Sequence alignment for CL0352

PF06013

Q97MZ9_CLOAB/4-89-------KIR-------------LTVSEIDHTASVFAKNGQDIEN----VLK.ALTNEK.NKL.---VS..S-WE.GDAA
A9B0A6_HERA2/4-89-------KTK-------------FDPQVMQQAAATFGKAHEGLQD----VNQ.EVLSIA.NTL.---QE..S-LK.GDAG
Q81TJ4_BACAN/3-88-------LIK-------------ITPERLEQSAKLVQDIRQTLDN----MHK.DLYNQT.EYI.---AS..Q-WT.GATS
Q81R67_BACAN/3-88-------EIK-------------ITPEELERIAGNFKNAAGEAQS----QIN.RLEGDI.NSL.---EG..Q-WA.GATQ
Q81R60_BACAN/6-91-------EIK-------------VKPEQLEQIAKNISEMQTHSQN----IQQ.NLNQSM.FSI.---QM..Q-WQ.GATS
Q97LZ0_CLOAB/3-88-------LIK-------------MAPEELEQLAAKFSAASEESQQ----MVS.TLGSGI.ANV.---QQ..N-WA.GVSA
Q8ERJ1_OCEIH/4-89-------QIR-------------MSPEQLQAKAKRYGQSSQTIDQ----VLR.DLQGLQ.DEL.---RG..E-WE.GRAF
Q81HA0_BACCR/6-91-------QIR-------------MSPEELKSKAAQYGQGANQIED----ILS.QLQNLQ.NEL.---RG..E-WE.GRAF
A3CR39_STRSV/3-88-------QIK-------------LTPEELRTSANRYTEGSENVTQ----VLT.TLTNEQ.AII.---AD..N-WD.GSAF
A8FGZ8_BACP2/4-89-------IIR-------------VTPEELRATAKQYGVESQEVLN----QVD.RLNRMI.SDL.---KG..M-WE.GASS
Q65FF4_BACLD/4-90-------IIR-------------VTPAELRQMADRYQKESGDVTE----QVNQRLDQMI.NQL.---QD..M-WE.GESS
Q5WK78_BACSK/4-89-------LIR-------------VTPEELYQKADDYNRSSGEIHD----LVS.RLDGYR.DQL.---QG..M-WD.GQAS
A3DD43_CLOTH/4-90-------VIR-------------ITPEQVRSAAVKIGKKTSETTN----FLN.SIQREI.DSL.---KS..I-WE.GKAA
Q9KE84_BACHD/3-88-------QIR-------------MTPEELRTEANETRSDAASYQD----LLQ.RGDARI.EKL.---GS..T-WE.GEAF
Q97LY9_CLOAB/4-91-------KIK-------------MQGEQLDSVASNLLNDAKTVQT----VLD.NLQSKY.LQIL---ND..N-WE.GNSK
Q97LY7_CLOAB/15-100-------SMK-------------VNAEEIQAMAKRYKELADKAST----ILN.SLNSTI.DEM.---KQ..N-WK.GKSS
Q97MZ8_CLOAB/5-90-------KIE-------------VNTKMILDLSKRFKDASNTAKN----TKG.NMQKVT.DRL.---ID..G-WN.GKSV
Q97KJ1_CLOAB/6-91-------DIE-------------IDASIFEETIKVYSDSKVRLHD----ILC.DLENEL.RKM.---ED..T-WE.GDAK
Q97MZ2_CLOAB/6-93-------DIK-------------INMETLQSAINEYKNCKTTLEN----LLK.ELESGL.KALE---GT..E-WK.GAAK
Q97M02_CLOAB/3-88-------RYD-------------VTPKELKISAKIFKEKSDEIMG----RIS.RLKASV.DIY.---GA..T-WQ.GAGH
Q9L0T5_STRCO/28-115-------DLD-------------ITYQDMRDAAKHVVKEKEKLQE----KLD.GLRKYI.ANLV---ES..G-YVTKSSS
A6WCP9_KINRD/3-90-------NLN-------------VTFDDMRTAATNLDHGKAEIAD----QLA.RLKALV.DGLV---SS..G-YVTDRSS
Q6ACE0_LEIXX/8-95-------NIK-------------VSYAEIETSASQLSSGREEITT----KLQ.RMQSQI.QNLV---TS..G-FVTDQAS
A1T456_MYCVP/3-88-------HLK-------------VDPDVAFNTSRSVSNDAVELHE----QLD.SLQHDW.DNL.---SR..G-WS.GAAS
Q73SS3_MYCPA/16-101-------TVR-------------VDPVVMQGAAASLSGAAEHLSA----QLG.QLDDQV.GQM.---LG..G-WQ.GASG
A0QTK0_MYCS2/4-90-------SLE-------------VVTSELRSASAALADAGQRLQD----GLS.AVDLSV.DQLL---GS..G-WK.GGAG
A1SN44_NOCSJ/4-90-------PLA-------------ADHLAFRAAVAHVRGTVAQLAE----DRD.RVAARV.DALL---DR..G-WR.GGAA
Q5YN04_NOCFA/7-92-------PLN-------------VVPDAVTAVGRRAYDIAQQLKS----GSI.ALDREV.QAL.---FD..T-WK.GSAA
Q5YRS3_NOCFA/4-91-------ELQ-------------VEVDRLREAARFVADKAQIIRE----RVT.QLDTTIGKELL---AD..G-WQ.GKAA
O86644_STRCO/7-92-------RTA-------------VNYDTVTQAAIDVRKTTRELSE----GLE.TLMRKV.AAV.---AE..T-WQ.GEAK
Q82K72_STRAW/7-92-------GTQ-------------VTYDALDFAATSIGNEAKTLEQ----DLQ.ELKKLV.AQC.---KQ..Y-WD.GAAQ
ES6LX_MYCLE/3-88-------NIN-------------YQFGEIDAHGAAIRAQAAALET----THQ.AILATV.RDA.---AE..F-WG.GQGS
Q5Z1J3_NOCFA/4-90-------QIS-------------ANFAGVEDGARQIIKRAEGIRD----ELE.AFHKKV.EEFV---TT..N-WK.GATN
Q73TD4_MYCPA/3-88-------QIM-------------YNYPAMLSHAADMSGYAGTMQG----LGA.DIASEQ.ATL.---SN..A-WQ.GDTG
ESXR_MYCLE/3-88-------QIM-------------YNYPAMLDHAGNMSACAGALQG----VGI.DIAAEQ.AAL.---QA..C-WG.GDTG
Q6NJ54_CORDI/3-88-------KIK-------------YGFGEIEAAASDIQSTSGRINS----LLE.DLKAHI.RPM.---AA..A-WE.GESA
Q8NST7_CORGL/3-88-------MIR-------------YEFGAIQGAATDINSTSGRINS----LLD.GLKSQL.QPM.---VA..S-WE.GESS
A1SDG6_NOCSJ/5-90-------GLR-------------VNHAGLDTVADDLGQAVKRIDD----RLN.RLESEL.APL.---RS..D-WS.GSAQ
Q8G878_BIFLO/3-88-------QYQ-------------VDSERIQSSSAAVATSISQIRQ----AVG.GMYTNL.NAL.---QD..A-WR.GSAA
A1A0W4_BIFAA/3-88-------QYQ-------------VDSEQIQSSSAAVNASIQSIRQ----AVQ.GMYGNL.NNL.---QS..V-WR.GGAA
A6WE48_KINRD/3-88-------RFE-------------VDSARVEQASAAVARSSSSIAA----EVE.AMVRHL.LDL.---ES..C-WK.GQAA
A1R3I1_ARTAT/3-88-------VIS-------------VDTELLQLKSANVKGTVDRISS----DVQ.TMRRGL.EEL.---EA..T-WR.GTAA
A0JT10_ARTS2/3-88-------IIS-------------VDTELLQLKSANVKATVDRIST----DVQ.AMKRGL.DEL.---QG..T-WR.GSAA
A0LR18_ACIC1/3-88-------GIR-------------VTPEQLATLSGRLNSGSATIEG----ELR.AMAGAL.APL.---GT..D-WA.GMAQ
A5UYZ8_ROSS1/3-88-------PIS-------------LDPQQARATASVFDGGKGSIEG----ELS.RMMSSV.SEV.---TS..T-WS.GQSR
A5UYZ9_ROSS1/3-88-------MIS-------------LDTDAARSASATLAASKSSIEG----ELG.RMMSSA.NEV.---MS..T-WS.GTSR
A5UZ07_ROSS1/3-89-------QIK-------------ADTDALRATIAAMRQGSSAIEN----ALQ.QAAQAM.ATLQ---NS..R-WS.GNHQ
Q6NJ55_CORDI/4-89-------GFK-------------TEADVMRNTAHRVDDTNQEVSA----ELS.RLRSIV.DGV.---RA..S-WE.GTAQ
Q73S33_MYCPA/6-92-------TVS-------------TDFDLMRSVAGTTDARNEEIRA----MLQ.AFIGRM.SGVP---PA..A-WG.GLAA
ES6LY_MYCLE/5-91-------HFM-------------TDPQAMRDMARKFDMHAQNVRD----ESH.KMFMSS.MDIA---GA..G-WS.GTAQ
O05453_MYCTU/4-91-------TIQ-------------VTPQMLRSTANDIQANMEQAMG----IAKGYLANQE.NVMN---PA..T-WS.GTGV
A9B1N8_HERA2/5-91-------IVQ-------------ADFEVMDQVAQRLSKNAESVTA----MQN.TLKQTI.EDL.---RS..T-WL.GDAA
A9B0B5_HERA2/5-92-------VVQ-------------IQYEQTAQVAQHFGRLKQTVEQ----LQT.TIRNVS.QSLV---DG..D-WQ.GDAS
A9B2P0_HERA2/5-91-------VVE-------------INYAQMQQLSQRFQRQAEVVSQ----LQQ.QLNHTY.QQL.---QN..D-WH.GDAA
A9B726_HERA2/5-91-------VVQ-------------SDYEQLGQVATRFQKLHDQQTQ----MEA.MLRQTY.QQL.---RT..D-WK.GDAA
A9B720_HERA2/5-92-------IVQ-------------HKSDDMEQVSSRFQKLHDHQVQ----MEA.MIRRMY.EELR---GG..A-WQ.GDAA
A9B8D4_HERA2/5-92-------IVQ-------------AQFEQLEQIASRFNRQAEQSES----ITQ.SIRQVH.DALV---GG..Q-WQ.GDAA
A9AUV8_HERA2/5-92-------IVQ-------------IDYQEANQLAQRFSKQQTHVQA----ILQ.SLRQTI.QALE---NG..G-WM.GDAA
A9AUW0_HERA2/5-92-------IVQ-------------IQYQQLEQLAQRFAKQQTQVQA----ILQ.SLRQTI.QALE---HG..G-WM.GDAA
A9B561_HERA2/5-92-------IVQ-------------IDYAVVDTIIQRFQKLYDQSQT----IQA.SLCQTM.ASLQ---AG..Q-WQ.GSAA
A9B6G5_HERA2/5-91-------IIQ-------------VEYNHLLQVAQRFRTKAEAVVS----LRQ.QLRATV.GQL.---RN..D-WS.GIAA
Q5YRS2_NOCFA/6-91-------SYR-------------VNLQQLDDAITTMADFGTEVEG----WLR.EVDAKI.AAL.---HL..S-WS.SQAA
Q5ARS9_EMENI/25-110-------QIS-------------VDYGQLEQFAQDVQSFADSTYS----QFS.QVSAQF.DVL.---TG..S-YS.GSGR
O86643_STRCO/16-101-------SVD-------------YSDQDLTDLADKIRTFHTDVSS----RVT.SLNAVV.DMI.---QG..G-WQ.GAAG
Q5YU75_NOCFA/7-92-------SLA-------------AAPTELVAAAKAVRTLLDELSS----GFQ.SLDADV.ESL.---IG..S-WK.GRQG
A0QNJ5_MYCS2/3-88-------AMN-------------TDAAVLAKEAANFERISGELKG----VIA.QVESTG.SAL.---AA..Q-MV.GQAG
ESXB_MYCLE/3-88-------EMI-------------TEAAILTQQAAQFDQIASGLSQ----ERN.FVDSIG.QSF.---QN..T-WE.GQAA
A4FPH3_SACEN/3-88-------GFA-------------GDVEIIDKASGQIDEVRGNIEQ----AVN.TLQGQM.EPV.---LA..N-WK.GGAS
Q5Z1J2_NOCFA/6-93-------SLD-------------ASPELIAQKAKEFQEQHANLMA----AIR.TLKADE.DAV.---TNGAN-WK.GQAR
A5A655_BACLD/2-80-------..K-------------ISHNGTIKAHSHAKAIEKHVGD----SLK.KAKELK.AYVE---SG..K-WS.GKTR
B0RAY2_CLAMS/4-88-------.YQ-------------VDSEAVLSATAAVQGSIGRIQA----EVA.GLHGQL.AEL.---QG..S-WS.GSAA
B2HDH7_MYCMM/3-87-------.IN-------------YQFGDVDAHGALIRAQAASLEA----EHQ.AIVRDV.LAA.---GD..F-WG.GAGS
B2HNR7_MYCMM/7-90-------.LS-------------ANAAAMLGFAESLRGAAEHLQG----ELA.ELEGQV.GDM.---LG..G-WR.GASG
B8DTZ3_BIFA0/3-87-------QYQ-------------VDSERIAASSAAVCSSITAIRD----AVT.TMYANL.NAL.---QD..A-WR.GAAA
ES6LD_MYCTU/7-90-------.LR-------------VEPAVMQGFAASLDGAAEHLAV----QLA.ELDAQV.GQM.---LG..G-WR.GASG
ESXR_MYCTU/3-87-------QIM-------------YNYPAMMAHAGDMAGYAGTLQS----LGA.DIASEQ.AVL.---SS..A-WQ.GDTG
ESXK_MYCTU/5-90-------.FM-------------TDPHAMRDMAGRFEVHAQTVED----EAR.RMWASA.QNIS---GA..G-WS.GMAE
ESXB_MYCTU/3-88-------EMK-------------TDAATLAQEAGNFERISGDLKT----QID.QVESTA.GSL.---QG..Q-WR.GAAG
ESXA_MYCTU/5-87-------..Q-------------WNFAGIEAAASAIQGNVTSIHS----LLD.EGKQSL.TKL.---AA..A-WG.GSGS
Q2G182_STAA8/7-92-------.IK-------------ADGGKVDQAKQLAAKTAKDIEA----CQK.QTQQLA.EYIE---GS..D-WE.GQFA
Q2G189_STAA8/4-88-------.IK-------------MSPEEIRAKSQSYGQGSDQIRQ----ILS.DLTRAQ.GEI.---AA..N-WE.GQAF
Q81B80_BACCR/10-88-------...-------------..GSNTASAISYAQNIENGMKD----SLN.QAKDLK.AYVT---GA..K-WN.GKTR
Q8E1X1_STRA5/3-88-------QIK-------------LTPEELRISAQKYTTGSQSITD----VLT.VLTQEQ.AVI.---DE..N-WD.GTAF
Q8NST8_CORGL/6-89-------..R-------------TESDVMLATASQVDDINDQVQG----ELS.RLRGVV.DSV.---RG..S-WA.GQAQ
Q8YAQ4_LISMO/4-89-------.VK-------------IDAAKVAEAKKSAAIVEKSLES----THK.KCKSVI.SYVE---GA..S-WS.GKSR
Q8YAR0_LISMO/4-89-------QIR-------------MSPSELRDRAKTYGQSGRDIED----ILS.RLSQLQ.EQL.---RS..E-WE.GQAF
Q9X367_BACAN/4-89-------QIK-------------VTPEQLEQAAKTVKNTRSSLEY----IHQ.DLYSQT.EYI.---AS..Q-WS.GASS

PF10824

A0R672_MYCS2/1-104MSSDLEKNLT-------------VLTDHIRKLSTVHDKAVGEIDG----ANRSM.VENG-TNMW---ETHGV-IS-ALTN
A4FPN7_SACEN/1-99MA....DEMN-------------VVIEGLRSHASKVDGVVDRLNT----AVDAS..REV-TLNN---DAYGI-LC-QPFA
Q744T9_MYCPA/1-99MA....DSIH-------------VVPAHLRQAAAHHQDTSEYLRT----VPSSH..AAI-QESL---DSLGP-IF-SELR
A0QNK5_MYCS2/1-100MS....GDLK-------------VTAAELRELSERQRQIVENIAT----AAQAT.NNTT-ALVT---VTHGP-VC-APTI
A1TH04_MYCVP/1-103MND.RDRNLR-------------VLADHVIWLAGKQGAASGRITL----ANQAI.SGAS-DSVL---SSHGA-AC-LATH
A0QSQ2_MYCS2/3-102EF....DRAS-------------VDADALRAAAHGYDTVAETIDT----VIRTT.LGRP-AFDG---ASAGR-RH-VAHG
Y406_MYCLE/4-103MI....DNLT-------------VQSEHLNSLASQHENEAACASS----GVSAA.AGLA-NAVS---TSHGS-YC-AQFN
Q5Z2J0_NOCFA/9-106SA....TTLF-------------VVPEKVGEVGKYLYELAQALQA----ALDSA...AQ-DVSS---LTDGS-WT-GDHA
A0R2G1_MYCS2/1-98MN.....QVI-------------ANTGAMNSWQQQLGEVSSGVGN----LLNGT..PGV-SDVM---NTHGT-IG-FPMQ
A1TDN8_MYCVP/1-99MT....EPLS-------------VDADGVRSLGEIHNRVAAGLGS----LAAAS..PGP-AAVA---GSHGT-IA-AAVD
A0QQE6_MYCS2/1-94MI........-------------..TGYVQELAELQGRTAQQILS----ALEAA.QGVG-TSMW---KNHGM-VC-APSN
A0R605_MYCS2/34-130TN....PELH-------------VTPAEVRRSADQMDVVAHEASS----SRTAM....A-DGIS---GQTTA-WK-EAGT
Q5YTI6_NOCFA/5-105SM....ENLS-------------VDTGAVRAFATEHAGIAGQISA----AANMDLVGQV-SALT---PVFGL-IG-ADYL
A1T2U3_MYCVP/1-103MTS.PDGELH-------------VEPSHLRQLSARQNAAAAQIAD----AVPLT.ADES-DHVL---SSHGI-VC-MPTY
A1T184_MYCVP/1-96MS....APLE-------------VDTSVMRRVGSDFDSAGDRMAG----LQADAPLGDA-AAAV---PQ...-..-LQTA
A0QNI6_MYCS2/1-100MS....DDLR-------------VTTAHLRELSAKQGRAAAELAT----ATAVV.DGVD-TALR---FTHGP-IS-WGTA
B2HES8_MYCMM/2-99......ANLV-------------VTPQYLQTLAATQTQAAATAAS----AGAAS.TNLK-NEVW---VSHGV-IS-GASN
B2HT35_MYCMM/1-99MN....EILT-------------LQPDVISRLSQGHDATVTGLQA----ATAAP.AGIS-ANVA---TTHGT-FT-SEFN
ESPF_MYCTU/1-100MT....GFLG-------------VVPSFLKVLAGMHNEIVGDIKR----ATDTV.AGIS-GRVQ---LTHGS-FT-SKFN
ESPC_MYCTU/1-100MT....ENLT-------------VQPERLGVLASHHDNAAVDASS----GVEAA.AGLG-ESVA---ITHGP-YC-SQFN
Y027_MYCTU/1-98MT....DRIH-------------VQPAHLRQAAAHHQQTADYLRT----VPSSH..DAI-RESL---DSLGP-IF-SELR

PF00823

Q743Z9_MYCPA/26-174-------QLR..ADVFRTR..RG.......AAAAAWNGLAAELRS----AAA-SFGSVI-TGVG...DA--G.WQ-GPAA
Q73UE8_MYCPA/5-161-------FAP..PEVTSTLIHTGPGAGSLIEAAAAWQRVAVELEN----SVS-SYASTL-SSLI....E--S.WD-GPSA
PPE58_MYCTU/4-169-------MIP..AEYISNVIYEGPRADSLYAADQRLRQLADSVRT----TAE-SLNTTL-DELH....E--N.WK-GSSS
Q0S9F2_RHOSR/145-301-------WLPRGATVNSTTLAAGAGPVPLSVASAAWTALSTSFVD----ANL-TLVRVM-AELA....A--G.WQ-GVSA
Q73WQ9_MYCPA/13-170-------ALP..PEINSARMYSGPGSGPLTAAAAAWEELAAQLES----YAA-GYSATL-AELR...GP--A.WS-GDAA
Q741D6_MYCPA/5-161-------TRA..PESNSGRMHSGPGAGSLMDAAKAWGVLGAQLAD----TAL-TYRAVI-AELE...LG--D..Q-RAST
Q73TJ3_MYCPA/8-165-------AFP..PEVHSALLSSGPGPGPLLASAGAWNSLAAEYTS----AAE-ELTAVV-EGVQ...AG--A.WQ-GPSA
Q6MWX8_MYCTU/5-162-------VLP..PEINSVLMYSGAGSSPLLAAAAAWDGLAEELGS----AAV-SFGQVT-SGLT...AG--V.WQ-GAAA
A0QNJ4_MYCS2/4-161-------ALP..PEINTARLMVGAGPAPMLQAAAGWEGLAVLLET----QAA-ELAAAL-TNLT....S--V.WT-GAAS
Q73ZT3_MYCPA/6-163-------AYP..PEYNSGRMYVGAGSGPLLAAAAAWDELAAELQS----VGA-SYGSTV-ETLT...TG--P.WT-GPSS
Q73ZT6_MYCPA/6-163-------ALP..PEINSARIYAGPGSAPMMSAAAAWNTMAAEMRS----AAA-SYGAVI-SELN...SA--D.WF-GPSS
Q741X1_MYCPA/30-187-------ALP..PEVNSARMYAGPGPLSLTAAAVAWDALAAELHA----AAS-CYRSVI-AGLT...TG--R.WL-GPSS
Q73ZT2_MYCPA/5-162-------AFP..PEFNSGRMYSGPGAGSFVAAATAWQNLAAELQS----AAA-SYSTVL-SGLT...AG--P.WV-GPSS
Q5Z3L3_NOCFA/10-166-------WLPRMAEANSIALNAGAHAVPISAAATAWGALTAAWVD----ATA-TVTRVM-AELG....V--G.MQ-GVNG
Q73ZT0_MYCPA/5-162-------ALP..PEVNSGRMYVGAGSGPLLAAAAAWDALGAELYS----FAA-AYTSTI-AGLT...VG--S.WL-GPAA
Q73TD6_MYCPA/11-168-------ASP..PEVHSALLSAGPGSGPLLAAAGAWASLSAQYAT----AAA-ELSALL-GQVQ...AG--S.WE-GESA
Q73ZT5_MYCPA/6-163-------GLP..PEVNSARMYSGPGSESMLAAAAAWNALSSELRS----AAT-DYESAI-ATLT...GE--G.WF-GPSA
Q73TI1_MYCPA/8-165-------ASP..PEIHSALLSSGPGPGPLLEAAAAWSSLSAEYAS----AAD-ELTATL-AAVQ...AG--P.WE-GPTT
Q741D8_MYCPA/8-165-------TLP..PEVISTQIHVGPGAVPLLAAAAAWDGLAAELHG----TAA-SYASVI-SELV...VE--S.WQ-GSSS
PPE37_MYCTU/8-165-------AVP..PEVPSAWLSTGMGPGPLLAAARAWHALAAQYTE----IAT-ELASVL-AAVQ...AS--S.WQ-GPSA
Q73Y22_MYCPA/7-164-------FFP..PEINSALIAGGAGSGPLFEAASAWDGLAAELSS----SAS-SFQTVV-TDLA...AG--S.WM-GPSS
SRA_MYCLE/6-163-------VYS..PEVNAFLMSRGPGSTPLWGAAEAWISLAEQLME----AAQ-EVSDTI-VVAV...PA--S.FA-GETS
Q73U78_MYCPA/14-171-------ASP..PEVHSALLSSGPGPASMFAAAAAWSALGAEYAS----AAE-ELSGLL-ASAQ...AG--A.WQ-GPSA
Q745G2_MYCPA/8-167-------ART..PEDNDMLLKAGVGVGTHVANQTAWTTLAATHHA----SGV-ASAINT-AATS....A--S.WL-GAGS
Q73V32_MYCPA/5-161-------FLP..PEINSARMYTGAGAASLLAAAGSWDALSAELTA----TAD-GYESVL-SGL....GL--Q.WH-GPAA
Q741E7_MYCPA/8-165-------AFP..PEVHSAALSSGPGPGSLLAAEQAWQALSAEYAS----AAA-ELGDLL-AAVQ...AG--T.WQ-GPSA
Q5Z1M6_NOCFA/16-174-------AME..PDRMARELRTGPGSVPLAEAGAAWGRLAESFGA----AVV-EYELVM-ATLR....G--A.WQ-STTS
B2HCX8_MYCMM/6-162-------.LP..PEINSARMYSGPGSSPLLTVASAWSGLAAELSA----TAN-DYETVI-SGLQ...SQ--G.WV-GPSS
B2HD13_MYCMM/6-163-------MLP..PEINSSLMFSGAGSAPMLDAAAAWEGLASELGT----AAS-SFSSVT-SGLV...SD--A.WQ-GAAS
B2HD24_MYCMM/5-162-------MLP..PEINSARMFAGAGSGPMLSAAMAWDGLAVELGS----AAE-SFGSVT-SGLV...GS--S.WQ-GAAA
B2HDB1_MYCMM/8-164-------ASP..PEVHSSLLSTGPGPGGILVAAAGWLSLGALFEA----TAA-EVDHQI-CEAI....R--L.WQ-GRAA
B2HDH5_MYCMM/5-160-------ALP..PEINSARMYAGAGAGPMMAASAAWNGLAVELGT----TAA-SYESVI-TRLT...TE--S.WM-GPAS
B2HDM3_MYCMM/6-163-------ALP..PEINSARIYAGPGPGSLSAAAAGWASLAAELQA----AAG-YYQSVV-SGLT...SG--G.WL-GPAS
B2HEI4_MYCMM/9-165-------.SP..PEVHSALLSSGPGAASLQVSASAWTSLGAAYSS----AAD-ELTAVV-VVGE...TE--T.WE-GMGA
B2HEJ0_MYCMM/7-164-------ALP..PEVNSGLLYTGPGAAPMLTAATAWDGLATVLNS----AAA-SYASVV-SGLT...LE--S.WM-GPAS
B2HF23_MYCMM/8-160-------AAP..PEVHSALLSSGPGLGPLQAAAAAWAGLGEKLAL----AAV-DISFVL-GEVS....W--Q.WE-GAGA
B2HF25_MYCMM/2-159-------AVP..PEVHSALLSAGPGPGPLQEAATAWASLSVEYAS----VAE-DLAGVL-GGVQ...AQ--A.WQ-GPSA
B2HGH9_MYCMM/6-162-------.LP..PEVNSARMYSGPGSASLLAAAASWDMVAIELAS----AAE-GYRSVI-STLS...GM--Y.WW-GPAS
B2HH63_MYCMM/8-161-------ASP..PEVHSGLLSSGPGAGPMLASAAAWKSLSGEYAS----AAA-ELAGLV-GAVP....Q--V.WW-GPAE
B2HIP7_MYCMM/8-164-------ALP..PEVHSALLSAGPGPGPLREAAAAWTVLAAEHAS----AAE-ELTSIV-GGAA....A--A.WE-GPSA
B2HJ58_MYCMM/7-163-------.LP..PEVNSTLMYSGPGSGSMLAAAAAWQALGAELQC----TAN-SYRSLL-SGLV...SG--P.WS-GPAA
B2HJQ8_MYCMM/6-154-------.LP..PEVNSGR....ARPGSLQATAVALRGLTAGMRQ----IGA-ECSSIA-AGLT....S--G.WR-GPAA
B2HJR0_MYCMM/5-161-------ALP..PEINSARMYSGPGSTSMQTAATAWDALATELYS----AAS-CYSSIT-AGLA....G--K.WQ-GPAA
B2HKM4_MYCMM/2-159-------AIP..PEVHSALLSAGQGPGSLLAAAAQWQELSAQYSA----AVV-ELTQLL-AEVQ...AT--S.WQ-GYAA
B2HKT3_MYCMM/8-165-------ARP..PEINSALMYFGPGSRSMLAAAAAWDAVAFELGV----LAS-GYTSVI-SELT...SG--P.WV-GPAA
B2HKX5_MYCMM/9-166-------ALP..PEINSARMYFGAGAAPLLGAAAAWNDIAVELST----AAS-AIESVI-TRLS...SD--Q.WL-GTAS
B2HLK3_MYCMM/7-162-------..P..PELTSARIYSGPGSGQMFSAAEAWDGLAAELRL----AAS-SFESVT-ANLV...AG--A.WQ-GASA
B2HN16_MYCMM/9-165-------.SA..PEVHSALLSAGPGPGSLLAAAQTWTELSAEYLA----VAE-ELTAIL-TGVQ...AG--A.WD-GPSA
B2HNW0_MYCMM/10-165-------..P..PEVHSALLSSGPGPASLLSGAAAWAGLSTEYAS----VAD-ELMGVL-AAVQ...GG--A.WE-GLSA
B2HNW7_MYCMM/11-168-------ASP..PEVHSAMLSSGPGPASLLAAAGVWSALSAEYAL----TAA-ELSEVL-AAVQ...AG--A.WQ-GPSG
B2HQQ1_MYCMM/8-165-------WLP..PEINSALMFAGPGAGPLLAAAAAWGGLAEELAS----AVS-SFSSVT-SELT...SG--S.WL-GPSA
B2HRG4_MYCMM/5-161-------MFP..PEINSALIEAGPGSAPMLGAAAAWCGLASELRA----AAE-SFASIT-SDLA...SG--A.WQ-GPAA
B2HRT7_MYCMM/5-162-------ALP..PEVNSGRMYTGPGSTPMVSAASAWNRLASELSF----TAD-GYERVI-KALS...GE--E.WF-GPAS
B2HS07_MYCMM/5-162-------VLP..PEINSLRLFSGAGSTSMLEAAAAWGSLADELQV----AAS-SFSSVT-AGLA...SG--A.WQ-GPAS
B2HS70_MYCMM/6-162-------.LP..PEINSAKMYAGAGSGSILVAAEAWDSVAVDLYS----AAS-SCQSVI-WGLA...FG--Q.WV-GASA
B2HSM7_MYCMM/5-162-------VLP..PEVNSALIFTGPGAEPMRTAATAWGGMAVELES----AAD-SFASVT-SGLV...GG--A.WQ-GASS
B2HSS2_MYCMM/8-165-------AWP..PEVLSGALWSGSGPGPLFTAAAAWGSLGAEYAT----AAE-ELAAEL-AGMQ...VG--A.WQ-GPGA
B2HST8_MYCMM/6-163-------ALP..PEINSGRMYTGPGSGPMMAAASAWDALAAELSS----AAS-GYSSVI-AELT...SS--P.WL-GPAS
B2HSU0_MYCMM/7-164-------MLP..PEVTSALMYAGPGSSSMVAAASAWNALAAELNS----TAQ-GYLTVI-TQLS...SE--E.WM-GPAS
B2HSV2_MYCMM/10-166-------.LP..PEINSARMYSGPGSAPMLAAASAWKGLAAELRV----TVL-SYDSVL-RALT...GE--E.WY-GPAS
B2HSV3_MYCMM/6-163-------ALP..PEINSGRMYVGPGAAPLIAAAAAWDELAAELQS----MAA-SYGSTV-QGLT...VA--P.WT-GASS
B2HSV4_MYCMM/5-162-------AFP..PEINSGRMYTGPGSGPLLAAAAAWDAVAAELQS----TAA-AFSSVI-ASLT...SG--P.WI-GPSS
B2HT04_MYCMM/5-162-------MLP..PEVNSALMFTGAGSAPTLAAATAWDGLAAELGE----AAE-AFSSVT-SGLA...SG--S.WQ-GPAA
B2HT05_MYCMM/5-162-------MLP..PEINSARIFAGAGVGPTLAAAAAWDGLAADLAS----AAQ-SFSAIT-VGLV...GE--A.WQ-GAAA
I6X6H8_MYCTU/5-162-------VLP..PEINSLRMFIGAGTAPMLAAAAAWDGLAEELGT----AAQ-SFASVT-AGLA...GQ--A.WQ-GPAA
I6Y7L4_MYCTU/5-162-------VLP..PEINSARLYVGAGLAPMLDAAAAWDGLADELGS----AAA-SFSAVT-AGLA...GS--S.WL-GAAS
L0T6B3_MYCTU/5-162-------ALP..PEINSARIYSGPGSRPLMQAAAAWQRLANELTA----TAA-SYSSVI-SGLT...GD--D.WL-GPSA
PPE68_MYCTU/5-161-------AMP..PELNTARLMAGAGPAPMLAAAAGWQTLSAALDA----QAV-ELTARL-NSLG....E--A.WT-GGGS
PPE65_MYCTU/7-163-------.LP..PEVNSALMYAGPGSGPMLAAAAAWEALAAELQT----TAS-TYDALI-TGLA...DG--P.WQ-GSSA
PPE63_MYCTU/7-162-------.LS..PEVNSARMYAGGGPGSLSAAAAAWDELAAELWL----AAA-SFESVC-SGLA...DR--W.WQ-GPSS
PPE62_MYCTU/5-162-------VLP..PELNSLRMFTGAGSAPMLAAAVAWDGLAAELGS----AAS-SFGSVT-SDLA...SQ--A.WQ-GPAA
PPE61_MYCTU/7-163-------MLP..PEVNSTRMYSGPGAGSLWAAAAAWDQVSAELQS----AAE-TYRSVI-ASLT...GW--Q.WL-GPSS
PPE59_MYCTU/4-158-------MIP..AEYISNIIYEGPGADSLSAAAEQLRLMYNSANM----TAK-SLTDRL-GELQ....E--N.WK-GSSS
PPE49_MYCTU/7-164-------WLP..PEINSARMFAGAGSGPLFAAASAWEGLAADLWA----SAS-SFESVL-AALT...TG--P.WT-GPAS
PPE47_MYCTU/8-165-------ASP..PEVHSALLSAGPGPGSLQAAAAGWSALSAEYAA----VAQ-ELSVVV-AAVG...AG--V.WQ-GPSA
PPE45_MYCTU/5-162-------VLP..PEINSGRMYAGPGSGPMMAAAAAWDSLAAELGL----AAG-GYRLAI-SELT...GA--Y.WA-GPAA
PPE42_MYCTU/5-162-------VLP..PEVNSARIFAGAGLGPMLAAASAWDGLAEELHA----AAG-SFASVT-TGLA...GD--A.WH-GPAS
PPE38_MYCTU/7-164-------WLP..PEINSARIYAGAGSGPLFMAAAAWEGLAADLRA----SAS-SFDAVI-AGLA...AG--P.WS-GPAS
PPE36_MYCTU/6-162-------ALP..PEINSTRIYLGPGSGPILAAAQGWNALASELEK----TKV-GLQSAL-DTLL....E--S.YR-GQSS
PPE29_MYCTU/6-161-------.LP..PEINSGRMYTGPGPGPMLAAATAWDGLAVELHA----TAA-GYASEL-SALT....G--A.WS-GPSS
PPE28_MYCTU/7-164-------VLP..PEVNSARVFAGAGSAPMLAAAAAWDDLASELHC----AAM-SFGSVT-SGLV...VG--W.WQ-GSAS
PPE25_MYCTU/5-162-------ALP..PEINSGRMYCGPGSGPMLAAAAAWDGVAVELGL----AAT-GYASVI-AELT...GA--P.WV-GAAS
PPE24_MYCTU/5-162-------VLP..PEINSALIFAGAGPEPMAAAATAWDGLAMELAS----AAA-SFGSVT-SGLV...GG--A.WQ-GASS
PPE23_MYCTU/41-199-------ALP..PEINSGRMYSGPGSGPLMAAAAAWDGLAAELSS----AAT-GYGAAI-SELT...NM--RWWS-GPAS
PPE22_MYCTU/5-162-------ALP..PEVNSGRMYCGPGSAPMVAAASAWNGLAAELSV----AAV-GYERVI-TTLQ...TE--E.WL-GPAS
PPE21_MYCTU/5-162-------VLP..PEINSALMFAGAGPGPMLAAASAWTGLAGDLGS----AAA-SFSAVT-SQLA...TG--S.WQ-GPAS
PPE20_MYCTU/7-164-------AFP..PEVHSAMLNYGAGVGPMLISATQNGELSAQYAE----AAS-EVEELL-GVVA...SE--G.WQ-GQAA
PPE19_MYCTU/6-163-------ALP..PEINSARMYAGPGSASLVAAAKMWDSVASDLFS----AAS-AFQSVV-WGLT...TG--S.WI-GSSA
PPE17_MYCTU/6-159-------.FP..PEFNSLNIQGS..ARPFLVAANAWKNLSNELSY----AAS-RFESEI-NGLI....T--S.WR-GPSS
PPE14_MYCTU/6-162-------.LP..PEVNSSRMYSGPGPESMLAAAAAWDGVAAELTS----AAV-SYGSVV-STLI...VE--P.WM-GPAA
PPE13_MYCTU/5-165-------VLP..PEVNSARIYAGAGPAPMLAAAVAWDGLAAELGM----AAA-SFSLLI-SGLTAGPGS--A.WQ-GPAA
PPE12_MYCTU/6-163-------WLP..PETNSLRMYLGAGSRPLLAAAGAWDGLAEELHA----AAS-SFGSVT-SELA...GG--A.WQ-GPAS
PPE11_MYCTU/9-166-------ASP..PEVHSALLSSGPGPGPVLAAATGWSSLGREYAA----VAE-ELGALL-AAVQ...AG--V.WQ-GPSA
PPE04_MYCTU/8-165-------ASP..PEVHSALLSNGPGPGSLVAAATAWSQLSAEYAS----TAA-ELSGLL-GAVP...GW--A.WQ-GPSA
PPE03_MYCTU/6-163-------ASP..PEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAA----VAD-ELIGLL-GAVQ...TG--A.WQ-GPSA
PPE02_MYCTU/8-165-------ASP..PEVHSALLSSGPGPGPLLVSAEGWHSLSIAYAE----TAD-ELAALL-AAVQ...AG--T.WD-GPTA
PPE01_MYCTU/2-159-------AIP..PEVHSGLLSAGCGPGSLLVAAQQWQELSDQYAL----ACA-ELGQLL-GEVQ...AS--S.WQ-GTAA
Q6MWW0_MYCTU/6-163-------VLP..PEINSLRMYLGAGSAPMLQAAAAWDGLAAELGT----AAS-SFSSVT-TGLT...GQ--A.WQ-GPAS
PPE54_MYCTU/5-162-------VMP..PEINSLLIYTGAGPGPLLAAAAAWDELAAELGS----AAA-AFGSVT-SGLV...GG--I.WQ-GPSS
Q6MX48_MYCTU/6-162-------.SA..PEVNSLRMYLGAGSGPMLAAAAAWDGLADELAV----AAS-WFGSVT-SGLA...DA--A.WR-GPAA
Q73SY4_MYCPA/8-165-------WLP..PEVNSALIYSGPGPGPLLAAAAAWDGLAEELAS----SAQ-SFSSVT-SDLA...SG--S.WQ-GASS
Q73UE9_MYCPA/6-161-------.LP..PEVTSALIHAGPGAWSWIEAAGVWQQLSMELEQ----SAS-SYTAEL-AALS....T--T.WQ-GPSA
Q73V31_MYCPA/6-162-------.LP..PEVNSARMYAGPGSGSLLAAAGSWDSLAAELSI----TAA-VYESVL-AGLT...GL--Y.WH-GPAS
Q73WR0_MYCPA/6-163-------ALP..PEINSTRMYAGPGSAPLIAAAAAWDVLANALET----AAR-GYSAVI-TRLH...GE--S.WS-GSAS
Q73WR5_MYCPA/8-165-------ASP..PEVHSSLLSAGPGPGPLLAAAAAWSSLSVQYAE----SAD-ELVTLL-GAVR...AG--D.WD-GPTA
Q73YZ0_MYCPA/8-165-------AFP..PEVHSTLLSSGPGPAPLLAAATAWSSMSTEYAA----AAA-ELDGLL-AAAH...AG--A.WE-GPSA
Q73ZS9_MYCPA/7-162-------..P..PEITSAQLYTGPGAGPMLTAAAAWDALAAELQS----AAS-SYAAVV-NGLA...DE--A.WA-GPSA
Q73ZU5_MYCPA/7-163-------.FP..PEFNSARIYSGPGSGSLVAAASAWSSLAAELNA----AAL-SYDKVV-TALA...SE--E.WL-GSAS
Q741D9_MYCPA/6-160-------.LP..PEINSGRIYSGPGSAPLLAAAAAWHGLAAEMHS----AAA-SYGSAI-AELR....T--L.WH-GPSS
Q745B0_MYCPA/8-172-------ALP..PEVHSTLLSSGPGPGPLLAAAATWTGLSTQYDS----AAT-ELTAVL-TGSM....P--V.WD-GPTA
Q79FE1_MYCTU/5-161-------AYP..PEVNSANIYAGPGPDSMLAAARAWRSLDVEMTA----VQR-SFNRTL-LSLM....D--A.WA-GPVV
Q79FI8_MYCTU/5-162-------VLP..PEINSALIFAGAGSGPMLAAASAWDGLATELAS----AAV-SFGSVT-AGLV...GG--S.WQ-GRSS
Q79FI9_MYCTU/6-162-------.LP..PEINSALIFGGAGSEPMSAAAVAWDQLAMELAS----AAA-SFNSVT-SGLV...GE--S.WL-GPSS
Q79FK6_MYCTU/5-162-------ALP..PEVNSVRMYAGPGSAPMVAAASAWNGLAAELSS----AAT-GYETVI-TQLS...SE--G.WL-GPAS
Q7AQ23_MYCLE/8-164-------ASP..PEVHSALLSRGPGSGPLLVAAEAWRSLSSVYAE----MAD-ELVALL-VVVP...VS--S.WD-GSAA
Q7AQ89_MYCLE/6-161-------ALS..PETNSTRMYLGPGSSPILTAAAAWVVLAKELTA----AAQ-GLQSAV-EALL....T--T.FE-GESA

PF00934

L0T3X8_MYCTU/1-93MS-----NLL-------------VTPELVAAAAADLAGIGSAIGA....ANAAAGAP.T-MALLAA.GA--DEVS-AAVA
I6XHM5_MYCTU/1-93MS-----FVI-------------VAPEALMSVASEVAGIGSALNA....ANAAAAAP.T-TGVLAA.AA--DEVS-AAMA
B2HSS6_MYCMM/1-93MS-----LVT-------------VSPELVAGAASDLARIGSSLGA....ANAAAAGP.T-TTVLSA.AA--DEVS-VAIA
B2HP29_MYCMM/1-93MS-----YVV-------------AIPDMLASAAADVAGIGSSVGA....ANAAAVGA.T-TGVMAA.AD--DEVS-VAIA
B2HSA1_MYCMM/1-93MS-----FVF-------------AVPETMAAVTSELATIGSNLEM....ANAAAALP.T-TGLLAA.GA--DEVS-AAIA
B2HNN4_MYCMM/1-93MS-----FLT-------------TAPDLLEAAASDLADIGSVVAQ....ANAAAATP.M-TGVLAA.AK--DEVS-TAVA
B2HMJ7_MYCMM/1-93MS-----YVI-------------ATPDMLAAAASDLTNIGSTLGA....ANSAALAR.T-TGLLAA.AE--DEVS-TAIA
B2HT06_MYCMM/1-93MI-----DLL-------------ASPQAMTATATEVAEIGLAINQ....ADLAVAGP.T-TGLAAA.AA--DEVS-EAIA
W5T943_9NOCA/4-89..-----...-------------.DPVVAARTATDLDALADRLEA....GLKADTPA.L-K.VDAP.GL--DEVS-RRAA
A0QQ41_MYCS2/3-92..-----.LR-------------VVPEGLTAASSAVEALTARLAA....AHAAAAPM.I-STVLPP.AA--DAVS-LQTA
B2HSA9_MYCMM/1-92MS-----FLI-------------VTPELFIRAATNLEAVGSAVNA....ANSAVSW..T-EKVAAM.AA--DEVS-GAVA
B2HHU3_MYCMM/1-93MS-----YVV-------------AAPDFLSTAAEDLAAMGSAVST....ATAAAARS.T-TLLLAA.GA--DEVS-THIA
Q79FE6_MYCTU/1-93MS-----FLI-------------ASPEALAATATYLTGIGSAISA....ANAVAAAP.T-TEILAA.GT--DEVS-TAIS
V5X7I6_MYCNE/3-92..-----.LR-------------VVPEGLTAAGSAVESLTARLAA....AHAAAAPL.V-NAVIPP.AA--DPVS-LQTA
B2HKR1_MYCMM/1-93MS-----YVF-------------ATPELVAAAATDLAGVQSVLSA....ANSAAAGP.T-MAVMAA.GA--DEVS-ALIA
B2HRW8_MYCMM/1-93MS-----FAI-------------VRPEWVTAAASDLAGIGSSVGA....ANAAAAGS.T-TAVLAA.GA--DEVS-AVIA
B2HGK3_MYCMM/99-189..-----QLS-------------VAPPWLVSAAQDLQSIGSTLAA....ANGAAAGP.T-TVLATA.AA--DEVS-TAIA
L0J9T2_MYCSM/1-92MG-----MIV-------------FDPDALRRGADKLMTLAAQLRSDPGTRDSVVADV.V-AQLREL.AA--DRVS-ETQA
L0J902_MYCSM/3-92..-----.LD-------------VTPEALEAASAQVAALTGHLLA....VNASHMVA.N-HMILPP.GS--DIAS-IKTA
Q79FA8_MYCTU/1-94MS-----FLT-------------TQPEELAAAAGKLETIGSAMVA....QNAAAAAPTT-TGVIPA.AA--DEIS-VLQA
B2HHP4_MYCMM/1-93MA-----FVL-------------VAPEMVTAAASDLANIGSAINT....ANTAVAAP.T-AELLAA.GT--DEVS-EAIA
B2HHQ4_MYCMM/1-93MS-----LVI-------------AVPELVEAAATELAGIGSALGQ....ATAGAASP.T-VNILAA.AE--DEVS-AAIA
B2HJI4_MYCMM/1-93MT-----FLN-------------VLPEMVAAAAADLTNIGSSMTA....ANAMAAAS.T-TTVLAP.GA--DEVS-VAIA
B2HR24_MYCMM/1-93MS-----FVI-------------ADPEMVTAAAADLAGIRSTLGA....AAEAAAGP.T-TGVAAA.AA--DEVS-AAIA
WA22_MYCTU/1-93MS-----FVI-------------AVPETIAAAATDLADLGSTIAG....ANAAAAAN.T-TSLLAA.GA--DEIS-AAIA
Q6MWV6_MYCTU/1-93MS-----FVI-------------AVPEFLSAAATDLANLGSTISA....ANAAASIP.T-TGVLAA.GA--DDVS-AAIA
B2HIU2_MYCMM/1-93MR-----SVA-------------VAPQALMSAAMELQRIGSVLVE....ANTAAAAP.T-TGVLGA.GA--DEVS-SAIA
B2HIS1_MYCMM/4-94..-----YVI-------------AAPDAFSVASGELAGIEAAVKG....AAAAAAPS.T-TGIISA.AA--DEVS-TAIA
B2HN04_MYCMM/1-93MS-----FVS-------------VIPEQLTAAATNLAGVGSTIST....ANATAAGP.T-AAALAA.GA--DDVS-AAVS
B2HN17_MYCMM/1-93MS-----GVI-------------AALDTLTAAATDVAGLGAAINA....ANAAAAVS.T-TRLMAA.AG--DEVS-AAIA
B2HHL8_MYCMM/1-93MS-----YVI-------------AAPEELATAARNLANISVTINA....ANANAILA.T-TEVISP.GA--DAVS-AAIT
D6ZBI2_SEGRD/2-92..-----FVN-------------VEPEAISAAAATLEGLSMKLQA....MVAAASPA.L-QMIPPA.GY--EDVS-VFAS
B2HLV0_MYCMM/1-93MS-----YVR-------------TIPEFLSTAAADIGGIGSALTD....ASSAAAGP.T-TNLLAA.AA--DEVS-AVVS
B2HK44_MYCMM/1-93MS-----YVI-------------VAPEMLEAAASDLANIGSAIGV....ANAAAALP.T-TSVLAA.AA--DEVS-AAIA
B2HPB9_MYCMM/1-93MS-----FVI-------------ADTQWVSEAAGNLARIGSLIET....ANSAAATQ.T-TAVTAA.AA--DEVS-AAVA
B2HR25_MYCMM/1-93MS-----FVT-------------AVPELVESAAQDLAGIRSALVE....AAQAVAAP.T-TALAAA.GE--DEVS-AAIA
Q49724_MYCLE/4-91..-----FLR-------------VEVGGLMMAAGRLERITSESMA....CNAKLTPV.T-TKVVPP.AA--DQVS-KLVS
B2HL21_MYCMM/3-92..-----.VD-------------VVPQEVILAAGDLAGIGSTISA....ANNAAAPP.T-TVLTPA.AA--DEVS-AQLA
B2HT85_MYCMM/1-93MS-----YVI-------------AVPDLVAGAASELAGVGSTLST....ATTAAAAQ.T-TGVLAA.AG--DEVS-AAIA
B2HFK5_MYCMM/1-93MT-----LVD-------------VVPGMVQAAANDLAGLNTTLNA....ANAAAATQ.I-TTVVAA.AQ--DEVS-AAIA
B2HLZ6_MYCMM/3-94.S-----YVF-------------ATPEALTTVSSDLAGIGIAIRS....ANLTAAPS.T-TQVLAA.AQ--DEVS-AAIA
PG10_MYCTU/1-93MS-----WVM-------------VSPELVVAAAADLAGIGSAISS....ANAAAAVN.T-TGLLTA.GA--DEVS-TAIA
B2HT63_MYCMM/1-93MS-----YLI-------------AAPDLMAHATTELSSIGSALTA....ANAAAAVP.T-TGVLAA.GA--DDVS-AAVA
B2HEI0_MYCMM/3-94.S-----YVT-------------AAPEALAAAAGDLTGIGEALRA....ATAAAAPS.T-TSLVAA.AG--DEVS-TAIA
B2HEE1_MYCMM/1-93MS-----FLY-------------AAPDFVAAAATDLASIGSSINA....ASVAAAAP.T-TGILAA.GS--DEVS-TAIA
I6Y936_MYCTU/1-93MS-----FVT-------------IQPVVLAAATGDLPTIGTAVSA....RNTAVCAP.T-TGVLPP.AA--NDVS-VLTA
I6XEF1_MYCTU/1-93MS-----LVI-------------ATPQLLATAALDLASIGSQVSA....ANAAAAMP.T-TEVVAA.AA--DEVS-AAIA
B2HJR4_MYCMM/1-93MS-----FVI-------------TLPELIDSAAMDLANIGTALNS....ATAAASAS.T-TGILAP.AG--DEVS-AAVA
F5YWF5_MYCSD/2-87..-----...-------------.EPEAVLASSGVEAAITAETAA....AASSASPA.L-LGVLPM.GN--DPDS-IAFQ
B2HJI6_MYCMM/4-90..-----.MS-------------FDPAAASVAAAISAHASRGLDA....GTAAASSV.T-G.LAPA.GA--DEIS-AQFA
K0JUJ1_SACES/21-110..-----.MH-------------VAPEQILALKARYEEVRDTIHA....FILQEEFT.L-V.DAPAMAD--DEVS-QDAA
I6X486_MYCTU/1-93MS-----FVI-------------TNPEALTVAATEVRRIRDRAIQ....SDAQVAPM.T-TAVRPP.AA--DLVS-EKAA
B2HN54_MYCMM/1-93MS-----FVG-------------VAPEMVAVAASDLERLGSTISA....ANVAAAGS.T-TTILAA.GA--DEVS-AVIA
B2HEE3_MYCMM/1-93MS-----WVI-------------AAPEYVAAAANDLGGIGSTLAQ....ANAAALAP.I-TTVLPA.GA--DEVS-AAIS
B2HMC4_MYCMM/1-93MS-----FAV-------------VAPELMRVAASDLANIGSTLSA....ANAVAAAQ.T-TAVQAA.AA--DEVS-TAIA
B2HLJ4_MYCMM/1-93MP-----HIA-------------VAPDLVASAANQLERIGSALSA....ANLTAAAP.T-TTVMAA.GA--DEVS-TAVA
PG46_MYCTU/1-93MS-----FVI-------------AVPEALTMAASDLANIGSTINA....ANAAAALP.T-TGVVAA.AA--DEVS-AAVA
B2HR55_MYCMM/1-93MS-----FVI-------------TAPELISAAATDLAGIGSTISA....ANAAASAS.T-TAVAAA.AA--DEVS-TAVA
B2HRG2_MYCMM/1-93MA-----YLT-------------VFPDMLAGAAGDLVGIGSQLAA....ANTAAIGP.T-TTVLAA.GA--DEVS-AAIA
L7N680_MYCTU/1-93MS-----FVV-------------TVPEAVAAAAGDLAAIGSTLRE....ATAAAAGP.T-TGLAAA.AA--DDVS-IAVS
B2HG27_MYCMM/1-93MS-----FVA-------------VAPDLLATATMDLDRIGNAINA....GSTAAAAS.T-TEVAAA.AA--DEIS-TAVA
B2HT93_MYCMM/1-93MS-----YVF-------------AAHELMAAAAGELNDVGALLGS....ANTAAAAS.T-TDLMAA.AG--DEVS-LAIA
B2HM39_MYCMM/1-93MS-----YVI-------------AAPEMLAGAATDLAGIGAALQS....ANGAAAAP.I-TGVLAA.GA--DDIS-AAVA
B2HIY5_MYCMM/1-93MS-----YLI-------------AAPELMQSAAADLAGIESALSA....ANVSAAVP.T-TQILAA.GA--DEVS-AAIA
H6R6F2_NOCCG/4-93..-----NVH-------------VTPELILAAAVELDLLADRLAG....VAAVAGPA.T-H.VLPS.GA--EEVS-LLAA
Q79FP0_MYCTU/1-93MS-----FVV-------------ANTEFVSGAAGNLARLGSMISA....ANSAAAAQ.T-TAVAAA.GA--DEVS-AAVA
Q6MX26_MYCTU/1-93ML-----YVV-------------ASPDLMTAAATNLAEIGSAIST....ANGAAALP.T-VEVVAA.AA--DEVS-TQIA
Q79FS8_MYCTU/1-86MS-----YMI-------------ATPAALTAAATDIDGIGSAVSV....ANAAAVAA.T-TGVLAA.GG--DEVL-AAIA
B2HN49_MYCMM/1-93MS-----YMF-------------AVPDTVAAAAADLAGIGSTLNA....ATAAAAAP.T-TGVLAA.GA--DQVS-AAVA
Q79FD3_MYCTU/1-93MS-----RLI-------------VAPDWLASAAAEVQSIGSALSA....ANAAAAAP.T-TLLVAA.AE--DEVS-AAAA
B2HMF9_MYCMM/1-93MS-----FVS-------------VAPEAVATAASDLARIGSSIDA....VNAAAAGA.T-TTVLAA.GA--DEVS-VAIA
F5YTX3_MYCSD/1-93MS-----FVT-------------THPEAMAATASNLQAIGSAMTA....QNTAAAAP.T-TGIAPA.GA--DEVS-VLQA
L7N6A7_MYCTU/1-84M.-----...-------------.....LASAATDLAGIGSALSA....ANAAAAAP.T-TAMLAA.CA--DEVS-AVVA
PG34_MYCTU/1-93MS-----FVV-------------AAPEVVVAAASDLAGIGSAIGA....ANAAAAVP.T-MGVLAA.GA--DEVS-AAVA
PG20_MYCTU/1-93MS-----YMI-------------AVPDMLSSAAGDLASIGSSINA....STRAAAAA.T-TRLLPA.AA--DEVS-AHIA
B2HM19_MYCMM/1-93MS-----YLA-------------IAPEIVAAAAADMDGIGSAITA....ANAAAAIP.T-SAIAAA.AA--DEIS-AAIA
F5Z3K2_MYCSD/1-93MS-----FVN-------------TQPEALTAAAGNLAAIGSALSA....QNAAAATP.T-TGVVPA.AA--DEVS-ALTA
F5YVB3_MYCSD/1-93MS-----FVN-------------TQPEALASAASELRGIGSVVAA....QNMAAAGP.T-TVLPPA.AA--DEVS-ALTA
B2HHN1_MYCMM/3-94.A-----FVY-------------AAPEELAAASSSLSSLGSSIRE....AHAASAGL.T-TSIAAA.AE--DEVS-AAVA
Q79FV6_MYCTU/1-93MS-----FVI-------------AAPDLVAMATEDLAGIGASLTA....ANAAAAVP.T-SGLLAA.AG--DEVS-AAIA
B2HSI7_MYCMM/1-92MS-----FVS-------------VSPELVIDGAAALTQIGSSIDE....ANAAAGA..T-TAVLPP.GV--DEVS-VALA
D6ZDG0_SEGRD/3-92..-----.LR-------------TLPEGMTAVSSLVEGITARLAA....AHAAAAPA.I-TAVAPP.AI--DAVS-LSAA
B2HHB3_MYCMM/1-93MS-----YMS-------------ISPEIVSSAAGELANIGSTVSA....ANAAAAVA.T-TELLAA.GS--DEVS-TRIA
B2HT84_MYCMM/1-93MS-----FVN-------------VTPEAVAAAASDLTGIGSVLGE....ANAVAARA.T-TTVLAA.GG--DEVS-AAIA
G8RGS0_MYCRN/3-92..-----.LR-------------VVPEGLVAASTAVEGLTARLAA....AHAAAAPV.V-SAVAPP.AV--DPVS-LQTA
B2HK25_MYCMM/1-93MP-----HVT-------------TSPNLLAATAGDLAAIASTMRQ....ASAAAAAP.T-AAVQPA.GG--DIVS-AGIA
B2HPB7_MYCMM/1-93MS-----LLV-------------VAPELVTSAAADLQGIGSSVNA....ANAAAAIS.T-TELTAA.AA--DEVS-AAAA
B2HQP5_MYCMM/1-93MS-----YLI-------------ATPDLLSAAATDLAGIGNTIGQ....ASYAAAAP.T-TAVISA.AA--DEIS-MQIA
Q6MWY0_MYCTU/4-94S.-----.LM-------------VAPELVAAAAADLTGIGQAISA....ANAAAAGP.T-TQVLAA.AG--DEVS-AAIA
B2HMC5_MYCMM/1-93MA-----YVI-------------ADLEAMAAAAADLAGVNSAIAA....ANGIAAVP.T-TAVQAC.AG--DQVS-AAVA
L0TCB8_MYCTU/1-93MS-----FVV-------------AVPEALAAAASDVANIGSALSA....ANAAAAAG.T-TGLLAA.GA--DEVS-AALA
B2HJ76_MYCMM/1-93MS-----YVV-------------AASDLLASTATELARIDAALNT....ANAAAVLP.T-TVLQAA.GA--DEVS-AAVA
Q9CCR0_MYCLE/4-91..-----..G-------------VIPEGLEGASAVIEALTAHLAT....VHAEAAPF.I-MEVIPP.GS--GSVS-VQNQ
B2HSR7_MYCMM/1-93MS-----YLI-------------AAPEMVAAAATDLASVGSSISA....ANAAAAAP.T-MSVLAA.GA--DEVS-AVVA
J9RQ80_9ACTO/4-93.S-----QLR-------------VEPAELISAASDLDRIADRLEL....ALTGAGRS.L-T.VAAQ.GR--DEVS-AAAA
W5T6J3_9NOCA/5-92..-----.LG-------------VQPEVVLAASAELDLLAERLAA....ASALSGPA.T-H.VIPA.GA--EEVS-AMAA
A1T177_MYCVP/2-92.Q-----PLS-------------HNPGAIGVGGQVTANGARGLAT....GTAATSAV.S-A.LAPA.GA--DEVS-AAAA
B2HQU6_MYCMM/1-93MS-----FVS-------------VVPEWVAAAATDVAGIGSVVGA....ANAAAAGA.T-TSVTAA.AG--DEVS-VAIA
B2HF24_MYCMM/3-92..-----.LR-------------VVPEGLVATSAAVEALTARLAA....ANAALAPL.I-TAVVPP.AA--DPVS-LEAA
Q5Z1M7_NOCFA/11-98..-----.VQ-------------FDPTVAREVATRLDDLADRLEQ....GLRDNEPA.L-T.VEPA.GL--DAVS-TRAA
D5URB6_TSUPD/1-93MV-----GLN-------------VAPIQLLSGTNEVIANVATTSG....LVGGAAGT.L-GAVIPA.GI--DDVS-LMVA
B2HN64_MYCMM/1-93MA-----FVF-------------ATPELVSAAAQDVANIGTSLGA....ANAAVAAP.T-TSVLAA.GG--DEVS-HAIA
PG24_MYCTU/1-93MS-----FVI-------------AAPETLVRAASDLANIGSTLGA....ANAAALGP.T-TELLAA.GA--DEVS-AAIA
E9T269_COREQ/4-90..-----HVY-------------VDPDVLLAAAGEIEALVTRLQT....SLAVHSPA.L-N.VAPS.GA--EEVS-VLAA
B2HEC9_MYCMM/1-93MS-----FLT-------------TAPEFVNAAASDLASIGTAVSQ....ANAAALAP.T-TGVLAA.GA--DEVS-AAIT
B2HEW9_MYCMM/1-93MT-----ALT-------------AVPEIVVHAATELRDIGSSVNT....ANAMATTQ.T-TTIVAA.AQ--DEVS-AAIA
Q79G04_MYCTU/1-93MS-----YVI-------------AAPEMLATTAADVDGIGSAIRA....ASASAAGP.T-TGLLAA.AA--DEVS-SAAA
B2HN65_MYCMM/1-93MA-----FVI-------------AAPELVSAAAENVASIGTSLGA....ANAAVAAS.T-TSVLSA.GA--DDVS-QAIA
B2HDU1_MYCMM/1-93MG-----YVV-------------AAPEILSVAASDLANIGSALQA....ANAAATTP.T-VSVLAA.AA--DEVS-EAIA
B2HG78_MYCMM/1-93MA-----FVT-------------SAPEALTAAALNLHSVGAGMSA....GNAAAMAP.I-TGVVPA.AA--DEVS-ALTA
Q6MX28_MYCTU/1-92MS-----FVI-------------ATPEMLTTAATDLAKIGSTITA....ANTAAAA..V-AKVLPA.SA--DEVS-VAVA
B2HLH8_MYCMM/1-94MS-----FVN-------------VAPQQLSAAAADVAGIGSAVST....ASRAAAGP.T-LGLLAA.GA--DEVS-VGIA
B2HFQ1_MYCMM/1-93MS-----FVN-------------VAPEMVAAAVEDLAGIGSSISA....ANAAAVAL.T-TDVVPA.AA--DEVS-AAIA
B2HDH4_MYCMM/1-93MS-----FLK-------------TVPEELTAAAAQLGTIGSSMSA....QNAAAAAP.T-TVIAPA.AL--DEVS-ALQA
PG35_MYCTU/1-93MS-----FLV-------------VVPEFLTSAAADVENIGSTLRA....ANAAAAAS.T-TALAAA.GA--DEVS-AAVA
B2HP80_MYCMM/1-93MS-----FVV-------------TAPETVVAAASQLTGIGSAIEA....ANAAAAAL.T-TRLLPA.AA--DEVS-AGIA
B2HE92_MYCMM/1-93MS-----LLV-------------VAPEWLTSAAAELQSIESALSA....ANAAAAVP.T-TGLAAA.AA--DEVS-TAVA
B2HEI9_MYCMM/1-93MS-----FVV-------------TQPERLAAAAGSLQEVGSAVSA....QSAAAVAP.T-TSVAPA.AA--DQVS-ALTA
F5YTX5_MYCSD/1-93MS-----FVS-------------AQPEELTAAAGELTGIGAAMAA....QNAAAAAA.T-TGVVPA.AA--DPVS-ALTA
F5YSC7_MYCSD/1-93MS-----FVV-------------TQPESLSGAAGDLQGIGSAVHA....QSAAVAAP.T-TAMAAP.AS--DAVS-MSIA
Q9CD31_MYCLE/3-91..-----.LR-------------VVPEKLAATSEAMKALTARLEA....AHAAAFPC.L-VAVVPP.AA--DPVS-LQTA
B2HN11_MYCMM/2-90..-----..V-------------TIPEQLSIAATSLANIGSTIST....ANTAAAAP.T-TTLLAA.GA--DEVS-TAIA
B2HN55_MYCMM/1-93MS-----YLI-------------AAPDLLMTAAADAEGIASSIMA....ANLAAFAP.T-STLMAA.AG--DEVS-TAIA
B2HRC5_MYCMM/1-93MS-----FVV-------------VSPEVLAVAGRDLASIGSAISQ....ANVAAAAP.T-MGALAA.GA--DEVS-AAVA
B2HR92_MYCMM/1-92MS-----FVI-------------AEPELMAAAATDLATIGSTLSA....AHLAAA.P.T-AAVLPA.AG--DEVS-VGIA
B2HPR0_MYCMM/1-92MS-----FVV-------------ATPEMLVGAATQMERIGSALGA....ANVVAAPA.I-TSVVAA.AE--DEVS-AAIA
B2HRI5_MYCMM/1-93MS-----YVI-------------AAPELLAGAATDLAGLGSTLQI....ANRAAAAT.I-TGVPAA.GA--DDVS-AALA
B2HSE2_MYCMM/1-93MS-----FTV-------------VEPQMLTAAAADLAKIGAAIDT....VSTAAAAS.T-TNLLPA.AA--DEVS-AAIA
B2HDQ4_MYCMM/1-93MS-----SMA-------------VFPEAVSAAAANVANIGRALSA....ANAAATVP.T-TNLLAA.GT--DEIS-TAVA
B2HLT8_MYCMM/1-93MS-----YLL-------------AEPELLASVATEIDGIGSAIST....AGTAAAGP.T-SSLLAA.AG--DEVS-GAIA
B2HDQ3_MYCMM/1-93MS-----YVL-------------AAPDAMATAASSVTNIGGALSA....ANAMATAP.T-TGVLAA.AA--DEIS-VAMA
Q79FV8_MYCTU/1-93MS-----YVS-------------VLPATLATAATEVARIGSALSL....ASAVAAAQ.T-SAVQAA.AA--DEVS-AAIA
B2HR23_MYCMM/1-93MS-----FLL-------------VQPEMVSAATESLTAIRSALGE....VSAAVAGP.T-TAVVAA.AG--DEVS-AAIS
F5YV21_MYCSD/2-90..-----..S-------------ALPEELTATAAELSSIGNAVAA....QNTAAAGP.T-TGVVPA.AA--DEVS-ALTA
L7N697_MYCTU/1-93MS-----FVF-------------AVPEMVAATASDLASLGAALSE....ATAAAAIP.T-TQVLAA.AA--DEVS-AAIA
Q79FW5_MYCTU/1-93MS-----FVI-------------VARDALAAAAADLAQIGSAVNA....GNLAAANP.T-TAVAAA.AA--DEVS-AALA
B2HT01_MYCMM/1-92MS-----FVW-------------VSPELVSAAAADVAGIGSAVGA....ANTAAAAA.T-TELLAA.GG--DEVS-AAIA
F5YYX8_MYCSD/3-92..-----.LN-------------VVPEGLAAASAAVEALTARLAA....AQAAAAPL.I-TAVVPP.AA--DPVS-LQTA
B2HJR3_MYCMM/1-93MS-----FVI-------------AVPDFIGSAATDLTGIGSTLSA....ANAAAAIP.T-TEILAA.AE--DEIS-TAIA
L7N6B5_MYCTU/1-93MS-----FVN-------------VDPFGMLAAAATLESLGSHMAV....SNAAVASV.T-TKVPPP.AA--DYVS-KKLS
B2HIY0_MYCMM/1-93MS-----HLV-------------TQPQLMTAAAEDLVGIQTSIAE....ASIAVGGR.T-TGLAAA.AA--DEVS-AAIA
B2HSW4_MYCMM/1-93MA-----FVL-------------AVPDMVAGAAADLAGVGSVIDA....ANTAAAGS.T-TGIVAA.AE--DEVS-AAIA
Q6MWW8_MYCTU/1-93MS-----FVL-------------ISPEVVSAAAGDLANVGSTISA....ANKAAAAA.T-TQVLAA.GA--DEVS-ARIA
I6YGS7_MYCTU/1-93MS-----IMH-------------AEPEMLAATAGELQSINAVARA....GNAAVAGP.T-TGVVPA.AA--DLVS-LLTA
L7N6A1_MYCTU/1-93MS-----FVI-------------AAPEVMAAAATDLANIGSSISA....ASAAAAGP.T-MGILAA.GA--DEVS-VAIS
B2HJ40_MYCMM/1-93MP-----LVF-------------ATPEIIAAAATDLAQIGSAISG....ANTAAAAP.T-TEVLAA.GA--DEVS-TVVA
B2HN52_MYCMM/1-93MS-----FVS-------------VTPEMVVAAASDLSGINSAIAQ....ANSVAAAA.T-TTVLPA.AA--DEVS-AAIA
Q79FR3_MYCTU/1-93MS-----FVM-------------AYPEMLAAAADTLQSIGATTVA....SNAAAAAP.T-TGVVPP.AA--DEVS-ALTA
B2HLV1_MYCMM/1-93MS-----YVI-------------TAPEMLTTAATDLDGIGSAIKA....ASAAVAGP.T-TGVAAA.AA--DEVS-GAIA
B2HS54_MYCMM/1-93MS-----FLV-------------TAPEILAAAATDLDGIGAAIGA....ANAAAAAP.T-TAVLAA.GA--DEIS-AAMA
PG33_MYCTU/1-93MS-----FVV-------------TIPEALAAVATDLAGIGSTIGT....ANAAAAVP.T-TTVLAA.AA--DEVS-AAMA
B2HS53_MYCMM/1-93MS-----YLV-------------AVPEMLASAALDLDNIGSTITA....ANAAAAAP.T-TAVLAA.GA--DEIS-AAVA
Q73SD0_MYCPA/1-93MS-----FVQ-------------ATPEFVAAAATDLARIGSTISS....ANTAALGP.T-SGVLAP.GA--DEVS-ASIA
Q79FK9_MYCTU/1-93MS-----YLV-------------VVPELVAAAATDLANIGSSISA....ANAAAAAP.T-TALVAA.GG--DEVS-AAIA
B2HHV7_MYCMM/1-93MS-----FVL-------------VAPDMLATAAADVVQIGSAVSA....GNLAAAIP.T-TEVMAA.AA--DEVS-GAIA
B2HN68_MYCMM/3-94.S-----FVI-------------ATPEFLTAAANDLSGIGDAVRA....ATGAAAPS.T-TAIAPL.AG--DEVS-AAVT
L7N661_MYCTU/1-93MS-----HLV-------------TAPDMLATAAAHVDEIASTLRA....ANAAAAGP.T-CNLLAA.AG--DEVS-AATA
B2HKK6_MYCMM/1-93MS-----HLV-------------AIPDLLASAAADLAGVGSSVRA....ANVAAAGS.T-TALLAA.AG--DEVS-AAIA
L7N659_MYCTU/1-93MS-----HVT-------------AAPNVLAASAGELAAIGSTMRA....ANAAAAAP.T-AGVLAA.GG--DDVS-AGIA
Q79FU2_MYCTU/1-92MS-----FVN-------------VAPQLVSTAAADAARIGSAINT....ANTAAAA..T-TQVLAA.AQ--DEVS-TAIA
B2HRZ1_MYCMM/1-93MS-----YVS-------------AVPEAVSAAATDLAGIGSTIAA....ANALAAVP.T-TDLLAA.GA--DEVS-TAIA
I6Y2J4_MYCTU/2-94VS-----YVV-------------ALPEVMSAAATDVASIGSVVAT....ASQGVAGA.T-TTVLAA.AE--DEVS-AAIA
I6YG87_MYCTU/3-92..-----.FT-------------AQPEMLAAAAGELRSLGATLKA....SNAAAAVP.T-TGVVPP.AA--DEVS-LLLA
Q6MWW9_MYCTU/1-93MS-----FVL-------------VSPETVAAVATDLKRIGASLAH....ENASAAAS.T-TAVVSA.AA--DEVS-TAVA
B2HR57_MYCMM/1-93MS-----FLI-------------AAPDMVAAAATDLASIGSTINT....ANAAASAL.T-TSVAAA.AA--DEVS-TAVA
B2HIR9_MYCMM/1-94MS-----FVV-------------TAPQLLEAAAAQLAGIGSSIST....ASATAASP.T-AMPVGALGA--DEIS-SAVA
Q741T4_MYCPA/1-93MS-----FLT-------------TTTEEMLAAEALLSGINSNLAA....QNAGAASA.T-TAIAPA.AA--DPVS-AQQA
B2HR17_MYCMM/1-93MS-----FLN-------------VAPEMVAAAADNVESIGSALTA....AQAAAAAP.T-IELVAP.AA--DGVS-IAVT
H6N0V6_GORPV/3-87..-----...-------------VDPHELSRACADLERLALSLEE....ALGRLAAE.A-A.VAAP.GR--DEVS-VTTA
B2HSX8_MYCMM/1-93MS-----FVV-------------AAPEMVQAAASDIASIGSTINM....ANVAATAP.T-TAVLAA.GA--DEVS-AVIA
B2HEF1_MYCMM/1-93MS-----YVM-------------AVPELLASAAADLEGIGSALST....ANALALPS.T-SEILAA.GT--DEIS-TAVA
B2HLL6_MYCMM/1-94MS-----YVF-------------ASPEVLNAAAAEVSTIGSSLQT....ANASAAAP.T-TALLSALGA--DEVS-AAVT
B2HLH9_MYCMM/1-94MS-----FVF-------------ASPEVLGAAAAQAAVIGSGVQT....AGAWAAGP.T-TALAGALGA--DEVS-VAVA
A0QNJ3_MYCS2/1-92MQ-----PMT-------------HNPGAEAVAAQVIANAARGLAG....GTTASAAV.T-A.LVPA.GA--DEVS-ALAA
Q79FB3_MYCTU/1-93MS-----FVI-------------AAPEFLTAAAMDLASIGSTVSA....ASAAASAP.T-VAILAA.GA--DEVS-IAVA
B2HSU2_MYCMM/1-93MS-----FVT-------------TQPEALAAAAANLQGIGTTMSA....QNAAAAAP.T-TGVVPA.AA--DEVS-ALTA
B2HLT7_MYCMM/1-93MT-----YMM-------------TQPQLLTSAAADVEGIRWALTQ....ANAAAAGP.T-TSLVAA.AA--DEVS-TAAA
B2HJX1_MYCMM/1-93MS-----LVV-------------AEPDALSNAAGHLAGIGSKIED....ATAAGAGP.T-TTVAAA.AS--DDVS-IAIS
B2HEZ0_MYCMM/1-93MT-----YLV-------------TVPQTVATAAGNLAAIGSSITD....ASAAAAAP.T-TELAAA.GA--DEIS-AAIA
PE23_MYCTU/1-93MQ-----FLS-------------VIPEQVESAAQDLAGIRSALSA....SYAAAAGP.T-TAVVSA.AE--DEVS-TAIA
Q79FP1_MYCTU/1-93MS-----LVI-------------VTPETVAAAASDVARIGSSIGV....ANSAAAGS.T-TSVLAA.GA--DEVS-AAIA
L7N656_MYCTU/1-93MA-----FVL-------------VCPDALAIAAGQLRHVGSVIAA....RNAVAAPA.T-AELAPA.AA--DEVS-ALTA
B2HM53_MYCMM/1-93MS-----FVI-------------AVPDAVTAAVSDLANIGSVLTT....ANAAAALP.T-TTVVAA.AG--DEIS-AAVA
I6Y8K5_MYCTU/1-93MS-----FVI-------------AAPEAIAAAATDLASIGSTIGA....ANAAAAAN.T-TAVLAA.GA--DQVS-VAIA
B2HGS2_MYCMM/1-93MS-----FVS-------------VTQEALAAAASDVGVIGSSLQA....ANVVAAAP.T-AGVLAA.GA--DEVS-VAMA
G8RMI5_MYCRN/1-92MQ-----PME-------------HNPGAVGIGAQVVANGVRGLAA....GTTATAAV.S-A.LVPA.GA--DEVS-AQAA
B2HS71_MYCMM/1-93MS-----SVT-------------ARPEALAAAAGTLGSIGAALNA....GNAAAAAP.M-TGVLPP.AA--DEVS-ELLA
Q79G08_MYCTU/1-93MS-----FVS-------------VAPEIVVAAATDLAGIGSAISA....ANAAAAAP.T-TAVLAA.GA--DEVS-AAIA
B2HLL1_MYCMM/1-93MS-----YLI-------------ASPEHLASSARDLVRLGSVVAD....ANAAAAAP.T-TGVLAA.AV--DEVS-IQIA
B2HIU5_MYCMM/1-93MA-----FLV-------------AEPQVMATVAGQVEEIGSAIGV....ANEFAAGS.I-SGVAAA.AG--DEVS-AAIA
B2HF28_MYCMM/5-95..-----QVT-------------VVPAVVEMAANDLATIGSTISQ....ANAAALAP.I-TGLLPA.GT--DEVS-AGIA
F5YYX0_MYCSD/3-91..-----.LH-------------VVPEGLAATSAAVEAIAATLAA....AHASAAPL.I-TAVVPP.AM--DPVS-LQAA
Q79FD4_MYCTU/1-93MS-----YVI-------------ATPEMMATAAFDLARIGSQVSA....ASAVAAMP.T-TEVVAA.GA--DEVS-AGIA
B2HJ59_MYCMM/1-93MS-----HVT-------------AQPEIVAGVALELQAINSAARA....GDEVAVAP.T-TGVVPP.AA--DLVS-MLTA
L7N693_MYCTU/1-94MS-----FVF-------------AAPEALAAAAADMAGIGSTLNA....ANVVAAVP.T-TGVLAA.AA--DEVS-TQVA
V5X6V7_MYCNE/5-92..-----..A-------------HNPAVLGVGNQVIANGSRGLAT....GTAATAEA.S-A.LLPA.GA--EEVS-VQAV
F5YWS6_MYCSD/1-93MS-----FLT-------------ADPEALRAAADCLSSTGGALAS....QNTAAQVP.T-TGVLPP.AA--DEIS-AMLA
B2HHZ9_MYCMM/1-93MS-----YLI-------------VAPEAMTAAAGDLAGIGSSVAA....ANAAAAGP.T-TAMLTA.AA--DEVS-TAIA
D5UWF8_TSUPD/4-88.S-----RLS-------------MAPQEVRDVARGIERIVEDLRGAQERFAAHAEPA.A-T......GR--DEVS-TAVA
B2HDT7_MYCMM/1-93MS-----FVI-------------AVPEVVGSAASEVAGIGSALGE....ATAAAAAP.T-VQVLAA.AQ--DEVS-QAIA
B2HP27_MYCMM/1-93MA-----FLF-------------VAPETLTAAAADIAGIGSTLGE....AGAAAATP.T-TAVLAA.GA--DDVS-AAVA
B2HMV9_MYCMM/1-93MT-----FVL-------------VSPEAMASAAADIERIGALLTQ....GNAAAASP.T-INVASA.AA--DEVS-TAIA
B1MEI5_MYCA9/25-113..-----.LQ-------------VDPDVMKDAAVEYDAMAQRLQE....ALDKQLET.A-K.FGSA.GR--DEVS-TAVS
B2HNH3_MYCMM/1-93MS-----FVV-------------VDPEMVAATAADLANIGSTIGA....ANGAAAAT.T-RAVLAA.GG--DEIS-AAVA
B2HFX6_MYCMM/1-93MW-----YLS-------------VAPDELAAAATELRDVGSIVST....VNAAAAVP.T-TALWPA.AA--DEVS-AAIA
B2HNZ4_MYCMM/1-93MS-----FVV-------------VVPEMLSMAATDLASVGSAVSA....ANTAAAAP.T-TSVLAA.AG--DEVS-AAVA
B2HP93_MYCMM/4-94V.-----.LV-------------VAPEALSAAAANIAGIGSSLGA....ANAAAVTP.T-TTVLAA.GT--DEVS-GAIA
B1MHU0_MYCA9/3-91..-----.LN-------------VVPEGLTAASAAVEALTARLAA....VNAAAAPV.I-GAVMPP.AA--DPVS-MQSA
B2HS12_MYCMM/1-93MS-----YLT-------------VAPEALSAATSDAAEIGSALAA....ANAAAAAR.T-AGLLSA.GG--DEVS-AAIA
L0T2H7_MYCTU/1-93MS-----LLI-------------TSPATVAAAATHLAGIGSALST....ANAAAAAP.T-TALSVA.GA--DEVS-VLIA
B2HDJ7_MYCMM/1-93MS-----FVL-------------VTPEALSAAAADTARIGSAINA....ATTAAAAQ.T-TSVVAA.AG--DEVS-AAVA
Q6MWX5_MYCTU/1-92MS-----FVI-------------ANPEMLAAAATDLAGIRSAISA....ATAAAAAP.T-IQVAAA.GA--DEVS-LAIS
B2HSB5_MYCMM/1-93MS-----FVF-------------AEPQYLSAAATDLASIGSTIDT....AGSAAALA.T-TGVIPA.GL--DEVS-AGIA
B2HJB3_MYCMM/1-93MS-----FVL-------------ATPELMTTAAQDLAAIRSTLGE....ASATAAAP.T-TALAAA.AE--DEIS-TGIA
Q79FR5_MYCTU/1-93MS-----FVT-------------TRPDSIGETAANLHEIGVTMSA....HDDGVTPL.I-TNVESP.AH--DLVS-IVTS
Q79FQ7_MYCTU/1-93ME-----YLI-------------AAQDVLVAAAADLEGIGSALAA....ANRAAEAP.T-TGLLAA.GA--DEVS-AAIA
A1T262_MYCVP/3-92..-----.LR-------------VVPEGLTAAGAAVEALTARMAA....AHAAAAPV.V-TAVLPP.AA--DVVS-LQAA
B2HLD1_MYCMM/2-90..-----MLR-------------VIPEGLAGASAAVAALTARLAA....AHAVAAPA.I-TAVIPP.AA--DPVS-VRNA
B1MAP1_MYCA9/3-91..-----.LN-------------VVPEGLTATSAAVEALTARLAA....AHAAAAPV.I-GAVVPP.AA--DPVS-LETA
D0L2D2_GORB4/4-93.S-----QLS-------------VDPAELLSAAADIDRIADRVER....SLLAAGQA.L-P.VAPQ.GR--DEVS-VAAA
B2HR45_MYCMM/1-93MS-----FLI-------------AAPEMLTAAAADIATIGSTISA....ADAIAAAP.T-TSVLAA.AA--DEVS-LAIA
F6EE96_AMYSD/5-91..-----.LY-------------VNPEALWEAAQRLEAMAHRITA....DLARCASA.L-S.PVPA.GL--DEVS-LAAA
B2HLT9_MYCMM/1-93MT-----YVF-------------VEPETITTMAADLEGIGSTIDA....ASAAAAGP.T-SRLVSA.AA--DEVS-TAIA
B2HLG6_MYCMM/1-93MS-----FVS-------------VAPSLLDAAARDLAGLGAGLRE....ANLAAAGA.T-MGVLPA.AG--DEVS-AAIA
B2HT48_MYCMM/1-93MS-----FVI-------------AEPELLAATATHLSSLRTTLVA....ANAAAAVP.T-TGLLAA.AD--DEVS-VAIA
B2HLL3_MYCMM/1-94MS-----FVV-------------VSAQELESAAALLAGVGSNVGA....AGSAAAGP.T-AAVLGALGA--DEVS-AAVA
Q79FJ9_MYCTU/4-95.S-----QMI-------------VAPAFVDAAAKDLATIGSAISR....ANAEALVP.I-TALLPA.GA--DDVS-AAIA
B2HLF8_MYCMM/4-92..-----.MS-------------IDPVAADIGAQLAEGAFRGLQA....GATAATSI.T-S.VRPA.GA--DEVS-TQAM
Q79FW8_MYCTU/1-93MS-----FVL-------------AMPEVLGSAATDLAALGSVLGA....ADAAAAAT.T-TGIVAA.AQ--DEVS-AAIA
B2HR85_MYCMM/1-93MS-----DVM-------------VAPELVAAAANDYAKIGVLLGE....AHAAAAAS.T-VELLPA.AA--DEVS-AGIA
PE15_MYCTU/3-91..-----.LR-------------VVPESLAGASAAIEAVTARLAA....AHAAAAPF.I-AAVIPP.GS--DSVS-VCNA
Q79FL8_MYCTU/1-93MS-----FLL-------------VEPDLVTAAAANLAGIRSALSE....AAAAASTP.T-TALASA.GA--DEVS-AAVS
Q6MX17_MYCTU/3-92..-----.LR-------------VVPEGLAAASAAVEALTARLAA....AHAGAAPA.I-TAVVAP.AA--DPVS-LQSA
Q79FP3_MYCTU/1-93MS-----NVM-------------VVPGMLSAAAADVASIGAALSA....ANGAAAPT.T-AGVLAA.GA--DEVS-AAIA
B2HPP6_MYCMM/3-92..-----.LQ-------------VVPEGLLAASAAVQAITARLAA....AHAAAAPA.I-SAVVPP.AV--DPVS-LQTA
B2HHC0_MYCMM/1-93MS-----LVM-------------VVPECLNQAAGQLENIGTALGA....ANAAAAPP.T-TGIAAA.AG--DEVS-AAVA
H6MY81_GORPV/1-91MT-----ELS-------------ADTAKISEVAGQLGKLADRLNG....VLNTADAS.L-T.PQPA.GS--DEVS-VRAA
B2HR22_MYCMM/1-93MS-----FVN-------------VVPNTVAAAAGDLASIRSALSE....ATAAAAGP.T-TDVLAA.GG--DEVS-TAIS
B2HRA3_MYCMM/1-93MS-----YFI-------------AVPDELALAATELDSIGAALSV....ANVAAALP.T-TGILAA.GA--DDVS-TAIA
B2HEZ3_MYCMM/1-93MS-----FLT-------------VLPDMVATSAENLVDVCSTLGV....ANAAAAVP.T-TGIAAA.AS--DEVS-TAIA
B2HI03_MYCMM/1-93MT-----YVV-------------VSPEIVAAAAGTLTRISSSVSA....ANAAAAAS.T-TDLLAA.GA--DEVS-TRIA
Q6MX50_MYCTU/1-93MS-----FVI-------------AQPEMIAAAAGELASIRSAINA....ANAAAAAQ.T-TGVMSA.AA--DEVS-TAVA
Q79FV3_MYCTU/1-93MS-----YVL-------------ATPEMVAAAANNLAQIGSTLSA....ANAAALAP.T-TGVLAA.GA--DEVS-AAVA
F5Z171_MYCSD/1-93MS-----FVT-------------TQPEALLAAVANLRAIGSSLAA....HSAAAASP.T-TGVVPA.AA--DQVS-ALTA
B2HGB4_MYCMM/1-93MS-----LVR-------------VAPQVVADGVGNLARIRSSIGV....ANAAAAAA.T-TTMVPA.GG--DEVS-VAVV
Q79FU3_MYCTU/1-92MS-----FVV-------------TAPPVLASAASDLGGIASMISE....ANAMAAVR.T-TALAPA.AA--DEVS-AAIA
P71664_MYCTU/1-93MS-----FLF-------------AQPEMLGAAATDLASIGSAIST....ANAAAAAA.T-TRVLAA.GA--DEVS-AAVA
B2HPP0_MYCMM/1-93MT-----YVI-------------TQPDILTTAAADIADIRSAIGV....ANAAAASP.T-TAMMAA.AG--DEVS-QLIA
B2HLJ3_MYCMM/1-93MS-----YLL-------------VTPELLTSAATDLEGIASALST....ANLAAAVP.T-TGVLAA.GA--DEVS-AAVA
Q6MWW6_MYCTU/1-93MS-----FVL-------------IAPEFVTAAAGDLTNLGSSISA....ANASAASA.T-TQVLAA.GA--DEVS-ARIA
B2HLV2_MYCMM/1-93MS-----YVL-------------TAPDLLASAATDVDGIAATLQV....ANSAAAAP.T-SGLLAA.AQ--DEVS-AAIA
B2HI17_MYCMM/2-92..-----AVV-------------VSPAILATTSDKALTIGSLIRE....ANRLAEFA.T-TQLAPA.AG--DEIS-AAVA
B2HSB1_MYCMM/1-93MS-----YVA-------------AVPEALTAAASDVAGIGTTISS....ANAAASAP.T-TGVLAA.AG--DQVS-AQVA
Q7AQ88_MYCLE/4-94..-----FLN-------------AEPQALTAAANTLEGLSAATVA....SNAAAAQL.T-TEIAPP.AA--DDVS-ILLA
PG44_MYCTU/1-93MS-----FVT-------------AAPEMLATAAQNVANIGTSLSA....ANATAAAS.T-TSVLAA.GA--DEVS-QAIA
Q79G06_MYCTU/40-131.S-----YVF-------------AQPSVLAAAATDLAGIGSAINQ....ATAAVAAP.T-TGLAAA.AA--DEVS-TALA
B2HMF4_MYCMM/1-93MS-----YVL-------------VTPEMVATAAADAAAIGSTVSA....ANAAAAIP.T-TAIATA.AA--DDVS-AAIA
B2HP28_MYCMM/1-93MS-----FVI-------------TAPEALTAAATDLASLGSTIGA....ANAAAVAP.T-TAVLAA.GA--DEVS-AAVA
Q79FT0_MYCTU/1-93MS-----FVV-------------VAPEVLAAAASDLAGIGSTLAQ....ANAAALAP.T-TAVLAA.GA--DEVS-AAIA
Q79FT3_MYCTU/1-93MS-----FVL-------------VSPSQLMAAAADVAGIGSAISA....ANAAALAP.T-SVLAAA.GA--DEVS-AAVA
B2HLU0_MYCMM/1-93MS-----YVV-------------AQPPAIAAAATELTGIGSALSE....ATAAAAGP.T-TAILSA.AA--DEVS-TAIA
L7N681_MYCTU/1-93MS-----FLT-------------VAPDMVTAAAGNLESVGSALNE....AAAAAAPA.T-VGLAAP.AA--DRVS-AVVA

PF10817

Q73RU9_MYCPA/1-104--------MF-------------VDTDLLHSGGNQSHRAGGHARDG---ADQLAGGTVA-SGMF---GD--FAAA-DAFH
B2HNS0_MYCMM/1-104--------MF-------------VDTGLLHLGGNESHRAGGHAQEG---ADRLALGPLM-SGMF---GD--FAAA-DAFH
Y2078_MYCTU/1-104--------MF-------------VDVELLHSGANESHYAGEHAHGG---ADQLSRGPLL-SGMF---GT--FPVA-QTFH

PF06013

Q97MZ9_CLOAB/4-89KAFSSEFD.QFAPQV.TQFAK-LVEQIGQQLKSASKTMQDTDA-------------------------------------
A9B0A6_HERA2/4-89NEFVETLQ.IMAQSV.AKFAA-KMTEIQNDIKVSMQQMADTDN-------------------------------------
Q81TJ4_BACAN/3-88QNFYQMFN.EAKPKI.FEVNN-LLDKISEKLKHSAKKFREADQ-------------------------------------
Q81R67_BACAN/3-88AKFRGEFI.QSKQAM.QQYIP-ILEGISTDLKRIADKFRNTDN-------------------------------------
Q81R60_BACAN/6-91QHFYGEYM.RSMRLM.ESYIR-NLQVTEKELRRIAQKFRQADE-------------------------------------
Q97LZ0_CLOAB/3-88TKFFGEYQ.QWSKTM.TGYVQ-LLQQISNELKGQAQKFRDADL-------------------------------------
Q8ERJ1_OCEIH/4-89EKFDMQFQ.ELKPKV.QDFSQ-LMLDIENQLVKTAEAVAQQDE-------------------------------------
Q81HA0_BACCR/6-91EGFDQQFN.QLKPKV.QNFAQ-LLQEINMQLNKTAEAVASHDE-------------------------------------
A3CR39_STRSV/3-88DSFEAQFN.ELSPKI.KEFAT-LLQDINAQLIKVADIVEQTDQ-------------------------------------
A8FGZ8_BACP2/4-89EAFADQYE.QLKPSF.IKMSD-LLTDVSNQLDQTANTLESTDQ-------------------------------------
Q65FF4_BACLD/4-90RAFSEQYQ.ELRPSF.IKMAE-LLSDVSKQLHQTANTLESTDQ-------------------------------------
Q5WK78_BACSK/4-89EAFIQQYD.ELKPSF.VRMGD-LLGEVSEQLRNSGRTLEETDQ-------------------------------------
A3DD43_CLOTH/4-90EAYVEQFM.ALRKELETKLNQ-CLSDLERSLTSVANALEQADK-------------------------------------
Q9KE84_BACHD/3-88QGFAAQWQ.DKRKHV.EELIQ-LYEELGAQTDDIANVVETTDQ-------------------------------------
Q97LY9_CLOAB/4-91DKFVDDFQNNTMKLL.QNCVN-NLNNTGNSLKQIVEMFAETDS-------------------------------------
Q97LY7_CLOAB/15-100DTFVSNYD.GWKSNG.RRYVN-EIDRIADELKNASERFREADR-------------------------------------
Q97MZ8_CLOAB/5-90REFQNTYK.ILYQNM.NTYSD-ALDTLSKNLEQIAKSFNDADA-------------------------------------
Q97KJ1_CLOAB/6-91KEFDSTFP.GFYSAM.KKDCD-MLEELIKELKLVKTSFESLDT-------------------------------------
Q97MZ2_CLOAB/6-93EAFVNAQFPNFKEGM.QRHCN-MIGELIKELQETAKEFTKLDN-------------------------------------
Q97M02_CLOAB/3-88DAFESKYK.IIEKDI.QNIAK-KLDNIAWELNNTANTFEQADE-------------------------------------
Q9L0T5_STRCO/28-115KAFDDNFD.EFTRGA.KDTLD-GLDGMGDYLTMAADKFEQIDD-------------------------------------
A6WCP9_KINRD/3-90VAFKDSYD.EFNTGI.TQVLE-GLTGMSGYLNSAAQTLSDADS-------------------------------------
Q6ACE0_LEIXX/8-95GKFNDAYT.KYTTSA.NTLIA-QLNEIQQFLTGTANAMRDLDS-------------------------------------
A1T456_MYCVP/3-88SAYSPLWA.EWLDGA.TTLVD-TLEELSRKVAAAAAQYVDQDG-------------------------------------
Q73SS3_MYCPA/16-101SAYAAAWE.LWHRGA.REVQL-GLAMLARLVGQAGEAYASNEA-------------------------------------
A0QTK0_MYCS2/4-90SAYSEQWD.KWHNGA.GQVIR-GLQAMSESLKASADSYSATDQ-------------------------------------
A1SN44_NOCSJ/4-90TSFAAGWA.EWARAA.DAVRR-GLELMGDLLEAADRDLVRADT-------------------------------------
Q5YN04_NOCFA/7-92DAYREGWD.DMQDGA.MKAWD-ALTDLASKLGVSASTLRDQDT-------------------------------------
Q5YRS3_NOCFA/4-91SAYDESWV.EWKQGA.DDIVA-ALDSSASNLLDAANRYEMWDA-------------------------------------
O86644_STRCO/7-92TAYGEIQR.SSATEM.DQMCQ-KLARIAQLLDDSVIGYQDTDK-------------------------------------
Q82K72_STRAW/7-92DAFDSKLA.RWDKEA.NDIHT-ALTGIGHAVGTAGGTYMGGDK-------------------------------------
ES6LX_MYCLE/3-88TAHEMFIA.DLGRNF.QMIYE-QANSHGQKVQRASSSMADTDR-------------------------------------
Q5Z1J3_NOCFA/4-90EAFAQLQR.TWQQNV.DQLNT-TLAGAGQLVSSGNSELQSTDS-------------------------------------
Q73TD4_MYCPA/3-88MTYQVWQA.QWNEAM.ESLVR-AYQSMASTHEANTMSMLARDQ-------------------------------------
ESXR_MYCLE/3-88ISYQAWQV.QWNQAT.EEMVR-AYHAMANTHQNNTLAMLTRDQ-------------------------------------
Q6NJ54_CORDI/3-88QAYNEAQQ.QWDSSA.AELNT-ILSTISNTVRQGNDRMSEVNR-------------------------------------
Q8NST7_CORGL/3-88EAYSEAQL.KWDRAA.AELNT-ILATISNTVAQGAERMSDVNR-------------------------------------
A1SDG6_NOCSJ/5-90QAYTAAKA.KWDGAM.QEMKG-LLQETSSTVVQSNAEYRAADQ-------------------------------------
Q8G878_BIFLO/3-88TQFTAVAE.QWRAAQ.QQMEA-SLESIQRSLTQASTVYADAEI-------------------------------------
A1A0W4_BIFAA/3-88TQFTAVAE.QWRAAQ.QQMEQ-SLESIQRALMQASTLYSETEM-------------------------------------
A6WE48_KINRD/3-88AGFQALSG.QWRGTQ.DRVRS-ALDDIQRALAQAGRQYADVES-------------------------------------
A1R3I1_ARTAT/3-88TNFQALVL.EWSLTQ.SKVEA-SLASINMALSSAAASYVEVEQ-------------------------------------
A0JT10_ARTS2/3-88TNFQGLIT.EWTITQ.GKVEA-ALASINTALASAAATYAQAEQ-------------------------------------
A0LR18_ACIC1/3-88QRFEMLWA.EWQKSA.EGLHQ-ALTGIAQLLNQASINYAEAER-------------------------------------
A5UYZ8_ROSS1/3-88QQFESRWE.EWSQRL.RTMMD-ELQNLANGLRREAEEFESVDR-------------------------------------
A5UYZ9_ROSS1/3-88QQFESQWE.QWCQKL.RTMME-ELQSLSNGLRREAEEFEAVDR-------------------------------------
A5UZ07_ROSS1/3-89QQAEEVWT.RLQAQF.APTIE-ALNQIANRTERFTNALEEAGR-------------------------------------
Q6NJ55_CORDI/4-89VSFDNLMQ.RWDASA.KGLQD-ALQSISDNIRGNATSFENVEA-------------------------------------
Q73S33_MYCPA/6-92ARFKEMID.RWNAES.VRLYH-ALHAIADTIRHNAATLQDAGQ-------------------------------------
ES6LY_MYCLE/5-91LTSHDTMG.QINQAF.RHIVT-LLQDVRDQLGTAADRYEHQEE-------------------------------------
O05453_MYCTU/4-91VASHMTAT.EITNEL.NKVLT-GGTRLAEGLVQAAALMEGHEA-------------------------------------
A9B1N8_HERA2/5-91VAFQKEMQADILPAV.QRLIN-AFQTAQSTTLEIKKVLQEAEQ-------------------------------------
A9B0B5_HERA2/5-92VAFAKELDGEIYPTF.NRLIT-AFQTAQEVTLEVQKIFGQAEE-------------------------------------
A9B2P0_HERA2/5-91KSFFNEMQTSIFPTF.GKLKE-VLVTAQQVTLNVNSILREAET-------------------------------------
A9B726_HERA2/5-91VAFFGEMDDSIFPAL.KRLQT-TLTSASALTTQISQIFRQAEE-------------------------------------
A9B720_HERA2/5-92QAFFAEMNEHIFPAM.KRFQN-VLAVSGEVTKQISQIFRQAEE-------------------------------------
A9B8D4_HERA2/5-92KAFANEMQSNVFPAF.RRLTA-ALRESQAVTLQIKNLMRQAEE-------------------------------------
A9AUV8_HERA2/5-92TACFKEFHAEVVPAY.TRLSN-VLGEGQSTLQGIATLFRQAEE-------------------------------------
A9AUW0_HERA2/5-92TACFKEFHAEIVPAY.CKLQH-VFSESQTSLNQIAQLFHEAEA-------------------------------------
A9B561_HERA2/5-92NACFQEFDHVVKPAF.QRLLH-SLQGSVETTKAIRKIMADAEA-------------------------------------
A9B6G5_HERA2/5-91TAFFHEFQAEVDPAL.ERLRE-ALETARDVAMAIHTGMRSAEE-------------------------------------
Q5YRS2_NOCFA/6-91EAQRAAHN.RWMAGA.EEMRE-NLDELREVARRAHTNYTAAVQ-------------------------------------
Q5ARS9_EMENI/25-110ESFGQLLA.KLSASV.YDIQR-VSADIASTIDATASAYEDAES-------------------------------------
O86643_STRCO/16-101KEFDSVQR.GVNQHL.KKLQD-NLVDLEEVMRMSVKGFTQHEQ-------------------------------------
Q5YU75_NOCFA/7-92ERFAAGYA.EVRGGL.SELLD-AMRDTTVALDTSAEAYLGLEG-------------------------------------
A0QNJ5_MYCS2/3-88TAAQAALA.RFHEAA.AKQVQ-ELNEISANIHTSGTQYTSTDE-------------------------------------
ESXB_MYCLE/3-88SAALGALG.RFDEAM.QDQIR-QLESIVDKLNRSGGNYTKTDD-------------------------------------
A4FPH3_SACEN/3-88DVFRKLMD.AFQENA.KKIND-KLNELSENVKSSGQDYAQREE-------------------------------------
Q5Z1J2_NOCFA/6-93DAFNAFME.RYYFQA.DKLND-KLMETSEKLIKAGSSFADQDT-------------------------------------
A5A655_BACLD/2-80DAFLSYLE.LIIELN.ADMKD-ALKEHTAALDALEKH......-------------------------------------
B0RAY2_CLAMS/4-88TAFQGVVA.EWKGTQ.QRVEE-ALASINQALSAAARQYAEVEE-------------------------------------
B2HDH7_MYCMM/3-87VACQEFIT.QLGRNF.QVIYE-QANSHGQKVQAAGNNMAQTDS-------------------------------------
B2HNR7_MYCMM/7-90SAFASAWE.LWRRGA.GEVQL-GLSMLAESVGQAGAGYQANE.-------------------------------------
B8DTZ3_BIFA0/3-87AQFNMVAS.EWRRTQ.QQMEL-SLEAMQQALTQASTVYADAE.-------------------------------------
ES6LD_MYCTU/7-90SAYGSAWE.LWHRGA.GEVQL-GLSMLAAAIAHAGAGYQHNE.-------------------------------------
ESXR_MYCTU/3-87ITYQGWQT.QWNQAL.EDLVR-AYQSMSGTHESNTMAMLARD.-------------------------------------
ESXK_MYCTU/5-90ATSLDTMA.QMNQAF.RNIVN-MLHGVRDGLVRDANNYEQQEQ-------------------------------------
ESXB_MYCTU/3-88TAAQAAVV.RFQEAA.NKQKQ-ELDEISTNIRQAGVQYSRADE-------------------------------------
ESXA_MYCTU/5-87EAYQGVQQ.KWDATA.TELNN-ALQNLARTISEAGQAMASTE.-------------------------------------
Q2G182_STAA8/7-92NKVKDVLL.IMAKFQ.EELVQ-PMADHQKAIDNLSQNLAKYDT-------------------------------------
Q2G189_STAA8/4-88SRFEEQFQ.QLSPKV.EKFAQ-LLEEIKQQLNSTADAVQEQDQ-------------------------------------
Q81B80_BACCR/10-88DAFLSYLD.LIIQYN.SEMVE-AFEGHTKALKELDKSIQT...-------------------------------------
Q8E1X1_STRA5/3-88DSFEAQFN.ELSPKI.TQFAQ-LLEDINQQLLKVADVVEQTDS-------------------------------------
Q8NST8_CORGL/6-89VSFDSLMN.RWNSSA.RQLQE-ALASISDNIRHNARSFENTEA-------------------------------------
Q8YAQ4_LISMO/4-89DAFLTFME.LIEKYH.ADVKK-NYKKQKKALTALEDYVEDFEN-------------------------------------
Q8YAR0_LISMO/4-89MRFDDQFE.QLKPKV.TEFAN-LMDQINDQLEKTANAVEEHDQ-------------------------------------
Q9X367_BACAN/4-89DRFYQMFN.EAKPMM.FNILQ-ELDKIAVELERAAVKFREADE-------------------------------------

PF10824

A0R672_MYCS2/1-104WAVADAVE-ARTAAG-GALRR-VSVELSEKLRAAATNYDNTDSTEAG---------------------------------
A4FPN7_SACEN/1-99LMIESVEQ-NGVETL-RKAVD-AMREVADNVRATAEEYQAVDDDNSS---------------------------------
Q744T9_MYCPA/1-99DAGRELLE-LRRQCY-EQQAA-DHADLADQLTVSAAMWEQHEQEAAD---------------------------------
A0QNK5_MYCS2/1-100AAIGAAGF-SRDAAA-AAMQG-VSTSLAEKLDEAATNYERTDAAKAG---------------------------------
A1TH04_MYCVP/1-103LAVTAAER-ARSTAG-AKIYE-IATDLEDRLRAAAALYDNVDYQNGR---------------------------------
A0QSQ2_MYCS2/3-102NAVRGALD-DLTGAM-RQWAT-AADEIAHLLRTSAGRYAAADDHAAA---------------------------------
Y406_MYCLE/4-103DTLKMYED-AHRTLG-ESLHT-GGIDLARVLRVAAAMYCDADEICGS---------------------------------
Q5Z2J0_NOCFA/9-106TDFANAWA-DLRTSG-DQIMA-ALTELAEKLGVTAHTYQARDENNAG---------------------------------
A0R2G1_MYCS2/1-98SAFDAAHA-ARGGAM-GATQA-ASSKISDLLRQAAQAYERGDVTAAD---------------------------------
A1TDN8_MYCVP/1-99TALTGALG-SRSGTL-AGTRT-AGDTISELLHQAALAYERGDHRGAE---------------------------------
A0QQE6_MYCS2/1-94SAVIAAET-ARRAAC-TRMNA-KSEELAQKLGMARKLYDGTDMQEEQ---------------------------------
A0R605_MYCS2/34-130PGFAKFVD-IAHSQA-ERLRT-DLTGLRDRLRTAADVYERRDHEAGG---------------------------------
Q5YTI6_NOCFA/5-105LSFAAAQV-LQAKDI-NDLAA-KYNDLSWKAFSAAALFENTDGENAG---------------------------------
A1T2U3_MYCVP/1-103LAAQAAGV-ARAKAG-VAVQV-MSEAFAANLDSAAANYSWTDQDSGS---------------------------------
A1T184_MYCVP/1-96AACNAART-TVATEM-TKIAG-SARTYGADLRSAADRYDATDETSGR---------------------------------
A0QNI6_MYCS2/1-100AAVEAVQH-ARRAAG-TGMVK-VSQELETKLDTAAGRYHRTDSTMGD---------------------------------
B2HES8_MYCMM/2-99TSFANAEA-ARRAAA-NSMNT-TSSKLAAKLRTASSAYQGVDEQAGE---------------------------------
B2HT35_MYCMM/1-99NALSEFEA-VRARAG-QALQG-VATGLSKNLNKALTAYVNTDRAGAE---------------------------------
ESPF_MYCTU/1-100DTLQEFET-TRSSTG-TGLQG-VTSGLANNLLAAAGAYLKADDGLAG---------------------------------
ESPC_MYCTU/1-100DTLNVYLT-AHNALG-SSLHT-AGVDLAKSLRIAAKIYSEADEAWRK---------------------------------
Y027_MYCTU/1-98DTGRELLE-LRKQCY-QQQAD-NHADIAQNLRTSAAMWEQHERAASR---------------------------------

PF00823

Q743Z9_MYCPA/26-174SSMMAAAA-PQLAWL-SGTAG-RAELAAGQALAAVSAYETAFAETVP.........PPVIAANRALLLQ..LLATNFLGQ
Q73UE8_MYCPA/5-161MAMLQSVQ-PYLLWL-RETAQ-QSAQLANSAEAAATAFGTVRSTVVH.........PSVVSANRTRLAQ..LLATNRFGT
PPE58_MYCTU/4-169EWMADAAL-RYLDWL-SKHSR-QILRTARVIESLVMAYEETLLRVVP.........PATIANNREEVRR..LIASNVAGG
Q0S9F2_RHOSR/145-301AAALAKIT-PFTVWT-AECAE-LAADTAAKAGLEAGAYTTAALIMPS.........IPEIVAVKTAK....ATAYSTGGA
Q73WQ9_MYCPA/13-170AAMAAAVE-PYVAWA-TGTAA-RAGQAAAQARAAAAAHEAAFAATVP.........PHVVAANRIQLAT..LIATNFFGQ
Q741D6_MYCPA/5-161TAITQAVA-PYLAWL-DATAA-RARQTATQATAAAGAYGLALAAVVA.........PHVIAANRLRRIS..LAEANCLGQ
Q73TJ3_MYCPA/8-165ESYVAAHA-PYLAWL-TQASA-DSAGAAARHEAAAAAYTAALAAMPT.........LGELAANHATHAA..LQATNFFGI
Q6MWX8_MYCTU/5-162AAMAAAAA-PYAGWL-GSVAA-AAEAVAGQARVVVGVFEAALAATVD.........PALVAANRARLVA..LAVSNLLGQ
A0QNJ4_MYCS2/4-161ERAVAATM-PMITWL-QTTAA-QAQKRALQASAQASSYSLALATTPP.........LPEIEQNHITHGV..LEATNFLGI
Q73ZT3_MYCPA/6-163IAMAAAAA-PYVAWL-QATGA-QAEQAGAQAKLAAAAYETAFAATVP.........PPVIAANRALLAT..LVATNMLGQ
Q73ZT6_MYCPA/6-163MSMLAAVT-PYLAWL-TDTAT-RAEEAAAQANSAATAYEAAFAMTVP.........PAVVAANRAQLAM..LVATNVFGQ
Q741X1_MYCPA/30-187LAMASAFA-PYMAWM-AGAAG-RAAETAGQARLAVEVFEAAFAMTVP.........PPAVAANRVQLAT..LIATNFFGQ
Q73ZT2_MYCPA/5-162LAMASAAA-PYVAWM-QQTAA-QAAETAAQATAAATAYETAFAAHVP.........PAVITENRALLAQ..LVATNIFGQ
Q5Z3L3_NOCFA/10-166IAALSRLV-GFTGWA-EQQGV-MAAAMGSKAAANATAYTVASLAMPS.........LPEILATNAAV....VASANPAGA
Q73ZT0_MYCPA/5-162TSMSAAAA-PFIAWA-TTTAG-RAEQVATQARLAAAAYETAFAATVP.........PPVIAANRSLLMT..LIATNILGQ
Q73TD6_MYCPA/11-168EQYAAAHL-PYLAWL-QQASA-DSAGAAAQQEVAATAYTTALAAMPT.........LAELAANHTIHGV..LLATNFFGI
Q73ZT5_MYCPA/6-163AKMSAAVT-PYLEWL-HTTAT-QAEQAGAQANAAAAAYQAAFAATVP.........PAVVAANRTQLAN..LVAGNIFGQ
Q73TI1_MYCPA/8-165EAYVAAHA-PYLAWL-DQSSA-DAAGEAAQHEIAASAYTVALATMPT.........LPELATNHATHAA..LVATNFFGI
Q741D8_MYCPA/8-165GSMAAAAA-PYVAWL-SATAG-LAEQTAAQARAAAAAYEAAVAATVP.........PAVVAANRSLLAT..LLQTNILGQ
PPE37_MYCTU/8-165DRFVVAHQ-PFRYWL-THAAT-VATAAAAAHETAAAGYTSALGGMPT.........LAELAANHAMHGA..LVTTNFFGV
Q73Y22_MYCPA/7-164VAMTAAAA-PYVQWL-IIAAA-QAEVAALQARLAALAFEGALVATVP.........LPAVLANRARLLV..LIATNFFGQ
SRA_MYCLE/6-163DMLASRVS-TFVAWL-DGNAE-NAGLIARVLHAVAYAFEEARAGMVP.........LLTVLGNIIHTMA..LKAINWFGQ
Q73U78_MYCPA/14-171ASYVAAHG-PYLAWL-TRASA-HSAAAAAQHETAGTAYTAALAAMPT.........LPELAANHAVHGA..LVATNFFGI
Q745G2_MYCPA/8-167AASAANVT-MLNASL-HGLAG-WVDVKPAVVATAISAYQMAYGSMRP.........APECIANRTETATDYGINPLVLGA
Q73V32_MYCPA/5-161DAMAFAAA-RYLTWL-RATAE-QTKQTAMQARTAAAAYEQAYAMTVP.........PPVIAANRTLLAS..LVATNIMGQ
Q741E7_MYCPA/8-165EAFVAAHV-PYLAWL-LQNST-NSTAAAREAETVAAAYTAALSAMPT.........LEQLATNHAVFAQ..LVATNFFGV
Q5Z1M6_NOCFA/16-174RDVLEKVT-GLRDWL-IEAAG-AAADHAAKAHAQAAAYEVARLAMPD.........GGELAALAEAKRMLEAMTAGLGAP
B2HCX8_MYCMM/6-162EAMANSIW-PYVAWL-RATAA-ATEQSASKARIAASAYEAAFAATVP.........PPQIAANRAELTG..LISTNVVGQ
B2HD13_MYCMM/6-163AAMNAVAT-PYAQFL-SAAST-QAAGAASQAKAVAGAFEVARAAMIH.........PLEVLANRNVFVQ..LIRTNLFGL
B2HD24_MYCMM/5-162AAMSAAAA-PYVSWL-NAAAV-RAGEAALQAKEVVSAFEAARAAMIH.........PLAVAANRNALVQ..LVLTNLFGQ
B2HDB1_MYCMM/8-164DDYVAAHT-PYVVWL-DHAAI-VCQRAGAALQMMVAAYSDALAEMPT.........MAELQENHAVHGV..LVATNFFGL
B2HDH5_MYCMM/5-160MAMIAAAQ-PYLAWL-TYTSE-AAMHAGAQAAASAAAYEAAFAMTVP.........PPVVAANRSLLAA..LVATNFLGI
B2HDM3_MYCMM/6-163LSMASAFW-PYVTWT-SMVAT-QAGEAASQATLAVAAYETALAMTVP.........PPVVAANRVQLAT..LTATNFFGQ
B2HEI4_MYCMM/9-165ASYAAAHQ-PYVAWL-MRNGA-EAEAMAAEHEAMAAAYCAALAAMPT.........MGELAENHLTHGV..LLGTNFFGI
B2HEJ0_MYCMM/7-164ASMAAAAA-PYATWL-AVANE-QARQTAAQARAAATAFETAFAVVVP.........PPLIAANRSQVAS..LVVANVLGQ
B2HF23_MYCMM/8-160ESYVAENI-RYKAWL-AEAAL-VCAEAAAALEAAAAAYSGALAEMPT.........LTELAENHTVHEV..LVAMNFFGV
B2HF25_MYCMM/2-159ASYVAAHL-PYAAWL-TKASA-DYAVMAAEQEVVAAEYVAALAAMPT.........LAELAGNHATHAV..LLGTNFFGI
B2HGH9_MYCMM/6-162AAMLAATG-PFIDWL-EITGA-LASETANQAAAAAAAYEQAYAMTVP.........PIVVAANRALLVA..LVASNFFGQ
B2HH63_MYCMM/8-161QSYAAANE-RYLAWL-TQVSA-DYARQAALVDVVVAAYGAAVAAMPS.........LVELAANHTVHAV..LSATNFFGV
B2HIP7_MYCMM/8-164QSYVDAHV-PYLTWL-ATTSA-DYAATAIEHEVAADAYAGALTAMPT.........LAELAANRTTHTA..LVATNFFGL
B2HJ58_MYCMM/7-163AAMSAAAA-PHLAWL-SATAA-QAEQVGRQAAAAASAYEAAFAGMVP.........PAVVAANRAMLAT..LVATNLFGQ
B2HJQ8_MYCMM/6-154VPVMRVIA-PHWALL-TALAR-HASQTAVQAETAAQAYEQAAAKMTS.........AQLIAPNRMMRKW..LSANNFLGQ
B2HJR0_MYCMM/5-161TAMAQAAA-PYAAWL-STTAA-QAELASAQARAAVSAHAGAFAATVP.........PPVIAANRAHLAA..LIATNLLGQ
B2HKM4_MYCMM/2-159HQWLAAHG-PYLIWL-EQAAI-DSSVTAAQHRIAAAGYSSAVAAMPT.........LAELAANHAIHGV..LVVTNFFGI
B2HKT3_MYCMM/8-165ASMVGASA-PYVAWL-RASAI-RAERTASQARSAAAAYEAAFVMTVP.........PPVVAANRVLLTT..LIVTNFFGQ
B2HKX5_MYCMM/9-166LSMAAAAQ-PLLAWL-SYTAE-SSALAAAQAAASVAAFETAFAMTVP.........PAEVAANRARLAE..LMATNIFGQ
B2HLK3_MYCMM/7-162TAMAAVAT-PHVRLL-QGLAG-QAEQAAAQARVVASAFEAVRAATVH.........PALVAANRAQFVS..LALSNIFGQ
B2HN16_MYCMM/9-165QCCIAAYV-PYLSWL-MQASA-DSAATAAAHQAAATAYTGALAAMPT.........LGELAANHATHAV..LVATNFFGL
B2HNW0_MYCMM/10-165ELYVAAHV-PYLMWL-MRASA-TSAQAAAQHEAAAAAYTTALAAMPT.........MPELAANHVIHGV..LMATNFFGI
B2HNW7_MYCMM/11-168FQYVAAHL-PYVAWL-LQASA-DGAGKAAEHEAAAVAYSGALAAMPT.........LTELGANHALHGV..LVATNFFGL
B2HQQ1_MYCMM/8-165AAMMAVAT-QYMAWL-GAAAA-QAEQAAAQAAVTAGAFESALAATVQ.........PAVVTANRGLMQV..LAATNWLGF
B2HRG4_MYCMM/5-161TAMTQAAA-PYAAWL-CTAAA-QSESAASQAGAVATAFEAARTAIVS.........PVIINANRALTAL..LANTNFFGL
B2HRT7_MYCMM/5-162AMMLEAIT-PYVTWM-RSTAV-QAEQAAKQAEAAVAAFEAAFTGVVP.........PPLIASNRMQLMT..LMARNIYGQ
B2HS07_MYCMM/5-162AAMSAVAA-PYASWL-SAAAA-QAAGTAGRASAAAAVFEAAQAAIVH.........PAMVAANRNELVA..LVISNLFGQ
B2HS70_MYCMM/6-162SLMGAAAA-PYVAWL-GATAT-RAELAANQARGAAVAYESAFAATVP.........PALILENRLQLVT..LIATNIFGQ
B2HSM7_MYCMM/5-162VAMGTAAA-SYLGWL-NAAAA-HAEQAAAQAEALVAEFAAAQSAMVQ.........PFLLAANRSSLVS..LVLSNLFGQ
B2HSS2_MYCMM/8-165ESCMAAYL-PYLQWL-AQNST-VCGESAAQLEIVATAYISALAAMPT.........LTELAANHTTHAV..LLGTNFFGI
B2HST8_MYCMM/6-163RSMMSAVA-PYVTWL-SAAAA-QTETAASQARAAAAAYETAFVMTVP.........PPVIAANRVLLMT..LVATNFFGQ
B2HSU0_MYCMM/7-164ATMAQAVE-PYMTWM-SVTAG-QAEHAATQAQSAAAAFETAFAAVVP.........PPLIATNRAELTQ..ALQTNMFGL
B2HSV2_MYCMM/10-166ASMAAAAA-PYVAWM-STTAA-QAEESAVQAAAAAAAYEAAFSATVA.........PTVITANRAQLMV..LVATNVLGQ
B2HSV3_MYCMM/6-163ITMAAAAA-PYVTWI-NTTGV-QAEQAATQAKLAAGAYETAFAATVP.........PPVIAANRALLMA..LIATNIFGQ
B2HSV4_MYCMM/5-162LAMAAAVA-PYVTWM-GATAA-QAAQAATQATAAATAYETAFAAHVP.........PVEIAANRAQLAM..LVATNLFGQ
B2HT04_MYCMM/5-162AAMAAAAA-PYAGWL-SAAAT-RALGAATQAKAAAAVFESAQAATVH.........PELVLANRNQLVS..LVLSNLFGQ
B2HT05_MYCMM/5-162TAMAAAAR-PYASWL-GTAAA-RAAVTAAQANAAAAVFEAAQAATAH.........PELVAANRNQLVS..LVVSNLFGQ
I6X6H8_MYCTU/5-162LAMAAAAA-PYAGWL-TAAAA-QSAGAAGQARAVASIFEAAQAATVL.........PAAVAANRDAFVQ..LVMTNLFGQ
I6Y7L4_MYCTU/5-162TAMTGAAA-PYLGWL-SAAAA-QAQQAATQTRLAAAAFEAALAATVH.........PAIISANRALFVS..LVVSNLLGQ
L0T6B3_MYCTU/5-162LSMAAAAV-PYVAWM-RATAA-SAEQAAAQAVAAANAYESAYAATVP.........PTVIAANRRTMLS..LVQTNVFGQ
PPE68_MYCTU/5-161DKALAAAT-PMVVWL-QTAST-QAKTRAMQATAQAAAYTQAMATTPS.........LPEIAANHITQAV..LTATNFFGI
PPE65_MYCTU/7-163ASMVAAAT-PQVAWL-RSTAG-QAEQAGSQAVAAASAYEAAFFATVP.........PPEIAANRALLMA..LLATNFLGQ
PPE63_MYCTU/7-162RMMAAQAA-RHTGWL-AAAAT-QAEGAASQAQTMALAYEAAFAATVH.........PALVAANRALVAW..LAGSNVFGQ
PPE62_MYCTU/5-162AAMAAAAA-PYAGWL-SAAAA-RAAGAAAQAKAVASAFEAARAATVH.........PLLVAANRNAFAQ..LVMSNWFGL
PPE61_MYCTU/7-163VRMGAAVT-PYVEWL-TTTAA-QARQTATQITAAATGFEQAFAMTVP.........PPAIMANRAQVLS..LIATNFFGQ
PPE59_MYCTU/4-158DLMADAAG-RYLDWL-TKHSR-QILETAYVIDFLAYVYEETRHKVVP.........PATIANNREEVHR..LIASNVAGV
PPE49_MYCTU/7-164MSMAAAAS-PYVGWL-STVAS-QAQLAAIQARAAATAFEAALAATVH.........PTAVTANRVSLAS..LIAANVLGQ
PPE47_MYCTU/8-165ELFVAAYV-PYVAWL-VQASA-DSAAAAGEHEAAAAGYVCALAEMPT.........LPELAANHLTHAV..LVATNFFGI
PPE45_MYCTU/5-162ASMVAAVT-PYVAWL-SATAG-QAEQAGMQARAAAAAYELAFAMTVP.........PPVVVANRALLVA..LVATNFFGQ
PPE42_MYCTU/5-162LAMTRAAS-PYVGWL-NTAAG-QAAQAAGQARLAASAFEATLAATVS.........PAMVAANRTRLAS..LVAANLLGQ
PPE38_MYCTU/7-164VAMAGAAA-PYVGWL-SAAAG-QAELSAGQATAAATAFEAALAATVH.........PAAVTANRVLLGA..LVATNILGQ
PPE36_MYCTU/6-162QALIQQTL-PYVQWL-TTTAE-HAHKTAIQLTAAANAYEQARAAMVP.........PAMVRANRVQTTV..LKAINWFGQ
PPE29_MYCTU/6-161TSMASAAA-PYVAWM-SATAV-HAELAGAQARLAIAAYEAAFAATVP.........PPVIAANRAQLMV..LIATNIFGQ
PPE28_MYCTU/7-164AAMVDAAA-SYIGWL-STSAA-HAEGAAGLARAAVSVFEEALAATVH.........PAMVAANRAQVAS..LVASNLFGQ
PPE25_MYCTU/5-162LSMVAAAT-PYVAWL-SQAAA-RAEQAGMQAAAAAAAYEAAFVMTVP.........PPVITANRVLVMT..LIATNFFGQ
PPE24_MYCTU/5-162SAMAAAAA-PYAAWL-AAAAV-QAEQTAAQAAAMIAEFEAVKTAVVQ.........PMLVAANRADLVS..LVMSNLFGQ
PPE23_MYCTU/41-199DSMVAAVL-PFVGWL-STTAT-LAEQAAMQARAAAAAFEAAFAMTVP.........PPAIAANRTLLMT..LVDTNWFGQ
PPE22_MYCTU/5-162TLMVEAVA-PYVAWM-RATAI-QAEQAASQARAAAAAYETAFAAIVP.........PPLIAANRARLTS..LVTHNVFGQ
PPE21_MYCTU/5-162AAMTGVAA-SYARWL-TTAAA-QAEQAAGQAQAAVSAFEAALAATVH.........PGAVSANRGRLRS..LVASNLLGQ
PPE20_MYCTU/7-164EAFVAAYM-PFLAWL-IQASA-DCVEMAAQQHVVIEAYTAAVELMPT.........QVELAANQIKLAV..LVATNFFGI
PPE19_MYCTU/6-163GLMVAAAS-PYVAWM-SVTAG-QAELTAAQVRVAAAAYETAYGLTVP.........PPVIAENRAELMI..LIATNLLGQ
PPE17_MYCTU/6-159TIMAAAVA-PFRAWI-VTTAS-LAELVADHISVVAGAYEAAHAAHVP.........LPVIETNRLTRLA..LATTNIFGI
PPE14_MYCTU/6-162AAMAAAAT-PYVGWL-AATAA-LAKETATQARAAAEAFGTAFAMTVP.........PSLVAANRSRLMS..LVAANILGQ
PPE13_MYCTU/5-165AAMAAAAA-PYLSWL-NAATA-RAEGAAAGAKAAAAVYEAARAATAH.........PALVAANRNQLLS..LVLSNLFGQ
PPE12_MYCTU/6-163AAMANAAG-PYASWL-TAAGA-QAELAARQARAAAGAFEEALAGVVH.........PAVVQANRVRTWL..LAVSNVFGQ
PPE11_MYCTU/9-166ESFAAACL-PYLSWL-TQASA-DCAAAAARLEAVTAAYAAALVAMPT.........LAELAANHATHGA..MVATNFFGI
PPE04_MYCTU/8-165EWYVAAHL-PYVAWL-TQASA-DAAGAAAQHEAAAAAYTTALAAMPT.........LAELAANHVIHTV..LVATNFFGI
PPE03_MYCTU/6-163AAYVAAHA-PYLAWL-MRASE-TSAEAAARHETVAAAYTTAVAAMPT.........LVELAANHTLHGV..LVATNFFGI
PPE02_MYCTU/8-165AVYVAAHT-PYLAWL-VQASA-NSAAMATRQETAATAYGTALAAMPT.........LAELGANHALHGV..LMATNFFGI
PPE01_MYCTU/2-159TQYVAAHG-PYLAWL-EQTAI-NSAVTAAQHVAAAAAYCSALAAMPT.........PAELAANHAIHGV..LIATNFFGI
Q6MWW0_MYCTU/6-163AAMAAAAA-PYAGFL-TTASA-QAQLAAGQAKAVASVFEAAKAAIVP.........PAAVAANREAFLA..LIRSNWLGL
PPE54_MYCTU/5-162VAMAAAAA-PYAGWL-SAAAA-SAESAAGQARAVVGVFEAALAETVD.........PFVIAANRSRLVS..LALSNLFGQ
Q6MX48_MYCTU/6-162VAMARAVA-PYLGWL-ISATA-QAEQAAAQARVAVATFEAARAATVH.........PAIVAANRAVLVS..LVSSNLLGF
Q73SY4_MYCPA/8-165AAMMTVAN-QYVSWL-SAAAA-QAEEVSHQASAIATAFEVALAATVQ.........PAVVAANRALVQA..LAATNWLGQ
Q73UE9_MYCPA/6-161LAMTRALE-PYVDWL-RITAQ-QCQEIATSVQTATAAFELTHWTVVH.........PSLVAANRARLAM..LLATNFFGI
Q73V31_MYCPA/6-162RAMAAGAA-PYVGWL-HTTAE-RAQQTATQARAAAAAYELAHAMTVP.........PAAVAANRTQLAA..LVATNFFGQ
Q73WR0_MYCPA/6-163VAMAGAAA-PYFAWL-AEAGT-QAEEAAGQARAAAAAYEAAFGATVP.........PAVVTANRALFAQ..LVASNILGQ
Q73WR5_MYCPA/8-165GAYLAAHA-PYLAWL-ARAST-DSAAVAAQQEVAAAAYTAALAAMPT.........LPELAANHAAHAV..LTATNFFGI
Q73YZ0_MYCPA/8-165EQYVAAHA-PYHAWL-LESAA-KSSTAASLHETAAGAYTAALAAMPT.........LGELATNHAVHGA..LVATNFFGI
Q73ZS9_MYCPA/7-162AAMAAAAA-PYVAWL-SATSA-QARTAAEQATAAASAFESAFAAVVP.........PAEVATNRARLAM..LLASNVFGQ
Q73ZU5_MYCPA/7-163ASMASAVA-PYVGWM-STTAA-QAEEAASQARAAAAAFEAALAASVP.........PPVIAANRMQVSQ..LQATNVLGQ
Q741D9_MYCPA/6-160TAMAAAAA-PFIAWL-GGTAA-QAEQTAAQATA.AAAYDSVFAATVP.........PPVIAANRALLAS..LIATNVLGQ
Q745B0_MYCPA/8-172DRYVAAHM-PYLAWL-QLAGA-LSAEAAAQHQGVATAYTAALAAMPTLPELAAMPTLPELAANHATHAA..LVATNFFGV
Q79FE1_MYCTU/5-161MQLMEAAK-PFVRWL-TDLCV-QLSEVERQIHEIVRAYEWAHHDMVP.........LAQIYNNRAERQI..LIDNNALGQ
Q79FI8_MYCTU/5-162VAMAAAAA-PYAGWL-AAAAT-QAEQAATQAQVMVAEFEAVRLAMVQ.........PALVAANRSGLIS..LVISNLFGQ
Q79FI9_MYCTU/6-162AAMAAAVA-PYLGWL-AAAAA-QAQRSATQAAALVAEFEAVRAAMVQ.........PALVAANRSDLVS..LVFSNFFGQ
Q79FK6_MYCTU/5-162AAMAEAVA-PYVAWM-SAAAA-QAEQAATQARAAAAAFEAAFAATVP.........PPLIAANRASLMQ..LISTNVFGQ
Q7AQ23_MYCLE/8-164EAYVIAYL-PYLGWL-RQASV-DSAVMAAHYETMATAYITTLAMMPT.........LAELAANRTAHTV..LVTTNFFGI
Q7AQ89_MYCLE/6-161AALAERVT-PYEKWL-TQNAA-SAELTATQLTVAANAYETAFTMTVP.........PLMVFVNRAQACL..LIMSNIFGQ

PF00934

L0T3X8_MYCTU/1-93AVFSSYAQ-QYQALS-AAAAA.FHDQFVRALAAGAGAYAGAEAA------------------------------------
I6XHM5_MYCTU/1-93ALFGAHAQ-EYQRLS-AQAAG.FHAQFVQALNAGVNSYASAEAA------------------------------------
B2HSS6_MYCMM/1-93TLFGTHAA-EYQSLS-ARMAA.FHEQFVQTLTSGAGIYVSTEAT------------------------------------
B2HP29_MYCMM/1-93ALFSGHGQ-AYRAIS-AQAAA.FHDQFLRALTGAGGAYAAAEAA------------------------------------
B2HSA1_MYCMM/1-93ALFDEHAL-GYQTIS-AQASA.FHARFMSALNTGAGAYAAAEAA------------------------------------
B2HNN4_MYCMM/1-93ALFSEYGQ-GYQALS-AQAAE.FHTQFVQALTSNAGAYATAEAA------------------------------------
B2HMJ7_MYCMM/1-93SLFSASAQ-EYQMVS-TRAAH.LHAEFVHSLTRAGAAYAAAEAV------------------------------------
B2HT06_MYCMM/1-93TLFDNYAQ-GYQAVS-RQAAA.FHDAFAQTLFAASDSYVRAEAA------------------------------------
W5T943_9NOCA/4-89ATLTDVGV-SFDSSS-VMGVQ.ELRKLAATLRAQARGLTQMDAD------------------------------------
A0QQ41_MYCS2/3-92AGFSANGA-QQSAVA-AQGVE.ELGRSGVGVGESGVSYATGDAQ------------------------------------
B2HSA9_MYCMM/1-92SWFGGFAQ-EYQTAT-AQAGA.FHERFLQTLAASAASYEHAEAA------------------------------------
B2HHU3_MYCMM/1-93ALFSTHGL-QYQLAS-AQAAE.FHERFVLTLAADANTYLTTEIA------------------------------------
Q79FE6_MYCTU/1-93ALFGAHAQ-AYQALS-AHVAA.FHDQFVHTLTAGAGSYMAAEAA------------------------------------
V5X7I6_MYCNE/3-92AGLSAHGN-AHSAVA-ALAVE.ELGRAGLGVAQSGASYASGDAQ------------------------------------
B2HKR1_MYCMM/1-93GLFDAHAQ-AYQALS-AQALV.FHDQFVQMLNAGASSYAAAEAA------------------------------------
B2HRW8_MYCMM/1-93GFFGAHAQ-EYQAIS-ARVAT.YHQQFVQSLNGSAGAYAAADAA------------------------------------
B2HGK3_MYCMM/99-189ALFAGHAR-EYHSLS-GHFGA.FNQQFVQALNSASGAYASAEAQ------------------------------------
L0J9T2_MYCSM/1-92A.LGNAAD-TFEANA-AVAPE.SIEDFARRLQAVADNQEA....------------------------------------
L0J902_MYCSM/3-92ASLQAQGV-DHDAMA-AMGNF.QMAASSYGVAESGVSYATGDAE------------------------------------
Q79FA8_MYCTU/1-94PLFTAYGT-LYQQVS-AEAAA.VYDLFVKTLGVSAGTYAATEAA------------------------------------
B2HHP4_MYCMM/1-93SLFSGHAL-DYQNLG-ARMTA.FHDQFVAALTAGGGLYSSAEAA------------------------------------
B2HHQ4_MYCMM/1-93AVFSGHAQ-AYQAAS-AQAQV.FQRQFAQALAAGATSYAGAESA------------------------------------
B2HJI4_MYCMM/1-93GLLRLHGQ-QYQQFG-AHLSE.FHARFTQMLSAGANEYSLAEAA------------------------------------
B2HR24_MYCMM/1-93HLFGAYGQ-EFQALN-GRAAA.FHAELVRLLNGGAASYLSAEVV------------------------------------
WA22_MYCTU/1-93ALFGAHGR-AYQAAS-AEAAA.FHGRFVQALTTGGGAYAAAEAA------------------------------------
Q6MWV6_MYCTU/1-93ALFGAHAQ-AYQTIS-AQAAT.FHAQFVQTLSAGAGAYANAEAA------------------------------------
B2HIU2_MYCMM/1-93ALLAGHAQ-AYQRLG-AQVAM.FHQQFVQSLNVGAELYAAAEAA------------------------------------
B2HIS1_MYCMM/4-94RLFGSYAD-EFQTLS-AQATR.FQAQFERALSEAGAAYAAAEAA------------------------------------
B2HN04_MYCMM/1-93SFFGAYAR-DYQAFS-VQVEA.LHDQFVRAVTSGAASYAGAEAT------------------------------------
B2HN17_MYCMM/1-93ALFSDHAL-QYQAVS-AEAVA.FHGRFVQALTGGVQMYAAAETA------------------------------------
B2HHL8_MYCMM/1-93ALINSHGL-GYQSIS-QQTTA.FHDRFMQTVNAAAASYTTTDLT------------------------------------
D6ZBI2_SEGRD/2-92AQHMFNSD-NFLMMA-EQSIL.ELQRLIIALNEHAMEYTAQDAG------------------------------------
B2HLV0_MYCMM/1-93KVFGGYGL-SAQAVL-TQASA.FHDEFTELLANAGGIYAQAEVD------------------------------------
B2HK44_MYCMM/1-93AVFGEHGQ-AYQAFS-AQATA.FHADFVEALTTGVGSYAAAEAT------------------------------------
B2HPB9_MYCMM/1-93SLFGSHGQ-SFQAVS-LQAAA.FHERFVQTLFGGAAAYTAAEAA------------------------------------
B2HR25_MYCMM/1-93ALFGTFGQ-EYQAVS-AQAAS.FHESFVRVLSGAAASYVEAEVA------------------------------------
Q49724_MYCLE/4-91QVFSSYGK-QYEGYA-AQGVD.QSRLFVQSLKDAAGDYMDS...------------------------------------
B2HL21_MYCMM/3-92AVFGDYAR-QFQALS-ARAEQ.FHDQFVNTLRAAGYTYEDAEYT------------------------------------
B2HT85_MYCMM/1-93AVFSAHGQ-SYQTLS-AQAET.FHAQFVQALSAGASAYTQAEAA------------------------------------
B2HFK5_MYCMM/1-93AQFSGHGL-AYQQLS-TQVGV.FSDQFVAALSASASGYSAAEAA------------------------------------
B2HLZ6_MYCMM/3-94GFFSGHAQ-QFQTLS-AQASA.FHDQFVETLSGASGAYAAAEAA------------------------------------
PG10_MYCTU/1-93ALFGAQGQ-AYQAAS-AQAAA.FYAQFVQALSAGGGAYAAAEAA------------------------------------
B2HT63_MYCMM/1-93SLFAGHAQ-AYQSLG-GQVAA.FHQQFLEGLRGASGAYAAAEAA------------------------------------
B2HEI0_MYCMM/3-94TLFSEHAQ-SYQALS-AQMAA.FHDRFMNALAGASGSYASAEAA------------------------------------
B2HEE1_MYCMM/1-93GMFAAHAQ-AYQALS-TQADL.FHAQFVQLLNSGASAYTGAEAA------------------------------------
I6Y936_MYCTU/1-93ARFTAHTK-HYRVVS-KPAAL.VHGMFVALPAATADAYATTEAV------------------------------------
I6XEF1_MYCTU/1-93GLFGAHAR-QYQALS-VQVAA.FHEQFVQALTAAAGRYASTEAA------------------------------------
B2HJR4_MYCMM/1-93TLFSQHAH-AYQAAS-AQAAT.FQQRFVQALTAGASAYAGAESA------------------------------------
F5YWF5_MYCSD/2-87AALLASGS-EYLGIV-AEHSA.QRGLYSGAQSTAAGVYSATEA.------------------------------------
B2HJI6_MYCMM/4-90AAFAAEGA-QVLALN-TAAQD.ELARAGQALRQIAGMYSAVD..------------------------------------
K0JUJ1_SACES/21-110GTFSANAT-VALEVT-RKFII.ELDHNIEQLDNAAKTYRLVEDT------------------------------------
I6X486_MYCTU/1-93TFLVEYAR-KYRQTI-AAAAV.VLEEFAHALTTGADKYATAEAD------------------------------------
B2HN54_MYCMM/1-93ALFGTHAL-EYQAIS-TQLSV.FHEQFVQTLTNGVGAYSAAELV------------------------------------
B2HEE3_MYCMM/1-93FLFGAHAQ-AYQALS-AQAAS.FHQQFVQLMSGGATEYAAAEAA------------------------------------
B2HMC4_MYCMM/1-93ALFGWHAQ-TYQSLS-AQATS.FHDQFVQTLASSGTSYWSAEAT------------------------------------
B2HLJ4_MYCMM/1-93ALFGGHAQ-EYQALV-ARAEA.FHQQFVQLMTTGAGSYAAAEAA------------------------------------
PG46_MYCTU/1-93ALFGSYAQ-SYQAFG-AQLSA.FHAQFVQSLTNGARSYVVAEAT------------------------------------
B2HR55_MYCMM/1-93TLFGAHAQ-QYQSLG-SQMAA.FHDDFVRILASGSNLYATAEAT------------------------------------
B2HRG2_MYCMM/1-93AVFSGHGQ-AYQVLS-AQVAA.FHQRFVEALNAGAQSYVGAEAA------------------------------------
L7N680_MYCTU/1-93QLFGRYGQ-EFQTVS-NQLAA.FHTEFVRTLNRGAAAYLNTESA------------------------------------
B2HG27_MYCMM/1-93ELFGAYAR-GYQIIG-AQAAM.FHAEFVRALDIGAGAYWATEVA------------------------------------
B2HT93_MYCMM/1-93RVFGAYGR-DYQAFG-VQAAE.FHERFVQALRAGAGAYGAAEAA------------------------------------
B2HM39_MYCMM/1-93ALFSGHAL-DYQALS-TQMAG.FHQQFVTALNSAGASYAAAEAA------------------------------------
B2HIY5_MYCMM/1-93ALFGAHAQ-AYQALG-SHVTA.FHQEFVQALNSGAASYANAEAA------------------------------------
H6R6F2_NOCCG/4-93NHFNHAAL-THDRSI-AQAIL.ELHHAAAILRTQLAQYMAEDAM------------------------------------
Q79FP0_MYCTU/1-93ALFGAHGQ-TYQVLS-AQAAA.FHSQFVQALSGGAQAYAAAEAT------------------------------------
Q6MX26_MYCTU/1-93ALFGAHAR-SYQTLS-TQAAA.FHSRFVQALTTAAASYASVEAA------------------------------------
Q79FS8_MYCTU/1-86RLFNANAE-EYHALS-AQVAA.FQTLFVRTLTGGCGV.......------------------------------------
B2HN49_MYCMM/1-93ALFSGHAL-DYQALS-TQVAA.FHTQFVEAVTGAGNAYAAAEAA------------------------------------
Q79FD3_MYCTU/1-93ALFANYGR-EYQTLS-VRFAS.LDQQFAQALNSAAASYQTAEAT------------------------------------
B2HMF9_MYCMM/1-93ALFGTHAQ-EYQAIS-TRISA.LNERFVALLTAGNNSYAASESA------------------------------------
F5YTX3_MYCSD/1-93TQFAAYGQ-LYQQIS-AQAAA.IQEMFVNTLRTSADSYGSTETA------------------------------------
L7N6A7_MYCTU/1-84SLFARHAQ-AYQALS-LQATA.FHQQFVQALTGAGGAYAAAEAV------------------------------------
PG34_MYCTU/1-93DLFGAHAQ-AYQALS-AQAAL.FHEQFVHAMTAGAGAYAGAEAA------------------------------------
PG20_MYCTU/1-93ALFSGHGE-GYQAIA-RQMAA.FHDQFTLALTSSAGAYASAEAT------------------------------------
B2HM19_MYCMM/1-93ELFGNHAQ-QYQALS-AQIAR.FHDQFVRSLSGAAQTYASAEAT------------------------------------
F5Z3K2_MYCSD/1-93AQFAAHAS-MYQSIS-AQAEA.IHQAFVATLNSSANSYAATEAA------------------------------------
F5YVB3_MYCSD/1-93ALFSAHAQ-AYQEVS-AQAAA.IHEAFVRTLALSSESYAATEAV------------------------------------
B2HHN1_MYCMM/3-94KLFGGYAQ-QFQALG-AQASL.FHDQFVQALNGGGFLYAATEAA------------------------------------
Q79FV6_MYCTU/1-93ALFSSHGQ-QYQAMS-AQAAA.FHARFVQALAGAMGAYAAAEAA------------------------------------
B2HSI7_MYCMM/1-92ALFVAHGR-EYESLS-AQVAL.FHRRFVQMLAAASGGYAEAEAA------------------------------------
D6ZDG0_SEGRD/3-92SKLSAQGA-ERQISG-ATGVA.ELGSSSLGVAESGASYLEGDLA------------------------------------
B2HHB3_MYCMM/1-93ALFGANGV-EYQAIS-AQIAS.FHDRFVAALNTGTSSYVWAEAT------------------------------------
B2HT84_MYCMM/1-93ALFSFHGQ-SYQTLG-AQAEA.FHAQFAQLMANGAGTYASAEAA------------------------------------
G8RGS0_MYCRN/3-92AGLSAHGM-QHNTMA-AIGVE.ELGRSGIGVGESGTSYATGDAT------------------------------------
B2HK25_MYCMM/1-93SLFGAHAY-NYQVLS-AKAAE.FHDRFVEILQTSAQAYGSTEAT------------------------------------
B2HPB7_MYCMM/1-93TLLGGFGQ-QYQALA-GQLAT.AYDQLASKLAADAAAYLGAESA------------------------------------
B2HQP5_MYCMM/1-93ALFGAHGQ-SFQAVS-SQAAL.FHDQFVQALTTGASSYASAEAA------------------------------------
Q6MWY0_MYCTU/4-94ALFGTHAQ-EYQALS-ARVAT.FHEQFVRSLTAAGSAYATAEAA------------------------------------
B2HMC5_MYCMM/1-93ALFAAHAQ-GYQSIS-AQMSA.MHDQLVQTLSASSASYAGAEAS------------------------------------
L0TCB8_MYCTU/1-93SLFSGHAV-SYQQVA-AQATA.LHDQFVQALTGAGGSYALTEAA------------------------------------
B2HJ76_MYCMM/1-93ALFSSHAR-AYQALS-VQAGQ.FHQWFTQTLSGAGLSYASAEAA------------------------------------
Q9CCR0_MYCLE/4-91VGFNVHGC-QYVAMT-AHGAE.ELGRWGVGVAESGVSYALRDA.------------------------------------
B2HSR7_MYCMM/1-93ALFDAHAQ-AYQSLS-AQAAL.FHEQFVQALNAGAGSYALAEAA------------------------------------
J9RQ80_9ACTO/4-93ASFSAVAA-SFEKDT-ATGVL.EMRKIAAVLRAQAAGFIEGDA.------------------------------------
W5T6J3_9NOCA/5-92THLNEGAL-SHDRAV-AQAIL.ELHHAAAILRTQLASFIADDA.------------------------------------
A1T177_MYCVP/2-92VTFAAEGI-QTLGIN-ALAQE.EIARAGASIIEAAGAYQAVDAS------------------------------------
B2HQU6_MYCMM/1-93ALFGGFGR-EYQAVC-GQWAE.FEQRFARALGAGAGAYAGAEAA------------------------------------
B2HF24_MYCMM/3-92IGFSAHGV-EHVAVT-TEGIE.ELGRSGVGVGESGLSYASGDAA------------------------------------
Q5Z1M7_NOCFA/11-98QTMNQVAA-NYAENA-AAGVL.ELRKLAAVLRGQVDEFGRAED.------------------------------------
D5URB6_TSUPD/1-93AGSAAHAA-NYLAVT-VVDHA.AVAQYAVSLSAVAATYVAADNA------------------------------------
B2HN64_MYCMM/1-93TMLRNHGA-QYQALS-AQGAQ.VHQRIVQLLNSASGAYASAEAA------------------------------------
PG24_MYCTU/1-93SLFAAHGQ-AYQAVS-AQMSA.FHAQFVQTFTAGAGAYASAEAA------------------------------------
E9T269_COREQ/4-90GYFNRLAG-SFGAAT-SRGIE.ELAAAAAMLRAQAAAYREE...------------------------------------
B2HEC9_MYCMM/1-93ALFGAHAQ-TYQALS-AQAAT.FHAQFVQLMATSAGRYATAEAA------------------------------------
B2HEW9_MYCMM/1-93ALFSVHGQ-TYQQLS-AQAIT.FHEQFVRALSSAGGAYAAAEAA------------------------------------
Q79G04_MYCTU/1-93ALFSEYAR-ECQEVL-KQAAA.FHGEFTRALAAAGAAYAQAEAS------------------------------------
B2HN65_MYCMM/1-93ALLSSHGA-QYQALS-AQAAQ.FHQGFMQLLNSAGGAYAGAEAA------------------------------------
B2HDU1_MYCMM/1-93ELFGTYAR-DYQAIS-AQAAR.FHAEFVQAVNADAEWYSATEVA------------------------------------
B2HG78_MYCMM/1-93AHFAAHGA-MYQTLS-AQAQA.IHEMFVTTLQASGGSYAETEAA------------------------------------
Q6MX28_MYCTU/1-92ALFGTHAQ-EYQTVS-AQVAT.FHDRFVQTLSAAASSYVAAEAV------------------------------------
B2HLH8_MYCMM/1-94ALFTDHAQ-QYDVVL-REFLDGLQGGFGRTLDTAAKAYASAEAA------------------------------------
B2HFQ1_MYCMM/1-93ALFGSHAR-EYQAIS-AQSAA.FHERLVQTLRSGASAYLGTELA------------------------------------
B2HDH4_MYCMM/1-93ALFTAYGT-YYQQVS-ADAQA.MHDMFVNTLGASAGTYGATENL------------------------------------
PG35_MYCTU/1-93ALFARFGQ-EYQAVS-AQASA.FHQQFVQTLNSASGSYAAAEAT------------------------------------
B2HP80_MYCMM/1-93ALMSTHAQ-EYQLLG-GQLAT.YHDQLVQALDRTAGWYADAETG------------------------------------
B2HE92_MYCMM/1-93TLFAGFGQ-EYQAIS-TQLSA.FQQQFALTLNSSAGSYSAAEAQ------------------------------------
B2HEI9_MYCMM/1-93ARFSAHAQ-LYQMVS-AQAVA.IHDRFVAALAAGAQSYEAAEAA------------------------------------
F5YTX5_MYCSD/1-93AQFVAHAD-LYQSVS-AQANA.THQMFVTTLMTSAGSYEATEAA------------------------------------
F5YSC7_MYCSD/1-93ALFNANGA-LFQDVA-AQAAA.VHQMFVSTLNGGGMAYASTEAA------------------------------------
Q9CD31_MYCLE/3-91AGFSARGQ-EHALVA-AQGVE.ELGRAGIGVGQSSTHYAISDA.------------------------------------
B2HN11_MYCMM/2-90ALFGSHGQ-AFQALS-AQAEN.LHGQFVTTLNSSAFSYASAEAA------------------------------------
B2HN55_MYCMM/1-93SLFAGHAQ-EYQLLS-ARAAV.FYEQFVQALSTASGAYAAAEAA------------------------------------
B2HRC5_MYCMM/1-93AVFSGHAQ-AYQALG-AQVAA.FHDQLVTALDAAAGKYASAEVA------------------------------------
B2HR92_MYCMM/1-92QLFSAHAQ-DYQTLA-GQAAA.FHEQFVQNLTASATSYFGIDAA------------------------------------
B2HPR0_MYCMM/1-92SLFSECAQ-AYRVLS-IHAAD.FHGSFVQAVKCAAERYQAAEA.------------------------------------
B2HRI5_MYCMM/1-93AVFSGHAL-DYQALS-AQMAG.VHQRFVQALTASGSSYAAAEAA------------------------------------
B2HSE2_MYCMM/1-93SLFGTHAL-AYQAIG-AQAAT.FHDGFVQALSRAASRYAATEVA------------------------------------
B2HDQ4_MYCMM/1-93SLFSGHGQ-AYQRLA-NQLMA.FHDQFAQALTAGASAYTGAEAT------------------------------------
B2HLT8_MYCMM/1-93NLFSVYGR-ECQAVL-AQVEA.FRSEFAQTLAAAGVAYAQTEAA------------------------------------
B2HDQ3_MYCMM/1-93SVFSDHAL-SYQQVA-ARMAA.FHDQFVAALHSGAGAYLTAETA------------------------------------
Q79FV8_MYCTU/1-93ALFSAHGR-DFQALS-ARAAA.FHHEFVQALAAGAGSYAVAEIA------------------------------------
B2HR23_MYCMM/1-93QVFGAYGQ-EFQALN-AQAAA.FQAEFEGLLSGGAAAYVSAEAL------------------------------------
F5YV21_MYCSD/2-90AQFARHAQ-MYQAIS-KRAAV.VHERFVIMLQRNAQSYAATDAA------------------------------------
L7N697_MYCTU/1-93ELFGAHGQ-EFQALS-AQASA.FHDRFVRALSAAAGWYVDAEAA------------------------------------
Q79FW5_MYCTU/1-93ALFGAHAR-EYQAAA-AQAAA.YHEQFVHRLSAAATSYAVTEVT------------------------------------
B2HT01_MYCMM/1-92ELFGMYGR-DYQRIA-VEAAG.FHARVAALLGAGADSYGWAES.------------------------------------
F5YYX8_MYCSD/3-92AGFSAQGT-EHAAVA-AQGAT.ELGRAGVGVGESGVNYAAGDAA------------------------------------
B2HJR3_MYCMM/1-93ALFSGHAQ-AYQAAS-AQAAA.FGSRFVQALTSGAGAYTSAEAA------------------------------------
L7N6B5_MYCTU/1-93LFFSSHGQ-QYQVQA-ARGTA.FHRKLVRTLANGALAYEEVEIA------------------------------------
B2HIY0_MYCMM/1-93DVFSVFGE-DYQAFA-RQVEA.YHNAFVQTLTASANAYGHAEAD------------------------------------
B2HSW4_MYCMM/1-93ALFSGHGQ-AYQQIS-ARVAE.FHAQFERVLAAGAQAYSGAEAA------------------------------------
Q6MWW8_MYCTU/1-93ALFGMYGL-EYQAIS-AQVAA.YHQQFVQTLRTGAASYMLAEAT------------------------------------
I6YGS7_MYCTU/1-93SQFAAHAQ-LYQAIS-AEAMA.VQEQLATTLGISAGSYAATEAA------------------------------------
L7N6A1_MYCTU/1-93ALFGSHAQ-GYQTLS-AQLAA.YHNQFVRALNAGAGSYASAEAA------------------------------------
B2HJ40_MYCMM/1-93SLFSRYAQ-AYQVLG-ADMAA.IHDQFVQALNAGANWYAGVESA------------------------------------
B2HN52_MYCMM/1-93ALFGTHAQ-QYQAIS-AELAA.FHDRFVQSLNTGAGSYLRAEAA------------------------------------
Q79FR3_MYCTU/1-93AHFAAHAA-MYQSVS-ARAAA.IHDQFVATLASSASSYAATEVA------------------------------------
B2HLV1_MYCMM/1-93KLFGMFGQ-EYQSVV-AQASA.FQTEFTRLLATAGDSYAITEAS------------------------------------
B2HS54_MYCMM/1-93SLFTAHAQ-AYQGLS-VQVGA.FHNQFVQALTGAGGAYAAAEAA------------------------------------
PG33_MYCTU/1-93ALFSGHAQ-AYQALS-AQAAL.FHEQFVRALTAGAGSYAAAEAA------------------------------------
B2HS53_MYCMM/1-93ALFTGHAQ-AYQWLG-AQAGA.FHSQFIQALTGSGIAYAGAEAA------------------------------------
Q73SD0_MYCPA/1-93ALFDAHSQ-VYQALS-AQAAA.FHSQFVQLMNGGALQYAVTEAA------------------------------------
Q79FK9_MYCTU/1-93ALFGAHAR-AYQALS-AQAAM.FHEQFVRALAAGGNSYAVAEAA------------------------------------
B2HHV7_MYCMM/1-93ALFGANAQ-EYQAAA-AQAAT.FHEQFVRALSEAGASYASAEAT------------------------------------
B2HN68_MYCMM/3-94RMFGAYAQ-EFQTLS-ARMEQ.FHTDFVRALLTGAGAYSGAEAA------------------------------------
L7N661_MYCTU/1-93ALFSAYGR-EYQAVV-KQAAA.FHSEFTRTLEAAGNAYAHAEAA------------------------------------
B2HKK6_MYCMM/1-93TLLSGQGR-QYQAIS-VQVAA.FHAGFVQALGGAGGAYGAAERA------------------------------------
L7N659_MYCTU/1-93ALFGARAQ-AYQAIS-AQAAL.FHDRFVQILQEGAAAYAMAEAA------------------------------------
Q79FU2_MYCTU/1-92ALFGSHGQ-HYQAIS-AQVAA.YQQRFVLALSQAGSTYAVAEAA------------------------------------
B2HRZ1_MYCMM/1-93SLLGTHAQ-TYQTLS-AQVAA.FHRQLVAGLHSGAAAYTAAEAV------------------------------------
I6Y2J4_MYCTU/2-94ALFSGHGQ-DYQALS-AQLAV.FHERFVQALTGAAKGYAAAELA------------------------------------
I6YG87_MYCTU/3-92TQFRTHAA-TYQTAS-AKAAV.IHEQFVTTLATSASSYADTEAA------------------------------------
Q6MWW9_MYCTU/1-93ALFSQHAQ-GYQAAA-AQVAA.FHSRFVQALTAGAGAYAFAEAA------------------------------------
B2HR57_MYCMM/1-93HVFDTYAQ-EYQTFG-AHMAA.FHDQFVQTLKTGALAYTGAEAA------------------------------------
B2HIR9_MYCMM/1-94VMFGNHAQ-AYQAVS-AQAAA.FHDRFVQALTASAESYAGAEAA------------------------------------
Q741T4_MYCPA/1-93AIFSAYGT-QYQAIA-SEAQT.LLEQYSQTLGISSNSYGDTEAV------------------------------------
B2HR17_MYCMM/1-93AAFGSAAE-EFQELG-AQAAA.FHEQIVALLNTAAAAYAGAEAT------------------------------------
H6N0V6_GORPV/3-87ASATAVAD-RFAEDA-TSGIE.QLRNIAAMLRSHAGDLADAD..------------------------------------
B2HSX8_MYCMM/1-93ALFAAHGQ-AYQTLS-AQAAQ.FHDQFVAAMTSAAGAYSGAEAA------------------------------------
B2HEF1_MYCMM/1-93SLFADHAQ-DYRTIS-LEANA.FHQQFWRSLSGAAASYSGAEAA------------------------------------
B2HLL6_MYCMM/1-94AMFGNHAQ-AYQAVS-TQAAE.FHDRFVAALTAGADAYSSAEAS------------------------------------
B2HLH9_MYCMM/1-94QLFDGHGQ-AYQAIS-AQAAV.FHGRFVAALNAAADSYAGAEAA------------------------------------
A0QNJ3_MYCS2/1-92VAFASEGV-EALAAN-AFAQE.ELTRAGAAFAEIAGIYNAVDAA------------------------------------
Q79FB3_MYCTU/1-93ALFGMHGQ-AYQALS-VQASA.FHQQFVQALTAGAYSYASAEAA------------------------------------
B2HSU2_MYCMM/1-93AQFAAHAQ-MYQAVS-AQAAA.IHEMFVNTLATSSGSYAATEAA------------------------------------
B2HLT7_MYCMM/1-93KLFGGYAL-EYQSVI-GHVTA.FHEEFVRTLAAAGTAYAGAEAV------------------------------------
B2HJX1_MYCMM/1-93EFFGTYGK-QFQTFS-ARAAA.FHDEFVSLLRGGAAAYLDTEFA------------------------------------
B2HEZ0_MYCMM/1-93QLFGTHAQ-IYQRIS-AQAMA.FHDQFARSLSAASGSYANAEAT------------------------------------
PE23_MYCTU/1-93SIFGAYGR-QCQVLS-AQASA.FHDEFVNLLKTGATAYRNTEFA------------------------------------
Q79FP1_MYCTU/1-93TLFGSHAR-EYQAIS-TQVAA.FHDRFAQTLSAAVGSYVSAEAT------------------------------------
L7N656_MYCTU/1-93TQFNFHAA-MYQAVG-AQAIA.MNEAFVAMLGASADSYAATEAA------------------------------------
B2HM53_MYCMM/1-93ALFGSYAQ-GYQSLS-AQAAA.FHERFLQTLSGGAGAYAAAEAA------------------------------------
I6Y8K5_MYCTU/1-93AAFGAHGQ-AYQALS-AQAAT.FHIQFVQALTAGAGSYAAAEAA------------------------------------
B2HGS2_MYCMM/1-93ALFSGHGQ-AYQALS-AQANA.FHAQFLQALTNAGGAYAAAEVA------------------------------------
G8RMI5_MYCRN/1-92AVFAKEGV-ETLALN-TFAQE.ELSRAGAAYMEIAGIYEAVDGA------------------------------------
B2HS71_MYCMM/1-93TQFATHAA-MYQMVS-AKAAA.IHEHFAATLATSAASYLSTETA------------------------------------
Q79G08_MYCTU/1-93ALFSGHAQ-AYQALS-AQAAA.FHQQFVQTLAGGAGAYAAAEAQ------------------------------------
B2HLL1_MYCMM/1-93ALFGAHAH-SYQQLS-AQAAT.FHEQFVQTLATASRAYASAEAV------------------------------------
B2HIU5_MYCMM/1-93SFFAAHGQ-AYQAVA-GQVEA.FHTEFQQALAQAGNAYVQAEAA------------------------------------
B2HF28_MYCMM/5-95ALFEAHGN-AYQTLG-AQTLA.LHEQFVKLMSGGAAQYAAAEAA------------------------------------
F5YYX0_MYCSD/3-91AELSMQGS-QHEAVA-ARGTE.VLRRAGVGVAAAGANYHAADT.------------------------------------
Q79FD4_MYCTU/1-93ALFSAHAQ-EYQALS-AQAAA.FHDQFVHTLTAAARWYTATEIA------------------------------------
B2HJ59_MYCMM/1-93AQFAAHAR-VYQAIS-AQAAA.VQDQLVTVLGISAGSYAATEAA------------------------------------
L7N693_MYCTU/1-94ALLSAHAQ-GYQQLS-RQMMTAFHDQFVQALRASADAYATAEAS------------------------------------
V5X6V7_MYCNE/5-92LAFASEGA-QMAALN-AYAQQ.ELARAGAAYLEATGIYTTADAQ------------------------------------
F5YWS6_MYCSD/1-93ARFTTQAQ-HYQQVS-AQAAA.IHEMFVATLNGSASTYAAAEAA------------------------------------
B2HHZ9_MYCMM/1-93AFFSAHAA-DYQRLA-GQAAA.LHTQLERVLSAGAVAYAAAETT------------------------------------
D5UWF8_TSUPD/4-88RTTSEIGV-AQRALG-ETAVT.DLRVLGEALTRHA......DTV------------------------------------
B2HDT7_MYCMM/1-93AVFSTHAQ-AYQAAS-AQAQS.LGQRFAQALAAGAGSYSSAEAA------------------------------------
B2HP27_MYCMM/1-93TLFSSYGQ-AYQSLS-AQAAQ.FHSQFVQAMQAGAGSYATAEAS------------------------------------
B2HMV9_MYCMM/1-93ALFSQHAK-TYQLLA-AELAA.IPDRFTKTVLASANSYASAEAT------------------------------------
B1MEI5_MYCA9/25-113HASAKTNE-NFEKVA-KDGIE.QLKRIAEAFRRNSQAFVDLEHH------------------------------------
B2HNH3_MYCMM/1-93ACFEAQAE-AYQTFG-AHTAA.LHDQIVRALTAGAGGYSAVEAA------------------------------------
B2HFX6_MYCMM/1-93ALFSSHAQ-QYQSLS-VQVAA.YHDQFVRALAAGGASYSLAEAA------------------------------------
B2HNZ4_MYCMM/1-93ALFSDHAH-NYQALG-RQAAA.FHDQFVAALSAGGGGYGAAETA------------------------------------
B2HP93_MYCMM/4-94TLFCGYAR-DYQNLS-TQLAD.FHQQFLQALTGSANSYTAAEAA------------------------------------
B1MHU0_MYCA9/3-91ALFSAHGL-ERTGAG-ARAAY.ELGRSGVGATEAAASYTVGDI.------------------------------------
B2HS12_MYCMM/1-93AVFSAHGV-QYQAIS-AQMAQ.FHRQFAQALSAANRSYALAEAA------------------------------------
L0T2H7_MYCTU/1-93ALFEAYAQ-EYQALS-AQALA.FHDQFVQALNMGAVCYAAAETA------------------------------------
B2HDJ7_MYCMM/1-93TLFGTYGQ-TYQALA-AQAST.LHQQFENALTAAGSSYAGAEAA------------------------------------
Q6MWX5_MYCTU/1-92ALFGQHAQ-AYQALS-AQATI.FHDQFVQALTSGGNLYAAAES.------------------------------------
B2HSB5_MYCMM/1-93ALFGAHGQ-AYQELS-ARAAL.FHDEFVRVLSAGADAYASSEVA------------------------------------
B2HJB3_MYCMM/1-93ALFGAFGS-DYQAIS-AQAQA.FHEQLINLLTASGGAYLSAETA------------------------------------
Q79FR5_MYCTU/1-93MLFSMHGE-LYKAIA-RQAHV.IHESFVQTLQTSKTSYWLTELA------------------------------------
Q79FQ7_MYCTU/1-93SLFSGNAQ-AYQALS-AQAAA.FHQQFVRALSSAAGSYAAAEAA------------------------------------
A1T262_MYCVP/3-92TGFSARAA-EHQSVA-AQGVE.ELGRSGIAVGESAASYAGGDAM------------------------------------
B2HLD1_MYCMM/2-90AGFSAVGV-EHSAMA-TEGIE.ELGRSGVGVGEAGISYTVGD..------------------------------------
B1MAP1_MYCA9/3-91AGFSARGI-EHSGVA-AQAVE.ELGRAGLGVSESAASYTTGDM.------------------------------------
D0L2D2_GORB4/4-93TTFSAVAE-DFAADT-ATGVH.ELRKIAAVLRAQAHGFVEGDA.------------------------------------
B2HR45_MYCMM/1-93GLFSAHAK-QYQAFS-VQAAT.FHEQLVRSLAAGGFSYATAEAA------------------------------------
F6EE96_AMYSD/5-91RWSSSASS-SLNHRT-HAAVA.ELRAASGALAAIAADYSAND..------------------------------------
B2HLT9_MYCMM/1-93GLFGGYGQ-QYQAVV-AHAAA.FHQQFTQTVAAAGLAYAQTEAS------------------------------------
B2HLG6_MYCMM/1-93ELFGGFGR-EYQAVG-ARMAL.LHDDFVRALTAGGSAYGQAEAL------------------------------------
B2HT48_MYCMM/1-93AGFRAYGQ-AYQALS-TRAAD.VHARFVQALAAGADRYASAEAA------------------------------------
B2HLL3_MYCMM/1-94ELFGDHAQ-AYQVVS-AQAAA.FHQRFVVALAAAAGSYGRAESA------------------------------------
Q79FJ9_MYCTU/4-95ALFATHGQ-AYQELS-AHAVA.FHEQFVQLMSAGAAQYASAEAA------------------------------------
B2HLF8_MYCMM/4-92LAFTKHAG-QMLALN-QAAQE.ELRRAGEAVNAIARMYADTDVA------------------------------------
Q79FW8_MYCTU/1-93ALFSAHGR-AYQVAS-AQAAA.VHAQFVEALSAGAGAYASAEAA------------------------------------
B2HR85_MYCMM/1-93HLFSEHAE-DYQKVA-SQAAA.FHDRFAAQVNASAGGYASAEAA------------------------------------
PE15_MYCTU/3-91VEFSVHGS-QHVAMA-AQGVE.ELGRSGVGVAESGASYAARDA.------------------------------------
Q79FL8_MYCTU/1-93RLFGAYGQ-QFQALN-ARAAT.FHAEFVSLLNGGAAAYTGAEAA------------------------------------
Q6MX17_MYCTU/3-92VGFSALGS-EHAAIA-GEGVE.ELGRSGVAVGESGIGYAAGDAV------------------------------------
Q79FP3_MYCTU/1-93SLFSGYAR-DYQALS-AQMAR.FHQQFVQALTASVGSYAAAEAA------------------------------------
B2HPP6_MYCMM/3-92VVFSAQGG-ERALVG-VQGVD.ELARSGVGVAESGADYAARDAM------------------------------------
B2HHC0_MYCMM/1-93SLFAEHGQ-GFQHLC-GEAAA.FHSRFVQALGGAGSAFAASEAT------------------------------------
H6MY81_GORPV/1-91TTMGQVHQ-TFRKAG-DGGVA.ELREISDAVATVSSSLADTDT.------------------------------------
B2HR22_MYCMM/1-93QLFGAHGQ-EFQVVS-AQLRG.FHDQLVRLMRAGAAAYASVEAT------------------------------------
B2HRA3_MYCMM/1-93ALFAGHAQ-AYQALS-TAAST.FHTQFVRALNLSGGAYAAADAA------------------------------------
B2HEZ3_MYCMM/1-93TLFGSYAQ-EYQTLS-ARAAA.FHDEFVSVLKGSGAAYLSAEVA------------------------------------
B2HI03_MYCMM/1-93ALFGVHGL-EYQHIS-AQAAA.YHEQFIQAMQGGARSYAWAEAA------------------------------------
Q6MX50_MYCTU/1-93ALFSSHAQ-AYQAAS-AQAAA.FHAQVVRTLTVDAGAYASAEAA------------------------------------
Q79FV3_MYCTU/1-93SLFSGHAQ-AYQTLG-TQAAA.FHERFIQALSTAAGAYGSAEAA------------------------------------
F5Z171_MYCSD/1-93VQFANHGQ-SYQAVS-TQAVA.VHEMFVNALSNGANAYAATEAA------------------------------------
B2HGB4_MYCMM/1-93GLFRGLGQ-DYQLFG-AQLEQ.FHQRFVQILDAARTAYLETETA------------------------------------
Q79FU3_MYCTU/1-92ALFSSYAR-DYQTLS-VQVTA.FHVQFAQTLTNAGQLYAVVDV.------------------------------------
P71664_MYCTU/1-93ALFSGHAQ-TYQALR-TQAAA.FHQQIVQTLTSTAGAYASAEAA------------------------------------
B2HPP0_MYCMM/1-93KLFSAYGQ-ECQAVI-TDAAV.FHDHFAATLAAAGSVYTQAEAA------------------------------------
B2HLJ3_MYCMM/1-93SLFAGYGQ-AYQSIS-LQANA.FQAQFIQAINGAGGAYAAAEAA------------------------------------
Q6MWW6_MYCTU/1-93ALFGGFGL-EYQAIS-AQVAA.YHQRFVQALSTGAGAYASAEAA------------------------------------
B2HLV2_MYCMM/1-93KVFSAYGQ-EYQAAI-AQASA.FHTEFTRALAAAGAAYAQAEAA------------------------------------
B2HI17_MYCMM/2-92TLFACYGQ-TYQTLG-IAAAR.FHDEFVGNLRAAATSYASAEAT------------------------------------
B2HSB1_MYCMM/1-93ALFSSHGE-IYQRLS-SQLST.FHDQFAAALNTSANSYASAEAN------------------------------------
Q7AQ88_MYCLE/4-94HFFSGHGR-QYQAHA-SQGAT.NHQDLIQSLLTSSSAYAGTETA------------------------------------
PG44_MYCTU/1-93RLFSDYAT-HYQSLN-AQAAA.FHHSFVQTLNAAGGAYSSAEAA------------------------------------
Q79G06_MYCTU/40-131TLFGAYGQ-QFQAIS-AQVAA.FHNEFTQRLAAAANAFVNAEAT------------------------------------
B2HMF4_MYCMM/1-93ALFNAHAE-QYQALS-VRVAE.LHESFTRALTAGSTAYATAEAA------------------------------------
B2HP28_MYCMM/1-93ALFDAQGQ-AYQLLS-ARAAT.FHEQFLQALSGGGASYAAAEAA------------------------------------
Q79FT0_MYCTU/1-93SLFGAHGQ-AYQAVS-AQMSA.FHAQFMQALTGAGGAYAAAEAV------------------------------------
Q79FT3_MYCTU/1-93ALFSAHAG-QYQQLG-ARAAL.FHEQFVQALTGAASAYASAEAT------------------------------------
B2HLU0_MYCMM/1-93QLLGTFGA-EYQGIS-TQLAA.FHAQIAQRLATVANYYINAEEI------------------------------------
L7N681_MYCTU/1-93AMLGAYAR-DFQGIS-AQIAG.FHNQFVGALRGGAAAYASAEAA------------------------------------

PF10817

Q73RU9_MYCPA/1-104SAVVVAHE-QHVQNL-QAHSE-TLTGVGTKAHHAANGFTNMDQQNATEMRALRPSSSP----------------------
B2HNS0_MYCMM/1-104NGVHSAHA-QHVRNL-QAHQE-ALTAVGSNAHLAAKGFTAMDEHNAEALQAVRWSAGT----------------------
Y2078_MYCTU/1-104DAVGAAHA-QQMRNL-HAHRQ-ALITVGEKARHAATGFTDMDDGNAAELKAVVCSCAT----------------------

PF06013

Q97MZ9_CLOAB/4-89-------------------------------------------
A9B0A6_HERA2/4-89-------------------------------------------
Q81TJ4_BACAN/3-88-------------------------------------------
Q81R67_BACAN/3-88-------------------------------------------
Q81R60_BACAN/6-91-------------------------------------------
Q97LZ0_CLOAB/3-88-------------------------------------------
Q8ERJ1_OCEIH/4-89-------------------------------------------
Q81HA0_BACCR/6-91-------------------------------------------
A3CR39_STRSV/3-88-------------------------------------------
A8FGZ8_BACP2/4-89-------------------------------------------
Q65FF4_BACLD/4-90-------------------------------------------
Q5WK78_BACSK/4-89-------------------------------------------
A3DD43_CLOTH/4-90-------------------------------------------
Q9KE84_BACHD/3-88-------------------------------------------
Q97LY9_CLOAB/4-91-------------------------------------------
Q97LY7_CLOAB/15-100-------------------------------------------
Q97MZ8_CLOAB/5-90-------------------------------------------
Q97KJ1_CLOAB/6-91-------------------------------------------
Q97MZ2_CLOAB/6-93-------------------------------------------
Q97M02_CLOAB/3-88-------------------------------------------
Q9L0T5_STRCO/28-115-------------------------------------------
A6WCP9_KINRD/3-90-------------------------------------------
Q6ACE0_LEIXX/8-95-------------------------------------------
A1T456_MYCVP/3-88-------------------------------------------
Q73SS3_MYCPA/16-101-------------------------------------------
A0QTK0_MYCS2/4-90-------------------------------------------
A1SN44_NOCSJ/4-90-------------------------------------------
Q5YN04_NOCFA/7-92-------------------------------------------
Q5YRS3_NOCFA/4-91-------------------------------------------
O86644_STRCO/7-92-------------------------------------------
Q82K72_STRAW/7-92-------------------------------------------
ES6LX_MYCLE/3-88-------------------------------------------
Q5Z1J3_NOCFA/4-90-------------------------------------------
Q73TD4_MYCPA/3-88-------------------------------------------
ESXR_MYCLE/3-88-------------------------------------------
Q6NJ54_CORDI/3-88-------------------------------------------
Q8NST7_CORGL/3-88-------------------------------------------
A1SDG6_NOCSJ/5-90-------------------------------------------
Q8G878_BIFLO/3-88-------------------------------------------
A1A0W4_BIFAA/3-88-------------------------------------------
A6WE48_KINRD/3-88-------------------------------------------
A1R3I1_ARTAT/3-88-------------------------------------------
A0JT10_ARTS2/3-88-------------------------------------------
A0LR18_ACIC1/3-88-------------------------------------------
A5UYZ8_ROSS1/3-88-------------------------------------------
A5UYZ9_ROSS1/3-88-------------------------------------------
A5UZ07_ROSS1/3-89-------------------------------------------
Q6NJ55_CORDI/4-89-------------------------------------------
Q73S33_MYCPA/6-92-------------------------------------------
ES6LY_MYCLE/5-91-------------------------------------------
O05453_MYCTU/4-91-------------------------------------------
A9B1N8_HERA2/5-91-------------------------------------------
A9B0B5_HERA2/5-92-------------------------------------------
A9B2P0_HERA2/5-91-------------------------------------------
A9B726_HERA2/5-91-------------------------------------------
A9B720_HERA2/5-92-------------------------------------------
A9B8D4_HERA2/5-92-------------------------------------------
A9AUV8_HERA2/5-92-------------------------------------------
A9AUW0_HERA2/5-92-------------------------------------------
A9B561_HERA2/5-92-------------------------------------------
A9B6G5_HERA2/5-91-------------------------------------------
Q5YRS2_NOCFA/6-91-------------------------------------------
Q5ARS9_EMENI/25-110-------------------------------------------
O86643_STRCO/16-101-------------------------------------------
Q5YU75_NOCFA/7-92-------------------------------------------
A0QNJ5_MYCS2/3-88-------------------------------------------
ESXB_MYCLE/3-88-------------------------------------------
A4FPH3_SACEN/3-88-------------------------------------------
Q5Z1J2_NOCFA/6-93-------------------------------------------
A5A655_BACLD/2-80-------------------------------------------
B0RAY2_CLAMS/4-88-------------------------------------------
B2HDH7_MYCMM/3-87-------------------------------------------
B2HNR7_MYCMM/7-90-------------------------------------------
B8DTZ3_BIFA0/3-87-------------------------------------------
ES6LD_MYCTU/7-90-------------------------------------------
ESXR_MYCTU/3-87-------------------------------------------
ESXK_MYCTU/5-90-------------------------------------------
ESXB_MYCTU/3-88-------------------------------------------
ESXA_MYCTU/5-87-------------------------------------------
Q2G182_STAA8/7-92-------------------------------------------
Q2G189_STAA8/4-88-------------------------------------------
Q81B80_BACCR/10-88-------------------------------------------
Q8E1X1_STRA5/3-88-------------------------------------------
Q8NST8_CORGL/6-89-------------------------------------------
Q8YAQ4_LISMO/4-89-------------------------------------------
Q8YAR0_LISMO/4-89-------------------------------------------
Q9X367_BACAN/4-89-------------------------------------------

PF10824

A0R672_MYCS2/1-104-------------NIDT--------------------------
A4FPN7_SACEN/1-99-------------MLGE--------------------------
Q744T9_MYCPA/1-99-------------KFGS--------------------------
A0QNK5_MYCS2/1-100-------------DLDG--------------------------
A1TH04_MYCVP/1-103-------------DVSA--------------------------
A0QSQ2_MYCS2/3-102-------------RVGG--------------------------
Y406_MYCLE/4-103-------------DIKS--------------------------
Q5Z2J0_NOCFA/9-106-------------AIQN--------------------------
A0R2G1_MYCS2/1-98-------------DLKK--------------------------
A1TDN8_MYCVP/1-99-------------AIRT--------------------------
A0QQE6_MYCS2/1-94-------------KLDD--------------------------
A0R605_MYCS2/34-130-------------ALDS--------------------------
Q5YTI6_NOCFA/5-105-------------QLNV--------------------------
A1T2U3_MYCVP/1-103-------------NIDG--------------------------
A1T184_MYCVP/1-96-------------AIDG--------------------------
A0QNI6_MYCS2/1-100-------------ALDE--------------------------
B2HES8_MYCMM/2-99-------------SLDK--------------------------
B2HT35_MYCMM/1-99-------------ILD.--------------------------
ESPF_MYCTU/1-100-------------VIDK--------------------------
ESPC_MYCTU/1-100-------------AIDG--------------------------
Y027_MYCTU/1-98-------------SLG.--------------------------

PF00823

Q743Z9_MYCPA/26-174NTPA.......IADVEA.QY.GEMWAQDTAAMYGYALASAAAS
Q73UE8_MYCPA/5-161NTAA.......IAETEN.EY.QTMWANNSAALSRYQAASSQAT
PPE58_MYCTU/4-169KHSSNRRPRGTIRAVPGRKYPSNGPLSKLDPICAIEAAPMAGA
Q0S9F2_RHOSR/145-301LNGT.......AAAAEA.AD.RAMDIRAGLVMEGYEAASNILA
Q73WQ9_MYCPA/13-170NAPA.......IAATES.CY.AEMWAQDATAMYGYAAASSAAT
Q741D6_MYCPA/5-161LSPA.......VADADA.DY.ERMWAQDAAAMYAYARASAGVW
Q73TJ3_MYCPA/8-165NTIP.......IAVNEA.DY.ARMWVQAATTMTTYQAVSTAAV
Q6MWX8_MYCTU/5-162NTPA.......IAAAEA.EY.ELMWAADVAAMAGYHSGASAAA
A0QNJ4_MYCS2/4-161NTVP.......IALNEM.DYFVRMWNQAAGAMDVYHAETTVNL
Q73ZT3_MYCPA/6-163NTPA.......IAATEA.HY.MEMWAQDAAAMYAYAASSASAA
Q73ZT6_MYCPA/6-163NTPA.......IATTEA.EY.GQMWAQDAAAMNGYAVASTAAT
Q741X1_MYCPA/30-187NAAA.......IAATEA.EY.AEMWAQDAAAMYEYAAGSAAAC
Q73ZT2_MYCPA/5-162NTAA.......IAANEA.QY.GEFWAQDATAMDTYFAASATAA
Q5Z3L3_NOCFA/10-166VSGA.......FEAAEL.AK.HAMDLRAALVMETYEAATTAVV
Q73ZT0_MYCPA/5-162NTAA.......IAAAEA.EY.AEMWAQDAAAMYAYAAASAAAT
Q73TD6_MYCPA/11-168NTIP.......IAVNEA.DY.ARMWVQAATTMGTYQAVAGSAL
Q73ZT5_MYCPA/6-163NAGL.......IAANEA.QY.GDMWAQDAAAMTGYASASNAAT
Q73TI1_MYCPA/8-165NTIP.......IALNEA.DY.ARMWVQAATTMSTYQTVSTSTL
Q741D8_MYCPA/8-165NDAA.......IAATED.EY.GQMWAQDVAAMFSYAAASESAG
PPE37_MYCTU/8-165NTIP.......IALNEA.DY.LRMWIQAATVMSHYQAVAHESV
Q73Y22_MYCPA/7-164NTAA.......IAQTEL.EY.VEMWLRDVAAMLGYHAGAQSAA
SRA_MYCLE/6-163VSTT.......VAALEA.DY.DLMWVQNSTAMTTYRDTVLRET
Q73U78_MYCPA/14-171NTIP.......IAVNEA.DY.ARMWVQAAGTMATYQAVSTAAV
Q745G2_MYCPA/8-167LTPR.......IASLEL.EYYGSMWPNNSAVGASYGAVLTALA
Q73V32_MYCPA/5-161NTAA.......IADTEA.QY.ADFWAQDTAAMAGYSASSTAAT
Q741E7_MYCPA/8-165NTIP.......IAQNEI.EY.LQMWLQAATTMAIYEAVSETAM
Q5Z1M6_NOCFA/16-174IRAV.......AAETDA.DA.DVAKAAASRVMRAYEAATEPLA
B2HCX8_MYCMM/6-162NSAA.......IAAAEA.QY.GEMWSQDAATMYAYAASCATAT
B2HD13_MYCMM/6-163NAPA.......IMAAEG.QY.EQMWAQDVAAMVGYHGGASSAA
B2HD24_MYCMM/5-162NAPA.......IAAAEG.SY.EQMWAADVAAMLGYHGGASAAA
B2HDB1_MYCMM/8-164NGVP.......IAVNEA.DY.VRMWIQAAGVMGVYESCTSAAL
B2HDH5_MYCMM/5-160NTPA.......IMATEA.LY.AEMWAQDAGAMYGYAAASST..
B2HDM3_MYCMM/6-163NSPA.......IAATEA.AY.SEMWAQDALAMYDYAANSASAC
B2HEI4_MYCMM/9-165NTVP.......IAVNEA.DY.ARMWVQAATAMSAYDAASTVFA
B2HEJ0_MYCMM/7-164NTPA.......IETLQA.EY.AEMWAQDAAVMYQYSAASEAAS
B2HF23_MYCMM/8-160NVAP.......IALNEA.DY.VRMWIQAAGVMGVYQACS....
B2HF25_MYCMM/2-159NTIP.......IALNEA.DY.ARMWVQAATVMSVYQAGSTAAL
B2HGH9_MYCMM/6-162NTAA.......IEATEA.EY.AEMWAQDAGAMYDYAATSAMAT
B2HH63_MYCMM/8-161NTIP.......IAVNEM.DY.VRMWVQAAAVMGTYQMITQ...
B2HIP7_MYCMM/8-164NTVP.......ITVNEA.DY.ARMWVQAATTMGAYQVISGTAL
B2HJ58_MYCMM/7-163NTPA.......IAVVEA.EY.AEMWAQDANAMYQYAATAAAAA
B2HJQ8_MYCMM/6-154ASPV.......IAELEA.EY.DRVWVHCADAVHDFAGALA...
B2HJR0_MYCMM/5-161NSPA.......IATTEA.NY.EQMWAQDAAAMYGYAGACASAT
B2HKM4_MYCMM/2-159NAIP.......IALNEA.DY.VRMWIQAAETMTTYQAVSEVAA
B2HKT3_MYCMM/8-165NTPA.......IAVTEA.QY.AEMWAQDAAAMYGYAASSATAT
B2HKX5_MYCMM/9-166NVPA.......IAATEA.RY.GEMWAQDASAMYGYAASCAGAV
B2HLK3_MYCMM/7-162NAPA.......IAAVET.DY.EEMWAQDVTAMVGYHSTSSAAA
B2HN16_MYCMM/9-165NTIP.......IALNEV.DY.VRMWIQAATTMSVYQAVAADAL
B2HNW0_MYCMM/10-165NTIP.......IAANEA.DY.VRMWIQAATTMSTYQAVSAAAV
B2HNW7_MYCMM/11-168NAIP.......IALNEA.DY.VRMWVQAATTMGLYQATAGAAL
B2HQQ1_MYCMM/8-165NTPA.......IMDIEA.AY.EQMWALDVAAMAAYHAEASAAA
B2HRG4_MYCMM/5-161NFPA.......IAAAEG.LY.EEMWAQDVAVMSGYHATVSEI.
B2HRT7_MYCMM/5-162YTAE.......IASLEA.QD.AEMWAQDARAMYTYAGSSASAT
B2HS07_MYCMM/5-162NAPA.......IAATEA.VY.EQLWAQDVAVMAGYHAGVSAIA
B2HS70_MYCMM/6-162NTPA.......IATTEA.EY.GEMWAQDAAAMYGYAGSAAMLA
B2HSM7_MYCMM/5-162NAPA.......IAAVEA.EY.EQMWALDVSTMATYHAGASAAA
B2HSS2_MYCMM/8-165NTIP.......IALNEA.DY.VRMWVQAATTMGVYDAISAVAL
B2HST8_MYCMM/6-163NTPA.......IAATEA.QY.MEMWAQDAAAMYSYAGSSALAT
B2HSU0_MYCMM/7-164NNGV.......IAQLEA.QY.AEMWAQDASAMYNYAASSALAT
B2HSV2_MYCMM/10-166NTPA.......IAAVEA.QY.CEMWAQDAMAMYGYAGSSAAAT
B2HSV3_MYCMM/6-163NTPA.......IAAAEA.QY.LEMWAQDAAAMYAYAGTAAAAS
B2HSV4_MYCMM/5-162NTAA.......IAAAES.QY.AEMWAQDATAMDGYASSSAAAS
B2HT04_MYCMM/5-162NAPA.......IAATES.TY.EELWAQDVAAMVGYHGGASAVA
B2HT05_MYCMM/5-162NAPA.......IALTEA.AY.DQLWAQDVAAMAGYHSGASAVA
I6X6H8_MYCTU/5-162NAPL.......IAAAEG.VY.EEMWAADVAAMSGYYSGASAIA
I6Y7L4_MYCTU/5-162NAPA.......IAATEA.AY.EQMWAQDVAAMFGYHAGASAAV
L0T6B3_MYCTU/5-162NTPA.......IATSET.HY.GEMWAHDILAMDGYAGASGAAS
PPE68_MYCTU/5-161NTIP.......IALTEM.DYFIRMWNQAALAMEVYQAETAVN.
PPE65_MYCTU/7-163NTAA.......IAATEA.QY.AEMWAQDAAAMYGYAGASAAAT
PPE63_MYCTU/7-162NTPA.......IAAAEA.IY.EQMWAQDVVAMLNYHAVASAV.
PPE62_MYCTU/5-162NAPL.......IAAVEG.AY.EQMWAADVAAMVGYHSGASAAA
PPE61_MYCTU/7-163NTAA.......IAALET.QY.AEMWEQDATAMYDYAATSAAA.
PPE59_MYCTU/4-158NTPA.......IAGLDA.QY.QQYRAQNIAVMNDYQSTARF..
PPE49_MYCTU/7-164NTPA.......IAATEF.DY.LEMWAQDVAAMVGYHAGAKSVA
PPE47_MYCTU/8-165NTIP.......IALNEA.DY.VRMWVQAATVMSAYEAVVGAAL
PPE45_MYCTU/5-162NTPA.......IAATEA.QY.AEMWAQDAAAMYAYAGSAAIAT
PPE42_MYCTU/5-162NAPA.......IAAAEA.EY.EQIWAQDVAAMFGYHSAASAVA
PPE38_MYCTU/7-164NTPA.......IAATEF.DY.VEMWAQDVGAMVGYHAGAAAVA
PPE36_MYCTU/6-162FSTR.......IADKEA.DY.EQMWFQDALVMENYWEAVQEAI
PPE29_MYCTU/6-161NTPA.......IMMTEA.QY.MEMWAQDAAAMYGYAGSSATAS
PPE28_MYCTU/7-164NAPA.......IAALES.LY.ECMWAQDAAAMAGYYVGASAVA
PPE25_MYCTU/5-162NSAA.......IAVAEA.QY.AEMWAQDAVAMYGYAAASASAS
PPE24_MYCTU/5-162NAPA.......IAAIEA.TY.EQMWAADVSAMSAYHAGASAIA
PPE23_MYCTU/41-199NTPA.......IATTES.QY.AEMWAQDAAAMYGYASAAAPAT
PPE22_MYCTU/5-162NTAS.......IAATEA.QY.AEMWAQDAMAMYGYAGSSATAT
PPE21_MYCTU/5-162NAPA.......IAAVEA.VY.EQMWAADVAAMLGYHGEASAVA
PPE20_MYCTU/7-164NTIP.......IAINEA.EY.VEMWVRAATTMATYSTVSRSAL
PPE19_MYCTU/6-163NTPA.......IAVNEA.EY.GEMWAQDAAAMFGYAATAATAT
PPE17_MYCTU/6-159HTPA.......IFALDA.LY.AQYWSQDGEAMNLYATMAAAAA
PPE14_MYCTU/6-162NSAA.......IAATQA.EY.AEMWAQDAAVMYSYEGASAAAS
PPE13_MYCTU/5-165NLPA.......IAATEA.SY.EQLWAQDVAAMVGYHGGASTVA
PPE12_MYCTU/6-163NAPA.......IAAMES.TY.EQMWAQDVAVMAGYHAASSAAA
PPE11_MYCTU/9-166NTIP.......IAVNEA.DY.VRMWLQAATTMATYQAVADSAV
PPE04_MYCTU/8-165NTIP.......ITLNEA.DY.VRMWLQAAAVMGLYQAASGAAL
PPE03_MYCTU/6-163NTIP.......IALNEA.DY.ARMWTQAASTMATYQAVAEAAV
PPE02_MYCTU/8-165NTIP.......IALNES.DY.ARMWIQAATTMASYQAVSTAAV
PPE01_MYCTU/2-159NTVP.......IALNEA.DY.VRMWLQAADTMAAYQAVADAAT
Q6MWW0_MYCTU/6-163NAPW.......IAAVES.LY.EEYWAADVAAMTGYHAGASQAA
PPE54_MYCTU/5-162NTPA.......IAAAEF.DY.ELMWAQDVAAMLGYHTGASAAA
Q6MX48_MYCTU/6-162NAPA.......IAATEA.AY.ERMWAQDVAAMVGYHAGASAAV
Q73SY4_MYCPA/8-165NTPA.......IADIEA.AY.EQMWASDVAAMFGYHADASAAV
Q73UE9_MYCPA/6-161NYPA.......IAETEA.EY.HAMWVNNSAAMYRYAATSATAV
Q73V31_MYCPA/6-162NTAA.......IAATEA.QY.AEYWAQDAAAMYAYSASSAAAA
Q73WR0_MYCPA/6-163NTAA.......IGEAEG.AY.AEMWAQDAAAMYGYAAASSGAT
Q73WR5_MYCPA/8-165NTIP.......IAVNEA.DY.ARMWVQAATVMGTYQDVAAAAL
Q73YZ0_MYCPA/8-165NTIP.......IAVNEA.DY.ARMWVQAATTMSTYQAVSQSAL
Q73ZS9_MYCPA/7-162NSAA.......IAAAEA.EY.GQMWAQDAAAMFGYASASAAAT
Q73ZU5_MYCPA/7-163NTPL.......IAQFEA.QY.GEYWAQDAAAMYSYAGQSASAS
Q741D9_MYCPA/6-160NTPA.......IAATEA.HY.AEMWAQDAAAMYAYAGASAVAT
Q745B0_MYCPA/8-172NTIP.......IAVNEA.DY.ARMWTQAATTMTTYQATTEAV.
Q79FE1_MYCTU/5-161FTAQ.......IADLDQ.EY.DDFWDEDGEVMRDYRLRVSDAL
Q79FI8_MYCTU/5-162NAPA.......IAAAEA.AY.EEMWALDVSAMAAYHSGASAVA
Q79FI9_MYCTU/6-162NAPA.......IAAIEA.AY.EQMWAIDVSVMSAYHAGASAVA
Q79FK6_MYCTU/5-162NTSA.......IAAAEA.QY.GEMWAQDSAAMYAYAGSSASAS
Q7AQ23_MYCLE/8-164NTIP.......IARNEI.DY.VRMWVEAAIAMGTYQEVSTVV.
Q7AQ89_MYCLE/6-161NSTA.......IAEKEA.EY.TEMWIQDAAAMTSYQASVLEA.

PF00934

L0T3X8_MYCTU/1-93-------------------------------------------
I6XHM5_MYCTU/1-93-------------------------------------------
B2HSS6_MYCMM/1-93-------------------------------------------
B2HP29_MYCMM/1-93-------------------------------------------
B2HSA1_MYCMM/1-93-------------------------------------------
B2HNN4_MYCMM/1-93-------------------------------------------
B2HMJ7_MYCMM/1-93-------------------------------------------
B2HT06_MYCMM/1-93-------------------------------------------
W5T943_9NOCA/4-89-------------------------------------------
A0QQ41_MYCS2/3-92-------------------------------------------
B2HSA9_MYCMM/1-92-------------------------------------------
B2HHU3_MYCMM/1-93-------------------------------------------
Q79FE6_MYCTU/1-93-------------------------------------------
V5X7I6_MYCNE/3-92-------------------------------------------
B2HKR1_MYCMM/1-93-------------------------------------------
B2HRW8_MYCMM/1-93-------------------------------------------
B2HGK3_MYCMM/99-189-------------------------------------------
L0J9T2_MYCSM/1-92-------------------------------------------
L0J902_MYCSM/3-92-------------------------------------------
Q79FA8_MYCTU/1-94-------------------------------------------
B2HHP4_MYCMM/1-93-------------------------------------------
B2HHQ4_MYCMM/1-93-------------------------------------------
B2HJI4_MYCMM/1-93-------------------------------------------
B2HR24_MYCMM/1-93-------------------------------------------
WA22_MYCTU/1-93-------------------------------------------
Q6MWV6_MYCTU/1-93-------------------------------------------
B2HIU2_MYCMM/1-93-------------------------------------------
B2HIS1_MYCMM/4-94-------------------------------------------
B2HN04_MYCMM/1-93-------------------------------------------
B2HN17_MYCMM/1-93-------------------------------------------
B2HHL8_MYCMM/1-93-------------------------------------------
D6ZBI2_SEGRD/2-92-------------------------------------------
B2HLV0_MYCMM/1-93-------------------------------------------
B2HK44_MYCMM/1-93-------------------------------------------
B2HPB9_MYCMM/1-93-------------------------------------------
B2HR25_MYCMM/1-93-------------------------------------------
Q49724_MYCLE/4-91-------------------------------------------
B2HL21_MYCMM/3-92-------------------------------------------
B2HT85_MYCMM/1-93-------------------------------------------
B2HFK5_MYCMM/1-93-------------------------------------------
B2HLZ6_MYCMM/3-94-------------------------------------------
PG10_MYCTU/1-93-------------------------------------------
B2HT63_MYCMM/1-93-------------------------------------------
B2HEI0_MYCMM/3-94-------------------------------------------
B2HEE1_MYCMM/1-93-------------------------------------------
I6Y936_MYCTU/1-93-------------------------------------------
I6XEF1_MYCTU/1-93-------------------------------------------
B2HJR4_MYCMM/1-93-------------------------------------------
F5YWF5_MYCSD/2-87-------------------------------------------
B2HJI6_MYCMM/4-90-------------------------------------------
K0JUJ1_SACES/21-110-------------------------------------------
I6X486_MYCTU/1-93-------------------------------------------
B2HN54_MYCMM/1-93-------------------------------------------
B2HEE3_MYCMM/1-93-------------------------------------------
B2HMC4_MYCMM/1-93-------------------------------------------
B2HLJ4_MYCMM/1-93-------------------------------------------
PG46_MYCTU/1-93-------------------------------------------
B2HR55_MYCMM/1-93-------------------------------------------
B2HRG2_MYCMM/1-93-------------------------------------------
L7N680_MYCTU/1-93-------------------------------------------
B2HG27_MYCMM/1-93-------------------------------------------
B2HT93_MYCMM/1-93-------------------------------------------
B2HM39_MYCMM/1-93-------------------------------------------
B2HIY5_MYCMM/1-93-------------------------------------------
H6R6F2_NOCCG/4-93-------------------------------------------
Q79FP0_MYCTU/1-93-------------------------------------------
Q6MX26_MYCTU/1-93-------------------------------------------
Q79FS8_MYCTU/1-86-------------------------------------------
B2HN49_MYCMM/1-93-------------------------------------------
Q79FD3_MYCTU/1-93-------------------------------------------
B2HMF9_MYCMM/1-93-------------------------------------------
F5YTX3_MYCSD/1-93-------------------------------------------
L7N6A7_MYCTU/1-84-------------------------------------------
PG34_MYCTU/1-93-------------------------------------------
PG20_MYCTU/1-93-------------------------------------------
B2HM19_MYCMM/1-93-------------------------------------------
F5Z3K2_MYCSD/1-93-------------------------------------------
F5YVB3_MYCSD/1-93-------------------------------------------
B2HHN1_MYCMM/3-94-------------------------------------------
Q79FV6_MYCTU/1-93-------------------------------------------
B2HSI7_MYCMM/1-92-------------------------------------------
D6ZDG0_SEGRD/3-92-------------------------------------------
B2HHB3_MYCMM/1-93-------------------------------------------
B2HT84_MYCMM/1-93-------------------------------------------
G8RGS0_MYCRN/3-92-------------------------------------------
B2HK25_MYCMM/1-93-------------------------------------------
B2HPB7_MYCMM/1-93-------------------------------------------
B2HQP5_MYCMM/1-93-------------------------------------------
Q6MWY0_MYCTU/4-94-------------------------------------------
B2HMC5_MYCMM/1-93-------------------------------------------
L0TCB8_MYCTU/1-93-------------------------------------------
B2HJ76_MYCMM/1-93-------------------------------------------
Q9CCR0_MYCLE/4-91-------------------------------------------
B2HSR7_MYCMM/1-93-------------------------------------------
J9RQ80_9ACTO/4-93-------------------------------------------
W5T6J3_9NOCA/5-92-------------------------------------------
A1T177_MYCVP/2-92-------------------------------------------
B2HQU6_MYCMM/1-93-------------------------------------------
B2HF24_MYCMM/3-92-------------------------------------------
Q5Z1M7_NOCFA/11-98-------------------------------------------
D5URB6_TSUPD/1-93-------------------------------------------
B2HN64_MYCMM/1-93-------------------------------------------
PG24_MYCTU/1-93-------------------------------------------
E9T269_COREQ/4-90-------------------------------------------
B2HEC9_MYCMM/1-93-------------------------------------------
B2HEW9_MYCMM/1-93-------------------------------------------
Q79G04_MYCTU/1-93-------------------------------------------
B2HN65_MYCMM/1-93-------------------------------------------
B2HDU1_MYCMM/1-93-------------------------------------------
B2HG78_MYCMM/1-93-------------------------------------------
Q6MX28_MYCTU/1-92-------------------------------------------
B2HLH8_MYCMM/1-94-------------------------------------------
B2HFQ1_MYCMM/1-93-------------------------------------------
B2HDH4_MYCMM/1-93-------------------------------------------
PG35_MYCTU/1-93-------------------------------------------
B2HP80_MYCMM/1-93-------------------------------------------
B2HE92_MYCMM/1-93-------------------------------------------
B2HEI9_MYCMM/1-93-------------------------------------------
F5YTX5_MYCSD/1-93-------------------------------------------
F5YSC7_MYCSD/1-93-------------------------------------------
Q9CD31_MYCLE/3-91-------------------------------------------
B2HN11_MYCMM/2-90-------------------------------------------
B2HN55_MYCMM/1-93-------------------------------------------
B2HRC5_MYCMM/1-93-------------------------------------------
B2HR92_MYCMM/1-92-------------------------------------------
B2HPR0_MYCMM/1-92-------------------------------------------
B2HRI5_MYCMM/1-93-------------------------------------------
B2HSE2_MYCMM/1-93-------------------------------------------
B2HDQ4_MYCMM/1-93-------------------------------------------
B2HLT8_MYCMM/1-93-------------------------------------------
B2HDQ3_MYCMM/1-93-------------------------------------------
Q79FV8_MYCTU/1-93-------------------------------------------
B2HR23_MYCMM/1-93-------------------------------------------
F5YV21_MYCSD/2-90-------------------------------------------
L7N697_MYCTU/1-93-------------------------------------------
Q79FW5_MYCTU/1-93-------------------------------------------
B2HT01_MYCMM/1-92-------------------------------------------
F5YYX8_MYCSD/3-92-------------------------------------------
B2HJR3_MYCMM/1-93-------------------------------------------
L7N6B5_MYCTU/1-93-------------------------------------------
B2HIY0_MYCMM/1-93-------------------------------------------
B2HSW4_MYCMM/1-93-------------------------------------------
Q6MWW8_MYCTU/1-93-------------------------------------------
I6YGS7_MYCTU/1-93-------------------------------------------
L7N6A1_MYCTU/1-93-------------------------------------------
B2HJ40_MYCMM/1-93-------------------------------------------
B2HN52_MYCMM/1-93-------------------------------------------
Q79FR3_MYCTU/1-93-------------------------------------------
B2HLV1_MYCMM/1-93-------------------------------------------
B2HS54_MYCMM/1-93-------------------------------------------
PG33_MYCTU/1-93-------------------------------------------
B2HS53_MYCMM/1-93-------------------------------------------
Q73SD0_MYCPA/1-93-------------------------------------------
Q79FK9_MYCTU/1-93-------------------------------------------
B2HHV7_MYCMM/1-93-------------------------------------------
B2HN68_MYCMM/3-94-------------------------------------------
L7N661_MYCTU/1-93-------------------------------------------
B2HKK6_MYCMM/1-93-------------------------------------------
L7N659_MYCTU/1-93-------------------------------------------
Q79FU2_MYCTU/1-92-------------------------------------------
B2HRZ1_MYCMM/1-93-------------------------------------------
I6Y2J4_MYCTU/2-94-------------------------------------------
I6YG87_MYCTU/3-92-------------------------------------------
Q6MWW9_MYCTU/1-93-------------------------------------------
B2HR57_MYCMM/1-93-------------------------------------------
B2HIR9_MYCMM/1-94-------------------------------------------
Q741T4_MYCPA/1-93-------------------------------------------
B2HR17_MYCMM/1-93-------------------------------------------
H6N0V6_GORPV/3-87-------------------------------------------
B2HSX8_MYCMM/1-93-------------------------------------------
B2HEF1_MYCMM/1-93-------------------------------------------
B2HLL6_MYCMM/1-94-------------------------------------------
B2HLH9_MYCMM/1-94-------------------------------------------
A0QNJ3_MYCS2/1-92-------------------------------------------
Q79FB3_MYCTU/1-93-------------------------------------------
B2HSU2_MYCMM/1-93-------------------------------------------
B2HLT7_MYCMM/1-93-------------------------------------------
B2HJX1_MYCMM/1-93-------------------------------------------
B2HEZ0_MYCMM/1-93-------------------------------------------
PE23_MYCTU/1-93-------------------------------------------
Q79FP1_MYCTU/1-93-------------------------------------------
L7N656_MYCTU/1-93-------------------------------------------
B2HM53_MYCMM/1-93-------------------------------------------
I6Y8K5_MYCTU/1-93-------------------------------------------
B2HGS2_MYCMM/1-93-------------------------------------------
G8RMI5_MYCRN/1-92-------------------------------------------
B2HS71_MYCMM/1-93-------------------------------------------
Q79G08_MYCTU/1-93-------------------------------------------
B2HLL1_MYCMM/1-93-------------------------------------------
B2HIU5_MYCMM/1-93-------------------------------------------
B2HF28_MYCMM/5-95-------------------------------------------
F5YYX0_MYCSD/3-91-------------------------------------------
Q79FD4_MYCTU/1-93-------------------------------------------
B2HJ59_MYCMM/1-93-------------------------------------------
L7N693_MYCTU/1-94-------------------------------------------
V5X6V7_MYCNE/5-92-------------------------------------------
F5YWS6_MYCSD/1-93-------------------------------------------
B2HHZ9_MYCMM/1-93-------------------------------------------
D5UWF8_TSUPD/4-88-------------------------------------------
B2HDT7_MYCMM/1-93-------------------------------------------
B2HP27_MYCMM/1-93-------------------------------------------
B2HMV9_MYCMM/1-93-------------------------------------------
B1MEI5_MYCA9/25-113-------------------------------------------
B2HNH3_MYCMM/1-93-------------------------------------------
B2HFX6_MYCMM/1-93-------------------------------------------
B2HNZ4_MYCMM/1-93-------------------------------------------
B2HP93_MYCMM/4-94-------------------------------------------
B1MHU0_MYCA9/3-91-------------------------------------------
B2HS12_MYCMM/1-93-------------------------------------------
L0T2H7_MYCTU/1-93-------------------------------------------
B2HDJ7_MYCMM/1-93-------------------------------------------
Q6MWX5_MYCTU/1-92-------------------------------------------
B2HSB5_MYCMM/1-93-------------------------------------------
B2HJB3_MYCMM/1-93-------------------------------------------
Q79FR5_MYCTU/1-93-------------------------------------------
Q79FQ7_MYCTU/1-93-------------------------------------------
A1T262_MYCVP/3-92-------------------------------------------
B2HLD1_MYCMM/2-90-------------------------------------------
B1MAP1_MYCA9/3-91-------------------------------------------
D0L2D2_GORB4/4-93-------------------------------------------
B2HR45_MYCMM/1-93-------------------------------------------
F6EE96_AMYSD/5-91-------------------------------------------
B2HLT9_MYCMM/1-93-------------------------------------------
B2HLG6_MYCMM/1-93-------------------------------------------
B2HT48_MYCMM/1-93-------------------------------------------
B2HLL3_MYCMM/1-94-------------------------------------------
Q79FJ9_MYCTU/4-95-------------------------------------------
B2HLF8_MYCMM/4-92-------------------------------------------
Q79FW8_MYCTU/1-93-------------------------------------------
B2HR85_MYCMM/1-93-------------------------------------------
PE15_MYCTU/3-91-------------------------------------------
Q79FL8_MYCTU/1-93-------------------------------------------
Q6MX17_MYCTU/3-92-------------------------------------------
Q79FP3_MYCTU/1-93-------------------------------------------
B2HPP6_MYCMM/3-92-------------------------------------------
B2HHC0_MYCMM/1-93-------------------------------------------
H6MY81_GORPV/1-91-------------------------------------------
B2HR22_MYCMM/1-93-------------------------------------------
B2HRA3_MYCMM/1-93-------------------------------------------
B2HEZ3_MYCMM/1-93-------------------------------------------
B2HI03_MYCMM/1-93-------------------------------------------
Q6MX50_MYCTU/1-93-------------------------------------------
Q79FV3_MYCTU/1-93-------------------------------------------
F5Z171_MYCSD/1-93-------------------------------------------
B2HGB4_MYCMM/1-93-------------------------------------------
Q79FU3_MYCTU/1-92-------------------------------------------
P71664_MYCTU/1-93-------------------------------------------
B2HPP0_MYCMM/1-93-------------------------------------------
B2HLJ3_MYCMM/1-93-------------------------------------------
Q6MWW6_MYCTU/1-93-------------------------------------------
B2HLV2_MYCMM/1-93-------------------------------------------
B2HI17_MYCMM/2-92-------------------------------------------
B2HSB1_MYCMM/1-93-------------------------------------------
Q7AQ88_MYCLE/4-94-------------------------------------------
PG44_MYCTU/1-93-------------------------------------------
Q79G06_MYCTU/40-131-------------------------------------------
B2HMF4_MYCMM/1-93-------------------------------------------
B2HP28_MYCMM/1-93-------------------------------------------
Q79FT0_MYCTU/1-93-------------------------------------------
Q79FT3_MYCTU/1-93-------------------------------------------
B2HLU0_MYCMM/1-93-------------------------------------------
L7N681_MYCTU/1-93-------------------------------------------

PF10817

Q73RU9_MYCPA/1-104-------------------------------------------
B2HNS0_MYCMM/1-104-------------------------------------------
Y2078_MYCTU/1-104-------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window