Sequence alignment for CL0350

PF08683

H0VWE0_CAVPO/1041-1154PRLYKEPSAKSNKFIIHNALSHCCLAGKV--NEPQKNRILEVAGLQKSKA...NHFLILLR..DFQLSFLLLYTL.....
H3A647_LATCH/1122-1240PKLYKEPSAKSNKHIIHNALSHCCLAGKV--NESQKNKILE..EMEKSKS...NHFLILFR..DSSCQFRAVYTFS....
W5L5A1_ASTMX/1372-1490PRLFKEPSAKSNKPIIQNAIAHCCLAGKV--NEAQKNAILE..EIERCES...NHLMILFR..DGGCQFRALYTFA....
H3DN31_TETNG/1371-1489PKLFKEPSSKSNKPIIINAIAHCCLAGKV--NESQKNAVLE..ELERCES...NHLIILFR..DGGCQYRAIYSYS....
G3ID54_CRIGR/1300-1418PKLFKEPSSKSNKPIIHNAISHCCLAGKV--NEPHKNSILE..ELEKCDA...NHYIILFR..DAGCQFRALYCYQ....
K1RG89_CRAGI/1629-1748PKLFVKPSSKSNRHIIINAISQCVLAGPV--NSDQKNKVLE..VLAKSDA...KHFLILFR..DHSCQFRGLYSFD....
T1FTM3_HELRO/1327-1453PKLFVKPSSKSNRHLIENALSHCCLAGTV--NQDNKAKVLE..VLQRSES...KHFVVLFR..DVGMQYRGLYAYS....
T1FT91_HELRO/16-146PRLFVKPSSKSNKNIVENALSHCCLAGLV--NQDVKCKALE..ALQKSSS...KHFVVLFR..DVGMQYRGLYAYNINHN
T1JVZ3_TETUR/1171-1291PKLYVKPTAKSNRGIITNAIN.VVLAGAV--NANLKKKVLE..EMNNSES...KHFLILFR..GAGMQFRAIYSYN....
H9K1S2_APIME/47-165PRLYKQPTTKSNRGIMLNAVEYCVFPGTV--NKEAKRRVLD..EIAKSES...KHFLILFR..DAGCQFRALYSYC....
E9GLG3_DAPPU/4-122PRLYKQPAARSNRSIILNAVEYCVFPGVV--NREAKQRVLE..EITRSES...KNFLVLFR..DGGLTFRALYSFN....
E1JH92_DROME/43-161PKLYKQPAAKSNRGIILNAVEYCVFPGVV--NREAKQKVLE..KIARSEA...KHFLVLFR..DAGCQFRALYSYQ....
B5DQ16_DROPS/103-223SKLYRQPAGKSNRGNILNAVEYCILPGAV--NSKAKQKVIE..KIARSEA...AHFLVLFR..DVGCQFRALYSYM....
T1JA50_STRMM/1688-1805PKLFKQPTAKSNRGIIINAIN.TVLAGAV--NQETKKRALE..EIAQCDS...KHFLILFR..DSGCQFRALYSYY....
B7P704_IXOSC/1368-1485PKLFVKPAAKSNRGIVLNALN.TVLAGQV--NADTKRRVLE..EMGVSDS...KHFLILFR..DAGCQFRGLYSYQ....
C1E9P5_MICSR/31-163PRLFKAAPPLSNKKLVRNALRHVCLAGAA--MRTQLDEALT..ALDAVAPDVATVFVILFRENTSPHKYRALYALVSGDG
E4XQ07_OIKDI/331-449TRVFKEPTTKSNKQLMEMALKFHALPGPV--NKNERLKAMD..SMSNSGA...NHFLALYK....DKAYRGLYEVH....
U4PLF6_CAEEL/247-365HKLYAKTVTKSNRGLINNALQFSVFPGAV--NNATRQATIT..QMASSSS...KHFLILFR..DQKCQYRGLYTWD....
G7Y8F7_CLOSI/1059-1177TKLFVQLQSKSNRRVIANALSHCCLAGPV--NLEAKQTALT..ALGCSDG...KHFIVLLR...SHCQYSGLYSFS....
U6IMV1_HYMMI/1470-1589PKLFVKPKSKSNRQVIVNAISHCCLAGTV--NEPAKKLALQ..ELAAVDG...SHFIVLFR..DNRCQYRALYAFD....
G4VB99_SCHMA/1240-1359PRLFVKPKAKSNRTVVVNAISHCCLAGTV--NEPTKQLALK..ELAATEG...THFMILFR..DSRCQYRAVYSFD....
A7RQ86_NEMVE/2759-2876PQCYVKPSGKSNRKLIVNAISYVCLSGTV--NKDAKERCLQ..AISESNG...YHFMVLFK..D.GLKFRGLYSFN....
W4ZGS9_STRPU/2051-2169PKLFVKPTSKSNRHIIINAISHCILAGVV--NEKTKDKVLQ..EIAKADQ...KHFMILFR..DHSLQFRSLYSFT....
H2YGU2_CIOSA/310-428PKLFKKLSSKSNRALIHNALSHCCLPGKV--NESARLKILQ..ELEQSEA...RHLMVLFR..DNKCQYRALYSYN....
I3JUZ7_ORENI/1350-1468PKLYKEPSAKSNKHIIQNALAHCCLAGKV--NEGQKNKILD..EMEKSEA...NNFLVLFR..DAGCQFRSVYTYC....
F1QBR7_DANRE/1083-1201PKLFKEPSFKSNKFIIHSALSRCCLAGKV--NESQKNKIIE..EMEKSSA...SHFLILMR..DSNCQFRAIYTLD....
H2UUV8_TAKRU/1336-1454PKLFKEPSFKSNKFIIHNALSRCCLAGKV--NETQKNKIVE..EMEKSDA...NHFLILFR..DASCQFRGVYTMN....
I3IZS8_ORENI/1088-1206PKLYKEPSFKSNKFIIHNAITRCCLAGKV--NEPQKNKIVE..EMEKSTA...NHFLILFR..DSSCQFRAVYTMN....
G3HWW5_CRIGR/80-198PRLYKEPSAKSNKFIIHNALSHCCLAGKV--NEPQKNRILE..EIEKSKA...NHFLILFR..DSSCQFRALYTLS....

PF09939

B1M1G6_METRJ/7-71-------IQEHAEVVGSD-G---KHVGTV--DHI....D-K------------.GEIKLTK-------------------
C6XB17_METGS/7-69-------ILPGMPVLSAQ-N---TKVGTV--DGL....E-G------------TNLIKLTK-------------------
B0T0F4_CAUSK/7-71-------IREHLEVVGSD-G---GHVGRV--DHV....V-G------------.GDIELSK-------------------
B2IBV7_BEII9/496-558-------IHDHMNVMASD-G---QLIGVV--DHL....E-G------------.DRIMLTS-------------------
W6RB10_9RHIZ/7-74-------IKEHAEVIGAD-G---VHVGTV--DHV....E-G------------.HRIKLTK-------------------
E8UBB3_DEIML/25-87-------ITEHLQVKDVN-G---EHVGTV--DHL....E-G------------.DRIKLTR-------------------
E3FW49_STIAD/7-69-------VQPKMPVICSN-N---VPFARV--DHM....D-G------------SDTIKLAR-------------------
Q9RUW9_DEIRA/22-82-------..EHLQVKDKD-G---EHVGTV--DHF....D-G------------.NQLKLTR-------------------
B4RFD3_PHEZH/7-71-------IVQHMEVVGSD-G---GHVGRV--DHV....V-G------------.DEIELTK-------------------
D1CAB7_SPHTD/8-67-------IRPGMEVVGAD-R---VTVGRV--ERV.....-G------------EDAFLIRR-------------------
Q1GXW5_METFK/7-69-------ILPGMPVICSQ-G---GQFATV--DHM....E-G------------SNQIKLQK-------------------
Q9A832_CAUCR/53-117-------IKERHEVVGSD-G---GHVGRV--DHI....A-G------------.GEIQLAQ-------------------
G2INV1_9SPHN/7-71-------VREHMDIIGAD-G---VHIGTV--DKV....E-G------------.DRIKMTK-------------------
Q98NL9_RHILO/7-74-------IREHMEVVGAD-G---VHLGTV--DKV....D-G------------.QRIKLTK-------------------
Q2N7C7_ERYLH/7-66-------IKEHMEVVNAE-G---LHVGTV--DKI....Q-D------------.DNIKLTK-------------------
F0RQJ0_DEIPM/7-67-------IKADMPILCAD-G---NEHGKV--DHL....D-G------------.EYIKITK-------------------
Q1QG65_NITHX/7-70-------VREHMVVVASD-G---ETIGKV--DHI....E-G------------ANKIKLTK-------------------
D9QJA5_BRESC/7-71-------IKEHLEVVGSD-G---GHVGRV--DHV....L-G------------.DQIELAK-------------------
S5YA75_PARAH/7-73-------VKPGVEIVGAD-G---VHVGVV--DAL....D-G------------.DRIRLKR-------------------
W0AGA3_9SPHN/224-287-------VTEHMEVVGSD-G---VHVGIV--DKV....R-G------------.DRILLTK-------------------
W5X645_9BACT/7-70-------IQVRQEVVGLD-G---EHVGTV--DHL....D-G------------.NTIKLTR-------------------
A5VBW0_SPHWW/202-265-------VQEHQEVVGAD-G---AHIGTV--DHV....R-G------------.DRILLTK-------------------
G4RDP0_PELHB/7-71-------IKAGMEVLGAD-G---APVGTV--ASV....D-G------------.DRIRLEA-------------------
W0HSK3_9ENTR/7-72-------IMEHAQVTCCG-G---NHVGIV--DHM....E-G------------EDHIKLAK-------------------
C5AUI3_METEA/7-71-------IREHATVVGSD-G---GHVGTV--DHV....G-K------------.GEIKLTK-------------------
D4Z3N5_SPHJU/213-277-------VREHMEVVGSD-G---EHVGTV--DKL....R-G------------.DRIILTK-------------------
B8IND9_METNO/7-71-------IKEHMPVVGSD-G---GHVGTV--DHL....D-G------------.QRIKLTA-------------------
F7QG37_9BRAD/7-70-------IKEHMDVIDSA-G---KNIGKV--DHL....E-G------------NDKIKLTK-------------------
D9QI61_BRESC/7-71-------IKEHMEVIGAD-G---VHLGTV--DKI....E-G------------.DRIKLTK-------------------
Q6FG17_ACIAD/9-74-------IQHHAEVIGSD-R---QHVGTV--DHL....D-G------------QDKIKLAK-------------------
E8U4C3_DEIML/7-67-------IREHMDVICAD-G---HHHGQV--DHL....D-G------------.EYLKLTR-------------------
H8GZJ1_DEIGI/24-85-------..EHLQVKDVN-G---EHVGTV--DHM....E-G------------ADQLKLTK-------------------
Q1J0W1_DEIGD/32-93-------..EHMQVKDKN-G---DYVGTV--DHI....E-G------------.DQLKLTK-------------------
L0A9J6_DEIPD/7-67-------IREHMPIKCAD-N---KDHGLV--DRI....D-G------------.EYIKVTR-------------------
B9L317_THERP/160-226-------.DRGTAVIASD-G---TRLGKV--EHVHLNED-G------------.EIVSLAV-------------------
E6WLA8_PANSA/7-72-------VLDHAQVVDVN-G---EHVGIV--DHF....E-G------------DDKIKLAK-------------------
Q2K7A6_RHIEC/7-70-------IREHMEVRAAD-G---THVGTV--DQL....D-G------------PTRIKLTK-------------------
A6X517_OCHA4/5-71-------IQENMEVIGAD-G---VHVGTV--DRV....E-D------------.NRIKLKK-------------------
Q9RUN6_DEIRA/6-66-------IKEHMPIICAD-G---KNHGEV--DHL....D-G------------.EYIKIAK-------------------
L0A6S8_DEIPD/9-69-------IQHHMGIRDIN-G---QELGRV--DHV....E-G------------.DYVKITK-------------------
Q89BX0_BRADU/7-71-------IKEHMDVISSD-R---KMVGKV--DHL....D-G------------TDKIKLTK-------------------
G4SX79_META2/7-69-------IKPDMPVVCSQ-D---GQFATV--DHM....E-G------------PSTIKLKK-------------------
B9TN44_RICCO/7-69-------IKADMPVTTAQ-A---EHFAVV--DHL....E-S------------DDVIKLKK-------------------
D1CHC1_THET1/11-87-------VREDMEVYCSD-G---EKVGKV--GEV....N-I------------GTETSAGQ-------------------
F0RR01_DEIPM/12-72-------ITKHMPVFCAE-G---NNHGLV--DHL....D-G------------.DYIKLVK-------------------
L0D7J3_SINAD/77-139-------IREHMEVYGSC-G---NLLGKV--DHV....E-G------------.DHIKLTK-------------------
B9JP41_AGRRK/5-71-------IKENMEVIGAD-G---VHVGTV--ERL....E-G------------.DRIKLKK-------------------

PF05239

F5J6L5_9RHIZ/23-102PSLIASDKVEGTRVYGAD.G...KHIGSI..QRIILEKR.G------------GRVAYAVL-------------------
M4MND6_SINM2/36-117PTDVLSYNLINLNVTNTA.N...ESIGEI..KDLVLS...E------------GQLAGYIL-------------------
B1BXY5_CLOPF/90-162EDEYFIVDLVGCTVVDTE.G...FEYGKI..KDV.IQTP.S------------NDVYWVQG-------------------
A0A029T300_STRPY/96-169EGEFYYHQIIGMAVYEKD.....VLIGHV..KEI.LQPG.A------------NDVWIVKR-------------------
Q98MZ5_RHILO/112-191TEAIAASRVIGTSVYNTE.G...RSIGSI..EDIMLDKT.S------------NGIMFAVI-------------------
M4IQE9_RHIML/10-89HDLIASDRVVGTAVYDMN.G...ENVGSI..ERIILEKR.G------------GRVAYAVM-------------------
O28740_ARCFU/3-81M.IGEITTFFGMRVFTDE.G...RYVGRV..EDVILDQN.T------------KSIRGLAI-------------------
I6UR69_9EURY/1-71M.VMRLSKIYGKQIYTTK.G...KYVGYV..DEVIIDID.E------------GRGEVVLL-------------------
F7UNG5_SYNYG/4-81DNIRLRNEFINTEVITRSSG...KKLGVV..KEVLVDVD.Q------------REIVALGL-------------------
D6EQW7_STRLI/6-79RTDIDPRNLIGRKAFDRD.G...SRIGTV..DEVYLDDA.T------------GVPEWAAI-------------------
F5J745_9RHIZ/96-170DDEFYYADLEGLEAVDAE.G...KSYGAV..SAV.YDFG.A------------GDLLELKG-------------------
I0LL17_CORGK/96-169EDGFYDHELEGLRVIHEG.....EDIGEV..TGV.MHGP.A------------GEILEVRL-------------------
O27055_METTH/11-97GKMVELSSLYGLEIYTSR.G...KYVGRV..QDVVLNIK.K------------GRVSTLKV-------------------
E2L106_BORBG/94-166EGEYYLGKLIGYAIVNNN.....KKLGEV..VAF.FEYL.N------------SVFLEVRV-------------------
I0HUK4_RUBGI/139-212DVAKQDSDPRGKPVYGAD.G...AQAGTV..TDLWVDTP.E------------NLFRYFEV-------------------
RIMM_BACHD/97-172EGEFFYHEIIGCSVVTIA.G...EELGKV..KEI.LSPG.A------------NDVWVVQC-------------------
F2HJM9_LACLV/97-170DGEFYYHEIIGSDVYEND.....ILIGQI..SEI.LQPG.A------------NDVWVVKR-------------------
O26906_METTH/8-84GVQMKVTEFLGLKVLDKN.A...MEIGKV..SDLEVDPE.E------------GLIKSLII-------------------
RIMM_RHILO/95-169EDEFYHADLVGLEVRDDT.G...TALGKV..VAV.HNFG.G------------GDILDVTL-------------------
RIMM_MYCLB/104-177PDTYYDHQLEGLQVRTMM.G...RDVGVV..AEV.LHTA.A------------GELLAVRC-------------------
Q8TT13_METAC/152-231PEFLSASTIKGDKIISST.G...EDIGKI..DELMIDLE.N------------GRVAYAAV-------------------
Q9RCZ1_STRCO/2-76ITREEIANVLDQPVYDGD.G...NKIGDA..KHVFFDDM.T------------GRPEWVSV-------------------
A0A008AU35_STAAU/94-166ENEFYYSDIIGCTVFDDQ.E...TPIGRV..INI.FETG.A------------NDVWVIKG-------------------
I6V2D8_9EURY/1-87MVKIRASKLRDVELITDT.G...VRLGWV..YDLLFEEE.G------------EEKGKILA-------------------
Q9V279_PYRAB/1-70M.VMELSKLYGKLIYNTK.G...KYVGKV..DEVVIDIK.E------------REGRVLIL-------------------
Q97L79_CLOAB/5-84LNNFFLSEVLYRKVYDEY.G...EYVGKL..WDIYVTAD.E------------SYPRAIGY-------------------
D5RFY3_FUSNC/93-167EDEYLVSDMIGFKVYDVKGD...EYLGEI..TEI.MDTA.A------------HDIYVIES-------------------
B1BG32_CLOPF/3-86NNVRYLSEIERYEIININDG...EKYSGLINNDVIIDE..E------------GKLKYLIV-------------------
Q8YXT2_NOSS1/83-164IEVEALSNLINWEVITET.G...EVLGRV..RGFRFEAE.T------------GKLNTIVI-------------------
D6ERH6_STRLI/93-167EDEYYDHQLIDLDVVTED.G...TEVGRI..TEI.SHLP.T------------QDLFVVER-------------------
Q98FN8_RHILO/179-262ADGNLATNIIGKTVYNGT.GDDAQNIGSV..NDIVLSK..E------------GKAESLVI-------------------
Q98FN8_RHILO/47-130AEGNIVTNIIGESVYNGT.GDDAENIGKV..SDVVFDK..D------------GMAKSVVI-------------------
Q9HJW3_THEAC/44-126LVMEFYSRVNQKPVMSSS.G...EIIGYV..KSFMADEK.W------------NLTTMVAK-------------------
Q9X7S4_STRCO/2-79DELMAARSLTTRPVVTLG.G...DAVAHV..KDTVCDAA.A------------ERITGFTL-------------------
Q8KZ61_9PROT/139-211KVHKNDPDPRGQAVFGCD.G...AQGATV..VDLWVDRA.E------------PHFRYAEL-------------------
H1CR04_CLOPF/4-80LTMFLYSNIINKKIYDEF.N...EVLGVL..KDVYVTTE.D------------GYPRIIGY-------------------
Q8TT13_METAC/9-88PDFLSANTLKGDKVVNRA.G...EDIGKI..EELMIDLQ.D------------GRVGYAVL-------------------
Q984C7_RHILO/152-230GPGLRVDEIVGSEVRSSD.D...KIVGEV..RNVVIGTK.D------------RWDYAVVA-------------------
Q8YLI3_NOSS1/15-92DTEFDNYNIKDFDVYSDIDN...DKVGTV..KHILVD.D.S------------GRFRYLVV-------------------
Q8RA47_THETN/1-81M.SVRLSEFGSKEIVNIVDG...KRWGLVEDSDLIIDED.T------------GKIHSIVL-------------------
J7JY51_BACIU/19-95HTLRTCHEVEGFPVYSERTS...SYLGTI..SDICFSLK.G------------DCLGFILA-------------------
Q9FHG3_ARATH/177-263EGEFYSRDLVGMRVLLKETG...QLVGTV..ANI.FDNG.G------------NDLLHVLL-------------------
O29888_ARCFU/1-79M.YVPARSLARKSVVLTD.G...TVVGTL..YNITVDFK.T------------GTIVNLLV-------------------
Q8YPZ0_NOSS1/27-104QDSFQGNDIKGLGVYTERSD...EKIGTV..NDVLVD.D.E------------GHFRYLIV-------------------
D4FWS0_BACNB/1-81M...RLSELSGKEIVDIKRA...ERLGVLGQTDLEINEQ.D------------GQITALLI-------------------
Q8PVJ8_METMA/1-79M.RAELTSLFGLNIYTNN.G...VYVGKL..QDLVIDVE.E------------QKVTGLAV-------------------
Q9RVX7_DEIRA/85-163EALAGKTNLIGMTLLTTD.G...QTLGKI..TDVYFDER.S------------GQVEGYEA-------------------
RIMM_DEIRA/98-175EGTFYYHDLRGLEVYGAG.G...ERLGTV..SDV.MDAG.H------------QDLLVVDY-------------------
B1BJ77_CLOPF/1-72M..YRIRDLIGLKVFDSN.G...KKVGVV..CDLAIDYF.N------------GKVMGFII-------------------
Q8YXT2_NOSS1/4-80EQIIRRSDILNTQVITRDNG...KRLGIV..SQVWVDID.Q------------REVVALGL-------------------
B2S4E4_TREPS/101-174AGEFYLADLCRCELVFE..G...SAVGVV..LSV.VEGG.G------------SSLLEVQR-------------------
Q979P9_THEVO/4-82FEAYTIENLRGKYVYTNK.G...IFVGQV..SDVILDFD.N------------NVVHGLFI-------------------
Q98FN8_RHILO/332-413VGEIKASDLKGTTVYGAN.D...AKVGEI..GDVVLTP..D------------KKTDAVIV-------------------
Q8YPY9_NOSS1/14-91RETFGGDDVKALELYTQS.G...VRVGAI..ADVLVD.N.E------------GRFRYLVI-------------------
RIMM_NOSS1/159-240EDEYHVVDLIGMEVFLQASG...DLVGAV..VDV.I.PA.G------------NDLLEVSL-------------------
A0A023WIW9_CAMJU/95-175KDEFFYFDILECEVFEED.....KRLGKV..VDI.LETG.A------------SYLFEIQS-------------------
B0R4K6_HALS3/3-85ADADEITSLVGREVYSNN.G...VFVGEV..EDIQLNLN.A------------EAVTGLAL-------------------
Q9KDE9_BACHD/84-153PLMHGQHKLQGKPLITEE.G...ERLGLV..QDVYFLEK.A------------GKIVAYEV-------------------
Q93RD8_THETI/139-214SIAEGDPDPRGMTVVGLD.G...EVAGTV..SDVWVDRS.E------------PQIRYLEV-------------------
Q9KDE9_BACHD/1-73MRTF..ASLEGLPVIDRQTG...NELGSV..MDGIIA...P------------DRMMGFLV-------------------
Q8KYZ8_9PROT/141-216FHVSAGRDPRGKPVVAGD.G...EVIGRI..NDMWIDVP.E------------QMVRYLTV-------------------
Q9X7S4_STRCO/87-169HQQNLRARLRGARVLTEA.G...TEIGTV..LDVVVEGGTG------------GRVVGFRV-------------------
M1Q0V3_METMZ/2-84SKVFARNLLFNKQVMATD.G...TEIGTL..SNIVIEIK.G------------GRIIDLMV-------------------
M1PY15_METMZ/7-86PEFLSASTIKGDKVVNTA.G...EDLGKI..EELMIDVD.D------------GRIAYAAL-------------------
A0A024I550_LISMN/97-171ENEFYFHEIIGCTVVTTD.G...EELGEI..TEI.LTPG.A------------NDVWVVKG-------------------
Y1118_METJA/1-81MEKMPAKLLFERSIIGNK.G...SVIGKV..KDIVFDEK.V------------GRLVSLEV-------------------
Y916_METJA/1-83M.AIRVSDILDKPIYTTT.A...IYVGKV..YDVMLDLN.K------------GVISGLIV-------------------
Q98P08_RHILO/254-335IDKIRAEDLVGTTVYGAN.D...AKVGKI..GDVVLTG..D------------KKVDAVLI-------------------
Y1314_DEIRA/22-95DTSM..YNPVGAAAYGVN.G...DKIGTV..RDALVEPE.T------------GRIRYFLV-------------------
Q98P08_RHILO/125-208PNGSLVSKIIGATVYNGT.DANAQTIGKV..NDVLLAK..D------------GKAQSLII-------------------
M1PY15_METMZ/146-225PIFLSADSIKGNKVVNRD.G...NDIGKI..DEIMIDLQ.D------------GNVAYAAV-------------------
F7UQ71_SYNYG/108-184PGEFHVTDLLGLIVYDHDNG...DRLGIV..TD..FYSA.G------------NDLLGITL-------------------
Q8TV79_METKA/1-85MRIL..RDLIGKPVIDSS.A...KHIGEV..LDVEFDEE.S------------GEVTTLIV-------------------
RIMM_CHLTE/94-167DDRAYIHELIGLDVFDET.E...GRVGKI..SDV.LQMP.A------------HDVYEVDT-------------------
D0GDM0_BRUML/47-131PGQLLTSDFIGQPVYNGP.SDDADNIGTV..NDIILGA..D------------GTPQAIVI-------------------
F0K604_CLOAE/90-164EGQYFIKDIIGCNVFDEN.D...KDLGEV..YDV.ISTK.N------------NDVYCIRK-------------------
F6BUU3_SINMB/96-170EDEFFYADLEGLEAVDRT.G...KSYGSV..TGV.FDFG.A------------GDLLELKG-------------------
Q8TTG0_METAC/16-93RTFVAATEIKGSKILTVK.D...EELGTI..KEVMIDSE.W------------GRIAYVVF-------------------
A0A014MKM5_BRUML/96-170EDEFFQTDLIGLEAVDGD.G...KSYGVV..SAI.FDFG.G------------GDLIELSE-------------------
F0K6L6_CLOAE/3-86DNVKYYSEVEKYEIININDG...EKYATVSNNDIIIDD..S------------GKMISLII-------------------
F0K5B3_CLOAE/1-72M..IRSREFIGADVYSTK.G...EKIGAV..DDVILNFS.S------------GFVLGFKI-------------------
F0K5U4_CLOAE/3-84LPSHSINAMKSMEVIDINTG...TKLGLI..KDLKIDTE.E------------YKVISIIL-------------------
D4FWD1_BACNB/1-81M..ISISEFQVKDVVNVSNG...KKLGSI..GDIDINVT.T------------GKIQAIIL-------------------
RCEH_BLAVI/144-217SIAEGDVDPRGLPVVAAD.G...VEAGTV..TDLWVDRS.E------------HYFRYLEL-------------------
D4FWJ7_BACNB/98-172EGEFYFHEIIGCEVFTEE.G...ELIGKV..KEI.LTPG.A------------NDVWVIGR-------------------
Q8TT13_METAC/470-549PDFLSANTIKTDRVVNTA.G...EDLGRI..DELMIDLD.N------------GRVAYAVL-------------------
F7UNG5_SYNYG/83-164VEVDLYSPLVNSEVVTET.G...EPLGRV..RDFQFDLA.T------------GKVSSIII-------------------
Q9RJP4_STRCO/15-90FEAENIRDWRGLDVVDYD.G...RKIGTL..ESIYFDTL.T------------DRPAFATV-------------------
Q9K9U3_BACHD/1-82M..LKISDLQAKDIVNMENG...RRLGTI..TDLDINLT.T------------GQISSLVI-------------------
A9CG63_AGRT5/75-157ENQVSANDYIGKSVYTGA.D...ESIGNV..TNLIMEQ..D------------GGLVAAVI-------------------
RIMM_AQUAE/95-164EEEYYAYELVGMEVETDK.G...KKLGKV..ERV.QDMG.P------------YDALVLDK-------------------
Q8TT14_METAC/106-185PDFLSSGTIKGDKVINKA.E...EHLGKI..EELMIDLE.N------------GRVAYAVL-------------------
Q8YLG6_NOSS1/15-91NEIFGGNDIKDFDVYADN.....DKIGNV..DNILVDED.D------------GHFRYFII-------------------
Q9HJM4_THEAC/8-86EKEFDVASLIGKDVYTIK.G...IKVGRV..NDIVLDFD.K------------NQIHGIFI-------------------
B1BWA6_CLOPF/3-83ENLFSLNNLRAMEVIDVSEG...KKLGLI..ADVKIDCD.D------------NRILSIII-------------------
I0ZIN9_HELPX/101-181EGEFFYCDLVGLSVVEEN.....EILGKV..IEI.QRIS.Q------------TDYFLVET-------------------
Q7CY35_AGRT5/58-138KTDLTASQLDGMDIYNAQ.N...ENIGEI..EDVVIGD..G------------KSVIGLVA-------------------
Q8R9H5_THETN/1-81M..IKASDLRDKEVIDINTG...EKLGNI..IDIDVNLE.E------------GKIEGIIL-------------------
F0K5B3_CLOAE/73-150GSFIRFNSIKNMDVINYD.G...TILGMV..EEIMFDEK.T------------FKIKGIIV-------------------
D9PY16_METTM/9-79GEEKYWSEIKGYQVATNN.A...RILGEL..EELIINDK.T------------GKITDVVI-------------------
Q97A34_THEVO/1-81M.MDFYSRLIEKPVMSSS.G...EIIGHV..KNFSIDEK.W------------NIVTMIAS-------------------
A0A038FBU7_MYCTX/100-173PDTYYDHQLVGLMVQTAT.G...EGVGVV..TEV.VHTA.A------------GELLAVKR-------------------
Q9KA86_BACHD/1-79M...RLSEISGKEIIDFQRG...ERLGVLGQTDLVIDEE.N------------GQIEAFII-------------------
Q9RVX7_DEIRA/1-75M..IKGKELLGRPVVAVSNG...AQVDNV..HDVVFDHQ.G------------NRVLALLV-------------------
B8GVS8_CAUCN/97-173DDEFYLTDLVGLTVRHIQTD...QLLGRV..KSV.QNFG.A------------GDILEITP-------------------
D5ANS0_RHOCB/142-214MKVSAGRDPRGMPVQAGD.T...EVVGKI..VDMWVDIP.E------------QLVRYLEV-------------------
F6E1B0_SINMK/85-167ENQVSANTYIGQSVYNAS.D...ESIGEI..NDLIIEK..E------------GGIAAAVV-------------------
Q16DS5_ROSDO/140-215FIVSAGRDPRGLPVMSGD.K...EIVGKI..TDMWIDEP.E------------QLVRFLEF-------------------
Q8RTW1_9PROT/141-213KVNSRDPDPRGCAVIACD.G...KQGGTV..TDLWVDRA.E------------PLFRYAEV-------------------
A3PL22_RHOS1/140-212FHVSAGKNPIGLPVRGCD.L...EIAGKV..VDIWVDIP.E------------QMARFLEV-------------------
D5AWT2_RICPP/94-165EDEFYIADLNHLQILDQS.N...KEIGKI..KNI.LNFG.A------------GDIIEIEF-------------------
Q8TZ43_METKA/14-101KRYVRFQRLLGMEVFTED.G...RRVGTV..EDVTFDPR.T------------GDLVRFLV-------------------
M1PY15_METMZ/656-735PEFLSAGTIKGDKVINTE.G...EDLGKI..EELMIDLD.D------------GRVGYAVL-------------------
F2GRW5_BRUM5/6-88NEGLSAEKLIGAMVYDAD.E...TKIGTI..GDVLMSA..D------------GQTEAFVA-------------------

PF08683

H0VWE0_CAVPO/1041-1154.......GRL.R..IL.HCLGG.YRPCIVTPAM..GL....SHLQRFTRI.RAKTMSMSVDAFTI-
H3A647_LATCH/1122-1240.......WDS.E..EM.TRLTG.IGPRIITKSMIEGIYKYSSDRKLFTQI.PSKTLSMSVDAVTI-
W5L5A1_ASTMX/1372-1490.......LDT.E..EI.LKLAG.TGPRAITRKMIDKLFKYSSDRKQFTVI.PAKTVSASVDAITI-
H3DN31_TETNG/1371-1489.......PDT.E..EM.VKFTG.TGPRAIGHKMVDKLYKYSSDRKQFTVI.PAKTVSVSIDALTI-
G3ID54_CRIGR/1300-1418.......PDT.E..EI.YKLTG.TGPKSITKKMIDKLYKYSSDRKQFNLI.PAKTMSVSVDALTI-
K1RG89_CRAGI/1629-1748.......PDS.E..DS.IKIHG.IGPKQITSKMIERFYKYNSGGKSFSEVTSTKHLSVSIDAVVI-
T1FTM3_HELRO/1327-1453TTASNGGADG.D..EI.VKLHG.VGPKIVTSKLIEKFFKYNSGSKTFSEVTSTKHLSATIDGITL-
T1FT91_HELRO/16-146IPCSDIGTRG.C..EI.VRLHG.VGPKVVEPKQIEKFFKYNSGAKNFFEVTSTKHLSATIDGVTL-
T1JVZ3_TETUR/1171-1291.......PDREDRQEI.VKLHG.NGPKIVTDDMIDKFYKYNCGGKNFNEV.QTKHLSVTIDAFTI-
H9K1S2_APIME/47-165.......PDR.E..EV.SKLYG.TGPKQVIDKMFDKFFKYNSGAKCFSQV.HTKHLTVTIDAFTI-
E9GLG3_DAPPU/4-122.......PEK.E..EI.IKMYG.TGPKLVNDTMFEKFFKYNSGGKCFSQV.HTKHLTVTIDAFTI-
E1JH92_DROME/43-161.......PET.D..QV.TKLYG.TGPSQVEEVMFDKFFKYNSGGKCFSQV.HTKHLTVTIDAFTI-
B5DQ16_DROPS/103-223.......PESGD..RVQTKLYG.TGPSQVDGAMLDKFFKYISERKCFSEV.HTRHLNVTIDAFTI-
T1JA50_STRMM/1688-1805.......PER.D..EV.FKLFG.TGPKQVMQHMMDRYFKYNSGGKSFMEI.QTKHLTVTIDAFTI-
B7P704_IXOSC/1368-1485.......PER.E..EV.GRLFG.VGPRTVTAPMMDLFFKYNSGAKSFSRI.HTKHLTVTIDAFTI-
C1E9P5_MICSR/31-163GV.....DDADG..VL.VKIHGTGGPARVGLQWVDATMKYDSGQREFKPLATSGRLTPLTAAVTL-
E4XQ07_OIKDI/331-449.T.....VEELM..RI.SKIHG.TGPKEVSETMIAELLKFNSGSKNFQLV.DGKTLSPAIDGFRL-
U4PLF6_CAEEL/247-365........EISD..TA.VKISG.QGPPKCTEAMMNSMFKYDSGAKNFTNI.ATKHLSATIDGFAI-
G7Y8F7_CLOSI/1059-1177........AADD..VG.VRISG.LGPKRIDNSLVERFYKYDSGSKRFTEITSTSHLSTVVDAVML-
U6IMV1_HYMMI/1470-1589.......FDT.E..EL.KLICG.NGPRKITHGMCDKFFKYNSGAKQFSEITSTKHLSAVVDAITI-
G4VB99_SCHMA/1240-1359.......LEL.E..EL.RIICG.NGPRRITHEMVNRFFKYNSGAKQFTEITSTKHLSPVVDAVTI-
A7RQ86_NEMVE/2759-2876.......PEN.E..QL.YKVFG.IGPRVITAKMIDNLYKYSSGGKEFVKI.HSKTLSISVDGLSI-
W4ZGS9_STRPU/2051-2169.......PES.E..EL.TKVYG.TGPRHITNKMTDTLYKYNSGGKHFAKV.PSKSLSVQIDGVTI-
H2YGU2_CIOSA/310-428.......PET.E..KL.TKING.TGPHTISAYMILSLFKYNSGRRAFTCV.PSKTLSVSIDAITI-
I3JUZ7_ORENI/1350-1468.......PET.E..EI.TKLAG.IGPKNITTKMIEALYKYNSDRKQFSQI.PAKTMSASVDAITI-
F1QBR7_DANRE/1083-1201.......GQS.E..EL.HRLCG.VGPRVISSSAVEAIYKYSSDRKQFNTL.PSRTLSMSVDAFTI-
H2UUV8_TAKRU/1336-1454.......SDS.Q..EL.VRLAG.VGPRTIGSTQVESMFKYSSDRKQFSTI.PSKTMGMSVDAFTI-
I3IZS8_ORENI/1088-1206.......PET.D..EM.ARLTG.IGPRVITLDMVESIYKYSSDRKQFTVI.PSKTMSMSVDAFTI-
G3HWW5_CRIGR/80-198.......GET.E..EL.SRLAG.YGPRTVTPAMVEGIYKYNSDRKRFTQI.PAKTMSMSVDAFTI-

PF09939

B1M1G6_METRJ/7-71-------KDPSA--G.-.....-......GLH...HFIPVD-----FVQSIDGGKVRLDRPADEVM
C6XB17_METGS/7-69-------DEQ..--..-.....-......GQH...HYIPKD-----WVASTDNAEVKLSCDEKRAV
B0T0F4_CAUSK/7-71-------LDLGG--G.-.....-......FKH...HLIPVT-----WVDHVDDDGVHLTLTKDDAK
B2IBV7_BEII9/496-558-------SDSPD--..-.....-......HLE...HFIPLA-----WVKTIG.ADVELDKPANMVK
W6RB10_9RHIZ/7-74-------KDSGE--GS-H....-.....RGHH...HYIPLG-----LVAEIEGDKVRLSANGDVAV
E8UBB3_DEIML/25-87-------TDSRD--..-.....-......GQH...HYIDLS-----DVRSADDVAVYLDKARDQL.
E3FW49_STIAD/7-69-------DEN..--..-.....-......GEH...HYIPLS-----WVQSVDDAGIHLDRPGKEAM
Q9RUW9_DEIRA/22-82-------DDSTD--..-.....-......GQH...HYVALS-----QVESMDNVAVYLNVSRNDI.
B4RFD3_PHEZH/7-71-------LDLAA--G.-.....-......LKH...HMIPMS-----WVDRVEEDTVCLNRTKAAAK
D1CAB7_SPHTD/8-67-------DLEPP--..-.....-............RVLPFT-----AVREVANGVVTLMLKAREV.
Q1GXW5_METFK/7-69-------DEN..--..-.....-......GQH...HYIPVS-----WVTATDNAEVTVDRPGEQAM
Q9A832_CAUCR/53-117-------FDLGG--G.-.....-......LKH...HLIPLS-----WVEYIDDAKVHLSVTKDDAK
G2INV1_9SPHN/7-71-------ADSGS--HG-.....-......SHH...HYLSGG-----LVAEIEGDQVRLSATGAAA.
Q98NL9_RHILO/7-74-------ADSGE--GA-H....-.....KGHH...HYIPLA-----LVAEVDGKKVWLSANSDVAV
Q2N7C7_ERYLH/7-66-------SDSMD--..-.....-......DMH...HFLSLD-----DVEKLDDNRVYLKKDA....
F0RQJ0_DEIPM/7-67-------DAH..--..-.....-......GQH...HWLPLS-----TVDHVD.QHVHLKLKHEEVK
Q1QG65_NITHX/7-70-------GDSPD--..-.....-......GKH...HFIPLD-----WVENVD.DRIHLGKAAKDVR
D9QJA5_BRESC/7-71-------LDLAG--G.-.....-......FKH...HMIPVS-----WVESVDDDKVRLSLTKDDAK
S5YA75_PARAH/7-73-------KDVAH--G.-.....-......GESPGARYISVN-----NIASTEGGKLWLSANADLV.
W0AGA3_9SPHN/224-287-------NDKDA--G.-.....-......GHH...HSIPSR-----WIDRVD.DRVILEKTAQQAQ
W5X645_9BACT/7-70-------KDSDS--E.-.....-......GQH...HWIPLD-----LVAEVD.DKVYLSVTTPEAK
A5VBW0_SPHWW/202-265-------GDRDA--G.-.....-......GHH...HSVPCA-----WIAEVS.DKVTLNRTAAQAQ
G4RDP0_PELHB/7-71-------VDIGS--HA-.....-......GHK...HYIPGG-----IVAIVEDNTVRLSATGANA.
W0HSK3_9ENTR/7-72-------NDPES--G.-.....-......GKH...HLIPLS-----WVKEVKENKVILSKTQDEVH
C5AUI3_METEA/7-71-------SDADA--G.-.....-......GLH...HYIPLD-----LVIAVEGDQVHLDRSAEEVK
D4Z3N5_SPHJU/213-277-------NDQES--G.-.....-......GVH...HSIPSS-----WIRSVDAQKVTLEKTAEQAQ
B8IND9_METNO/7-71-------SDPDA--G.-.....-......GHH...HFIHID-----SIASIEGGQVRLNRTTAQAK
F7QG37_9BRAD/7-70-------ASSPD--..-.....-......GQH...HFVPVA-----WIDHVD.THVHLNKAVNDVS
D9QI61_BRESC/7-71-------ADSGS--HS-.....-......DHH...HYLSGG-----MVAEVEGNQVRLSANADNA.
Q6FG17_ACIAD/9-74-------NDQAA--Q.-.....-......GQH...HYIPTQ-----WVQQIQGNQVVLNKTAEQVF
E8U4C3_DEIML/7-67-------DAQ..--..-.....-......GQH...HWLPLS-----TVDHVD.EHVHLNLRHEEVA
H8GZJ1_DEIGI/24-85-------NDSTD--..-.....-......GQH...YYVQLS-----QVESMDEVAVYLNVTRDEI.
Q1J0W1_DEIGD/32-93-------SGSHD--..-.....-......GQH...HYVPLS-----SVESMDDVAVYLNVTRDQIK
L0A9J6_DEIPD/7-67-------DEH..--..-.....-......GQH...HWLPLS-----AVDHVD.EHVHLKLNHEQLH
B9L317_THERP/160-226-------DPGLF--G.-.....-......GEP...LHIPAE-----WIDSVTEEAVHLTVDAATA.
E6WLA8_PANSA/7-72-------SDPEA--G.-.....-......GQH...HIIPFS-----WVKEVDDNKVILSKTRDDIE
Q2K7A6_RHIEC/7-70-------TDSED--..-.....-......GKH...HLIPLD-----WVDHVD.AHVHLSKNARDVR
A6X517_OCHA4/5-71-------TDNSG--MH-S....-......DHH...HYIELG-----FVADIEGDKVRLSANADVAV
Q9RUN6_DEIRA/6-66-------DAQ..--..-.....-......GQH...HWLPLS-----AVDHVD.EHVHLKLSHEQVH
L0A6S8_DEIPD/9-69-------DTD..--..-.....-......GNH...HWIPDD-----LIMRVD.QYVHLNLAGEEVM
Q89BX0_BRADU/7-71-------QSSPD--..-.....-......GQHH..HFIPLS-----WVDHVD.QHVHLNKTGADIT
G4SX79_META2/7-69-------DKT..--..-.....-......GRH...HYIPVC-----WVTSTEDGRVKVDRPGDEAM
B9TN44_RICCO/7-69-------DEA..--..-.....-......GVH...HYIPVS-----WVISTEGGIVKINRTLAQVT
D1CHC1_THET1/11-87-------VDTEE--RS-FFQVK-RGIFGLGDD...LYVPAE-----QIQEVTDDRVVLACTKDEL.
F0RR01_DEIPM/12-72-------DEQ..--..-.....-......GQH...HWLPLS-----AVDHVD.EYVHLNLSHAEVA
L0D7J3_SINAD/77-139-------NDSPD--..-.....-......GQH...HKIPLS-----WVAKVH.DHVHLSKSCGEAQ
B9JP41_AGRRK/5-71-------SDSFG--RH-E....-......GHY...HYIEIG-----FVAGIEGDKVRLSANADIAV

PF05239

F5J6L5_9RHIZ/23-102-------SFGGF--LG-I....-.....GDDY---YPLPWE....KLHYDEELDGYRIDLTKEQI-
M4MND6_SINM2/36-117-------SVGGV--LG-M....-.....GERY---VVVSPKALKITYVENDKKWTAVMDATKDQL-
B1BXY5_CLOPF/90-162-------K....--..-.....-.......KE---VLVPVLK.DIVLDINMDEKLITIRPSGEWQ-
A0A029T300_STRPY/96-169-------QGK..--..-.....-.......RD---LLLPYIP.PVVLNVDVPNKRVDVELMEGLD-
Q98MZ5_RHILO/112-191-------GFGGF--LG-I....-.....GEKY---HAIPWA....SLDYDENRGGYVVPFSKEQL-
M4IQE9_RHIML/10-89-------SFGGI--LG-I....-.....GHEH---YPLPWE....MLDYNTDLGGFQVNITKEQV-
O28740_ARCFU/3-81-------SDYNK--.A-LI...-...DSHAKG---VIIPYR......VVKAVGDIIIIKDLFKRK-
I6UR69_9EURY/1-71-------ALPG.--..-.....-.......ER---VGVPYE......RVTAVGDIILVEATTEKK-
F7UNG5_SYNYG/4-81-------RDN..--..-.....-.......FL---SLTGMPQYLYLNSIVQTGDVVLVENDDVFE-
D6EQW7_STRLI/6-79-------RTGLF--S.-.....-.......RD---AFVPLE......PSELVDGALRVPFDRALI-
F5J745_9RHIZ/96-170-------AGR..--..-.....-.......RP---ALIPFSE.AAVLEIDLEAGRILIDPMAAGL-
I0LL17_CORGK/96-169-------TSG..--..-.....-.......KE---TLIPFVH.AIVPEVDLEEGTATITPPEGLL-
O27055_METTH/11-97-------RPMRH--DK-KNVGI-KDVLKTSIR---IVPESD......EIRPIQEEGIIDINYDRV-
E2L106_BORBG/94-166-------GI...--..-.....-.......KF---FFIPFLS.IYIGDINTQEKTIELKVLDLLK-
I0HUK4_RUBGI/139-212-------ELAEG--G.-.....-.......RK---VLLPVN......FAILKRDAVKVTALLGHQ-
RIMM_BACHD/97-172-------RRGG.--..-.....-.......KD---LLIPYIE.QVVKQVDLEKQQITIEPMEGLL-
F2HJM9_LACLV/97-170-------KGK..--..-.....-.......RD---LLLPYIP.PVILNVDVNQHRVDVSIMEGLD-
O26906_METTH/8-84-------SKGEL--SL-.....-.....KQRT---FIVDME......SVSRVGDYVVLAIAADEA-
RIMM_RHILO/95-169-------AGR..--..-.....-.......KG---VLIPFTQ.AAVPDVSVAEGFVRVDPVAAGL-
RIMM_MYCLB/104-177-------DS...--..-.....-.......GE---VLVPFVG.AIVKLVSLDDGIVEIDPPKGLL-
Q8TT13_METAC/152-231-------SHGGY--LG-V....-.....GSKF---FAIPWQ....ALQLKVHEHAFVLDISKETL-
Q9RCZ1_STRCO/2-76-------KTGMF--G.-.....-......STE---SFVPIR......DAALVQDHLEVPYGKDQV-
A0A008AU35_STAAU/94-166-------S....--..-.....-.......KE---YLIPYIA.DVVKEVDVENKKIIITPMEGLL-
I6V2D8_9EURY/1-87-------ILAEP--DE-DIDIS-KFRITEDEL---LIIPIT......AVKSIGEVIIIDSSKLAQ-
Q9V279_PYRAB/1-70-------ALPG.--..-.....-.......ER---VGVPYE......KVVAVGDIILVQA.SEKK-
Q97L79_CLOAB/5-84-------KIKKG--G.-.....-.......EY---INYEFKSIHFYREDESRKIYMQVKAVKDTI-
D5RFY3_FUSNC/93-167-------EE...--..-.....-.......FE---TMIPDVD.VFIKNIDFENRKMLVDTIEGMK-
B1BG32_CLOPF/3-86-------NLGGG--.K-FNL..-...FNSDEY---LEIEWE.....NVKRIGAKTIILDVDSDMI-
Q8YXT2_NOSS1/83-164-------ASLGV--PQ-.....-......IPD---QFLSTYEISIEEVVSTGPNRLIVFEGAEER-
D6ERH6_STRLI/93-167-------PDG..--..-.....-.......SE---VYVPFVS.EIVTGIDLDAQRAVIDPPPGLI-
Q98FN8_RHILO/179-262-------GVGGF--LG-L....-.....GAKN---VTYDFNKAQW..AEKNGDRWLVAQTTKEAL-
Q98FN8_RHILO/47-130-------GVGGF--LG-V....-.....GTKN---VAFDYDKLQW..AEKNGDRWLVAQTTKDEL-
Q9HJW3_THEAC/44-126-------PSGGR--GR-LNI..-..PTDDDGN---YLIPMS......NVNVGNDAIVVMNIESIR-
Q9X7S4_STRCO/2-79-------TGRGL--LS-.....-.....GPLK---EGLPWS.....AVYALGHDAVMIRDRRGLV-
Q8KZ61_9PROT/139-211-------EVGD.--..-.....-.......RR---VLLPMT.....MARVKRDGSVHVKSIRSDQ-
H1CR04_CLOPF/4-80-------KVKR.--..-.....-.......DG---VIFDYEF.KNIDFYQKDNGKFKIQIRGSRE-
Q8TT13_METAC/9-88-------SFGGF--LG-M....-.....SDKF---FAIPWQ....ALQLRVHEHAFLLDIPKETL-
Q984C7_RHILO/152-230-------SGGFF--IA-.....-.....GKDS---IVVPLR....YLQVNEERTSFYLRISSADV-
Q8YLI3_NOSS1/15-92-------DTGFW--FF-.....-......GRQ---VLLPIG....RSRFNYTNRRVYANGLTKEQ-
Q8RA47_THETN/1-81-------YEPGG--.F-FR...-....GRGNY---IEIPWD......AIKRIGDDMIIVEFEGKP-
J7JY51_BACIU/19-95-------QK...--..-.....-.......RF---LHHHHALLRACDISSIFDDRILASVSSEQL-
Q9FHG3_ARATH/177-263-------DSSME--VC-NGN..-...AKTNQL---VWIPFVD.AIVPDVDLERKEMYITPPKGLL-
O29888_ARCFU/1-79-------KPENE--.I-PDF..-...KKEEGL---YIIPFE......CVRSLKDFIVVDR.RRVR-
Q8YPZ0_NOSS1/27-104-------DLGFW--IF-.....-......GKK---VLLPVG....RSRIDYGAGRVYAIGMTRDQ-
D4FWS0_BACNB/1-81-------PTVKW--.F-GL...-...RKQGHD---IRVPWH.....HIQKIGSDMIILDVPEEMP-
Q8PVJ8_METMA/1-79-------SDINR--.E-LF...-...DISSRG---IIIPYR......WVITAADIIIVRDVIQRY-
Q9RVX7_DEIRA/85-163-------SGGLF--AD-M....-.....TNGR---TFIPAP.....QSIQIGKDSAIVPAGVAAA-
RIMM_DEIRA/98-175-------GGGTS--F.-.....-.......VP---LQAPYVE.VPLAGGKPGAVHLTADAPAGLI-
B1BJ77_CLOPF/1-72-------TKKLF--S.-.....-.......KR---DYVDLT......NVISLSDTIMTEGVHVHR-
Q8YXT2_NOSS1/4-80-------RDS..--..-.....-.......LI---SISGLPRYMYLSSIHQYGDVILVDN.EDVI-
B2S4E4_TREPS/101-174-------THG..--..-.....-.......GV---CYVPFHR.TFIGDVDVGRKKIELLQRWILE-
Q979P9_THEVO/4-82-------AKTNE--.K-LV...-....KDGDP---ISIPYN......YVRSIGDIIILKSFPDLM-
Q98FN8_RHILO/332-413-------NVGGF--LG-I....-.....GTKE---VAVGLDNLKFM.TDKNGKKYLYTTFTKEQL-
Q8YPY9_NOSS1/14-91-------DTHID--DS-.....-.....ISKK---ILLPIG....LSQINYPERRVYVDGLSKEQ-
RIMM_NOSS1/159-240-------HEPVT--SD-K....-.....KPKT---VLIPFVK.AIAPVVDLQTRRIEITPPPGLL-
A0A023WIW9_CAMJU/95-175-------DEKWV--EK-K....-.....YPKI---FFIPYLD.KFVKNIDIEKRQIFCTQDAFLI-
B0R4K6_HALS3/3-85-------TELNA--.D-LFAA.-..QMTGQKG---VIVPYR......WVRAVGDIILINDVVERY-
Q9KDE9_BACHD/84-153-------TEGLL--AD-I....-.....TE..---............GRKVVRSNGPVTVGKDVL-
Q93RD8_THETI/139-214-------EVAAN--K.-.....-.......KK---VLLPIG....FSRFDKKARKVKVDAIKAAH-
Q9KDE9_BACHD/1-73-------NKNGW--F.-.....-......HRH---QWLPLD.....HIISLGTDGVMIEAKGLSK-
Q8KYZ8_9PROT/141-216-------DLNPE--GT-.....-......GQT---RLIPIN......FCKINDDRVTVRSIYGAN-
Q9X7S4_STRCO/87-169-------AASRR--FV-PGP..-...TRHRRR---VYVPRG......RTLTVSGRALVLPDGAVR-
M1Q0V3_METMZ/2-84-------SPNPT--FD-ASR..-..YKKEDNY---LLIPFD......SVSAIKDYIIIDKMKARA-
M1PY15_METMZ/7-86-------SFGGF--LG-M....-.....GNKL---FAIPWQ....ALKLRLHEHTFLLDIPKETL-
A0A024I550_LISMN/97-171-------ADK..--..-.....-.......KE---KLIPYIA.DVVKEINIDDQKITIEVMEGLL-
Y1118_METJA/1-81-------EPAEH--.S-PIM..-...REEGRN---VLIPYK......LVVAIKDVVVIDETNLNR-
Y916_METJA/1-83-------SDIQN--.G-CLKD.-.YVTDPSKK---VVLPFN......LITAIGNIILVKPPADSG-
Q98P08_RHILO/254-335-------DVGGF--LG-I....-.....GAKE---VAVGMDNLKFM.TDKSGNKYLYTNFTKEQF-
Y1314_DEIRA/22-95-------DVGGW--FS-.....-......SKE---VLVPVG......YGRVDDSGVYFDSLTKDQ-
Q98P08_RHILO/125-208-------GVGGF--LG-I....-.....GEKN---VAFDFNKAQW..AEKDGKRWLVIKTTKEDL-
M1PY15_METMZ/146-225-------SHGGI--LG-I....-.....GSKL---FAIPWK....AFSLRIRDNAFILDIPEETF-
F7UQ71_SYNYG/108-184-------DKNPD--..-.....-.......KE---VLVPFVE.AIVPTVELAEQRLEIKTIPGLL-
Q8TV79_METKA/1-85-------GHSKR--PG-VLRKI-KWLGGEEKA---VRIPYS......NVVAIEDMVLVEGRWVSR-
RIMM_CHLTE/94-167-------GD...--..-.....-.......RK---VLIPAVE.DFITETDLEKGMVRLKRFKEFL-
D0GDM0_BRUML/47-131-------GVGGF--LG-V....-.....GEKD---VAIGCNHFSWV.DKSGGTRWLMVDADKEQL-
F0K604_CLOAE/90-164-------EGQ..--..-.....-.......QD---ILVPALK.DIVLKIEIENKKIVIKAVEEWL-
F6BUU3_SINMB/96-170-------PGL..--..-.....-.......RP---VLIPFTE.WSVLEIDLEAGKLVIDPTAAGL-
Q8TTG0_METAC/16-93-------ACDCF--LG-M....-.....KCKF---FAIPWG......ALHTSRGDYILKVDKDAF-
A0A014MKM5_BRUML/96-170-------KGK..--..-.....-.......RP---MLIPFTE.AAVPEIDFDKGIIKVEPHAAGL-
F0K6L6_CLOAE/3-86-------GNNNT--.G-FSL..-...FSKNEF---FEVEWQ.....YIKKIGARTIIMDVDNSVM-
F0K5B3_CLOAE/1-72-------NKGKV--F.-.....-......NKH---CCISVK......NMVSFTSKMIVNYVP.YK-
F0K5U4_CLOAE/3-84-------PGSKV--.G-GW...-...FSKGND---IEIDWT.....DIQKIGVDVILVNGDNLFV-
D4FWD1_BACNB/1-81-------GGNGK--.V-LGF..-...FGKEEE---LVIPWR.....NIVKIGEDVILVRLSEPHA-
RCEH_BLAVI/144-217-------SVAGS--A.-.....-.......RT---ALIPLG......FCDVKKDKIVVTSILSEQ-
D4FWJ7_BACNB/98-172-------KGK..--..-.....-.......KD---ALIPYIE.SVVKHIDVREKKIEIELMEGLI-
Q8TT13_METAC/470-549-------SFGGF--LG-M....-.....SDKL---FAIPWN....FLTYRAHEHAFTLDIPRDVL-
F7UNG5_SYNYG/83-164-------ASLGL--PQ-.....-......IPD---QLISTYELSIDEVVSSGPNRLIVFEGAEER-
Q9RJP4_STRCO/15-90-------TIGLP--TR-.....-......RRL---VFVPVD......KATVGPSYLKVTYDKSLV-
Q9K9U3_BACHD/1-82-------GGGGK--.V-MGL..-..FGRGEDE---VVIPWK.....NIIKIGSDVILVEVPQFND-
A9CG63_AGRT5/75-157-------GVGGF--LG-I....-.....GAKD---VAVPMDKVTMTRNTQDGTIRLTTTETAETL-
RIMM_AQUAE/95-164-------.....--..-.....-.......EN---LLVPFVS.DIVLKVDKENKKIIVK..EELL-
Q8TT14_METAC/106-185-------SFGGF--LG-M....-.....GDKF---FAIPWQ....ALQLKVHKHAFVLDVPKETL-
Q8YLG6_NOSS1/15-91-------DTGFW--VF-.....-......GKK---VLLPIG....LARLNYENKRLLVPGLTKEQ-
Q9HJM4_THEAC/8-86-------MNTND--.R-LV...-....KNGDP---ISIPFN......YVKAIGDIIILKSFPDLM-
B1BWA6_CLOPF/3-83-------PGEKT--.S-FF...-....SKSED---IEIEWS.....DVYKVGVDVILIDSKGKNI-
I0ZIN9_HELPX/101-181-------TLNLV--EK-G....-.....LAKI---FLIPYRD.FYIQEILLQDKKITTHNAKTLL-
Q7CY35_AGRT5/58-138-------SVGGF--LG-.....-......IDK---SYVVLDPASVAVHNDNGTWKAYVDTTKDAL-
Q8R9H5_THETN/1-81-------PKETG--.F-FRF..-...FSKEAE---IYLPWA.....AIKKIGSDVILVDFRSANG-
F0K5B3_CLOAE/73-150-------SRGF.--..-.....-.......FA---NLVSGKKIILEGNYMLGKKNLFCFSNDKNL-
D9PY16_METTM/9-79-------KVD..--..-.....-.......SG---RNVTVK......GAKKKGDYLLVPFGKVEK-
Q97A34_THEVO/1-81-------PASKK--YE-NLP..-...TDDDGN---FLIPMA......NVNVGKDAIVVMNIESIK-
A0A038FBU7_MYCTX/100-173-------DS...--..-.....-.......DE---VLVPFVR.AIVTSVSLDDGIVEIDPPHGLL-
Q9KA86_BACHD/1-79-------PTMRW--.F-GF...-...GKKEKE---VTVYWD.....QIKKIGQDMIIIDL..EHM-
Q9RVX7_DEIRA/1-75-------EEGGW--L.-.....-......RAA---KAVPFG.....RVQSIGEKAVMIATPEDVV-
B8GVS8_CAUCN/97-173-------DLGG.--..-.....-.......PT---WYLPFTR.AAVPEVRVSEGLILADPPALVG-
D5ANS0_RHOCB/142-214-------ELNSG--..-.....-.......KK---KLLPMT......MLKIWSDRVRVNAITSDL-
F6E1B0_SINMK/85-167-------GVGGF--LG-I....-.....GEKN---VAVPFDKIAVADQPDSDDIKLTTTETADSL-
Q16DS5_ROSDO/140-215-------ELEGK--WG-.....-......SGT---RLVPMT......FANIKSNRVNIAALYGEH-
Q8RTW1_9PROT/141-213-------DVGD.--..-.....-.......GT---RLLPMT.....MARVSKDGTVQVKSIRSDQ-
A3PL22_RHOS1/140-212-------ELKDG--..-.....-.......ST---RLLPMQ......MVKVQSNRVHVNALSSDL-
D5AWT2_RICPP/94-165-------LDK..--..-.....-.......TT---ELLPFN....KEFFPIITKDYVILNYQTKV-
Q8TZ43_METKA/14-101-------IVTEQ--PS-GGGLL-PLPGGGGRR---TETVDA.....ELVKAVGDIIIIESPEKAS-
M1PY15_METMZ/656-735-------SFGGF--LG-M....-.....GDKL---FAIPWK....ALSLKVHEHAFVLNIPKDVL-
F2GRW5_BRUM5/6-88-------DVGGF--LG-I....-.....NSKP---VAISIANLDVATGKDGKLSVFTQFTKKDLQ-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window