Sequence alignment for CL0347

PF00335

TET6_ARATH/5-240SNTVIGVLNLL.TLLASIPIIGT.......A..LYK........................................ARSS
B3DL95_XENTR/9-226IKITMFIFNLI.FWLGGCGILGV.......G..VWLAVTQGKF.................ATLSVSFPSLSAASL.....
TSN8_HUMAN/8-233IKYSMFTFNFL.FWLCGILILAL.......A..IWVRVSNDSQ.................AIFGSEDVGSSS........
Q7T376_DANRE/7-212LKYIMCVVNFI.FFICGAAIFGM.......G..IYL..................................MTFSRLSLLP
Q6Z8Q8_ORYSJ/6-255SNNVIGALNLV.TLLLSAPILSG.......G..IWM......................................ATRGDG
Q16HS1_AEDAE/10-224LRCTLILLNML.CFLSGLSLAIV.......G....AV.............................MHTKLAAITNLTHR
TSN11_BOVIN/16-247LKYLLFIFNFF.FWVGGAAVMAV.......G..VWTLV...........................EKSGY..LGVLASST
Q22RT6_TETTS/14-273LCYANLVTGLV.GIITGIVLLGVNSDYKDFG...............................................ES
A0EF92_PARTE/8-262LKCIVEFEAIL.ILIAGLGSF.........GFTIYL................................QIEFNLAKEDDE
TET9_ARATH/5-254SNSLVGILNFF.VFLLSVPILST.......G..IWL.......................................SLKAT
TSN8_BOVIN/8-234IKCSMFIFNFV.FWLCGAIILSV.......A..ISIRAGKIGQ.................EILAPGDADLNL........
A0BI34_PARTE/8-266LKCFVQLEGWL.TFVIGILAIVA.......AIIVTVI.............................QKSFDDAIKDLGIT
TET11_ARATH/5-258SNFMVGLANTL.VMLVGASAIGY.......S..IYM......................................FVHQGV
Q5ZII8_CHICK/16-246LKYLLFIFNFF.FWLAGGAVMAV.......G..AWTLA...........................KKSDY..ISLLSSST
TSN33_MOUSE/22-263VKYLLFFFNML.FWVISMVMVAV.......G..VYARL...........................MKHAEAALACL....
CD37_RAT/11-269IKYFLFVFNLF.FFVLGGLIFCF.......G..TWILI...........................DKTSFVSFVGLSFVP
G7NV03_MACFA/7-238IKTIMILFNLL.IFLCGAALLAV.......G..IWVSI...........................DGASFLKIFGPLSSS
Q6Z5Z9_ORYSJ/6-259SNAVFAAINVV.TLLLGAAVLAA.......G..IYY..................................GAPHRGGGGV
TET15_ARATH/54-309VNILAAGVLPIFTFVLSLTLLGY.......A..VWLLYMR.......................SYDCED...........
Q6DHQ4_DANRE/9-229LRYGMVFFNLL.FWLCGCGILGV.......G..VWLSITQGNF.................ATLSSSLPSLSAANL.....
M4EKP0_BRARP/5-250SNAAVITTNAI.LALIGLATLCF.......S..VYL.......................................FIEGP
A0BP70_PARTE/8-281LKFSVQFQAWV.ILIVGVSSLIG............TIVI.........................NVDQRQYLDYLDEFTN
TET13_ARATH/17-268QNMSFPFNTIF.LISSAIFLVTA.......A..FWF..................................VAVMTLHYRT
TSPE_DICDI/17-217VRGPFIILNSIIFSLSFILLCST.......GIIIYYLNEY.......................YLVKDL...........
Q29D35_DROPS/10-258AKYLLCIFNFI.FFVLGTIIFGV.......G..LWLAVDKHSL.................IALLKLVESERIEQFTQTQV
A8XFB8_CAEBR/16-252VKFSYIVTALI.SILFSISCICY.......G..IWL..................................LARRSQYAEL
Q9VMJ6_DROME/19-264LKYLLFASNVI.LWLSALLVLSV.......G..IWAWS............................EKGMFRNIARLHFI
Q16HS3_AEDAE/7-220VKTSLIVLNMI.CLLCGLWLTIV.......GLVMMY.................................KYSDLIHLTGR
Q9FVY6_ORYSJ/6-253SAFVIRWINFF.TMILALLVVGF.......G..FWM..................................S......THN
CD82_HUMAN/9-255TKYFLFLFNLI.FFILGAVILGF.......G..VWILA...........................DKSSFISVLQTSSSS
Q16LT3_AEDAE/15-238VKYMIFVINFM.FLLTAILIVTV.......G....SAI............................GTIFGDFEYFIDSH
Q6Z6K0_ORYSJ/4-255SNNITACVTLM.ALICAVPVIAS.......G..VWF.......................................ASAQG
Q176T5_AEDAE/21-243IKYLLFVFNLI.FAVSGLVLLIA.......GIIVLL................................DVNDYQHFVEDK
Q7Q1S3_ANOGA/10-238IKYLLFLFNFF.FAITGVIIMAV.......G....LTV............................QGAYHNFRDILDAK
TSN32_HUMAN/10-222AKCQMLVTCFF.ILLLGLSVATM..........VTLTYFGAHF..................AVIRRASLEKNPYQAVHQW
ROM1_BOVIN/17-291LAQGLWLLSWL.LVLVGGLTLLC.......SGHLLV.................................QLWHLGTFLAP
Q9VID1_DROME/9-227VKYLTFFCNLL.FALTGLLIFLV.......GGMVQL................................NYAHYSNFVSDH
Q245V1_TETTS/10-273LRRITEISACI.MCILGVFAIIF.......G.....................................GVLLGQNKKVTS
TSN12_HUMAN/10-247LRCLLYALNLL.FWLMSISVLAV.......S..AWMRDYLNNV.................LTLTAETRVEEAVILTY...
Q75IM5_ORYSJ/7-245SNVMIGYLNLA.TLLASIPVIGA.......G..LWM.......................................AKGST
Q292V6_DROPS/10-210WKYALFATCIL.ITACTVLFFSC.......GVVTWG............................................
A8WRV5_CAEBR/10-229IKYFFWLINLL.FFVLGAVIVGL.......S..IWMLVDKNSL..................TTVASTVKVDLSQVLNQVN
A1Z6T8_DROME/8-219LRYVLCVISGI.CALGGCLLIWY.......G..AWL...............................LDSLSEEQRMLGM
Q6NYK2_DANRE/16-288LAQGLWMLSWL.ATVGGAITFTL.......GCFLKT..................................ELRRRGEVMD
Q7QJ21_ANOGA/10-221FKYLVYAYVIL.ISICGGAQLVI.......GAFLLW...................................THKQYAPIV
A2DRK6_TRIVA/8-224AVALIGVINLVILVVMGVVAYFCLDIIKQVT.................................................
H3D1H6_TETNG/10-250LRLGLLAFSCL.FWAAGLALFTL.......G..VWA.................................QISLADYMTLS
Q16GP3_AEDAE/10-260AKTLLSVFNFV.FFVLGSIVLGV.......G..IWLVADKSSF.................IALLKMVESDQLEHFTQPAV
TSN14_HUMAN/15-260YKYLLFSYNII.FWLAGVVFLGV.......G..LWAWS...........................EKGVLSDLTKVTRMH
TET5_ARATH/5-241SNTVIGFLNIL.TLISSIVLLGS.......A..LWM........................................GRSK
Q7SXT2_DANRE/17-242LKTFLISYSLI.FWFTGVILLAV.......G..VWGK..............................VNLEFDLLVNSEH
CD63_MOUSE/10-230VKFLLYVLLLA.FCACAVGLIAI.......GVAVQV...................................VLKQAITHE
Q67WQ6_ORYSJ/5-255SNGLLGLLNAG.VLVLAVVVLGG.......G..IWL......................................SNRAAT
F1Q6P4_DANRE/9-244TKYFLFLFNFI.FFIFGATIMGF.......G..LWILL...........................DNQSLIAVLQESSVI
H3CCQ2_TETNG/10-244TKYFLFLLNFI.FFLCGAVIVGF.......G..LWLLL...........................DNQSFIVVLSDSTAV
Q9NB13_DROME/8-220VNFILYIVNIV.FLIVGILLIVL.......GSIMLS...............................DL...SRFDVAGS
Q06AT4_PIG/11-256FQSLLVFGNVI.IGMCGIALTAE............CIFF..........................VSDQYSLYPLLEATD
A2DY51_TRIVA/8-215LRWVIIIINIL.IVIAAVIACAV............VYT............................RIGKTSGTTEYYKL
M9PDV2_DROME/9-255IRRTFCWLNII.LWLCSCAFLGA.......G..LWLRLSYAGY.................ATLLPQHAGLSADTI.....
Q4D6X7_TRYCC/24-264FRALLMGMNIL.LTAGAVAGLAV.......G....L...............................LERSTMEKTLKNL
F6ZCC3_XENTR/17-288.AQILWILNWV.SVVTGLIIFSL.......GLFLKI..................................EIKKRSELMV
C4Q3U8_SCHMA/13-222LKYSMFVFCLI.AWVLGLITFIV.......G....IVA...........................RVNGSFGILDAHIPA
Q3UGA5_MOUSE/75-317VKYLIFLSNFL.FSLPSLLALAA.......G..LWG.................................LTVKRSQGIGW
H3DF34_TETNG/10-245TKYFLFLFNLL.FFVFGGLIMGF.......G..LWVLL...........................ENQSFIAVLQESSDT
Q24FE3_TETTS/6-262LKKSVIITNSL.LLLVGLFFIIY............P...............................AILYQQYAYTTYT
Q29IZ2_DROPS/19-231VKYTLFCFNIV.AWMIATALFAL.......T..VWL................................RAEPGFNDWLRI
Q86D97_SCHMA/8-230LRVILVVFNFL.VVLIGLSVLGF.......SVYIYL...............................EPEAQDIILASGQ
Q9V3X2_DROME/10-260VKYLMVLINIL.FWLIGLTIVVT.......S..VWMLT............................DPTFMLSMTQNYNH
Q24C21_TETTS/15-284LQVYISWTSYI.NLVISIAALAFGIYIGVKNKSVWSNSSFD.....................WNKTLIA...........
Q4S5B5_TETNG/9-229IKYMLFLFNLF.FWLGGCGLLGV.......G..LWLSVSQGSF.................ATLSPSFPSLSAANL.....
TSN6_BOVIN/17-236FKSVLLIYTFI.FWITGVILLAV.......G..IWGK..............................VSLENYFSLLNEK
A1Z6U7_DROME/8-215IKYTGLLSNLL.YMLLGIGVMS........G.......................................AGLGLQMAEP
Q16HX5_AEDAE/10-217IKYVLFVFNLL.CSLCGIALVVI.......G....GVS............................LAKIADLQDISDEH
Q19983_CAEEL/8-276LRIVTFLFNFA.FWLSGVVVFGL.......G..IWLLF............................DPAASDFFALHSTH
TSN5_HUMAN/15-260IKYFIFGFNVI.FWFLGITFLGI.......G..LWAWN...........................EKGVLSNISSITDLG
Q7KJ73_DROME/8-218VKYILFIFNTI.VSVIGILGIVY.......GVLILKS.............................IGV...VEVNGQVG
A8X5P0_CAEBR/8-222IKLLFFIINFF.ICIFGALICGF.......S..LWANLDKEFGTHLGDFVRQIDGIDVKLINEIAEYQASLWI.......
TSPD_DICDI/12-222LKVPLIILNVI.LWLLGLVLVII.......G....GICVGF......................FSRFKELQEVGGVSESI
Q5I0R1_XENTR/8-226LKYSMFAFNFL.FWLCGCVILGV.......S..IWVRV............................SKSVQQELNIDGGS
Q29JV1_DROPS/15-245AKYMLIIVSFM.FALTAILLIMV.......G....TTI............................QTIFGDFSVFIDGH
Q4D693_TRYCC/54-284HRFSTACFSAF.LILLGVAMSAVIAIGGSKS............................................KELNF
A1Z8K7_DROME/9-232IKYVLFAFNVL.FAISGLGILIA.......GAVVLA................................DVNEFNHFVEGR
G4LW70_SCHMA/11-211LKSCVFVLNII.CLLCSLVLIGA.......G..AYVE..............................VKFSQYGDNLHKV
TSPA_DICDI/15-222LKVPLIILNII.LWILGLVLVIV.......G....GICVSF......................LSNFKDFTKASDAKSAL
F1R4A1_DANRE/13-253VKYTLFVCCYV.FWVFSAGLIAV.......G..IYAK.............................IAK...ESDVVDTL
Q16LT4_AEDAE/35-245VKYSVLVLTGM.CLILEVIQIVL.......G....A...............................GAGNIFADFHIFL
Q7JWV7_DROME/8-217VKYVLFIFNIL.FVICGILLITF.......GSIMVS...............................TI...KDFSGVGE
Q7K2V7_DROME/8-218FKYLLYLLNLV.FVAGGILLIVV.......GSIMLS...............................TM...GNFTAFDG
Q16J92_AEDAE/10-259IKYLVILVNLL.FWLIGFAIVLL.......A..IWMLT............................DPTFLISMTQNENN
Q16TV5_AEDAE/9-253IRRTFCSFNVL.IWLCGSCFLAI.......G..VWLRFAAPGY.................ATLLPDHAALSADCL.....
A0CWV3_PARTE/5-271VKKVVGFGAFL.IILIGLALLGF.......G..VYVLY...........................KQVGLNYADLYFNTA
Q22495_CAEEL/38-296VKYSVFSFNVI.FFLLGFGLLLF.......G..VWAQI...........................EKNTFVNMLSKASKL
A2BIP5_DANRE/17-256LKFSLNVYSML.FSLLGLCVLCI.......G..VYAEV...........................ERQKNRT....LEGV
Q16LT5_AEDAE/18-239IKFFLFMTNVM.FVFVGILVIST.......G....AAV............................RSVYSDFTAFVDEQ
H3DMZ9_TETNG/8-216VKYLLFFFNLL.FWISGCIILGV.......S..IYVKVTKDTLGI..............PMDSLPGVDL...........
Q6P2T9_DANRE/10-229VKYLLFFFNFI.FWLCGLALIVL.......GILVHV..................................SLHNTAILQG
TSN15_MOUSE/20-258LKFSLIIYSTV.FWLIGGLVLSV.......G..IYAEA...........................ERQKYKT....LESA
Q17441_CAEEL/24-258CSKCQLFISYL.LVIVGILFLAL.......A..IWL..................................YIFRGDLIPL
Q9XVI4_CAEEL/9-222VKYLLFLANLV.LWVGGLSLIIV.......GSILQL................................KFDNVLDILGDE
H3CSH9_TETNG/9-236SKTVLVFLNMI.FWAAAGILCYV.......G..AYVFITYDDYDHF...........FEDVYTFIPAVT...........
Q7K010_DROME/7-210VKLIVYALDVL.CTLLALVLISF.......G..IYV......................................AVSYNL
Q292W4_DROPS/8-216VKYILFIFNLL.CSICGILLIVF.......GGLLFS...............................NI...HNIDDFAE
Q1HRC5_AEDAE/14-233VKYSMFVSNFI.IFIGGAIVFGL.......G..VWTVVDKNFINEL...........LGTNLFSGAVYV...........
Q6YWS4_ORYSJ/5-273SNGVLGALSFA.ALLASVPLIGA.......G..AYL.......................................LDHPA
O44582_CAEEL/30-289LKWLVFLLNSI.VFLVGVGILAL.......G..VYLFIKDFREVK.............LVDIILNPAIL...........
A2EZ30_TRIVA/8-218ARTIIGLVNLIILIVMAVILYFSWDQIKQIK................................................I
H3DJN8_TETNG/8-231SKTVLLFLSLV.FWAAGAALAYV.......G..AYVIKSYDNFDSF...........IQDRYTLIPAAI...........
Q7JZW3_DROME/8-216VKHVLLLLNFV.FSVLGLALIAF.......G..IFF...................................LISAAENAV
TSPB_DICDI/15-222LKVPLIAFNTI.LWVLGLVLVII.......G....SIGVSF......................FSNFKDFTKVSKASAAL
TSN16_HUMAN/11-245LKKLLSLLNGF.VAVSGIILVGLGIGGKCGG.......................................ASLTNVLGLS
Q7PTA7_ANOGA/10-219IKYLLFIFNLL.CSLCGIALIVI.......G....AVS............................LVKLEELREISDEY
B4I8V1_DROSE/10-227FKYLVYSYVVL.LALTGAAQIFL.......GTSLLW...................................GHSVYYGIV
CD81_MOUSE/10-229IKYLLFVFNFV.FWLAGGVILGV.......A..LWLRHDPQTTSLLYLEL....GNKPAPNTFYVGIYI...........
Q9W4X6_DROME/43-294VKYMIFLLNFV.FWLFGGLLLGI.......G..VYAFR...........................DKWEDANGSVRLENF
Q24C18_TETTS/15-277IQIYISWTSYI.NLLISIAALAFGAYEGIRKKDLWSKSSFD.....................WNKALVF...........
TET2_ARATH/4-252ANNLTAILNLL.ALLCSIPITAS.......G..IWL.......................................ASKPD
Q4DD38_TRYCC/91-307FGYALIFINFT.FIMASMLLVMS.......G......................................IVARQNAAVRL
H2VAF3_TAKRU/17-288.AQTVWFMYWF.AVLAGVLVFSM.......GLFFKI..................................ELRKRSELMD
Q29JV0_DROPS/11-237VKYTLFGFNLI.FLITGIILIAV.......G....AGV............................GSVYTGYELFLAGK
Q7JZW7_DROME/8-209LQWTSVVFSTL.TLIVGVLAALA.......G..........................................VYELDKF
TSN10_HUMAN/76-318VKYLIFLSNFP.FSLLGLLALAI.......G..LWG.................................LAVKGSLGSDL
Q7K527_DROME/8-207IKYSLFLFNAL.WAILGILVLIF.......GGLGWG............................................
L9JBT3_TUPCH/22-369VKYLLFFFNML.FWVISMVMVAV.......G..VYARL...........................MKHAEAALACL....

PF04103

FCERB_HUMAN/60-204---FLGVT...-QILTAMICLCF-------G..TVV--------------------------------CSVLDISHIE.G
FCERB_MOUSE/52-195---FLGAT...-QILVGLICLCF-------G..TIV--------------------------------CSVLYVSDFD.E
T176B_HUMAN/66-229---ALGVT...-QILLGVVSCVL-------G..VCL--------------------------------SLGPWT......
A6H741_BOVIN/62-223---ALGVT...-QLLLGAISCAL-------G..GLL--------------------------------YLGPWI......
T176B_MOUSE/60-224---SLGVT...-QILLGLVSCAL-------G..VCL--------------------------------YFGPWT......
T176B_RAT/60-224---SLGVT...-QILLGLVSCVL-------G..VCL--------------------------------YFGPWT......
T176A_RAT/63-223---ASWVV...-QIVLGILSVVL-------G..GIL--------------------------------YICHYL......
T176A_HUMAN/56-214---ASWVM...-QIVLGILSAVL-------G..GFF--------------------------------YIRDYT......
T176A_BOVIN/63-220---TSWVM...-QIVLGLLSGVL-------G..GFL--------------------------------YIFSST......
Q4TAI3_TETNG/57-208---LLGTL...-HILAGLLNILL-------S..VIL--------------------------------CAGGRYP.....
A7SQ32_NEMVE/7-164---LLGIISSF-HLVFGVFSVVL-------G..IVT--------------------------------FKVAPY......
Q95PZ5_CAEEL/94-253---RLCLV...-ELMLAVVILGG-------G..IWC--------------------------------YRDTSD......
Q9GYM6_CAEEL/45-206---ALANV...-HVFLGIIMIVL-------SGLADY--------------------------------ASTRIN......
Q1LVQ8_DANRE/42-197---LVALL...-QLLLGIAVAAV-------A..FLM--------------------------------LAISSS......
H3D3M7_TETNG/37-190---.VALL...-QLLLGVAVTVV-------A..FLM--------------------------------LAISPS......
Q3TRE0_MOUSE/29-182---.LALL...-QLALGIAVTVL-------G..FLM--------------------------------ASISPS......
A7S4D6_NEMVE/20-179---GFGVV...-QVILGLSLTGL-------S..FAA--------------------------------FALSES......
Q0V9M1_XENTR/36-200---SLGVS...-QMVLGCLIVAV-------S..FAA--------------------------------LALTTS......
F6PJ14_XENTR/5-167---SLGLL...-QLILGCCTVAL-------S..FGA--------------------------------LSLSKS......
F189B_MOUSE/36-196---TLGLA...-QVLLGILVITF-------S..MVA--------------------------------SSVTTT......
Q5BLA7_DANRE/16-153---VLGIL...-QVACAGLCVVC-------G..FMD--------------------------------AVFRKS......
F7AIP4_XENTR/16-154---VLGIL...-QIACAGISIVS-------G..FMD--------------------------------GAFRRE......
Q08BU9_DANRE/43-180---SIGVV...-LSMMGVGLFLF-------G..IPM--------------------------------TVHTDI......
F1RAY4_DANRE/49-184---.IGVV...-LVMMGVCLFMF-------G..IPM--------------------------------TTPKDM......
F7ESV6_XENTR/53-198---VLGVI...-QLFTGITQIAA-------G..IVL--------------------------------CIAMASR.....
H3C9F3_TETNG/67-212---ALGVV...-QIMVGLVCVAF-------A.....--------------------------------LRAAFS......
MS4A3_MOUSE/27-172---ALGAI...-QILNGILILAL-------G..IFL--------------------------------VCLQHVSHHFRH
MS4A3_HUMAN/50-196---VLGAI...-QILNAAMILAL-------G..VFL--------------------------------GSLQYPYHFQKH
M4A4A_HUMAN/65-207---VLGVV...-QILTALMSLSM-------G..ITM--------------------------------MCMASNTYG...
M4A6C_MOUSE/47-207---VIVAI...-QIMCAVTVLAL-------G..IIL--------------------------------ASVPPVPYFN.S
M4A6B_MOUSE/47-204---VMAAI...-QIMCAVMVLSL-------G..IIL--------------------------------ASVPSNLHFT.S
M4A6D_MOUSE/47-207---VMAAI...-QIMCAVMVLSL-------G..IIL--------------------------------ASVPSNLHFT.S
MS4A7_HUMAN/47-207---VLGTV...-QILCCLLISSL-------G..AIL--------------------------------VFAPYPSHFN.P
F6RP33_BOVIN/48-208---VLGII...-QILCFLVISSL-------G..VIL--------------------------------VSVPNSSQLS.P
Q99N04_MOUSE/47-204---VLGTI...-QLLCALILASF-------G..GIL--------------------------------VSASYFNP....
MS4A5_HUMAN/49-189---ILGTI...-QILFGIMTFSF-------G..VIF--------------------------------LFTLLKPYP...
Q810P8_MOUSE/49-189---ILGTT...-QILFGIMNFSF-------G..VIF--------------------------------LFTLVNPYP...
Q2KII2_BOVIN/49-189---ILGAV...-QILLGAMNFSF-------G..TVL--------------------------------LFTLEDPYP...
Q3LRP2_CALJA/51-216---VLGAV...-QIMNGLFHIAL-------G..GLL--------------------------------MIPAGVY.....
CD20_MOUSE/44-210---ALGAV...-QIMNGLFHITL-------G..GLL--------------------------------MIPTGVF.....
CD20_CANFA/51-216---TLGAV...-QIMNGLFHIAL-------G..SLL--------------------------------MIHTDVC.....
W5PU80_SHEEP/51-216---ALGAV...-QIMNGLFHIAL-------G..SLM--------------------------------LIHADVY.....
M3VZQ9_FELCA/52-215---.LGAV...-QIMNGLFHMAL-------G..GLL--------------------------------MIHMEVY.....

PF13273

Q8Y8F2_LISMO/3-121KRTGEIVLAII-GLVLSLLAQAF-------I-------------------------------------AIIGLLMISGSK
Q8Y8B4_LISMO/3-92SRKPEIIIGLI-GSIIGILVGFW-------I-------------------------------------INYGDSVTDYIQ
C7N721_SLAHD/168-273VEEL.GMYNLI-GTAANAVLAAA-------Y-------------------------------------LGFMQVASSSLQ
G2TQJ8_BACCO/2-106KRTAEIVLSII-GAVLNGLAAIL-------V-------------------------------------IFFTIAMKSQSI
U5LDQ7_9BACI/5-123TYRVPKLLGLI-SFGITVLINFT-------A-------------------------------------GLFYFLVSRGYT
E8SF89_STAPH/28-121KRTVEKVLTWV-GIVLHIVWILL-------L-------------------------------------VGLVKVIQTPE.
F9UT90_LACPL/16-98SRTAELVLGII-GGIFGIIAGLL-------A-------------------------------------MTI.........
B5IAA3_ACIB4/5-90YPSAAFIITII-GAIFALFGWLI-------I-------------------------------------SIAGVMI.....
O26620_METTH/8-82SRTLELVLGVI-GGIFGLLGGLF-------A-------------------------------------IVF.........
C2X4G3_BACCE/18-98KRTPEFVLGLI-GGILGIIISII-------L-------------------------------------IVVAFNIME...
I0JHL5_HALH3/2-113KRTAEIVLTVI-GIVLYGLPILL-------S-------------------------------------GIFLSNKDNPQF
A3DKS5_STAMF/4-94KPVAAFILGLI-AGIFGILSGIG-------T-------------------------------------LIA.........
E8SF88_STAPH/14-126NRLAEKILGWL-SWLLLLGTTVV-------A-------------------------------------MFFGLVLFSNES
Q65KT1_BACLD/2-84KRTTEFVLGLI-GGIFGFIGAFL-------A-------------------------------------LIV.........
A5F9L1_CLOK5/1-82MKKTAFILGTI-AGIVGIISCGI-------L-------------------------------------LYV.........
D3FS61_BACPE/1-122MNKKHMMIRFI-SV...ISLGLL-------V-------------------------------------GGTAFLLLIGPL
Q5HQ65_STAEQ/2-105NRKVEKRLAWI-ANILSLLFLIF-------G-------------------------------------ILSIFVINNTSN
K0J606_AMPXN/3-111NRRIEIFLIIM-GMAIFFFFGIS-------G-------------------------------------VTMINVHGDDEA
B9EB15_MACCJ/41-157SRIPEKIFGWL-AWLPLLVIALF-------G-------------------------------------LYQLLVNGNNPE
Q8ERL5_OCEIH/2-100NRSVERILSTI-AVCVDAGFAIF-------L-------------------------------------GIFALIINVNLR
A0B9F9_METTP/2-84SRNAELALGIV-GGLFGILTGII-------V-------------------------------------MFI.........
Q5HKY5_STAEQ/3-109QRKGELILSWI-GNGLHLLYVFL-------V-------------------------------------GIFFIMTQTSEF
A5UL06_METS3/42-117SRTLELVLGII-GAIFGLLGGVF-------A-------------------------------------IML.........
B9DJ67_STACT/3-106KRTAEHVLTWI-GVGLSVLGLLV-------L-------------------------------------GLILPFISGDDF
B9DJA4_STACT/148-230NRVAEMVLGIM-GSVFGIIAGIF-------G-------------------------------------LLL.........
B9DPZ9_STACT/15-127SRVAEKVLGWL-NWIGLLLLTVA-------T-------------------------------------MFIALVSFSNDT
Q65EV2_BACLD/2-89KRTAEFTLSLI-ATIFLTIGWFF-------T-------------------------------------AIFTFFY.....
K8E281_CARML/2-111ERKTEFILTLI-GAILSGLFSLL-------M-------------------------------------IGITFLIGIGIS
C3AKH5_BACMY/2-83KRTPEFILGLI-GGIFGVIGSFI-------I-------------------------------------LMIAITAMDG..
T0TBR3_9STRE/2-102KRKSEKILLIL-GSIWNVITALL-------T-------------------------------------IFGYSDWFQKEG
D7CIL7_SYNLT/1-83MRVASMILGII-GGIAGFGGALF-------A-------------------------------------LFV.........
Q3Y3E6_ENTFC/2-107KRKWELLLGMV-GGSLSLIFFGG-------L-------------------------------------AVTLSNMSASEF
Q12UE5_METBU/2-98SKKTETIFGIA-GGSIGVIIAAV-------I-------------------------------------FYVAIINIWPG.
V5XRN1_ENTMU/2-106TKKWEITFGLI-GGSTALLFFGG-------I-------------------------------------AVTFNQMSLSNF
Q2G173_STAA8/1-105MEKSIKIMTII-GIVVQGLATVF-------S-------------------------------------LLLMVLAASGVM
Q81BB0_BACCR/2-82TRTPEFVLGLI-GGILGIIISII-------L-------------------------------------IVVAFNIME...
Q5HQP3_STAEQ/1-105MNKAINITSLI-GIILQSFSSLL-------F-------------------------------------LVFLVFSITGAM
E6TU87_BACCJ/2-115KRTGEIVLGVI-GAIGYAFFTVA-------G-------------------------------------FFFLWLQNQDEF
A8FJ46_BACP2/3-107RRKGEKIMGII-SIVLNVIGVGF-------G-------------------------------------ALILSLGPSFYD
Q8Y9W6_LISMO/2-106NRQTEFTLLIV-GASLSILTFLG-------A-------------------------------------MLYTIIFGLNTL
Q5HQ66_STAEQ/14-126NRLTEKILGWF-SWVFLLILTIV-------S-------------------------------------MFIALVSFSNDT
S6C3Q0_9ACTN/167-273EIEGIGLLAVI-GAAVNAVLSVA-------Y-------------------------------------MFAMEASSATFQ
B8D0X9_HALOH/8-93VSSAPLILGII-GGVLGIPASFC-------A-------------------------------------GAC.........
Q81UE0_BACAN/2-84KRTTEFVLGLI-GGIFGILCAFI-------A-------------------------------------LFI.........
Q97LL2_CLOAB/4-86KRTVEFVLGLI-GGIFGIISGIG-------A-------------------------------------VGL.........
Q5WAY8_BACSK/3-120KRTGERVLGII-GIVCFMLGTLF-------L-------------------------------------GGAMALQGQGFY
A5N2M2_CLOK5/4-86KKTVELVLGLI-GGILGIIAGIY-------S-------------------------------------MNI.........
A5UKZ4_METS3/8-83SRIFELIVGGL-GALVSLVSSSF-------I-------------------------------------LLI.........
B9DQ00_STACT/2-98NRKLERVIGWI-GVGLTLLYTLL-------F-------------------------------------LIGLTLGKGTLS
Q8Y911_LISMO/3-104PRKSEFVLTLI-AGITGIIAGIT-------G-------------------------------------IAGGGLLAALSG
L0EGZ3_THECK/2-105KRTFEIALSVL-GIIASLVMVGT-------G-------------------------------------IVFLYLTKSEKF
Q2G2G5_STAA8/2-104NRKPELIMAWI-ANSISIIYLLV-------M-------------------------------------GLSYFSLKSGNA
R5AN22_9FIRM/46-142NLFSAHLLNII-AFCLPVLMTLG-------M-------------------------------------FLVIPQMSKNDS
Q8YAT4_LISMO/1-81MK.VEGLLGFL-GAALGIGFSLM-------V-------------------------------------LVI.........
Q2G2G6_STAA8/14-126SRLTEKVLGWL-CWVMLLVLTVI-------T-------------------------------------MFIALVSFSNNT

PF00335

TET6_ARATH/5-240TTCENFLQT--------------------PLLVIGF..IILIV-----SLAG...FIG.ACFNV----A....WAL-W-V
B3DL95_XENTR/9-226.........--------------------.FMVTGS..IIMVV-----GFIG...CLG.AVTEH----R....CLL-L-T
TSN8_HUMAN/8-233.YVAVDI..--------------------.LIAVGA..IIMIL-----GFLG...CCG.AIKES----R....CML-L-L
Q7T376_DANRE/7-212SLQAMSIAN--------------------TLFITGI..IITCV-----SFLG...FLG.ALKEN----R....CLL-I-S
Q6Z8Q8_ORYSJ/6-255GECDRHLSS--------------------PAIALGA..VLMAV-----SLAG...LVG.ACCRV----T....WLL-W-V
Q16HS1_AEDAE/10-224DNLLTSQSL--------------------LAMGLGV..IIFAV-----SFFG...FCG.AAKHS----Y....CMT-V-T
TSN11_BOVIN/16-247FAASAYI..--------------------.LIFAGA..LVMVT-----GFLG....FGAVIRED----R....GCL-S-A
Q22RT6_TETTS/14-273YNIYKASYT--------------------LLILVGV..FFAIL-----GLLG...ICA.QRKKR----N....CTM-T-I
A0EF92_PARTE/8-262TNKGQGILV--------------------AFWIFSS..SMILN-----GIIG...IFG.GKKKS----A....CLL-L-I
TET9_ARATH/5-254TQCERFLDK--------------------PMIALGV..FLMII-----AIAG...VVG.SCCRV----T....WLL-W-S
TSN8_BOVIN/8-234.FIAVNI..--------------------.LIFVGA..VIMIL-----GFLG...CCG.AMKEN----Q....FMM-I-L
A0BI34_PARTE/8-266DINTSAIIV--------------------PFWIFAA..VVIFF-----AISG...LCG.AKHRS----K....CLL-A-I
TET11_ARATH/5-258TDCESAIRI--------------------PLLTTGL..ILFLV-----SLLG...VIG.SCFKE----N....LAM-V-S
Q5ZII8_CHICK/16-246YSATAYI..--------------------.LVVAGV..VVMVT-----GILG...CCA.TFKER----R....NLL-R-V
TSN33_MOUSE/22-263AVDPAIL..--------------------.LIVVGV..LMFLL-----TFCG...CIG.SLREN----I....CLL-Q-T
CD37_RAT/11-269LQTWSKV..--------------------.LSVSGV..LTMAL-----ALLG...CVG.ALKEL----R....CLL-G-L
G7NV03_MACFA/7-238AMQFVNVGY--------------------FLIAAGA..VVFAL-----GFLG...CYG.AQTES----K....CAL-M-T
Q6Z5Z9_ORYSJ/6-259TECERFLRA--------------------PALALGG..AIVAV-----SLAG...LAG.ACCRA----T....PLL-W-A
TET15_ARATH/54-309.........--------------------.ILGLPRVQTLASV-----GLLA...VFV.VSNAA----L....FLR-R-K
Q6DHQ4_DANRE/9-229.........--------------------.LIAAGT..VVMVI-----GCLG...CVG.AVKEN----R....PLL-L-S
M4EKP0_BRARP/5-250SQCQRFIQN--------------------PLIVTAT..LLFFI-----SSLG...LIA.ALYDN----Y....III-T-V
A0BP70_PARTE/8-281SKPSDGILI--------------------ALYIFSS..ILILF-----GICG...IVG.GWKRI----G....TLL-F-C
TET13_ARATH/17-268DECNRFVTT--------------------PGIFISF..SLLAM-----SLTG...FYA.AYFKS----D....CLF-R-I
TSPE_DICDI/17-217.....TIPL--------------------GSFILSA..YMVIT-----TIVG...GIA.IWKKK----L....GLH-L-T
Q29D35_DROPS/10-258IEQLAYV..--------------------.LIVIGA..VMFFM-----SFLG...YLG.AMRES----R....CLL-S-T
A8XFB8_CAEBR/16-252VSPSLYVDV--------------------GRILV....IISIL-----SIANYLICFYAIFKEM----R....CIV-T-S
Q9VMJ6_DROME/19-264ALDPAFV..--------------------.LIILGG..VTFLL-----GFMG...SVG.ALREN----T....CLL-G-A
Q16HS3_AEDAE/7-220DTVLASATK--------------------LTVVLGW..AIAAT-----GFYG...IHG.VIRRS----Y....PLM-V-L
Q9FVY6_ORYSJ/6-253DECRRSLTI--------------------PVMGLGG..VIFLI-----SLVG...FLG.AWKKI----A....CLL-W-T
CD82_HUMAN/9-255LRMGAYV..--------------------.FIGVGA..VTMLM-----GFLG...CIG.AVNEV----R....CLL-G-L
Q16LT3_AEDAE/15-238FFSPAHL..--------------------.MVAIGI..IMIFV-----SIFG...CFG.AIKES----T....AMI-N-I
Q6Z6K0_ORYSJ/4-255EECARLARW--------------------PVAILGG..LILLA-----ALAG...FVG.AYWNR----R....RLL-A-F
Q176T5_AEDAE/21-243LMAPPVV..--------------------.LIVVGT..FVFLV-----ASLG...CYG.AIKES----P....KLL-N-A
Q7Q1S3_ANOGA/10-238FFSIPTF..--------------------.LVVIGS..FIFVI-----AFFG...CCG.AYKEN----Y....CMT-L-T
TSN32_HUMAN/10-222AFSAGLSLV--------------------GLLTLGA..VLSAA-----A..........TVREA----Q....GLM-A-G
ROM1_BOVIN/17-291SCPFSALPQ--------------------VALAASA..VALGT-----GLVGSGASRASLDAEQ----YPPWRGVL-G-P
Q9VID1_DROME/9-227VWTAPII..--------------------.LMIVGA..AVAVI-----CFLG...CCG.ALKES----S....CMI-L-S
Q245V1_TETTS/10-273DSANFIAAS--------------------FGIMLGLGFILLLV-----GALG...LLA.WKKRN----N....CLL-G-I
TSN12_HUMAN/10-247...FPVVHP--------------------VMIAVCC..FLIIV-----GMLG...YCG.TVKRN----L....LLL-A-W
Q75IM5_ORYSJ/7-245ATCSSMLQT--------------------PLLVIGF..VVLLV-----SLAG...FVG.ACFHV----A....WAL-W-L
Q292V6_DROPS/10-210SAASIFGSY--------------------TTALIGA..AVFGV-----AFLG...VYV.ALKES----YK..YSIL-F-M
A8WRV5_CAEBR/10-229IQQINTFLY--------------------VALVIGG..ALLIL-----GFFG...CCG.SCCES----V....CAI-S-I
A1Z6T8_DROME/8-219DHGEDLAAV--------------------LCVLLGT..VIVVA-----SIFG...SVA.VAKDS----R....VLL-I-C
Q6NYK2_DANRE/16-288NTDIHCVPN--------------------TLMIVGL..ASMGG-----NYFASRICQDALDAGR----FPRWKTYM-K-P
Q7QJ21_ANOGA/10-221KNQFWEPFA--------------------VLIGLGI..ISQAL-----CYLG...WTS.TSRKQ----R....CYL-G-L
A2DRK6_TRIVA/8-224ISEVKSSKT--------------------FLFSAAVIGVIALT-----CIIG...FFMLCCYKN----Q....CFR-T-T
H3D1H6_TETNG/10-250ANAYPNAPS--------------------ILLATGA..AVTAW-----GFLA...CLG.VAANL----P....RLL-R-A
Q16GP3_AEDAE/10-260IEQLAYF..--------------------.LIAIGA..IMFFL-----SFLG...YCG.AIRES----Q....CLL-T-T
TSN14_HUMAN/15-260GIDPVVL..--------------------.VLMVGV..VMFTL-----GFAG...CVG.ALREN----I....CLL-N-F
TET5_ARATH/5-241TTCEHFLQK--------------------PLLILGL..AILIL-----SVAG...LVG.ACCDV----A....WVL-W-V
Q7SXT2_DANRE/17-242GTNAPYV..--------------------.LIGTGA..VIIIF-----GLFG...CFA.TCRGS----P....WML-K-L
CD63_MOUSE/10-230TTAGSLLPV--------------------VIIAVGA..FLFLV-----AFVG...CCG.ACKEN----Y....CLM-I-T
Q67WQ6_ORYSJ/5-255TDCERFMER--------------------PVVALGV..LLLAL-----SLAG...LAG.ALCGA----S....CLL-W-L
F1Q6P4_DANRE/9-244LKVVSYI..--------------------.LIGVGS..FSMLL-----GFLG...CLG.AIYEI----R....CLL-G-L
H3CCQ2_TETNG/10-244.KTACYI..--------------------.LIGVGA..FSMLL-----GFLG...CLG.AIYEV----R....CLL-G-L
Q9NB13_DROME/8-220GTDPNTIPI--------------------CVTVLGG..LIFVV-----SFFG...CYG.IFRQS----V....CMT-G-A
Q06AT4_PIG/11-256NDDIYGAAW--------------------IGIFVGI..CLFCL-----SVLG...IVG.IMKSN----R....KIL-L-V
A2DY51_TRIVA/8-215FKDSTALYP--------------------FFAILAVCAAVCII-----GVFL.......ICCEN----R....CWA-I-F
M9PDV2_DROME/9-255.........--------------------.FMGIGG..TGFVV-----SFFG...CCG.AWVQS----R....CLL-V-L
Q4D6X7_TRYCC/24-264CQSCHAIFI--------------------AYISVFS..GLLLF-----SLLG...FFA.LCTRN----T....LLR-V-L
F6ZCC3_XENTR/17-288SGNMHTVPN--------------------MLIAVGV..IACVI-----NFFGGKICYDCSDANK----FVRWKLFM-L-P
C4Q3U8_SCHMA/13-222VHAGANL..--------------------.LIAVGF..FIMIM-----GFLG...CCG.AIRES----Q....CLL-F-L
Q3UGA5_MOUSE/75-317GGPVPTDPM--------------------LMLVLGG.LVVSVV-----SLSG...CLG.AFCEN----S....CLL-H-W
H3DF34_TETNG/10-245VKVASYI..--------------------.LIGVGS..LSMAL-----GFFG...CIG.AIYEV----R....CLL-G-L
Q24FE3_TETTS/6-262NNLFSGILI--------------------FGIVLGV..FLILW-----TLFG...VLA.AQKNN----T....MIQ-A-A
Q29IZ2_DROPS/19-231LEAQSFYIG--------------------VYVLIGVSIIMMAV-----SFLG...CLS.ALMEN----T....LAL-F-V
Q86D97_SCHMA/8-230QHAVQIMLY--------------------ALMGIGG..ITLVI-----ALFG...CCG.AYHES----Q....CLL-G-T
Q9V3X2_DROME/10-260YHIALYV..--------------------.FLAIGI..LITLG-----AFFG...CCG.VCRES----Q....CLL-V-S
Q24C21_TETTS/15-284.........--------------------.LLIAGS.VFLLLA-----SIAG...ICG.GRKQN----K....CCI-F-I
Q4S5B5_TETNG/9-229.........--------------------.IITLGS..IVMVT-----GFLG...CLG.AIKEN----K....CLL-L-S
TSN6_BOVIN/17-236ATNVPFV..--------------------.LIGTGT..VIILL-----GTFG...CFA.TCRAS----A....WML-K-L
A1Z6U7_DROME/8-215NTPEHTYFV--------------------KSLVLGG..SICMI-----VMFG...CYG.MVANL----L....CVN-L-I
Q16HX5_AEDAE/10-217SIVAPSIL.--------------------.FIVLGS..VVFVI-----AFFG...CCG.AIRES----Y....CMT-S-T
Q19983_CAEEL/8-276PGAFRYVGW--------------------FLVGAGA..IIILV-----GYFG...CIG.AWKMN----Q....CAL-A-F
TSN5_HUMAN/15-260GFDPVWL..--------------------.FLVVGG..VMFIL-----GFAG...CIG.ALREN----T....FLL-K-F
Q7KJ73_DROME/8-218FPIQALMPI--------------------ILISLGS..IVVFI-----SFLG...CCG.AIRES----V....CMT-M-S
A8X5P0_CAEBR/8-222.........--------------------.LVAVGA..LLFIV-----GFFG...CCG.AGCES----P....VLL-G-L
TSPD_DICDI/12-222KSISVSLPA--------------------GVLSIGI..FFMVL-----TVAG...CIV.AYKEK----M....VGL-V-F
Q5I0R1_XENTR/8-226LLSAVDL..--------------------.MIAVGA..IIMVL-----GFFG...CCG.AIRES----R....CLL-L-L
Q29JV1_DROPS/15-245FASPPAL..--------------------.LIAIGF..ILIAV-----AALG...AYG.AVKES----V....MVI-N-L
Q4D693_TRYCC/54-284CHDCKTLIL--------------------FLLVPGI..FFVVM-----GIVG...GVS.AWRET----K....ICS-A-L
A1Z8K7_DROME/9-232VLAPPIV..--------------------.LIVTGL..IIFLI-----ASLG...CFG.AIKES----P....TLL-I-T
G4LW70_SCHMA/11-211WQAAPIA..--------------------.IIVVGV..IILIV-----SFLG...CCG.AIKEN----V....CML-Y-M
TSPA_DICDI/15-222SNLTTSIPA--------------------GVLVIGI..LFVIF-----TVVG...CFV.AYKEK----L....VGL-V-I
F1R4A1_DANRE/13-253MADPALL..--------------------.LIVVGS..LMFTI-----TFLG...CFG.ALRNA----S....LLL-N-M
Q16LT4_AEDAE/35-245DDNFHSLTD--------------------FILAVGI..IMLLI-----VLFG...SVG.IVIEN----M....TII-M-I
Q7JWV7_DROME/8-217TFTANSVAI--------------------IILVLGC..VVFLV-----AFMG...CCG.AIREN----S....CAL-T-S
Q7K2V7_DROME/8-218GVNTQTIPI--------------------CIIVIGS..VTFVV-----AFFG...CCG.TIREN----A....CCT-T-I
Q16J92_AEDAE/10-259YFIGLYI..--------------------.LLVVGG..LMLSV-----AFLG...CCG.AFKES----Q....CML-F-S
Q16TV5_AEDAE/9-253.........--------------------.FMTIGV..ISFVI-----AFFG...CCG.SWFQS----R....CFL-I-I
A0CWV3_PARTE/5-271SWLKTLSEY--------------------GLLILGA..VILIT-----GIAG...AKG.SSQKK----TSCRGCLL-L-T
Q22495_CAEEL/38-296YLDPTWP..--------------------.LLIVGF..LTFII-----GFSG...CVG.SLREN----T....SFL-T-F
A2BIP5_DANRE/17-256FLAPAVV..--------------------.LILLGL..VMFTV-----SVIG...MVG.SLRDN----K....TLL-H-M
Q16LT5_AEDAE/18-239FYSPACM..--------------------.FVVVGV..ITVAI-----ATFG...FIG.TIRES----S....LLI-N-I
H3DMZ9_TETNG/8-216.........--------------------.MIAIGV..IIMVL-----GFLG...CCG.AIRES----R....CLL-L-L
Q6P2T9_DANRE/10-229ASGSPMV..--------------------.LIVVGV..IIFFI-----SFFG...CCG.AWKEN----Q....CMV-V-T
TSN15_MOUSE/20-258FLAPAII..--------------------.LILLGV..VMFIV-----SFIG...VLA.SLRDN----L....CLL-Q-S
Q17441_CAEEL/24-258IQSHFYVKC--------------------IYLAVGCGVFNVII-----GFLV.....H.SAVSN----R....CAL-V-F
Q9XVI4_CAEEL/9-222RLATPIL..--------------------.LLVIGS..LCTLL-----GFLG...CCG.AIREN----Y....CLT-V-S
H3CSH9_TETNG/9-236.........--------------------.IIGVGA..LLFII-----GLIG...CCA.TVRES----C....CGL-T-T
Q7K010_DROME/7-210NEIGQLTAY--------------------GYVGLGA..AALLV-----VLWG...YLS.AWREN----V....CCT-V-T
Q292W4_DROPS/8-216ALRTQQVPI--------------------TMIVLGT..VILLI-----SWFG...CCG.AIRES----Y....CMS-M-T
Q1HRC5_AEDAE/14-233.........--------------------.LIATSA..LVCLL-----SFFG...CIG.AAKEY----K....CML-L-T
Q6YWS4_ORYSJ/5-273SECQRLVRV--------------------PAVALGS..AALLL-----SLMA...IAGVTCCRG----A....ALL-W-A
O44582_CAEEL/30-289.........--------------------.ISIFGF..SICVV-----SFFG...FMG.ALRDN----I....FLL-K-C
A2EZ30_TRIVA/8-218DEIKSSKKV--------------------LIFVIVVVAIIAIT-----CIIG...FFL.LCCDS----K....CFR-M-T
H3DJN8_TETNG/8-231.........--------------------.IICISV..VMFIF-----GLVG...CCA.TIRES----K....VGL-G-F
Q7JZW3_DROME/8-216SIGKNVAGG--------------------LIIALGV..VILII-----AIFG...CLA.AIHEA----P....VRL-L-I
TSPB_DICDI/15-222SNLTTGAPA--------------------GVLVIGI..FFVIL-----TVIG...CFV.AGKEK----L....VGL-V-I
TSN16_HUMAN/11-245SAYLLHVGN--------------------LCLVMGC..ITVLL-----GCAG...WYG.ATKES----R....GTL-L-F
Q7PTA7_ANOGA/10-219NIVAPSIL.--------------------.LIVFGS..VVFVI-----SFFG...CCG.AIRES----Y....CMT-S-T
B4I8V1_DROSE/10-227QNKLWAPAA--------------------ILLCLGP..VTFIL-----CWMG...CQA.TNQRK----R....CLL-G-M
CD81_MOUSE/10-229.........--------------------.LIAVGA..VMMFV-----GFLG...CYG.AIQES----Q....CLL-G-T
Q9W4X6_DROME/43-294YDVFLNISL--------------------VMILAGT..VIFLV-----SFSG...CVG.ALREN----T....FLL-K-F
Q24C18_TETTS/15-277.........--------------------.LLVVGS.ILLFFT-----SIAG...IIG.GRKKN----K....CCI-F-F
TET2_ARATH/4-252NECVNLLRW--------------------PVVVLGV..LILVV-----SATG...FIG.AYKYK----E....TLL-A-V
Q4DD38_TRYCC/91-307CEPCGQIAM--------------------SALVFGI..ILCLF-----TILG...FMW.IRQRQ----M....MFL-L-V
H2VAF3_TAKRU/17-288NNESHFLPN--------------------LLILMGL..IACGM-----NVFGGKVCYDSLDPAK----FVKWKPML-K-N
Q29JV0_DROPS/11-237FFSIPTF..--------------------.LIVIGA..FIIVI-----TFFG...CWG.ALKEN----Y....CLV-L-S
Q7JZW7_DROME/8-209NEGSAEHTE--------------------KFVQLGMAGALILA-----GLVG...CLG......----.....AIF-G-S
TSN10_HUMAN/76-318GGPLPTDPM--------------------LGLALGG.LVVSAA-----SLAG...CLG.ALCEN----T....CLL-R-G
Q7K527_DROME/8-207.AMPDAYAI--------------------GILILGG..TILVI-----SLFG...CCG.AVRES----P....RML-W-T
L9JBT3_TUPCH/22-369AVDPAIL..--------------------.LIVVGV..LMFLL-----TFCG...CIG.SLREN----I....CLL-Q-T

PF04103

FCERB_HUMAN/60-204DIFSSFKAG--------------------YPFWGAI--FFSIS-----GMLS---.IISERRNA....T----YLV.R-G
FCERB_MOUSE/52-195EVLLLYKLG--------------------YPFWGAV--LFVLS-----GFLS---.IISERKNT....L----YLV.R-G
T176B_HUMAN/66-229...VLSASG--------------------CAFWAGS--VVIAA-----GAGA---.IVHEKHPG....K----LAG.Y-I
A6H741_BOVIN/62-223...QLRASG--------------------CALWAGF--VAIAA-----GVGA---.IVHEKRRG....K----LSG.C-V
T176B_MOUSE/60-224...ELCAFG--------------------CAFWSGS--VAILA-----GVGT---.IVHEKRQG....K----LSG.Q-V
T176B_RAT/60-224...ELCASG--------------------CAFWSGS--VAILA-----GVGI---.VIHEMGQG....K----LSG.H-I
T176A_RAT/63-223...AMNTQG--------------------APFWTGI--VAMLA-----GAVA---.FLQKKRGG....T----CWA.L-M
T176A_HUMAN/56-214...LLVTSG--------------------AAIWTGA--VAVLA-----GAAA---.FIYEKRGG....T----YWA.L-L
T176A_BOVIN/63-220...TLRNSG--------------------APIWTGA--VAVLA-----GAVA---.FIYEKRGG....I----YWA.L-L
Q4TAI3_TETNG/57-208..WPIRESY--------------------FPFWIGG--MYILI-----GAMC---.VWSERRPS....P----CLV.I-L
A7SQ32_NEMVE/7-164...FYGVFG--------------------MGIWLGA--WMLIT-----GVAG---LLTASVPTN....M----CRL.G-S
Q95PZ5_CAEEL/94-253....YCPYY--------------------SAIWTSA--IYIIN-----AIVG---.SAAAKMGA....L----NLY.M-A
Q9GYM6_CAEEL/45-206...TIRLHG--------------------LEEICSF--YFVLV-----GLVG---.ICGSASYR....R----GLV.I-T
Q1LVQ8_DANRE/42-197....LLARE--------------------TPHWAGI--IMCVV-----SLLG---.FVLFCITRVPDER----..A.L-L
H3D3M7_TETNG/37-190....LLARE--------------------TPHWAGI--ILCLV-----SVLG---.FILYCITYL..PD----ERT.S-A
Q3TRE0_MOUSE/29-182....LLVRD--------------------TPFWAGI--IVCVV-----AYLG---.LFMLCVSYQ..VD----ERT.C-V
A7S4D6_NEMVE/20-179...DRIRNA--------------------CPYWAGF--TVFFS-----GGVG---.IVAWRHST....I----LSM.G-L
Q0V9M1_XENTR/36-200...ARVRHS--------------------CPFWAGF--SVLLS-----GLIG---.VVAWKRPL....S----LVI.T-F
F6PJ14_XENTR/5-167...PQIRSS--------------------CPFWAGS--SVILS-----GIVG---.LTTWKRPM....V----LLV.N-L
F189B_MOUSE/36-196...ESIKRS--------------------CPSWAGF--SLAFS-----GLVG---.IVSWKRPF....T----LVI.S-F
Q5BLA7_DANRE/16-153..TTLSETR--------------------APLWAGL--IMAAP-----GVLA---.LFASQKKN....P----YLV.N-V
F7AIP4_XENTR/16-154..STLGRTR--------------------APLWAGL--IMTIP-----GVLA---.LFSSQKKN....P----VLV.N-A
Q08BU9_DANRE/43-180..MTSADVF--------------------SPFWLGI--LFCVC-----GVLY---.ILSERSPS....K----KII.T-A
F1RAY4_DANRE/49-184....MTDQF--------------------SPFWLGV--LFCIC-----GLVY---.ILSERNPS....K----KMI.T-A
F7ESV6_XENTR/53-198.YHVISGSG--------------------VPFWTGV--MYMIS-----GALS---.VAASSKPT....L----GKM.K-S
H3C9F3_TETNG/67-212...PLLVLH--------------------AALGLAV--AFVVS-----GSLT---.LAALRRTS....V----SSV.W-T
MS4A3_MOUSE/27-172FFFFTFYTG--------------------YPLWGAV--FFISS-----GSLT---.VAAGRNPT....R----MLM.Q-N
MS4A3_HUMAN/50-196FFFFTFYTG--------------------YPIWGAV--FFCSS-----GTLS---.VVAGIKPT....R----TWI.Q-N
M4A4A_HUMAN/65-207SNPISVYIG--------------------YTIWGSV--MFIIS-----GSLS---.IAAGIRTT....K----GLV.R-G
M4A6C_MOUSE/47-207VFSVLLKSG--------------------YPFIGAL--FFIAS-----GILS---.IITERKST....K----PLV.D-A
M4A6B_MOUSE/47-204VFSVLLKSG--------------------YPFIGAL--FFIVS-----GILS---.IVTETKST....K----ILV.D-S
M4A6D_MOUSE/47-207VFSILLESG--------------------YPFVGAL--FFAIS-----GILS---.IVTEKKMT....K----PLV.H-S
MS4A7_HUMAN/47-207AISTTLMSG--------------------YPFLGAL--CFGIT-----GSLS---.IISGKQST....K----PFD.L-S
F6RP33_BOVIN/48-208AISSILMTG--------------------YPFLGAL--CFAIT-----GTVS---.IISGKKSN....K----PFA.I-N
Q99N04_MOUSE/47-204EVSTTLISG--------------------YLFIGSL--CFAIA-----GILS---.IISEKIST....K----PFA.L-S
MS4A5_HUMAN/49-189RFPFIFLSG--------------------YPFWGSV--LFINS-----GAFL---.IAVKRKTT....E----TLI.I-L
Q810P8_MOUSE/49-189RFPFIFISG--------------------YPFWGSV--LFINS-----GAFL---.IALKRKTT....D----TLI.K-M
Q2KII2_BOVIN/49-189RFPFIFISG--------------------YPFWSSI--LFVNS-----GAFL---.VALERKTT....E----TLV.T-L
Q3LRP2_CALJA/51-216.APICVTVW--------------------YPLWGGI--MYIIS-----GSLL---.AATEKNSR....K----SLV.K-G
CD20_MOUSE/44-210.APICLSVW--------------------YPLWGGI--MYIIS-----GSLL---AAAAEKTSR....K----SLV.K-A
CD20_CANFA/51-216.APICITMW--------------------YPLWGGI--MFIIS-----GSLL---.AAADKNPR....K----SLV.K-G
W5PU80_SHEEP/51-216.MPICVTLW--------------------YPLWGGI--VHIIS-----GSLL---.AAAEKNST....Q----SMASS-G
M3VZQ9_FELCA/52-215.APICMTVW--------------------YPLWGGI--MYIIS-----GSLL---.VAAEKNPR....K----TVV.K-G

PF13273

Q8Y8F2_LISMO/3-121GKEGLTTFYNNYYKTMTEWEI........PKKEVPD--PDRVL.....DFVQ---------------------TLS-W.T
Q8Y8B4_LISMO/3-92TFTYLP..............................--..........GELG---------------------NEL-A.N
C7N721_SLAHD/168-273SFAYYFDPT....................HPNYALK--ASADV.....SIFS---------------------GSA-L.P
G2TQJ8_BACCO/2-106IDQLKND......................ASIREAD--FQTVL.....HTIQ---------------------TLG-W.G
U5LDQ7_9BACI/5-123ANVLTELISSDPKFQREMSGQDG......TAAAREI--ADGTM.....DFVE---------------------VVL-I.I
E8SF89_STAPH/28-121.............................FQQEIQA--TGQDI.....AQIE---------------------NLG-S.S
F9UT90_LACPL/16-98.................................GGI--GSALE.....TSGS---------------------AGV-S.N
B5IAA3_ACIB4/5-90....................................--SSYPE.....SSVS---------------------WFG-V.V
O26620_METTH/8-82....................................--..........SVFG---------------------PEL-L.Y
C2X4G3_BACCE/18-98....................................--..........GVDY---------------------GLL-A.Y
I0JHL5_HALH3/2-113RQELENMMNSSPEMQGN............GAI...N--VNQML.....DAMG---------------------TFT-M.V
A3DKS5_STAMF/4-94.............................SVFSVKV--PVPIA.....GFLG---------------------TLL-I.I
E8SF88_STAPH/14-126SIQSLENSIANNATLQEL...........LTNNNMN--ATQFV.....IMLQ---------------------NGV-W.A
Q65KT1_BACLD/2-84.................................GGL--DASFN.....SSGT---------------------SDI-I.G
A5F9L1_CLOK5/1-82.............................GLNTTVD--HDNVY.....SVI.---------------------...-..I
D3FS61_BACPE/1-122DQHQGIRSVVIDLYQMDPKVQRDTLSGTLQIQPDEF--ATNTL.....HYIN---------------------QYM-Y.L
Q5HQ65_STAEQ/2-105QQQYNELM.....................KQFSGNN--QDMSS.....EMFL---------------------VSL-I.A
K0J606_AMPXN/3-111ALEIYEQFMQE..................EAAELEN--VPTYD.....EFVE---------------------TLR-T.A
B9EB15_MACCJ/41-157FVQAMKDGLNNEIQSNSQMADA.......FNQMGLT--VEEAV.....PLFV---------------------KTF-W.Y
Q8ERL5_OCEIH/2-100EGT..........................SVIPHED--LPMIF.....SIFL---------------------HLL-W.L
A0B9F9_METTP/2-84.................................GGI--GGAVG.....AEGA---------------------ETV-T.V
Q5HKY5_STAEQ/3-109KNGMIQGFIEE..................NPGEYDL--AYQTY.....NLML---------------------GLG-V.V
A5UL06_METS3/42-117....................................--....S.....SFGG---------------------TEI-F.A
B9DJ67_STACT/3-106IQGIQEGD.....................GSLTYED--AAASA.....SFFH---------------------AFA-T.I
B9DJA4_STACT/148-230.................................GGI--SSSLG.....EADG---------------------GSI-F.G
B9DPZ9_STACT/15-127SIQKLEQTLTNNEFAQQI...........LTNNGLN--TTQFV.....IWLQ---------------------NGI-W.A
Q65EV2_BACLD/2-89................................GFTP--ADEAD.....MGFF---------------------YYL-L.I
K8E281_CARML/2-111ATSYTASDDYYYDS...............YNYSDSL--SASEA.....SIII---------------------GAF-A.V
C3AKH5_BACMY/2-83....................................--..........YIDY---------------------KLL-T.Y
T0TBR3_9STRE/2-102MSS..........................FEHHKQV--SYASV.....SLLD---------------------SLT-K.F
D7CIL7_SYNLT/1-83.................................GGV--DASFS.....ASGT---------------------SSI-I.G
Q3Y3E6_ENTFC/2-107KKSY.........................QSLAVDH--STLSL.....ENTF---------------------GLL-QDM
Q12UE5_METBU/2-98.............................GGTMMYG--TSEVF.....GISD---------------------PFV-V.M
V5XRN1_ENTMU/2-106RETY.........................QALSLEG--FGSVK.....ETFE---------------------SLR-S.M
Q2G173_STAA8/1-105TTDVSTTVN....................GEVDPVD--AETAA.....AIFT---------------------VLF-L.S
Q81BB0_BACCR/2-82....................................--..........GVDY---------------------ELL-A.Y
Q5HQP3_STAEQ/1-105DANFTTTVN....................GETTVHS--AEAAQ.....HVFS---------------------VGF-L.V
E6TU87_BACCJ/2-115MGELSAELQAD..................DELSAAE--VDAVLGFLDGGFLS---------------------SSG-I.F
A8FJ46_BACP2/3-107QINEVLQ......................EEGETLP--IETLE.....ASVN---------------------SFG-T.Q
Q8Y9W6_LISMO/2-106MVADTF.......................GYYSSSE--ETILL.....GIIT---------------------FFS-V.V
Q5HQ66_STAEQ/14-126SIANLENTLNNNELVQQI...........LANNDLS--TTQFV.....IWLQ---------------------NGV-W.A
S6C3Q0_9ACTN/167-273SFQYYFDPT....................HPNVAMA--NPANV.....SLFT---------------------GDS-M.T
B8D0X9_HALOH/8-93..............................AGFITA--MSSTA.....EEAS---------------------AVA-D.F
Q81UE0_BACAN/2-84.................................GGV--ASAME.....AEGA---------------------SNV-I.G
Q97LL2_CLOAB/4-86.................................GGL--GSAVG.....ASGS---------------------TTV-G.G
Q5WAY8_BACSK/3-120EDFFMEMANEDSELWEGEENP........PIVSQED--AAATS.....AFFE---------------------ELN-FGM
A5N2M2_CLOK5/4-86.................................GGL--ASVFH.....VDRA---------------------VTV-N.N
A5UKZ4_METS3/8-83....................................--....G.....SFGF---------------------GAT-S.F
B9DQ00_STACT/2-98K............................ILLKQGD--TSMSS.....SYLQ---------------------ESM-I.F
Q8Y911_LISMO/3-104SEELSN.......................ATAMTAA--DSEAL.....AAAG---------------------GLT-V.I
L0EGZ3_THECK/2-105LQYLE........................EGWSESE--NAYTL.....EQLG---------------------QAG-T.M
Q2G2G5_STAA8/2-104SQREELA......................KQLSQNG--GKVSL.....DMLQ---------------------TTM-G.A
R5AN22_9FIRM/46-142D............................SAADLSV--TVEPP.....DISG---------------------NLL-L.V
Q8YAT4_LISMO/1-81..................................PD--ISQAL.....EEES---------------------FFF-Y.M
Q2G2G6_STAA8/14-126SIANLENTLNNNAFIQQL...........LAGNGYN--TTQFV.....IWLQ---------------------NGI-W.A

PF00335

TET6_ARATH/5-240YL..VV--MIFL.....IATLMGLTL.FGLVVTSQGGGVEVP......................................
B3DL95_XENTR/9-226FF..VI--LLII.....FLLEMISMA.LFLTYTEQ.............................................
TSN8_HUMAN/8-233FF..IG--LLLI.....LLLQVATGI.LGAVFKSK.............................................
Q7T376_DANRE/7-212FF..IL--LFIL.....MLAELAAAC.LMLMYESK.............................................
Q6Z8Q8_ORYSJ/6-255YL..LA--MFAL.....IVALLGFTA.FAFAVTNRGAGEAVS......................................
Q16HS1_AEDAE/10-224YV..LM--LMTL.....IVVQIALAV.LLFAGVDQ.............................................
TSN11_BOVIN/16-247YF..CL--LLAI.....FLVELVAGV.LAHVYYQR.............................................
Q22RT6_TETTS/14-273YNIGVI--VLMI.....FIGCSLIVMIYTKVKLSQFKDDTNCSKQSLMKDLKATYDAGKSLLCSS.RCPCDANPISFPAQ
A0EF92_PARTE/8-262FN..LV--NIAL.....FLGFVGLTV.AGYVRAHQINGLDVSTYCSNNPPLQQTW.....................DLGQ
TET9_ARATH/5-254YL..FV--MFFL.....ILIVLCFTI.FAFVVTSKGSGETIQ......................................
TSN8_BOVIN/8-234FF..VG--LLMI.....LLLQVAAGI.VATTRKSK.............................................
A0BI34_PARTE/8-266FN..LG--NICL.....FLAFLSLSI.VAYVIGSFFDVSNCSNSSNELQIENLYKM..................SESTLC
TET11_ARATH/5-258YL..II--LFGG.....IVALMIFSI.FLFFVTNKGAGRVVS......................................
Q5ZII8_CHICK/16-246YF..IL--LLCI.....FLLEIIAGI.LAYIYYQQ.............................................
TSN33_MOUSE/22-263FS..LC--LTIV.....FLLQLAAGI.LGFVFSDK.............................................
CD37_RAT/11-269YF..GM--LLLL.....FATQITLGI.LISTQRVR.............................................
G7NV03_MACFA/7-238FF..FI--LLLI.....FIAEVAAAV.VALVYTTMAEH..........................................
Q6Z5Z9_ORYSJ/6-259YL..LL--TGLL.....ILAAACFGV.FALVVTNAGAGRAVS......................................
TET15_ARATH/54-309FPMPAL--VVMV.....VVLLLMLFIGLAYAGVNEMQ...........................................
Q6DHQ4_DANRE/9-229FF..IL--LLLI.....FLLEILFII.LFFSYQDQ.............................................
M4EKP0_BRARP/5-250YL..FF--LFLS.....ILLTLIFSI.FIFLVTNSSAGKAFS......................................
A0BP70_PARTE/8-281FN..IG--NFIL.....AIAFLGLAI.LGFSLGQSAHWIDIFSDEQCLQSEYFTGSATLNNVYA...EAEEVFCKTIYKN
TET13_ARATH/17-268HF..FI--FFLW.....MFVVVSKAI.FVIFLHKETNPRLFP......................................
TSPE_DICDI/17-217FM..VF--LVVL.....IVCLVGVSAKMIVDSGNP.............................................
Q29D35_DROPS/10-258YA..TF--LILL.....LVAGIVAGG.LAAFYKEK.............................................
A8XFB8_CAEBR/16-252CA..VA--SIVI.....AVMLIIGGL.IGLNFRDQ.............................................
Q9VMJ6_DROME/19-264YA..IF--LSVL.....LIAEIGFCA.VAFVLKDKG............................................
Q16HS3_AEDAE/7-220YV..FL--LGVL.....ITFQLSMAA.LLIYRSNRTP...........................................
Q9FVY6_ORYSJ/6-253YL..VM--LFVV.....LVAIMVFTV.LAFIITNTGTGHSVS......................................
CD82_HUMAN/9-255YF..AF--LLLI.....LIAQVTAGA.LFYFNMGK.............................................
Q16LT3_AEDAE/15-238YG..VL--LAIV.....FILEVAAAI.SAFALQGQ.............................................
Q6Z6K0_ORYSJ/4-255YL..FA--MASL.....IALLIALLV.FAFAVTRGSGAYPVL......................................
Q176T5_AEDAE/21-243FA..VF--LLIV.....LLIEVAVAI.AAVAFKSD.............................................
Q7Q1S3_ANOGA/10-238FS..VL--LILI.....FILELAAGI.SGYVLRND.............................................
TSN32_HUMAN/10-222GF..LC--FSLA.....FCAQVQVVF.WRLHSPTQ.............................................
ROM1_BOVIN/17-291LL..VA--GTAG.....GGGLLVLALGLALALPGT.............................................
Q9VID1_DROME/9-227FA..LL--AVVI.....FLFEIGLGL.AGYVKHTG.............................................
Q245V1_TETTS/10-273YI..VC--LCIVVACSAIVFGVSAGA.YQIVQDSKDDTNCQKKDFLIYSRKVYEKAQTVFCSKD..CMCQVKQSYLNPNT
TSN12_HUMAN/10-247YF..GS--LLVI.....FCVELACGV...WTYEQELMVPV........................................
Q75IM5_ORYSJ/7-245YL..LA--MMLL.....IAFLLGLTA.FGFAVTAGGGGTQVP......................................
Q292V6_DROPS/10-210FV..SG--LVIVTMVAYFFTFAAMKGDLLAHFDER.............................................
A8WRV5_CAEBR/10-229YF..IL--VLIL.....FVIEVVAIV.LYFVKKTE.............................................
A1Z6T8_DROME/8-219YA..VL--LVFL.....LIVQIVLVSISYAASRDF.............................................
Q6NYK2_DANRE/16-288FF..GC--SIFF.....TTLMLISII.LSYIMKGS.............................................
Q7QJ21_ANOGA/10-221FC..AF--LVLF.....IVILFLVSG.WSVATKAH.............................................
A2DRK6_TRIVA/8-224YA..VL--YFII.....VVAECA....LLYFIYKTYPTLLHDL.....................................
H3D1H6_TETNG/10-250YG..FF--QFVT.....LIAALAAGL.SGLFYRED.............................................
Q16GP3_AEDAE/10-260YG..LF--LIVI.....LILEVTACG.LAAAYKES.............................................
TSN14_HUMAN/15-260FC..GT--IVLI.....FFLELAVAV.LAFLFQDW.............................................
TET5_ARATH/5-241YL..FF--MVFI.....IVALMGLTL.FGFIVTSHSGGVVVD......................................
Q7SXT2_DANRE/17-242YA..MF--LVLV.....FLAELVAGI.SGFIFRHE.............................................
CD63_MOUSE/10-230FA..IF--LSLI.....MLVEVAVAI.AGYVFRDQ.............................................
Q67WQ6_ORYSJ/5-255YL..LA--LFLL.....ILALFVFTV.FAFVVTNRGAGWVVS......................................
F1Q6P4_DANRE/9-244YF..TC--LLLI.....LLAQVAVSI.LIYFQRDL.............................................
H3CCQ2_TETNG/10-244YF..AC--LLLI.....LLAQITAGT.LIYFQKDA.............................................
Q9NB13_DROME/8-220YT..SM--VFVL.....FILQLVLTC.WVFVNRSA.............................................
Q06AT4_PIG/11-256YF..IL--MFIV.....YGFEVASCI.TAATQRDF.............................................
A2DY51_TRIVA/8-215YV..VC--LFLV.....LIVEIIILI.CMFLLTNV.............................................
M9PDV2_DROME/9-255YF..ML--IVML.....FMSEFLVGS.IAFLFRGG.............................................
Q4D6X7_TRYCC/24-264YF..IY--LFVV.....FLGAFSSSIAYVLVSTDR.............................................
F6ZCC3_XENTR/17-288YI..IC--TFFF.....TFCVFAGAI.MCYTTRNE.............................................
C4Q3U8_SCHMA/13-222FF..AF--VFFC.....FTLLMAAGL.WAVAWSSK.............................................
Q3UGA5_MOUSE/75-317YC..GA--VLFC.....LALEALAGV.LMVTLWKP.............................................
H3DF34_TETNG/10-245YF..TF--LLLI.....LIAQVTAGV.LIYFQRDR.............................................
Q24FE3_TETTS/6-262YN..VG--IIML.....FLLSIAILA.ISCIVQYEVPSYKNDEKCTQQSILIQLQQLN..............HKSSLTLC
Q29IZ2_DROPS/19-231FI..GT--QLFG.....FVALVAGSA.VTMQYSTI.............................................
Q86D97_SCHMA/8-230YF..TI--LIVI.....FATQVTGAT.LGYLYREE.............................................
Q9V3X2_DROME/10-260FF..CV--ILIV.....MVAQIAAGA.WAFHNKDK.............................................
Q24C21_TETTS/15-284FQ..IL--SIIL.....ALFFLVAGF.IFLGLTDSHFTDIKDSTCQDKGSNGTEIFYYGQEAYNSAFSLFCTQRCPCKVT
Q4S5B5_TETNG/9-229FF..IV--LLII.....LLAELILLI.LFFVYTDK.............................................
TSN6_BOVIN/17-236YA..MF--LTLI.....FLVELVAAI.IGFVFRHE.............................................
A1Z6U7_DROME/8-215FT..MF--ILIA.....LAAEY.....LQLHHYHSPSLRSPGGAWQ..................................
Q16HX5_AEDAE/10-217YG..FF--LMVL.....IIAQIVVAA.LVFIYVGD.............................................
Q19983_CAEEL/8-276FC..CI--LILA.....FFLELAAAV.TLFHKQEH.............................................
TSN5_HUMAN/15-260FS..VF--LGII.....FFLELTAGV.LAFVFKDW.............................................
Q7KJ73_DROME/8-218YA..TF--LLIL.....LILQLTFVV.LLFTHREE.............................................
A8X5P0_CAEBR/8-222FI..FI--IVIL.....TAVELGATI.FAMTNRNE.............................................
TSPD_DICDI/12-222YT..IL--MLVL.....LVVLIGIGGEALTYHNAD.............................................
Q5I0R1_XENTR/8-226FF..IG--LFLI.....LALQITAGV.LGAVYKPK.............................................
Q29JV1_DROPS/15-245YG..VC--LFLV.....FILEVSAAI.AAFVMQSQ.............................................
Q4D693_TRYCC/54-284FS..LL--LVIA.....AFVVLGTGVTVVIAYTQVV............................................
A1Z8K7_DROME/9-232FA..VL--LAVI.....FIVELAVGI.AASVFKKD.............................................
G4LW70_SCHMA/11-211YA..FF--LVVL.....LIAELAAAI.VAVVYKDR.............................................
TSPA_DICDI/15-222YC..AV--MLIL.....LVILIGVGGKAITLHNDD.............................................
F1R4A1_DANRE/13-253FV..AI--LLVV.....LLLQVTAAV.LGLLFSEK.............................................
Q16LT4_AEDAE/35-245YI..VL--FSIV.....VVLEIIVAI.SAYVMTHH.............................................
Q7JWV7_DROME/8-217YS..VV--MLVL.....LVSQLALII.YVWVDHVQ.............................................
Q7K2V7_DROME/8-218YA..IC--MLIL.....FGLQLALSI.WIFAANDK.............................................
Q16J92_AEDAE/10-259FF..SC--LLIV.....LVAEIAAGA.WAYHNSAK.............................................
Q16TV5_AEDAE/9-253YF..TL--VVLL.....FLSEFLLGS.LAFVFRGG.............................................
A0CWV3_PARTE/5-271YQ..IG--AILF.....FVLCTGLAI.GTLIYSSDLFGQECTNKDYFKLVDTQIQQ..................AEQIFC
Q22495_CAEEL/38-296YS..TL--LGLL.....LIAEFSAGV.FAYACRDQ.............................................
A2BIP5_DANRE/17-256FL..CV--LCVL.....LALQAIALI.IALIFEKT.............................................
Q16LT5_AEDAE/18-239YC..GL--LSVV.....FLLEVTATL.VGVHHRHE.............................................
H3DMZ9_TETNG/8-216FF..IG--LLLI.....FILLLAAGI.VGAVGESK.............................................
Q6P2T9_DANRE/10-229FA..II--LSLI.....VITEIGAGI.AGYIFRGK.............................................
TSN15_MOUSE/20-258FM..YI--LGIC.....LVMELIGGI.VALIFRNQ.............................................
Q17441_CAEEL/24-258YL..LM--LIFS.....MIMEGCLIY.FTFSYHAT.............................................
Q9XVI4_CAEEL/9-222FA..VL--LALL.....ITCEIAAVI.IGYALHDS.............................................
H3CSH9_TETNG/9-236FV..VI--LLLV.....FMTEVAVVV.LGYVYRAK.............................................
Q7K010_DROME/7-210FI..IF--LCLV.....IIAQFAVVY.LLITQEKT.............................................
Q292W4_DROPS/8-216YS..IL--LFVL.....MIGQLALVI.YMWLQKDK.............................................
Q1HRC5_AEDAE/14-233YF..IL--IFLI.....FVTMLIGGI.LGYVFREK.............................................
Q6YWS4_ORYSJ/5-273YA..SA--MFLL.....IVGMFFVTA.FVFVVTNRGVATAVS......................................
O44582_CAEEL/30-289FAACVF--LSYI.....LVVAVTLVF.FTLFYTDT.............................................
A2EZ30_TRIVA/8-218YA..IL--YFII.....VIAEIV....LVYFTVKAFPKIIDDT.....................................
H3DJN8_TETNG/8-231FF..LI--IMLI.....FAAEVAALV.FGFIYRGK.............................................
Q7JZW3_DROME/8-216YV..GA--VVLL.....ILAQLIFLGMSSHGTKDG.............................................
TSPB_DICDI/15-222YT..ML--MLII.....LVALIGVGGKALTLHNDD.............................................
TSN16_HUMAN/11-245CI..LS--MVIV.....LIMEVTAATVVLLFFPIV.............................................
Q7PTA7_ANOGA/10-219YS..FF--LILL.....VIAQIVIAV.LVFVFVGD.............................................
B4I8V1_DROSE/10-227FA..AL--LVAC.....ICVQFIICG.WSLAMREN.............................................
CD81_MOUSE/10-229FF..TC--LVIL.....FACEVAAGI.WGFVNKDQ.............................................
Q9W4X6_DROME/43-294YS..MC--LLLF.....FLLEMAIAI.VCFVCPQY.............................................
Q24C18_TETTS/15-277FQ..IF--SIAL.....SFSFLIVAF.VFLGMTDSHVFDIKDTNCQSKNDIFKYSQEAYDQA......NELFCSEQCPCK
TET2_ARATH/4-252YL..CC--MAIL.....IGLLLVVLI.FAFVVTRPDGSYRVP......................................
Q4DD38_TRYCC/91-307YV..GY--LVVL.....FIALFALIIAAAVYDRDTRV...........................................
H2VAF3_TAKRU/17-288FL..VF--CVVF.....NSLLFVTAL.LCFVMRFP.............................................
Q29JV0_DROPS/11-237FS..IM--LAII.....FILELSAGI.SGYVLRND.............................................
Q7JZW7_DROME/8-209IKVMVV--NLIL.....LLALIASHI.WKVSHYNETKQ..........................................
TSN10_HUMAN/76-318FS..GG--ILAF.....LVLEAVAGA.LVVALWGP.............................................
Q7K527_DROME/8-207YA..SL--LLIL.....LLLIVAFII...LNPKDV.............................................
L9JBT3_TUPCH/22-369FS..LC--LTVV.....FLLQLAAGV.LGFVFSDK.............................................

PF04103

FCERB_HUMAN/60-204SL--GA--NTAS-----SIAGGTGIT-ILIINLKK---------------------------------------------
FCERB_MOUSE/52-195SL--GA--NIVS-----SIAAGTGIA-MLILNLTN---------------------------------------------
T176B_HUMAN/66-229SS--LL--TLAG-----FATAMAAVV-LCVNSFIW---------------------------------------------
A6H741_BOVIN/62-223SG--LL--TLAG-----IATAVAAVV-FCVNSFIW---------------------------------------------
T176B_MOUSE/60-224SC--LL--LLAC-----IATAAAATV-LGVNSLIR---------------------------------------------
T176B_RAT/60-224SR--LL--LLAC-----SATAAAATV-MGVKSLIW---------------------------------------------
T176A_RAT/63-223RI--LL--VLAS-----FCTAVAAIV-IGSREFNN---------------------------------------------
T176A_HUMAN/56-214RT--LL--TLAA-----FSTAIAALK-LWNEDFRY---------------------------------------------
T176A_BOVIN/63-220RT--LL--ALAA-----FSTATAATI-IGAGRFYE---------------------------------------------
Q4TAI3_TETNG/57-208NV--HL--NIVG-----LAFAVAAIV-LYSQSLAD---------------------------------------------
A7SQ32_NEMVE/7-164FI--GC--SLVG-----LVTLFVCAI-IIGLGVLQ---------------------------------------------
Q95PZ5_CAEEL/94-253HL--TL--SLVS-----VMMCLISGG-LSARNWAL---------------------------------------------
Q9GYM6_CAEEL/45-206YL--VM--CIHS-----IFIFVPAII-TVSSFDIH---------------------------------------------
Q1LVQ8_DANRE/42-197QF--VI--KLLY-----FFLCTMGLV-MSVVVIAF---------------------------------------------
H3D3M7_TETNG/37-190QF--IC--EVLY-----FILCSIGLV-LSVLVVAF---------------------------------------------
Q3TRE0_MOUSE/29-182QF--SM--KVFY-----FLLSALGLM-VCMLAVAF---------------------------------------------
A7S4D6_NEMVE/20-179FT--FF--SAVC-----VVLHMIGTI-LTGEVGGL---------------------------------------------
Q0V9M1_XENTR/36-200FM--LL--SAVC-----VMLNLAGSI-LSCQNAQL---------------------------------------------
F6PJ14_XENTR/5-167FV--ML--SVVC-----VLLNLAGFI-LGCQGAQF---------------------------------------------
F189B_MOUSE/36-196FS--LL--SVLC-----VMLSMAGSV-LSCKNAQL---------------------------------------------
Q5BLA7_DANRE/16-153MI--VS--SVVS-----LFAVVIVFV-YACVTLSY---------------------------------------------
F7AIP4_XENTR/16-154LI--AA--SVFS-----CFTTLIVIV-YASLTLGY---------------------------------------------
Q08BU9_DANRE/43-180SF--AL--SIIS-----TIGVVSACM-DFIKSMVI---------------------------------------------
F1RAY4_DANRE/49-184SL--AL--SIVS-----TFGVIFAVL-DISQHISH---------------------------------------------
F7ESV6_XENTR/53-198SM--AL--NIVS-----CVCAAIAVI-IYIVIILD---------------------------------------------
H3C9F3_TETNG/67-212AA--LS--NGIS-----ALVGLVGVA-YLGFLMAS---------------------------------------------
MS4A3_MOUSE/27-172SF--GI--NIAS-----TTIAFVGTV-FLSVHLAF---------------------------------------------
MS4A3_HUMAN/50-196SF--GM--NIAS-----ATIALVGTA-FLSLNIAV---------------------------------------------
M4A4A_HUMAN/65-207SL--GM--NITS-----SVLAASGIL-INTFSLAF---------------------------------------------
M4A6C_MOUSE/47-207SL--TL--NILS-----VSFAFVGII-IISVSLAG---------------------------------------------
M4A6B_MOUSE/47-204SL--TL--NILS-----VSFAFMGII-IISVSLAG---------------------------------------------
M4A6D_MOUSE/47-207SL--AL--SILS-----VLSALTGIA-ILSVSLAA---------------------------------------------
MS4A7_HUMAN/47-207SL--TS--NAVS-----SVTAGAGLF-LLADSMVA---------------------------------------------
F6RP33_BOVIN/48-208SL--IF--SAVS-----SVAAGVGLI-LLAGSLVA---------------------------------------------
Q99N04_MOUSE/47-204SL--AS--NVAS-----SVVAVIGLF-LFTYCLIA---------------------------------------------
MS4A5_HUMAN/49-189SR--IM--NFLS-----ALGAIAGII-LLTFGFIL---------------------------------------------
Q810P8_MOUSE/49-189SR--AM--NLLS-----ALGAAAGII-LLIFGFLL---------------------------------------------
Q2KII2_BOVIN/49-189SR--IM--NSLS-----AVAAAAGII-LLIIGFLI---------------------------------------------
Q3LRP2_CALJA/51-216KM--IM--NSLS-----LFAAIAGMI-LSIMDILN---------------------------------------------
CD20_MOUSE/44-210KV--IM--SSLS-----LFAAISGII-LSIMDILN---------------------------------------------
CD20_CANFA/51-216KM--IM--NSLS-----LFAAISGII-FLIMDIFN---------------------------------------------
W5PU80_SHEEP/51-216RI--IM--NSLS-----LFAAISGII-FLIMDIFN---------------------------------------------
M3VZQ9_FELCA/52-215KM--IM--NSLS-----LFAAISGMI-LLIMDIFN---------------------------------------------

PF13273

Q8Y8F2_LISMO/3-121AL--TG..GLIT-----LALGIFGIY-YIF....K---------------------------------------------
Q8Y8B4_LISMO/3-92LG--WI..TLIA-----SVVALIASL-LIK....S---------------------------------------------
C7N721_SLAHD/168-273AT--VI..AIVA-----IVVSLLAVF-MGK....K---------------------------------------------
G2TQJ8_BACCO/2-106IA--VV..LIIG-----TVIGIVAAV-QLR....N---------------------------------------------
U5LDQ7_9BACI/5-123FL--VF..WLLM-----LFLNLAGIL-TIK....K---------------------------------------------
E8SF89_STAPH/28-121TF--LL..ALIP-----LVFAIVAVF-IFK.....---------------------------------------------
F9UT90_LACPL/16-98LG--VG..CIIV-----SVLAIILSV-MIN....R---------------------------------------------
B5IAA3_ACIB4/5-90CA--IV..GIIG-----SVLGFLAAF-WMR.....---------------------------------------------
O26620_METTH/8-82LG--MS..AILA-----SILGIIGSV-YVR....N---------------------------------------------
C2X4G3_BACCE/18-98YS--II..LTVQ-----IGLLILSCL-VNK....V---------------------------------------------
I0JHL5_HALH3/2-113VM--VA..ALVA-----IALGILSIV-FLK....G---------------------------------------------
A3DKS5_STAMF/4-94LG--LW..WLIA-----GIIIIVGSI-WINSGVPS---------------------------------------------
E8SF88_STAPH/14-126FI--VY..LIIC-----LLISFLALI-SMN.....---------------------------------------------
Q65KT1_BACLD/2-84LG--WG..AIFL-----SILGIIASV-IVR....K---------------------------------------------
A5F9L1_CLOK5/1-82IS--FI..GLIL-----QIVGLVYAL-MVE....S---------------------------------------------
D3FS61_BACPE/1-122PI--GA..LILS-----AALTVVSLF-ILN....K---------------------------------------------
Q5HQ65_STAEQ/2-105SL--VI..LGFS-----TLLGFVGTM-VIE....G---------------------------------------------
K0J606_AMPXN/3-111GV--IT..LVLA-----EAAGIVSIL-LLK....N---------------------------------------------
B9EB15_MACCJ/41-157FL--AY..SLIP-----IILGLIGLL-KMK.....---------------------------------------------
Q8ERL5_OCEIH/2-100PA--VM..YFIS-----FILGLIGVL-KLK....V---------------------------------------------
A0B9F9_METTP/2-84LG--FG..AILF-----GIIGIVGGA-LVT....H---------------------------------------------
Q5HKY5_STAEQ/3-109FI--II..LLIL-----LIVSIVAAI-LIG....K---------------------------------------------
A5UL06_METS3/42-117LG--IS..ALLA-----SIVGIVGSV-YVK....N---------------------------------------------
B9DJ67_STACT/3-106GL--VL..GIIT-----LILAIIGGV-FIN....K---------------------------------------------
B9DJA4_STACT/148-230QA--IG..VIFV-----CIVTIVISC-IIN....K---------------------------------------------
B9DPZ9_STACT/15-127VI--VY..LIVC-----LLISFLALI-SMN.....---------------------------------------------
Q65EV2_BACLD/2-89YT--YL..SIPL-----LVLIWVATF-KVK....A---------------------------------------------
K8E281_CARML/2-111IS--AI..FIAT-----AIFGFIAAF-KVK....K---------------------------------------------
C3AKH5_BACMY/2-83YS--IL..LIIQ-----IGLLVLACS-VNK....V---------------------------------------------
T0TBR3_9STRE/2-102IM--IF..GLVI-----LVMGIITFL-VTRFIEDE---------------------------------------------
D7CIL7_SYNLT/1-83LG--VT..AIFF-----SLLGLVGGA-LAL....K---------------------------------------------
Q3Y3E6_ENTFC/2-107TG--LFAVVLFI-----SLAFLAVAL-FLT....A---------------------------------------------
Q12UE5_METBU/2-98MG--FGTVTLIL-----GLIGIAGGI-VAK....T---------------------------------------------
V5XRN1_ENTMU/2-106TG--VFNVSLFL-----SLVGLCLAL-YLS....L---------------------------------------------
Q2G173_STAA8/1-105LF--IF..GIIS-----IILGAIGMF-KAS....K---------------------------------------------
Q81BB0_BACCR/2-82YS--II..LTVQ-----IGFFILSCL-VNK....V---------------------------------------------
Q5HQP3_STAEQ/1-105IF--IV..AIFS-----IIFGIIGMM-KKK....T---------------------------------------------
E6TU87_BACCJ/2-115LI--IL..SVVA-----IVLGIVAMV-LLK....G---------------------------------------------
A8FJ46_BACP2/3-107YM--VV..SIIA-----AVLSIVGVI-LLK....T---------------------------------------------
Q8Y9W6_LISMO/2-106AA--FF..ALGS-----AVFGFIGAF-KVK....S---------------------------------------------
Q5HQ66_STAEQ/14-126II--VY..FIVC-----LLISFLALI-SMN.....---------------------------------------------
S6C3Q0_9ACTN/167-273AL--VI..AAIA-----LVVALIGAL-AGK....K---------------------------------------------
B8D0X9_HALOH/8-93YM--WV..CLIG-----AVLGLIFAI-RSK....K---------------------------------------------
Q81UE0_BACAN/2-84LG--WA..AVAL-----SILGIVGSV-MVK....S---------------------------------------------
Q97LL2_CLOAB/4-86LG--IV..AILF-----SVLGIVGAV-FVR....T---------------------------------------------
Q5WAY8_BACSK/3-120YT--LA..SFIA-----GVAGIVAVV-LVG....K---------------------------------------------
A5N2M2_CLOK5/4-86FG--IG..AIIL-----SILGIIGAL-IVK....N---------------------------------------------
A5UKZ4_METS3/8-83LG--LI..ATLG-----SFLGIFASI-HVF....K---------------------------------------------
B9DQ00_STACT/2-98EA--VA..LIVV-----ALIAAVGIV-LSK....K---------------------------------------------
Q8Y911_LISMO/3-104FS--II..ALVL-----GIALIVFAV-LIK....R---------------------------------------------
L0EGZ3_THECK/2-105FI--TP..GLIG-----IALGLCAVW-LLK....G---------------------------------------------
Q2G2G5_STAA8/2-104LA--II..LLIS-----TLYGIFATI-CIK....G---------------------------------------------
R5AN22_9FIRM/46-142CF--LV..GLII-----FVIGIIIYL-KPE....R---------------------------------------------
Q8YAT4_LISMO/1-81LT--IG..SLVL-----SGVGLAGSF-IVS....H---------------------------------------------
Q2G2G6_STAA8/14-126II--VY..FIVC-----LLISFLALI-SMN.....---------------------------------------------

PF00335

TET6_ARATH/5-240.........GRIYKEYRLGDY.HPW.LRERVRDP.EYWNSIRSCILSSKTCTKI.................ESWTTLDYF
B3DL95_XENTR/9-226................FHNYA.QED.LKKGL.QLYNTTGNLGL.....................................
TSN8_HUMAN/8-233......................SDRIVNETLYENTKLLSATGESEK................................QF
Q7T376_DANRE/7-212..........................IENFIKDDLVDGLNQSIKNRKQ.............................HNT
Q6Z8Q8_ORYSJ/6-255.........GRGYREYRLGDY.STW.LRRHVGSS.KNWDKIRSCLAGADVCRSLQ...............DRNETWAQFV
Q16HS1_AEDAE/10-224................NRHDY.LEW.FDEYFDHNISVSKASSVV....................................
TSN11_BOVIN/16-247................LSDEL.KQH.LTRTLAENYRQPGAAEI.....................................
Q22RT6_TETTS/14-273VYSNFYFANNGVERLDECNNY.THK.IDINFSYDYNNYNDYLRNL...................................
A0EF92_PARTE/8-262NLLCSAECQCYIEDPTNLPTAYFNHTTNSSAANRVQDCSSFDNWDSSR.............................RSQ
TET9_ARATH/5-254.........GKAYKEYRLEAY.SDW.LQRRVNNA.KHWNSIRSCLYESKFCYNLEL.............VTANHTVSDFY
TSN8_BOVIN/8-234......................TEQALNKTLLINARLLSSTDENER................................VF
A0BI34_PARTE/8-266KSSCECYYSEKMTKEVELAVKSYSA.TDKTKPTRVQDCPGFDSKYK................................TQ
TET11_ARATH/5-258.........GRGYKEYRTVDF.STW.LNGFVGG..KRWVGIRSCLAEANVCDDLSD.............GRVSQIADAFY
Q5ZII8_CHICK/16-246................LSTEL.KEN.LKNTMTEKYRKEGEERV.....................................
TSN33_MOUSE/22-263................ARGKV.SEI.INNAI.VHYRDDLDL.......................................
CD37_RAT/11-269................LERRV.QEL.VLRTI.QSYRTNPDETAA....................................
G7NV03_MACFA/7-238............FLTLL.........VVPAIKKDYGSQKDF.......................................
Q6Z5Z9_ORYSJ/6-259.........GRGFREYHLGDY.STW.LRRSVEDG.GHWARIRSCLVDTGVCRSL................KSNQTLDEFV
TET15_ARATH/54-309..............SRRFPAT.RMW.FKLKIMDDHVTWNNIKSCVYDKGACNDLI...............YGSPNEKPYN
Q6DHQ4_DANRE/9-229................IDLYA.QND.LKKGL.QLFGTEGNIGL.....................................
M4EKP0_BRARP/5-250.........DKGIGNVKTGDL.QNW.IGDHFLQG.KNWEGIKRCMADSSICRF...................RPRDVDFD
A0BP70_PARTE/8-281APGCQCYYTGSMTESTSESVQFYSS.SNSDLPIRIQQCQQYNDYKSDY.............................DEE
TET13_ARATH/17-268.........GTKIYEFRYEDY.SGW.VSRLVIKD.DEWYRTRRCLVKDNVCNRL................NHKMPASEFY
TSPE_DICDI/17-217........................EKLQHKIENIWYKVGNYQHHSKH...............................YH
Q29D35_DROPS/10-258................VRAES.KNF.LQTTITSYSLGENVDAS.....................................
A8XFB8_CAEBR/16-252..........................LTHYTPLNLKMLTSLRELYGTHD...........................MKGI
Q9VMJ6_DROME/19-264...............WIKDQATEGL...KAFIRHYREDADQ.......................................
Q16HS3_AEDAE/7-220..............YLEVQRF.EME.FDHVLRTGIS............................................
Q9FVY6_ORYSJ/6-253.........GVRYKEYRLQDY.SSW.FIKQLNDT.EKWTHLRSCLVKSDDCNGLS...............RRYKTLKQYK
CD82_HUMAN/9-255................LKQEM.GGI.VTELI.RDYNSSREDSL.....................................
Q16LT3_AEDAE/15-238................VKEMV.RRT.LNESM.ASYNDNANV.......................................
Q6Z6K0_ORYSJ/4-255.........GRAYDEYHLDGF.SMW.LRGYVSDDPARWERIKACLVVSDTCKKLAR.............QAGFLTADQFY
Q176T5_AEDAE/21-243................LQNAL.QSQ.LEKSISRRNKAD..........................................
Q7Q1S3_ANOGA/10-238................TRELV.SNA.LNSSM.KSYGGENAGDI.....................................
TSN32_HUMAN/10-222..........................VEDAMLDTYDLVYEQAMKGTS..............................HVR
ROM1_BOVIN/17-291..........................LDTGLEEGLGSALVHYKDTEVPG...........................RCQA
Q9VID1_DROME/9-227................LHQIM.ESQ.FNSTM.QHYKERADY.......................................
Q245V1_TETTS/10-273ISSWNWSETQGKVKSQDCPTF.NQS.IDFTIPSDIGNLSDL.......................................
TSN12_HUMAN/10-247...........QWSDMV.......T.LKARM..........TNYGLPR............................YRWL
Q75IM5_ORYSJ/7-245.........GRPYREYHTSDY.SSW.LQKHIQDA.KYWRPALACVVGSKACPKI.................ANWSPMDYL
Q292V6_DROPS/10-210..........................VRQLFEEKTHS...........................................
A8WRV5_CAEBR/10-229..........................LQQGLTTIWRDELVSKYNNNQ...............................QI
A1Z6T8_DROME/8-219..........................LPDSLRQGLDDLWDLQHEG...................................
Q6NYK2_DANRE/16-288..........................LETSLKIGLKNGIRFYKDTDIPG...........................RCFQ
Q7QJ21_ANOGA/10-221..........................LIVPAEVAIETSFTEFLAKDNT.............................NDQ
A2DRK6_TRIVA/8-224........DTWWDKNKG...............................................................
H3D1H6_TETNG/10-250..........................IAGGFRSGLQRAVAGYTEDE................................GR
Q16GP3_AEDAE/10-260................AKTET.KNY.LQTTISKYYSSNDRNQSDA..................................V
TSN14_HUMAN/15-260................VRDRF.REF.FESNI.KSYRDDIDL.......................................
TET5_ARATH/5-241.........GRVYKEFKLEAY.HPW.LKTRVVDT.NYWVTIKTCLLGSVTCSKL.................ALWTPLDYL
Q7SXT2_DANRE/17-242..........................IKAVLKGAYQKAESNYMGK..................................D
CD63_MOUSE/10-230..........................VKSEFNKSFQQQMQNYLKDN................................KT
Q67WQ6_ORYSJ/5-255.........GRGYREYRLGDY.STW.LQRRVENS.ANWAKIRSCLQDGKVCEKLG...............ARRETMDQFV
F1Q6P4_DANRE/9-244................LKTEA.DKI.VSQVV.ANYPGQNKTA......................................
H3CCQ2_TETNG/10-244................LHEET.FKV.IGTVL.DGYPGNNSSV......................................
Q9NB13_DROME/8-220..........................FLGDMSNLVNLLWDSHD.....................................
Q06AT4_PIG/11-256....................FTPNLFLKQMLERYQNNSPPSNDDKWKN.............................NGV
A2DY51_TRIVA/8-215..........................VMDFAETKWNKGVTDKGM....................................
M9PDV2_DROME/9-255................LGRTL.ANE.LRFGIERHYNSSDRGSLVAP................................SV
Q4D6X7_TRYCC/24-264............................VNLQTGWDKAAVSN......................................
F6ZCC3_XENTR/17-288..........................LESALYRGLKDALKNYKDTDIPG...........................RCFL
C4Q3U8_SCHMA/13-222................VNHYM.YRY.LEEQVIRYRETEPENES.....................................
Q3UGA5_MOUSE/75-317..........................LQDSLKYTLHAAIIHYWDDP................................DL
H3DF34_TETNG/10-245................LKHEM.SDI.IKDMI.VTYTGVNRTA......................................
Q24FE3_TETTS/6-262QNDCLCNFKGTQEEADKLGIN.NFN.HKDSSPVRVQDCQIFEDFQFEN............................QSEN
Q29IZ2_DROPS/19-231.................NSSL.QPL.LNVSLRRFVSTSEYTYS.....................................
Q86D97_SCHMA/8-230..........................IMKYVDDRMREGIEEYSMLRD...............................QR
Q9V3X2_DROME/10-260................LDDIV.RAA.VKSSVQEEYGQSTMSSR.....................................
Q24C21_TETTS/15-284NTEVKSYITKNYIQMVPF........MQDNGSVKVQDCQDYKTVFSNSD...........................VKNQ
Q4S5B5_TETNG/9-229................VSENA.RRD.LKEGL.ALYTTDNNAGL.....................................
TSN6_BOVIN/17-236..........................IKNSLKNNYEKALKQYNATGD...............................YR
A1Z6U7_DROME/8-215.....QLELAWHGLDRD...............................................................
Q16HX5_AEDAE/10-217..........................AKAAFKKGFARLFDERDRPQ.................................N
Q19983_CAEEL/8-276..........................IKHYVESSMYDTIRNRYSS..................................E
TSN5_HUMAN/15-260................IKDQL.YFF.INNNI.RAYRDDIDL.......................................
Q7KJ73_DROME/8-218..........................FENAMGNVIENAWNSEHTY..................................K
A8X5P0_CAEBR/8-222..........................FVSSIQQVLEKSSSAPEL....................................
TSPD_DICDI/12-222..........................IGIEIEDNWKNISYSNQ.....................................
Q5I0R1_XENTR/8-226..........................IEAQLNQTFYKLLPLSGQDE................................SF
Q29JV1_DROPS/15-245................VRDML.MRT.MYQSM.ANYETDPYV.......................................
Q4D693_TRYCC/54-284...............SSDDSL.ALY.WERAVSNT..............................................
A1Z8K7_DROME/9-232................LEGMV.KNS.LQESIKRSNSED..........................................
G4LW70_SCHMA/11-211..........................IDSEIDALMTGALDKPTKE..................................I
TSPA_DICDI/15-222..........................IINEVGGAWEHVANGTK.....................................
F1R4A1_DANRE/13-253................VQERT.EQL.MMKAI.VRYRDDQDL.......................................
Q16LT4_AEDAE/35-245..........................VDDMLTIRMNNAFAQYRYDP................................DV
Q7JWV7_DROME/8-217..........................IQQSLEKIVQTIWDQRKTD...................................
Q7K2V7_DROME/8-218..........................FLSSMGKAVDKAWDENNAA..................................Q
Q16J92_AEDAE/10-259................LDSYV.RSA.VKEAVQDEYSVVATR.......................................
Q16TV5_AEDAE/9-253................IGRMMVHE..LKYGIEKHYNVSDRGGIFAP................................SV
A0CWV3_PARTE/5-271SSYCQCYITEETLNRNQTAFAGKNYTTDKNVEQKIEKIQECPGYEVNA............................YSAA
Q22495_CAEEL/38-296................LDNYIRN...LLNDVVVGYRDDPDL.......................................
A2BIP5_DANRE/17-256................TIKLF.QNS.IREGI.KHYYDDLDF.......................................
Q16LT5_AEDAE/18-239................VNGFL.AQS.LNGSL.QRYPWNSHI.......................................
H3DMZ9_TETNG/8-216......................VQEWVKDRLEEKFSPLSSKPESV...................................
Q6P2T9_DANRE/10-229................VNELLDQSF...NTMIAGYNKTEEY.......................................
TSN15_MOUSE/20-258................TIDFL.NDN.IRRGI.ENYYDDLDF.......................................
Q17441_CAEEL/24-258....................Y.EQE.LNASLPNDILNNYNLDPNI...................................
Q9XVI4_CAEEL/9-222................FRLGI.GNQ.LQTGMVRYHESRGV........................................
H3CSH9_TETNG/9-236..........................VEDEVNSSIKKVFDQYNGVNS..............................NAQ
Q7K010_DROME/7-210....................V.ASN.LANALEATWEEELNS.......................................
Q292W4_DROPS/8-216..........................YLVIMGDVVEKAWERRTRR...................................
Q1HRC5_AEDAE/14-233..........................VSQTMQQEMHSSMTFYGAYGK..............................RSI
Q6YWS4_ORYSJ/5-273.........GTGYGDYRVRDY.SEW.LRARIEDY.ETWHRIESCMADAAVCGGPLAGINPGEFYRLHLPLIQCELNTTVV
O44582_CAEEL/30-289................TEGLS.ANW.LLLYAVKNYHTNRNL.......................................
A2EZ30_TRIVA/8-218........EDWWNENKG...............................................................
H3DJN8_TETNG/8-231..........................ISKDLDRSMTEVFNKYDGTS................................AE
Q7JZW3_DROME/8-216..........................ISGSINEGFDRLWESERNQ...................................
TSPB_DICDI/15-222..........................VVKQIGNAWEDVSNGPK.....................................
TSN16_HUMAN/11-245..........................GDVALEHTFVTLRKNYRGYNEP.............................DDY
Q7PTA7_ANOGA/10-219..........................VTTAIKKGFERVFENRDNPV.................................N
B4I8V1_DROSE/10-227..........................LPTSVEIFIDDSFVEFLDKFSRT...........................KVDN
CD81_MOUSE/10-229..........................IAKDVKQFYDQALQQAVMDDDA.............................NNA
Q9W4X6_DROME/43-294................MNTFL.EKQ.FTHKIIHSYRDDPDL.......................................
Q24C18_TETTS/15-277VTDEDVKEYLEDTDYII.........DNVNGKTKVQDCDDFKKYFSDSD...........................VNDS
TET2_ARATH/4-252.........GRGYKEYRLEGF.SNW.LKENVVDS.KNWGRLRACLADTNVCPKLN..............QEFITADQFFS
Q4DD38_TRYCC/91-307.............SVMDPSKF.LDA.WKRGVNNTKTGR..........................................
H2VAF3_TAKRU/17-288..........................LQFTLAEGLRNGMKYYKDTDTPG...........................RCYM
Q29JV0_DROPS/11-237................ASSLI.KTS.LTESL.KDYNTFTQSPT.....................................
Q7JZW7_DROME/8-209............LDATEVYVM.DLW.MKELVH................................................
TSN10_HUMAN/76-318..........................LQDSLEHTLRVAIAHYQDDP................................DL
Q7K527_DROME/8-207..........................FKKYALQTVENQWELEQTK...................................
L9JBT3_TUPCH/22-369................ARGKV.SEI.INNAI.VHYRDDLDL.......................................

PF04103

FCERB_HUMAN/60-204--------------------------SLAYIHI...............--------------------------------
FCERB_MOUSE/52-195--------------------------NFAYMNN...............--------------------------------
T176B_HUMAN/66-229--------------------------QTEPFLYIDTVCDRSDPV.FPT--------------------------------
A6H741_BOVIN/62-223--------------------------QYDGFYDISSVCDSLVP...VT--------------------------------
T176B_MOUSE/60-224--------------------------QTSVPYYVEIFSTCNPLQSSMD--------------------------------
T176B_RAT/60-224--------------------------QTSASYYFEISSTCDSLQPSIV--------------------------------
T176A_RAT/63-223--------------------------YWYYLRDDVCKSDTSY....RW--------------------------------
T176A_HUMAN/56-214--------------------------GYSYYNSACRISSSS......D--------------------------------
T176A_BOVIN/63-220--------------------------YHFIFYKGICNVSPS.......--------------------------------
Q4TAI3_TETNG/57-208--------------------------LYIRWICERDY...........--------------------------------
A7SQ32_NEMVE/7-164--------------------------HFKFESSINREYY.........--------------------------------
Q95PZ5_CAEEL/94-253--------------------------VGTYHHPRIDRDEAFC....LL--------------------------------
Q9GYM6_CAEEL/45-206--------------------------FYQHECWGECDWHLLA.....T--------------------------------
Q1LVQ8_DANRE/42-197--------------------------QCYHYTLTNSFSC.........--------------------------------
H3D3M7_TETNG/37-190--------------------------AGHHYSQASGFSC.........--------------------------------
Q3TRE0_MOUSE/29-182--------------------------AAHHYSLLAQFTC.........--------------------------------
A7S4D6_NEMVE/20-179--------------------------LKSVLECQFSEVDQSC.....I--------------------------------
Q0V9M1_XENTR/36-200--------------------------VSSLEGCQLINFNSDGVCVCCE--------------------------------
F6PJ14_XENTR/5-167--------------------------VSSVPSCQLVEMNEGKVC.VCC--------------------------------
F189B_MOUSE/36-196--------------------------ARDFRECSMEGKVCVC....CP--------------------------------
Q5BLA7_DANRE/16-153--------------------------GEEDDEI...............--------------------------------
F7AIP4_XENTR/16-154--------------------------GEDDDDI...............--------------------------------
Q08BU9_DANRE/43-180--------------------------IERQDEY...............--------------------------------
F1RAY4_DANRE/49-184--------------------------NRWMVWF...............--------------------------------
F7ESV6_XENTR/53-198--------------------------IHYYRAH...............--------------------------------
H3C9F3_TETNG/67-212--------------------------YRPAKLFCDDA...........--------------------------------
MS4A3_MOUSE/27-172--------------------------NTQAFKG...............--------------------------------
MS4A3_HUMAN/50-196--------------------------NIQSLRS...............--------------------------------
M4A4A_HUMAN/65-207--------------------------YSFHHPY...............--------------------------------
M4A6C_MOUSE/47-207--------------------------LHPASEQCKQSKEL........--------------------------------
M4A6B_MOUSE/47-204--------------------------LHPASEQCLQSK..........--------------------------------
M4A6D_MOUSE/47-207--------------------------LEPALQQCKLAFTQ........--------------------------------
MS4A7_HUMAN/47-207--------------------------LRTASQHCGSEMDY........--------------------------------
F6RP33_BOVIN/48-208--------------------------LRTASQQCDSGRDY........--------------------------------
Q99N04_MOUSE/47-204--------------------------LGSAFPHCNSEKKF........--------------------------------
MS4A5_HUMAN/49-189--------------------------DQNYICG...............--------------------------------
Q810P8_MOUSE/49-189--------------------------DGEFICG...............--------------------------------
Q2KII2_BOVIN/49-189--------------------------DRDFLCG...............--------------------------------
Q3LRP2_CALJA/51-216--------------------------IKLSHFLKMESLNLIRA..YTP--------------------------------
CD20_MOUSE/44-210--------------------------MTLSHFLKMRRLELIQT..SKP--------------------------------
CD20_CANFA/51-216--------------------------ITISHFFKMENLNLIKA..PMP--------------------------------
W5PU80_SHEEP/51-216--------------------------MTISHFFKMENLNLIKT..QMP--------------------------------
M3VZQ9_FELCA/52-215--------------------------IAISHFFKMENLNLLKSP.KPY--------------------------------

PF13273

Q8Y8F2_LISMO/3-121--------------------------------------------------------------------------------
Q8Y8B4_LISMO/3-92--------------------------------------------------------------------------------
C7N721_SLAHD/168-273--------------------------------------------------------------------------------
G2TQJ8_BACCO/2-106--------------------------------------------------------------------------------
U5LDQ7_9BACI/5-123--------------------------------------------------------------------------------
E8SF89_STAPH/28-121--------------------------------------------------------------------------------
F9UT90_LACPL/16-98--------------------------------------------------------------------------------
B5IAA3_ACIB4/5-90--------------------------------------------------------------------------------
O26620_METTH/8-82--------------------------------------------------------------------------------
C2X4G3_BACCE/18-98--------------------------------------------------------------------------------
I0JHL5_HALH3/2-113--------------------------------------------------------------------------------
A3DKS5_STAMF/4-94--------------------------------------------------------------------------------
E8SF88_STAPH/14-126--------------------------------------------------------------------------------
Q65KT1_BACLD/2-84--------------------------------------------------------------------------------
A5F9L1_CLOK5/1-82--------------------------------------------------------------------------------
D3FS61_BACPE/1-122--------------------------------------------------------------------------------
Q5HQ65_STAEQ/2-105--------------------------------------------------------------------------------
K0J606_AMPXN/3-111--------------------------------------------------------------------------------
B9EB15_MACCJ/41-157--------------------------------------------------------------------------------
Q8ERL5_OCEIH/2-100--------------------------------------------------------------------------------
A0B9F9_METTP/2-84--------------------------------------------------------------------------------
Q5HKY5_STAEQ/3-109--------------------------------------------------------------------------------
A5UL06_METS3/42-117--------------------------------------------------------------------------------
B9DJ67_STACT/3-106--------------------------------------------------------------------------------
B9DJA4_STACT/148-230--------------------------------------------------------------------------------
B9DPZ9_STACT/15-127--------------------------------------------------------------------------------
Q65EV2_BACLD/2-89--------------------------------------------------------------------------------
K8E281_CARML/2-111--------------------------------------------------------------------------------
C3AKH5_BACMY/2-83--------------------------------------------------------------------------------
T0TBR3_9STRE/2-102--------------------------------------------------------------------------------
D7CIL7_SYNLT/1-83--------------------------------------------------------------------------------
Q3Y3E6_ENTFC/2-107--------------------------------------------------------------------------------
Q12UE5_METBU/2-98--------------------------------------------------------------------------------
V5XRN1_ENTMU/2-106--------------------------------------------------------------------------------
Q2G173_STAA8/1-105--------------------------------------------------------------------------------
Q81BB0_BACCR/2-82--------------------------------------------------------------------------------
Q5HQP3_STAEQ/1-105--------------------------------------------------------------------------------
E6TU87_BACCJ/2-115--------------------------------------------------------------------------------
A8FJ46_BACP2/3-107--------------------------------------------------------------------------------
Q8Y9W6_LISMO/2-106--------------------------------------------------------------------------------
Q5HQ66_STAEQ/14-126--------------------------------------------------------------------------------
S6C3Q0_9ACTN/167-273--------------------------------------------------------------------------------
B8D0X9_HALOH/8-93--------------------------------------------------------------------------------
Q81UE0_BACAN/2-84--------------------------------------------------------------------------------
Q97LL2_CLOAB/4-86--------------------------------------------------------------------------------
Q5WAY8_BACSK/3-120--------------------------------------------------------------------------------
A5N2M2_CLOK5/4-86--------------------------------------------------------------------------------
A5UKZ4_METS3/8-83--------------------------------------------------------------------------------
B9DQ00_STACT/2-98--------------------------------------------------------------------------------
Q8Y911_LISMO/3-104--------------------------------------------------------------------------------
L0EGZ3_THECK/2-105--------------------------------------------------------------------------------
Q2G2G5_STAA8/2-104--------------------------------------------------------------------------------
R5AN22_9FIRM/46-142--------------------------------------------------------------------------------
Q8YAT4_LISMO/1-81--------------------------------------------------------------------------------
Q2G2G6_STAA8/14-126--------------------------------------------------------------------------------

PF00335

TET6_ARATH/5-240QR...DMTSVQS....................................................................
B3DL95_XENTR/9-226TN...AWDIVQTEF..................................................................
TSN8_HUMAN/8-233QE...AIIVFQEEF..................................................................
Q7T376_DANRE/7-212TD...DWDKVQETF..................................................................
Q6Z8Q8_ORYSJ/6-255AD...DLSPVQS....................................................................
Q16HS1_AEDAE/10-224DP...VIDYLQTTY..................................................................
TSN11_BOVIN/16-247TA...SVDRLQQDF..................................................................
Q22RT6_TETTS/14-273VN...LLRTAEESF..................................................................
A0EF92_PARTE/8-262AK...LFKSLEKKY..................................................................
TET9_ARATH/5-254KE...DLTAFES....................................................................
TSN8_BOVIN/8-234QK...AFSELQEEL..................................................................
A0BI34_PARTE/8-266AA...ALQLMEEKW..................................................................
TET11_ARATH/5-258HK...NLSPIQS....................................................................
Q5ZII8_CHICK/16-246TS...AVDKLQQEF..................................................................
TSN33_MOUSE/22-263QN...LIDFGQKKF..................................................................
CD37_RAT/11-269EE...SWDYAQFQL..................................................................
G7NV03_MACFA/7-238TQ...VWNTTMTEL..................................................................
Q6Z5Z9_ORYSJ/6-259NS...NLSPLQS....................................................................
TET15_ARATH/54-309RR...KMPPIKN....................................................................
Q6DHQ4_DANRE/9-229TN...AWSIVQTDF..................................................................
M4EKP0_BRARP/5-250AK...HLSHVKF....................................................................
A0BP70_PARTE/8-281AE...YLKSIEEQF..................................................................
TET13_ARATH/17-268QM...NLTPIQS....................................................................
TSPE_DICDI/17-217HG...IIEIIEKHH..................................................................
Q29D35_DROPS/10-258TL...MWNQLMGNF..................................................................
A8XFB8_CAEBR/16-252TE...SWDALQSNF..................................................................
Q9VMJ6_DROME/19-264QN...LIDWIQEDW..................................................................
Q16HS3_AEDAE/7-220SE...RIYQFQADH..................................................................
Q9FVY6_ORYSJ/6-253LA...DLTPMES....................................................................
CD82_HUMAN/9-255QD...AWDYVQAQV..................................................................
Q16LT3_AEDAE/15-238QQ...SVDFMQRVL..................................................................
Q6Z6K0_ORYSJ/4-255QS...RLSPLQS....................................................................
Q176T5_AEDAE/21-243MT...AWNSVHKKM..................................................................
Q7Q1S3_ANOGA/10-238TL...VWDEIQVDF..................................................................
TSN32_HUMAN/10-222RQ...ELAAIQDVF..................................................................
ROM1_BOVIN/17-291KR...LLDELQLRH..................................................................
Q9VID1_DROME/9-227RD...AWTLLQTEL..................................................................
Q245V1_TETTS/10-273TK...LLGYVETSF..................................................................
TSN12_HUMAN/10-247TH...AWNFFQREF..................................................................
Q75IM5_ORYSJ/7-245QH...DLTPIQS....................................................................
Q292V6_DROPS/10-210ND...KMQPIHSLF..................................................................
A8WRV5_CAEBR/10-229HQ...ALDQLQSSL..................................................................
A1Z6T8_DROME/8-219NS...TLNTYEEWL..................................................................
Q6NYK2_DANRE/16-288KQ...TIDRLQMEF..................................................................
Q7QJ21_ANOGA/10-221TH...IWNRLQRDF..................................................................
A2DRK6_TRIVA/8-224SV...EVKKVESSL..................................................................
H3D1H6_TETNG/10-250AD...ALDSLQRAL..................................................................
Q16GP3_AEDAE/10-260TL...MWNYLMSEM..................................................................
TSN14_HUMAN/15-260QN...LIDSLQKAN..................................................................
TET5_ARATH/5-241QK...DLSPLQS....................................................................
Q7SXT2_DANRE/17-242DE...DLDRIQRTL..................................................................
CD63_MOUSE/10-230AT...ILDKLQKEN..................................................................
Q67WQ6_ORYSJ/5-255GS...NLSPIQS....................................................................
F1Q6P4_DANRE/9-244EQ...AWDYLQRTM..................................................................
H3CCQ2_TETNG/10-244MQ...AWDFIQRTM..................................................................
Q9NB13_DROME/8-220YT...AMGVLEETF..................................................................
Q06AT4_PIG/11-256TK...TWDRLMLQD..................................................................
A2DY51_TRIVA/8-215EN...VTRNIEILL..................................................................
M9PDV2_DROME/9-255AS...IWDSVQQSF..................................................................
Q4D6X7_TRYCC/24-264AE...GMCSLELQF..................................................................
F6ZCC3_XENTR/17-288KS...TIDLLQIEF..................................................................
C4Q3U8_SCHMA/13-222TK...LMDFIQKKF..................................................................
Q3UGA5_MOUSE/75-317HF...LLDQVQLGL..................................................................
H3DF34_TETNG/10-245EH...TWDYIQKTM..................................................................
Q24FE3_TETTS/6-262SE...VLKFLEELF..................................................................
Q29IZ2_DROPS/19-231NY...VLTMIQENI..................................................................
Q86D97_SCHMA/8-230ENPVPFMDSIQRML..................................................................
Q9V3X2_DROME/10-260TV...TFDTLQKNL..................................................................
Q24C21_TETTS/15-284AN...WLQSLEDSF..................................................................
Q4S5B5_TETNG/9-229KD...AWNTIQAEW..................................................................
TSN6_BOVIN/17-236SD...AVDKIQSML..................................................................
A1Z6U7_DROME/8-215PE...LMHQYEASQ..................................................................
Q16HX5_AEDAE/10-217AE...LIDTIQANL..................................................................
Q19983_CAEEL/8-276TAFKDAFDTVQEKF..................................................................
TSN5_HUMAN/15-260QN...LIDFTQEYW..................................................................
Q7KJ73_DROME/8-218GG...VFDTIQKSL..................................................................
A8X5P0_CAEBR/8-222RK...NIKPIQNML..................................................................
TSPD_DICDI/12-222SV...VIKKLEQFF..................................................................
Q5I0R1_XENTR/8-226KT...SFENIQKES..................................................................
Q29JV1_DROPS/15-245ES...GVDFMQSGL..................................................................
Q4D693_TRYCC/54-284PS...RICDLQCWL..................................................................
A1Z8K7_DROME/9-232TM...AWDNIQQKL..................................................................
G4LW70_SCHMA/11-211TE...FMNLIQSSF..................................................................
TSPA_DICDI/15-222NS...TLTRLENFL..................................................................
F1R4A1_DANRE/13-253EN...VIDFVQKKF..................................................................
Q16LT4_AEDAE/35-245RH...SINDMQRTL..................................................................
Q7JWV7_DROME/8-217AL...LMDTLQRSF..................................................................
Q7K2V7_DROME/8-218GY...PMDALQLAF..................................................................
Q16J92_AEDAE/10-259TT...TMDSIQKYF..................................................................
Q16TV5_AEDAE/9-253AS...IWDKVQVEL..................................................................
A0CWV3_PARTE/5-271VS...LLGTAEQLL..................................................................
Q22495_CAEEL/38-296QL...LIDSMQETW..................................................................
A2BIP5_DANRE/17-256KN...ILDYVQEKF..................................................................
Q16LT5_AEDAE/18-239QK...SVDFMQIEL..................................................................
H3DMZ9_TETNG/8-216QQ...DFEKLQREL..................................................................
Q6P2T9_DANRE/10-229RT...TLDSIQKQL..................................................................
TSN15_MOUSE/20-258KN...IMDFVQKKF..................................................................
Q17441_CAEEL/24-258AK...AVNYLQRDS..................................................................
Q9XVI4_CAEEL/9-222ES...AWDKTHQLF..................................................................
H3CSH9_TETNG/9-236SR...AIDYVQRQL..................................................................
Q7K010_DROME/7-210PG...AMSLYQNWF..................................................................
Q292W4_DROPS/8-216AD...YMDAIQISM..................................................................
Q1HRC5_AEDAE/14-233TQ...AWDMTQERL..................................................................
Q6YWS4_ORYSJ/5-273SDYLCDVTTVQS....................................................................
O44582_CAEEL/30-289AE...IMDALQENL..................................................................
A2EZ30_TRIVA/8-218KQ...SVKDIESDL..................................................................
H3DJN8_TETNG/8-231SS...AADYLQTQL..................................................................
Q7JZW3_DROME/8-216TG...ALSYYESWL..................................................................
TSPB_DICDI/15-222NS...TILKLENFL..................................................................
TSN16_HUMAN/11-245ST...QWNLVMEKL..................................................................
Q7PTA7_ANOGA/10-219AD...LVNSIQQNL..................................................................
B4I8V1_DROSE/10-227LH...LWNRMQSQL..................................................................
CD81_MOUSE/10-229KA...VVKTFHETL..................................................................
Q9W4X6_DROME/43-294QN...FIDFAQQEF..................................................................
Q24C18_TETTS/15-277VD...WVESLEDTF..................................................................
TET2_ARATH/4-252SS...KITPLQS....................................................................
Q4DD38_TRYCC/91-307NH...DICLLQERF..................................................................
H2VAF3_TAKRU/17-288KR...TLDLMQIEF..................................................................
Q29JV0_DROPS/11-237TA...LWDDVQHDF..................................................................
Q7JZW7_DROME/8-209HG...AMQDLQQEY..................................................................
TSN10_HUMAN/76-318RF...LLDQVQLGL..................................................................
Q7K527_DROME/8-207PG...SMDIIQKTY..................................................................
L9JBT3_TUPCH/22-369QN...LIDFGQKKMVPNAKKEAPAPPKAEAKAEALKAKKAALKGVHSHKKKKIHTSPIFRRPKTLWLRKRPKHPGKSAPR

PF04103

FCERB_HUMAN/60-204-----.........------------------------------------------------------------------
FCERB_MOUSE/52-195-----.........------------------------------------------------------------------
T176B_HUMAN/66-229-----TGYRWMRRS------------------------------------------------------------------
A6H741_BOVIN/62-223-----PTSWYQRRS------------------------------------------------------------------
T176B_MOUSE/60-224-----PGYGTVRYS------------------------------------------------------------------
T176B_RAT/60-224-----DRFRSVRFT------------------------------------------------------------------
T176A_RAT/63-223-----STMPSITPV------------------------------------------------------------------
T176A_HUMAN/56-214-----WNTPAPTQS------------------------------------------------------------------
T176A_BOVIN/63-220-----WRPTGAPTL------------------------------------------------------------------
Q4TAI3_TETNG/57-208-----....YSTES------------------------------------------------------------------
A7SQ32_NEMVE/7-164-----..IAKGPNY------------------------------------------------------------------
Q95PZ5_CAEEL/94-253-----GTHDTSRIS------------------------------------------------------------------
Q9GYM6_CAEEL/45-206-----SFPSNSKCQ------------------------------------------------------------------
Q1LVQ8_DANRE/42-197-----.REMREDCI------------------------------------------------------------------
H3D3M7_TETNG/37-190-----.GPARGDCV------------------------------------------------------------------
Q3TRE0_MOUSE/29-182-----.ETSLDSCQ------------------------------------------------------------------
A7S4D6_NEMVE/20-179-----CCDSIMTCK------------------------------------------------------------------
Q0V9M1_XENTR/36-200-----MQHQTSGCS------------------------------------------------------------------
F6PJ14_XENTR/5-167-----EEIYANKCL------------------------------------------------------------------
F189B_MOUSE/36-196-----PIPLHRPCP------------------------------------------------------------------
Q5BLA7_DANRE/16-153-----.........------------------------------------------------------------------
F7AIP4_XENTR/16-154-----.........------------------------------------------------------------------
Q08BU9_DANRE/43-180-----.........------------------------------------------------------------------
F1RAY4_DANRE/49-184-----.........------------------------------------------------------------------
F7ESV6_XENTR/53-198-----....QAMCV------------------------------------------------------------------
H3C9F3_TETNG/67-212-----....TWGDV------------------------------------------------------------------
MS4A3_MOUSE/27-172-----.........------------------------------------------------------------------
MS4A3_HUMAN/50-196-----.........------------------------------------------------------------------
M4A4A_HUMAN/65-207-----.........------------------------------------------------------------------
M4A6C_MOUSE/47-207-----.SLIEHDYY------------------------------------------------------------------
M4A6B_MOUSE/47-204-----..ELRPTEY------------------------------------------------------------------
M4A6D_MOUSE/47-207-----.LDTTQDAY------------------------------------------------------------------
MS4A7_HUMAN/47-207-----.LSSLPYSE------------------------------------------------------------------
F6RP33_BOVIN/48-208-----.LSSMPYST------------------------------------------------------------------
Q99N04_MOUSE/47-204-----.LSLLSYLK------------------------------------------------------------------
MS4A5_HUMAN/49-189-----.........------------------------------------------------------------------
Q810P8_MOUSE/49-189-----.........------------------------------------------------------------------
Q2KII2_BOVIN/49-189-----.........------------------------------------------------------------------
Q3LRP2_CALJA/51-216-----TINIYNCEP------------------------------------------------------------------
CD20_MOUSE/44-210-----YVDIYDCEP------------------------------------------------------------------
CD20_CANFA/51-216-----YVDIHNCDP------------------------------------------------------------------
W5PU80_SHEEP/51-216-----YININNCER------------------------------------------------------------------
M3VZQ9_FELCA/52-215-----IDIHTCQPE------------------------------------------------------------------

PF13273

Q8Y8F2_LISMO/3-121--------------------------------------------------------------------------------
Q8Y8B4_LISMO/3-92--------------------------------------------------------------------------------
C7N721_SLAHD/168-273--------------------------------------------------------------------------------
G2TQJ8_BACCO/2-106--------------------------------------------------------------------------------
U5LDQ7_9BACI/5-123--------------------------------------------------------------------------------
E8SF89_STAPH/28-121--------------------------------------------------------------------------------
F9UT90_LACPL/16-98--------------------------------------------------------------------------------
B5IAA3_ACIB4/5-90--------------------------------------------------------------------------------
O26620_METTH/8-82--------------------------------------------------------------------------------
C2X4G3_BACCE/18-98--------------------------------------------------------------------------------
I0JHL5_HALH3/2-113--------------------------------------------------------------------------------
A3DKS5_STAMF/4-94--------------------------------------------------------------------------------
E8SF88_STAPH/14-126--------------------------------------------------------------------------------
Q65KT1_BACLD/2-84--------------------------------------------------------------------------------
A5F9L1_CLOK5/1-82--------------------------------------------------------------------------------
D3FS61_BACPE/1-122--------------------------------------------------------------------------------
Q5HQ65_STAEQ/2-105--------------------------------------------------------------------------------
K0J606_AMPXN/3-111--------------------------------------------------------------------------------
B9EB15_MACCJ/41-157--------------------------------------------------------------------------------
Q8ERL5_OCEIH/2-100--------------------------------------------------------------------------------
A0B9F9_METTP/2-84--------------------------------------------------------------------------------
Q5HKY5_STAEQ/3-109--------------------------------------------------------------------------------
A5UL06_METS3/42-117--------------------------------------------------------------------------------
B9DJ67_STACT/3-106--------------------------------------------------------------------------------
B9DJA4_STACT/148-230--------------------------------------------------------------------------------
B9DPZ9_STACT/15-127--------------------------------------------------------------------------------
Q65EV2_BACLD/2-89--------------------------------------------------------------------------------
K8E281_CARML/2-111--------------------------------------------------------------------------------
C3AKH5_BACMY/2-83--------------------------------------------------------------------------------
T0TBR3_9STRE/2-102--------------------------------------------------------------------------------
D7CIL7_SYNLT/1-83--------------------------------------------------------------------------------
Q3Y3E6_ENTFC/2-107--------------------------------------------------------------------------------
Q12UE5_METBU/2-98--------------------------------------------------------------------------------
V5XRN1_ENTMU/2-106--------------------------------------------------------------------------------
Q2G173_STAA8/1-105--------------------------------------------------------------------------------
Q81BB0_BACCR/2-82--------------------------------------------------------------------------------
Q5HQP3_STAEQ/1-105--------------------------------------------------------------------------------
E6TU87_BACCJ/2-115--------------------------------------------------------------------------------
A8FJ46_BACP2/3-107--------------------------------------------------------------------------------
Q8Y9W6_LISMO/2-106--------------------------------------------------------------------------------
Q5HQ66_STAEQ/14-126--------------------------------------------------------------------------------
S6C3Q0_9ACTN/167-273--------------------------------------------------------------------------------
B8D0X9_HALOH/8-93--------------------------------------------------------------------------------
Q81UE0_BACAN/2-84--------------------------------------------------------------------------------
Q97LL2_CLOAB/4-86--------------------------------------------------------------------------------
Q5WAY8_BACSK/3-120--------------------------------------------------------------------------------
A5N2M2_CLOK5/4-86--------------------------------------------------------------------------------
A5UKZ4_METS3/8-83--------------------------------------------------------------------------------
B9DQ00_STACT/2-98--------------------------------------------------------------------------------
Q8Y911_LISMO/3-104--------------------------------------------------------------------------------
L0EGZ3_THECK/2-105--------------------------------------------------------------------------------
Q2G2G5_STAA8/2-104--------------------------------------------------------------------------------
R5AN22_9FIRM/46-142--------------------------------------------------------------------------------
Q8YAT4_LISMO/1-81--------------------------------------------------------------------------------
Q2G2G6_STAA8/14-126--------------------------------------------------------------------------------

PF00335

TET6_ARATH/5-240........................................GCCK....................................
B3DL95_XENTR/9-226........................................RCCG..V.KN.......ATDW...................
TSN8_HUMAN/8-233........................................KCCG..LVNG.......AADW...................
Q7T376_DANRE/7-212........................................GCCG..I.QN.......ATDW...................
Q6Z8Q8_ORYSJ/6-255........................................GCCK....................................
Q16HS1_AEDAE/10-224........................................GCCG..K.IS.......FLDW...................
TSN11_BOVIN/16-247........................................KCCG..S.NS.......SADWLQS................
Q22RT6_TETTS/14-273........................................NCSG..F.CS..........TNS.................
A0EF92_PARTE/8-262........................................DCSG..W.................................
TET9_ARATH/5-254........................................GCCK....................................
TSN8_BOVIN/8-234........................................KCCG..LVNG.......ASDW...................
A0BI34_PARTE/8-266........................................QCSG..W.................................
TET11_ARATH/5-258........................................GCCK....................................
Q5ZII8_CHICK/16-246........................................KCCG..S.NN.......YTDWADS................
TSN33_MOUSE/22-263........................................SCCG..G.IS.......YRDWSQNMY..............
CD37_RAT/11-269........................................RCCG..W.QS.......PRDWNKA................
G7NV03_MACFA/7-238........................................KCCG..F.TN.......YTDFE..................
Q6Z5Z9_ORYSJ/6-259........................................GCCK....................................
TET15_ARATH/54-309........................................GCCM....................................
Q6DHQ4_DANRE/9-229........................................RCCG..V.TN.......HTDW...................
M4EKP0_BRARP/5-250........................................GCCR....................................
A0BP70_PARTE/8-281........................................SCSGWCFPSSI....YIFSDV...................
TET13_ARATH/17-268........................................GCCK....................................
TSPE_DICDI/17-217........................................RCCG....................................
Q29D35_DROPS/10-258........................................GCCG..I.TD.......YHDFDAS................
A8XFB8_CAEBR/16-252........................................KCCG..VNGTDDAQIWKTSKWY..................
Q9VMJ6_DROME/19-264.......................................LQCCG..I.DG.......PKDWDSNNYF.............
Q16HS3_AEDAE/7-220........................................GCCG..K.RS.......FRDW...................
Q9FVY6_ORYSJ/6-253........................................GCCR....................................
CD82_HUMAN/9-255........................................KCCG..W.VS.......FYNWTD.................
Q16LT3_AEDAE/15-238........................................ECCG..V.DS.......YEDWTFFFK..............
Q6Z6K0_ORYSJ/4-255........................................GCCK....................................
Q176T5_AEDAE/21-243........................................MCCG..I.EG.......PKNW...................
Q7Q1S3_ANOGA/10-238........................................DCCG..V.YN.......SSDWGR.................
TSN32_HUMAN/10-222........................................LCCG..K.KS..............................
ROM1_BOVIN/17-291........................................HCCGRHG..........YKDWFGIQWVSNRYLDP......
Q9VID1_DROME/9-227........................................DCCG..I.NG.......PNDW...................
Q245V1_TETTS/10-273........................................DCSG..F.CSKQPIYYFSNSY...................
TSN12_HUMAN/10-247........................................KCCG..V.VY.......FTDW...................
Q75IM5_ORYSJ/7-245........................................GCCK....................................
Q292V6_DROPS/10-210........................................RCCG..L.EG.......PQDY...................
A8WRV5_CAEBR/10-229........................................QCCG..A.SG.......CSDY...................
A1Z6T8_DROME/8-219........................................HCCG..R.NS.......AEDY...................
Q6NYK2_DANRE/16-288........................................HCCGNTD..........YRDWFEVQWISNRYLDF......
Q7QJ21_ANOGA/10-221........................................RCCG..Y.NG.......IHDY...................
A2DRK6_TRIVA/8-224........................................ECCG.............FIKEYNETEMMNCGYTSNSSSTD
H3D1H6_TETNG/10-250........................................DCCG..A.EG.......WRDWLNSDWAV............
Q16GP3_AEDAE/10-260........................................HCCG..V.DD.......YRDFNLS................
TSN14_HUMAN/15-260........................................QCCG..A.YG.......PEDWDLNVY..............
TET5_ARATH/5-241........................................GCCK....................................
Q7SXT2_DANRE/17-242........................................QCCG..E.EN.......YTSWA..................
CD63_MOUSE/10-230........................................NCCG..A.SN.......YTDWE..................
Q67WQ6_ORYSJ/5-255........................................GCCK....................................
F1Q6P4_DANRE/9-244........................................QCCG..W.NG.......RMDWDE.................
H3CCQ2_TETNG/10-244........................................ECCG..W.TS.......QQDWSG.................
Q9NB13_DROME/8-220........................................GCCG..D.TS.......YTNY...................
Q06AT4_PIG/11-256........................................YCCG..V.NG.......PSDWQKYTSAFRTENNDADYPWP
A2DY51_TRIVA/8-215........................................ECCS....................................
M9PDV2_DROME/9-255........................................ECCG..V.SS.......YEDWY..................
Q4D6X7_TRYCC/24-264........................................HCSG................WKELCNTSNVEFMNP...LI
F6ZCC3_XENTR/17-288........................................HCCGNNG..........FRDWFEIQWISARYLDM......
C4Q3U8_SCHMA/13-222........................................GCCG..V.TS.......AADY...................
Q3UGA5_MOUSE/75-317........................................QCCG..A.VS.......YQDWQQNL...............
H3DF34_TETNG/10-245........................................KCCG..W.TG.......PGNWSN.................
Q24FE3_TETTS/6-262........................................GCSG..F.CSQNS.YYLFSDL...................
Q29IZ2_DROPS/19-231........................................GCCG..A.TG.......PWDY...................
Q86D97_SCHMA/8-230........................................RCCG..V.NG.......YEDY...................
Q9V3X2_DROME/10-260........................................KCCG..A.DG.......PGDWATSRFNNVD..........
Q24C21_TETTS/15-284........................................DCTG..M.CKKPANIYFFSDI...................
Q4S5B5_TETNG/9-229........................................RCCG..V.TG.......HRDW...................
TSN6_BOVIN/17-236........................................HCCG..V.TN.......YRDWK..................
A1Z6U7_DROME/8-215........................................HCCG..Y.NG.......ADDY...................
Q16HX5_AEDAE/10-217........................................ECCG..N.KN.......RFDW...................
Q19983_CAEEL/8-276........................................ECCG..V.KT.......YTDWLSARWDAEPSTQLEVNEED
TSN5_HUMAN/15-260........................................QCCG..A.FG.......ADDWNLNIY..............
Q7KJ73_DROME/8-218........................................HCCG..S.SS.......ALDY...................
A8X5P0_CAEBR/8-222........................................HCCG..A.TS.......QTQYLYV................
TSPD_DICDI/12-222........................................ECCC....FD..............................
Q5I0R1_XENTR/8-226........................................QCCG..LVNG.......YTDW...................
Q29JV1_DROPS/15-245........................................ECCG..V.NK.......PEDWKDYFS..............
Q4D693_TRYCC/54-284........................................HCSG..F.AS..........THCCVSNVTAERLP......
A1Z8K7_DROME/9-232........................................MCCG..V.DS.......PADW...................
G4LW70_SCHMA/11-211........................................HCCG..A.KG.......PNDY...................
TSPA_DICDI/15-222........................................KCCK....................................
F1R4A1_DANRE/13-253........................................KCCG..V.DS.......YLDWSKNMY..............
Q16LT4_AEDAE/35-245........................................QCCG..F.HR.......YTDW...................
Q7JWV7_DROME/8-217........................................KCCG..L.NG.......FADY...................
Q7K2V7_DROME/8-218........................................SCCG..N.TG.......YQQY...................
Q16J92_AEDAE/10-259........................................HCCG..A.EG.......PNDWQSSVYNNAD..........
Q16TV5_AEDAE/9-253........................................QCCG..V.SS.......YEDWY..................
A0CWV3_PARTE/5-271........................................NCAG..W.................................
Q22495_CAEEL/38-296........................................MCCG..I.NG.......ADDWDRNTYF.............
A2BIP5_DANRE/17-256........................................SCCG..G.DE.......YKDWEVNQ...............
Q16LT5_AEDAE/18-239........................................ECCG..V.NN.......YQDWEDVF...............
H3DMZ9_TETNG/8-216........................................KCCG..L.KG.......PSDW...................
Q6P2T9_DANRE/10-229........................................KCCG..G.NS.......SSDW...................
TSN15_MOUSE/20-258........................................KCCG..G.ED.......YRDWSKNQ...............
Q17441_CAEEL/24-258........................................KCCG..S.NA.......FNDWPKPEVED............
Q9XVI4_CAEEL/9-222........................................ECCG..V.TN.......SSDW...................
H3CSH9_TETNG/9-236........................................QCCG..I.HN.......YSDWQY.................
Q7K010_DROME/7-210........................................QCCG..R.GS.......PQDY...................
Q292W4_DROPS/8-216........................................ECCG..R.TN.......FSDY...................
Q1HRC5_AEDAE/14-233........................................KCCG..V.KH.......YNDW...................
Q6YWS4_ORYSJ/5-273........................................GCCK....................................
O44582_CAEEL/30-289........................................ECCG..V.SSIA...QGYRDWNMSYQ..............
A2EZ30_TRIVA/8-218........................................ECCG.............FKTAYNAAEMANCGYQQNNTSNS
H3DJN8_TETNG/8-231........................................MCCG..V.YN.......YTSWIG.................
Q7JZW3_DROME/8-216........................................QCCG..V.NS.......SEDY...................
TSPB_DICDI/15-222........................................KCCY....................................
TSN16_HUMAN/11-245........................................KCCG..V.NN.......YTDFSG.................
Q7PTA7_ANOGA/10-219........................................QCCG..K.RS.......FLDY...................
B4I8V1_DROSE/10-227........................................QCCG..V.DG.......PLDY...................
CD81_MOUSE/10-229........................................NCCG..S.NAL.....TT..LTTTI...............
Q9W4X6_DROME/43-294........................................KCCGLSN.SG.......YQDWSKNE...............
Q24C18_TETTS/15-277........................................DCTG..M.CTKPLNIYFFSNI...................
TET2_ARATH/4-252........................................GCCK....................................
Q4DD38_TRYCC/91-307........................................NCSG..F.RD..........GCCVAGVCYD..........
H2VAF3_TAKRU/17-288........................................RCCGNDN..........YRDWFEIQWVSNRYLDF......
Q29JV0_DROPS/11-237........................................NCCG..V.SD.......YKDW...................
Q7JZW7_DROME/8-209........................................ECCG..D.KG.......FSDY...................
TSN10_HUMAN/76-318........................................RCCG..A.AS.......YQDWQQNL...............
Q7K527_DROME/8-207........................................YCCG..R.DS.......AQDY...................
L9JBT3_TUPCH/22-369RNKLDHSAVIKFPLTAQSAMKKIEDNNTLVFVMDVKATSTSCCG..G.IS.......YKDWSLNMY..............

PF04103

FCERB_HUMAN/60-204----------------------------------------.HSC------------------------------------
FCERB_MOUSE/52-195----------------------------------------..CK------------------------------------
T176B_HUMAN/66-229----------------------------------------QENQ------------------------------------
A6H741_BOVIN/62-223----------------------------------------SYSS------------------------------------
T176B_MOUSE/60-224----------------------------------------DDSD------------------------------------
T176B_RAT/60-224----------------------------------------DDSD------------------------------------
T176A_RAT/63-223----------------------------------------PEEA------------------------------------
T176A_HUMAN/56-214----------------------------------------PEEV------------------------------------
T176A_BOVIN/63-220----------------------------------------SPDL------------------------------------
Q4TAI3_TETNG/57-208----------------------------------------PWQK------------------------------------
A7SQ32_NEMVE/7-164----------------------------------------HKEY------------------------------------
Q95PZ5_CAEEL/94-253----------------------------------------YIFS------------------------------------
Q9GYM6_CAEEL/45-206----------------------------------------IMCG------------------------------------
Q1LVQ8_DANRE/42-197----------------------------------------CTLD------------------------------------
H3D3M7_TETNG/37-190----------------------------------------CTLS------------------------------------
Q3TRE0_MOUSE/29-182----------------------------------------CKLP------------------------------------
A7S4D6_NEMVE/20-179----------------------------------------QSVP------------------------------------
Q0V9M1_XENTR/36-200----------------------------------------NPGE------------------------------------
F6PJ14_XENTR/5-167----------------------------------------EREN------------------------------------
F189B_MOUSE/36-196----------------------------------------EWGQ------------------------------------
Q5BLA7_DANRE/16-153----------------------------------------.FHA------------------------------------
F7AIP4_XENTR/16-154----------------------------------------FSSP------------------------------------
Q08BU9_DANRE/43-180----------------------------------------.THN------------------------------------
F1RAY4_DANRE/49-184----------------------------------------HRAH------------------------------------
F7ESV6_XENTR/53-198----------------------------------------CYEL------------------------------------
H3C9F3_TETNG/67-212----------------------------------------TPTD------------------------------------
MS4A3_MOUSE/27-172----------------------------------------.CQS------------------------------------
MS4A3_HUMAN/50-196----------------------------------------CHSS------------------------------------
M4A4A_HUMAN/65-207----------------------------------------.CNY------------------------------------
M4A6C_MOUSE/47-207----------------------------------------QPFY------------------------------------
M4A6B_MOUSE/47-204----------------------------------------HYYQ------------------------------------
M4A6D_MOUSE/47-207----------------------------------------HFFS------------------------------------
MS4A7_HUMAN/47-207----------------------------------------YYYP------------------------------------
F6RP33_BOVIN/48-208----------------------------------------YYYS------------------------------------
Q99N04_MOUSE/47-204----------------------------------------SHHW------------------------------------
MS4A5_HUMAN/49-189----------------------------------------...Y------------------------------------
Q810P8_MOUSE/49-189----------------------------------------...Y------------------------------------
Q2KII2_BOVIN/49-189----------------------------------------...Y------------------------------------
Q3LRP2_CALJA/51-216----------------------------------------VTPS------------------------------------
CD20_MOUSE/44-210----------------------------------------SNSS------------------------------------
CD20_CANFA/51-216----------------------------------------ANPS------------------------------------
W5PU80_SHEEP/51-216----------------------------------------ANPD------------------------------------
M3VZQ9_FELCA/52-215----------------------------------------SKPS------------------------------------

PF13273

Q8Y8F2_LISMO/3-121--------------------------------------------------------------------------------
Q8Y8B4_LISMO/3-92--------------------------------------------------------------------------------
C7N721_SLAHD/168-273--------------------------------------------------------------------------------
G2TQJ8_BACCO/2-106--------------------------------------------------------------------------------
U5LDQ7_9BACI/5-123--------------------------------------------------------------------------------
E8SF89_STAPH/28-121--------------------------------------------------------------------------------
F9UT90_LACPL/16-98--------------------------------------------------------------------------------
B5IAA3_ACIB4/5-90--------------------------------------------------------------------------------
O26620_METTH/8-82--------------------------------------------------------------------------------
C2X4G3_BACCE/18-98--------------------------------------------------------------------------------
I0JHL5_HALH3/2-113--------------------------------------------------------------------------------
A3DKS5_STAMF/4-94--------------------------------------------------------------------------------
E8SF88_STAPH/14-126--------------------------------------------------------------------------------
Q65KT1_BACLD/2-84--------------------------------------------------------------------------------
A5F9L1_CLOK5/1-82--------------------------------------------------------------------------------
D3FS61_BACPE/1-122--------------------------------------------------------------------------------
Q5HQ65_STAEQ/2-105--------------------------------------------------------------------------------
K0J606_AMPXN/3-111--------------------------------------------------------------------------------
B9EB15_MACCJ/41-157--------------------------------------------------------------------------------
Q8ERL5_OCEIH/2-100--------------------------------------------------------------------------------
A0B9F9_METTP/2-84--------------------------------------------------------------------------------
Q5HKY5_STAEQ/3-109--------------------------------------------------------------------------------
A5UL06_METS3/42-117--------------------------------------------------------------------------------
B9DJ67_STACT/3-106--------------------------------------------------------------------------------
B9DJA4_STACT/148-230--------------------------------------------------------------------------------
B9DPZ9_STACT/15-127--------------------------------------------------------------------------------
Q65EV2_BACLD/2-89--------------------------------------------------------------------------------
K8E281_CARML/2-111--------------------------------------------------------------------------------
C3AKH5_BACMY/2-83--------------------------------------------------------------------------------
T0TBR3_9STRE/2-102--------------------------------------------------------------------------------
D7CIL7_SYNLT/1-83--------------------------------------------------------------------------------
Q3Y3E6_ENTFC/2-107--------------------------------------------------------------------------------
Q12UE5_METBU/2-98--------------------------------------------------------------------------------
V5XRN1_ENTMU/2-106--------------------------------------------------------------------------------
Q2G173_STAA8/1-105--------------------------------------------------------------------------------
Q81BB0_BACCR/2-82--------------------------------------------------------------------------------
Q5HQP3_STAEQ/1-105--------------------------------------------------------------------------------
E6TU87_BACCJ/2-115--------------------------------------------------------------------------------
A8FJ46_BACP2/3-107--------------------------------------------------------------------------------
Q8Y9W6_LISMO/2-106--------------------------------------------------------------------------------
Q5HQ66_STAEQ/14-126--------------------------------------------------------------------------------
S6C3Q0_9ACTN/167-273--------------------------------------------------------------------------------
B8D0X9_HALOH/8-93--------------------------------------------------------------------------------
Q81UE0_BACAN/2-84--------------------------------------------------------------------------------
Q97LL2_CLOAB/4-86--------------------------------------------------------------------------------
Q5WAY8_BACSK/3-120--------------------------------------------------------------------------------
A5N2M2_CLOK5/4-86--------------------------------------------------------------------------------
A5UKZ4_METS3/8-83--------------------------------------------------------------------------------
B9DQ00_STACT/2-98--------------------------------------------------------------------------------
Q8Y911_LISMO/3-104--------------------------------------------------------------------------------
L0EGZ3_THECK/2-105--------------------------------------------------------------------------------
Q2G2G5_STAA8/2-104--------------------------------------------------------------------------------
R5AN22_9FIRM/46-142--------------------------------------------------------------------------------
Q8YAT4_LISMO/1-81--------------------------------------------------------------------------------
Q2G2G6_STAA8/14-126--------------------------------------------------------------------------------

PF00335

TET6_ARATH/5-240.....................PP.TA.........CTYEAGVVDGGG.........................DCFRWNNG
B3DL95_XENTR/9-226...............LESKGSVP.HT.........CCVEHSPA................................CKSNP
TSN8_HUMAN/8-233...............GNNFQHYP.EL.........CACLDKQRP..............................CQSYNG
Q7T376_DANRE/7-212..................QGFVP.QS.........CNI..........................................
Q6Z8Q8_ORYSJ/6-255.....................PP.TS.........CNFTYGGGTRWGKTARL...............SSADPDCDEWSND
Q16HS1_AEDAE/10-224..................GNKLP.DS.........CCADG......................................QR
TSN11_BOVIN/16-247.........SYILSPEAEGRRVP.DS.........CCKTVVARC..............................GQRAHP
Q22RT6_TETTS/14-273...........YYVFRNINDGTP.SA......................................................
A0EF92_PARTE/8-262...................................CTPFSLQI.................................FYDI
TET9_ARATH/5-254.....................PS.ND.........CDFTYITSTTWNKTSG................THKNSDCQLWDNE
TSN8_BOVIN/8-234...............GSNFQHYY.RT.........CECPSESDSS.............................CTKYSG
A0BI34_PARTE/8-266...................................CTPYPIQQ.................................FNDV
TET11_ARATH/5-258.....................PP.SD.........CNFEFRNATFWIPPSKNE............TAVAENGDCGTWSNV
Q5ZII8_CHICK/16-246.........MWIKSPEASGRKVP.DS.........CCKTITVLC..............................GRRDHP
TSN33_MOUSE/22-263.......FNCSEDNPSRERCSVP.YS.........CCLPTPNQAVINTMCG.................QGMQALDYLEAS
CD37_RAT/11-269.........QMLKANGSEELFVP............CSCYNSTATNDSSGFDKLFLSQLS.RLGPRAKLRQTADICALPAK
G7NV03_MACFA/7-238...........DSPYVRENNAFP.PF.........CCNNVTNTVNE...........................TCTKEKA
Q6Z5Z9_ORYSJ/6-259.....................PP.TA.........CNFTYQNETYWIKPPTP..............SNYSDPDCNSWSND
TET15_ARATH/54-309.....................PP.ET.........CNMDAINATFWYRRKDEGPPSSMNLMYGDEMMVGRISDCQLWRND
Q6DHQ4_DANRE/9-229.............FQVYNTSRVP.DS.........CCLEYSDNC...............................GLENP
M4EKP0_BRARP/5-250.....................PP.VE.........CGFEAKNATWWTVPATS..............TAEIKGDCKTWSNT
A0BP70_PARTE/8-281..................NAGTP.........................................................
TET13_ARATH/17-268.....................PP.LS.........CGLNYEKPNNWTVSRYY...............NNLEVDCKRWNNS
TSPE_DICDI/17-217........................WSKEI..EGNYCVH..........................................
Q29D35_DROPS/10-258..........PAWKENKGNRTIP.EA.........CCVLKDVAALVPRD.....................EDCVTNPSDS
A8XFB8_CAEBR/16-252............MHQKAPKSLIP.ESCCIPSEIDRCRSNPF.....................................DS
Q9VMJ6_DROME/19-264.......NCSSIAIGSREACGVP.FS.........CCRRRPQEVIKNKQC..................GYDVRKEGYPVD
Q16HS3_AEDAE/7-220...............LNDDGSIP.TS.........CCIEG......................................SN
Q9FVY6_ORYSJ/6-253.....................PP.AE.........CGYPAVNASYFDLSYHP...............VSTNVDCKLYKNA
CD82_HUMAN/9-255..........NAELMNRPEVTYP............CSCEVKGEEDNSLSVRKGF..........CEAPGNRTQSGNHPED
Q16LT3_AEDAE/15-238........NSPNATEGTNSFVVP.ES.........CCPPSTL...................................KES
Q6Z6K0_ORYSJ/4-255.....................PP.AV.........CGYNYVSPTVWAGPAAR...............PAADADCGAWGND
Q176T5_AEDAE/21-243..............YDNNNKTMP.AS.........CCKPDLIDPDTND.......................CKNAPPLFM
Q7Q1S3_ANOGA/10-238...........ANAVKFNETFLP.MT.........CCRQQTGAVGY..........................VACPDPTS
TSN32_HUMAN/10-222......................P.FSRLGSTEADLCQG..........................................
ROM1_BOVIN/17-291NDPDVVDRIQSNVEGLYLIDGVP.FSCCNPHSPRPCLQSQLSDPHA...........................HPLFDPR
Q9VID1_DROME/9-227.............ETVYRNSTLP.AA.........CCSVINLSE..............................AKECTN
Q245V1_TETTS/10-273...................KGQP.TK......................................................
TSN12_HUMAN/10-247.............LEMTEMDWPP.DS.........CCVREFPGCS............................KQAHQED
Q75IM5_ORYSJ/7-245.....................PP.TA.........CAYSGGVAVGAQD.......................EDCFRWNNA
Q292V6_DROPS/10-210..............LGEENGALP.AS.........CCFAF......................................DC
A8WRV5_CAEBR/10-229................MVYGAFP.TS.........CQC..........................................
A1Z6T8_DROME/8-219...............LHLEKMPP.PS.........CCLNR......................................DC
Q6NYK2_DANRE/16-288SSKEVKDRIRSNVDGRYLVDGVP.FSCCNPSSPRPCIQYKITNDSA...........................HYNYEHE
Q7QJ21_ANOGA/10-221..............KKNKQMGFP.WS.........CYD..........................................
A2DRK6_TRIVA/8-224TNSSENKTANAETNTTETNSTDS.TI......................................................
H3D1H6_TETNG/10-250......QHTTFQTSENGSSVSLP.DS.........CCVRRKGCKNRP.........................LMSDDNEG
Q16GP3_AEDAE/10-260..........DKWNESKGNRLIP.EA.........CCMQTSLFELLDK.......................NCPVSPSES
TSN14_HUMAN/15-260.......FNCSGASYSREKCGVP.FS.........CCVPDPAQKVVNTQCG.................YDVRIQLKSKWD
TET5_ARATH/5-241.....................PP.TS.........CVYNTDTVIQQD........................PDCYRWNNA
Q7SXT2_DANRE/17-242............NTTYFEKEGIP.KS.........CCNVTASVNCTSA.......................ELKDLKKAD
CD63_MOUSE/10-230............NIPGMAKDRVP.DS.........CCINITVGC..............................GNDFKE
Q67WQ6_ORYSJ/5-255.....................PP.TG.........CNFAYVSETVWTKPSGF..............NSTDDPDCTTWSND
F1Q6P4_DANRE/9-244..........NHIIKNNTVPLYP............CSCHNYSIQAPIVP....................DNGFCQASSSD
H3CCQ2_TETNG/10-244..........NMIIKNSSMLLFP............CSCQNISTAAGNAS....................DSGFCEAPTPD
Q9NB13_DROME/8-220...............NNIGLSVP.GT.........CCGYLDRQA..............................TCNTPS
Q06AT4_PIG/11-256RQCCVMNKLKEPLNLEACKLGVP.........................................................
A2DY51_TRIVA/8-215........................FNQPTVSETVRCLADTSSP.................................YNKE
M9PDV2_DROME/9-255...........DIQSWPGRRWVP.ES.........CCRTLYDQRQVLTEGSG..............DGMMRPDCGRSENP
Q4D6X7_TRYCC/24-264RKGNQLSLREGALGDVNTAEMLPHTSNNNSDSKIICPTCSE.....................................ED
F6ZCC3_XENTR/17-288GSKEVVDRFKSNVDGKYLLDGVP.FSCCNPNSPRPCIQYQITNNTA...........................HYNYDYL
C4Q3U8_SCHMA/13-222.................GTRSPP.KS.........CTV..........................................
Q3UGA5_MOUSE/75-317........YFNCSSPGVQACSLP.AS.........CCINPQEDGAVVNTQ...................CGFGALGLDQN
H3DF34_TETNG/10-245..........NLLIKNSSQNLYP............CSCRNESLPGSDIR....................PVGLCEHLSTD
Q24FE3_TETTS/6-262..................NDGIP.NG......................................................
Q29IZ2_DROPS/19-231...............LDLHQPLP.SS.........CRD..........................................
Q86D97_SCHMA/8-230..................RESIP.IA.........CCDHHVST................................CLNAL
Q9V3X2_DROME/10-260....RTNIVEIAVSSMNVFYNIP.ES.........CCKDNLKDNECELS.....................RRLKFGGPLN
Q24C21_TETTS/15-284..................NNGIP.DN......................................................
Q4S5B5_TETNG/9-229.............YAALHDNLVP.DS.........CCQLPFQGC...............................GRNSS
TSN6_BOVIN/17-236............DTNYYSEKGFP.ES.........CCKLEDCS................................PQRDA
A1Z6U7_DROME/8-215...............KRLHLLVP.AS.........CYQAA......................................VN
Q16HX5_AEDAE/10-217..................GINIP.QS.........CCRTGT....................................APG
Q19983_CAEEL/8-276AGRIEHGIGAFGGNKGTGYGRVP.SS.........CCNEHGKLSYPNNCG..................RSFSQAPLNTYA
TSN5_HUMAN/15-260.......FNCTDSNASRERCGVP.FS.........CCTKDPAEDVINTQCG.................YDARQKPEVDQQ
Q7KJ73_DROME/8-218...............IGKGDLVP.PS.........CCSGSC.....................................LI
A8X5P0_CAEBR/8-222..........KDGL.....................CG...........................................
TSPD_DICDI/12-222........................ESDLKLNCTALCPQD........................................D
Q5I0R1_XENTR/8-226..................GANIP.AS.........CICPTTSRTN............................NCIYFAG
Q29JV1_DROPS/15-245........PNKNETLDTDDVVVP.NS.........CCGGLAQDIN............................DASQVTC
Q4D693_TRYCC/54-284DVSPCYLLAEDGVTTLDPNTLQP.VSWPSLTCAPRCN...........................................
A1Z8K7_DROME/9-232.............RTLSANKTLP.GS.........CCQPQYIDSTVGH.......................CLESPALGK
G4LW70_SCHMA/11-211..................LGNVP.AS.........CKE..........................................
TSPA_DICDI/15-222........................WSNVSIDSSDLCPKD.........................................
F1R4A1_DANRE/13-253.......FNSSEHNPSLEAYGVP.FS.........CCIRQKNETVFNSMCG.................YETQKMKKSLAG
Q16LT4_AEDAE/35-245..............FEFNEDRIP.SS.........CFAS........................................L
Q7JWV7_DROME/8-217..................GITYP.AS.........CCDSPSNG................................TCALT
Q7K2V7_DROME/8-218...................ETVP.SS.........CCGYKDRTK...............................VCEAE
Q16J92_AEDAE/10-259....RSSIVNIAISKLNVAYKVP.ES.........CCVEGLSAAECNNA....................RTKGLITSIIK
Q16TV5_AEDAE/9-253...........DISAWPGERWVP.RS.........CCRPRYNSLMMEGSGD................DLHSVDCRKAGDP
A0CWV3_PARTE/5-271...................................CTPAPYY..................................IFSD
Q22495_CAEEL/38-296.......SIEAREVASPEAGGVP.FS.........CCINSSKLEFKNYFCGHGVRLK.....PESHMAAHLAAQRVMAHT
A2BIP5_DANRE/17-256........YHLCDGKSPLACGVP.YT.........CCIRQSVGEVVNTLCG.................YKTLHQQREALD
Q16LT5_AEDAE/18-239........AVVDLDNGDLEAELP.AS.........CCREYL....................................DGE
H3DMZ9_TETNG/8-216...................TKIP.DS.........CRCNTTEP.................................DCPS
Q6P2T9_DANRE/10-229............VNFSADHISVP.DS.........CCKNVTKNCG............................IGAMTKP
TSN15_MOUSE/20-258........YHDCSAPGPLACGVP.YT.........CCIRNTTDVVNTMCG..................YKTIDKERLNAQ
Q17441_CAEEL/24-258......HYLPYAKTVVQRVQYIP.DS.........CCKSTHQRKG.............................CALSDS
Q9XVI4_CAEEL/9-222................LTFTTIP.DS.........CCIEEIEG................................CAREN
H3CSH9_TETNG/9-236..........THWYEESKNNSVP.IS.........CCKYSVGS................................CTGSL
Q7K010_DROME/7-210...............IVNERLPP.ET.........CFRNH......................................DK
Q292W4_DROPS/8-216................SFQGYFP.PS.........CCKDTNN...................................CRP
Q1HRC5_AEDAE/14-233..................RGSIP.QS.........CCQKTFTDY..............................KPCQDH
Q6YWS4_ORYSJ/5-273.....................PP.VY.........CGYERVNETFWIAPARG..............LDAADVDCLEWSND
O44582_CAEEL/30-289.......FNCTNSNPQPEKCGVP.FS.........CCRKSVISEAAGSSNPLLPAM......RSLECWQNALTKRPGDLE
A2EZ30_TRIVA/8-218TDNNITDTNSTENNTTGN..............................................................
H3DJN8_TETNG/8-231...........TPWYSSHNNTVP.LS.........CCKNATGCS..............................GRLDQL
Q7JZW3_DROME/8-216...............WIIHHGIP.SS.........CCPESKC..................................MDTP
TSPB_DICDI/15-222........................WNSTSSRNPLLCPKD.........................................
TSN16_HUMAN/11-245...........SSFEMTTGHTYP.RSCCKSIGSVSCDGR........................................D
Q7PTA7_ANOGA/10-219.................GVASFP.QS.........CCSSGGT...................................APL
B4I8V1_DROSE/10-227..............RR...LSLP.WS.........CCSRPEH...................................AYE
CD81_MOUSE/10-229........LRNSLCPSGGNILTP.LL......................................................
Q9W4X6_DROME/43-294........YFNCSSPSVEKCGVP.YS.........CCINATDISSGLVNIMC...............GYGVQNAPVPEAT
Q24C18_TETTS/15-277..................NRGIP.DT......................................................
TET2_ARATH/4-252.....................PP.TA.........CGYNFVNPTLWLNPTN................MAADADCYLWSND
Q4DD38_TRYCC/91-307...AIDPPEWVDAVCPLCPSFPP.MS......................................................
H2VAF3_TAKRU/17-288SSKEVKDRIGSNVDGQYLMDGVP.FSCCNPSSPRPCIQLQMTNNSA...........................HYSYDHY
Q29JV0_DROPS/11-237.............AVTYPNASLP.IS.........CCTIPVGAAGTF........................SCFNNFTSE
Q7JZW7_DROME/8-209...............TSLNMKVP.RS.........CFHTK......................................DG
TSN10_HUMAN/76-318........YFNCSSPGVQACSLP.AS.........CCIDPREDGASVNDQ...................CGFGVLRLDAD
Q7K527_DROME/8-207............LDIKFWNNTVP.SS.........CCKDD......................................SC
L9JBT3_TUPCH/22-369.......FNCSEDNPSRERCSVP.YS.........CCLPTPNQAVINTMCG.................QGMQALDYLEAS

PF04103

FCERB_HUMAN/60-204------------------------QK------------------------------------------------------
FCERB_MOUSE/52-195------------------------NV------------------------------------------------------
T176B_HUMAN/66-229------------------------WQ------------------------------------------------------
A6H741_BOVIN/62-223------------------------WE------------------------------------------------------
T176B_MOUSE/60-224------------------------WK------------------------------------------------------
T176B_RAT/60-224------------------------WR------------------------------------------------------
T176A_RAT/63-223------------------------NR------------------------------------------------------
T176A_HUMAN/56-214------------------------RR------------------------------------------------------
T176A_BOVIN/63-220------------------------ER------------------------------------------------------
Q4TAI3_TETNG/57-208------------------------LF------------------------------------------------------
A7SQ32_NEMVE/7-164------------------------SR------------------------------------------------------
Q95PZ5_CAEEL/94-253------------------------HM------------------------------------------------------
Q9GYM6_CAEEL/45-206------------------------DH------------------------------------------------------
Q1LVQ8_DANRE/42-197------------------------PE------------------------------------------------------
H3D3M7_TETNG/37-190------------------------QE------------------------------------------------------
Q3TRE0_MOUSE/29-182------------------------SS------------------------------------------------------
A7S4D6_NEMVE/20-179------------------------SY------------------------------------------------------
Q0V9M1_XENTR/36-200------------------------TL------------------------------------------------------
F6PJ14_XENTR/5-167------------------------FL------------------------------------------------------
F189B_MOUSE/36-196------------------------EL------------------------------------------------------
Q5BLA7_DANRE/16-153------------------------HP------------------------------------------------------
F7AIP4_XENTR/16-154------------------------PH------------------------------------------------------
Q08BU9_DANRE/43-180------------------------NI------------------------------------------------------
F1RAY4_DANRE/49-184------------------------NM------------------------------------------------------
F7ESV6_XENTR/53-198------------------------NS------------------------------------------------------
H3C9F3_TETNG/67-212------------------------TE------------------------------------------------------
MS4A3_MOUSE/27-172------------------------SP------------------------------------------------------
MS4A3_HUMAN/50-196------------------------SE------------------------------------------------------
M4A4A_HUMAN/65-207------------------------YG------------------------------------------------------
M4A6C_MOUSE/47-207------------------------NS------------------------------------------------------
M4A6B_MOUSE/47-204------------------------FL------------------------------------------------------
M4A6D_MOUSE/47-207------------------------PE------------------------------------------------------
MS4A7_HUMAN/47-207------------------------IY------------------------------------------------------
F6RP33_BOVIN/48-208------------------------IY------------------------------------------------------
Q99N04_MOUSE/47-204------------------------KN------------------------------------------------------
MS4A5_HUMAN/49-189------------------------SH------------------------------------------------------
Q810P8_MOUSE/49-189------------------------SP------------------------------------------------------
Q2KII2_BOVIN/49-189------------------------SG------------------------------------------------------
Q3LRP2_CALJA/51-216------------------------EK------------------------------------------------------
CD20_MOUSE/44-210------------------------EK------------------------------------------------------
CD20_CANFA/51-216------------------------EK------------------------------------------------------
W5PU80_SHEEP/51-216------------------------EN------------------------------------------------------
M3VZQ9_FELCA/52-215------------------------EK------------------------------------------------------

PF13273

Q8Y8F2_LISMO/3-121------------------------NK------------------------------------------------------
Q8Y8B4_LISMO/3-92------------------------AP------------------------------------------------------
C7N721_SLAHD/168-273------------------------DG------------------------------------------------------
G2TQJ8_BACCO/2-106------------------------NK------------------------------------------------------
U5LDQ7_9BACI/5-123------------------------NP------------------------------------------------------
E8SF89_STAPH/28-121------------------------..------------------------------------------------------
F9UT90_LACPL/16-98------------------------NH------------------------------------------------------
B5IAA3_ACIB4/5-90------------------------NP------------------------------------------------------
O26620_METTH/8-82------------------------NP------------------------------------------------------
C2X4G3_BACCE/18-98------------------------NN------------------------------------------------------
I0JHL5_HALH3/2-113------------------------DK------------------------------------------------------
A3DKS5_STAMF/4-94------------------------SV------------------------------------------------------
E8SF88_STAPH/14-126------------------------..------------------------------------------------------
Q65KT1_BACLD/2-84------------------------KA------------------------------------------------------
A5F9L1_CLOK5/1-82------------------------KT------------------------------------------------------
D3FS61_BACPE/1-122------------------------NS------------------------------------------------------
Q5HQ65_STAEQ/2-105------------------------RK------------------------------------------------------
K0J606_AMPXN/3-111------------------------DK------------------------------------------------------
B9EB15_MACCJ/41-157------------------------..------------------------------------------------------
Q8ERL5_OCEIH/2-100------------------------NS------------------------------------------------------
A0B9F9_METTP/2-84------------------------NH------------------------------------------------------
Q5HKY5_STAEQ/3-109------------------------NA------------------------------------------------------
A5UL06_METS3/42-117------------------------NA------------------------------------------------------
B9DJ67_STACT/3-106------------------------KA------------------------------------------------------
B9DJA4_STACT/148-230------------------------NR------------------------------------------------------
B9DPZ9_STACT/15-127------------------------..------------------------------------------------------
Q65EV2_BACLD/2-89------------------------NS------------------------------------------------------
K8E281_CARML/2-111------------------------DS------------------------------------------------------
C3AKH5_BACMY/2-83------------------------NN------------------------------------------------------
T0TBR3_9STRE/2-102------------------------IL------------------------------------------------------
D7CIL7_SYNLT/1-83------------------------KP------------------------------------------------------
Q3Y3E6_ENTFC/2-107------------------------KG------------------------------------------------------
Q12UE5_METBU/2-98------------------------DK------------------------------------------------------
V5XRN1_ENTMU/2-106------------------------KG------------------------------------------------------
Q2G173_STAA8/1-105------------------------NK------------------------------------------------------
Q81BB0_BACCR/2-82------------------------NN------------------------------------------------------
Q5HQP3_STAEQ/1-105------------------------NT------------------------------------------------------
E6TU87_BACCJ/2-115------------------------NN------------------------------------------------------
A8FJ46_BACP2/3-107------------------------DR------------------------------------------------------
Q8Y9W6_LISMO/2-106------------------------DG------------------------------------------------------
Q5HQ66_STAEQ/14-126------------------------..------------------------------------------------------
S6C3Q0_9ACTN/167-273------------------------QG------------------------------------------------------
B8D0X9_HALOH/8-93------------------------SP------------------------------------------------------
Q81UE0_BACAN/2-84------------------------KA------------------------------------------------------
Q97LL2_CLOAB/4-86------------------------KG------------------------------------------------------
Q5WAY8_BACSK/3-120------------------------KP------------------------------------------------------
A5N2M2_CLOK5/4-86------------------------KT------------------------------------------------------
A5UKZ4_METS3/8-83------------------------DS------------------------------------------------------
B9DQ00_STACT/2-98------------------------NR------------------------------------------------------
Q8Y911_LISMO/3-104------------------------NA------------------------------------------------------
L0EGZ3_THECK/2-105------------------------NR------------------------------------------------------
Q2G2G5_STAA8/2-104------------------------RR------------------------------------------------------
R5AN22_9FIRM/46-142------------------------KK------------------------------------------------------
Q8YAT4_LISMO/1-81------------------------KP------------------------------------------------------
Q2G2G6_STAA8/14-126------------------------..------------------------------------------------------

PF00335

TET6_ARATH/5-240VEMLCYECDACKAGV...LEEIRLDWRKLSVVNILVLV...............LLIAVYAAGCCA
B3DL95_XENTR/9-226KLWW...EEACYNKV...RNWVESNIRSV.GIFG.ICIL......VVQV....FGLIFSMLMYCQ
TSN8_HUMAN/8-233KQVY...KETCISFI...KDFLAKNLIIV.IGIS.FGLA......VIEI....LGLVFSMVLYCQ
Q7T376_DANRE/7-212.SGTSNWHKGCFKLL...ENSFESNLLSTGIGVIVVCI........IEV....LGMCFSMTLFCH
Q6Z8Q8_ORYSJ/6-255ADEVCYGCRSCKAGV...VAALKRDWKRVAIVNVVFLA...............FIVVVYSVGCCA
Q16HS1_AEDAE/10-224GPNCVPFKEGCERML...EGYIRQTGKIIGWILMWLTV........FEF....IALTLACCLANG
TSN11_BOVIN/16-247SNIYK.VEGGCISKL...EQFLADHLLLM.GAVG.IGVA......CLQI....CGMILTCGLHRR
Q22RT6_TETTS/14-273.......GKDCKEEF...LNFISKNI.IIAIVITSILV...............VYMLIVTYLSLS
A0EF92_PARTE/8-262NHKFDESNNQCLLSS...QQQIYDTLKLIGDISAGAVV........IMG....LMVIFTFCLCCH
TET9_ARATH/5-254KHKLCYNCKACKAGF...LDNLKAAWKRVAIVNIIFLV...............LLVVVYAMGCCA
TSN8_BOVIN/8-234KTIY...KQSCFASI...SQMFSKRLFIV.LALA.FGLA......AIEV....LGLIFSIVLYCQ
A0BI34_PARTE/8-266NSNVKNHNYPCYKGM...IEYFQNMFTTTGSILFSLAA..........LF..GVMVILTCCLCCH
TET11_ARATH/5-258QTELCFNCNACKAGV...LANIREKWRNLLVFNICLLI...............LLITVYSCGCCA
Q5ZII8_CHICK/16-246SNIY..KENGCITKL...ENFIQEHLKII.GIVG.ISIA......CVQI....FGMIFTCCLYRS
TSN33_MOUSE/22-263KVIY...TNGCIDKL...VNWIHSNLFLL.GGVA.LGLA......IPQL....VGILLSQVLVNQ
CD37_RAT/11-269AHIY...REGCARSL...QKWLHNNIISI.VGIC.LGVG......LLEL....GFMTLSIFLCRN
G7NV03_MACFA/7-238DNQK...VEGCFQQL...LYDIRTNAVTVGGVAAGIGG........LEL....AAMIVSMYLYCN
Q6Z5Z9_ORYSJ/6-259QSELCYGCQSCKAGV...LGNLRSSWKKIAFVNAAFVA...............LLLVVYSLGCCA
TET15_ARATH/54-309WSILCYDCRSCKFGF...IRSVRRKWWQLGIFLIVISI...............LLLMSHLLIFLA
Q6DHQ4_DANRE/9-229GTWW...TAPCYERV...KGWLQENLVAL.WIFA.LCTA......LTQI....LGLVFSMTIFCH
M4EKP0_BRARP/5-250QSELCYACESCKVGV...YKGIRKRWRILLVFNLLLIL...............LVVLLYSCGCCV
A0BP70_PARTE/8-281.......KDHCYGAI...TGYAKDICVYIGAVAVSVCF........IMI....LCITCVLCLCFH
TET13_ARATH/17-268ADTLCFDCDSCKAVI...IADVHNTSFSITV.NIIHII...............FSLCIGMTGWFA
TSPE_DICDI/17-217FNRRESGHGYCAPYV...EKSVESILKYLGYYGIVLSV........IEL....ILLILSGFFLLK
Q29D35_DROPS/10-258NSFY...KKGCYEVF...TEWLIGQRELI.IIVIGVGI........VHL....ILIILAFSLCKA
A8XFB8_CAEBR/16-252GSPAPYYTNTCYEPL...QNDLLHVMNVASWLCITNAI...............VQIIPSVASCWY
Q9VMJ6_DROME/19-264RNIH...ERGCLRAG...EDWLEAHLISVAIGCVALLV..........L....QGMELSKIIYEK
Q16HS3_AEDAE/7-220DHSCRSFAEGCVQIL...ERYVSHITKGLGIGLLILAA........IDF....AALLFASCFVHG
Q9FVY6_ORYSJ/6-253RSVLCYDCDSCKAGV...AQYMKTEWRVVAIFNVILFV...............ILSFVYFVACCA
CD82_HUMAN/9-255WPVY...QEGCMEKV...QAWLQENLGII.LGVG.VGVA......IIEL....LGMVLSICLCRH
Q16LT3_AEDAE/15-238CIPY...EYGCMDRL...QWVVAQSAALI.ATGA.ITVS......FVQI....LGSVCAFMLART
Q6Z6K0_ORYSJ/4-255PSQLCYECESCRAGL...LAALRAQWHRANVALVVATV...............ALVFLYLVGCSA
Q176T5_AEDAE/21-243DRYY...QDGCLMKL...KEHFDKNAVVL.IAVG.FVIA......AFQL....LGVIFACWLSAA
Q7Q1S3_ANOGA/10-238ATLR...KTGCIDSF...GDFIKAHAVSL.GAAG.IALA......VIQF....FGILFACYLAKQ
TSN32_HUMAN/10-222EEAA...REDCLQGI...RSFLRTHQQVA.SSLTSIGL.......ALTV....SALLFSSFLWFA
ROM1_BOVIN/17-291QPNLNLWSQGCHEVL...LGHLQGLASTLGNMLAVTFL........LQ.....TLVLLGLRYLQT
Q9VID1_DROME/9-227THAT...QHGCLQKL...LEILDSKTLIL.ASVV.LGVA......GIQM....LTILFACCLYRS
Q245V1_TETTS/10-273.........DCKLEL...LNFLDTSLLSLANGGLAVLI........ISI....IGCVCSCSLICH
TSN12_HUMAN/10-247LSDL..YQEGCGKKM...YSFLRGTKQLQVLRFLGISIG......VTQI....LAMILTITLLWA
Q75IM5_ORYSJ/7-245AGILCYGCESCRAGV...MEKVREDWHKISVLNVMVLV...............VLICICACGCCA
Q292V6_DROPS/10-210SNPTNVFQQGCATKA...NENLKMQADITYYCCMAIIA........LEF....MGILTAYYMGRA
A8WRV5_CAEBR/10-229ATLS...QQGCATLF...WNAFQTNLIYV.AFVGIIVL.......FVEA....LAMIFSCIIINA
A1Z6T8_DROME/8-219TKHLNLFMTGCEVKF...KEYVGAKTANFHSLSWFLVI........FEF....AGSVTTCYLVDS
Q6NYK2_DANRE/16-288TEELNLFIHGCREAL...VNYFMGLMNTIGAVVLSVFL........IQ.....CSVLSSVRLLQT
Q7QJ21_ANOGA/10-221PIDTKVFNTGCMHVF...VKSIEMNMIRVAVVAVASAL........IQS....LGIFCAIQLTML
A2DRK6_TRIVA/8-224........ETCYNKV...NDKLTKSKKGLMIAGIGIAA........VQI....ILLIYSLWFGCC
H3D1H6_TETNG/10-250VAAAGIHPHGCFRKV...FSLVNDNVFHIAAAVLGLAF........TQI....GGIALACLLAKK
Q16GP3_AEDAE/10-260NSYY...KKGCYNAL...IDWIMYNRNLV.IIVA.IGVG......LVQL....LAIFLSFCLCKS
TSN14_HUMAN/15-260ESIF...TKGCIQAL...ESWLPRNIYIV.AGVF.IAIS......LLQI....FGIFLARTLISD
TET5_ARATH/5-241ATVLCYDCDTCRAGV...LETVRRDWHKLSLVNVIVVI...............FLIAVYCVGCCA
Q7SXT2_DANRE/17-242SVVY...HQGCFSLM...STTMEANLGII.AGIS.FGIA......FFQV....IGIFLACCLSRY
CD63_MOUSE/10-230STIH...TQGCVETI...AIWLRKNILLVAAAALGIAF........VEV....LGIIFSCCLVKS
Q67WQ6_ORYSJ/5-255QTALCYDCQSCKAGV...LANLKNDWKKIATVNIIFLI...............FLIIVYSVGCCA
F1Q6P4_DANRE/9-244WPIY...QTGCLEHV...GSWLFTNYGII.LGIC.LGVA......VIEL....LGMILSMGLCKS
H3CCQ2_TETNG/10-244WPVY...EAGCAASV...ERWVLTNIGVV.LGIC.VGVA......VIEL....LGMVLSICLCKN
Q9NB13_DROME/8-220VYQS...RPGCSAKF...EEFWNDNMDII.RWSG.LGLC......IFDL....VVFLIAGALTNC
Q06AT4_PIG/11-256...GYYHNQGCYELI...SGPMNRHAWGVAWFGFAILC.......WT......FWVLLGTMFYWS
A2DY51_TRIVA/8-215TDVAKASTTGCYDAI...KGKVKKNMYGLAAAAIVIIV........FEL....ALIVISCMYACC
M9PDV2_DROME/9-255SLWW...DKGCAHSL...QSWFTGQLNVV.GAVG.LGIA......FVQL....FGLITSMLLFCT
Q4D6X7_TRYCC/24-264QKEINGYNVTCESVVMGKIKEHLKEVLPIGLSITSIAL...............LGMIVTCLIQHE
F6ZCC3_XENTR/17-288TEELNIWIRGCREAL...LEYYDDLMQSIGLTVLLIWL........FE.....LSVLTGVRYLQT
C4Q3U8_SCHMA/13-222TKSIQSYSRGCHEVL...VEACRSNLSVI.CGVG.ISFA......LILI....SGMVFSMMLCCA
Q3UGA5_MOUSE/75-317VAGQVVFLQGCWPAL...QEWLRGNTGAIGDCAVAVVM........IQG....TELLLAACLLRA
H3DF34_TETNG/10-245LPVY...ETGCITNV...EKWLLENCGVI.LGIC.AVVA......VIEL....LGMILSMFLCKS
Q24FE3_TETTS/6-262.........DCKVHV...INFVEDNIIAIVISSSFITV........LLL....VSLIFNILFYLE
Q29IZ2_DROPS/19-231TVSGNAFFNGCVDEL...TWFFEGKTGWIVALAMTLAM........LNV....ICGTMSFVLVQA
Q86D97_SCHMA/8-230LSPEEVYKEGCKDKY...KVMLKDKLVIIFLATVSIAA........FEI....FCLLFSMVMCCT
Q9V3X2_DROME/10-260NAIY...QQGCVDKL...IEIIYENWVTI.FAVTAAVI.......LLEL....LSLTFALSLCCA
Q24C21_TETTS/15-284........DTCKEKFQDFVQSYGRVAYIVGLIVGAYLL...............INAILAFCLCCR
Q4S5B5_TETNG/9-229NTFW...TRGCYEKV...EAWLDENKHLL.GTIA.MCVL......VIQL....LGMAFSMTLYQQ
TSN6_BOVIN/17-236DKVN...NEGCFIMV...MTIIESEMGVV.AGIS.FGVA......CFQL....IGIFLAYCLSRA
A1Z6U7_DROME/8-215DTAQQIYPSGCLETLNRSQRYIQHRDKLYMWAIVGLEI.......FILL....QTVALSVLLFRL
Q16HX5_AEDAE/10-217CVFF...VEGCQSRI...GEFIDTAGDVL.GWVS.LGVA......AVEL....VGLIAACCLANG
Q19983_CAEEL/8-276QFIN...TRGCADAV...YESVSSSLSLIVGVCVVLCI........VQL....LGIVLSMTLCCC
TSN5_HUMAN/15-260IVIY...TKGCVPQF...EKWLQDNLTIV.AGIF.IGIA......LLQI....FGICLAQNLVSD
Q7KJ73_DROME/8-218PTNY...YPGCRGKF...VELMTTGSDNA.KYVGIGLI.......GIEL....IGFIFACCLANN
A8X5P0_CAEBR/8-222.PKPIAYPDNCFDRI...SHMVQSWGESI.VVVAFILL.......AIEL....FAILFSCILCRS
TSPD_DICDI/12-222QKNILYNGTFCYDVI...FGAVNSKLYLVGSAGVAIGV........IEL....VSLMFALFLIVR
Q5I0R1_XENTR/8-226KNYY...KETCLGVI...SDFFKNHLVII.IGIA.FGLA......AVEI....FGLVFSMILYCQ
Q29JV1_DROPS/15-245LDTF...DYGCFRKM...NFIISQSAMLI.ATGA.TTVA......FVQL....LGVLCAFMLAKT
Q4D693_TRYCC/54-284..SSNIYNATCKEPL...QEFFMNLFPLTTGGLFALGL...............VFLGFASLAVYR
A1Z8K7_DROME/9-232DKYF...QVGCVGKL...KDRIEKNAIIL.IGVG.IGIA......FIQI....LGIVLACYLANS
G4LW70_SCHMA/11-211ENLT..YTEGCVSVF...GAFLKRNLVIV.ACVA.FGVC......FFQL....LSIVIACCLGRQ
TSPA_DICDI/15-222GDKIKYEGHYCGEAL...SDQFSSKIYAVGAAGLAIGI........IEL....VAILFSLFLIIR
F1R4A1_DANRE/13-253RLIY...TSGCLDEM...VWWGQQNLLLV.GGMT.LVLL......CLEI....CMMSLASVQLCQ
Q16LT4_AEDAE/35-245EEGSTPFQQGCFNRM...SQVISYVVNLMASGTT.III.......IFQV....ICIVSAVVFLIK
Q7JWV7_DROME/8-217QVMT...RSSCLKAV...DSFWDTNVSII.KYAG.LGVT......AVEL....VAFIFACCLANQ
Q7K2V7_DROME/8-218IYSQ...RPGCRQEF...VDFWASNTDLI.RWSSLIIA.......LFEL....GIFIMSCCLASA
Q16J92_AEDAE/10-259DDIY...SDGCMEKL...VNEIKKNIKSV.YIIGACVI.......GVEI....LALFFALFLCCA
Q16TV5_AEDAE/9-253SLLW...DKSCGQIL...QMWFVQRLHVV.GTVGLVIA.......FLQL....FGLISSMLLFCT
A0CWV3_PARTE/5-271INDDSFNGESCFIET...KHFVESSGKTLGYVLLGLGI..........YF..GINVLFVLLICCH
Q22495_CAEEL/38-296ASIY...TEGCLPKL...QLWLNNNMLLVAVSMVIIAI........IQV....LGICFAQNLKSD
A2BIP5_DANRE/17-256GVIH...VRGCIHAV...NLWMGDNIGAT.IGIC.CAVG......LPQL....LGILLSCVFWNL
Q16LT5_AEDAE/18-239CVPF...NTGCFQKM...YALLRHCSKTVFSGLL.LVA.......GVQI....SAALFAFILGKR
H3DMZ9_TETNG/8-216SKIY...QSNCIDKT...AEWMKSNLEVV.LGVA.FGIA......ILLI....FGMVMAMMLYCQ
Q6P2T9_DANRE/10-229TVIY...LEGCQPIL...ETRIKENILWIAVGALVIGF........VQI....TGIVLACILSRA
TSN15_MOUSE/20-258NIIH...VRGCTNAV...LIWFMDNYTIM.AGLL.LGIL......LPQF....LGVLLTLLYITR
Q17441_CAEEL/24-258PNNI..FYRGCLPFL...KEEVYNNLNFL.FTVTAASL.......VLHF....ANLIFGCCTCFR
Q9XVI4_CAEEL/9-222APLF...EPGCIHSV...EQWVLKNGAMV.GGICAVLA.......AIQL....VGVCFACCLSKS
H3CSH9_TETNG/9-236THPGDLYQEGCEALV...VKKLREIMMYVIWTALTFAA........IQI....LGMLCACVVLCR
Q7K010_DROME/7-210SKPENLIHTGCRVEF...ENYWQHLTKIF.NILALVLI.......GFEL....LLSVISCRLCNS
Q292W4_DROPS/8-216DTVY...RRGCKAAF...VEFWDRNSDII.KYAGLVIA.......AIEF....VGFVFACCLANS
Q1HRC5_AEDAE/14-233PTPENIYIQGCLDIT...SNLIRDNAAFIGASGIIVAI........LLI....FGMIFSCSLFRM
Q6YWS4_ORYSJ/5-273QAVLCFRCNACKASA...LDTVRRNWRAVAVLNVAVLA...............ILMLAYSLACCS
O44582_CAEEL/30-289HDIY...TRGCLQPL...RTLFESHAVHVGAFVALLIVP......VC......ISVCLTNILAKQ
A2EZ30_TRIVA/8-218.......VQTCYNKI...DENLNKSKKGLKIARIVVIV........VQA....LLLIYSIWYGCC
H3DJN8_TETNG/8-231DLLN...LQGCETEL...DRLFQGVLGYALLVILGFAI........IKF....FGMLSVCVISCK
Q7JZW3_DROME/8-216SRVF...KTGCKAAF...VKYLDDKLLVF.KIVCWLLV.......IGEA....VGAVFGWLLYSS
TSPB_DICDI/15-222SKGIPKYTDTCDSVI...SSKISSNLYLVGAAAVSIGV........IEF....ICMLFALFLIIR
TSN16_HUMAN/11-245VSPNVIHQKGCFHKL...LKITKTQSFTLSGSSLGAAV........IQRWGSRYVAQAGLELLA.
Q7PTA7_ANOGA/10-219CVPF...ASGCLSRL...SEFLDSAGNIV.AWVS.LGVA......AVEL....VGLISACCLANA
B4I8V1_DROSE/10-227SACDTHYKRGCLAVV...SEQIRNRLLITAFGAAIIAI........FQS....LGIFCAVHLTIL
CD81_MOUSE/10-229.......QQDCHQKI...DELFSGKLYLI.GIAA.IVVA......VIMI....FEMILSMVLCCG
Q9W4X6_DROME/43-294KLIW...TSGCIEIV...RVWAEHNLYVI.AGNA.LGIA......LIQL....LVIYLAKTLEGQ
Q24C18_TETTS/15-277........ETCRVKFQNFVSSYGKVAYVVGFVVGSYLL...............VNAILAFCLCCR
TET2_ARATH/4-252QSQLCYNCNSCKAGL...LGNLRKEWRKANLILIITVV...............VLIWVYVIACSA
Q4DD38_TRYCC/91-307.......PVVCTDVV...YSTVRKNLSGF......LVIS......IFSMVLVVVGILFALLSRSA
H2VAF3_TAKRU/17-288TEELNVWRRGCREAL...LSYYGGMMTSIGVLVLLVTI........LE.....FGVTVGLQYVNS
Q29JV0_DROPS/11-237GVRH...TYGCLDGF...SNYIASHAVSL.GAAG.VVIA......VLQF....FGVIFACYIARE
Q7JZW7_DROME/8-209IHALYPYGEGCMAAVKRAYLQIYRYEKWVHCGLIGYEV...............VGIILGITLCCQ
TSN10_HUMAN/76-318AAQRVVYLEGCGPPL...RRWLRANLAASGGYAIAVVL........LQG....AELLLAARLLGA
Q7K527_DROME/8-207VNPLNLYVRGCLIKV...EEAFADEATTL........GYLEWGLLGFNA....VILLLAIILAIH
L9JBT3_TUPCH/22-369KVIY...TNGCIDKL...VNWIHSNLFLL.GGVA.LGLA......IPQL....VGILLSQILVNQ

PF04103

FCERB_HUMAN/60-204-------FFETKCFM---ASF...STEIVVMMLFLTILG--------------LGSAVSLTICGA
FCERB_MOUSE/52-195-------TEDDGCFV---ASF...TTELVLMMLFLTILA--------------FCSAVLFTIYRI
T176B_HUMAN/66-229-------KEECRAYM---QMLRKLFTAIRALFLAVCVLK--------------VIVSLVSLGVGL
A6H741_BOVIN/62-223-------EENCRRYM---QMLMDLFLGIRALLLAICALQ--------------VTVSLASLGVGL
T176B_MOUSE/60-224-------TERCREYL---NMMMNLFLAFCIMLTVVCILE--------------IVVSVASLGLSL
T176B_RAT/60-224-------TERCREYL---RMMMNLFLAFCILFTVICILK--------------IVVSVASLGLSL
T176A_RAT/63-223-------IGLCKYYT---SMLKTLLISLQAMLLGVWVLL--------------LLASLIPVCVYL
T176A_HUMAN/56-214-------LHLCTSFM---DMLKALFRTLQAMLLGVWILL--------------LLASLTPLWLYC
T176A_BOVIN/63-220-------LQQCTAYV---NMLKALFISINAMLLGVWVLL--------------LLASLLPLCLCC
Q4TAI3_TETNG/57-208-------EEKCREKM---LLTEWLLRCIIILLIILSVME--------------LCVSVSSAVLGI
A7SQ32_NEMVE/7-164-------PQEHFDER---NQNGENGVGIYGTLLALIVMD--------------VIVNLVTMAVCK
Q95PZ5_CAEEL/94-253-------DKYDFAKC---LWQLKVGVAVNSVQFVIAAIE--------------VFLNILSAILCM
Q9GYM6_CAEEL/45-206-------VDDAMRRR---MTRLGTDYRLDAGLIAAAILE--------------FLLSIATCVVAS
Q1LVQ8_DANRE/42-197-------DPIARMFV---FSAVSDCSDITSTLPMYYLLQ--------------VLLNLAQAIVCL
H3D3M7_TETNG/37-190-------DPIARTFT---YEGVGDCQAITGTLTLYFLVQ--------------IVLNLAQALVC.
Q3TRE0_MOUSE/29-182-------EPLSRAFV---YRDVTDCTSVTGTFKLFLIIQ--------------MVLNLVCGLVC.
A7S4D6_NEMVE/20-179-------KFEGVDDC---DILTGLLKELMYGLCVLNIFG--------------SLVCFIATILGC
Q0V9M1_XENTR/36-200-------KLNPLQEC---SAVRLTLKDLLFSVCALNIIS--------------TIVCALATAMCC
F6PJ14_XENTR/5-167-------KLFPVQSC---NAVHLLLKKVFFALCALNALT--------------TTVCLVAAALR.
F189B_MOUSE/36-196-------KVALNSTC---DEARGALKNLLFSVCGLTICA--------------AIICTLSAIVCC
Q5BLA7_DANRE/16-153-------VPEVRFVL---SRM...VKGANCTLLVACTGS--------------LLFSSLIAYIGC
F7AIP4_XENTR/16-154-------VIHARFIL---GKL...VQGANIAMLIASVSS--------------LCVALCIAYMGC
Q08BU9_DANRE/43-180-------TEDDYVYL---RQH...YSAVVAMECVFLCHG--------------LIGGVLLIIMTC
F1RAY4_DANRE/49-184-------TETELLYM---TQH...YSAVETMGCVFLCHS--------------LIGGVLLIIMTC
F7ESV6_XENTR/53-198-------TCKGSFYP---QTV...ITGMVAVLFILTIVE--------------LCVSLSTSIFAC
H3C9F3_TETNG/67-212-------RRDCLWKI---SLLDVSEYGSLGVLLVLLVLQ--------------VCVSITVSVFS.
MS4A3_MOUSE/27-172-------SPDVCISL---GSS...SDGLVSLMLILTLLE--------------LSVTISISAMWC
MS4A3_HUMAN/50-196-------SPDLCNYM---GSI...SNGMVSLLLILTLLE--------------LCVTISTIAMWC
M4A4A_HUMAN/65-207-------NSNNCHGT---MSI...LMGLDGMVLLLSVLE--------------FCIAVSLSAFGC
M4A6C_MOUSE/47-207-------DRSECAVT---KSI...LTGALSVMLIISVLE--------------LGLALLSAMLWL
M4A6B_MOUSE/47-204-------DRNECFAA---KSV...LAGVFSLMLISTMLE--------------LGLAVLTAMLWW
M4A6D_MOUSE/47-207-------PLNSCFVA---KAA...LTGVFSLMLISSVLE--------------LGLAVLTATLWW
MS4A7_HUMAN/47-207-------EIKDCLLT---SVS...LTGVLVVMLIFTVLE--------------LLLAAYSSVFWW
F6RP33_BOVIN/48-208-------DVKDCLLT---SVD...LTGVLLVMLNFTVLE--------------LLAAAYASVFWW
Q99N04_MOUSE/47-204-------EDKNCYLA---YVG...AMSALGMMLLFTVLE--------------VFLAGYSSIFWW
MS4A5_HUMAN/49-189-------QNSQCKAV---TVL...FLGILITLMTFSIIE--------------LFISLPFSILGC
Q810P8_MOUSE/49-189-------DGMQCGVI---TIL...FIGILVMLMIFSIVE--------------LFISLFSSVLGC
Q2KII2_BOVIN/49-189-------EVSECHAV---TTL...FIGILIMLMAFSIIE--------------FLISLSFSVMRG
Q3LRP2_CALJA/51-216-------NSPSTQYC---YSIQTLFLGILSVMLIFAFFQ--------------ELVIAGIVENEW
CD20_MOUSE/44-210-------NSPSTQYC---NSIQSVFLGILSAMLISAFFQ--------------KLVTAGIVENEW
CD20_CANFA/51-216-------NSLSIQYC---GSIRSVFLGVFAVMLIFAFFQ--------------KLVTAGIVENEW
W5PU80_SHEEP/51-216-------NSQSMEYC---ARIRFVFLSNFAVMMIFAFLQ--------------KLVTAGTVENE.
M3VZQ9_FELCA/52-215-------NSLSIKYC---DSIRSVFLSIFAVMVVFTLFQ--------------KLVTAGIVEN..

PF13273

Q8Y8F2_LISMO/3-121-------KPV.FAGY--------------------------------------LFLAAGVVSLLS
Q8Y8B4_LISMO/3-92-------R...GWGV--------------------------------------ILVIIGIVLFFV
C7N721_SLAHD/168-273-------NWK.LWGA--------------------------------------VIVAAGLVCAFA
G2TQJ8_BACCO/2-106-------RPK.LSGI--------------------------------------LLIIGALLVFFF
U5LDQ7_9BACI/5-123-------K...AAAV--------------------------------------IFIVVGVLSLPT
E8SF89_STAPH/28-121-------.KNILAGI--------------------------------------LLILAAATGLFL
F9UT90_LACPL/16-98-------V...LMGW--------------------------------------LIILCGILNFVF
B5IAA3_ACIB4/5-90-------EKVHSGGV--------------------------------------LAIIAAVITIWS
O26620_METTH/8-82-------R...RGGA--------------------------------------VLIISAVWLLIS
C2X4G3_BACCE/18-98-------K...VYGV--------------------------------------CMIVIPIVMLFM
I0JHL5_HALH3/2-113-------KPK.AAGI--------------------------------------ILIVTAIIMTFG
A3DKS5_STAMF/4-94-------R...KGGI--------------------------------------VVLIFSILSLPN
E8SF88_STAPH/14-126-------.HRIVSGL--------------------------------------LFLLVAIVTLPL
Q65KT1_BACLD/2-84-------K...LGGI--------------------------------------LLIISGIGGLIC
A5F9L1_CLOK5/1-82-------E...IAGK--------------------------------------VMIVAGISDLIV
D3FS61_BACPE/1-122-------K...MSGS--------------------------------------LFMFAAAASCFT
Q5HQ65_STAEQ/2-105-------N...LAAS--------------------------------------LLIAAAIVGLFT
K0J606_AMPXN/3-111-------RPK.VAGV--------------------------------------LLLIVGIFVSSL
B9EB15_MACCJ/41-157-------.KRIFAGI--------------------------------------MLLLAGLFTTPF
Q8ERL5_OCEIH/2-100-------K...LSGI--------------------------------------MFVSASCMTGVF
A0B9F9_METTP/2-84-------R...AGGA--------------------------------------LMLLSGILGFVT
Q5HKY5_STAEQ/3-109-------K...VSGI--------------------------------------LLVITGIIGLFL
A5UL06_METS3/42-117-------K...TGGI--------------------------------------ILIISAIWLLIS
B9DJ67_STACT/3-106-------K...TAGI--------------------------------------LLLIAGIITLLG
B9DJA4_STACT/148-230-------I...AMGV--------------------------------------ILIIGGLLNFIL
B9DPZ9_STACT/15-127-------.IRVLSGI--------------------------------------LFLIASIITLPL
Q65EV2_BACLD/2-89-------K...GWGI--------------------------------------FILIMGVLYTFS
K8E281_CARML/2-111-------R...GWGI--------------------------------------AVFICGILSIST
C3AKH5_BACMY/2-83-------I...AYGL--------------------------------------CMILLPLVTLVM
T0TBR3_9STRE/2-102-------NKKSLLGL--------------------------------------SYVL.....LFN
D7CIL7_SYNLT/1-83-------K...VAGI--------------------------------------MMLISAIGGVIS
Q3Y3E6_ENTFC/2-107-------KYLTTATG--------------------------------------LYFITGFILLIG
Q12UE5_METBU/2-98-------K...KGGK--------------------------------------LMLASGILGIAL
V5XRN1_ENTMU/2-106-------KASPMAAL--------------------------------------IYLISGVLLLFG
Q2G173_STAA8/1-105-------K...MSGI--------------------------------------LLIIGAVISGNI
Q81BB0_BACCR/2-82-------K...VYGV--------------------------------------CMIVIPIVMLFM
Q5HQP3_STAEQ/1-105-------I...ASGV--------------------------------------FYIIGAILSLNM
E6TU87_BACCJ/2-115-------KPK.VSGL--------------------------------------LFIITSVVAAIA
A8FJ46_BACP2/3-107-------RAV.ISGV--------------------------------------LFLVSAVTLLIG
Q8Y9W6_LISMO/2-106-------PKVKTLGV--------------------------------------CFIVLGGLQVFT
Q5HQ66_STAEQ/14-126-------.IRILSGL--------------------------------------LFLIAAIVTIPL
S6C3Q0_9ACTN/167-273-------AWK.VWGA--------------------------------------VVAIAGLVCAVA
B8D0X9_HALOH/8-93-------K...SSGI--------------------------------------VMIIAAVLTGFT
Q81UE0_BACAN/2-84-------K...VGGG--------------------------------------MMTIAAIGGFIC
Q97LL2_CLOAB/4-86-------K...LGGA--------------------------------------FMIIAAIGGFIC
Q5WAY8_BACSK/3-120-------V...VASI--------------------------------------LFLGSTLLYAIM
A5N2M2_CLOK5/4-86-------K...LGGI--------------------------------------FMIIAALGGLVC
A5UKZ4_METS3/8-83-------D...VGGF--------------------------------------LFIVSAILVLLG
B9DQ00_STACT/2-98-------I...IGGI--------------------------------------LLVIAAIVGIFL
Q8Y911_LISMO/3-104-------K...VFGI--------------------------------------LTLVAGVVGFFL
L0EGZ3_THECK/2-105-------NAAVAGWG--------------------------------------LIIVSVALCFVS
Q2G2G5_STAA8/2-104-------K...LSII--------------------------------------LFVIAIIVSLMA
R5AN22_9FIRM/46-142-------M...KWAY--------------------------------------IYLFLAISDLIL
Q8YAT4_LISMO/1-81-------R...LGGA--------------------------------------MMVAAAIGCTMS
Q2G2G6_STAA8/14-126-------.IRILSGF--------------------------------------LFLISAIVTIPL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window