQIKDASASGV..P........IVIIA.---V--G-V-VI.FFV.A-------------------FFG-C.CG.AW
Q8AV91_PETMA/9-216.IFDNPNAPTTYYIG..I........YVLIV.---V--G-A-LM.MVG.G-------------------FLG-C.CG.AI
Q292W4_DROPS/7-217....DDFAEALRTQQ.VP........ITMIV.---L--G-T-VI.LLI.S-------------------WFG-C.CG.AI
Q7JWP5_DROME/7-206........YKFEHFN.TA........AFVIIA---V--G-V-VV.VLT.A-------------------LFG-A.LG.AA
A2DRK6_TRIVA/7-225........IIKQVTI.SEVKSSKTFL.FSAA.---V--I-G-VI.ALT.C-------------------IIG-FFML.CC
A0EF92_PARTE/7-263........QIEFNLAKEDDETNKGQGILVAFW---I--F-S-SS.MILNG-------------------IIG-I.FG.GK
Q4D6X7_TRYCC/23-265........ERSTMEK.TLKNLCQSCHAIFIAY---I--S-V-FSGLLLFS-------------------LLG-F.FA.LC
Q9NB07_APIME/7-222...GVSKQIETGLAF.PS........ITLIV.---L--G-S-II.FVI.S-------------------FFG-C.CG.AI
CD82_HUMAN/8-256.ISVLQTSSSSLRMG..A........YVFIG.---V--G-A-VT.MLM.G-------------------FLG-C.IG.AV
Q86FC1_SCHJA/3-271NAESQKDDIDKIIRN.IFTFVSPFGITIAIIG---I--G-C-VI.I...A-------------------LFG-F.CG.VC
RDS1_XENLA/10-290........VQLWIHNEVMENTSAHAVPNTVIT---A--G-L-VG.ILL.G-------------------IYA-GKVS.QA
Q16HS3_AEDAE/6-221....IHLTGRDTVLA.SA........TKLTVV---L--G-W-AI.AAT.G-------------------FYG-I.HG.VI

PF04103

Q7QF09_ANOGA/191-317--------IARNAS..........LAMAGTGL---W--C-G-AI-AGIAG-------------------SLG.L-MN-VK
T176B_HUMAN/66-229--------SLGPWT.........VLSASGCAF---W--A-G-SV-VIAAG-------------------AGA.I-VH-EK
M4A14_HUMAN/44-221--------ALNYIGFSQ...RLPLVVLTGYPF---W--G-A-LI-FILTG-------------------YLT.V-TD-KK
M4A10_HUMAN/59-193--------ASIVKNL......HLVVLKSWYPF---W--G-A-AS-FLISG-------------------ILA.I-TM-KT
Q3UAR5_MOUSE/47-204--------VSASYFNP....EVSTTLISGYLF---I--G-S-LC-FAIAG-------------------ILS.I-IS-EK
Q4RID0_TETNG/40-178--------MAFTSS.........ARVRQSCPF---W--A-G-FF-VVASG-------------------VVG.I-IS-WR
MS4A5_HUMAN/49-189--------LFTLLKPYP...RFPFIFLSGYPF---W--G-S-VL-FINSG-------------------AFL.I-AV-KR
Q3LRP2_CALJA/51-216--------MIPAGVY......APICVTVWYPL---W--G-G-IM-YIISG-------------------SLL.A-AT-EK
A7S4D6_NEMVE/20-179--------FALSES.........DRIRNACPY---W--A-G-FT-VFFSG-------------------GVG.I-VA-WR
Q16GM4_AEDAE/220-341--------LARNAS..........LAMAGTGL---W--C-G-AI-SGIAG-------------------SLG.L-MN-VK
MS4A3_MOUSE/27-172--------VCLQHVSHHFRHFFFFTFYTGYPL---W--G-A-VF-FISSG-------------------SLT.V-AA-GR
CD20_MOUSE/44-210--------MIPTGVF......APICLSVWYPL---W--G-G-IM-YIISG-------------------SLLAA-AA-EK
Q3TPB3_MOUSE/27-182--------ASISPS..........LLVRDTPF---W--A-G-II-VCVVA-------------------YLG.L-FM-LC
A5WUV1_DANRE/56-184--------TSYGYY.........LFLFTGASY---W--G-S-LI-YIIAG-------------------SLS.I-AA-EN
A5WUU6_DANRE/48-180--------TVFTHS.........TFAFSGVPY---V--G-S-LI-YITAG-------------------SLS.I-AA-EN
Q0V9M1_XENTR/36-200--------LALTTS.........ARVRHSCPF---W--A-G-FS-VLLSG-------------------LIG.V-VA-WK
FCERB_HUMAN/60-204--------CSVLDISHIE.GDIFSSFKAGYPF---W--G-A-IF-FSISG-------------------MLS.I-IS-ER
M4A13_MOUSE/15-152--------LYMGQIKGVFGTYEPVTYKMGTSL---W--.-G-FA-FVISG-------------------AFT.V-KA-AK
A2BIL3_DANRE/61-221--------LSLSNS.........PPIRNSCPF---W--A-G-SS-VILSG-------------------IIG.L-TT-WK
Q810P8_MOUSE/49-189--------LFTLVNPYP...RFPFIFISGYPF---W--G-S-VL-FINSG-------------------AFL.I-AL-KR
T176A_RAT/63-223--------YICHYL.........AMNTQGAPF---W--T-G-IV-AMLAG-------------------AVA.F-LQ-KK
Q4RKB8_TETNG/40-175--------HFTEVT.........EVVSLLVPW---W--S-G-LT-FLTAG-------------------IAG.I-VL-DK
Q4SW16_TETNG/67-213--------LRAAFS.........PLLVLHAAL---G--L-A-VA-FVVSG-------------------SLT.L-AA-LR
M4A6C_MOUSE/47-207--------ASVPPVPYFN.SVFSVLLKSGYPF---I--G-A-LF-FIASG-------------------ILS.I-IT-ER
Q5U4S5_XENLA/37-192--------AASCPS..........LLPRDTPY---W--A-G-IC-VSAVA-------------------VLG.L-IL-LC
T176B_MOUSE/60-224--------YFGPWT.........ELCAFGCAF---W--S-G-SV-AILAG-------------------VGT.I-VH-EK
M4A6B_MOUSE/47-204--------ASVPSNLHFT.SVFSVLLKSGYPF---I--G-A-LF-FIVSG-------------------ILS.I-VT-ET
A2RRW5_DANRE/53-183--------T..............AFAFSGIPY---G--A-S-LI-YITAG-------------------SLS.I-AA-ET
Q5R1M8_FELCA/51-217--------MIHMEVY......APICMTVWYPL---W--G-G-IM-YIISG-------------------SLL.V-AA-EK
Q4RKB7_TETNG/24-169--------INTEGP.........VPKLFVLPL---L--L-G-IL-IVAGG-------------------SLT.I-AN-ER
M4A8A_MOUSE/87-225--------ITNLFSHY.....TPVSLYGGFPF---W--G-G-IW-FIISG-------------------SLS.V-AA-ET
Q95PZ5_CAEEL/94-253--------YRDTSD..........YCPYYSAI---W--T-S-AI-YIINA-------------------IVG.S-AA-AK
Q1LVQ8_DANRE/42-197--------LAISSS..........LLARETPH---W--A-G-II-MCVVS-------------------LLG.F-VL-FC
Q17QX1_BOVIN/51-216--------LIHMDVY......MPICVTLWYPL---W--G-G-IM-FIISG-------------------SLL.A-AA-EK
A5WUV2_DANRE/56-191--------TIYGNY.........IFFFTGVSY---V--A-S-LI-YITTG-------------------LLS.I-AA-EN
Q29RT3_BOVIN/44-181--------ALNYFNFAQ...RFPLVFLTGYPF---W--G-A-FI-FTVTG-------------------YLTGA-HS-ND
Q58DM5_BOVIN/48-208--------VSVPNSSQLS.PAISSILMTGYPF---F--G-A-LC-FAITG-------------------TVS.I-IS-GK
A3KNL7_DANRE/59-198--------TIDAAS.........IFVFSGAPY---W--G-S-VL-YITAG-------------------SLA.I-DA-EN
Q8MJ38_PIG/60-203--------CSMLNISEFK.EDFFSSFKAGYPF---W--G-A-AL-FAISG-------------------FLS.V-MS-EE
M4A15_MOUSE/76-198--------LMVRRGHL.....GMLFIEGGVPF---W--G-G-AC-FIISG-------------------SLS.V-AA-ER
A5PMI8_DANRE/61-210--------TIDFDYRYH...DPHLSVASGITY---W--G-S-LV-YISAG-------------------SLS.V-AA-QN
A6H741_BOVIN/62-223--------YLGPWI.........QLRASGCAL---W--A-G-FV-AIAAG-------------------VGA.I-VH-EK
Q4JF27_HUMAN/46-188--------MCMASNTYG...SNPISAYIGYTI---W--G-S-VM-FIISG-------------------SLP.I-AA-GI
Q5BLB6_DANRE/53-183--------T..............LFAAGGVSY---V--A-S-LI-YITAG-------------------SLS.I-AA-EN
Q5M796_XENTR/47-192--------CIAMASR......YHVISGSGVPF---W--T-G-VM-YMISG-------------------ALS.V-AA-SS
M4A6D_MOUSE/47-207--------ASVPSNLHFT.SVFSILLESGYPF---V--G-A-LF-FAISG-------------------ILS.I-VT-EK
Q4SZQ8_TETNG/34-173--------LGQGLS.........SWGIDVAFF---I--S-S-LL-VIIAG-------------------SVA.I-AA-QN
Q4TAI3_TETNG/57-208--------CAGGRYP.......WPIRESYFPF---W--I-G-GM-YILIG-------------------AMC.V-WS-ER
Q567H8_DANRE/59-196--------TVYVDS.........SFVFSGVSY---W--G-S-LI-YIIAG-------------------SLS.I-AA-DS
MS4A3_HUMAN/50-196--------GSLQYPYHFQKHFFFFTFYTGYPI---W--G-A-VF-FCSSG-------------------TLS.V-VA-GI
A7E2J6_DANRE/50-185--------IGYEMF.........FFINTGVSY---W--A-S-LI-YITAG-------------------SLS.I-AA-ET
FCERB_MOUSE/52-195--------CSVLYVSDFD.EEVLLLYKLGYPF---W--G-A-VL-FVLSG-------------------FLS.I-IS-ER
Q4S7F2_TETNG/34-189--------LAISPS..........LLARETPH---W--A-G-II-LCLVS-------------------VLG.F-IL-YC
Q08BU9_DANRE/43-180--------TVHTDI........MTSADVFSPF---W--L-G-IL-FCVCG-------------------VLY.I-LS-ER
Q5BLA7_DANRE/16-153--------AVFRKS........TTLSETRAPL---W--A-G-LI-MAAPG-------------------VLA.L-FA-SQ
MS4A7_HUMAN/47-207--------VFAPYPSHFN.PAISTTLMSGYPF---L--G-A-LC-FGITG-------------------SLS.I-IS-GK
T176A_HUMAN/56-214--------YIRDYT.........LLVTSGAAI---W--T-G-AV-AVLAG-------------------AAA.F-IY-EK
Q0P3U8_DANRE/59-198--------TVYAES.........VFVFSGIPY---W--G-S-LI-YIAAG-------------------SLS.I-AA-EN
Q80WF0_RAT/44-182--------TLNFMFSSK...KVPLVILSGYPF---W--G-A-VI-FFLTG-------------------FVT..-KS-HD
M4A10_MOUSE/56-190--------ISTVKNL......HLVVLKCWYPL---W--G-T-VS-FLVAG-------------------MAA.M-TT-VT
CD20_CANFA/51-216--------MIHTDVC......APICITMWYPL---W--G-G-IM-FIISG-------------------SLL.A-AA-DK
M4A12_HUMAN/90-225--------CLISFSFREVLGFASTAVIGGYPF---W--G-G-LS-FIISG-------------------SLS.V-SA-SK
Q9EQY9_MOUSE/43-171--------LANLSSE......PLIYAVLMAPS---W--G-P-IM-LIGSG-------------------SLA.I-AA-GV
A7SQ32_NEMVE/7-164--------FKVAPY.........FYGVFGMGI---W--L-G-AW-MLITG-------------------VAGLL-TA-SV
M4A8B_HUMAN/71-207--------ATVLVGEY.....LSISFYGGFPF---W--G-G-LW-FIISG-------------------SLS.V-AA-EN
M4A4D_MOUSE/43-170--------ILNRVSE......RFMSVLLLAPF---W--G-S-IM-FIFSG-------------------SLS.I-AA-GV
A3KNQ4_DANRE/48-184--------TTPKDM..........MTDQFSPF---W--L-G-VL-FCVCG-------------------LVY.I-LS-ER
Q9GYM6_CAEEL/45-206--------ASTRIN.........TIRLHGLEE---I--C-S-FY-FVLVG-------------------LVG.I-CG-SA
A5PM84_DANRE/63-199--------TFNVRYQ......PAIVVFSGITY---W--G-S-FI-YISAG-------------------SLS.V-VA-QN
Q3T128_BOVIN/66-204--------GTVLMGNY.....TAVSFYGGFPF---W--G-G-IW-FIISG-------------------SLS.V-LA-EK
A0JMW7_XENLA/42-205--------LSLSKS.........PQIRSSCPF---W--A-G-SS-VILSG-------------------IVG.L-TT-WK
Q9ES61_MOUSE/43-171--------LTTLFSE......LPTSVMLMVPI---W--G-S-IM-FIVSG-------------------SLS.I-AA-GV
Q28GK5_XENTR/3-141--------GAFRRE........STLGRTRAPL---W--A-G-LI-MTIPG-------------------VLA.L-FS-SQ
F189B_MOUSE/36-196--------SSVTTT.........ESIKRSCPS---W--A-G-FS-LAFSG-------------------LVG.I-VS-WK
T176B_RAT/60-224--------YFGPWT.........ELCASGCAF---W--S-G-SV-AILAG-------------------VGI.V-IH-EM
Q2KII2_BOVIN/49-189--------LFTLEDPYP...RFPFIFISGYPF---W--S-S-IL-FVNSG-------------------AFL.V-AL-ER
Q1LX35_DANRE/59-175--------SCLTFS.........CSASMTAPI---W--C-G-LF-FIATG-------------------SLA.M-DV-QR
M4A18_BOVIN/154-273--------SLYRQY........SYSAISGYLV---W--G-G-IF-FIISG-------------------SLS.V-EA-EK
Q567A9_DANRE/32-162--------F..............AYAAGGVSY---G--A-S-VI-YIIAG-------------------SLS.I-AA-EI
T176A_BOVIN/63-220--------YIFSST.........TLRNSGAPI---W--T-G-AV-AVLAG-------------------AVA.F-IY-EK

PF13273

D7UXS6_LISGR/3-100----------------....IL...FMGIMLA...L..L.G.I......G.T............S....INTDALTSDDV
C2RQC7_BACCE/10-90----------------....II...ISIILIV...VAFN.I.ME...GVD.Y............E....L..........
C3AKH5_BACMY/2-83----------------....VI...GSFIILM...I..A.I.T......A.MDGY......IDYK....L..........
Q2B2X7_9BACI/2-86----------------....IL...LSFIGFV...I..A.F.V......A.AAS.......DDQQAAGII..........
C9B7Y0_ENTFC/3-104----------------....IL...CSLLALM...G..G.M.F......L.S............S....IDSTTLNTTEL
C7DIS7_9EURY/29-132----------------....ML...FGFVAVL...G..A.S.L......I.S............S....LPTNAAVSGAP
D7DCC0_STAHD/4-91----------------....LL...FGIVVLV...A..S.S.I......L.A............T....IFIGF......
A0B9F9_METTP/2-84----------------....IL...TGIIVMF...I..G.G.I......G.GAVGA....EGAET....V..........
Q12UE5_METBU/2-98----------------....VI...IAAVIFY...V..A.I.INIWPGGG.TMMY......GTSE....VFGISD.....
B9DJA4_STACT/148-230----------------....II...AGIFGLL...L..G.G.I......S.SSLGE....ADGGS....I..........
C4WAZ9_STAWA/11-93----------------....ML...GGLFAIM...V..G.S.I......G.NEFEA....SDSGQ....V..........
Q4L9M4_STAHJ/13-95----------------....II...GGLIALI...L..T.N.Y......D.KSY........GSELVGLM..........
A5UKZ4_METS3/8-83----------------....LV...SSSFILL...I..G.S.F......G.F...........GA....T..........
A5N2M2_CLOK5/4-86----------------....II...AGIYSMN...I..G.G.L......A.SVFHV....DRAVT....V..........
Q97LL2_CLOAB/4-86----------------....II...SGIGAVG...L..G.G.L......G.SAVGA....SGSTT....V..........
A9VVN7_BACWK/2-84----------------....IL...CALIALF...I..G.G.L......S.SALDS....DGANT....I..........
B3ZH23_BACCE/2-84----------------....II...CAFIALM...I..G.G.M......G.AAFEA....EGADS....I..........
C3BEA6_BACMY/2-84----------------....IL...CAFLVIF...F..G.G.L......G.SAFEA....DGANQ....L..........
Q4V1S6_BACCZ/2-84----------------....IL...CAVLVLF...F..G.G.F......G.TAIDV....DGADQ....I..........
D4FV71_BACNA/2-84----------------....FI...GAFLALI...V..G.G.L......D.ASFNS....SGTSD....I..........
C2VWU6_BACCE/24-113----------------....IL...FSSFAIF...I..G.F.IS...DLG.PIMDSTTGEIPTNT....T..........
C2U6N9_BACCE/2-85----------------....LL...CSLVILF...L..G.R.L......A.Y............E....MGELE......
A5UL06_METS3/42-117----------------....LL...GGVFAIM...L..S.S.F......GGT............E....I..........
O26620_METTH/8-82----------------....LL...GGLFAIV...F..S.V.F......G.P............E....L..........
C8JWL3_LISMN/13-93----------------....VL...AATTLLG...F..T.I.PD...IDD.P............D....F..........
D7V0U0_LISGR/3-121----------------....AI..LQGLFSLV...S..S.W.V......G.NITQ......SNAE....SSDFAARYESA
C8JTX3_LISMN/3-121----------------....LL...AQAFIAI...I..G.L.LMISGSKG.KEG........LTT....FYNNYYKTMTE
D3KN98_LISMN/3-121----------------....VL...AQAFIAV...I..G.I.LM...MSG.SKGK.....EGLTT....FYNNYYKTMTE
Q92D69_LISIN/3-121----------------....VL...MQAAIAV...I..G.L.LLVNGSKG.KE.........GLT....TYYNNYYQTVT
D3ULL7_LISSS/3-121----------------....VL...MQAAIAT...I..G.L.LMVNGAKG.K...........EG....LATYYNNYYQT
A8FJ46_BACP2/3-107----------------....VI..GVGFGALI...L....S.L......G.P............S....FYDQINEVLQE
B4AK11_BACPU/3-107----------------....AI..GVGFGALIL.SV..GPS.F......Y.N............E....INEVLQEEGET
C2H7S4_ENTFC/2-107----------------....LI..FFGGLAVT...L..S.N.M......S.A...........SE....FKKSYQSLAVD
C9ATK3_ENTFC/2-107----------------....LI..FFGGLAVT...L..S.N.M......S.A...........SE....FKKSYQSLAVD
E6TU87_BACCJ/2-115----------------....AFFTVAGFFFLW...L..Q.N.Q......D.EF.........MGE....LSAELQADDEL
B9CUN6_STACP/3-110----------------....LL..YLGFIALM...V..S.M.M......G.NKD.......FKHE....MIHNTQDSNQG
C5QNE2_STAEP/3-110----------------....LL..YLGFIVLM...V..S.M.M......G.NKD.......FKDE....MINSSQSSNPN
C2LZ67_STAHO/18-125----------------....AL...VAIMFLM...I..K.P.F.....IG.N...........AD....FKEQIINETQK
Q4L9F8_STAHJ/19-126----------------....AL...AAIMFLV...L..K.PLM......G.NSN.......FKDQ....MISESQKQGNS
C4WCX0_STAWA/2-110----------------....LF...I.LLGLG...I..G.T.MFG..GTS..............E....VQKEIKRQAKE
Q4A0V3_STAS1/2-109----------------....IL..GVVLMAVL...I..P.M.M......G.NGE.......VKEA....FISQMMQEDSS
C5QZN6_STAEP/3-109----------------....LL...YVFLIGI...F..F.I.M......T.QT..........SD....FKNGMIQGFIE
D3QGJ5_STALH/3-111----------------....AV...YFFILLL...M..S.L.I.....FT.N...........DD....FKKFMIMKEIQ
D3QGJ6_STALH/3-111----------------....TL...YVIFLVL...I..Q.M.M......V.SD..........SD....FKEQLANELQK
Q4A0E9_STAS1/2-112----------------....FI...LIFLMAI...V..A.P.F......F.N............D....VSVKNELIEVI
C5NV51_9BACL/5-120----------------....IV...ITGFLAY...G..S.F.F......K.I............S....LLKDNQEFLNL
C5NWK3_9BACL/5-118----------------....II...VTGLMSLGAFS..G.Q.L......E.T............A....LRQPELEQMLH
Q49WN0_STAS1/2-102----------------....IL...FLLLMVL..VF..S.F.M......N.VPEFK....EAFHQ....MNQQQGLEM..
Q8ERL5_OCEIH/2-100----------------AGFAIF...LGIFALI...I..N.V.NL...REG.T............S....VIPHEDLPM..
A7A3G5_BIFAD/15-115----------------....VI...MASITLF..MF..T.S.WFK..GQA...................YDLLEHNGLLK

PF00335

TSN15_MOUSE/19-259.......RDN----L..........CLLQSFMY.ILGICLVMELIG---GI------VALIF--RNQTIDFLNDNI....
Q29BB1_DROPS/7-204.......KHH----Q...............YMI.ILFMLFLIQFSI---AS------SCLAV--NSEQQQQF........
TSPC_DICDI/14-226.......KEK----L..........VGLVLYTM.LMLILLVVLIGI---GG------KALTL--DKEDAVSIIGT.....
TSN33_MOUSE/21-264.......REN----I..........CLLQTFSL.CLTIVFLLQLAA---GI------LGFVF--SDKARGKVSEI.....
Q9VMJ6_DROME/18-261.......REN----T..........CLLGAYAI.FLSVLLIAEIGF---CA------VAFVL--KDKGWIKDQATE....
Q7QJ21_ANOGA/9-222.......RKQ----R..........CYLGLFCA.FLVLFIVILFLV---SG------WSVAT--KAHLIVPAEVAI....
Q7Q8G1_ANOGA/14-231.......KES----TAMINIVSRLQRWRNTLAAAITAFVLRGQVSM---MV------RQKIF--DSMGD...........
Q84WF6_ARATH/4-245.......CDV----A..........WVLWVYLF.FMVFIIVALMGL---TL------FGFIV--TSHSGGVVVDGRVY..
TSPE_DICDI/16-219.......KKK----L..........GLHLTFMV.FLVVLIVCLVGV---SA------KMIVD--SGNPEKLQHKIEN...
Q16LT3_AEDAE/14-239.......KES----T..........AMINIYGV.LLAIVFILEVAA---AI------SAFAL--QGQVKEMVRRTL....
Q5C164_SCHJA/7-207.......TKN----V..........CLLTTYCI.LLSILIIAQIAA---GI------YAIIE--KPKVKRHVTTAL....
Q8SU08_ENCCU/10-189.......SRR----R..........LRMLVYIS.TTLILMNVQAIM---AV------KSTVI--HERSRAWA........
Q9W4X6_DROME/42-295.......REN----T..........FLLKFYSM.CLLLFFLLEMAI---AI------VCFVC--PQYMNTFLEKQF....
Q9NB13_DROME/7-221.......RQS----V..........CMTGAYTS.MVFVLFILQLVL---TC------WVFVN--RSAFLGDMSN......
Q6DCP2_XENLA/9-233.......KEN----Y..........CMVTTFAV.VLVLIFLVEIAA---AI------AAYVY--KDKLRTAFEESF....
Q6GLY9_XENLA/10-290CSDANKFVRW----K..........LFMLPYII.CTFFFTFCVFAG---AI------MCYTM--RNELESALYRGLK...
Q8SY17_DROME/7-219.......RES----V..........CMTMSYAT.FLLILLILQLTF---VV------LLFTH--REEFENAMGNV.....
Q1EC46_DROME/7-202.......KES----I..........CVTWAYATSMLVMLIVSIVML---FV------FRMHF--EEDSITKLK.......
TSPD_DICDI/11-224.......KEK----M..........VGLVFYTI.LMLVLLVVLIGI---GG------EALTY--HNADIGIEIE......
A2FKF6_TRIVA/7-185.......RCP----AFF......LGLFLLFYAL.FIIGMIVIYVVF---YS------KLFDE--LGNQWNK.........
A2DWZ1_TRIVA/7-204.......GSV----K..........CCRVSYAI.FYIIVIIAEIIF---VA------VAIKY--TKNVDKEAG.......
Q4DD38_TRYCC/86-309.......QRQ----M..........MFLLVYVG.YLVVLFIALFAL---II------AAAVY--DRDTRVSVMDPSK...
TSN16_HUMAN/10-243.......KES----R..........GTLLFCIL.SMVIVLIMEVTA---AT------VVLLF--FPIVGDVALEHTF...
Q5KAR0_CRYNJ/191-384.......LNN----R..........TFLAIFTL.LLWVDFGLLVAP---GY------ITYKQ--KTFNLEGKI.......
TSN32_HUMAN/9-229.......REA----Q..........GLMAGGFL.CFSLAFCAQVQV---VF------WRLHS--PTQVEDAMLDTY....
Q9V3X2_DROME/9-261.......RES----Q..........CLLVSFFC.VILIVMVAQIAA---GA------WAFHN--KDKLDDIVRAAV....
TSPB_DICDI/14-224.......KEK----L..........VGLVIYTM.LMLIILVALIGV---GG------KALTL--HNDDVVKQIG......
Q9VID1_DROME/8-228.......KES----S..........CMILSFAL.LAVVIFLFEIGL---GL------AGYVK--HTGLHQIMESQF....
Q64HX8_ONCMY/9-234.......KES----Y..........CMVTMFSI.LLGLIIITEIGA---AI------AGYVF--RGKLTVIVHDGL....
Q29IZ2_DROPS/18-232.......MEN----T..........LALFVFIG.TQLFGFVALVAG---SA------VTMQY--STINSSLQPLLN....
Q1HRC5_AEDAE/13-234.......KEY----K..........CMLLTYFI.LIFLIFVTMLIG---GI------LGYVF--REKVSQTMQQEM....
TS31A_XENLA/8-198.......SHH----Q..........VMLFIYMV.VLILVFIFQFIV---SC------SCLAM--NRSQQEYF........
Q17441_CAEEL/23-259.......VSN----R..........CALVFYLL.MLIFSMIMEGCL---IY------FTFSY--HATYEQELNASL....
Q5DG31_SCHJA/16-308FGYCIFNVSS----P..........ILLLTHII.CNFILILAFLSV---SV------CGFLL--LLQLDFDFANKFT...
Q2TCS3_BRABE/7-240.......SSN----K..........CMLTTFAV.INSLMLLVQLVV---GI------LLLVF--AGQINIWIKWIFE...
Q2TCS2_BRABE/9-231.......LEN----K..........CLLGTFFA.CLFVLLIAEVGV---AI------YAVVK--KPDAEKFLKEGL....
Q9ZUN5_ARATH/3-256.......KYK----E..........TLLAVYLC.CMAILIGLLLVV---LI------FAFVV--TRPDGSYRVPGRGY..
TSPA_DICDI/14-224.......KEK----L..........VGLVIYCA.VMLILLVILIGV---GG------KAITL--HNDDIINEVG......
IM23_SCHMA/10-212.......KEN----V..........CMLYMYAF.FLVVLLIAELAA---AI------VAVVY--KDRIDSEIDAL.....
Q29JV0_DROPS/10-238.......KEN----Y..........CLVLSFSI.MLAIIFILELSA---GI------SGYVL--RNDASSLIKTSL....
Q6GP84_XENLA/8-227.......TEH----R..........CLLLTFFV.ILLIIFLLEMVS---MT------LFLTY--TEQFHNYAQEDL....
Q5DB78_SCHJA/24-277.......REN----N..........CLLKFYYS.ILTLLFLTEVIC---CV------LFFVY--RESAIRKLEELI....
A0BI34_PARTE/7-267.......HRS----K..........CLLAIFNL.GNICLFLAFLSL---SI------VAYVI--GSFFDVSNCSNSSNEL
Q5GM22_TAESO/9-219.......YNN----T..........CMLKTFAA.IVGILLVAEIIC---AI------VLLVY--RHDFVRLVGKEMQ...
Q9XVI4_CAEEL/8-223.......REN----Y..........CLTVSFAV.LLALLITCEIAA---VI------IGYAL--HDSFRLGIGNQL....
A2G3J8_TRIVA/7-186.......RCP----SFI......LGFILLVYAA.AVIGAIVLYIMF---NS------KVWDT--MRENWKKY........
A2EZ33_TRIVA/7-201.......NKS----K..........CFRITYAI.LYLVVVIIEIVL---IA------CSVKD--YQTILEDA........
Q5DH84_SCHJA/4-271.......NRS----S..........TFFLLYEV.TLTVCTIVHIVW---IS------LLLKN--PESTTKSFQINF....
Q60D82_BRAOL/4-254.......YDN----Y..........IIITLYLF.FLFLSILLTLIF---SI------FIFLV--TNSSAGKAFSDKGI..
Q4RYD3_TETNG/10-300SLDPTKFVKW----K..........PMLKNFLV.FCVVFNSLLFVT---AL------LCFVM--RIPLQFTLAEGLR...
Q24C21_TETTS/14-285.......KQN----K..........CCIFIFQI.LSIILALFFLVA---GF------IFLGL--TDSHFTDIKDSTC...
A2DI21_TRIVA/15-204.......NNT----G..........LGWIVFHC.CMAVLLIIEVFL---VV------STSSY--SGFVKTV.........
Q6GNW4_XENLA/9-244.......NEI----R..........CLLGLYFT.FLLIILIAQVAA---GI------LIYLQ--RDTLKTEMSSIIH...
Q4SU90_TETNG/14-272.......RGR----P..........WMLKLYAV.FLALVFMTELIA---GI------SGFIF--RHEVTAKMNEHHPTLA
Q2TCR9_BRABE/6-237.......RES----S..........TLLKAYVA.LLALMFILEVIA---GI------LGWVY--RNELDRWIRDSF....
Q7T376_DANRE/6-213.......KEN----R..........CLLISFFI.LLFILMLAELAA---AC------LMLMY--ESKIENFIKDDL....
Q7JZW7_DROME/7-210..........----............FGSIKVMVVNLILLLALIAS---HI------WKVSH--YNETKQLDATEV....
Q4PLY6_IXOSC/9-219.......RES----Y..........HMIMAFSI.LLTVVLICELGA---AI------AAYVY--RSKIESALRTAA....
Q2TCS4_BRABE/9-233.......KEN----K..........IMLMIFAG.ILGVLFLIELIA---GI------LGVVY--RDQVTEWTRSSF....
A1Z8K7_DROME/8-233.......KES----P..........TLLITFAV.LLAVIFIVELAV---GI------AASVF--KKDLEGMVKNS.....
A1Z6U3_DROME/7-206.......MEN----V..........CMTATYGFLLLAQLIISLLGI---FR------FKFTE--EYIEKFAAEE......
Q5DH43_SCHJA/12-223.......RES----Q..........CLLFLFFA.FVFFCFTLLMAA---GL------WAVAW--SSKVNHYMYRYL....
TSN12_HUMAN/9-249.......KRN----L..........LLLAWYFG.SLLVIFCVELAC---GV------WTYEQ--ELMVPVQWSDMVT...
Q7Q1S3_ANOGA/9-239.......KEN----Y..........CMTLTFSV.LLILIFILELAA---GI------SGYVL--RNDTRELVSNAL....
Q5PQ10_XENLA/8-231.......KGS----R..........CKQGCFMY.FIVVVLCLEASA---GV------LTFVY--MDRMDLELNPM.....
O44582_CAEEL/29-290.......RDN----I..........FLLKCFAA.CVFLSYILVVAV---TL------VFFTL--FYTDTTEGLSAN....
Q06AT4_PIG/10-258.......KSN----R..........KILLVYFI.LMFIVYGFEVAS---CI------TAATQ--RDFFTPNLFLKQML..
Q6DDY1_XENLA/6-239.......KES----K..........CLLLTFFT.IILIIFIAEVAG---AV------VALVY--SSLAESILGPLL....
Q9UAI4_DROME/9-228.......QRK----R..........CLLGMFAA.LLVACICVQFII---CG------WSLAM--RENLPTSVEIFID...
Q503H8_DANRE/10-204.......RES----Q..........CLLGSFFA.CLLLIFGAEVAA---GV------FGFLN--KDQIIKEVQN......
Q5BL96_DANRE/12-254.......RNA----S..........LLLNMFVA.ILLVVLLLQVTA---AV------LGLLF--SEKVQERTEQLM....
Q292V6_DROPS/9-211.......SYK----Y..........SILFMFVS.GLVIVTMVAYFF---TF------AAMKG--DLLAHFDERV......
Q16TV5_AEDAE/8-254.......FQS----R..........CFLIIYFT.LVVLLFLSEFLL---GS------LAFVF--RGGIGRMMVHELKY..
Q7K527_DROME/7-213.......RES----P..........RMLWTYAS.LLLILLLLIVAF---II------LNPKD--VFKKYALQTV......
A8WRV5_CAEBR/9-230.......CES----V..........CAISIYFI.LVLILFVIEVVA---IV------LYFVK--KTELQQGLTTIW....
Q5ZII8_CHICK/15-247.......KER----R..........NLLRVYFI.LLLCIFLLEIIA---GI------LAYIY--YQQLSTELKENL....
TSN14_HUMAN/14-261.......REN----I..........CLLNFFCG.TIVLIFFLELAV---AV------LAFLF--QDWVRDRFREFF....
Q2TCR8_BRABE/9-244.......KEN----Y..........CMVTTFAG.RLSLIFILEIAA---GI------TGYVL--RNDIENVIDTAM....
Q2TCS8_BRABE/8-228.......KEN----R..........CMLGAFFT.LLLILLLVEIGV---AI------YAFVQ--RGQFFSLIGTAV....
Q86FE8_SCHJA/7-285.......NEN----R..........RLLQVSAG.FMTILIVLEVAG---AI------TMGSL--ASKWTEDYEHTNKA..
A1Z6U7_DROME/7-216.......ANL----L..........CVNLIFTM.FILIALAAEYLQ---LH------HYHSP--SLRSPGGAWQQ.....
Q6GQE5_XENLA/9-221.......QES----E..........CMLGLFFV.FLLVIFAIEIAA---GI------WGFTN--KDKVVDELKTFY....
Q9U2K6_CAEEL/7-216.......IRS----K..........YLLAPYFL.FMVILFLLEIAI---GI------TVLVK--RRSVRRTVKE......
Q8MS10_DROME/8-256.......VQS----R..........CLLVLYFM.LIVMLFMSEFLV---GS------IAFLF--RGGLGRTLANELRF..
Q29JV1_DROPS/14-246.......KES----V..........MVINLYGV.CLFLVFILEVSA---AI------AAFVM--QSQVRDMLMRTM....
Q6Z5Z9_ORYSJ/5-263.......CRA----T..........PLLWAYLL.LTGLLILAAACF---GV------FALVV--TNAGAGRAVSGRGF..
Q4RSA5_TETNG/8-245.......YEV----R..........CLLGLYFT.FLLLILIAQVTA---GV------LIYFQ--RDRLKHEMSDII....
Q6NYK2_DANRE/10-290ALDAGRFPRW----K..........TYMKPFFG.CSIFFTTLMLIS---II------LSYIM--KGSLETSLKIGLK...
Q6DDY2_XENLA/8-252.......RGS----R..........TMVLTYLV.LMMIVYIFECAS---CI------TSFTH--RDYMINSNVIKGQ...
Q0V996_XENTR/6-236.......KES----R..........CMLMLFFI.IILIIFIAEVAG---AV------VVLAF--SSVSRIFIEYLGN...
Q5DDB8_SCHJA/7-215.......KEL----K..........IITYVHIV.ALIIITIIELCI---AT------VSAVT--TDPFFGKVYNAL....
Q4T8J0_TETNG/8-244.......YEV----R..........CLLGLYFA.CLLLILLAQITA---GT------LIYFQ--KDALHEETFKVI....
CD63_MOUSE/9-231.......KEN----Y..........CLMITFAI.FLSLIMLVEVAV---AI------AGYVF--RDQVKSEFNKSF....
Q6P0W1_DANRE/7-218.......CSS----K..........GSLSVFAG.LLSVLILIEISA---GV------MVIMQ--SGKVSDELVEFY....
TSP1_CAEEL/7-221.......PKR----K..........GFMITYLV.LIIVLVSLEIGC---GV------AVLVR--RNSLHDNTNS......
Q1L9G8_DANRE/9-220.......KES----A..........CMLGLFFM.FLLVIFAAEVAA---GI------WGLSN--KDKIVSDIQQFY....
Q16J92_AEDAE/9-260.......KES----Q..........CMLFSFFS.CLLIVLVAEIAA---GA------WAYHN--SAKLDSYVRSAV....
Q29D35_DROPS/9-259.......RES----R..........CLLSTYAT.FLILLLVAGIVA---GG------LAAFY--KEKVRAESKNFL....
Q3ZLC3_OREMO/6-225.......RES----R..........CMLLLFFI.FLLIIFILLVAA---GI------AGAVS--QNKMEDWVNEQL....
Q75IM5_ORYSJ/6-249.......FHV----A..........WALWLYLL.AMMLLIAFLLGL---TA------FGFAV--TAGGGGTQVPGRPY..
Q16LT5_AEDAE/17-240.......RES----S..........LLINIYCG.LLSVVFLLEVTA---TL------VGVHH--RHEVNGFLAQSL....
A2G0G6_TRIVA/19-208.......NNN----T..........CIWLLFHA.FNSVMLIVEIIV---CL------MSSNL--QGFTKSF.........
Q5DGI2_SCHJA/10-219.......TKN----T..........CCLTIYAI.LLSVMVAAEIGV---GI------AAAVL--KEDVKTSFVSVV....
Q7JWV7_DROME/7-218.......REN----S..........CALTSYSV.VMLVLLVSQLAL---II------YVWVD--HVQIQQSLEKI.....
Q9FVY6_ORYSJ/5-257.......KKI----A..........CLLWTYLV.MLFVVLVAIMVF---TV------LAFII--TNTGTGHSVSGVRY..
A2AGS8_MOUSE/8-247.......REN----R..........CLLLFFFL.FILIIFLVELSA---AI------LAFIF--REHLTREFFTKE....
Q6INJ9_XENLA/8-187.......KHH----Q..........VLLFFYMI.ILFLVFVVQFSV---SC------ASLAI--NSDQQKQL........
CD53_MOUSE/8-210.......KEN----K..........CLLMSFFV.LLLIILLAEVTI---AI------LLFVY--EQKLNTLVAEGL....
A8X5P0_CAEBR/7-223.......CES----P..........VLLGLFIF.IIVILTAVELGA---TI------FAMTN--RNEFVSSIQQ......
Q86FA1_SCHJA/5-268.......CKN----L..........LCLRIYIG.LLLVLVVIEITA---MS------FYYTD--RESIFKLARDIA....
A1Z6U8_DROME/7-209.......RES----I..........RMTWIYAAILLALVFSQITVI---LA------QPINY--ELLANETIY.......
TSN6_BOVIN/16-237.......RAS----A..........WMLKLYAM.FLTLIFLVELVA---AI------IGFVF--RHEIKNSLKNNY....
Q6Z6K0_ORYSJ/3-259.......WNR----R..........RLLAFYLF.AMASLIALLIAL---LV------FAFAV--TRGSGAYPVLGRAYD.
Q4SM43_TETNG/8-236.......RES----C..........CGLTTFVV.ILLLVFMTEVAV---VV------LGYVY--RAKVEDEVNSSI....
Q0QBV5_HELTB/11-271.......MNS----K..........CLLVVYFI.VILIIFIAQLVG---CA------LVLAY--RSEVDAFVSNQL....
Q5DFJ8_SCHJA/7-215.......TKQ----K..........LVIYVHIF.ALIVVILMEIGT---AT------KVAAV--DNQFTSDSLST.....
Q6DHQ4_DANRE/8-230.......KEN----R..........PLLLSFFI.LLLLIFLLEILF---II------LFFSY--QDQIDLYAQNDL....
Q245V1_TETTS/9-275.......KRN----N..........CLLGIYIVCLCIVVACSAIVF---GV------SAGAY--QIVQDSKDDTNC....
Q5DHJ8_SCHJA/10-217.......KKL----N..........IIAIAHMS.CLGITLLINICI---AI------AAAAT--QDNYNASVQESL....
Q24FE3_TETTS/5-264.......KNN----T..........MIQAAYNV.GIIMLFLLSIAI---LA------ISCIV--QYEVPSYKNDEK....
Q4T2B0_TETNG/10-333CTDTNRFLRW----K..........LVMMPYII.CTLFFTCCVLVG---AL------MCYSM--RSQLEASLSLGLR...
Q2TCS0_BRABE/9-233.......KEN----R..........LFLLLFAI.LIGLLVILEFVA---GI------LAVVY--RNDLDKWVTDAV....
Q6Z8Q8_ORYSJ/5-259.......CRV----T..........WLLWVYLL.AMFALIVALLGF---TA------FAFAV--TNRGAGEAVSGRGY..
Q6W8Q0_BRABE/9-238.......WEN----K..........CLLGAFLA.IMGVLSLIEIII---GG------VALAN--KHKAENYLKEKI....
Q0V9E6_XENTR/12-237.......KEN----N..........MLIKTFIG.IMVVIFIIEIIV---GI------SAYSY--REKLQSDISRRF....
TSN8_BOVIN/7-235.......KEN----Q..........FMMILFFV.GLLMILLLQVAA---GI------VATTR--KSKTEQALNKTLL...
Q4D693_TRYCC/53-289.......RET----K..........ICSALFSL.LLVIAAFVVLGT---GV------TVVIA--YTQVVSSDDSL.....
Q5I0R1_XENTR/7-227.......RES----R..........CLLLLFFI.GLFLILALQITA---GV------LGAVY--KPKIEAQLNQTF....
Q24FE4_TETTS/5-254.......KQS----N..........NILGAYNV.GYFIFLSVSIST---LV------VSLLS--YQEVEEYKNDTD....
Q9M0B7_ARATH/4-258.......CRV----T..........WLLWSYLF.VMFFLILIVLCF---TI------FAFVV--TSKGSGETIQGKAY..
A0BP70_PARTE/7-282.......KRI----G..........TLLFCFNI.GNFILAIAFLGL---AI------LGFSL--GQSAHWIDIFSDEQCL
Q7K010_DROME/6-211.......REN----V..........CCTVTFII.FLCLVIIAQFAV---VY------LLITQ--EKTVASNLANA.....
Q67WQ6_ORYSJ/4-259.......CGA----S..........CLLWLYLL.ALFLLILALFVF---TV------FAFVV--TNRGAGWVVSGRGY..
TSN1_MACFA/6-239.......TES----K..........CALMTFFF.ILLLIFIAEVAA---AV------VALVY--TTMAEHFLTLLV....
Q19983_CAEEL/7-278.......KMN----Q..........CALAFFCC.ILILAFFLELAA---AV------TLFHK--QEHIKHYVESSM....
TSN2_MOUSE/10-214.......RES----Q..........CVLGSFFT.CLLVIFAAEVTT---GV------FAFIG--KDVAIRHVQSMY....
O44420_SCHJA/9-217.......KPK----Q..........FIVIMHIA.IVFIAVLGEICI---AS------ITISS--IDQFHSTVNSSL....
A8XY10_CAEBR/57-274.......GRS----R..........LFLVIYSM.VVFLLFVATLSC---GI------YLLYK--KDGLDVEISDAL....
ROM1_BOVIN/11-293SLDAEQYPPW----RGV......LGPLLVAGTA.GGGGLLVLALGL---AL------ALPGT--LDTGLEEGLGSA....
Q3UFS7_MOUSE/74-318.......CEN----S..........CLLHWYCG.AVLFCLALEALA---GV------LMVTL--WKPLQDSLKYTL....
Q2TCS6_BRABE/12-229.......KEN----S..........CLLGTFFI.CLLLLLCLEIGI---GI------YAAVQ--KDQFYEVVEKAM....
Q9SI56_ARATH/15-273.......FKS----D..........CLFRIHFF.IFFLWMFVVVSK---AI------FVIFL--HKETNPRLFPGTKIYE
Q9NB09_MANSE/12-245.......KES----T..........CLVNIFAV.ILSIVFALEIAA---SI------AAYAL--RGQVTTMLDTNL....
Q1HQ39_BOMMO/7-211.......RES----N..........CMLVTYAI.FMLVLMALKLTL---GV------MVFVN--LDGVVAAIP.......
Q16HS1_AEDAE/9-225.......KHS----Y..........CMTVTYVL.MLMTLIVVQIAL---AV------LLFAG--VDQNRHDYLEWFD...
TSN5_HUMAN/14-261.......REN----T..........FLLKFFSV.FLGIIFFLELTA---GV------LAFVF--KDWIKDQLYFFI....
TSN10_HUMAN/75-319.......CEN----T..........CLLRGFSG.GILAFLVLEAVA---GA------LVVAL--WGPLQDSLEHTL....
A2ECP6_TRIVA/7-193..........----...........IISGIFTI.LITIFCIILFSL---YL------SKKEE--IVESYHY.........
A2FGU0_TRIVA/7-203.......TNS----K..........CLRLTYSN.LLVLIFLLQIAS---VA------IFFVF--KQRTEVDI........
Q7EZC8_ORYSJ/6-199.......SRG----G..........CCLSFYSF.LIILFILVELAA---GG------FIFF.--................
Q2TCS7_BRABE/7-197.......KHH----Q..........VLLFFYMV.ILFLLFIIQFSI---SC------ACLAF--STTYKEQL........
Q6P2T9_DANRE/9-230.......KEN----Q..........CMVVTFAI.ILSLIVITEIGA---GI------AGYIF--RGKVNELLDQSF....
Q6P7J5_XENLA/7-233.......QES----C..........CGLGCFMF.LISIIFVAGVTA---II------LGLVF--VDKINPELEKNM....
Q7K2V7_DROME/7-219.......REN----A..........CCTTIYAI.CMLILFGLQLAL---SI------WIFAA--NDKFLSSMGKA.....
Q7PTA7_ANOGA/9-220.......RES----Y..........CMTSTYSF.FLILLVIAQIVI---AV------LVFVF--VGDVTTAIKKGF....
Q9C5W7_ARATH/6-190.......SRS----V..........CCLSCYSL.LLILLILVELGF---AA------FIFF.--................
Q5D928_SCHJA/7-215.......KPK----H..........SSFLLYII.ALTVTTVIEMSS---AI------ASTIT--TDQFEINARISL....
A2G7G6_TRIVA/7-186.......RCP----SLI......LGIILLIYSC.GVIGAIVVYILF---KK------NIIQE--IGKQWNA.........
Q9NB12_DROME/7-217.......HEA----P..........VRLLIYVG.AVVLLILAQLIF---LG------MSSHG--TKDGISGSINE.....
Q53GA9_HUMAN/7-234.......KKS----R..........CMLLLFFI.GLLLILLLQVAT---GI------LGAVF--KSKSDRIVNETLY...
Q16LT4_AEDAE/34-247.......IEN----M..........TIIMIYIV.LFSIVVVLEIIV---AI------SAYVM--THHVDDMLTIRM....
O96962_SUBDO/13-238.......ALS----R..........ILIGIYAV.IIVIFIIIELAS---GI------VGFVF--RDRVESTVSDNA....
A1Z6T8_DROME/7-220.......KDS----R..........VLLICYAV.LLVFLLIVQIVL---VS------ISYAA--SRDFLPDSLRQ.....
A2GDR3_TRIVA/7-201.......GNI----K..........CYRVTYAI.LFIVVVVIEIVI---IA------VAIGI--VKKINTTV........
CD37_RAT/10-270.......KEL----R..........CLLGLYFG.MLLLLFATQITL---GI------LISTQ--RVRLERRVQELV....
Q4SA96_TETNG/3-245.......ANL----P..........RLLRAYGF.FQFVTLIAALAA---GL------SGLFY--REDIAGGFRSGL....
A2EZ30_TRIVA/7-219.......D.S----K..........CFRMTYAI.LYFIIVIAEIVL---VY------FTVKA--FPKIIDDT........
Q176T5_AEDAE/20-244.......KES----P..........KLLNAFAV.FLLIVLLIEVAV---AI------AAVAF--KSDLQNALQSQ.....
LBM_DROME/7-199.......RES----V..........VLTATSAV.FLLILAILQIVS---TC------LFLHE--FDVKSGR.........
Q6QSX5_ORNMO/7-221.......IDS----P..........CMLLTYFI.AMLVLLLMECAV---AG------LVWKV--ADGDTLQRHLAT....
Q6YWS4_ORYSJ/4-277.......CRG----A..........ALLWAYAS.AMFLLIVGMFFV---TA------FVFVV--TNRGVATAVSGTGY..
Q5DHT1_SCHJA/5-217.......KGG----K..........CLLTMHII.ALIIATIIDIST---AT------LSAIK--QNEFLTKAGQVL....
A0CWV3_PARTE/4-273.......QKK----TSC......RGCLLLTYQI.GAILFFVLCTGL---AI------GTLIY--SSDLFGQ.........
Q9NB10_MANSE/9-232.......KEN----H..........CMIVTFSV.FLLIIFIAEMAV---GI------AGYMK--HSDLEASIVRHL....
A2DY51_TRIVA/7-217.......CEN----R..........CWAIFYVV.CLFLVLIVEIII---LI------CMFLL--TNVVMDFAET......
Q8LAM6_ARATH/4-263.......FKE----N..........LAMVSYLI.ILFGGIVALMIF---SI------FLFFV--TNKGAGRVVSGRGY..
Q9C7C1_ARATH/4-244.......FNV----A..........WALWVYLV.VMIFLIATLMGL---TL------FGLVV--TSQGGGVEVPGRIY..
Q8AV92_PETMA/9-221.......QES----Q..........CMPGSFFV.CLLVVFAAEIAA---GI------WGFLS--KEQIPQDMKKFY....
Q4RL59_TETNG/34-259.......RES----K..........VGLGFFFL.IIMLIFAAEVAA---LV------FGFIY--RGKISKDLDRSM....
Q16HX5_AEDAE/9-218.......RES----Y..........CMTSTYGF.FLMVLIIAQIVV---AA------LVFIY--VGDAKAAFKKGF....
Q9FJN3_ARATH/7-267.......RRK----F..........PMPALVVM.VVVLLLMLFIGL---AY------AGVNE--MQSRRFPATRMW....
Q7JYY8_DROME/7-209.......RVS----L..........GLVWSYVI.CLLILLCLQIYI---IA------AAHST--DYVERSKKDF......
TSN11_BOVIN/15-248.......RED----R..........GCLSAYFC.LLLAIFLVELVA---GV------LAHVY--YQRLSDELKQHL....
Q86D97_SCHMA/7-231.......HES----Q..........CLLGTYFT.ILIVIFATQVTG---AT------LGYLY--REEIMKYVDDRMR...
Q4S5B5_TETNG/8-230.......KEN----K..........CLLLSFFI.VLLIILLAELIL---LI------LFFVY--TDKVSENARRDL....
Q5XGS2_XENLA/8-220.......KEN----K..........CLLLTFFI.LLLLILLVEVTM---AI------FLFVY--EKQLDKYVRERL....
Q24C18_TETTS/14-278.......KKN----K..........CCIFFFQI.FSIALSFSFLIV---AF------VFLGM--TDSHVFDIKDTN....
TSN31_MOUSE/8-196.......NHH----Q..........VLLFFYMI.ILGLVFIFQFGI---SC------SCLAI--NRNTQADV........
Q568F4_DANRE/16-258.......RDN----K..........TLLHMFLC.VLCVLLALQAIA---LI------IALIF--EKTTIKLFQNSI....
Q22495_CAEEL/37-297.......REN----T..........SFLTFYST.LLGLLLIAEFSA---GV------FAYAC--RDQLDNYIRNLL....
Q4RGV0_TETNG/6-216.......RES----R..........CLLLLFFI.GLLLIFILLLAA---GI------VGAVG--ESKVQEWVKDRL....
A2D8F2_TRIVA/5-200.......SKN----K..........CMSVIQSI.IFLVLAAICIGI---IV------GTVLY--NKKAFDKFGAYW....
Q2F647_BOMMO/7-228.......RES----H..........CMVVTYAI.FLLVIIIVQVVI---SV------LLFTY--GESIKESIMDGV....
Q22RT6_TETTS/6-279.......KKR----N..........CTMTIYNI.GVIVLMIFIGCS---LI------VMIYT--KVKLSQFKDDTN....
A8XFB8_CAEBR/15-256ICFYAIFKEM----R..........CIVTSCAV.ASIVIAVMLIIG---GL------IGLNF--RDQLTHYTPLNLK...
Q3UWG5_MOUSE/9-230.......QES----Q..........CLLGTFFT.CLVILFACEVAA---GI------WGFVN--KDQIAKDVKQFY....
Q16GP3_AEDAE/9-261.......RES----Q..........CLLTTYGL.FLIVILILEVTA---CG------LAAAY--KESAKTETKNYLQ...
Q6P3H3_DANRE/8-245.......YEI----R..........CLLGLYFT.CLLLILLAQVAV---SI------LIYFQ--RDLLKTEADKIV....
Q7SXT2_DANRE/16-243.......RGS----P..........WMLKLYAM.FLVLVFLAELVA---GI------SGFIF--RHEIKAVLKGA.....
Q86FE6_SCHJA/8-220.......HYS----R..........CLLGIYFA.LLLVIFAVEIAI---GV------AGFVH--REQARAIIHETL....
Q4S5Y2_TETNG/9-225.......KEN----Y..........CMITTFAI.LLTLVIIVEIAA---AI------AGYIF--RNSLTDMIS.......
Q8AV91_PETMA/9-216.......QES----Q..........CMLGTFFT.LIVILFSDEIRA---AV------WAFMF--HDEVETQMIEYY....
Q292W4_DROPS/7-217.......RES----Y..........CMSMTYSI.LLFVLMIGQLAL---VI------YMWLQ--KDKYLVIMGDV.....
Q7JWP5_DROME/7-206.......RES----S..........ATSKVFVV.ILIVLVILEVLA---VG------FLWVF--QTSLLINVDKTF....
A2DRK6_TRIVA/7-225.......YKN----Q..........CFRTTYAV.LYFIIVVAECAL---LY------FIYKT--YPTLLHDL........
A0EF92_PARTE/7-263.......KKS----A..........CLLLIFNL.VNIALFLGFVGL---TV------AGYVR--AHQINGLDVSTYCSNN
Q4D6X7_TRYCC/23-265.......TRN----T..........LLRVLYFI.YLFVVFLGAFSS---SI------AYVLV--STDRVNLQT.......
Q9NB07_APIME/7-222.......RES----H..........CMTITFAS.FLLFILLVQIAV---AV------YAFIV--VKNDDNFRNISE....
CD82_HUMAN/8-256.......NEV----R..........CLLGLYFA.FLLLILIAQVTA---GA------LFYFN--MGKLKQEMGGIV....
Q86FC1_SCHJA/3-271.......RNN----K..........KLLGIYAF.FVGILTLAMLTT---PV------VLYYK--KDDFIAKTENLY....
RDS1_XENLA/10-290SMDVTKYQRW----K..........SFMMPFFF.LAILSCLVCLAA---LV------LSVAL--RGTLEESLKIGLK...
Q16HS3_AEDAE/6-221.......RRS----Y..........PLMVLYVF.LLGVLITFQLSM---AA------LLIYR--SNRTPYLEVQRF....

PF04103

Q7QF09_ANOGA/191-317-------MAK....T----------....GFLA-VNLICVASSTLG---LA------LTGIG--AVRD------------
T176B_HUMAN/66-229-------HPG....K----------LAGYISSL-LTLAGFATAMAA---VV------LCVNS--FIWQ------------
M4A14_HUMAN/44-221-------SK......----------LLGQGVTG-MNVISSLVAITG---IT------FTILS--YRHQ------------
M4A10_HUMAN/59-193-------FSK....T----------YLKMLCLM-TNLISLFCVLSG---LF------VISKD--LFLE------------
Q3UAR5_MOUSE/47-204-------IST....K----------PFALSSLA-SNVASSVVAVIG---LF------LFTYC--LIAL------------
Q4RID0_TETNG/40-178-------RPL....T----------LVVSLFML-LSAVCVILSLAG---SM------LSCQN--AQMV------------
MS4A5_HUMAN/49-189-------KTT....E----------TLIILSRI-MNFLSALGAIAG---II------LLTFG--FILD------------
Q3LRP2_CALJA/51-216-------NSR....K----------SLVKGKMI-MNSLSLFAAIAG---MI------LSIMD--ILNI------------
A7S4D6_NEMVE/20-179-------HST....I----------LSMGLFTF-FSAVCVVLHMIG---TI------LTGEV--GGLL------------
Q16GM4_AEDAE/220-341-------MAK.....----------...TGFLA-VNLICVASSTLG---LA------LTGIG--AVRD------------
MS4A3_MOUSE/27-172-------NPT....R----------MLMQNSFG-INIASTTIAFVG---TV------FLSVH--LAFN------------
CD20_MOUSE/44-210-------TSR....K----------SLVKAKVI-MSSLSLFAAISG---II------LSIMD--ILNM------------
Q3TPB3_MOUSE/27-182-------VSYQVDER----------..TCVQFS-MKVFYFLLSALG---LM------VCMLA--VAFA------------
A5WUV1_DANRE/56-184-------KINSPTGL----------CLVRASLG-MNIFSAIAAGIS---II------VLPIG--LAFG------------
A5WUU6_DANRE/48-180-------KIDSPAGL----------CLVRASLG-MNIFSAIATGIA---II------MLSLG--LTIG------------
Q0V9M1_XENTR/36-200-------RPL....S----------LVITFFML-LSAVCVMLNLAG---SI------LSCQN--AQLV------------
FCERB_HUMAN/60-204-------RNA....T----------YLVRGSLG-ANTASSIAGGTG---IT------ILIIN--LKKS------------
M4A13_MOUSE/15-152-------YQS....R----------HMILCTMS-LNILCIIITIVA---AS------LTIVE--LSHF------------
A2BIL3_DANRE/61-221-------RPM....L----------LLVNLFVL-LSVVCILLNLAG---FI------LCCQG--VQLV------------
Q810P8_MOUSE/49-189-------KTT....D----------TLIKMSRA-MNLLSALGAAAG---II------LLIFG--FLLD------------
T176A_RAT/63-223-------RGG....T----------CWALMRIL-LVLASFCTAVAA---IV------IGSRE--FNNY------------
Q4RKB8_TETNG/40-175-------LCN....M----------KILGVCLL-TSVASAVLSVVA---VV------VYSVD--LLRN------------
Q4SW16_TETNG/67-213-------RTS....V----------SSVWTAAL-SNGISALVGLVG---VA------YLGFL--MASY------------
M4A6C_MOUSE/47-207-------KST....K----------PLVDASLT-LNILSVSFAFVG---II------IISVS--LAGL------------
Q5U4S5_XENLA/37-192-------LPYQPDEK----------..TMCQFV-LKLLYFLLSALG---LI------ICVTA--VAFA------------
T176B_MOUSE/60-224-------RQG....K----------LSGQVSCL-LLLACIATAAAA---TV------LGVNS--LIRQ------------
M4A6B_MOUSE/47-204-------KST....K----------ILVDSSLT-LNILSVSFAFMG---II------IISVS--LAGL------------
A2RRW5_DANRE/53-183-------KINSPAGL----------CLVRASLG-MNIFSAIAAGIS---II------MLSVQ--LALG------------
Q5R1M8_FELCA/51-217-------NPR....K----------SLVKGKMI-MNSLSLFAAISG---MI------LLIMD--IFNI------------
Q4RKB7_TETNG/24-169-------NPS....R----------LLLQQCVT-SNVAGLVGTLLA---LC------LYGYS--LSAV------------
M4A8A_MOUSE/87-225-------QPN...SP----------CLLNGSVG-LNIFSAICSAVG---IM------LFITD--ISIS------------
Q95PZ5_CAEEL/94-253-------MGA....L----------NLYMAHLT-LSLVSVMMCLIS---GG------LSARN--WALV------------
Q1LVQ8_DANRE/42-197-------ITRVPDER----------..ALLQFV-IKLLYFFLCTMG---LV------MSVVV--IAFQ------------
Q17QX1_BOVIN/51-216-------NST....Q----------SMLTGRLI-MNSLSLFAAISG---II------FLIMD--IFNM------------
A5WUV2_DANRE/56-191-------KINSPSAL----------CLVRASLG-MNIFSAIAAVFS---II------MLSLG--LAVG------------
Q29RT3_BOVIN/44-181-------KCV.....----------..GQGVTG-LNVISSVVAVAG---II------LTIIS--YRYQ------------
Q58DM5_BOVIN/48-208-------KSN....K----------PFAINSLI-FSAVSSVAAGVG---LI------LLAGS--LVAL------------
A3KNL7_DANRE/59-198-------KRNSPTNL----------CLVKGSLG-MNIFSAIVAGTA---IV------IISMD--MLTG------------
Q8MJ38_PIG/60-203-------KQA....I----------YLLRGMLG-ANTISSIAAGVG---TV------ILIIN--LKKS------------
M4A15_MOUSE/76-198-------NHT....S----------CLLKSSLG-TNILSAMAAFAG---TA------ILLMD--FGVT------------
A5PMI8_DANRE/61-210-------KLH....A----------CVVKASLI-MNVLSAITAAAA---IT------LMSIE--LFAG------------
A6H741_BOVIN/62-223-------RRG....K----------LSGCVSGL-LTLAGIATAVAA---VV------FCVNS--FIWQ------------
Q4JF27_HUMAN/46-188-------RTT....K----------GLVRGSLG-MNITSSVLAASG---IL------INTFS--LAFY------------
Q5BLB6_DANRE/53-183-------KINSPSAL----------CLVRASLG-MNIFSAIAAGSS---II------MLSLG--LAFG------------
Q5M796_XENTR/47-192-------KPT....L----------GKMKSSMA-LNIVSCVCAAIA---VI------IYIVI--ILDI------------
M4A6D_MOUSE/47-207-------KMT....K----------PLVHSSLA-LSILSVLSALTG---IA------ILSVS--LAAL------------
Q4SZQ8_TETNG/34-173-------LH.....L----------PTLRACLG-MQIVACGATLFN---II------SSMAK--YEIM------------
Q4TAI3_TETNG/57-208-------RPS....P----------CLVILNVH-LNIVGLAFAVAA---IV------LYSQS--LADL------------
Q567H8_DANRE/59-196-------KINLPAGL----------CLVRASLG-MNIFSAIAAGIA---II------MLSVD--LALG------------
MS4A3_HUMAN/50-196-------KPT....R----------TWIQNSFG-MNIASATIALVG---TA------FLSLN--IAVN------------
A7E2J6_DANRE/50-185-------NIISPAGL----------CLVRASLG-MNIFSAIAAGIS---II------VISVN--LAFA------------
FCERB_MOUSE/52-195-------KNT....L----------YLVRGSLG-ANIVSSIAAGTG---IA------MLILN--LTNN------------
Q4S7F2_TETNG/34-189-------ITYLPDER----------..TSAQFI-CEVLYFILCSIG---LV------LSVLV--VAFA------------
Q08BU9_DANRE/43-180-------SPS....K----------KIITASFA-LSIISTIGVVSA---CM------DFIKS--MVII------------
Q5BLA7_DANRE/16-153-------KKN....P----------YLVNVMIV-SSVVSLFAVVIV---FV------YACVT--LSYG------------
MS4A7_HUMAN/47-207-------QST....K----------PFDLSSLT-SNAVSSVTAGAG---LF------LLADS--MVAL------------
T176A_HUMAN/56-214-------RGG....T----------YWALLRTL-LTLAAFSTAIAA---LK------LWNED--FRYG------------
Q0P3U8_DANRE/59-198-------KHDSPTSL----------CLVKGSLG-MNIFSAVTAAIA---FI------LLSVD--LGNG------------
Q80WF0_RAT/44-182-------KQR....Q----------ILKQDITV-MNIFSSLTALAG---IA------LILFS--FTQH------------
M4A10_MOUSE/56-190-------FPK....T----------SLKVLCVI-ANVISLFCALAG---FF------VIAKD--LFLE------------
CD20_CANFA/51-216-------NPR....K----------SLVKGKMI-MNSLSLFAAISG---II------FLIMD--IFNI------------
M4A12_HUMAN/90-225-------ELS....R----------CLVKGSLG-MNIVSSILAFIG---VI------LLLVD--MCIN------------
Q9EQY9_MOUSE/43-171-------KPT....K----------SLIISRLT-LNTITSALAATA---SI------MGVVS--VAVG------------
A7SQ32_NEMVE/7-164-------PTN....M----------CRLGSFIG-CSLVGLVTLFVC---AI------IIGLG--VLQH------------
M4A8B_HUMAN/71-207-------QPY...SY----------CLLSGSLG-LNIVSAICSAVG---VI------LFITD--LSIP------------
M4A4D_MOUSE/43-170-------KPT....K----------AMIISSLS-VNTISSVLAVAA---SI------IGVIS--VISG------------
A3KNQ4_DANRE/48-184-------NPS....K----------KMITASLA-LSIVSTFGVIFA---VL------DISQH--ISHN------------
Q9GYM6_CAEEL/45-206-------SYR....R----------GLVITYLV-MCIHSIFIFVPA---II------TVSSF--DIHF------------
A5PM84_DANRE/63-199-------HLH....L----------CVVKASLG-MNVFSTVTSGIA---II------LLGID--FGLL------------
Q3T128_BOVIN/66-204-------HSR...SS----------CLLNSSVG-FNIVSAIFSMVG---IT------LFIVE--LIIN------------
A0JMW7_XENLA/42-205-------RPM....V----------LLVNLFVM-LSVVCVLLNLAG---FI------LGCQG--AQFV------------
Q9ES61_MOUSE/43-171-------TPT....K----------CLIVASLT-LNTITSVLAATA---SI------MGVVS--VAVG------------
Q28GK5_XENTR/3-141-------KKN....P----------VLVNALIA-ASVFSCFTTLIV---IV------YASLT--LGYG------------
F189B_MOUSE/36-196-------RPF....T----------LVISFFSL-LSVLCVMLSMAG---SV------LSCKN--AQLA------------
T176B_RAT/60-224-------GQG....K----------LSGHISRL-LLLACSATAAAA---TV------MGVKS--LIWQ------------
Q2KII2_BOVIN/49-189-------KTT....E----------TLVTLSRI-MNSLSAVAAAAG---II------LLIIG--FLID------------
Q1LX35_DANRE/59-175-------KPK....R----------IKVITLLG-LNIFSLLFAICS---FT------TFFIK--SSQL------------
M4A18_BOVIN/154-273-------DRS....S----------CMVHGSVG-MNVVSAIVSLAG---VL------LLLVD--LIRN------------
Q567A9_DANRE/32-162-------KINSPDAL----------CLVRASLG-MNIFSAIAAGIS---II------VLSQA--MAFV------------
T176A_BOVIN/63-220-------RGG....I----------YWALLRTL-LALAAFSTATAA---TI------IGAGR--FYEY------------

PF13273

D7UXS6_LISGR/3-100......................IGLTVGGGIVF-YFFLLAVAACII...GF......IAAFK..MKN.------------
C2RQC7_BACCE/10-90................................L-AYYSIILTVQIG...LF......ILSCL..VNK.------------
C3AKH5_BACMY/2-83................................L-TYYSILLIIQIG...LL......VLACS..VNK.------------
Q2B2X7_9BACI/2-86................................F-IVTLLFFMIQAG...AL......IVGCL..VNR.------------
C9B7Y0_ENTFC/3-104TS.................KDIDMLVNLSGNVV-LFGGITLVFSIM...IF......IIGFL..VRK.------------
C7DIS7_9EURY/29-132IIN...............ATEQAQLQASSGAIA-AEGALGIVCGIV...II......IASIM..VHR.------------
D7DCC0_STAHD/4-91...........................GGPLIL-IIGVWWFIAAIL...II......IGSLW..INSG------------
A0B9F9_METTP/2-84................................T-VLGFGAILFGII...GI......VGGAL..VTH.------------
Q12UE5_METBU/2-98...........................PFVVMM-GFGTVTLILGLI...GI......AGGIV..AKT.------------
B9DJA4_STACT/148-230................................F-GQAIGVIFVCIV...TI......VISCI..INK.------------
C4WAZ9_STAWA/11-93................................F-GLGVAVILTCII...TL......ILSCI..INK.------------
Q4L9M4_STAHJ/13-95................................T-IVATSSIILSAI...TL......TLSCL..INK.------------
A5UKZ4_METS3/8-83................................S-FLGLIATLGSFL...GI......FASIH..VFK.------------
A5N2M2_CLOK5/4-86................................N-NFGIGAIILSIL...GI......IGALI..VKN.------------
Q97LL2_CLOAB/4-86................................G-GLGIVAILFSVL...GI......VGAVF..VRT.------------
A9VVN7_BACWK/2-84................................I-ALGWGAVILSIL...GI......CGAIL..VKT.------------
B3ZH23_BACCE/2-84................................I-GLGWGAVALSIL...GI......VGCVV..VKK.------------
C3BEA6_BACMY/2-84................................M-TQGWIAVLLSIL...GI......VGSVI..VKG.------------
Q4V1S6_BACCZ/2-84................................I-ILGWGAVFSSIL...GI......IGSVV..VKS.------------
D4FV71_BACNA/2-84................................I-GLGWGAIFLSIL...GI......VASVI..IRK.------------
C2VWU6_BACCE/24-113................................M-ILGSISLIASIL...GI......IGSIL..IKT.------------
C2U6N9_BACCE/2-85...........................GAEKGL-TVGCMGAFFSIL...GF......FGFIK..AKG.------------
A5UL06_METS3/42-117................................F-ALGISALLASIV...GI......VGSVY..VKN.------------
O26620_METTH/8-82................................L-YLGMSAILASIL...GI......IGSVY..VRN.------------
C8JWL3_LISMN/13-93................................S-YWLLSILLTSIFSISGV......VGSLF..VRK.------------
D7V0U0_LISGR/3-121LRDANVSPS....DAPDVHTVITGLHTFGTWSL-IILIVTVIISVL...GI.......YFII..GNK.------------
C8JTX3_LISMN/3-121WEIPKK..........EVPDPDRVLDFVQTLSW-TALTGGLITLAL...GIF....GIYYIF..KNK.------------
D3KN98_LISMN/3-121WEIP..............KKEIPDPDRVLDFVQ-TLSWTALTGGLI...TLVLGGFGIYYIL..KNK.------------
Q92D69_LISIN/3-121EWEI.............PKDEIPDPDRIFDFVH-TLSWTALSGGII...TLIVGAAGIYYIM..KNK.------------
D3ULL7_LISSS/3-121LTEMEIP.......KNDIPDPDRVFDFVHMLSW-TALSGGIITLIL...GV......VGIFYIINNK.------------
A8FJ46_BACP2/3-107EGET..............LPIETLEASVNSFGT-QYMVVSIIAAVL...SI......VGVIL..LKTD------------
B4AK11_BACPU/3-107LP..................IETLQASVNAFGT-QFMVVSGIAAVL...SI......VGVIL..LKTD------------
C2H7S4_ENTFC/2-107HPA................LSLENTFELLQDMT-GLFAVVLFISLA...FL......AVALF..LTA.------------
C9ATK3_ENTFC/2-107HPTL..............SLENTFELLQDMTGL-FAVVLFISLSFL...AV......ALFLT..AKG.------------
E6TU87_BACCJ/2-115SAAEV...........DAVLGFLDGGFLSSSGI-FLIILSVVAIVL...GI......VAMVL..LKGN------------
B9CUN6_STACP/3-110VSS...............DQLNQSYGMLSSMGT-WYIIGFIVLLIL...AI......IATLL..ISK.------------
C5QNE2_STAEP/3-110VSS...............DQLNQYYGMLSSMGT-GFIIFLIALLIL...AI......IGTIL..ISK.------------
C2LZ67_STAHO/18-125QGNEV...........SITEINNGMDALGGLFN-FFTWGAFIPLIL...AI......IGGIL..INK.------------
Q4L9F8_STAHJ/19-126VST...............SELNQGIDVLGSFFS-FLTWGAVISLIL...AI......IGGIL..ISK.------------
C4WCX0_STAWA/2-110QAASNP..........AVDSSSHMSELLPSILK-VGLIYGLVILVI...AL......IATLL..IKK.------------
Q4A0V3_STAS1/2-109FTY...............EDGNTIFSTFSGLLT-TGLVLGIILLII...AL......IAVFL..ISK.------------
C5QZN6_STAEP/3-109ENPGE............YDLAYQTYNIMLGLGV-VLIIILLILLIV...SI......VAAIL..IGK.------------
D3QGJ5_STALH/3-111RPDENV..........TLSEAVMSVNVLSTLVT-IQAIINIVILVL...AI......IGVIF..IHR.------------
D3QGJ6_STALH/3-111NPDSNV..........SRDQTIEAVNSVATNSS-GWIMIGIVILGL...TL......VAAIM..LSK.------------
Q4A0E9_STAS1/2-112NQSNIYNQ......NASQMDPANIVDLVSNLFI-LALIVVIVCTVI...AI......IFAIL..TNK.------------
C5NV51_9BACL/5-120FKKELAKNPNGANLNGVNLSAEQLLDYTIQGLK-MYSVLLIVLVVV...AL......LASFL..MKK.------------
C5NWK3_9BACL/5-118NLLQDPAM.....KSLMASTRMDIVTLLATGVK-IYAIVAIVLVVL...AL......IASFT..MRA.------------
Q49WN0_STAS1/2-102.......................SMETFKTSIM-FQGVLLIISTIL...GI......LGTFI..IKG.------------
Q8ERL5_OCEIH/2-100.......................IFSIFLHLLW-LPAVMYFISFIL...GL......IGVLK..LKV.------------
A7A3G5_BIFAD/15-115......................TDYSAVDNAST-VVGIYALLVLII...GI......VSFIM..SMRC------------

PF00335

TSN15_MOUSE/19-259................................................................RRGIENYYDDLDFKNI
Q29BB1_DROPS/7-204....................................................................AEQGWMTVPPEL
TSPC_DICDI/14-226...................................................................SWVQISNSLKNST
TSN33_MOUSE/21-264.................................................................INNAIVHYRDDLDLQ
Q9VMJ6_DROME/18-261................................................................GLKAFIRHYREDADQQ
Q7QJ21_ANOGA/9-222...............................................................ETSFTEFLAKDNTNDQT
Q7Q8G1_ANOGA/14-231........................................................................YKQQDGYR
Q84WF6_ARATH/4-245................................KEF.KLE......................AYHPWLKTRVVDTNYWVTI
TSPE_DICDI/16-219..................................I.W..........................YKVGNYQHHSKHYHHGI
Q16LT3_AEDAE/14-239................................................................NESMASYNDNANVQQS
Q5C164_SCHJA/7-207................................................................KDLVRQYGQDKHLDKV
Q8SU08_ENCCU/10-189.....................................................................DWRWDSLNEEQ
Q9W4X6_DROME/42-295...............................................................THKIIHSYRDDPDLQNF
Q9NB13_DROME/7-221...................................................................LVNLLWDSHDYTA
Q6DCP2_XENLA/9-233................................................................KDGMSRYNNTKEMADS
Q6GLY9_XENLA/10-290..................................D.A.........................VKHYKDTDIPGRCFLKST
Q8SY17_DROME/7-219.................................................................IENAWNSEHTYKGGV
Q1EC46_DROME/7-202....................................................................QAFAKQTNTFDA
TSPD_DICDI/11-224..................................................................DNWKNISYSNQSVV
A2FKF6_TRIVA/7-185.....................................................................HRGDGTPIGNA
A2DWZ1_TRIVA/7-204...................................................................DYWAESGVNDSVK
Q4DD38_TRYCC/86-309..................................F.L..........................DAWKRGVNNTKTGRNHD
TSN16_HUMAN/10-243..................................V.T..........................LRKNYRGYNEPDDYSTQ
Q5KAR0_CRYNJ/191-384....................................................................NSQWSRYLGTEG
TSN32_HUMAN/9-229..................................D............................LVYEQAMKGTSHVRRQE
Q9V3X2_DROME/9-261..................................K.S..........................SVQEEYGQSTMSSRTVT
TSPB_DICDI/14-224..................................................................NAWEDVSNGPKNST
Q9VID1_DROME/8-228................................................................NSTMQHYKERADYRDA
Q64HX8_ONCMY/9-234...............................................................NDMVTKYSNGTAEFKKA
Q29IZ2_DROPS/18-232..................................V............................SLRRFVSTSEYTYSNYV
Q1HRC5_AEDAE/13-234..................................H............................SSMTFYGAYGKRSITQA
TS31A_XENLA/8-198....................................................................LNTTWRRMSNET
Q17441_CAEEL/23-259...............................................................PNDILNNYNLDPNIAKA
Q5DG31_SCHJA/16-308.................................LA.IT........................KYYGINLSLRRNVGLTTA
Q2TCS3_BRABE/7-240..................................R.Q..........................LRQRTSLERFDEQYKSF
Q2TCS2_BRABE/9-231..................................D............................KIAEKKYQDLDPELQRL
Q9ZUN5_ARATH/3-256................................KEY.RLE......................GFSNWLKENVVDSKNWGRL
TSPA_DICDI/14-224..................................................................GAWEHVANGTKNST
IM23_SCHMA/10-212.................................................................MTGALDKPTKEITEF
Q29JV0_DROPS/10-238..................................T............................ESLKDYNTFTQSPTTAL
Q6GP84_XENLA/8-227..................................K............................KGLQLYNTTGNLGLTNA
Q5DB78_SCHJA/24-277..................................K.T..........................TFVTQYRELGFEDTTNF
A0BI34_PARTE/7-267QIENLYKMS.............ESTLCKSSCECYY.SEKMTKEVELAVK..SYSATDKTKPTRVQDCPGFDSKYKTQAAA
Q5GM22_TAESO/9-219..................................E.A.........................IQELQSKRLSGSDPTLKA
Q9XVI4_CAEEL/8-223................................................................QTGMVRYHESRGVESA
A2G3J8_TRIVA/7-186.....................................................................EGKNDTAIGKA
A2EZ33_TRIVA/7-201....................................................................ETWWIENEGTQD
Q5DH84_SCHJA/4-271..................................E.K..........................HFRSYKSIKSHDGASLF
Q60D82_BRAOL/4-254................................GNV.KTG......................DLQNWIGDHFLQGKNWEGI
Q4RYD3_TETNG/10-300..................................N.G.........................MKYYKDTDTPGRCYMKRT
Q24C21_TETTS/14-285..................................Q.D.........................KGSNGTEIFYYGQEAYNS
A2DI21_TRIVA/15-204.....................................................................SNNWYSFDDPT
Q6GNW4_XENLA/9-244..................................D.L..........................IVTYDYEDGKNTSCETT
Q4SU90_TETNG/14-272NAQR.......................CRLGNKLH.LCVSVCVQ...........IKGTFFTTYNEAVMRYDGLDDRSLA
Q2TCR9_BRABE/6-237..................................S.R..........................TFNGRFIDEFSDDFQDA
Q7T376_DANRE/6-213..................................V.D..........................GLNQSIKNRKQHNTTDD
Q7JZW7_DROME/7-210.................................................................YVMDLWMKELVHHGA
Q4PLY6_IXOSC/9-219................................................................TNSVDKYFNDTEVEKL
Q2TCS4_BRABE/9-233..................................I.E..........................ALGTGKIDAKSENFKAL
A1Z8K7_DROME/8-233.................................................................LQESIKRSNSEDTMA
A1Z6U3_DROME/7-206..................................................................VQMKWDEELVEPGA
Q5DH43_SCHJA/12-223..................................E.E..........................QVIRYRETEPENESTKL
TSN12_HUMAN/9-249..................................L.K..........................ARMTNYGLPRYRWLTHA
Q7Q1S3_ANOGA/9-239..................................N............................SSMKSYGGENAGDITLV
Q5PQ10_XENLA/8-231.................................................................LKAFENYNGSKSDLT
O44582_CAEEL/29-290..................................W.L..........................LLYAVKNYHTNRNLAEI
Q06AT4_PIG/10-258.................................ER.YQ.......................NNSPPSNDDKWKNNGVTKT
Q6DDY1_XENLA/6-239..................................K.P..........................VLQNDYGSSSKPDVTKI
Q9UAI4_DROME/9-228..................................D.S.........................FVEFLDKFSRTKVDNLHL
Q503H8_DANRE/10-204..................................................................YYESATKMENGTVI
Q5BL96_DANRE/12-254................................................................MKAIVRYRDDQDLENV
Q292V6_DROPS/9-211...................................................................RQLFEEKTHSNDK
Q16TV5_AEDAE/8-254.................................GI.EK........................HYNVSDRGGIFAPSVASI
Q7K527_DROME/7-213...................................................................ENQWELEQTKPGS
A8WRV5_CAEBR/9-230...............................................................RDELVSKYNNNQQIHQA
Q5ZII8_CHICK/15-247..................................K.N..........................TMTEKYRKEGEERVTSA
TSN14_HUMAN/14-261................................................................ESNIKSYRDDIDLQNL
Q2TCR8_BRABE/9-244................................................................TDFMMKWTNKTEGRLA
Q2TCS8_BRABE/8-228..................................D............................TTSTVPYTSLDQAARTL
Q86FE8_SCHJA/7-285.................................RF.MT........................NYSGAIGTPDFTPIKSYT
A1Z6U7_DROME/7-216..................................................................LELAWHGLDRDPEL
Q6GQE5_XENLA/9-221..................................K............................DTYAKYMLNRDGPLKET
Q9U2K6_CAEEL/7-216...................................................................YVFDSFNMNAQAD
Q8MS10_DROME/8-256.................................GI.ER........................HYNSSDRGSLVAPSVASI
Q29JV1_DROPS/14-246................................................................YQSMANYETDPYVESG
Q6Z5Z9_ORYSJ/5-263................................REY.HLG......................DYSTWLRRSVEDGGHWARI
Q4RSA5_TETNG/8-245...............................................................KDMIVTYTGVNRTAEHT
Q6NYK2_DANRE/10-290..................................N.G.........................IRFYKDTDIPGRCFQKQT
Q6DDY2_XENLA/8-252..................................M.L..........................TYYSDSSTPQGRDVTGV
Q0V996_XENTR/6-236..................................V.A..........................VKYLHYQYGESDELTTI
Q5DDB8_SCHJA/7-215................................................................NTTINGFHLKVDIPSE
Q4T8J0_TETNG/8-244...............................................................GTVLDGYPGNNSSVMQA
CD63_MOUSE/9-231................................................................QQQMQNYLKDNKTATI
Q6P0W1_DANRE/7-218..................................S............................TVYAQYLNTRSASQAVS
TSP1_CAEEL/7-221...................................................................LIDAMYTTNSVND
Q1L9G8_DANRE/9-220..................................T............................QTVKNYKESPDGPLKET
Q16J92_AEDAE/9-260...............................................................KEAVQDEYSVVATRTTT
Q29D35_DROPS/9-259..................................Q.T..........................TITSYSLGENVDASTLM
Q3ZLC3_OREMO/6-225................................................................KTMLPFAKQPQSVKSD
Q75IM5_ORYSJ/6-249................................REY.HTS......................DYSSWLQKHIQDAKYWRPA
Q16LT5_AEDAE/17-240................................................................NGSLQRYPWNSHIQKS
A2G0G6_TRIVA/19-208.....................................................................SVEWLKADEAV
Q5DGI2_SCHJA/10-219................................................................RNSVSEYSKNPDIQNL
Q7JWV7_DROME/7-218..................................................................VQTIWDQRKTDALL
Q9FVY6_ORYSJ/5-257................................KEY.RLQ......................DYSSWFIKQLNDTEKWTHL
A2AGS8_MOUSE/8-247...............................................................LTKHYQGDNDTDVFSAT
Q6INJ9_XENLA/8-187.....................................................................LEVGWNHTNGA
CD53_MOUSE/8-210................................................................NDSIQHYHSDNSTMKA
A8X5P0_CAEBR/7-223..................................................................VLEKSSSAPELRKN
Q86FA1_SCHJA/5-268..................................E.N..........................SLRNYQSIGSNNTDSIV
A1Z6U8_DROME/7-209....................................................................DAWQGQLYHSDR
TSN6_BOVIN/16-237...............................................................EKALKQYNATGDYRSDA
Q6Z6K0_ORYSJ/3-259................................EYH.LDG......................FSMWLRGYVSDDPARWERI
Q4SM43_TETNG/8-236..................................K............................KVFDQYNGVNSNAQSRA
Q0QBV5_HELTB/11-271..................................S.S..........................TMDSYEGESANDTISTA
Q5DFJ8_SCHJA/7-215..................................................................SIKSYEKDFKYQIQ
Q6DHQ4_DANRE/8-230..................................K............................KGLQLFGTEGNIGLTNA
Q245V1_TETTS/9-275.................................................................QKKDFLIYSRKVYEK
Q5DHJ8_SCHJA/10-217.................................................................TNTIKSYRQSQYQEE
Q24FE3_TETTS/5-264................................................................CTQQSILIQLQQLNHK
Q4T2B0_TETNG/10-333..................................N.A.........................MVHYKDTDTPGRCYLKRT
Q2TCS0_BRABE/9-233..................................N.K..........................ALDGEKVNDKNANFQQF
Q6Z8Q8_ORYSJ/5-259................................REY.RLG......................DYSTWLRRHVGSSKNWDKI
Q6W8Q0_BRABE/9-238..................................D............................HISDRKYQNLTAEVKKF
Q0V9E6_XENTR/12-237................................................................QQILSKYGIDGQLTRS
TSN8_BOVIN/7-235..................................I.N..........................ARLLSSTDENERVFQKA
Q4D693_TRYCC/53-289..................................................................ALYWERAVSNTPSR
Q5I0R1_XENTR/7-227................................................................YKLLPLSGQDESFKTS
Q24FE4_TETTS/5-254................................................................CSQNIKFIRLFELNNI
Q9M0B7_ARATH/4-258................................KEY.RLE......................AYSDWLQRRVNNAKHWNSI
A0BP70_PARTE/7-282QSEYFTGSATLNNVYAEAEEVFCKTIYKNAPGCQCYYTGSMTESTSESVQFYSSSNSDLPIRIQQCQQYNDYKSDYDEEA
Q7K010_DROME/6-211..................................................................LEATWEEELNSPGA
Q67WQ6_ORYSJ/4-259................................REY.RLG......................DYSTWLQRRVENSANWAKI
TSN1_MACFA/6-239...............................................................VPAIKKDYGSQKDFTQV
Q19983_CAEEL/7-278...............................................................YDTIRNRYSSETAFKDA
TSN2_MOUSE/10-214...............................................................EEAYSDYLKDRARGNGT
O44420_SCHJA/9-217................................................................LQAVKGYYSDKLYEEQ
A8XY10_CAEBR/57-274...............................................................NYMVQHYYQGPGVVQEA
ROM1_BOVIN/11-293..................................L............................VHYKDTEVPGRCQAKRL
Q3UFS7_MOUSE/74-318................................................................HAAIIHYWDDPDLHFL
Q2TCS6_BRABE/12-229..................................D............................GLSKTSYSSKDQASRTI
Q9SI56_ARATH/15-273FRYE......................DYSGWVSRL.VIKDDEWY...........RTRRCLVKDNVCNRLNHKMPASEFY
Q9NB09_MANSE/12-245................................................................RDTMPKYYRNPEVQDA
Q1HQ39_BOMMO/7-211...................................................................NWMNKTFQQDQDT
Q16HS1_AEDAE/9-225..................................E.Y..........................FDHNISVSKASSVVDPV
TSN5_HUMAN/14-261................................................................NNNIRAYRDDIDLQNL
TSN10_HUMAN/75-319................................................................RVAIAHYQDDPDLRFL
A2ECP6_TRIVA/7-193......................................................................VFENPDYLKF
A2FGU0_TRIVA/7-203....................................................................SSRWSAPNFADI
Q7EZC8_ORYSJ/6-199.............................................................................NHS
Q2TCS7_BRABE/7-197....................................................................LSFGWKHSATAT
Q6P2T9_DANRE/9-230................................................................NTMIAGYNKTEEYRTT
Q6P7J5_XENLA/7-233................................................................DTLFKNYNGADVPSST
Q7K2V7_DROME/7-219.................................................................VDKAWDENNAAQGYP
Q7PTA7_ANOGA/9-220.................................................................ERVFENRDNPVNADL
Q9C5W7_ARATH/6-190.............................................................................DNS
Q5D928_SCHJA/7-215................................................................MESIKSFNVNVNYMEE
A2G7G6_TRIVA/7-186.....................................................................HEGKDDPIGRA
Q9NB12_DROME/7-217.................................................................GFDRLWESERNQTGA
Q53GA9_HUMAN/7-234..................................E.N..........................TKLLSATGESEKQFQEA
Q16LT4_AEDAE/34-247................................................................NNAFAQYRYDPDVRHS
O96962_SUBDO/13-238................................................................VAAIENYYNSTSDRRV
A1Z6T8_DROME/7-220.................................................................GLDDLWDLQHEGNST
A2GDR3_TRIVA/7-201....................................................................QAWWDENKGKDT
CD37_RAT/10-270..................................L.R..........................TIQSYRTNPDETAAEES
Q4SA96_TETNG/3-245................................................................QRAVAGYTEDEGRADA
A2EZ30_TRIVA/7-219....................................................................EDWWNENKGKQS
Q176T5_AEDAE/20-244.................................................................LEKSISRRNKADMTA
LBM_DROME/7-199.....................................................................DMVEVAWQANN
Q6QSX5_ORNMO/7-221..................................T............................ITAKIDEINDNPKARRF
Q6YWS4_ORYSJ/4-277................................GDY.RVR......................DYSEWLRARIEDYETWHRI
Q5DHT1_SCHJA/5-217................................................................NDSSKLYYKNRLYETE
A0CWV3_PARTE/4-273.....................................................................ECTNKDYFKLV
Q9NB10_MANSE/9-232................................................................NETIDQYPTNKEVAKT
A2DY51_TRIVA/7-217..................................................................KWNKGVTDKGMENV
Q8LAM6_ARATH/4-263................................KEY.RT.......................VDFSTWLNGFVGGKRWVGI
Q9C7C1_ARATH/4-244................................KEY.RLG......................DYHPWLRERVRDPEYWNSI
Q8AV92_PETMA/9-221..................................T............................DLYHEYHEKKTDSSKAA
Q4RL59_TETNG/34-259................................................................TEVFNKYDGTSAESSA
Q16HX5_AEDAE/9-218.................................................................ARLFDERDRPQNAEL
Q9FJN3_ARATH/7-267.................................................................FKLKIMDDHVTWNNI
Q7JYY8_DROME/7-209...................................................................LATWADQRTNVER
TSN11_BOVIN/15-248..................................T.R..........................TLAENYRQPGAAEITAS
Q86D97_SCHMA/7-231..................................E.G..........................IEEYSMLRDQRENPVPF
Q4S5B5_TETNG/8-230..................................K............................EGLALYTTDNNAGLKDA
Q5XGS2_XENLA/8-220.................................................................TNSFEQNLKHNSSET
Q24C18_TETTS/14-278...............................................................CQSKNDIFKYSQEAYDQ
TSN31_MOUSE/8-196....................................................................INASWSVLSNST
Q568F4_DANRE/16-258................................................................REGIKHYYDDLDFKNI
Q22495_CAEEL/37-297................................................................NDVVVGYRDDPDLQLL
Q4RGV0_TETNG/6-216...............................................................EEKFSPLSSKPESVQQD
A2D8F2_TRIVA/5-200................................................................ENCSKSTNDSSSVCEA
Q2F647_BOMMO/7-228..................................G.V..........................LFKKRSDANADEAAEAV
Q22RT6_TETTS/6-279................................................................CSKQSLMKDLKATYDA
A8XFB8_CAEBR/15-256..................................M.L.........................TSLRELYGTHDMKGITES
Q3UWG5_MOUSE/9-230..................................D.Q..........................ALQQAVMDDDANNAKAV
Q16GP3_AEDAE/9-261.................................TT.I.........................SKYYSSNDRNQSDAVTLM
Q6P3H3_DANRE/8-245...............................................................SQVVANYPGQNKTAEQA
Q7SXT2_DANRE/16-243.................................................................YQKAESNYMGKDDED
Q86FE6_SCHJA/8-220................................................................KEGVDDWNNSNNEVRW
Q4S5Y2_TETNG/9-225....................................................................NYKNGTADFRKT
Q8AV91_PETMA/9-216..................................N............................GLYNDNSNSTRSATSKT
Q292W4_DROPS/7-217..................................................................VEKAWERRTRRADY
Q7JWP5_DROME/7-206..................................D............................KLWNDQPVPIKPGNQSQ
A2DRK6_TRIVA/7-225....................................................................DTWWDKNKGSVE
A0EF92_PARTE/7-263PPLQQTWDL.............GQNLLCSAECQCY.IEDPTNLPTAYFN.HTTNSSAANRVQDCSSFDNWDSSRRSQAKL
Q4D6X7_TRYCC/23-265....................................................................GWDKAAVSNAEG
Q9NB07_APIME/7-222..................................K............................YQEIFNGYFLNSESKDF
CD82_HUMAN/8-256..................................T............................ELIRDYNSSREDSLQDA
Q86FC1_SCHJA/3-271..................................V.E..........................STKSYVSLKSPDVRSVF
RDS1_XENLA/10-290..................................N.A.........................IRFYKDTDTPGRCYQKRS
Q16HS3_AEDAE/6-221................................................................EMEFDHVLRTGISSER

PF04103

Q7QF09_ANOGA/191-317--------------------------------------------------------------------------------
T176B_HUMAN/66-229--------------------------------------------------------------------------------
M4A14_HUMAN/44-221--------------------------------------------------------------------------------
M4A10_HUMAN/59-193--------------------------------------------------------------------------------
Q3UAR5_MOUSE/47-204--------------------------------------------------------------------------------
Q4RID0_TETNG/40-178--------------------------------------------------------------------------------
MS4A5_HUMAN/49-189--------------------------------------------------------------------------------
Q3LRP2_CALJA/51-216--------------------------------------------------------------------------------
A7S4D6_NEMVE/20-179--------------------------------------------------------------------------------
Q16GM4_AEDAE/220-341--------------------------------------------------------------------------------
MS4A3_MOUSE/27-172--------------------------------------------------------------------------------
CD20_MOUSE/44-210--------------------------------------------------------------------------------
Q3TPB3_MOUSE/27-182--------------------------------------------------------------------------------
A5WUV1_DANRE/56-184--------------------------------------------------------------------------------
A5WUU6_DANRE/48-180--------------------------------------------------------------------------------
Q0V9M1_XENTR/36-200--------------------------------------------------------------------------------
FCERB_HUMAN/60-204--------------------------------------------------------------------------------
M4A13_MOUSE/15-152--------------------------------------------------------------------------------
A2BIL3_DANRE/61-221--------------------------------------------------------------------------------
Q810P8_MOUSE/49-189--------------------------------------------------------------------------------
T176A_RAT/63-223--------------------------------------------------------------------------------
Q4RKB8_TETNG/40-175--------------------------------------------------------------------------------
Q4SW16_TETNG/67-213--------------------------------------------------------------------------------
M4A6C_MOUSE/47-207--------------------------------------------------------------------------------
Q5U4S5_XENLA/37-192--------------------------------------------------------------------------------
T176B_MOUSE/60-224--------------------------------------------------------------------------------
M4A6B_MOUSE/47-204--------------------------------------------------------------------------------
A2RRW5_DANRE/53-183--------------------------------------------------------------------------------
Q5R1M8_FELCA/51-217--------------------------------------------------------------------------------
Q4RKB7_TETNG/24-169--------------------------------------------------------------------------------
M4A8A_MOUSE/87-225--------------------------------------------------------------------------------
Q95PZ5_CAEEL/94-253--------------------------------------------------------------------------------
Q1LVQ8_DANRE/42-197--------------------------------------------------------------------------------
Q17QX1_BOVIN/51-216--------------------------------------------------------------------------------
A5WUV2_DANRE/56-191--------------------------------------------------------------------------------
Q29RT3_BOVIN/44-181--------------------------------------------------------------------------------
Q58DM5_BOVIN/48-208--------------------------------------------------------------------------------
A3KNL7_DANRE/59-198--------------------------------------------------------------------------------
Q8MJ38_PIG/60-203--------------------------------------------------------------------------------
M4A15_MOUSE/76-198--------------------------------------------------------------------------------
A5PMI8_DANRE/61-210--------------------------------------------------------------------------------
A6H741_BOVIN/62-223--------------------------------------------------------------------------------
Q4JF27_HUMAN/46-188--------------------------------------------------------------------------------
Q5BLB6_DANRE/53-183--------------------------------------------------------------------------------
Q5M796_XENTR/47-192--------------------------------------------------------------------------------
M4A6D_MOUSE/47-207--------------------------------------------------------------------------------
Q4SZQ8_TETNG/34-173--------------------------------------------------------------------------------
Q4TAI3_TETNG/57-208--------------------------------------------------------------------------------
Q567H8_DANRE/59-196--------------------------------------------------------------------------------
MS4A3_HUMAN/50-196--------------------------------------------------------------------------------
A7E2J6_DANRE/50-185--------------------------------------------------------------------------------
FCERB_MOUSE/52-195--------------------------------------------------------------------------------
Q4S7F2_TETNG/34-189--------------------------------------------------------------------------------
Q08BU9_DANRE/43-180--------------------------------------------------------------------------------
Q5BLA7_DANRE/16-153--------------------------------------------------------------------------------
MS4A7_HUMAN/47-207--------------------------------------------------------------------------------
T176A_HUMAN/56-214--------------------------------------------------------------------------------
Q0P3U8_DANRE/59-198--------------------------------------------------------------------------------
Q80WF0_RAT/44-182--------------------------------------------------------------------------------
M4A10_MOUSE/56-190--------------------------------------------------------------------------------
CD20_CANFA/51-216--------------------------------------------------------------------------------
M4A12_HUMAN/90-225--------------------------------------------------------------------------------
Q9EQY9_MOUSE/43-171--------------------------------------------------------------------------------
A7SQ32_NEMVE/7-164--------------------------------------------------------------------------------
M4A8B_HUMAN/71-207--------------------------------------------------------------------------------
M4A4D_MOUSE/43-170--------------------------------------------------------------------------------
A3KNQ4_DANRE/48-184--------------------------------------------------------------------------------
Q9GYM6_CAEEL/45-206--------------------------------------------------------------------------------
A5PM84_DANRE/63-199--------------------------------------------------------------------------------
Q3T128_BOVIN/66-204--------------------------------------------------------------------------------
A0JMW7_XENLA/42-205--------------------------------------------------------------------------------
Q9ES61_MOUSE/43-171--------------------------------------------------------------------------------
Q28GK5_XENTR/3-141--------------------------------------------------------------------------------
F189B_MOUSE/36-196--------------------------------------------------------------------------------
T176B_RAT/60-224--------------------------------------------------------------------------------
Q2KII2_BOVIN/49-189--------------------------------------------------------------------------------
Q1LX35_DANRE/59-175--------------------------------------------------------------------------------
M4A18_BOVIN/154-273--------------------------------------------------------------------------------
Q567A9_DANRE/32-162--------------------------------------------------------------------------------
T176A_BOVIN/63-220--------------------------------------------------------------------------------

PF13273

D7UXS6_LISGR/3-100--------------------------------------------------------------------------------
C2RQC7_BACCE/10-90--------------------------------------------------------------------------------
C3AKH5_BACMY/2-83--------------------------------------------------------------------------------
Q2B2X7_9BACI/2-86--------------------------------------------------------------------------------
C9B7Y0_ENTFC/3-104--------------------------------------------------------------------------------
C7DIS7_9EURY/29-132--------------------------------------------------------------------------------
D7DCC0_STAHD/4-91--------------------------------------------------------------------------------
A0B9F9_METTP/2-84--------------------------------------------------------------------------------
Q12UE5_METBU/2-98--------------------------------------------------------------------------------
B9DJA4_STACT/148-230--------------------------------------------------------------------------------
C4WAZ9_STAWA/11-93--------------------------------------------------------------------------------
Q4L9M4_STAHJ/13-95--------------------------------------------------------------------------------
A5UKZ4_METS3/8-83--------------------------------------------------------------------------------
A5N2M2_CLOK5/4-86--------------------------------------------------------------------------------
Q97LL2_CLOAB/4-86--------------------------------------------------------------------------------
A9VVN7_BACWK/2-84--------------------------------------------------------------------------------
B3ZH23_BACCE/2-84--------------------------------------------------------------------------------
C3BEA6_BACMY/2-84--------------------------------------------------------------------------------
Q4V1S6_BACCZ/2-84--------------------------------------------------------------------------------
D4FV71_BACNA/2-84--------------------------------------------------------------------------------
C2VWU6_BACCE/24-113--------------------------------------------------------------------------------
C2U6N9_BACCE/2-85--------------------------------------------------------------------------------
A5UL06_METS3/42-117--------------------------------------------------------------------------------
O26620_METTH/8-82--------------------------------------------------------------------------------
C8JWL3_LISMN/13-93--------------------------------------------------------------------------------
D7V0U0_LISGR/3-121--------------------------------------------------------------------------------
C8JTX3_LISMN/3-121--------------------------------------------------------------------------------
D3KN98_LISMN/3-121--------------------------------------------------------------------------------
Q92D69_LISIN/3-121--------------------------------------------------------------------------------
D3ULL7_LISSS/3-121--------------------------------------------------------------------------------
A8FJ46_BACP2/3-107--------------------------------------------------------------------------------
B4AK11_BACPU/3-107--------------------------------------------------------------------------------
C2H7S4_ENTFC/2-107--------------------------------------------------------------------------------
C9ATK3_ENTFC/2-107--------------------------------------------------------------------------------
E6TU87_BACCJ/2-115--------------------------------------------------------------------------------
B9CUN6_STACP/3-110--------------------------------------------------------------------------------
C5QNE2_STAEP/3-110--------------------------------------------------------------------------------
C2LZ67_STAHO/18-125--------------------------------------------------------------------------------
Q4L9F8_STAHJ/19-126--------------------------------------------------------------------------------
C4WCX0_STAWA/2-110--------------------------------------------------------------------------------
Q4A0V3_STAS1/2-109--------------------------------------------------------------------------------
C5QZN6_STAEP/3-109--------------------------------------------------------------------------------
D3QGJ5_STALH/3-111--------------------------------------------------------------------------------
D3QGJ6_STALH/3-111--------------------------------------------------------------------------------
Q4A0E9_STAS1/2-112--------------------------------------------------------------------------------
C5NV51_9BACL/5-120--------------------------------------------------------------------------------
C5NWK3_9BACL/5-118--------------------------------------------------------------------------------
Q49WN0_STAS1/2-102--------------------------------------------------------------------------------
Q8ERL5_OCEIH/2-100--------------------------------------------------------------------------------
A7A3G5_BIFAD/15-115--------------------------------------------------------------------------------

PF00335

TSN15_MOUSE/19-259MDFVQ...KKFK.C.CGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCI................................
Q29BB1_DROPS/7-204RQQVQ...ESLH.C.CGFNATSSINLPTSPLAPTDEPS..........................................
TSPC_DICDI/14-226ITKLE...DFLE.C.CCWSESYSNQTYK....................................................
TSN33_MOUSE/21-264NLIDFG.QKKFS.C.CGGISYRDWSQNMYFNCSEDNPSRERCSVPYSCC...............................
Q9VMJ6_DROME/18-261NLIDWIQEDWLQ.C.CGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSC...............................
Q7QJ21_ANOGA/9-222HIWNRL.QRDFR.C.CGYNGIHDYKKNKQMGF................................................
Q7Q8G1_ANOGA/14-231NPIDTL.QNTLE.C.CGVDGFSDWAQFLPSDGTVMEY...........................................
Q84WF6_ARATH/4-245KTCLL...GSVT...CSKLALWTPLDYLQKDLSPLQSGCCKPPTSC..................................
TSPE_DICDI/16-219IEIIE...KHHR.C.CGWSKEIEGNYCV....................................................
Q16LT3_AEDAE/14-239VDFMQ...RVLE.C.CGVDSYEDWTFFFKNSPNATEGTNS........................................
Q5C164_SCHJA/7-207LDEVQ...EKLQ.C.CGAESPADYSSE.....................................................
Q8SU08_ENCCU/10-189RNFVQ...SKFK.C.CGFLDSSDRS.......................................................
Q9W4X6_DROME/42-295IDFAQ...QEFK.C.CGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCI..............................
Q9NB13_DROME/7-221MGVLE...ETFG.C.CGDTSYTNYNNIGLSVPGTCC............................................
Q6DCP2_XENLA/9-233IDLLQ...KEFK.C.CGAFNSTDWKQYAPFVGTTNVPDS.........................................
Q6GLY9_XENLA/10-290IDLLQ...IQFR.C.CGNNGFRDWFEIQWISARYLDMGSKEVVNRFKSNVDGKYLLDG......................
Q8SY17_DROME/7-219FDTIQ...KSLH.C.CGSSSALDYIGKGDLVPP...............................................
Q1EC46_DROME/7-202MAEYQ...TQYQ.C.CGIYKLKDYGDAYITV.................................................
TSPD_DICDI/11-224IKKLE...QFFE.C.CCFDESDLKLNCTALC.................................................
A2FKF6_TRIVA/7-185IDNYE...KDHH...CSYWNE...........................................................
A2DWZ1_TRIVA/7-204DGVKKI.EKAGK.C.CGYDKPYANNSAE....................................................
Q4DD38_TRYCC/86-309ICLLQ...ERFN.C.SGFRDGCCVAGVCYDAIDPPE............................................
TSN16_HUMAN/10-243WNLVM...EKLK.C.CGVNNYTDFSGSSFEMTTGHTYPRS........................................
Q5KAR0_CRYNJ/191-384RLRIQ...DALR.C.CGYYSPFVEATVS....................................................
TSN32_HUMAN/9-229LAAIQ...DVFL.C.CGKKSPFSRLGSTE...................................................
Q9V3X2_DROME/9-261FDTLQ...KNLK.C.CGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNI.............................
TSPB_DICDI/14-224ILKLE...NFLK.C.CYWNSTSSRNPLLC...................................................
Q9VID1_DROME/8-228WTLLQ...TELD.C.CGINGPNDWETVYRNSTLPAAC...........................................
Q64HX8_ONCMY/9-234LDNLQ...VDLK.C.CGVTNATDWKGKFGSVPDSVPDSC.........................................
Q29IZ2_DROPS/18-232LTMIQ...ENIG.C.CGATGPWDYLDLHQPLP................................................
Q1HRC5_AEDAE/13-234WDMTQ...ERLK.C.CGVKHYNDWRGSIPQSCCQKT............................................
TS31A_XENLA/8-198RLNLE...ETLE.C.CGFLNTTEARELFNKDV................................................
Q17441_CAEEL/23-259VNYLQ...RDSK.C.CGSNAFNDWPKPEVEDHYLPYAKTVVQRVQ...................................
Q5DG31_SCHJA/16-308VDEIQ...SKFE.C.CGTFGEKSSNYSWFLYKGSSTWFYVTQKLDSKSVVQYVPDSCCVLKDRNLRFN............
Q2TCS3_BRABE/7-240LIFWQ...EHLT.C.CGLNSKDDWKDPLGSEARATCLCVFN.......................................
Q2TCS2_BRABE/9-231VDFFQ...KEFK.C.CGMNSTKDWAPDYPDTCNC..............................................
Q9ZUN5_ARATH/3-256RACLA...DTNV...CPKLNQEFITADQFFSSSKITPLQSGCCKPPTACGYN............................
TSPA_DICDI/14-224LTRLE...NFLK.C.CKWSNVSIDSSDLC...................................................
IM23_SCHMA/10-212MNLIQ...SSFH.C.CGAKGPDDYRGNVP...................................................
Q29JV0_DROPS/10-238WDDVQ...HDFN.C.CGVSDYKDWAVTYPNASLPISCCTI........................................
Q6GP84_XENLA/8-227WDIVQ...TEFR.C.CGVKNASDWLETKDSVPHTC.............................................
Q5DB78_SCHJA/24-277MDFIQ...KELN.C.CGPKSYLDWTANRYFSCNKSNVSPEACGVPYSCCR..............................
A0BI34_PARTE/7-267LQLME...EKWQ.C.SGWCTPYPIQQFN....................................................
Q5GM22_TAESO/9-219LEELQ...AKLK.C.CGGVGPSDWRVAPPSC.................................................
Q9XVI4_CAEEL/8-223WDKTH...QLFE.C.CGVTNSSDWLTFTTIPDSCC.............................................
A2G3J8_TRIVA/7-186IEEIE...GVLH...CKHWDD...........................................................
A2EZ33_TRIVA/7-201VKDVE...SDLE.C.CGFKVPYNATEMEN...................................................
Q5DH84_SCHJA/4-271IAVVM...IELK.C.CGFLDLLDFNEMKLVTQDVYDGRTYDNVLMPIP................................
Q60D82_BRAOL/4-254KRCMA...DSSI...CRFRPRDVDFDAKHLSHVKFGCCRPPVECGFEAKN..............................
Q4RYD3_TETNG/10-300LDLMQ...MEFR.C.CGNDNYRDWFEIQWVSNRYLDFSAKEVKDPTLMARSLFSRIGSNVDGQ.................
Q24C21_TETTS/14-285AFSLF...CTQR.CPCKVTNTEVKSYITKNYIQMVPFMQDNGSVKVQDCQDYKTVFSNS.....................
A2DI21_TRIVA/15-204KYELQ...SDLS.C.CGLSNSTDSPA......................................................
Q6GNW4_XENLA/9-244WDYIQ...RSLQ.C.CGWTSYQNWTENALIKNSTNEYPCSC.......................................
Q4SU90_TETNG/14-272VDGVQ...RSLR.C.CGVHNYTSWFNSVYFPVSGFPASCCV.......................................
Q2TCR9_BRABE/6-237VVYFQ...RRMD.C.CGLNTPEDWEEWQTVDSCVCPIDRY........................................
Q7T376_DANRE/6-213WDKVQ...ETFG.C.CGIQNATDWQGFVPQ..................................................
Q7JZW7_DROME/7-210MQDLQ...QEYE.C.CGDKGFSDYTSLNMKVPRS..............................................
Q4PLY6_IXOSC/9-219WDDIQ...SNLH.C.CGANSTDDFRGKIPSSCC...............................................
Q2TCS4_BRABE/9-233VTALQ...DQYS.C.CGLVNNTDWQNPQPCLCTVAN............................................
A1Z8K7_DROME/8-233WDNIQ...QKLM.C.CGVDSPADWRTLSANKTLPGSCCQPQ.......................................
A1Z6U3_DROME/7-206MDIYQ...TVYE.C.CGRDSPDDYVAIGRQTLP...............................................
Q5DH43_SCHJA/12-223MDFIQ...KKFG.C.CGVTSAADYGTRSPPK.................................................
TSN12_HUMAN/9-249WNFFQ...REFK.C.CGVVYFTDWLEMTEMDWPPDSCCV.........................................
Q7Q1S3_ANOGA/9-239WDEIQ...VDFD.C.CGVYNSSDWGRANAVKFNETFLPMTC.......................................
Q5PQ10_XENLA/8-231VDNIQ...KELH.C.CGLHNYTDWETTLWYKQNFTIPKT.........................................
O44582_CAEEL/29-290MDALQ...ENLE.C.CGVSSIAQGYRDWNMSYQFNCTNSNPQPEKCGVPFSCCRKSV.......................
Q06AT4_PIG/10-258WDRLM...LQDY.C.CGVNGPSDWQKYTSAFRTENNDADYPWPRQ...................................
Q6DDY1_XENLA/6-239WNATM...ENLH.C.CGFNGYTDFTNSTYYSNYRHYPSY.........................................
Q9UAI4_DROME/9-228WNRMQ...SQLQ.C.CGVDGPLDYRRLSLPWSCC..............................................
Q503H8_DANRE/10-204TSAFH...SVLD.C.CGTESSPIE........................................................
Q5BL96_DANRE/12-254IDFVQ...KKFK.C.CGVDSYLDWSKNMYFNSSEHNPSLEAYGVPFSCC...............................
Q292V6_DROPS/9-211MQPIH...SLFR.C.CGLEGPQDYLGEENGALPA..............................................
Q16TV5_AEDAE/8-254WDKVQ...VELQ.C.CGVSSYEDWYDISAWPGERWVPRSCCRPRYN..................................
Q7K527_DROME/7-213MDIIQ...KTYY.C.CGRDSAQDYLDIKFWNNTVP.............................................
A8WRV5_CAEBR/9-230LDQLQ...SSLQ.C.CGASGCSDYMVYGAF..................................................
Q5ZII8_CHICK/15-247VDKLQ...QEFK.C.CGSNNYTDWADSMWIKSPEASGRKVP.......................................
TSN14_HUMAN/14-261IDSLQ...KANQ.C.CGAYGPEDWDLNVYFNCSGASYSREKCGVPFSCC...............................
Q2TCR8_BRABE/9-244FDGVH...KKFE.C.CGVTNYTDWFDKSPNFNPNNQPNVPGSCCL...................................
Q2TCS8_BRABE/8-228VDFTQ...TYLK.C.CGMNDTNNYNPTPASCSCA..............................................
Q86FE8_SCHJA/7-285LKMEIM.MINLE.C.CGMNGVDDFENEQSRWYSEGRKYIESSPEDLVKIPAAC...........................
A1Z6U7_DROME/7-216MHQYE...ASQH.C.CGYNGADDYKRLHLLVPAS..............................................
Q6GQE5_XENLA/9-221LKGIH...FAMN.C.CGLTGTIDATLTDIC..................................................
Q9U2K6_CAEEL/7-216ISAFN...FRYN.C.CGAENLPNL........................................................
Q8MS10_DROME/8-256WDSVK...QSFE.C.CGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQ.................................
Q29JV1_DROPS/14-246VDFMQ...SGLE.C.CGVNKPEDWKDYFSPNKNETLDTDDVVV.....................................
Q6Z5Z9_ORYSJ/5-263RSCLV...DTGV...CRSLKSNQTLDEFVNSNLSPLQSGCCKPPTACNFTYQ............................
Q4RSA5_TETNG/8-245WDYIQ...KTMK.C.CGWTGPGNWSNNLLIKNSSQNLYPCSCRN....................................
Q6NYK2_DANRE/10-290IDRLQ...MEFH.C.CGNTDYRDWFEVQWISNRYLDFSSKEVKDRIRSNVDGRYLVDG......................
Q6DDY2_XENLA/8-252WLRMM...LEKN.C.CGVDGPLDWVDYSSTFRKTYNETTAPWPLW...................................
Q0V996_XENTR/6-236WNATM...KELK.C.CGFYSYEDFTNSTYYQRNQQYP...........................................
Q5DDB8_SCHJA/7-215YDELQ...IKLQ.C.CGLNSREDFDKRRLAL.................................................
Q4T8J0_TETNG/8-244WDFIQ...RTME.C.CGWTSQQDWSGNMIIKNSSMLLFPCSCQN....................................
CD63_MOUSE/9-231LDKLQ...KENN.C.CGASNYTDWENIPGMAKDRVPDS..........................................
Q6P0W1_DANRE/7-218LKMFH...DAFD.C.CGVGGSIELFVRDTC..................................................
TSP1_CAEEL/7-221LKIIQ...DKYN.C.CGIENSLFNVM......................................................
Q1L9G8_DANRE/9-220LTAIH...FSLQ.C.CGPTGLVTDGVSVTC..................................................
Q16J92_AEDAE/9-260MDSIQ...KYFH.C.CGAEGPNDWQSSVYNNADRSSIVNIAISKLNVAYKV.............................
Q29D35_DROPS/9-259WNQLM...GNFG.C.CGITDYHDFDASPAWKENKGNRTIPEACCV...................................
Q3ZLC3_OREMO/6-225LENLQ...KDLK.C.CGLVNGKTDWSPDPFPVSCRCNV..........................................
Q75IM5_ORYSJ/6-249LACVV...GSKA...CPKIANWSPMDYLQHDLTPIQSGCCKPPTACA.................................
Q16LT5_AEDAE/17-240VDFMQ...IELE.C.CGVNNYQDWEDVFAVVDLDNGDLE.........................................
A2G0G6_TRIVA/19-208KKEIQ...VDLR.C.CGLTNITDHEV......................................................
Q5DGI2_SCHJA/10-219FDKIQ...TEFK.C.CGSESSIDYTSTGQSVP................................................
Q7JWV7_DROME/7-218MDTLQ...RSFK.C.CGLNGFADYGITYPASCCD..............................................
Q9FVY6_ORYSJ/5-257RSCLV...KSDD...CNGLSRRYKTLKQYKLADLTPMESGCCRPPAECGYPA............................
A2AGS8_MOUSE/8-247WNSVM...ITFG.C.CGVNGPEDFKLASVFRLLTLDTEEVPKACC...................................
Q6INJ9_XENLA/8-187HTDIE...RSLN.C.CGFHSYSQNDTC.....................................................
CD53_MOUSE/8-210WDFIQ...TQLQ.C.CGVNGSSDWTSGP....................................................
A8X5P0_CAEBR/7-223IKPIQ...NMLH.C.CGATSQTQYLYVKD...................................................
Q86FA1_SCHJA/5-268YSVIM...PTLN.C.CGLVNGSDFDHAPRFQRNVFFNQQTYNLQYPI.................................
A1Z6U8_DROME/7-209MSYFE...IKYH.C.CGQTGPANYPDSGLVIPQS..............................................
TSN6_BOVIN/16-237VDKIQ...SMLH.C.CGVTNYRDWKDTNYYSEKGFPE...........................................
Q6Z6K0_ORYSJ/3-259KACLV...VSDT...CKKLARQAGFLTADQFYQSRLSPLQSGCCKPPAVCGYN...........................
Q4SM43_TETNG/8-236IDYVQ...RQ...C.CGIHNYSDWQYTHWYEESKNNSVPI........................................
Q0QBV5_HELTB/11-271WNAIQ...ILLE.C.CGTNGYEDWADSTWVNETSPMISIEGSSYAQTYPATCCV..........................
Q5DFJ8_SCHJA/7-215FDVLH...STFH.C.CGANSVRDFVNFRRYQR................................................
Q6DHQ4_DANRE/8-230WSIVQ...TDFR.C.CGVTNHTDWFQVYNTSRVPDSC...........................................
Q245V1_TETTS/9-275AQTVF...CSKD.CMCQVKQSYLNPNTISSWNWSETQGKVKSQDCPTFNQSIDFTIPSD.....................
Q5DHJ8_SCHJA/10-217FDQLH...TSFY.C.CGATSYKDFATHSMKI.................................................
Q24FE3_TETTS/5-264SSLTL...CQND.CLCNFKGTQEEADKLGINNFNHKDSSPVRVQDCQIFEDFQFEN........................
Q4T2B0_TETNG/10-333LDMLQ...IQLE.C.CGNTGYRDWFQVQWISKRYLDMSSSLVLGLFEGTSQSSRGFLEPVSPPMGLRGPPSSPPPYWDSA
Q2TCS0_BRABE/9-233VIDLQ...KQFT.C.CGLIQISDWGNPCNEGQCKTC............................................
Q6Z8Q8_ORYSJ/5-259RSCLA...GADV...CRSLQDRNETWAQFVADDLSPVQSGCCKPPTSCNFTY............................
Q6W8Q0_BRABE/9-238VDVIQ...AEMR.C.CGMKEVTDWAPDYPGTCNCTQKT..........................................
Q0V9E6_XENTR/12-237LDYAQ...QEFR.C.CGAQNFTDWMNVTVTLLPSSVPKSC........................................
TSN8_BOVIN/7-235FSELQ...EELK.C.CGLVNGASDWGSNFQHYYRTCE...........................................
Q4D693_TRYCC/53-289ICDLQ...CWLH.C.SGFASTHCCVSNVTAERLPDVSPCYLLAEDGV.................................
Q5I0R1_XENTR/7-227FENIQ...KESQ.C.CGLVNGYTDWGANIPASCICP............................................
Q24FE4_TETTS/5-254SYQSL...CQDG.CQCYFEGSQIQANQQQITSYSQTESDPVNVQECLVFQNFNLED........................
Q9M0B7_ARATH/4-258RSCLY...ESKF...CYNLELVTANHTVSDFYKEDLTAFESGCCKPSNDCDF............................
A0BP70_PARTE/7-282EYLKSI.EEQFS.C.SGWCFPSSIYIF.....................................................
Q7K010_DROME/6-211MSLYQ...NWFQ.C.CGRGSPQDYIVNERLPPET..............................................
Q67WQ6_ORYSJ/4-259RSCLQ...DGKV...CEKLGARRETMDQFVGSNLSPIQSGCCKPPTGCNFAY............................
TSN1_MACFA/6-239WNTTM...TELK.C.CGFTNYTDFEDSPYVRENNAFPPFC........................................
Q19983_CAEEL/7-278FDTVQ...EKFE.C.CGVKTYTDWLSARWDAEPSTQLEVNEEDAGRIEHGIGAFGGNKG.....................
TSN2_MOUSE/10-214LITFH...SAFQ.C.CGKESSEQVQPT.....................................................
O44420_SCHJA/9-217MDRLQ...SRYM.C.CGATSYRDYDKAHSIP.................................................
A8XY10_CAEBR/57-274LDKLQ...TTFR.C.CGNSGCSDFRMFRQ...................................................
ROM1_BOVIN/11-293LDELQ...LRHH.C.CGRHGYKDWFGIQWVSNRYLDPNDPDVVDRIQSNVEGLYLIDG......................
Q3UFS7_MOUSE/74-318LDQVQ...LGLQ.C.CGAVSYQDWQQNLYFNCSSPGVQACSLPASCCIN...............................
Q2TCS6_BRABE/12-229IDFVQ...KNLE.C.CGMNSTSNWNPKPPSCA................................................
Q9SI56_ARATH/15-273QMNLT...PIQSGC.CKPPLSCGLNYEKPNNWTVSRYYN.........................................
Q9NB09_MANSE/12-245FDFIQ...SRLN.C.CGVDSYLDWSDVFPPTGVNGISVANISVP....................................
Q1HQ39_BOMMO/7-211FHVIE...HRFS.C.CGPTGPGSYLSLTLPNT................................................
Q16HS1_AEDAE/9-225IDYLQ...TTYG.C.CGKISFLDWGNKLPDSC................................................
TSN5_HUMAN/14-261IDFTQ...EYWQ.C.CGAFGADDWNLNIYFNCTDSNASRERCGVPFSCC...............................
TSN10_HUMAN/75-319LDQVQ...LGLR.C.CGAASYQDWQQNLYFNCSSPGVQACSLPASCCID...............................
A2ECP6_TRIVA/7-193GLKIQ...NNFS.C.CGWENATDVPD......................................................
A2FGU0_TRIVA/7-203VKGIE...KKLV.C.CGFADTTQEDASR....................................................
Q7EZC8_ORYSJ/6-199WKDVI...PVDK...TG...............................................................
Q2TCS7_BRABE/7-197RADTQ...KAFN.C.CGLYNTTTSDPKDPVCT................................................
Q6P2T9_DANRE/9-230LDSIQ...KQLK.C.CGGNSSSDWVNFSADHISVPDSCC.........................................
Q6P7J5_XENLA/7-233VDFIQ...EQLE.C.CGRKNYTDWVETDWYLNNKSLPLS.........................................
Q7K2V7_DROME/7-219MDALQ...LAFS.C.CGNTGYQQYETVPSSCCGY..............................................
Q7PTA7_ANOGA/9-220VNSIQ...QNLQ.C.CGKRSFLDYGVASFPQSC...............................................
Q9C5W7_ARATH/6-190WRDEL...PSDR...TG...............................................................
Q5D928_SCHJA/7-215FNRLQ...QHFG.C.CGALSYLDYNRQVSDL.................................................
A2G7G6_TRIVA/7-186IPEAE...TYLG...CKGWNE...........................................................
Q9NB12_DROME/7-217LSYYE...SWLQ.C.CGVNSSEDYWIIHHGIPSS..............................................
Q53GA9_HUMAN/7-234IIVFQ...EEFK.C.CGLVNGAADWGNNFQHYPELCA...........................................
Q16LT4_AEDAE/34-247INDMQ...RTLQ.C.CGFHRYTDWFEFNEDRIP...............................................
O96962_SUBDO/13-238IDAIQ...NDFD.C.CGWNNYTDYTDREEEIPTSCICDDN........................................
A1Z6T8_DROME/7-220LNTYE...EWLH.C.CGRNSAEDYLHLEKMPPPS..............................................
A2GDR3_TRIVA/7-201IKSIK...EGLE.C.CGYKTPYSEEDMKN...................................................
CD37_RAT/10-270WDYAQ...FQLR.C.CGWQSPRDWNKAQMLKANGSEELFVPCSCYNSTATNDSS..........................
Q4SA96_TETNG/3-245LDSLQ...RALD.C.CGAEGWRDWLNSDWAVQHTTFQTSENGSSVSLP................................
A2EZ30_TRIVA/7-219VKDIE...SDLE.C.CGFKTAYNAAEMANCGYQQNNTSN.........................................
Q176T5_AEDAE/20-244WNSVH...KKMM.C.CGIEGPKNWYDNNNKTMPASCCKPD........................................
LBM_DROME/7-199MDSLQ...QKHE.C.CGQSSAQDYIHLSLLIPP...............................................
Q6QSX5_ORNMO/7-221MDLMQ...VHLE.C.CGAISKHDYEVRAMTIP................................................
Q6YWS4_ORYSJ/4-277ESCMA...DAAV...CGGPLAGINPGEFYRLHLPLIQCELNTTVVSDYLCDVTTVQSGCCK...................
Q5DHT1_SCHJA/5-217FNLMH...ITFE.C.CNAEFESSLYGTNHLV.................................................
A0CWV3_PARTE/4-273DTQIQ...QAEQ.IFCSSYCQCYITEETLNRNQTAFAGKNYTTDKNVEQKIEKIQECPGYE...................
Q9NB10_MANSE/9-232FDIVQ...TDLE.C.CGIKGPEDWAAHNLTIPSTCCTG..........................................
A2DY51_TRIVA/7-217TRNIE...ILLE.C.CSFNQPTVSETVRCLADT...............................................
Q8LAM6_ARATH/4-263RSCLA...EANV...CDDLSDGRVSQIADAFYHKNLSPIQSGCCKPPSDCNFEFR.........................
Q9C7C1_ARATH/4-244RSCIL...SSKT...CTKIESWTTLDYFQRDMTSVQSGCCKPPTAC..................................
Q8AV92_PETMA/9-221LITFH...KTLS.C.CGKMVITNLLDSDFK..................................................
Q4RL59_TETNG/34-259ADYLQ...TQLM.C.CGVYNYTSWIGTPWYSSHNNTVPL.........................................
Q16HX5_AEDAE/9-218IDTIQ...ANLE.C.CGNKNRFDWGINIPQSC................................................
Q9FJN3_ARATH/7-267KSCVY...DKGA...CNDLIYGSPNEKPYNRRKMPPIKNGCCMPPETCNMDAINATFWY.....................
Q7JYY8_DROME/7-209ISLLE...QKYS.C.CGQLGAHDYILMGRGIPL...............................................
TSN11_BOVIN/15-248VDRLQ...QDFK.C.CGSNSSADWLQSSYILSPEAEGRRVPD......................................
Q86D97_SCHMA/7-231MDSIQ...RMLR.C.CGVNGYEDYRESIPIACCDH.............................................
Q4S5B5_TETNG/8-230WNTIQ...AEWR.C.CGVTGHRDWYAALHDNLVPDSC...........................................
Q5XGS2_XENLA/8-220WHMIQ...RNLQ.C.CGINGSEDWMKKELHSSCC..............................................
Q24C18_TETTS/14-278ANELF...CSEQ.CPCKVTDEDVKEYLEDTDYIIDNVNGKTKVQDCDDFKKYFSDSDV......................
TSN31_MOUSE/8-196RHELE...RSFD.C.CGLFNLTTLRLQDDTS.................................................
Q568F4_DANRE/16-258LDYVQ...EKFS.C.CGGDEYKDWEVNQYHLCDGKSPLACGVPYTCCI................................
Q22495_CAEEL/37-297IDSMQ...ETWM.C.CGINGADDWDRNTYFSIEAREVASPEAGGVPFSCCINSSKL........................
Q4RGV0_TETNG/6-216FEKLQ...RELK.C.CGLKGPSDWTKIPDSCRC...............................................
A2D8F2_TRIVA/5-200IREAE...KTLG.C.TGWPKEEENAT......................................................
Q2F647_BOMMO/7-228FSELQ...RQFE.C.CGNTGAINYGQFTLPESCCVK............................................
Q22RT6_TETTS/6-279GKSLL...CSSR.CPCDANPISFPAQVYSNFYFANNGVERLDECNNYTHKIDINFSYDYNNY..................
A8XFB8_CAEBR/15-256WDALQ...SNFK.C.CGVNGTDDAQIWKTSKWYMHQKAPKSLIPE...................................
Q3UWG5_MOUSE/9-230VKTFH...ETLN.C.CGSNALTTLTTTILRNS................................................
Q16GP3_AEDAE/9-261WNYLM...SEMH.C.CGVDDYRDFNLSDKWNESKGNRLIPEACC....................................
Q6P3H3_DANRE/8-245WDYLQ...RTMQ.C.CGWNGRMDWDENHIIKNNTVPLYPCSCHN....................................
Q7SXT2_DANRE/16-243LDRIQ...RTLQ.C.CGEENYTSWANTTYFEKEGIPKSCCNV......................................
Q86FE6_SCHJA/8-220MDAVH...VMFQ.C.CGYNGPMDYGITRVPSCC...............................................
Q4S5Y2_TETNG/9-225LDKMQ...EDLK.C.CGVNSSADWRSFALDGNSVPDSCC.........................................
Q8AV91_PETMA/9-216LSIIH...STLD.C.CGQPNLNYTSLLS....................................................
Q292W4_DROPS/7-217MDAIQ...ISME.C.CGRTNFSDYSFQGYFPPS...............................................
Q7JWP5_DROME/7-206IASLE...RWLD.C.CGNVGPSDYILPPNS..................................................
A2DRK6_TRIVA/7-225VKKVE...SSLE.C.CGFIKEYNETEMMNCGYTSNSSSTDTN......................................
A0EF92_PARTE/7-263FKSLE...KKYD.C.SGWCTPFSLQIFY....................................................
Q4D6X7_TRYCC/23-265MCSLE...LQFH.C.SGWKELCNTSNVEFMNPLIRKGNQLSLREGALGDVNT............................
Q9NB07_APIME/7-222IDFIQ...KNLQ.C.CGVHSLSDYNDKPIPASCC..............................................
CD82_HUMAN/8-256WDYVQ...AQVK.C.CGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEED...............................
Q86FC1_SCHJA/3-271VAVTS...ITLK.C.CGSKSGADFVDSTNFQPTQTFNGKTYLNSKYP.................................
RDS1_XENLA/10-290MDKLQ...MDFQ.C.CGNNHPKDWFEVQWISNRYLDFSSKEVKDRIKSNVDGRYLMDS......................
Q16HS3_AEDAE/6-221IYQFQ...ADHG.C.CGKRSFRDWLNDDGSIPTS..............................................

PF04103

Q7QF09_ANOGA/191-317--------ANLA-Q-Q.........................---------------------------------------
T176B_HUMAN/66-229--------TEPF-L-YIDTVCDR........SDPV.FPTT.---------------------------------------
M4A14_HUMAN/44-221--------DKYC-Q-MPSFEEICVFSRTLFIVLFFLPSDVT---------------------------------------
M4A10_HUMAN/59-193--------SPFE-S-P.........................---------------------------------------
Q3UAR5_MOUSE/47-204--------GSAF-P-HCNSEK............KF.LS...---------------------------------------
Q4RID0_TETNG/40-178--------KSML-T-CQVEN..............G.L....---------------------------------------
MS4A5_HUMAN/49-189--------QNYI-C-G.........................---------------------------------------
Q3LRP2_CALJA/51-216--------KLSH-F-LKMESLNL........IRAY.TPT..---------------------------------------
A7S4D6_NEMVE/20-179--------KSVL-E-CQFSEVD..........QSC.ICC..---------------------------------------
Q16GM4_AEDAE/220-341--------ANLA-Q-Q.........................---------------------------------------
MS4A3_MOUSE/27-172--------TQAF-K-G.........................---------------------------------------
CD20_MOUSE/44-210--------TLSH-F-LKMRRLEL........IQTS.KPY..---------------------------------------
Q3TPB3_MOUSE/27-182--------AHHY-S-LLAQFT............CE.T....---------------------------------------
A5WUV1_DANRE/56-184--------P...-.-..........................---------------------------------------
A5WUU6_DANRE/48-180--------PY..-T-Y.........................---------------------------------------
Q0V9M1_XENTR/36-200--------SSLE-G-CQLINFNSD.......GVCV.CCEM.---------------------------------------
FCERB_HUMAN/60-204--------LAYI-H-I.........................---------------------------------------
M4A13_MOUSE/15-152--------RSVS-Y-R.........................---------------------------------------
A2BIL3_DANRE/61-221--------SSTI-N-CQLSEQGD.........LCY.CCS..---------------------------------------
Q810P8_MOUSE/49-189--------GEFI-C-G.........................---------------------------------------
T176A_RAT/63-223--------WYYL-R-DDVCKSDT.........SYR.WST..---------------------------------------
Q4RKB8_TETNG/40-175--------QEEA-C-V.........................---------------------------------------
Q4SW16_TETNG/67-213--------RPAK-L-FCDDA.....................---------------------------------------
M4A6C_MOUSE/47-207--------HPAS-E-QCKQSK............EL.SL...---------------------------------------
Q5U4S5_XENLA/37-192--------AYHH-S-YITKFT............CH.M....---------------------------------------
T176B_MOUSE/60-224--------TSVP-Y-YVEIFSTCN.......PLQS.SMDP.---------------------------------------
M4A6B_MOUSE/47-204--------HPAS-E-QCLQSK.............E.L....---------------------------------------
A2RRW5_DANRE/53-183--------SIH.-Y-Y.........................---------------------------------------
Q5R1M8_FELCA/51-217--------AISH-F-FKMENLNL........LKSP.KPYI.---------------------------------------
Q4RKB7_TETNG/24-169--------PKTV-C-PLI.......................---------------------------------------
M4A8A_MOUSE/87-225--------SGYI-Y-P.........................---------------------------------------
Q95PZ5_CAEEL/94-253--------GTYH-H-PRIDRDEA.........FCL.LGT..---------------------------------------
Q1LVQ8_DANRE/42-197--------CYHY-T-LTNSFS............CR.E....---------------------------------------
Q17QX1_BOVIN/51-216--------TISH-F-FKMENLNL........IKTQ.VPY..---------------------------------------
A5WUV2_DANRE/56-191--------PTN.-R-Y.........................---------------------------------------
Q29RT3_BOVIN/44-181--------HKYC-H-G.........................---------------------------------------
Q58DM5_BOVIN/48-208--------RTAS-Q-QCDSGR............DY.LS...---------------------------------------
A3KNL7_DANRE/59-198--------QFY.-G-Y.........................---------------------------------------
Q8MJ38_PIG/60-203--------SSYA-S-N.........................---------------------------------------
M4A15_MOUSE/76-198--------NWDV-.-..........................---------------------------------------
A5PMI8_DANRE/61-210--------DNYH-C-NYSG......................---------------------------------------
A6H741_BOVIN/62-223--------YDGF-Y-DISSVCDS.........LVP.VTP..---------------------------------------
Q4JF27_HUMAN/46-188--------SFHH-P-Y.........................---------------------------------------
Q5BLB6_DANRE/53-183--------RII.-S-Q.........................---------------------------------------
Q5M796_XENTR/47-192--------HYYR-A-HQA.......................---------------------------------------
M4A6D_MOUSE/47-207--------EPAL-Q-QCKLAF............TQ.LD...---------------------------------------
Q4SZQ8_TETNG/34-173--------PSYC-W-Y.........................---------------------------------------
Q4TAI3_TETNG/57-208--------YIRW-I-CERDY.....................---------------------------------------
Q567H8_DANRE/59-196--------PFSP-R-Y.........................---------------------------------------
MS4A3_HUMAN/50-196--------IQSL-R-S.........................---------------------------------------
A7E2J6_DANRE/50-185--------PVF.-G-F.........................---------------------------------------
FCERB_MOUSE/52-195--------FAYM-N-N.........................---------------------------------------
Q4S7F2_TETNG/34-189--------GHHY-S-QASGFS............CG.P....---------------------------------------
Q08BU9_DANRE/43-180--------ERQD-E-Y.........................---------------------------------------
Q5BLA7_DANRE/16-153--------EEDD-E-I.........................---------------------------------------
MS4A7_HUMAN/47-207--------RTAS-Q-HCGSEM............DY.LS...---------------------------------------
T176A_HUMAN/56-214--------YSYY-N-SACRISS..........SSD.WN...---------------------------------------
Q0P3U8_DANRE/59-198--------PLY.-L-Y.........................---------------------------------------
Q80WF0_RAT/44-182--------HKFC-H-I.........................---------------------------------------
M4A10_MOUSE/56-190--------GPFP-W-P.........................---------------------------------------
CD20_CANFA/51-216--------TISH-F-FKMENLNL........IKAP.MPY..---------------------------------------
M4A12_HUMAN/90-225--------GVAG-Q-D.........................---------------------------------------
Q9EQY9_MOUSE/43-171--------SQVP-I-R.........................---------------------------------------
A7SQ32_NEMVE/7-164--------FKFE-S-SINREY.............Y.I....---------------------------------------
M4A8B_HUMAN/71-207--------HPYA-Y-P.........................---------------------------------------
M4A4D_MOUSE/43-170--------VFRQ-F-R.........................---------------------------------------
A3KNQ4_DANRE/48-184--------RWMV-W-F.........................---------------------------------------
Q9GYM6_CAEEL/45-206--------YQHE-C-WGECDWH..........LLA.TSF..---------------------------------------
A5PM84_DANRE/63-199--------ISPS-C-D.........................---------------------------------------
Q3T128_BOVIN/66-204--------STYI-Y-P.........................---------------------------------------
A0JMW7_XENLA/42-205--------SSVP-S-CQLVELIE........GKVC.VCCE.---------------------------------------
Q9ES61_MOUSE/43-171--------SQFP-F-R.........................---------------------------------------
Q28GK5_XENTR/3-141--------EDDD-D-I.........................---------------------------------------
F189B_MOUSE/36-196--------RDFR-E-CSMEGKVC.........VCC.PPI..---------------------------------------
T176B_RAT/60-224--------TSAS-Y-YFEISSTCD.......SLQP.SIVD.---------------------------------------
Q2KII2_BOVIN/49-189--------RDFL-C-G.........................---------------------------------------
Q1LX35_DANRE/59-175--------GHAT-P-Q.........................---------------------------------------
M4A18_BOVIN/154-273--------PVID-.-..........................---------------------------------------
Q567A9_DANRE/32-162--------RIV.-T-R.........................---------------------------------------
T176A_BOVIN/63-220--------HFIF-Y-KGICNVS...........PS.WR...---------------------------------------

PF13273

D7UXS6_LISGR/3-100--------...G--------------------------------------------------------------------
C2RQC7_BACCE/10-90--------..VN--------------------------------------------------------------------
C3AKH5_BACMY/2-83--------..VN--------------------------------------------------------------------
Q2B2X7_9BACI/2-86--------..MN--------------------------------------------------------------------
C9B7Y0_ENTFC/3-104--------...N--------------------------------------------------------------------
C7DIS7_9EURY/29-132--------...Q--------------------------------------------------------------------
D7DCC0_STAHD/4-91--------IPSK--------------------------------------------------------------------
A0B9F9_METTP/2-84--------...N--------------------------------------------------------------------
Q12UE5_METBU/2-98--------...D--------------------------------------------------------------------
B9DJA4_STACT/148-230--------...N--------------------------------------------------------------------
C4WAZ9_STAWA/11-93--------...K--------------------------------------------------------------------
Q4L9M4_STAHJ/13-95--------...R--------------------------------------------------------------------
A5UKZ4_METS3/8-83--------...D--------------------------------------------------------------------
A5N2M2_CLOK5/4-86--------...K--------------------------------------------------------------------
Q97LL2_CLOAB/4-86--------...K--------------------------------------------------------------------
A9VVN7_BACWK/2-84--------...K--------------------------------------------------------------------
B3ZH23_BACCE/2-84--------...N--------------------------------------------------------------------
C3BEA6_BACMY/2-84--------...K--------------------------------------------------------------------
Q4V1S6_BACCZ/2-84--------...K--------------------------------------------------------------------
D4FV71_BACNA/2-84--------...K--------------------------------------------------------------------
C2VWU6_BACCE/24-113--------...K--------------------------------------------------------------------
C2U6N9_BACCE/2-85--------...A--------------------------------------------------------------------
A5UL06_METS3/42-117--------...N--------------------------------------------------------------------
O26620_METTH/8-82--------...N--------------------------------------------------------------------
C8JWL3_LISMN/13-93--------...H--------------------------------------------------------------------
D7V0U0_LISGR/3-121--------...K--------------------------------------------------------------------
C8JTX3_LISMN/3-121--------...K--------------------------------------------------------------------
D3KN98_LISMN/3-121--------...K--------------------------------------------------------------------
Q92D69_LISIN/3-121--------...N--------------------------------------------------------------------
D3ULL7_LISSS/3-121--------...K--------------------------------------------------------------------
A8FJ46_BACP2/3-107--------..RR--------------------------------------------------------------------
B4AK11_BACPU/3-107--------..RR--------------------------------------------------------------------
C2H7S4_ENTFC/2-107--------...K--------------------------------------------------------------------
C9ATK3_ENTFC/2-107--------...K--------------------------------------------------------------------
E6TU87_BACCJ/2-115--------..NK--------------------------------------------------------------------
B9CUN6_STACP/3-110--------...K--------------------------------------------------------------------
C5QNE2_STAEP/3-110--------...K--------------------------------------------------------------------
C2LZ67_STAHO/18-125--------...K--------------------------------------------------------------------
Q4L9F8_STAHJ/19-126--------...K--------------------------------------------------------------------
C4WCX0_STAWA/2-110--------...K--------------------------------------------------------------------
Q4A0V3_STAS1/2-109--------...K--------------------------------------------------------------------
C5QZN6_STAEP/3-109--------...N--------------------------------------------------------------------
D3QGJ5_STALH/3-111--------...R--------------------------------------------------------------------
D3QGJ6_STALH/3-111--------...H--------------------------------------------------------------------
Q4A0E9_STAS1/2-112--------...L--------------------------------------------------------------------
C5NV51_9BACL/5-120--------....--------------------------------------------------------------------
C5NWK3_9BACL/5-118--------...R--------------------------------------------------------------------
Q49WN0_STAS1/2-102--------...N--------------------------------------------------------------------
Q8ERL5_OCEIH/2-100--------...N--------------------------------------------------------------------
A7A3G5_BIFAD/15-115--------.LAP--------------------------------------------------------------------

PF00335

TSN15_MOUSE/19-259...............................RNTTDVVNTMCGYKTIDKERLNAQNIIHVRGCTNAVL...IWFM.DN..
Q29BB1_DROPS/7-204.........................................CELVNRKCCEQSNDVDCHCPACGPMLE...DKID.YA..
TSPC_DICDI/14-226.............................................DLCPKDDDGNIKYEDTYCEGIFT...KQVS.SK..
TSN33_MOUSE/21-264.............................LPTPNQAVINTMCGQGMQALDYLEASKVIYTNGCIDKLV...NWIH.SN..
Q9VMJ6_DROME/18-261.............................CRRRPQEVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGE...DWLE.AH..
Q7QJ21_ANOGA/9-222..............................................PWSCYDPIDTKVFNTGCMHVFV...KSIE.MN..
Q7Q8G1_ANOGA/14-231..........................................PETCCAAPPVNGECMPREYGCYSRLS...WLIS.QG..
Q84WF6_ARATH/4-245................................VYNTDTVIQQDPDCYRWNNAATVLCYDCDTCRAGVL...ETVR.RD..
TSPE_DICDI/16-219...................................................HFNRRESGHGYCAPYVE...KSVE.SI..
Q16LT3_AEDAE/14-239.......................................FVVPESCCPPSTLKESCIPYEYGCMDRLQ...WVVA.QS..
Q5C164_SCHJA/7-207...................................................RPPSCNKYNEGCIGKVT...DLTK.KH..
Q8SU08_ENCCU/10-189.....................................................GSSCGGSDGCVDAVY...KLSKSTA..
Q9W4X6_DROME/42-295............................NATDISSGLVNIMCGYGVQNAPVPEATKLIWTSGCIEIVR...VWAE.HN..
Q9NB13_DROME/7-221..........................................GYLDRQATCNTPSVYQSRPGCSAKFE...EFWN.DN..
Q6DCP2_XENLA/9-233.......................................CCKNITAGCGKAPFPPNSINTDGCANGID...QWVK.KN..
Q6GLY9_XENLA/10-290.....................VPFSCCNPNSPRPCIQYQITNNTAHYNYDFLTEELNIWTQGCREALL...GYYD.EL..
Q8SY17_DROME/7-219..............................................SCCSGSCLIPTNYYPGCRGKFV...ELMT.TG..
Q1EC46_DROME/7-202...............................................PSSCYDQNDTPYRDGCLAKME...TQYE.EL..
TSPD_DICDI/11-224................................................PQDDQKNILYNGTFCYDVIF...GAVN.SK..
A2FKF6_TRIVA/7-185..........................................................SSGSCKPLVQ...KLMKKVS..
A2DWZ1_TRIVA/7-204..................................................CGFQPSYENTTTCRQLVV...DKIN.AN..
Q4DD38_TRYCC/86-309...........................................WVDAVCPLCPSFPPMSPVVCTDVVY...STVR.KN..
TSN16_HUMAN/10-243......................................CCKSIGSVSCDGRDVSPNVIHQKGCFHKLL...KITK.TQ..
Q5KAR0_CRYNJ/191-384...................................................PLCYSRSNFPGCKS......QYLRLERRV
TSN32_HUMAN/9-229.................................................ADLCQGEEAAREDCLQGIR...SFLRTHQQV
Q9V3X2_DROME/9-261............................PESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLI...EIIY.EN..
TSPB_DICDI/14-224.................................................PKDSKGIPKYTDTCDSVIS...SKIS.SN..
Q9VID1_DROME/8-228.........................................CSVINLSEAKECTNTHATQHGCLQKLL...EILD.SK..
Q64HX8_ONCMY/9-234.......................................CINVTAGCGQGAMGDALKIHQTGCETVVE...KLLK.KN..
Q29IZ2_DROPS/18-232...............................................SSCRDTVSGNAFFNGCVDELT...WFFE.GK..
Q1HRC5_AEDAE/13-234..........................................FTDYKPCQDHPTPENIYIQGCLDITS...NLIR.DN..
TS31A_XENLA/8-198...............................................ALCSHVCPDPHKCLSCGDKML...NHAD.EA..
Q17441_CAEEL/23-259.................................YIPDSCCKSTHQRKGCALSDSPNNIFYRGCLPFLK...EEVY.NN..
Q5DG31_SCHJA/16-308...........NFFELQMKNDVFLDRETCIGYKSLATRDDTAPRIDNPAYITRSNTYLYEKGCVSVVK...QEYQ.KY..
Q2TCS3_BRABE/7-240......................................DPAIRNRECVPHDDNGNQVYVYKPCVDEFS...AFVG.KY..
Q2TCS2_BRABE/9-231............................................TVGDADTCDAATGRWKKPCDEEVI...NNLN.KN..
Q9ZUN5_ARATH/3-256...........................FVNPTLWLNPTNMAADADCYLWSNDQSQLCYNCNSCKAGLL...GNLR.KE..
TSPA_DICDI/14-224.................................................PKDGDKIKYEGHYCGEALS...DQFS.SK..
IM23_SCHMA/10-212.................................................ASCKEENLTYTEGCVSVFG...AFLK.RN..
Q29JV0_DROPS/10-238......................................PVGAAGTFSCFNNFTSEGVRHTYGCLDGFS...NYIA.SH..
Q6GP84_XENLA/8-227...........................................CAEHSPACKSNPSLWWQDACYNKVR...KWVE.TN..
Q5DB78_SCHJA/24-277............................QMNNININVINTSCGFGVQKSTTAVASRLVWTTGCVQALI...NVVE.SN..
A0BI34_PARTE/7-267..................................................DVNSNVKNHNYPCYKGMI...EYFQ.NM..
Q5GM22_TAESO/9-219...............................................CGKESGSCTSPYQTGCAEAMY...NEMK.DS..
Q9XVI4_CAEEL/8-223............................................IEEIEGCARENAPLFEPGCIHSVE...QWVL.KN..
A2G3J8_TRIVA/7-186..........................................................SNGSCKTLIE...DKVKKFA..
A2EZ33_TRIVA/7-201.................................................CGYQPTNSSNIETCYNKID...EKLK.KS..
Q5DH84_SCHJA/4-271..............................CCKMNDKLKLIDTNCPLTNYATDNDKAHHTKGCKEPFG...QKAF.RY..
Q60D82_BRAOL/4-254............................ATWWTVPATSTAEIKEDCKTWSNTQSQLCYSCETCKVGVY...KGIR.KR..
Q4RYD3_TETNG/10-300................YLMDGVPFSCCNPSSPRPCIQAQMTNNSAHYSYDHYTEELNVWRRGCREALL...SYYG.GM..
Q24C21_TETTS/14-285...................DVKNQANWLQSLEDSFDCTGMCKKPANIYFFSDINNGIPDNDTCKEKFQ...DFVQ.SY..
A2DI21_TRIVA/15-204....................................................LPCPGSSTKPCMKELTSLYNRIK.RI..
Q6GNW4_XENLA/9-244.....................................MTNQTSSNGFCEYKGSLESAVYKAGCMQGVE...SWLQ.DN..
Q4SU90_TETNG/14-272......................................SFSDCSYADLKNSTLAARKVHKQGCYQLVT...SFIE.RN..
Q2TCR9_BRABE/6-237......................................VNQYDWTEKCQEDRNDRTQSVYKSCWDNIS...LWLK.NH..
Q7T376_DANRE/6-213.................................................SCNISGTSNWHKGCFKLLE...NSFE.SN..
Q7JZW7_DROME/7-210.............................................CFHTKDGIHALYPYGEGCMAAVK...RAYL.QI..
Q4PLY6_IXOSC/9-219..............................................ENKPTTCDAAHAYKITCIDALI...NKFK.EK..
Q2TCS4_BRABE/9-233...........................................QYCRNYYPTPQSSCSIFRPCLFEFE...IYLK.KN..
A1Z8K7_DROME/8-233......................................YIDSTVGHCLESPALGKDKYFQVGCVGKLK...DRIE.KN..
A1Z6U3_DROME/7-206.............................................PSCYPQEDPQMPHYLAGCVQKSS...ENFVVLFSY
Q5DH43_SCHJA/12-223................................................SCTVSKSIQTYSRGCHEVLV...EACR.SN..
TSN12_HUMAN/9-249........................................REFPGCSKQAHQEDLSDLYQEGCGKKMY...SFLR.GTKQ
Q7Q1S3_ANOGA/9-239.....................................CRQQTGAVGYVACPDPTSATLRKTGCIDSFG...DFIK.AH..
Q5PQ10_XENLA/8-231.......................................CCNETFTSCNGNITETKEFYQEGCFEKLH...SRLN.YF..
O44582_CAEEL/29-290......................ISEAAGSSNPLLPAMRSLECWQNALTKRPGDLEHDIYTRGCLQPLR...TLFESHA..
Q06AT4_PIG/10-258..................................CCVMNKLKEPLNLEACKLGVPGYYHNQGCYELIS...GPMN.RH..
Q6DDY1_XENLA/6-239........................................CCNSTSNVVCTELSAMGAKISGCFDQLL...YLIR.KN..
Q9UAI4_DROME/9-228............................................SRPEHAYESACDTHYKRGCLAVVS...EQIR.NR..
Q503H8_DANRE/10-204......................................................TCTEGNKDCVQAIE...DFFN.EK..
Q5BL96_DANRE/12-254.............................IRQKNETVFNSMCGYETQKMKKSLAGRLIYTSGCLDEMV...WWGQ.QN..
Q292V6_DROPS/9-211............................................SCCFAFDCSNPTNVFQQGCATKAN...ENLK.MQ..
Q16TV5_AEDAE/8-254.................................SLMMEGSGDDLHSVDCRKAGDPSLLWDKSCGQILQ...MWFV.QR..
Q7K527_DROME/7-213...........................................SSCCKDDSCVNPLNLYVRGCLIKVE...EAFA.DE..
A8WRV5_CAEBR/9-230.................................................PTSCQCATLSQQGCATLFW...NAFQ.TN..
Q5ZII8_CHICK/15-247.....................................DSCCKTITVLCGRRDHPSNIYKENGCITKLE...NFIQ.EH..
TSN14_HUMAN/14-261.............................VPDPAQKVVNTQCGYDVRIQLKSKWDESIFTKGCIQALE...SWLP.RN..
Q2TCR8_BRABE/9-244..................................NAKTEFDVKNPDDTCGEGADTTKINTEGCLLKLE...GWLA.QN..
Q2TCS8_BRABE/8-228.............................................ASVSTTSICTGGNYNQPCKTAII...SFLA.EK..
Q86FE8_SCHJA/7-285.........................CQYSKKDFIKTGDYQSFNKYLRDENCVKAYPESNTVGCLAKVR...ENIQ.....
A1Z6U7_DROME/7-216.............................................CYQAAVNDTAQQIYPSGCLETLNRSQRYIQ.HRDK
Q6GQE5_XENLA/9-221................................................PNKQGILNILAARSCPDVID...EVFT.SK..
Q9U2K6_CAEEL/7-216......................................................NCFAGQPTCSSAVW...DRLD.FT..
Q8MS10_DROME/8-256................................RQVLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQ...SWFT.GQ..
Q29JV1_DROPS/14-246...................................PNSCCGGLAQDINDASQVTCLDTFDYGCFRKMN...FIIS.QS..
Q6Z5Z9_ORYSJ/5-263...........................NETYWIKPPTPSNYSDPDCNSWSNDQSELCYGCQSCKAGVL...GNLR.SS..
Q4RSA5_TETNG/8-245...................................ESLPGSDIRPVGLCEHLSTDLPVYETGCITNVE...KWLL.EN..
Q6NYK2_DANRE/10-290.....................VPFSCCNPSSPRPCIQYKITNDSAHYNYEHETEELNLFIHGCREALV...NYFM.GL..
Q6DDY2_XENLA/8-252..................................CCQRDSNFQIINQQGCVVGLKSYVYQQGCFDHIS...NAIN.SY..
Q0V996_XENTR/6-236.........................................PVCCANISPCQKYKIDPDVKGCLAAFE...HFFS.RN..
Q5DDB8_SCHJA/7-215................................................PHSCQYLMTGFKRGCIEALT...EWVQ.RY..
Q4T8J0_TETNG/8-244...................................ISTAAGNASDSGFCEAPTPDWPVYEAGCAASVE...RWVL.TN..
CD63_MOUSE/9-231........................................CCINITVGCGNDFKESTIHTQGCVETIA...IWLR.KN..
Q6P0W1_DANRE/7-218.................................................PDGNILKQLTFPSCPSVIK...DVFN.SNAP
TSP1_CAEEL/7-221....................................................YCGPMSQKPHCDVAVF...DSVD.NT..
Q1L9G8_DANRE/9-220.................................................PKQEGLANVITTGCSSVIQ...DMFN.SR..
Q16J92_AEDAE/9-260...........................PESCCVEGLSAAECNNARTKGLITSIIKDDIYSDGCMEKLV...NEIK.KN..
Q29D35_DROPS/9-259..................................LKDVAALVPRDEDCVTNPSDSNSFYKKGCYEVFT...EWLI.GQ..
Q3ZLC3_OREMO/6-225.........................................TKSATPAPGAECGSEGYYSTPCSTRII...NLMK.EN..
Q75IM5_ORYSJ/6-249................................YSGGVAVGAQDEDCFRWNNAAGILCYGCESCRAGVM...EKVR.ED..
Q16LT5_AEDAE/17-240........................................AELPASCCREYLDGECVPFNTGCFQKMY...ALLRHCS..
A2G0G6_TRIVA/19-208....................................................LPCPHGAEEGCIVQITKLMTTIK.NA..
Q5DGI2_SCHJA/10-219...............................................SSCTDSDTGLAYQEGCSNKII...AFFE.KY..
Q7JWV7_DROME/7-218.............................................SPSNGTCALTQVMTRSSCLKAVD...SFWD.TN..
Q9FVY6_ORYSJ/5-257...........................VNASYFDLSYHPVSTNVDCKLYKNARSVLCYDCDSCKAGVA...QYMK.TE..
A2AGS8_MOUSE/8-247.................................RREPQTRDGVVLSREECQLGRNPFINKQGCYTVIL...NTFE.TY..
Q6INJ9_XENLA/8-187....................................................GATCTQGCQPCAPIIE...RHAE.EV..
CD53_MOUSE/8-210..................................................PSSCPSGADVQGCYNKAK...SWFH.SN..
A8X5P0_CAEBR/7-223.................................................GLCGPKPIAYPDNCFDRIS...HMVQ.SW..
Q86FA1_SCHJA/5-268................................SCCKMDSKFVILDPTCPGEFNAHNSNIHQGCWPKLR...PVIG.....
A1Z6U8_DROME/7-209.............................................CYFNQNATVTTDLYTVGCNHQLA............
TSN6_BOVIN/16-237.........................................SCCKLEDCSPQRDADKVNNEGCFIMVM...TIIE.SE..
Q6Z6K0_ORYSJ/3-259..........................YVSPTVWAGPAARPAADADCGAWGNDPSQLCYECESCRAGLL...AALR.AQ..
Q4SM43_TETNG/8-236......................................SCCKYSVGSCTGSLTHPGDLYQEGCEALVV...KKLR.EI..
Q0QBV5_HELTB/11-271........................FEDKYTIISGGYWPTPVNISNCMGIQGSLSNSTLNTGGCYNAFQ...DFVT.SQ..
Q5DFJ8_SCHJA/7-215..............................................SYPNSCKHDTLLFPKGCISVLN...EFVQ.KY..
Q6DHQ4_DANRE/8-230..........................................CLEYSDNCGLENPGTWWTAPCYERVK...GWLQ.EN..
Q245V1_TETTS/9-275...................IGNLSDLTKLLGYVETSFDCSGFCSKQPIYYFSNSYKGQPTKDCKLELL...NFLD.TS..
Q5DHJ8_SCHJA/10-217................................................PPSCRVGDLTYATGCIEEVV...GFAQ.YQ..
Q24FE3_TETTS/5-264......................QSENSEVLKFLEELFGCSGFCSQNSYYLFSDLNDGIPNGDCKVHVI...NFVEDNI..
Q4T2B0_TETNG/10-333AVLCPHSRLRSNVGGRYLVDQVPFSCCSTFSPRPCIQQQVSDASAHFNYDRLSQRLNLWTRGCREALM...EHYT.GI..
Q2TCS0_BRABE/9-233...........................................PISAINQCETATCGRVYKPCVDKLN...QFLA.DN..
Q6Z8Q8_ORYSJ/5-259...........................GGGTRWGKTARLSSADPDCDEWSNDADEVCYGCRSCKAGVV...AALK.RD..
Q6W8Q0_BRABE/9-238........................................SDDVHDGDKGVCDTTSGRWAKPCDNKIL...DNLR.GA..
Q0V9E6_XENTR/12-237.......................................CRKVTPKCGEKVMAHQDNIFLEGCVIKMK...MWIS.QH..
TSN8_BOVIN/7-235.........................................CPSESDSSCTKYSGKTIYKQSCFASIS...QMFS.KR..
Q4D693_TRYCC/53-289...............................TTLDPNTLQPVSWPSLTCAPRCNSSNIYNATCKEPLQ...EFFM.NLFP
Q5I0R1_XENTR/7-227..........................................TTSRTNNCIYFAGKNYYKETCLGVIS...DFFK.NH..
Q24FE4_TETTS/5-254......................QDQNAEFLKSLEETFQCSGFCSKNSYYVFSNVNQGIPNKDCKDEMI...NYLEDKT..
Q9M0B7_ARATH/4-258..........................TYITSTTWNKTSGTHKNSDCQLWDNEKHKLCYNCKACKAGFL...DNLK.AA..
A0BP70_PARTE/7-282...................................................SDVNAGTPKDHCYGAIT...GYAK.DI..
Q7K010_DROME/6-211.............................................CFRNHDKSKPENLIHTGCRVEFE...NYWQ.HL..
Q67WQ6_ORYSJ/4-259..........................VSETVWTKPSGFNSTDDPDCTTWSNDQTALCYDCQSCKAGVL...ANLK.ND..
TSN1_MACFA/6-239......................................CNNVTNTVNETCTKEKADNQKVEGCFQQLL...YDIR.TN..
Q19983_CAEEL/7-278...................TGYGRVPSSCCNEHGKLSYPNNCGRSFSQAPLNTYAQFINTRGCADAVY...ESVS.SS..
TSN2_MOUSE/10-214....................................................CPKELPGHKNCIDKIE...TVIS.AK..
O44420_SCHJA/9-217................................................PFSCLTGYLVYSRGCAEAIN...SHLQ.RY..
A8XY10_CAEBR/57-274..................................................DIPRSCDIRCDGCHFRIM...IALR.IG..
ROM1_BOVIN/11-293.....................VPFSCCNPHSPRPCLQSQLSDPHAHPLFDPRQPNLNLWSQGCHEVLL...GHLQ.GL..
Q3UFS7_MOUSE/74-318..............................PQEDGAVVNTQCGFGALGLDQNVAGQVVFLQGCWPALQ...EWLR.GN..
Q2TCS6_BRABE/12-229..............................................CTKTVSHCVGGNWNRACNVQVR...MFLM.NS..
Q9SI56_ARATH/15-273........................................NLEVDCKRWNNSADTLCFDCDSCKAVII...ADVH.NT..
Q9NB09_MANSE/12-245...................................NSCCAESRFEIVDNTQIDECVKLYANGCLPRVF...YLVY.QS..
Q1HQ39_BOMMO/7-211...............................................CCSTTPCTVINAYAGCTEVLQ...ALFN.NY..
Q16HS1_AEDAE/9-225..............................................CADGQRGPNCVPFKEGCERMLE...GYIR.QT..
TSN5_HUMAN/14-261.............................TKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFE...KWLQ.DN..
TSN10_HUMAN/75-319..............................PREDGASVNDQCGFGVLRLDADAAQRVVYLEGCGPPLR...RWLR.AN..
A2ECP6_TRIVA/7-193.....................................................ELSCTGNYSCKPAIT...KVINRVTLS
A2FGU0_TRIVA/7-203..................................................CASNNVTNYDSSCETKIV...AQITKYK..
Q7EZC8_ORYSJ/6-199..............................................................NFDMMY...SFLK.EN..
Q2TCS7_BRABE/7-197...............................................SLPCAKDSGPPGCPSCMQKLL...PTIG.TA..
Q6P2T9_DANRE/9-230........................................KNVTKNCGIGAMTKPTVIYLEGCQPILE...TRIK.EN..
Q6P7J5_XENLA/7-233.......................................CCKKNAQDCQLVIGQINDIYTEACEPKLE...TLIH.QV..
Q7K2V7_DROME/7-219.............................................KDRTKVCEAEIYSQRPGCRQEFV...DFWA.SN..
Q7PTA7_ANOGA/9-220..............................................CSSGGTAPLCVPFASGCLSRLS...EFLD.SA..
Q9C5W7_ARATH/6-190..............................................................NFDTIY...NFLR.EN..
Q5D928_SCHJA/7-215................................................PSTCKVKTLVYAQGCVQAII...EYIH.PY..
A2G7G6_TRIVA/7-186.........................................................SNETTCYGKLN...TLIKKYA..
Q9NB12_DROME/7-217............................................CCPESKCMDTPSRVFKTGCKAAFV...KYLD.DK..
Q53GA9_HUMAN/7-234..........................................CLDKQRPCQSYNGKQVYKETCISFIK...DFLA.KN..
Q16LT4_AEDAE/34-247.............................................SSCFASLEEGSTPFQQGCFNRMS...QVISYVV..
O96962_SUBDO/13-238.......................................DGDGNKCIPISEMGVNSTVYTDGCRDSFV...DFPR.EY..
A1Z6T8_DROME/7-220.............................................CCLNRDCTKHLNLFMTGCEVKFK...EYVG.AK..
A2GDR3_TRIVA/7-201.................................................CGYHNTTATTIETCTQQVD...DLIK.AW..
CD37_RAT/10-270........................GFDKLFLSQLSRLGPRAKLRQTADICALPAKAHIYREGCARSLQ...KWLH.NN..
Q4SA96_TETNG/3-245..............................DSCCVRRKGCKNRPLMSDDNEGVAAAGIHPHGCFRKVF...SLVN.DN..
A2EZ30_TRIVA/7-219........................................STDNNITDTNSTENNTTGNVQTCYNKID...ENLN.KS..
Q176T5_AEDAE/20-244......................................LIDPDTNDCKNAPPLFMDRYYQDGCLMKLK...EHFD.KN..
LBM_DROME/7-199.............................................SCYADLQQTPDHLYLDGCIEKVQ...SFYESDK..
Q6QSX5_ORNMO/7-221...............................................QSCSSSRTNNIFIYGCSENLR...VLLE.RT..
Q6YWS4_ORYSJ/4-277.................PPVYCGYERVNETFWIAPARGLDAADVDCLEWSNDQAVLCFRCNACKASAL...DTVR.RN..
Q5DHT1_SCHJA/5-217................................................PESCTHGIEFYKQRCNVPLN...KYVR.YY..
A0CWV3_PARTE/4-273..................VNAYSAAVSLLGTAEQLLNCAGWCTPAPYYIFSDINDDSFNGESCFIETK...HFVE.SS..
Q9NB10_MANSE/9-232........................................IEINNSMAAQCTSSSPGFHSEGCLDKLV...THFK.DI..
A2DY51_TRIVA/7-217.............................................SSPYNKETDVAKASTTGCYDAIK...GKVK.KN..
Q8LAM6_ARATH/4-263........................NATFWIPPSKNETAVAAENGDCGTWSNVQTELCFNCNACKAGVL...TNIR.EK..
Q9C7C1_ARATH/4-244.................................TYEAGVVDGGGDCFRWNNGVEMLCYECDACKAGVL...EEIR.LD..
Q8AV92_PETMA/9-221................................................DICPTQKITDPTVDCIRQID...EIFT.SK..
Q4RL59_TETNG/34-259.......................................SCCKNATGCSGRLDQLDLLNLQGCETELD...RLFQ.GV..
Q16HX5_AEDAE/9-218...............................................CRTGTAPGCVFFVEGCQSRIG...EFID.TA..
Q9FJN3_ARATH/7-267...................RRKDEGPPSSMNLMYGDEMMVGRISDCQLWRNDWSILCYDCRSCKFGFI...RSVR.RK..
Q7JYY8_DROME/7-209.............................................SCYKDQERREYSLFSGGCLQAVQ...AHAT.DN..
TSN11_BOVIN/15-248.....................................SCCKTVVARCGQRAHPSNIYKVEGGCISKLE...QFLA.DH..
Q86D97_SCHMA/7-231...........................................HVSTCLNALLSPEEVYKEGCKDKYK...VMLK.DK..
Q4S5B5_TETNG/8-230..........................................CQLPFQGCGRNSSNTFWTRGCYEKVE...AWLD.EN..
Q5XGS2_XENLA/8-220.............................................PSKTNSNCSLSDSFPVGCSEALK...KWFE.NN..
Q24C18_TETTS/14-278.....................NDSVDWVESLEDTFDCTGMCTKPLNIYFFSNINRGIPDTETCRVKFQ...NFVS.SY..
TSN31_MOUSE/8-196................................................CSAVCKTKSSTCQMCGERFL...KHSD.KA..
Q568F4_DANRE/16-258..............................RQSVGEVVNTLCGYKTLHQQREALDGVIHVRGCIHAVN...LWMG.DN..
Q22495_CAEEL/37-297.......................EFKNYFCGHGVRLKPESHMAAHLAAQRVMAHTASIYTEGCLPKLQ...LWLN.NN..
Q4RGV0_TETNG/6-216..............................................NTTEPDCPSSKIYQSNCIDKTA...EWMK.SN..
A2D8F2_TRIVA/5-200.....................................................NETNSSTKTCKDTIQ...GGFK.K...
Q2F647_BOMMO/7-228..........................................KSILSTFAGNNCTVDAANPGCGPKIG...ELYQ.KW..
Q22RT6_TETTS/6-279.................NDYLRNLVNLLRTAEESFNCSGFCSTNSYYVFRNINDGTPSAGKDCKEEFL...NFISKNI..
A8XFB8_CAEBR/15-256..................................SCCIPSEIDRCRSNPFDSGSPAPYYTNTCYEPLQ...NDLL.HV..
Q3UWG5_MOUSE/9-230..............................................LCPSGGNILTPLLQQDCHQKID...ELFS.GK..
Q16GP3_AEDAE/9-261...................................MQTSLFELLDKNCPVSPSESNSYYKKGCYNALI...DWIM.YN..
Q6P3H3_DANRE/8-245...................................YSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVG...SWLF.TN..
Q7SXT2_DANRE/16-243.....................................TASVNCTSAELKDLKKADSVVYHQGCFSLMS...TTME.AN..
Q86FE6_SCHJA/8-220.............................................LNGECAMEYALLSFKTGCKERID...NIMH..N..
Q4S5Y2_TETNG/9-225........................................INVTKDCGKNKMTDGSVVYLKGCHDAVV...EFLK.KN..
Q8AV91_PETMA/9-216...................................................TYSCPPEYTKNCVDEIR...SFLG.TK..
Q292W4_DROPS/7-217.............................................CCKDTNNCRPDTVYRRGCKAAFV...EFWD.RN..
Q7JWP5_DROME/7-206.................................................CYNGESDKLNLEGCRQKFL...DFIA.DR..
A2DRK6_TRIVA/7-225.....................................SSENKTANAETNTTETNSTDSTIETCYNKVN...DKLT.KS..
A0EF92_PARTE/7-263..................................................DINHKFDESNNQCLLSSQ...QQIY.DT..
Q4D6X7_TRYCC/23-265...........................AEMLPHTSNNNSDSKIICPTCSEEDQKEINGYNVTCESVVM...GKIK.EH..
Q9NB07_APIME/7-222.............................................NSPENNTCSISNSYTNGCVEALK...DTVK.LA..
CD82_HUMAN/8-256..............................NSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQ...AWLQ.EN..
Q86FC1_SCHJA/3-271...............................PFCCKFNFFIVIADETCPSEFNAQNSNIANGCVEELK...NVIS.QY..
RDS1_XENLA/10-290.....................VPFSCCNPSSPRPCIQMQITNNSAHYSYNYQSDELNIWVRGCREALL...SYYT.GI..
Q16HS3_AEDAE/6-221.............................................CCIEGSNDHSCRSFAEGCVQILE...RYVS.HI..

PF04103

Q7QF09_ANOGA/191-317---------------------------------------------..............DEVSQTLLI---WG.....--
T176B_HUMAN/66-229---------------------------------------------GYRWMRRSQENQWQKEECRAYMQ---ML....R--
M4A14_HUMAN/44-221---------------------------------------------QNSEQPAPEENDQLQFVLQEEFS---SD....D--
M4A10_HUMAN/59-193---------------------------------------------..............IWRMYPNST---VH.....--
Q3UAR5_MOUSE/47-204---------------------------------------------..LLSYLKSHHWKNEDKNCYLAY---VG.....--
Q4RID0_TETNG/40-178---------------------------------------------...CVCCA.........PTHSCS---IN.....--
MS4A5_HUMAN/49-189---------------------------------------------...........YSHQNSQCKAVT---VL.....--
Q3LRP2_CALJA/51-216---------------------------------------------INIYNCEPVTPSEKNSPSTQYCY---SI....Q--
A7S4D6_NEMVE/20-179---------------------------------------------.DSIMTCKQSVPSYKFEGVDDCD---IL....T--
Q16GM4_AEDAE/220-341---------------------------------------------......................D---ES....V--
MS4A3_MOUSE/27-172---------------------------------------------.........CQSSPSPDVCISLG---SS.....--
CD20_MOUSE/44-210---------------------------------------------VDIYDCEPSNSSEKNSPSTQYCN---SI....Q--
Q3TPB3_MOUSE/27-182---------------------------------------------..SLDSCQCKLPSSEPLSRAFVY---RD....V--
A5WUV1_DANRE/56-184---------------------------------------------...................FYSY---SY....T--
A5WUU6_DANRE/48-180---------------------------------------------...............CRLYNYCE---DY....F--
Q0V9M1_XENTR/36-200---------------------------------------------QHQTSGCSNPGETLKLNPLQECS---AV....R--
FCERB_HUMAN/60-204---------------------------------------------.........HSCQKFFETKCFMA---SF.....--
M4A13_MOUSE/15-152---------------------------------------------..................NYGQA---KL.....--
A2BIL3_DANRE/61-221---------------------------------------------.ETPSAQCQEEKLIKIYAGHACG---TM....R--
Q810P8_MOUSE/49-189---------------------------------------------...........YSPDGMQCGVIT---IL.....--
T176A_RAT/63-223---------------------------------------------.MPSITPVPEEANRIGLCKYYTS---ML....K--
Q4RKB8_TETNG/40-175---------------------------------------------..........RVQYGCNDRYYAT---NL.....--
Q4SW16_TETNG/67-213---------------------------------------------...TWGDVTPTDTERRDCLWKIS---LL....D--
M4A6C_MOUSE/47-207---------------------------------------------..IEHDYYQPFYNSDRSECAVTK---SI.....--
Q5U4S5_XENLA/37-192---------------------------------------------..ATDWCQCTMDSSDPLSRTFQY---QN....V--
T176B_MOUSE/60-224---------------------------------------------GYGTVRYSDDSDWKTERCREYLN---MM....M--
M4A6B_MOUSE/47-204---------------------------------------------...RPTEYHYYQFLDRNECFAAK---SV.....--
A2RRW5_DANRE/53-183---------------------------------------------...............CRD.SYCY---DN....W--
Q5R1M8_FELCA/51-217---------------------------------------------DIHTCQPESKPSEKNSLSIKYCD---SI....R--
Q4RKB7_TETNG/24-169---------------------------------------------.....PTRFYSYHEQMNYDCPTE---VL....E--
M4A8A_MOUSE/87-225---------------------------------------------............SYYPYQENLGV---RT.....--
Q95PZ5_CAEEL/94-253---------------------------------------------.HDTSRISYIFSHMDKYDFAKCL---WQ....L--
Q1LVQ8_DANRE/42-197---------------------------------------------..MREDCICTLDPEDPIARMFVF---SA....V--
Q17QX1_BOVIN/51-216---------------------------------------------ININNCERANPDENNSQSVEYCA---RI....R--
A5WUV2_DANRE/56-191---------------------------------------------...............CRD.FYCY---NY....T--
Q29RT3_BOVIN/44-181---------------------------------------------............PSLEGICVIGR---VL.....--
Q58DM5_BOVIN/48-208---------------------------------------------..SMPYSTYYYSIYDVKDCLLTS---VD.....--
A3KNL7_DANRE/59-198---------------------------------------------...............CSD.YYCA---EMELKYT--
Q8MJ38_PIG/60-203---------------------------------------------..........CRNIYENDFCSTA---SF.....--
M4A15_MOUSE/76-198---------------------------------------------.......................---.......--
A5PMI8_DANRE/61-210---------------------------------------------.....CGNLMVNTTYIKILRVLY---KN.....--
A6H741_BOVIN/62-223---------------------------------------------TSWYQRRSSYSSWEEENCRRYMQ---ML....M--
Q4JF27_HUMAN/46-188---------------------------------------------.........CNYYGNSNNCHGTV---SI.....--
Q5BLB6_DANRE/53-183---------------------------------------------...............CTD.FHCY---ED....T--
Q5M796_XENTR/47-192---------------------------------------------.....MCVCYELNSTCKGSFYPQ---TV.....--
M4A6D_MOUSE/47-207---------------------------------------------..TTQDAYHFFSPEPLNSCFVAK---AA.....--
Q4SZQ8_TETNG/34-173---------------------------------------------........SSYENFTLHYETTCR---NI....Q--
Q4TAI3_TETNG/57-208---------------------------------------------...YSTESPWQKLFEEKCREKML---LT....E--
Q567H8_DANRE/59-196---------------------------------------------...............CGDSYYCY---NY....K--
MS4A3_HUMAN/50-196---------------------------------------------........CHSSSESPDLCNYMG---SI.....--
A7E2J6_DANRE/50-185---------------------------------------------...............CGHPDYYF---SE....R--
FCERB_MOUSE/52-195---------------------------------------------..........CKNVTEDDGCFVA---SF.....--
Q4S7F2_TETNG/34-189---------------------------------------------..ARGDCVCTLSQEDPIARTFTY---EG....V--
Q08BU9_DANRE/43-180---------------------------------------------.........THNNITEDDYVYLR---QH.....--
Q5BLA7_DANRE/16-153---------------------------------------------.........FHAHPVPEVRFVLS---RM.....--
MS4A7_HUMAN/47-207---------------------------------------------..SLPYSEYYYPIYEIKDCLLTS---VS.....--
T176A_HUMAN/56-214---------------------------------------------.TPAPTQSPEEVRRLHLCTSFMD---ML....K--
Q0P3U8_DANRE/59-198---------------------------------------------...............CSG.YYCG---EIERMYM--
Q80WF0_RAT/44-182---------------------------------------------............PSLDGPCVVGK---TL.....--
M4A10_MOUSE/56-190---------------------------------------------..............IWRPYPEPT---TY.....--
CD20_CANFA/51-216---------------------------------------------VDIHNCDPANPSEKNSLSIQYCG---SI....R--
M4A12_HUMAN/90-225---------------------------------------------...................YWAV---LS.....--
Q9EQY9_MOUSE/43-171---------------------------------------------....................DNY---TI.....--
A7SQ32_NEMVE/7-164---------------------------------------------..AKGPNYHKEYSRPQEHFDERN---QN....G--
M4A8B_HUMAN/71-207---------------------------------------------............DYYPYA..WGV---NP.....--
M4A4D_MOUSE/43-170---------------------------------------------.....................SQ---PA.....--
A3KNQ4_DANRE/48-184---------------------------------------------........HRAHNMTETEQLYMT---QH.....--
Q9GYM6_CAEEL/45-206---------------------------------------------.PSNSKCQIMCGDHVDDAMRRRM---TR....L--
A5PM84_DANRE/63-199---------------------------------------------...............YSSYYGNV---GI....C--
Q3T128_BOVIN/66-204---------------------------------------------............LYDPPSHTWGR---VP.....--
A0JMW7_XENLA/42-205---------------------------------------------EIYANKCLERENFLKLFPVQSCN---AV....H--
Q9ES61_MOUSE/43-171---------------------------------------------....................YNY---TI.....--
Q28GK5_XENTR/3-141---------------------------------------------........FSSPPHVIHARFILG---KL.....--
F189B_MOUSE/36-196---------------------------------------------.PLHRPCPEWGQELKVALNSTCD---EA....R--
T176B_RAT/60-224---------------------------------------------RFRSVRFTDDSDWRTERCREYLR---MM....M--
Q2KII2_BOVIN/49-189---------------------------------------------...........YSGEVSECHAVT---TL.....--
Q1LX35_DANRE/59-175---------------------------------------------.......................---.......--
M4A18_BOVIN/154-273---------------------------------------------.......................---.......--
Q567A9_DANRE/32-162---------------------------------------------...............CKD.AHCY---ND....V--
T176A_BOVIN/63-220---------------------------------------------.PTGAPTLSPDLERLQQCTAYVN---ML....K--

PF13273

D7UXS6_LISGR/3-100-----------------------------------------------------------------------Q..N-----
C2RQC7_BACCE/10-90-----------------------------------------------------------------------N..K-----
C3AKH5_BACMY/2-83-----------------------------------------------------------------------N..I-----
Q2B2X7_9BACI/2-86-----------------------------------------------------------------------H..K-----
C9B7Y0_ENTFC/3-104-----------------------------------------------------------------------Q..K-----
C7DIS7_9EURY/29-132-----------------------------------------------------------------------SKIK-----
D7DCC0_STAHD/4-91-----------------------------------------------------------------------V..R-----
A0B9F9_METTP/2-84-----------------------------------------------------------------------H..R-----
Q12UE5_METBU/2-98-----------------------------------------------------------------------K..K-----
B9DJA4_STACT/148-230-----------------------------------------------------------------------R..I-----
C4WAZ9_STAWA/11-93-----------------------------------------------------------------------R..V-----
Q4L9M4_STAHJ/13-95-----------------------------------------------------------------------R..V-----
A5UKZ4_METS3/8-83-----------------------------------------------------------------------S..D-----
A5N2M2_CLOK5/4-86-----------------------------------------------------------------------T..K-----
Q97LL2_CLOAB/4-86-----------------------------------------------------------------------G..K-----
A9VVN7_BACWK/2-84-----------------------------------------------------------------------A..K-----
B3ZH23_BACCE/2-84-----------------------------------------------------------------------A..K-----
C3BEA6_BACMY/2-84-----------------------------------------------------------------------V..K-----
Q4V1S6_BACCZ/2-84-----------------------------------------------------------------------S..G-----
D4FV71_BACNA/2-84-----------------------------------------------------------------------A..K-----
C2VWU6_BACCE/24-113-----------------------------------------------------------------------R..T-----
C2U6N9_BACCE/2-85-----------------------------------------------------------------------C..K-----
A5UL06_METS3/42-117-----------------------------------------------------------------------A..K-----
O26620_METTH/8-82-----------------------------------------------------------------------P..R-----
C8JWL3_LISMN/13-93-----------------------------------------------------------------------H..L-----
D7V0U0_LISGR/3-121-----------------------------------------------------------------------P..V-----
C8JTX3_LISMN/3-121-----------------------------------------------------------------------P..V-----
D3KN98_LISMN/3-121-----------------------------------------------------------------------P..A-----
Q92D69_LISIN/3-121-----------------------------------------------------------------------P..I-----
D3ULL7_LISSS/3-121-----------------------------------------------------------------------P..V-----
A8FJ46_BACP2/3-107-----------------------------------------------------------------------A..V-----
B4AK11_BACPU/3-107-----------------------------------------------------------------------A..V-----
C2H7S4_ENTFC/2-107-----------------------------------------------------------------------G..K-----
C9ATK3_ENTFC/2-107-----------------------------------------------------------------------Y..L-----
E6TU87_BACCJ/2-115-----------------------------------------------------------------------P..K-----
B9CUN6_STACP/3-110-----------------------------------------------------------------------S..K-----
C5QNE2_STAEP/3-110-----------------------------------------------------------------------P..K-----
C2LZ67_STAHO/18-125-----------------------------------------------------------------------P..K-----
Q4L9F8_STAHJ/19-126-----------------------------------------------------------------------P..K-----
C4WCX0_STAWA/2-110-----------------------------------------------------------------------A..K-----
Q4A0V3_STAS1/2-109-----------------------------------------------------------------------P..K-----
C5QZN6_STAEP/3-109-----------------------------------------------------------------------A..K-----
D3QGJ5_STALH/3-111-----------------------------------------------------------------------T..N-----
D3QGJ6_STALH/3-111-----------------------------------------------------------------------P..T-----
Q4A0E9_STAS1/2-112-----------------------------------------------------------------------S..K-----
C5NV51_9BACL/5-120-----------------------------------------------------------------------R..I-----
C5NWK3_9BACL/5-118-----------------------------------------------------------------------...F-----
Q49WN0_STAS1/2-102-----------------------------------------------------------------------R..V-----
Q8ERL5_OCEIH/2-100-----------------------------------------------------------------------S..K-----
A7A3G5_BIFAD/15-115-----------------------------------------------------------------------G..T-----

PF00335

TSN15_MOUSE/19-259YTIM......AGLLLGI....L.LPQFLGVLLTLL.YITRV
Q29BB1_DROPS/7-204FKLC......GGLGIFF....S.FTEVLAVF.....LARRY
TSPC_DICDI/14-226LVLV......GIAGVVI....G.CIEFVAMALSLF.LIIRI
TSN33_MOUSE/21-264LFLL......GGVALGL....A.IPQLVGILLSQV.LVNQI
Q9VMJ6_DROME/18-261LISV......AIGCVAL....L.VLQ..GME.....LSKII
Q7QJ21_ANOGA/9-222MIRV......AVVAVAS....A.LIQSLGIFCAIQ.LTMLL
Q7Q8G1_ANOGA/14-231SVLI......ATGTVAV....A.FVQVLGAVCAFM.LASAI
Q84WF6_ARATH/4-245WHKL......SLVNVIV....V.IFLIAVYCVGCC.AFKNA
TSPE_DICDI/16-219LKYL......GYYGIVL....S.VIELILLILSGFFLLKTN
Q16LT3_AEDAE/14-239AALI......ATGAITV....S.FVQILGSVCAFM.LARTI
Q5C164_SCHJA/7-207LNAT......IVTVFIF....A.LLQMICLVFAVC.VLMAI
Q8SU08_ENCCU/10-189SLMQ......RTLMFSF......FFESVGMG.....ILSML
Q9W4X6_DROME/42-295LYVI......AGNALGI....A.LIQLLVIYLAKT.LEGQI
Q9NB13_DROME/7-221MDII......RWSGLGL....C.IFDLVVFLIAGA.LTNCM
Q6DCP2_XENLA/9-233IGIV......AGVALGI....A.LFEILGIIFACC.LMKGI
Q6GLY9_XENLA/10-290MQSI......GLTVLLI......WLFELSVLTGVRYLQTSM
Q8SY17_DROME/7-219SDNA......KYVGIGL....I.GIELIGFIFACC.LANNV
Q1EC46_DROME/7-202LKGP......KIVGWML....M.VIEIGAFTFSTI.MGVSL
TSPD_DICDI/11-224LYLV......GSAGVAI....G.VIELVSLMFALFLIVRLY
A2FKF6_TRIVA/7-185IYYY......SILGSVA......LFLLIAVIIAFWKTCHKE
A2DWZ1_TRIVA/7-204KKRA......MIAGIIV....I.VFQLILFIYAVWYAFCYE
Q4DD38_TRYCC/86-309LSGF......LVISIFS....M.VLVVVGILFALLSRSANR
TSN16_HUMAN/10-243SFTL......SGSSLGA....A.VIQRWGSRYVAQ.AGLEL
Q5KAR0_CRYNJ/191-384LGIW......FTVSFAI......VPAHLLIILAAL.LCSNH
TSN32_HUMAN/9-229ASSL......TSIGLAL...TVSALLFSSFLWFAIRCGCSL
Q9V3X2_DROME/9-261WVTI......FAVTAAV....I.LLELLSLTFALS.LCCAV
TSPB_DICDI/14-224LYLV......GAAAVSI....G.VIEFICMLFALFLIIRIC
Q9VID1_DROME/8-228TLIL......ASVVLGV....A.GIQMLTILFACC.LYRSF
Q64HX8_ONCMY/9-234IMWV......IVAALVI....A.FLQIMGIIFACM.LMGGI
Q29IZ2_DROPS/18-232TGWI......VALAMTL....A.MLNVICGTMSFV.LVQAV
Q1HRC5_AEDAE/13-234AAFI......GASGIIV....A.ILLIFGMIFSCS.LFRMI
TS31A_XENLA/8-198LKIL......GGVGLFF....S.FTEILGVW.....LAFRF
Q17441_CAEEL/23-259LNFL......FTVTAAS....L.VLHFANLIFGCC.TCFRS
Q5DG31_SCHJA/16-308ALML......AASGTTA....L.VLSIVGFIISSV.LLFPI
Q2TCS3_BRABE/7-240MFVI......GGILVVI....C.ILEILAIVGACF.LLRRW
Q2TCS2_BRABE/9-231IVYI......GGGALGV....A.LIMVLGIILSCM.LFCHG
Q9ZUN5_ARATH/3-256WRKA......NLILIIT....V.VVLIWVYVIACS.AFRNA
TSPA_DICDI/14-224IYAV......GAAGLAI....G.IIELVAILFSLFLIIRIC
IM23_SCHMA/10-212LVIV......ACVAFGV....C.FFQLLSIVIACC.LGRQI
Q29JV0_DROPS/10-238AVSL......GAAGVVI....A.VLQFFGVIFACY.IAREI
Q6GP84_XENLA/8-227IQSV......GIFGICI....L.VVQVFGLIFSML.MYCQV
Q5DB78_SCHJA/24-277IVHF......ACGVSGV....A.VLQLLAILLAKT.LHTQI
A0BI34_PARTE/7-267FTTT......GSILFSL....A.ALFGVMVILTCC.LCCHP
Q5GM22_TAESO/9-219ALAF......GIVIIVI....G.LIQIGAIICAAC.LAKKV
Q9XVI4_CAEEL/8-223GAMV......GGICAVL....A.AIQLVGVCFACC.LSKSI
A2G3J8_TRIVA/7-186IAIY......VVFGLIA......LLLLFASGLAFYKVCRSD
A2EZ33_TRIVA/7-201KKGI......QIAGIVI....L.IIQALLLIYSLW.YAFCF
Q5DH84_SCHJA/4-271ISDL......AFISITL......VILNITLVVCVVLVLREL
Q60D82_BRAOL/4-254WRIL......LVFNLLL....I.LLVVLLYSWGCC.VRKNN
Q4RYD3_TETNG/10-300MTTI......