Sequence alignment for CL0352

PF06013

Q97MZ9_CLOAB/4-89-------KI-R-------------LTVSEIDHTASVFAKNGQDIEN---VLK.ALTNEK.NKL.---VS..S-WE.GDAA
A9B0A6_HERA2/4-89-------KT-K-------------FDPQVMQQAAATFGKAHEGLQD---VNQ.EVLSIA.NTL.---QE..S-LK.GDAG
Q92FP7_LISIN/3-89-------NV-K-------------IDAAKVAEAKKSAAIVEKSLES---THK.KCKSVI.SYVE---GA..S-WS.GKSR
Q65FP7_BACLD/20-106-------TV-K-------------ISHNGTIKAHSHAKAIEKHVGD---SLK.KAKELK.AYVE---SG..K-WS.GKTR
Q3EVF5_BACTI/10-96-------EV-E-------------IIGSNTASAISYAQNIENGMKD---SLN.QAKDLK.AYVT---GA..K-WN.GKTR
A7GQF4_BACCN/5-91-------EI-E-------------IYGSEALNALSYAEQIEQGVKD---SLQ.QARELQ.AYVI---SS..H-WN.GKTR
A5IPF7_STAA9/6-92-------GI-K-------------ADGGKVNQAKQLAAKIAKDIEA---CQK.QTQQLA.EYIE---GS..D-WE.GQFA
Q2ESP2_BACTU/5-90-------QI-K-------------VTPERLEQSAKMVIDSRTLLEQ---IHK.DLYQQT.EYI.---AS..Q-WS.GATS
Q7CMD2_BACAN/4-89-------QI-K-------------VTPEQLEQAAKTVKNTRSSLEY---IHQ.DLYSQT.EYI.---AS..Q-WS.GASS
Q635B3_BACCZ/3-88-------QI-K-------------VTPERLEQSAKLVLETKNRLEQ---IHK.DLYNQT.EYV.---AA..M-WN.GATS
A0RJQ0_BACAH/3-88-------EI-K-------------VTPEELEQVAKTVRNSRNYLEQ---LHQ.DLYNQT.QYI.---AS..M-WS.GATS
Q81TJ4_BACAN/3-88-------LI-K-------------ITPERLEQSAKLVQDIRQTLDN---MHK.DLYNQT.EYI.---AS..Q-WT.GATS
A0RLV8_BACAH/3-88-------QI-K-------------VTPEMLEEVANRASNTRHALES---IHN.NLCNQI.DHL.---CS..Q-WI.GASN
A0RD24_BACAH/3-88-------QI-K-------------VTPEELERVAKRANDTKHALES---IHN.NLCNQI.DYM.---CF..Q-WT.GASN
A0RGK4_BACAH/3-88-------EI-K-------------ITPEELRNRAKTFSYAQGEAKD---RHN.KILNEL.FNL.---QT..R-WI.GASS
A9VP01_BACWK/3-88-------EI-K-------------VTPEELRNRAKNFKYASAEATD---RHN.RILSEL.LNL.---QM..R-WI.GASS
Q63F57_BACCZ/5-90-------EI-K-------------VPPEELERISKNFHHAGIEAKM---KHE.NLKKDI.DML.---YN..C-WY.GLSS
A9VT14_BACWK/3-88-------QI-K-------------ITPEQLDQIAGRFTNAAAEAQQ---QIN.NLGNDI.ESL.---NG..Q-WS.GATQ
Q81R67_BACAN/3-88-------EI-K-------------ITPEELERIAGNFKNAAGEAQS---QIN.RLEGDI.NSL.---EG..Q-WA.GATQ
Q81R60_BACAN/6-91-------EI-K-------------VKPEQLEQIAKNISEMQTHSQN---IQQ.NLNQSM.FSI.---QM..Q-WQ.GATS
Q97LZ0_CLOAB/3-88-------LI-K-------------MAPEELEQLAAKFSAASEESQQ---MVS.TLGSGI.ANV.---QQ..N-WA.GVSA
Q63EA3_BACCZ/3-88-------DI-K-------------VTPEQLRKVAGTIRSTIMNATA---TQE.RLKRDI.DMI.---SS..N-WL.GSTY
A9VNM9_BACWK/4-87-------EI-K-------------VTPDHLRKLASNIEQTAHELSE---TYQ.RINQQL.FDL.---PF..Q-IS.GR..
Q92FQ4_LISIN/4-89-------QI-R-------------MSPSELRDRAKTYGQSGRDIED---ILS.RLSQLQ.DQL.---RS..E-WE.GQAF
Q8ERJ1_OCEIH/4-89-------QI-R-------------MSPEQLQAKAKRYGQSSQTIDQ---VLR.DLQGLQ.DEL.---RG..E-WE.GRAF
Q81HA0_BACCR/6-91-------QI-R-------------MSPEELKSKAAQYGQGANQIED---ILS.QLQNLQ.NEL.---RG..E-WE.GRAF
A5IPF0_STAA9/3-88-------MI-K-------------MSPEEIRAKSQSYGQGSDQIRQ---ILS.DLTRAQ.GEI.---AA..N-WE.GQAF
A3CR39_STRSV/3-88-------QI-K-------------LTPEELRTSANRYTEGSENVTQ---VLT.TLTNEQ.AII.---AD..N-WD.GSAF
Q8E7D1_STRA3/3-88-------QI-K-------------LTPEELRISAKKYTTGSQSITD---VLT.VLTQEQ.AVI.---DE..N-WD.GTAF
A2RMK4_LACLM/3-88-------AI-S-------------VTPAELKQQAQVYIQSKEQIEQ---AIQ.RVNSMN.STI.---AE..E-WK.GQAF
A4IKE4_GEOTN/4-89-------VI-R-------------LTPEELRGVARQYNVESSNVTE---LIA.RLDQMS.HTL.---QG..I-WE.GASS
A8FGZ8_BACP2/4-89-------II-R-------------VTPEELRATAKQYGVESQEVLN---QVD.RLNRMI.SDL.---KG..M-WE.GASS
Q65FF4_BACLD/4-90-------II-R-------------VTPAELRQMADRYQKESGDVTE---QVNQRLDQMI.NQL.---QD..M-WE.GESS
Q5WK78_BACSK/4-89-------LI-R-------------VTPEELYQKADDYNRSSGEIHD---LVS.RLDGYR.DQL.---QG..M-WD.GQAS
A5KPT5_9FIRM/4-89-------QI-R-------------ISPDQMRERANSYQTESGNVSE---MIG.RLDSLL.QSL.---LG..E-WE.GSAS
A3DD43_CLOTH/4-90-------VI-R-------------ITPEQVRSAAVKIGKKTSETTN---FLN.SIQREI.DSL.---KS..I-WE.GKAA
Q9KE84_BACHD/3-88-------QI-R-------------MTPEELRTEANETRSDAASYQD---LLQ.RGDARI.EKL.---GS..T-WE.GEAF
Q97LY9_CLOAB/4-91-------KI-K-------------MQGEQLDSVASNLLNDAKTVQT---VLD.NLQSKY.LQIL---ND..N-WE.GNSK
Q97LY7_CLOAB/15-100-------SM-K-------------VNAEEIQAMAKRYKELADKAST---ILN.SLNSTI.DEM.---KQ..N-WK.GKSS
Q97MZ8_CLOAB/5-90-------KI-E-------------VNTKMILDLSKRFKDASNTAKN---TKG.NMQKVT.DRL.---ID..G-WN.GKSV
Q97KJ1_CLOAB/6-91-------DI-E-------------IDASIFEETIKVYSDSKVRLHD---ILC.DLENEL.RKM.---ED..T-WE.GDAK
Q97MZ2_CLOAB/6-93-------DI-K-------------INMETLQSAINEYKNCKTTLEN---LLK.ELESGL.KALE---GT..E-WK.GAAK
Q97M02_CLOAB/3-88-------RY-D-------------VTPKELKISAKIFKEKSDEIMG---RIS.RLKASV.DIY.---GA..T-WQ.GAGH
Q9L0T5_STRCO/28-115-------DL-D-------------ITYQDMRDAAKHVVKEKEKLQE---KLD.GLRKYI.ANLV---ES..G-YVTKSSS
A6WCP9_KINRD/3-90-------NL-N-------------VTFDDMRTAATNLDHGKAEIAD---QLA.RLKALV.DGLV---SS..G-YVTDRSS
Q6ACE0_LEIXX/8-95-------NI-K-------------VSYAEIETSASQLSSGREEITT---KLQ.RMQSQI.QNLV---TS..G-FVTDQAS
A0QM17_MYCA1/4-89-------HL-T-------------MQLEAMASAAHILTNQADGFSS---ELD.SIADDW.RNL.---SS..T-WQ.GAAA
A1T456_MYCVP/3-88-------HL-K-------------VDPDVAFNTSRSVSNDAVELHE---QLD.SLQHDW.DNL.---SR..G-WS.GAAS
A5U9N3_MYCTA/6-91-------TL-R-------------VEPAVMQGFAASLDGAAEHLAV---QLA.ELDAQV.GQM.---LG..G-WR.GASG
Q73SS3_MYCPA/16-101-------TV-R-------------VDPVVMQGAAASLSGAAEHLSA---QLG.QLDDQV.GQM.---LG..G-WQ.GASG
A0PX50_MYCUA/6-91-------TL-G-------------ANAAAMLGFAESLHGAAEHLQG---ELA.ELEGQV.GDM.---LG..G-WR.GAAG
A3PWA4_MYCSJ/4-90-------SV-E-------------VVVSELVSAATRLADTGQRLQD---GLS.GVDLEV.GQLL---GS..G-WK.GGAA
A0QTK0_MYCS2/4-90-------SL-E-------------VVTSELRSASAALADAGQRLQD---GLS.AVDLSV.DQLL---GS..G-WK.GGAG
A1SN44_NOCSJ/4-90-------PL-A-------------ADHLAFRAAVAHVRGTVAQLAE---DRD.RVAARV.DALL---DR..G-WR.GGAA
Q5YN04_NOCFA/7-92-------PL-N-------------VVPDAVTAVGRRAYDIAQQLKS---GSI.ALDREV.QAL.---FD..T-WK.GSAA
Q5YRS3_NOCFA/4-91-------EL-Q-------------VEVDRLREAARFVADKAQIIRE---RVT.QLDTTIGKELL---AD..G-WQ.GKAA
O86644_STRCO/7-92-------RT-A-------------VNYDTVTQAAIDVRKTTRELSE---GLE.TLMRKV.AAV.---AE..T-WQ.GEAK
A8M600_SALAI/5-90-------LL-V-------------VNFAALQQASADIQRALNTLGA---QLD.QLETDA.APL.---VA..T-WT.GEAQ
Q82K72_STRAW/7-92-------GT-Q-------------VTYDALDFAATSIGNEAKTLEQ---DLQ.ELKKLV.AQC.---KQ..Y-WD.GAAQ
ES6LX_MYCLE/3-88-------NI-N-------------YQFGEIDAHGAAIRAQAAALET---THQ.AILATV.RDA.---AE..F-WG.GQGS
A0PSK7_MYCUA/2-87-------TI-N-------------YQFGDVDAHGALIRAQAASLEA---EHQ.AIVRDV.LAA.---GD..F-WG.GAGS
Q5Z1J3_NOCFA/4-90-------QI-S-------------ANFAGVEDGARQIIKRAEGIRD---ELE.AFHKKV.EEFV---TT..N-WK.GATN
A4T0V0_MYCGI/3-88-------QI-M-------------FNYPAMLNHAGEMSSYAGALQA---IGA.DIAAEQ.AAL.---KS..A-WQ.GDTG
A5U732_MYCTA/3-88-------QI-M-------------YNYPAMMAHAGDMAGYAGTLQS---LGA.DIASEQ.AVL.---SS..A-WQ.GDTG
Q73TD4_MYCPA/3-88-------QI-M-------------YNYPAMLSHAADMSGYAGTMQG---LGA.DIASEQ.ATL.---SN..A-WQ.GDTG
ESXR_MYCLE/3-88-------QI-M-------------YNYPAMLDHAGNMSACAGALQG---VGI.DIAAEQ.AAL.---QA..C-WG.GDTG
Q1B0C3_MYCSS/3-88-------QI-T-------------YNYPAMLGTAGEMHGHNTQLRT---VGA.GIASEQ.GAL.---AA..N-WQ.GDTG
Q1BFZ1_MYCSS/3-88-------EQ-V-------------WNFAGIEGGAGEINGAVSTTQG---LLD.EGKASL.GAL.---AA..V-WG.GSGS
A5U9K3_MYCTA/3-88-------EQ-Q-------------WNFAGIEAAASAIQGNVTSIHS---LLD.EGKQSL.TKL.---AA..A-WG.GSGS
Q6NJ54_CORDI/3-88-------KI-K-------------YGFGEIEAAASDIQSTSGRINS---LLE.DLKAHI.RPM.---AA..A-WE.GESA
Q8NST7_CORGL/3-88-------MI-R-------------YEFGAIQGAATDINSTSGRINS---LLD.GLKSQL.QPM.---VA..S-WE.GESS
A3TFP5_9MICO/5-90-------DI-K-------------VAGGGIDTLIDAMVKGVNDLKS---KVT.DMENDM.KPH.---MG..E-WE.AGAK
A3KJS8_STRAM/7-92-------YI-Y-------------VDYNHAEGAADDMVGQSQAIMS---ILA.NLEMEL.AEL.---RN..S-WI.GDDK
A1SDG6_NOCSJ/5-90-------GL-R-------------VNHAGLDTVADDLGQAVKRIDD---RLN.RLESEL.APL.---RS..D-WS.GSAQ
A8LV95_SALAI/3-88-------NY-T-------------FDFRQADAVLHDMNQINVRIRS---ALE.QMEQTV.EAS.---LA..Q-WT.GAAQ
A8M3S3_SALAI/3-88-------QY-T-------------IDFSAARATVAHMQDAQRRIQD---SLR.TLDEHS.RKS.---LQ..R-WD.SDAK
Q8G878_BIFLO/3-88-------QY-Q-------------VDSERIQSSSAAVATSISQIRQ---AVG.GMYTNL.NAL.---QD..A-WR.GSAA
A1A0W4_BIFAA/3-88-------QY-Q-------------VDSEQIQSSSAAVNASIQSIRQ---AVQ.GMYGNL.NNL.---QS..V-WR.GGAA
Q5YBV2_9BIFI/3-88-------QY-Q-------------VDSERIAASSAAVCSSITAIRD---AVT.TMYANL.NAL.---QD..A-WR.GAAA
A3TRR1_9MICO/4-89-------QF-Q-------------VDTERIQAASGDIARISSEIEG---QVA.QMLAKL.TAL.---QD..A-WK.GGAA
A4AIC4_9ACTN/3-88-------RY-Q-------------VDSDAVLSATSAVQNSIVRIQG---EVA.GLHGQL.TNL.---QG..S-WT.GQAA
A5CTX2_CLAM3/3-88-------RY-Q-------------VDSEAVLSATAAVQGSIGRIQA---EVA.GLHGQL.ADL.---QG..S-WT.GSAA
A6WE48_KINRD/3-88-------RF-E-------------VDSARVEQASAAVARSSSSIAA---EVE.AMVRHL.LDL.---ES..C-WK.GQAA
A1R3I1_ARTAT/3-88-------VI-S-------------VDTELLQLKSANVKGTVDRISS---DVQ.TMRRGL.EEL.---EA..T-WR.GTAA
A0JT10_ARTS2/3-88-------II-S-------------VDTELLQLKSANVKATVDRIST---DVQ.AMKRGL.DEL.---QG..T-WR.GSAA
A7B9U9_9ACTO/22-107-------AY-A-------------VDAEQIAAASAQACTTASTIRT---EVD.TMMAQL.LAL.---QD..T-WT.GGAQ
A0LR18_ACIC1/3-88-------GI-R-------------VTPEQLATLSGRLNSGSATIEG---ELR.AMAGAL.APL.---GT..D-WA.GMAQ
A5UYZ8_ROSS1/3-88-------PI-S-------------LDPQQARATASVFDGGKGSIEG---ELS.RMMSSV.SEV.---TS..T-WS.GQSR
A7NL38_ROSCS/3-88-------PI-S-------------LDPEQARSTASTFDGCKGTIEG---ELS.RMMGSV.NEV.---LA..T-WS.GQSR
A5UYZ9_ROSS1/3-88-------MI-S-------------LDTDAARSASATLAASKSSIEG---ELG.RMMSSA.NEV.---MS..T-WS.GTSR
A5UZ07_ROSS1/3-89-------QI-K-------------ADTDALRATIAAMRQGSSAIEN---ALQ.QAAQAM.ATLQ---NS..R-WS.GNHQ
Q6NJ55_CORDI/4-89-------GF-K-------------TEADVMRNTAHRVDDTNQEVSA---ELS.RLRSIV.DGV.---RA..S-WE.GTAQ
A4QBS1_CORGB/4-89-------LF-R-------------TESDVMLATAGQVDDINDQVQS---ELS.RLRGVV.DSV.---RG..S-WA.GQAQ
Q73S33_MYCPA/6-92-------TV-S-------------TDFDLMRSVAGTTDARNEEIRA---MLQ.AFIGRM.SGVP---PA..A-WG.GLAA
ES6LY_MYCLE/5-91-------HF-M-------------TDPQAMRDMARKFDMHAQNVRD---ESH.KMFMSS.MDIA---GA..G-WS.GTAQ
A5WPW1_MYCTF/4-90-------RF-M-------------TDPHAMRDMAGRFEVHAQTVED---EAR.RMWASA.QNIS---GA..G-WS.GMAE
O05453_MYCTU/4-91-------TI-Q-------------VTPQMLRSTANDIQANMEQAMG---IAKGYLANQE.NVMN---PA..T-WS.GTGV
A9B1N8_HERA2/5-91-------IV-Q-------------ADFEVMDQVAQRLSKNAESVTA---MQN.TLKQTI.EDL.---RS..T-WL.GDAA
A9B0B5_HERA2/5-92-------VV-Q-------------IQYEQTAQVAQHFGRLKQTVEQ---LQT.TIRNVS.QSLV---DG..D-WQ.GDAS
A9B2P0_HERA2/5-91-------VV-E-------------INYAQMQQLSQRFQRQAEVVSQ---LQQ.QLNHTY.QQL.---QN..D-WH.GDAA
A9B726_HERA2/5-91-------VV-Q-------------SDYEQLGQVATRFQKLHDQQTQ---MEA.MLRQTY.QQL.---RT..D-WK.GDAA
A9B720_HERA2/5-92-------IV-Q-------------HKSDDMEQVSSRFQKLHDHQVQ---MEA.MIRRMY.EELR---GG..A-WQ.GDAA
A9B8D4_HERA2/5-92-------IV-Q-------------AQFEQLEQIASRFNRQAEQSES---ITQ.SIRQVH.DALV---GG..Q-WQ.GDAA
A9AUV8_HERA2/5-92-------IV-Q-------------IDYQEANQLAQRFSKQQTHVQA---ILQ.SLRQTI.QALE---NG..G-WM.GDAA
A9AUW0_HERA2/5-92-------IV-Q-------------IQYQQLEQLAQRFAKQQTQVQA---ILQ.SLRQTI.QALE---HG..G-WM.GDAA
A9B561_HERA2/5-92-------IV-Q-------------IDYAVVDTIIQRFQKLYDQSQT---IQA.SLCQTM.ASLQ---AG..Q-WQ.GSAA
A9B6G5_HERA2/5-91-------II-Q-------------VEYNHLLQVAQRFRTKAEAVVS---LRQ.QLRATV.GQL.---RN..D-WS.GIAA
Q5YRS2_NOCFA/6-91-------SY-R-------------VNLQQLDDAITTMADFGTEVEG---WLR.EVDAKI.AAL.---HL..S-WS.SQAA
A8LV94_SALAI/5-90-------RV-S-------------TTEEGMRRAAQEFSDKATEFTG---SLQ.AVNGQM.AIL.---QG..S-WT.GQAS
A8M601_SALAI/3-88-------QT-Q-------------ADTAVMEQTAARFEQVDQELHS---MLS.GLMAQL.EVL.---RQ..A-WR.GAGG
Q5ARS9_EMENI/25-110-------QI-S-------------VDYGQLEQFAQDVQSFADSTYS---QFS.QVSAQF.DVL.---TG..S-YS.GSGR
O86643_STRCO/16-101-------SV-D-------------YSDQDLTDLADKIRTFHTDVSS---RVT.SLNAVV.DMI.---QG..G-WQ.GAAG
Q5YU75_NOCFA/7-92-------SL-A-------------AAPTELVAAAKAVRTLLDELSS---GFQ.SLDADV.ESL.---IG..S-WK.GRQG
A4T4Z6_MYCGI/5-91-------GM-E-------------ADTPQLVIEAGNFDRISGDLTA---ILG.SVQGTA.EVL.---KV..D-LAGGSSG
A4KMZ0_MYCTU/3-88-------EM-K-------------TDAATLAQEAGNFERISGDLKT---QID.QVESTA.GSL.---QG..Q-WR.GAAG
A0QNJ5_MYCS2/3-88-------AM-N-------------TDAAVLAKEAANFERISGELKG---VIA.QVESTG.SAL.---AA..Q-MV.GQAG
ESXB_MYCLE/3-88-------EM-I-------------TEAAILTQQAAQFDQIASGLSQ---ERN.FVDSIG.QSF.---QN..T-WE.GQAA
A4FPH3_SACEN/3-88-------GF-A-------------GDVEIIDKASGQIDEVRGNIEQ---AVN.TLQGQM.EPV.---LA..N-WK.GGAS
Q5Z1J2_NOCFA/6-93-------SL-D-------------ASPELIAQKAKEFQEQHANLMA---AIR.TLKADE.DAV.---TNGAN-WK.GQAR
A3TFP6_9MICO/5-90-------TH-S-------------VGAGAIAKSAGIVDQARTDLKT---KLG.TLQGQM.EEV.---KA..H-WQ.GAGA

PF10824

A0PRC6_MYCUA/1-99MA.....KL-V-------------VTPQYLQTLAATQTQAAATAAS...AGAAS.TNLK-NEVW---VSHGV-IS-GASN
A4KM90_MYCTU/1-100MT....ENL-T-------------VQPERLGVLASHHDNAAVDASS...GVEAA.AGLG-ESVA---ITHGP-YC-SQFN
A4TFT9_MYCGI/10-109FA....MKL-R-------------VDDQDMLQFAAANDLVASEVAA...NVQPD.AELL-AAMQ---TGYGP-VG-AEFT
A0R672_MYCS2/1-104MSSDLEKNL-T-------------VLTDHIRKLSTVHDKAVGEIDG...ANRSM.VENG-TNMW---ETHGV-IS-ALTN
A4KMY1_MYCTU/1-100MT....GFL-G-------------VVPSFLKVLAGMHNEIVGDIKR...ATDTV.AGIS-GRVQ---LTHGS-FT-SKFN
A4FPN7_SACEN/1-99MA....DEM-N-------------VVIEGLRSHASKVDGVVDRLNT...AVDAS..REV-TLNN---DAYGI-LC-QPFA
A0PKF1_MYCUA/1-99MA....DRI-H-------------VEPAHLREAAAHHEQTSEYLRS...VPSSH..AAI-QESL---NSLGP-IF-SELR
A2VMP0_MYCTU/1-100MT....GFL-G-------------VVPSFLKVLAGMHNEIVGDIKR...ATDTV.AGIS-GRVQ---LTHGS-FT-SKFN
A5U9J3_MYCTA/1-100MT....GFL-G-------------VVPSFLKVLAGMHNEIVGDIKR...ATDTV.AGIS-GRVQ---LTHGS-FT-SKFN
Q744T9_MYCPA/1-99MA....DSI-H-------------VVPAHLRQAAAHHQDTSEYLRT...VPSSH..AAI-QESL---DSLGP-IF-SELR
A5TY98_MYCTA/1-99MT....DRI-H-------------VQPAHLRQAAAHHQQTADYLRT...VPSSH..DAI-RESL---DSLGP-IF-SELR
A0Q8V7_MYCA1/1-99MA....DSI-H-------------VVPAHLRQAAAHHQDTSEYLRT...VPSSH..AAI-QESL---DSLGP-IF-SELR
A1KPV0_MYCBP/1-100MT....ENL-T-------------VQPERLGVLASHHDNAAVDASS...GVEAA.AGLG-ESVA---ITHGP-YC-SQFN
A4TG17_MYCGI/35-139MS...SAPV-S-------------VDPASLRTSAVDNDECAASYDEYRRQVSAWIDGVE-DEII---RCHGA-IA-APVG
A0QNK5_MYCS2/1-100MS....GDL-K-------------VTAAELRELSERQRQIVENIAT...AAQAT.NNTT-ALVT---VTHGP-VC-APTI
A1TH04_MYCVP/1-103MNDR.DRNL-R-------------VLADHVIWLAGKQGAASGRITL...ANQAI.SGAS-DSVL---SSHGA-AC-LATH
A2VMW8_MYCTU/1-99MT....DRI-H-------------VQPAHLRQAAAHHQQTADYLRT...VPSSH..DAI-RESL---DSLGP-IF-SELR
A5U8T9_MYCTA/1-100MT....ENL-T-------------VQPERLGVLASHHDNAAVDASS...GVEAA.AGLG-ESVA---ITHGP-YC-SQFN
C1AJ24_MYCBT/1-99MT....DRI-H-------------VQPAHLRQAAAHHQQTADYLRT...VPSSH..DAI-RESL---DSLGP-IF-SELR
Q6MZ31_MYCUA/1-87MR.......-.-------------........WAITQEHAADRCAS...ARAEN..PHA-IATA---ESWGP-LF-AEAR
A0QSQ2_MYCS2/3-102EF....DRA-S-------------VDADALRAAAHGYDTVAETIDT...VIRTT.LGRP-AFDG---ASAGR-RH-VAHG
Y028_MYCBO/1-99MT....DRI-H-------------VQPAHLRQAAAHHQQTADYLRT...VPSSH..DAI-RESL---DSLGP-IF-SELR
Y406_MYCLE/4-103MI....DNL-T-------------VQSEHLNSLASQHENEAACASS...GVSAA.AGLA-NAVS---TSHGS-YC-AQFN
Y3645_MYCBO/1-100MT....ENL-T-------------VQPERLGVLASHHDNAAVDASS...GVEAA.AGLG-ESVA---ITHGP-YC-SQFN
ESPC_MYCTU/1-100MT....ENL-T-------------VQPERLGVLASHHDNAAVDASS...GVEAA.AGLG-ESVA---ITHGP-YC-SQFN
Y027_MYCTU/1-99MT....DRI-H-------------VQPAHLRQAAAHHQQTADYLRT...VPSSH..DAI-RESL---DSLGP-IF-SELR
A4KN58_MYCTU/1-99MT....DRI-H-------------VQPAHLRQAAAHHQQTADYLRT...VPSSH..DAI-RESL---DSLGP-IF-SELR
A3Q4D4_MYCSJ/1-100MT...GGPL-F-------------VQTDGLRQFSQTHAEIAAGVSQ...LVGGA..PTV-AGVE---ASHGQ-IA-FAVQ
A4TFR2_MYCGI/1-98MA......L-E-------------VDTHAVDTYAESCRTVGAEVQA...DCQAD.PSVV-AAME---SGYGP-VG-AAFT
A0PW23_MYCUA/1-100MN....EIL-T-------------LQPDVISRLSQGHDATVTGLQA...ATAAP.AGIS-ANVA---TTHGT-FT-SEYN
Q5Z2J0_NOCFA/9-106SA....TTL-F-------------VVPEKVGEVGKYLYELAQALQA...ALDSA...AQ-DVSS---LTDGS-WT-GDHA
A1KEJ5_MYCBP/1-99MT....DRI-H-------------VQPAHLRQAAAHHQQTADYLRT...VPSSH..DAI-RESL---DSLGP-IF-SELR
A2VM00_MYCTU/1-100MT....ENL-T-------------VQPERLGVLASHHDNAAVDASS...GVEAA.AGLG-ESVA---ITHGP-YC-SQFN
A1UA43_MYCSK/1-103MTEG.PGEL-Q-------------VSPAHLRELSDKQNRAAHQIAA...ATTLT.NGVA-AEVE---RTHGR-VC-APAF
Q1B4R9_MYCSS/1-100MT...GGPL-F-------------VQTDGLRQFSQTHAEIAAGVSQ...LVGGA..PTV-AGVE---ASHGQ-IA-FAVQ
A0R2G1_MYCS2/1-98MN.....QV-I-------------ANTGAMNSWQQQLGEVSSGVGN...LLNGT..PGV-SDVM---NTHGT-IG-FPMQ
A4T8Y2_MYCGI/1-99MS....QPF-S-------------VDPDGVRALGEIHSGVAADLGS...MSASA..AGS-APVA---ATHGT-IA-AAVD
Q7TVH1_MYCBO/1-100MT....GFL-G-------------VVPSFLKVLAGMHNEIVGDIKR...ATDTV.AGIS-GRVQ---LTHGS-FT-SKFN
A1UQ32_MYCSK/1-99MT....DPI-H-------------IDPEVMRTVANQHDDVADQIAP...AREAS..TEI-LAAV---NTFGP-IM-HQFK
A1TDN8_MYCVP/1-99MT....EPL-S-------------VDADGVRSLGEIHNRVAAGLGS...LAAAS..PGP-AAVA---GSHGT-IA-AAVD
A0QQE6_MYCS2/1-94MI.......-.-------------..TGYVQELAELQGRTAQQILS...ALEAA.QGVG-TSMW---KNHGM-VC-APSN
Q1BET9_MYCSS/1-103MTEG.PGEL-Q-------------VSPAHLRELSDKQNRAAHQIAA...ATTLT.NGVA-AEVE---RTHGR-VC-APAF
ESPF_MYCTU/1-100MT....GFL-G-------------VVPSFLKVLAGMHNEIVGDIKR...ATDTV.AGIS-GRVQ---LTHGS-FT-SKFN
A0R605_MYCS2/34-130TN....PEL-H-------------VTPAEVRRSADQMDVVAHEASS...SRTAM....A-DGIS---GQTTA-WK-EAGT
Q5YTI6_NOCFA/5-105SM....ENL-S-------------VDTGAVRAFATEHAGIAGQISA...AANMDLVGQV-SALT---PVFGL-IG-ADYL
A4T505_MYCGI/1-96MT....RPL-D-------------VDTDHLRATAASFVAAAEQIAE...LDADAPLADA-AAAV---PA...-..-LRTA
A3PTP9_MYCSJ/1-103MSSP.FDQL-R-------------IDPAHLQDLADKQGGTATQIAS...AAPVT.QGVA-ASVA---TSHGN-IC-APTS
A5WU86_MYCTF/1-100MT....GFL-G-------------VVPSFLKVLAGMHNEIVDDIKR...ATDTV.AGIS-GRVQ---LTHGS-FT-SKFN
A1T2U3_MYCVP/1-103MTSP.DGEL-H-------------VEPSHLRQLSARQNAAAAQIAD...AVPLT.ADES-DHVL---SSHGI-VC-MPTY
A4TEX2_MYCGI/1-100ML....AHL-S-------------VETGLVHDYGVACATHAADLDA...AAARL.RGVG-VGAA---AAFGP-VG-APFL
A1T184_MYCVP/1-96MS....APL-E-------------VDTSVMRRVGSDFDSAGDRMAG...LQADAPLGDA-AAAV---PQ...-..-LQTA
A1KQK0_MYCBP/1-100MT....GFL-G-------------VVPSFLKVLAGMHNEIVGDIKR...ATDTV.AGIS-GRVQ---LTHGS-FT-SKFN
A4T2V3_MYCGI/252-348AP......L-R-------------V.SESIRGTAGIQQNVAATIDS...ARSAP.DGSA-GDVF---KTHGV-VC-TSTA
A0QNI6_MYCS2/1-100MS....DDL-R-------------VTTAHLRELSAKQGRAAAELAT...ATAVV.DGVD-TALR---FTHGP-IS-WGTA
C1AI73_MYCBT/1-100MT....ENL-T-------------VQPERLGVLASHHDNAAVDASS...GVEAA.AGLG-ESVA---ITHGP-YC-SQFN
A1UKB8_MYCSK/1-100MT...GGPL-F-------------VQTDGLRQFSQTHAEIAAGVSQ...LVGGA..PTV-AGVE---ASHGQ-IA-FAVQ

PF00823

A5WS31_MYCTF/7-165-------WL-P..PEINSARMFAGAGSGPLFAAASAWEGLAADLWA---SAS-SFESVL-AALT...TG--P.WT-GPAS
A5WSZ4_MYCTF/4-161-------MI-P..AEYISNIIYEGPGADSLSAAAEQLRLMYNSANM---TAK-SLTDRL-GELQ....E--N.WK-GSSS
C1AP76_MYCBT/5-162-------LL-P..PEINSGRMYTGPGPGPMLAAATAWDGLAVELHA---TAA-GYASEL-SALT....G--A.WS-GPSS
Q1B0C5_MYCSS/11-168-------AA-P..PEVHSTLLNVGGTPAGITAAGASWAQLAAQYIA---GIA-ELEGIL-ASVQ....A--N.YQ-GPSA
A4KDZ8_MYCTU/5-163-------VS-A..PEVNSLRMYLGAGSGPMLAAAAAWDGLADELAV---AAS-WFGSVT-SGLA...DA--A.WR-GPAA
Q7TYL4_MYCBO/5-162-------AY-P..PEVNSANIYAGPGPDSMLAAARAWRSLDVEMTA---VQR-SFNRTL-LSLM....D--A.WA-GPVV
A0PW88_MYCUA/6-164-------AL-P..PEINSARIYTGPGPGSLSAAAANWASLAAELQT---AAG-YYQSVV-SGLT...SG--G.WL-GPAS
A5TZB4_MYCTA/5-163-------AL-P..PEINSARIYSGPGSRPLMQAAAAWQRLANELTA---TAA-SYSSVI-SGLT...GD--D.WL-GPSA
A4KG95_MYCTU/5-160-------IF-P..PEFNSLNIQGS..ARPFLVAANAWKNLSNELSY---AAS-RFESEI-NGLI....T--S.WR-GPSS
A4KLV7_MYCTU/4-161-------MI-P..AEYISNIIYEGPGADSLSAAAEQLRLMYNSANM---TAK-SLTDRL-GELQ....E--N.WK-GSSS
Q7TWP0_MYCBO/5-163-------VM-P..PEINSLLIYTGAGPGPLLAAAAAWDELAAELGS---AAA-AFGSVT-SGLV...GG--I.WQ-GPSS
Q7TYR8_MYCBO/6-167-------VL-P..PEINSGRMFFGAGSGPMLAAAAAWDGLAAELGL---AAE-SFGLVT-SGLAGGSGQ--A.WQ-GAAA
A0Q926_MYCA1/8-164-------AL-P..PEVHSTLLSSGPGPGPLLAAAATWTGLSTQYDS---AAT-ELTAVL-TGSM....P--V.WD-GPTA
Q7D7Y7_MYCTU/18-176-------AL-P..PEINSGRMYCGPGSGPMLAAAAAWDGVAVELGL---AAT-GYASVI-AELT...GA--P.WV-GAAS
A0PSL4_MYCUA/6-164-------AL-P..PEINSGRMYTGPGSGPMMAAASAWDALAAELSS---AAS-GYSLVI-AELT...SS--P.WL-GPAS
A0PV61_MYCUA/6-164-------LL-P..PKVNSTLMYSGPGSGSMLAAAAAWQALGAELQC---TAD-SYRSLL-SGLV...SG--P.WS-GPAA
A1KER7_MYCBP/2-160-------AI-P..PEVHSGLLSAGCGPGSLLVAAQQWQELSDQYAL---ACA-ELGQLL-GEVQ...AS--S.WQ-GTAA
Q854W2_9CAUD/132-282-------SL-G..PEEFSEAIHSGKGSSDVWDFGRRWRRGSDDITQ---IGY-ESQRIS-MSID....E--H.WT-DSGN
Q743Z9_MYCPA/26-175-------QL-R..ADVFRTR..RG.......AAAAAWNGLAAELRS---AAA-SFGSVI-TGVG...DA--G.WQ-GPAA
Q7U053_MYCBO/7-165-------AF-P..PEVHSAMLNYGAGVGPMLISATQNGELSAQYAE---AAS-EVEELL-GVVA...SE--G.WQ-GQAA
Q8VIY0_MYCTU/6-164-------VL-P..PEINSLRMYLGAGSAPMLQAAAAWDGLAAELGT---AAS-SFSSVT-TGLT...GQ--A.WQ-GPAS
Q73UE8_MYCPA/5-162-------FA-P..PEVTSTLIHTGPGAGSLIEAAAAWQRVAVELEN---SVS-SYASTL-SSLI....E--S.WD-GPSA
A2VEZ8_MYCTU/8-166-------AS-P..PEVHSALLSNGPGPGSLVAAATAWSQLSAEYAS---TAA-ELSGLL-GAVP...GW--A.WQ-GPSA
A5U1I2_MYCTA/5-163-------VL-P..PEVNSALMFAGAGSGPTLAAAAAWDGLAAELGQ---AAN-SFSSAT-AALA...DT--A.WQ-GPAA
Q7TZA6_MYCBO/5-163-------VL-P..PEINSALIFAGAGSGPMLAAASAWDGLATELAS---AAV-SFGSVT-AGLV...GG--S.WQ-GRSS
A4KED0_MYCTU/8-166-------WL-P..PEINSALMFAGPGSGPLIAAATAWGELAEELLA---SIA-SLGSVT-SELT...SG--A.WL-GPSA
PPE58_MYCTU/4-170-------MI-P..AEYISNVIYEGPRADSLYAADQRLRQLADSVRT---TAE-SLNTTL-DELH....E--N.WK-GSSS
A1UQ41_MYCSK/9-167-------LN-P..PQVNYYQLVTGDEAATAAAAAAAHQATAAMLSA---EIA-TMTTST-TSTA...AV--G.WQ-GAGG
A5U0E2_MYCTA/6-164-------WL-P..PETNSLRMYLGAGSRPLLAAAGAWDGLAEELHA---AAS-SFGSVT-SELA...GG--A.WQ-GPAS
A0PQL0_MYCUA/8-165-------AA-P..PEVHSALLSSGPGLGPLQVAAAAWAGLGEKFAL---AAV-DISFVL-GEVS....W--Q.WE-GAGA
A1KN13_MYCBP/11-169-------AS-P..PEVHSALLSAGPGPGSLQAAAAGWSALSAEYAA---VAQ-ELSAVV-AAVG...AG--V.WQ-GPSA
A0QE87_MYCA1/5-163-------VL-P..PEVNSGRMYSGPGSGSMLAAASAWDELANELHV---TAA-NIESVI-SGLT...SE--P.WQ-GPSA
A0PSJ9_MYCUA/6-164-------AL-P..PEINSGRMYVGPGAAPLIAAAAAWDELAAELQS---MAA-SYGSTV-QGLT...VA--P.WT-GASS
Q8VIZ3_MYCTU/6-164-------AL-P..PEINSARMYAGPGSASLVAAAKMWDSVASDLFS---AAS-AFQSVV-WGLT...TG--S.WI-GSSA
A0PVU0_MYCUA/5-163-------MF-P..PEINSALIEAGPGSAPMLGAAAAWCGLASELRA---AAE-SFASIT-SDLA...SG--A.WQ-GPAA
PPE45_MYCBO/5-163-------VL-P..PEINSGRMYAGPGSGPMMAAAAAWDSLAAELGL---AAG-GYRLAI-SELT...GA--Y.WA-GPAA
PPE36_MYCTU/6-163-------AL-P..PEINSTRIYLGPGSGPILAAAQGWNALASELEK---TKV-GLQSAL-DTLL....E--S.YR-GQSS
A0PQD0_MYCUA/8-166-------AR-P..PEINSALMYFGPGSRSMLAAAAAWDAVAFELGV---LAS-GYTSVI-SELT...SG--P.WV-GPAA
A0QCD6_MYCA1/11-169-------AS-P..PEVHSSLLSAGPGPGPLLAAAAAWSSLSVQYAE---SAD-ELVTLL-GAVR...AG--D.WD-GPTA
Q8VJK7_MYCTU/38-196-------WL-P..PEINSARIYAGAGSGPLFMAAAAWEGLAADLRA---SAS-SFDAVI-AGLA...AG--P.WS-GPAS
A5U9K1_MYCTA/5-163-------AM-P..PELNTARLMAGAGPAPMLAAAAGWQTLSAALDA---QAV-ELTARL-NSLG....E--A.WT-GGGS
Q8VJP8_MYCTU/8-150-------AV-P..PEVPSAWLSTGMGPGPLLAAARAWHALAAQYTE---IAT-ELASVL-AAVQ...AS--S.WQ-GPSA
Q0S9F2_RHOSR/145-302-------WL-PRGATVNSTTLAAGAGPVPLSVASAAWTALSTSFVD---ANL-TLVRVM-AELA....A--G.WQ-GVSA
O33085_MYCLE/14-130-------EC-P..PN......Y..............WHTPAPSAKC---EPE-Q.....-.........--....-..AA
A1KJY1_MYCBP/5-163-------TL-P..PEINSALIFGGAGSEPMSAAAVAWDQLAMELAS---AAA-SFNSVT-SGLV...GE--S.WL-GPSS
A0PVS2_MYCUA/8-166-------AL-P..PEVNSGLLYAGPGAAPMLTAATAWDGLATVLNS---AAA-SYASVV-SGLT...LE--S.RM-GPAS
Q73WQ9_MYCPA/13-171-------AL-P..PEINSARMYSGPGSGPLTAAAAAWEELAAQLES---YAA-GYSATL-AELR...GP--A.WS-GDAA
A4KHR2_MYCTU/5-163-------VL-P..PEINSALIFAGAGPEPMAAAATAWDGLAMELAS---AAA-SFGSVT-SGLV...GG--A.WQ-GASS
A0QM56_MYCA1/8-166-------AF-A..PEVHSTLLSSGPGPAGLLSAAASWTSLSETYAS---AAA-ELSATL-AAAQ...SD--A.WQ-GPSA
Q50175_MYCLE/23-181-------AI-P..PEVHSVLLSAGQGAESLLVAATQWQELSKQYTY---AAA-ELTRLL-THVQ...AT--S.WR-GTSA
A0PN58_MYCUA/4-162-------TS-P..PEVHSALLSSGPGPASLLSGAAAWAGLSTEYAS---VAD-ELMGVL-AAVQ...GG--A.WE-GLSA
Q741D6_MYCPA/5-162-------TR-A..PESNSGRMHSGPGAGSLMDAAKAWGVLGAQLAD---TAL-TYRAVI-AELE...LG--D..Q-RAST
PPE03_MYCTU/6-164-------AS-P..PEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAA---VAD-ELIGLL-GAVQ...TG--A.WQ-GPSA
PPE28_MYCTU/7-165-------VL-P..PEVNSARVFAGAGSAPMLAAAAAWDDLASELHC---AAM-SFGSVT-SGLV...VG--W.WQ-GSAS
P95182_MYCTU/5-163-------VL-P..PEINSLRMFIGAGTAPMLAAAAAWDGLAEELGT---AAQ-SFASVT-AGLA...GQ--A.WQ-GPAA
Q73TJ3_MYCPA/8-166-------AF-P..PEVHSALLSSGPGPGPLLASAGAWNSLAAEYTS---AAE-ELTAVV-EGVQ...AG--A.WQ-GPSA
A0QM63_MYCA1/8-166-------AS-P..PELHSALLSSGPGPASLLAAAGAWSQLSAEYAS---AAE-QLSTLL-TGVA...AG--A.WQ-GVSG
Q6MWX8_MYCTU/5-163-------VL-P..PEINSVLMYSGAGSSPLLAAAAAWDGLAEELGS---AAV-SFGQVT-SGLT...AG--V.WQ-GAAA
A0PW45_MYCUA/5-163-------AL-P..PEINSARMYAGAGAGPMMAASAAWNGLAVELGT---TAA-SYESVI-TRLT...TE--S.WM-GPAS
A4KHL9_MYCTU/41-200-------AL-P..PEINSGRMYSGPGSGPLMAAAAAWDGLAAELSS---AAT-GYGAAI-SELT...NM--RWWS-GPAS
A0QNJ4_MYCS2/4-162-------AL-P..PEINTARLMVGAGPAPMLQAAAGWEGLAVLLET---QAA-ELAAAL-TNLT....S--V.WT-GAAS
A2VII8_MYCTU/5-163-------AL-P..PEVNSGRMYCGPGSAPMVAAASAWNGLAAELSV---AAV-GYERVI-TTLQ...TE--E.WL-GPAS
Q7U123_MYCBO/5-166-------VL-P..PEVNSARIYAGAGPAPMLAAAVAWDGLAAELGM---AAA-SFSLLI-SGLTAGPGS--A.WQ-GPAA
A1KJJ9_MYCBP/5-163-------AL-P..PEVNSVRMYAGPGSAPMVAAASAWNGLAAELSS---AAT-GYETVI-TQLS...SE--G.WL-GPAS
A0PSJ8_MYCUA/5-163-------AF-P..PEINSGRVYTGPGSEPLLAAAAAWDAVAAELQS---TAA-AFSSVI-ASLT...SG--P.WI-GPSS
A5U0V4_MYCTA/5-163-------LL-P..PEVNSSRMYSGPGPESMLAAAAAWDGVAAELTS---AAV-SYGSVV-STLI...VE--P.WM-GPAA
Q73ZT3_MYCPA/6-164-------AY-P..PEYNSGRMYVGAGSGPLLAAAAAWDELAAELQS---VGA-SYGSTV-ETLT...TG--P.WT-GPSS
A0PMC1_MYCUA/5-163-------IL-P..PEINSARMYSGPGSSPLLTVASAWSGLAAELSA---TAN-DYETVI-SGLQ...SQ--G.WV-GPSS
A0QGS4_MYCA1/7-165-------TF-P..PEFNSARIYSGPGSGSLVAAASAWSSLAAELNA---AAL-SYDKVV-TALA...SE--E.WL-GSAS
Q7TY90_MYCBO/5-163-------VL-P..PEVNSARIFAGAGLGPMLAAASAWDGLAEELHA---AAG-SFASVT-TGLA...GD--A.WH-GPAS
Q73ZT6_MYCPA/6-164-------AL-P..PEINSARIYAGPGSAPMMSAAAAWNTMAAEMRS---AAA-SYGAVI-SELN...SA--D.WF-GPSS
A0PNL9_MYCUA/8-166-------WL-P..PEINSALMFAGPGAGPLLAAAAAWGGLAEELAS---AVS-SFSSVT-SELT...SG--S.WL-GPSA
A0PN64_MYCUA/11-169-------AS-P..PEVHSAMLSSGPGPASLLAAAGVWSALSAEYAL---TAA-ELSEVL-AAVQ...AG--A.WQ-GPSG
Q741X1_MYCPA/30-188-------AL-P..PEVNSARMYAGPGPLSLTAAAVAWDALAAELHA---AAS-CYRSVI-AGLT...TG--R.WL-GPSS
A0PKJ5_MYCUA/5-163-------VD-P..PKLTLARIYSGPGSGQMFSAAQAWNGLAAELRL---AAS-SFESVT-ANLM...AG--A.WQ-GAWA
Q73ZT2_MYCPA/5-163-------AF-P..PEFNSGRMYSGPGAGSFVAAATAWQNLAAELQS---AAA-SYSTVL-SGLT...AG--P.WV-GPSS
A4KH93_MYCTU/8-166-------VL-P..PEINSALMFAGAGPGPMLAAASAWTGLAGDLHS---AAA-SFSAVT-SQLA...TG--S.WQ-GPAS
A0QG97_MYCA1/5-163-------VL-P..PEVNSARMYAGPGSGPMLAAAMAWDELAATLHS---TAD-SYQAEI-TALT...SG--P.WV-GPSA
A0QE79_MYCA1/5-163-------AL-P..PEINSGRMYSGPGPASLLAAAAGWESLAAELAD---GAG-NYQAVI-AGLT...NE--S.WL-GPAS
Q5Z3L3_NOCFA/10-167-------WL-PRMAEANSIALNAGAHAVPISAAATAWGALTAAWVD---ATA-TVTRVM-AELG....V--G.MQ-GVNG
A0QLP3_MYCA1/8-166-------WL-P..PEVNSALIYSGPGPGPLLAAAAAWDGLAEELAS---SAQ-SFSSVT-SDLA...SG--S.WQ-GASS
A0PN14_MYCUA/8-166-------AS-A..PEAHSALLSAGPGPGSLLAAAQTWTELSAEYLA---VAE-ELTAIL-TGVQ...AG--A.WD-GPSA
A0PMG2_MYCUA/5-163-------ML-P..PEINSARMFAGAGSGPMLSAAMAWDGLAVELGS---AAE-SFGSVT-SGLV...GS--S.WQ-GAAA
Q73ZT0_MYCPA/5-163-------AL-P..PEVNSGRMYVGAGSGPLLAAAAAWDALGAELYS---FAA-AYTSTI-AGLT...VG--S.WL-GPAA
Q49944_MYCLE/6-163-------AL-S..PETNSTRMYLGPGSSPILTAAAAWVVLAKELTA---AAQ-GLQSAV-EALL....T--T.FE-GESA
A0QKH5_MYCA1/5-162-------IL-P..PEVTSALIHAGPGAWSWIEAAGVWQQLSMELEQ---SAS-SYTAEL-AALS....T--T.WQ-GPSA
PPE02_MYCTU/8-166-------AS-P..PEVHSALLSSGPGPGPLLVSAEGWHSLSIAYAE---TAD-ELAALL-AAVQ...AG--T.WD-GPTA
A0PSS0_MYCUA/5-163-------VL-P..PEINSLRLFSDAGSTSMLEAAAAWGSLADELQV---AAS-SFSSVT-AGLA...SG--A.WQ-GPAS
A0PRN7_MYCUA/8-165-------AL-P..PEVHSAFLSAGPGPGLLREAAAAWTVLAAEHAS---AAE-ELTSIV-GGAA....A--A.WE-GPSA
A0PWN5_MYCUA/2-160-------AI-P..PEVHSALLSAGQGPGSLLAAAAQWQELSAQYSA---AVV-ELTQLL-AEVQ...AT--S.WQ-GYAA
A0QI00_MYCA1/5-162-------SL-P..PEINSGRIYSGPGSAPLLAAAAAWHGLAAEMHS---AAA-SYGSAI-AELR...TL--..WH-GPSS
A1UQ34_MYCSK/124-283-------AA-P..AEIISNAVHSG.DPASGEAFISGWRQVAGSARD---ASA-AVRLVA-DSLP....D--S.WD-SPVA
A0PMK0_MYCUA/5-163-------SL-P..PEFNSGKMYAGAGSGSILVAAEAWDSVAVDLYS---AAS-SCQSVI-WGLA...FG--Q.WV-GASA
Q73TD6_MYCPA/11-169-------AS-P..PEVHSALLSAGPGSGPLLAAAGAWASLSAQYAT---AAA-ELSALL-GQVQ...AG--S.WE-GESA
A1KPM4_MYCBP/6-164-------TL-S..PEVNSARMYAGGGPGSLSAAAAAWDELAAELWL---AAA-SFESVC-SGLA...DR--W.WQ-GPSS
A0PPB9_MYCUA/5-163-------AL-P..PEVNSGRMYTGPGSTPMVSAASAWNRLASELSF---TAD-GYERVI-KALS...GE--E.WF-GPAS
Q73ZT5_MYCPA/6-164-------GL-P..PEVNSARMYSGPGSESMLAAAAAWNALSSELRS---AAT-DYESAI-ATLT...GE--G.WF-GPSA
A0QFD7_MYCA1/8-166-------AF-P..PEVHSTLLSSGPGPAPLLAAATAWSSMSTEYAA---AAA-ELDGLL-AAAH...AG--A.WE-GPSA
A4TG23_MYCGI/4-162-------GF-P..PEVNTGRLIAGAGAQPYLQAEIGWQTLAADFTA---ATT-ALQTQI-AVVS....G--A.WQ-GMAS
A1KND1_MYCBP/5-163-------FL-P..PEINSARMYSGPGPNSMLVAAASWDALAAELAS---AAE-NYGSVI-ARLT...GM--H.WW-GPAS
Q7TW98_MYCBO/5-163-------VL-P..PELNSLRMFTGAGSAPMLAAAVAWDGLAAELGS---AAS-SFGSVT-SDLA...SQ--A.WQ-GPAA
Q73TI1_MYCPA/8-166-------AS-P..PEIHSALLSSGPGPGPLLEAAAAWSSLSAEYAS---AAD-ELTATL-AAVQ...AG--P.WE-GPTT
A0PML6_MYCUA/5-163-------ML-P..PEVNSALMFTGAGSAPTLAAATAWDGLVAELGE---AAE-AFSSVT-SGLA...SG--S.WQ-GPAA
A0PQG1_MYCUA/5-163-------AL-P..PEINSARMYFGAGAAPLLGAAAAWNDIAVELST---AAS-AIESVI-TRLS...SD--Q.WL-GTAS
A4KM96_MYCTU/6-164-------QL-P..PEVNSALMYAGPGSGPMLAAAAAWEALAAELQT---TAS-TYDALI-TGLA...DG--P.WQ-GSSA
A0PML7_MYCUA/5-163-------ML-P..PEINSARIFAGAGVGPTLAAAAAWDALAADLAS---AAQ-SFAAIT-VGLV...GE--A.WQ-GAAA
Q7TXX3_MYCBO/5-163-------AL-P..PEVNSARMYGGAGAADLLAAAAAWNGIAVEVST---AAS-SVGSVI-TRLS...TE--H.WM-GPAS
A2VIS4_MYCTU/5-162-------VL-P..PEINSGRMYAGPGRVRCWPRQRPGTGWPPNYSP---TAA-DYGSVI-SVLT....G--V.WS-GQSS
A1KFH6_MYCBP/5-163-------VL-P..PEINSARLYVGAGLAPMLDAAAAWDGLADELGS---AAA-SFSAVT-AGLA...GS--S.WL-GAAS
A4T4Z7_MYCGI/14-171-------AF-P..PEINTSRLQAGAGAVPMLQAAAGWEAFAISLET---QAD-ELASSL-ASLS....Q--N.WQ-GMAS
A5WSZ8_MYCTF/5-162-------LT-P..AHQISYQMYAGPGADSMRAASQQLRELAFSADT---TAD-SLNDTL-FDLD....D--T.WI-GGSS
A0QJT0_MYCA1/5-163-------FL-P..PEVNSARMYAGPGSGSLLAAAGSWDSLAAELSI---TAA-VYESVL-AGLT...GL--Y.WH-GPAS
A0QGQ3_MYCA1/5-163-------LQ-P..PEITSAQLYTGPGAGPMLTAAAAWDALAAELQS---AAS-SYAAVV-NGLA...DE--A.WA-GPSA
A0QJ03_MYCA1/5-150-------TL-P..PEVSTGLMHSGPGAGSLIRAAAAWDGLARQLRA---VAT-SY....-.........--....-RAAT
O33009_MYCLE/8-166-------AS-P..PEVHSALLSRGPGSGPLLVAAEAWRSLSSVYAE---MAD-ELVALL-VVVP...VS--S.WD-GSAA
A2VIS8_MYCTU/6-164-------AL-P..PEINSGRMYAGPGSGPLLAAAAAWDALAAELYS---AAA-SYGSTI-EGLT...VA--P.WM-GPSS
A0PQA6_MYCUA/5-162-------AL-P..PEINSARMYAGPGSTSMQTAATAWDALATELYS---AAS-CYSSIT-AGLA...GK--..WQ-GPAA
A0QCD1_MYCA1/6-164-------AL-P..PEINSTRMYAGPGSAPLIAAAAAWDVLANALET---AAR-GYSAVI-TRLH...GE--S.WS-GSAS
Q741D8_MYCPA/8-166-------TL-P..PEVISTQIHVGPGAVPLLAAAAAWDGLAAELHG---TAA-SYASVI-SELV...VE--S.WQ-GSSS
A0PSK0_MYCUA/9-167-------TL-P..PEINSARMYSGPGSAPMLAAASAWKGLAAELRV---TVL-SYDSVL-RALT...GE--E.WY-GPAS
Q7TW99_MYCBO/7-165-------ML-P..PEVNSTRMYSGPGAGSLWAAAAAWDQVSAELQS---AAE-TYRSVI-ASLT...GW--Q.WL-GPSS
PPE37_MYCTU/8-166-------AV-P..PEVPSAWLSTGMGPGPLLAAARAWHALAAQYTE---IAT-ELASVL-AAVQ...AS--S.WQ-GPSA
A0PVR6_MYCUA/8-166-------GS-P..PEVHSALLSSGPGAASLQVSASAWTSLGAAYSS---AAD-ELTAVV-VVGE...TE--T.WE-GMGA
Q73Y22_MYCPA/7-165-------FF-P..PEINSALIAGGAGSGPLFEAASAWDGLAAELSS---SAS-SFQTVV-TDLA...AG--S.WM-GPSS
A0PQL2_MYCUA/8-166-------AV-P..PEVHSALLSAGPGPGPLQEAATAWASLSVEYAS---VAE-DLAGVL-GGVQ...AQ--A.WQ-GPSA
A0PRS9_MYCUA/5-163-------FL-P..PEVNSARMYSGPGSASLLAAAASWDMVAIELAS---AAE-GYRSVI-STLS...GM--Y.WW-GPAS
A5TZH9_MYCTA/2-160-------AS-P..PEVHSALLSSGPGPGPVLAAATGWSSLGREYAA---VAE-ELGALL-AAVQ...AG--V.WQ-GPSA
Q79FJ7_MYCTU/5-163-------TL-P..PEINSARMYSGAGSAPMLAAASAWHGLSAELRA---SAL-SYSSVL-STLT...GE--E.WH-GPAS
SRA_MYCLE/6-164-------VY-S..PEVNAFLMSRGPGSTPLWGAAEAWISLAEQLME---AAQ-EVSDTI-VVAV...PA--S.FA-GETS
A1U9U3_MYCSK/8-166-------AL-P..PEVHSALLSSGPGPGSLLAAAGAWQSLSAEYAS---AAA-ELTGIL-GSVQ...AG--A.WE-GPSA
Q73U78_MYCPA/14-172-------AS-P..PEVHSALLSSGPGPASMFAAAAAWSALGAEYAS---AAE-ELSGLL-ASAQ...AG--A.WQ-GPSA
A0PQA4_MYCUA/5-158-------KL-P..PEVNSGR..ACPGS..LQATAVALRGLTAGMRQ---IGE-GCSSIA-AGLT....S--G.WR-GPAA
Q9CCQ9_MYCLE/7-165-------AF-P..PEVQSAMLNFGAGVGPMLNSASYNLWLSAEYRW---VAS-EVEALL-REVR...SG--G.WQ-GQAV
Q745G2_MYCPA/8-168-------AR-T..PEDNDMLLKAGVGVGTHVANQTAWTTLAATHHA---SGV-ASAINT-AATS....A--S.WL-GAGS
A0QGS6_MYCA1/6-164-------AL-P..PEINSGRMYAGPGSGPLMAAAAAWDEVAAELGI---AAS-GYHSVI-AELT...SG--P.WV-GPAS
A5WSZ5_MYCTF/1-158-------MI-P..AEYISNVIYEGPRADSLYAADQRLRQLADSVRT---TAE-SLNTTL-DELH....E--N.WK-GSSS
A0PSP2_MYCUA/8-166-------AW-P..PEVLSSALWSGSGPGPLFTAAAAWGSLGAEYAT---AAE-ELAAEL-AGMQ...VG--A.WQ-GPGA
Q73V32_MYCPA/5-162-------FL-P..PEINSARMYTGAGAASLLAAAGSWDALSAELTA---TAD-GYESVL-SGL....GL--Q.WH-GPAA
A0PM57_MYCUA/5-163-------VL-P..PEVNSALIFTGPGAEPMRTAATAWGGMAVELES---AAD-SFASVT-SGLV...GG--A.WQ-GASS
Q741E7_MYCPA/8-166-------AF-P..PEVHSAALSSGPGPGSLLAAEQAWQALSAEYAS---AAA-ELGDLL-AAVQ...AG--T.WQ-GPSA
A0PSL2_MYCUA/5-163-------ML-P..PEVTSALMYAGPGSSSMVAAASAWNALAAELNS---TAQ-GYLTVI-TQLS...SE--E.WM-GPAS
A0PLH5_MYCUA/8-165-------AS-P..PEVHSGLLSSGPGAGPMLASAAAWKSLSGEYAS---AAA-ELAGLV-GAVP....Q--V.WW-GPAE
A0PL97_MYCUA/8-140-------AS-P..PEVHSALLSAGPGPRPLHEAAAAWTALAAEHAS---AAE-ELTTML-GESA....M--A.WE-GPSA
A0PMF2_MYCUA/6-164-------ML-P..PEINSSLMFSGAGSAPMLDAAAAWEGLASELGT---AAS-SSSSVT-SGLV...SD--A.WQ-GAAS
Q5Z1M6_NOCFA/16-175-------AM-E..PDRMARELRTGPGSVPLAEAGAAWGRLAESFGA---AVV-EYELVM-ATLR....G--A.WQ-STTS
A0PS83_MYCUA/8-165-------AS-P..PEVHSSLLSTGPGPGGILVAAAGWLSLGALFEA---TAA-EVDHQI-CEAI....R--L.WQ-GRAA

PF04740

YEEF_BACSU/2-210-------KV---------------FEAKTLLSEATDRAKEYKELRT---QMV-NLRKAL-KGVA---DLSDSEFS-GKGA
YXID_BACSU/2-205-------KT---------------LDVHALHEGIQHTIEKLDKQKQ---QLE-KLEKSV-EHLA---GMKDA.LK-GKGG
A8FDL4_BACP2/2-210-------KI---------------LDAPSLLSAIEQRSKVYQELRD---EMQ-HVKKAL-KSVS---GLGDE.FT-GKGA
Q65L45_BACLD/27-230-------KT---------------LDVQALHKAIDQTVEQLKQQSE---EIV-NIKKSV-EGIT---SLNDA.LK-GKGG
Q5WBP9_BACSK/1-209-------MI---------------LDTNELITEIERSIEQKRDHRD---QLQ-TLQSKV-EAIC---QLET..LQ-GEGG
Q5WJ65_BACSK/2-209-------NT---------------LDVQEVLDALDEIVERKLHDQA---QLE-RLQASI-QKII---HLDS..LQ-GEGG
Q4EUK8_LISMN/2-192-------SR---------------IDIGEIQAFLYQLRAANEPGRK---TIQ-SIKAAV-TKYV---GDNS..LK-GKAV
Q65EU5_BACLD/2-205-------KT---------------LDVQALHNAIDQTLEQLKQQSD---EFS-KVKKAV-EGIT---SLDDA.LK-GKGG
A0AGW3_LISW6/2-192-------SR---------------IDIGEIRTFALQLKEANQQGKR---CIK-AIQTVV-TNYA---EEDS..LK-GKAI
Q9KAE5_BACHD/3-214-------KH---------------LDVGQCLTIIEGTNTALKSYMD---HFD-FMEAAI-SRVL---ELEGS.LK-GKGG
Q92CG1_LISIN/1-200-------MK---------------IDVRELNEIVSENIVMLKKEYE---NLN-IAMNAT-TNFT---VETQEFFK-GKTA
Q8EMS0_OCEIH/2-205-------KT---------------MDIKQLHTQIDQTQYMLNQSRQ---NLD-EMKKAV-ENLL---ESEDI.FT-GEAA
A0AFZ4_LISW6/5-192-------MF---------------LDSAD..QQVDAISSQCRTYIT---GLE-DVKTAI-AQFA---LEDS..LQ-GKTY
A8FFY0_BACP2/2-205-------KT---------------IDVFELKNGIDQTLNKLKQQSQ---NVK-SLEKQI-NQII---SLDSA.LK-GEAG
Q65NL2_BACLD/2-209-------KV---------------YEAETLISAMKQRSDEYKNLRE---QLV-SLKKAL-NSVA---ELDE..FQ-GKGA
Q5WD67_BACSK/2-203-------KK---------------YVASDFFSALDKIDSDMNQYTE---TLS-NVHSAI-QGVV---NLGDN.LT-GQGG
A7Z5G9_BACA2/2-210-------KV---------------FEAASFISAAEKRAKQYDQIRE---QFI-NLRKAF-QGMA---DLDDSEFS-GKGA
Q9K9X1_BACHD/2-213-------KF---------------LDVNQHLSELDEHISVLKSYGD---VFE-VAEARI-TRVI---NMDGA.FK-GEGA
A0AFU0_LISW6/2-192-------SR---------------IDIGEIRDFAFQLRAANQTGRK---IIQ-GIKTTV-TNYI---EDGS..LK-GKAV
A7Z9J4_BACA2/3-210-------KV---------------FESQSLTDEADKRKKQYEALEE---QLR-ALKQAF-QGVA---DLGDA.LK-GKGA
A0AEP1_LISW6/3-194-------KK---------------IDFDEIQNASNDFNEGSNEEII---RLY-SLLENI-DEIG---ALES..FQ-GKTA
YQCG_BACSU/2-210-------KV---------------FEAKTLLTEAEKRAQEYKDLKS---KMV-KLKKAF-KAVA---DLDDSEFS-GKGA
A7Z3I9_BACA2/2-210-------KV---------------FEATTLLAAAKQRAGEYKELRG---QMV-NLKKAF-QGMA---DLGDNDFS-GRGA
Q92ER0_LISIN/6-207-------SS---------------RDSEQVIKALSKNLASGKDVVA---QLK-EGSKKI-IQAV---DGRT..LS-GAAY
O64023_BPSPB/2-210-------KV---------------FEADSLLSEADKRTKEYKELRS---QMV-KLKKAF-KAVA---DLDDSKFS-GKSA
Q4EV84_LISMN/2-201-------SR---------------IDIAELNDFLQGLRSSNAEAKK---MIR-GIQQAA-SKYA---QDKS..LK-GQAV
Q65D27_BACLD/2-211-------KV---------------LDVSEVIDAIDQLIKEKKQEEK---EIN-AIRESV-QKIA---ELDDA.LK-GEGG
Q8ELE0_OCEIH/2-205-------KE---------------FDVKEIHQGVESAKTDLETVTE---DIS-HLQRSI-TDFH---GMEDA.LK-GKAG
Q8YA28_LISMO/2-201-------SR---------------IDIAELNDFLHGLRSSNAEAKA---MIR-KIKEAA-MDYA---QDNR..LK-GEAV
Q8EL62_OCEIH/2-205-------KT---------------VEASTIHEGIEQTTKLLSELAN---QVA-EVHGKI-TGIL---NTESD.FS-GQAA
Q5WKM5_BACSK/2-210-------KV---------------LDVQEVINGIDKLVDAKKEDIA---QLE-AVESSI-RKIH---NLHS..LQ-GEGG
Q92CT5_LISIN/2-196-------TR---------------IDIAEVNHFSHELKIANQQAKT---QIT-AIQNAI-IAYL---QDDS..LS-GEAI
Q65NH2_BACLD/2-205-------KT---------------LDVQAFQTGLDKTLTELKNQTD---EIS-KVKQSI-KGLT---SLDDA.LK-GAGG
Q8ERI3_OCEIH/3-199-------HK---------------VDISEVIELSEDVNSSTADIKT---SLN-SISESI-DRLN---SLES..FS-GKTA
Q65H85_BACLD/2-209-------KV---------------FEAHSLIEAANNRKKQYETFED---QLQ-TLKKAF-LGVA---DLGDD.FQ-GKGA

PF00934

A5WTG4_MYCTF/1-94MS-----FV.I-------------AVPEFLSAAATDLANLGSTISA---ANAAASIP.T-TGVL---AAGADDVS-AAIA
A5WKB5_MYCTF/1-94MS-----WV.M-------------VSPELVVAAAADLAGIGSAISS---ANAAAAVN.T-TGLL---TAGADEVS-TAIA
C1AQP8_MYCBT/1-94MQ-----FL.S-------------VIPEQVESAAQDLAGIRSALSA---SYAAAAGP.T-TAVV---SAAEDEVS-TAIA
A5WMC3_MYCTF/1-94MS-----NV.M-------------VVPGMLSAAAADVASIGAALSA---ANGAAAPT.T-AGVL---AAGADEVS-AAIA
Q79FU2_MYCTU/1-93MS-----FV.N-------------VAPQLVSTAAADAARIGSAINT---ANTAAAA..T-TQVL---AAAQDEVS-TAIA
A4KGC0_MYCTU/11-104VS-----FV.M-------------AYPEMLAAAADTLQSIGATTVA---SNAAAAAP.T-TGVV---PPAADEVS-ALTA
A4KFE3_MYCTU/1-94MS-----FV.I-------------AAPDLVAMATEDLAGIGASLTA---ANAAAAVP.T-SGLL---AAAGDEVS-AAIA
PG46_MYCTU/1-94MS-----FV.I-------------AVPEALTMAASDLANIGSTINA---ANAAAALP.T-TGVV---AAAADEVS-AAVA
PG34_MYCTU/1-94MS-----FV.V-------------AAPEVVVAAASDLAGIGSAIGA---ANAAAAVP.T-MGVL---AAGADEVS-AAVA
A5WJ08_MYCTF/32-125VS-----FV.I-------------AQPEMIAAAAGELASIRSAINA---ANAAAAAQ.T-TGVM---SAAADEVS-TAVA
A5U0D2_MYCTA/1-94MS-----FV.L-------------AMPEVLGSAATDLAALGSVLGA---ADAAAAAT.T-TGIV---AAAQDEVS-AAIA
A0PVK0_MYCUA/1-94MS-----FV.S-------------VGPGLLEAAARDLAGLGAGLRE---ANLAAAGA.T-VGVL---PAAGDEVS-AAIA
A5U7B2_MYCTA/2-95VS-----YV.V-------------ALPEVMSAAATDVASIGSVVAT---ASQGVAGA.T-TTVL---AAAEDEVS-AAIA
A0PSY5_MYCUA/1-94MS-----YM.F-------------AVPDTVAAAAADLAGIGSTLNA---ATAAAAAP.T-TGVL---AAGADQVS-AAVA
Q7DAD0_MYCTU/1-94MS-----YV.I-------------AAPEMLATAAADVDGIGSAIRA---ASASAAGP.T-TGLL---AAAADEVS-SAAA
A4KGY4_MYCTU/1-94MS-----FV.F-------------AVPEMVAATASDLASLGAALSE---ATAAAAIP.T-TQVL---AAAADEVS-AAIA
A0PTY2_MYCUA/1-94MA-----YV.I-------------ADLEAMAAAAADLAGVNSAIAA---ANGIAAVP.T-TAVQ---ACAGDQVS-AAVA
A5WQ97_MYCTF/1-94MS-----LV.I-------------ATPQLLATAALDLASIGSQVSA---ANAAAAMP.T-TEVV---AAAADEVS-AAIA
A5U225_MYCTA/1-94MS-----FV.I-------------AAPETLVRAASDLANIGSTLGA---ANAAALGP.T-TELL---AAGADEVS-AAIA
A5WKZ9_MYCTF/1-94MS-----FV.V-------------TAPPVLASAASDLGGIASMISE---ANAMAAVR.T-TALA---PAAADEVS-AAIA
A0PN15_MYCUA/1-94MS-----GV.I-------------AALDTLTAAATDVAGLGAAINA---ANAAAAVS.T-TRLM---AAAGDEVS-ADIA
A0PKU3_MYCUA/1-94MS-----FV.N-------------VTPEAVAAAASDLTGIGSVLGE---ANAVAARA.T-TTVL---AAGGDEVS-AAIA
A1KHM5_MYCBP/1-94MS-----FV.V-------------VAPEVLAAAASDLAGIGSTLAQ---ANAAALAP.T-TAVL---AAGADEVS-AAIA
A0PN06_MYCUA/1-94MS-----YV.V-------------ASPEYVAAAASDLAGIGSALST---ANAAAAAP.T-IEVL---AAGADEVS-AAIA
Q73ZU4_MYCPA/1-94MS-----FV.T-------------TQPEALAAAAGNLQAIGWTLSA---QNAAAAAP.T-TGVV---PAAADEVS-ALTA
Q79FE6_MYCTU/1-94MS-----FL.I-------------ASPEALAATATYLTGIGSAISA---ANAVAAAP.T-TEIL---AAGTDEVS-TAIS
Q7U161_MYCBO/1-94MS-----YV.S-------------VLPATLATAATEVARIGSALSL---ASAVAAAQ.T-SAVQ---AAAADEVS-AAIA
Q9L8K3_MYCMR/1-94MS-----FV.I-------------ADPEMVTAAAADLAGIRSTLGA---AAEAAAGP.T-TGVA---AAAADEVS-AAIA
A0PUM7_MYCUA/1-93MS-----FV.I-------------AEPELMAAAATDLATIGSTLSA---AHLAAA.P.T-AAVL---PAAGDEVS-VGIA
Q8VJ19_MYCTU/38-131MS-----FV.V-------------AVPEALAAAASDVANIGSALSA---ANAAAAAG.T-TGLL---AAGADEVS-AALA
A5TZR2_MYCTA/1-94MS-----NL.L-------------VTPELVAAAAADLAGIGSAIGA---ANAAAGAP.T-MALL---AAGADEVS-AAVA
Q79FP2_MYCTU/1-94MS-----LV.I-------------VAPETVAAAALDVARIGSSIGA---ANAAAAGS.T-TSVL---AAGADEVS-AAIA
Q79G09_MYCTU/1-94MS-----LL.I-------------TSPATVAAAATHLAGIGSALST---ANAAAAAP.T-TALS---VAGADEVS-VLIA
A0PST5_MYCUA/1-94MS-----YV.S-------------AVPEAVSAAATDLAGIGSTIAA---ANALAAVP.T-TDLL---AAAADEVS-TAIA
A0PU40_MYCUA/1-94MS-----FV.V-------------VDPEMVAATAADLANIGSTIGA---ANGAAAAT.T-RAVL---AAGGDEIS-AAVA
A0PP63_MYCUA/1-94MS-----FL.N-------------VAPEMVAAAADNVESIGSALTA---AQAAAAAP.T-IELV---APAADGVS-IAVT
A0PQV1_MYCUA/1-94MW-----YL.S-------------VAPDELAAAATELRGVGSIVST---VNAAAAVP.T-TALW---PAAADEVS-AAIA
PG36_MYCBO/1-94MS-----FV.I-------------ASPEALLAAATDLAAIRSTIRA---ANAAAAVP.T-TGAL---APAADEVS-AGIA
Q53504_MYCTU/1-94MS-----FV.I-------------AAPEVIAAAATDLASLGSSISA---ANAAAAAN.T-TALM---AAGADEVS-TAIA
Q6MWW8_MYCTU/1-94MS-----FV.L-------------ISPEVVSAAAGDLANVGSTISA---ANKAAAAA.T-TQVL---AAGADEVS-ARIA
A5U1B3_MYCTA/1-94MS-----FV.L-------------VSPSQLMAAAADVAGIGSAISA---ANAAALAP.T-SVLA---AAGADEVS-AAVA
A0PW15_MYCUA/1-94MS-----YV.I-------------AAPELLAGAATDLAGLGSTLQI---ANRAAAAT.I-TGVP---AAGADDVS-AALA
A0PVP7_MYCUA/1-94MS-----YV.M-------------AVPELLASAAADLEGIGSALST---ANALALPS.T-SEIL---AAGTDEIS-TAVA
A0PLN2_MYCUA/1-94MA-----FL.F-------------VAPETLTAAAADIAGIGSTLGE---AGAAAATP.T-TAVL---AAGADDVS-AAVA
Q6MWX5_MYCTU/1-94MS-----FV.I-------------ANPEMLAAAATDLAGIRSAISA---ATAAAAAP.T-IQVA---AAGADEVS-LAIS
A5TZV8_MYCTA/1-93MS-----FV.I-------------ATPEMLTTAATDLAKIGSTITA---ANTAAAA..V-AKVL---PASADEVS-VAVA
A4KK43_MYCTU/1-95MS-----FL.T-------------TQPEELAAAAGKLETIGSAMVA---QNAAAAAPTT-TGVI---PAAADEIS-VLQA
Q7U0H3_MYCBO/1-94MS-----FV.T-------------TRPDSIGETAANLHEIGVTMSA---HDDGVTPL.I-TNVE---SPAHDLVS-IVTS
Q73SD0_MYCPA/1-94MS-----FV.Q-------------ATPEFVAAAATDLARIGSTISS---ANTAALGP.T-SGVL---APGADEVS-ASIA
A5U8I8_MYCTA/1-94MS-----FV.L-------------IAPEFVTAAAGDLTNLGSSISA---ANASAASA.T-TQVL---AAGADEVS-ARIA
A1KEY0_MYCBP/1-94MS-----HL.V-------------TAPDMLATAAAHVDEIASTLRA---ANAAAAGP.T-CNLL---AAAGDEVS-AATA
A0PPR6_MYCUA/1-94MS-----FV.I-------------ADTQWVSEAAGSLARIGSLIET---ANSAAATQ.T-TAVT---AAAADEVS-AAVA
A0PW44_MYCUA/1-94MS-----FL.K-------------TVPEELTAAAAQLGTIGSSMSA---QNAAAAAP.T-TVIA---PAALDEVS-ALQA
A0PVT8_MYCUA/1-94MA-----YL.T-------------VFPDMLAGAAGDLVGIGSQLAA---ANTAAIGP.T-TTVL---AAGADEVS-AAIA
A5WSR4_MYCTF/3-95MS-----LM.V-------------A.PELVAAAAADLTGIGQAISA---ANAAAAGP.T-TQVL---AAAGDEVS-AAIA
A0PMJ9_MYCUA/1-94MS-----SV.T-------------ARPEALAAAAGTLGPIGAALSA---GNAAAAAP.M-TGVL---PPAADEVS-ELLA
A2VPQ0_MYCTU/1-93MS-----F..T-------------AQPEMLAAAAGELRSLGATLKA---SNAAAAVP.T-TGVV---PPAADEVS-LLLA
A4KFL9_MYCTU/1-94MS-----FV.T-------------IQPVVLAAATGDLPTIGTAVSA---RNTAVCAP.T-TGVL---PPAANDVS-VLTA
A4KKS6_MYCTU/3-96VV-----TL.R-------------VVPEGLAAASAAVEALTARLAA---AHAGAAPA.I-TAVV---APAADPVS-LQSA
A2VKU7_MYCTU/1-94MS-----FV.T-------------AAPEMLATAAQNVANIGTSLSA---ANATAAAS.T-TSVL---AAGADEVS-QAIA
A5U3I5_MYCTA/1-94MS-----FV.V-------------TIPEALAAVATDLAGIGSTIGT---ANAAAAVP.T-TTVL---AAAADEVS-AAMA
A0PML9_MYCUA/3-96VI-----DL.L-------------ASPQAMTATATEVAEIGLAINQ---ADLAVAGP.T-TGLA---AAAAAEVS-EAIA
Q741T4_MYCPA/1-94MS-----FL.T-------------TTTEEMLAAEALLSGINSNLAA---QNAGAASA.T-TAIA---PAAADPVS-AQQA
A0PVP0_MYCUA/1-94MS-----FL.Y-------------AAPDFVAAGATDLASIGSSINA---ASVAAAAP.T-TGIL---AAGSDEVS-TAIA
A5WSZ7_MYCTF/1-94MS-----FI.F-------------TTPQALDNAAKSVSGIHDLWLA---DSKTAITV.V-NAIV---PPAADPVS-NRMV
A2VJ92_MYCTU/1-94MS-----FL.V-------------VVPEFLTSAAADVENIGSTLRA---ANAAAAAS.T-TALA---AAGADEVS-AAVA
A0PKS2_MYCUA/1-94MS-----YL.I-------------AVPDLMAHATTELSSIGSALTA---ANAAAAVP.T-TGVL---AAGADDVS-AAVA
A1KH04_MYCBP/1-94MS-----YV.L-------------ATPEMVAAAANNLAQIGSTLSA---ANAAALAP.T-TGVL---AAGADEVS-AAVA
A1KJL7_MYCBP/1-94MA-----FV.L-------------VCPDALAIAAGQLRHVGSVIAA---RNAVAAPA.T-AELA---PAAADEVS-ALTA
A2VLI5_MYCTU/49-142ML-----YV.V-------------ASPDLMTAAATNLAEIGSAIST---ANGAAALP.T-VEVV---AAAADEVS-TQIA
A0PT39_MYCUA/1-94MS-----YL.A-------------IAPEIVAAAAADMDGIGSPITA---ANAAAAIP.T-SAIA---AAAADEIS-AAIA
Q49943_MYCLE/2-95PL-----FL.N-------------AEPQALTAAANTLEGLSAATVA---SNAAAAQL.T-TEIA---PPAADDVS-ILLA
A0PQY4_MYCUA/1-94MA-----QL.S-------------VAPPWLVSAAQDLQSIGSTLAA---ANGAAAGP.T-TVLA---TAAADEVS-TAIA
A0PU10_MYCUA/1-94MS-----YV.L-------------VTPEMVATAAADAAAIGSTVSA---ANAAAAIP.T-TAIA---TAAADDVS-AAIA
A2VKF6_MYCTU/1-94MS-----FV.I-------------TNPEALTVAATEVRRIRDRAIQ---SDAQVAPM.T-TAVR---PPAADLVS-EKAA
A0PQL4_MYCUA/3-96IL-----QV.T-------------VVPAVVEMAANDLATIGSTISQ---ANAAALAP.I-TGLL---PAGTDEVS-AGIA
A0PPD4_MYCUA/1-94MA-----FV.I-------------AAPELVSAAAENVASIGTSLGA---ANAAVAAS.T-TSVL---SAGADDVS-QAFA
Q7D7A7_MYCTU/1-94MS-----HV.T-------------AAPNVLAASAGELAAIGSTMRA---ANAAAAAP.T-AGVL---AAGGDDVS-AGIA
A1KLI5_MYCBP/1-94MS-----YV.I-------------ATPEMMATAAFDLARIGSQVSA---ASAVAAMP.T-TEVV---AAGADEVS-AGIA
Q9L8K4_MYCMR/1-94MS-----FL.L-------------VQPEMVSAATESLTAIRSALGE---VSAAVAGP.T-TAVV---AAAGDEVS-AAIS
A4KHS6_MYCTU/1-94MS-----YL.V-------------VVPELVAAAATDLANIGSSISA---ANAAAAAP.T-TALV---AAGGDEVS-AAIA
A5U308_MYCTA/1-94MS-----FL.L-------------VEPDLVTAAAANLAGIRSALSE---AAAAASTP.T-TALA---SAGADEVS-AAVS
A0PTJ3_MYCUA/1-94MS-----FV.S-------------VTQEALAAAASDVGVIGSSLQA---ANMSVAAP.T-AGVL---AAGADEVS-VAMA
A0PVH2_MYCUA/1-95MV-----ML.R-------------VIPEGLAGASAAVAGLTARLAA---AHAVAAPA.I-TAVI---PPAADPVS-VRNA
A1KKK5_MYCBP/1-94MS-----FV.I-------------AAPEVMAAAATDLANIGSSISA---ASAAAAGP.T-MGIL---AAGADEVS-VAIS
A5TYM6_MYCTA/39-132LS-----YV.F-------------AQPSVLAAAATDLAGIGSAINQ---ATAAVAAP.T-TGLA---AAAADEVS-TALA
A0PUM0_MYCUA/1-94MS-----DV.M-------------VAPELVAAAANDYAKIGVLLGE---AHAAAAAS.T-VELL---PAAADEVS-AGIA
Q5Z3L2_NOCFA/2-87VG-----HV.S-------------ISPELILAAAAELDLLAERLAA---A.ATLSGP.A-THVL---PSGAEEVS-LLAA
A2VM07_MYCTU/1-94MS-----IM.H-------------AEPEMLAATAGELQSINAVARA---GNAAVAGP.T-TGVV---PAAADLVS-LLTA
Q7D6Z7_MYCTU/10-103VS-----RL.I-------------VAPDWLASAAAEVQSIGSALSA---ANAAAAAP.T-TLLV---AAAEDEVS-AAAA
Q7VEQ9_MYCBO/1-94MS-----FV.N-------------VDPFGMLAAAATLESLGSHMAV---SNAAVASV.T-TKVP---PPAADYVS-KKLS
A0PT20_MYCUA/1-94MS-----YV.I-------------AAPEMLAGAATDLAGIGAALQS---ANGAAAAP.I-TGVL---AAGADEIS-AAVA
A5WMF0_MYCTF/6-99MS-----FV.V-------------ANTEFVSGAAGNLARLGSMISA---ANSAAAAQ.T-TAVA---AAGADEVS-AAVA
A0PVD2_MYCUA/1-81MS-----YV.M-------------AVPEIIEAAAS...........---..TAAASQ.T-AQTV---AAAEDEVS-AAIA
A0PUN3_MYCUA/1-78MS-----YF.I-------------AVPDELALAATELDSIGAALSV---ANVAAALP.T-TGIL---AAGADDVS-TAIA
Q73ZT7_MYCPA/1-94MM-----YV.T-------------AQPEAMNAAADRLQQIGTALAA---QTGANSAP.M-TGVV---PAAADPVS-LLAA
A0PRQ0_MYCUA/1-94MA-----FL.V-------------AEPQVMATAAGQVEEIGSAIGV---ANEFAAGS.I-SDVA---AAAGDEVS-AAIA
A0PPD7_MYCUA/2-95SS-----FV.I-------------ATPEFLTAAANDLSGIGDAVRA---ATGAAAPS.T-TAIA---PLAGDEVS-AAVT
A0PLN3_MYCUA/1-94MS-----FV.I-------------TAPEALTAAATDLASLGSTIGA---ANAAAVAP.T-TAVL---AAGADEVS-AAVA
Q9L8K5_MYCMR/1-94MS-----FV.N-------------VVPNTVAAAAGDLASIRSALSE---ATAAAAGP.T-TDVL---AAGGDEVS-TAIS
A0PSJ0_MYCUA/1-94MA-----FV.L-------------AVPDMVAEAAADLAGVGSVIDA---ANTAAAGS.T-TGIV---AAAEDEVS-AAIA
A0PSI6_MYCUA/1-94MS-----FV.V-------------AAPDAVTAAVQDLASIGSAINV---ANAAAATP.T-TGAL---AAAADEVS-AAVA
A0PNR1_MYCUA/1-94MS-----YV.L-------------TIPDALTSAARDVRGIGAAVDA---ANLTAAVP.T-AGVL---AAGADEVS-AAVA
A0PVM5_MYCUA/1-94MP-----HI.A-------------VAPDLVASAANQLERIGSALSA---ANLTAAAP.T-TTVM---AAGADEVS-TAVA
A0PTY1_MYCUA/1-94MS-----FA.V-------------VAPELMRVAASDLANIGSTLSA---ANAVAAAQ.T-TAVQ---AAAADEVS-TAIA
A5U9E1_MYCTA/1-94MS-----FV.V-------------TVPEAVAAAAGDLAAIGSTLRE---ATAAAAGP.T-TGLA---AAAADDVS-IAVS
A0PVS1_MYCUA/1-94MS-----FV.V-------------TQPERLAAAAGSLQEVGSAVSA---QSAAAVAP.T-TSVA---PAAADQVS-ALTA
Q7D879_MYCTU/1-94MS-----FL.T-------------VAPDMVTAAAGNLESVGSALNE---AAAAAAPA.T-VGLA---APAADRVS-AVVA
A0PR61_MYCUA/1-94MT-----LV.D-------------VVPGMVQAAANDLAGLNTTLNA---ANAAAATQ.I-TTVV---AAAQDEVS-AAIA
A5U1M1_MYCTA/1-95MS-----FV.F-------------AAPEALAAAAADMAGIGSTLNA---ANVVAAVP.T-TGVL---AAAADEVS-TQVA
A0PS20_MYCUA/1-94MS-----SI.A-------------VFPEAVSAAAADVANIGRALSA---ANAAATVP.T-TNLL---AAGTDEIS-TAVA
A0PVW6_MYCUA/1-94MS-----YL.V-------------AVPEMLASAALDLDNIGSTITA---ANAAAAAP.T-TAVL---AAGADEIS-AAVA
A0PMQ8_MYCUA/1-94MS-----YV.A-------------TVPEALTAAASDAAGIGTTISS---ANAAASAP.T-TGVL---AAAGDQVS-AQVA
A3PSJ4_MYCSJ/1-93MQ-----PL.E-------------HNPGA.AGIGGQVVANGARGLA---GGTAATAA.V-TALV---PAGADEVS-AMAA
Q79FJ9_MYCTU/3-96TS-----QM.I-------------VAPAFVDAAAKDLATIGSAISR---ANAEALVP.I-TALL---PAGADDVS-AAIA
A0PLN5_MYCUA/1-94MS-----YV.V-------------AIPDMLASAAADVAGIGSSVGA---ANTAAVGA.T-TGVM---AAADDEVS-VAIA
A2VG56_MYCTU/1-94MS-----FV.I-------------VARDALAAAAADLAQIGSAVNA---GNLAAANP.T-TAVA---AAAADEVS-AALA
A0PRW2_MYCUA/1-94MP-----HV.T-------------TSPNLLAATAGDLAAIASTMRQ---ASAAAAAP.T-AAVQ---PAGGDVVS-AGIA
A1KEU5_MYCBP/1-94MS-----FV.S-------------VAPEIVVAAATDLAGIGSAISA---ANAAAAAP.T-TAVL---AAGADEVS-AAIA
P71664_MYCTU/1-94MS-----FL.F-------------AQPEMLGAAATDLASIGSAIST---ANAAAAAA.T-TRVL---AAGADEVS-AAVA
Q73WT4_MYCPA/1-94MS-----FV.T-------------TRPEALLAVASMLEGLGSSMDA---QNAAAAAP.T-TSIA---PAAADEVS-ALQA
A0PNH3_MYCUA/1-94MS-----YV.I-------------AAPEEFASAARNLANIGVTINA---ANANAILA.T-TEVI---QPGADAVS-AAIT
A0PPN9_MYCUA/1-95MS-----VVLV-------------VAPEALSAAAANIAGIGSSLGA---ANAAAATP.T-TTVL---AAGTDEIS-TTIA
A0PV62_MYCUA/1-94MS-----HV.T-------------AQPEIVAGVALELQAINSAARA---GDEVAVAP.T-TGVV---PPAADLVS-MLTA
A0PL58_MYCUA/1-94MA-----SV.T-------------SAPEALTAAALNLHSVGAGTSA---GNAAAMAP.I-TGVV---PAAADEVS-ALTA
A0PVM4_MYCUA/1-94MS-----YL.L-------------VAPELLTSAATDLEGIASALST---ANLAAAVP.T-TGML---AAGADEVS-AAVA
Q744A0_MYCPA/1-94MS-----FL.M-------------VRPEILDAAARELHGINAAVLQ---SNSAVVTP.T-TAVA---PAAGDVVS-LVTA
Q79FB3_MYCTU/1-94MS-----FV.I-------------AAPEFLTAAAMDLASIGSTVSA---ASAAASAP.T-VAIL---AAGADEVS-IAVA
A1KI31_MYCBP/1-94ME-----YL.I-------------AAQDVLVAAAADLEGIGSALAA---ANRAAEAP.T-TGLL---AAGADEVS-AAIA
A0PM18_MYCUA/1-93MS-----FV.S-------------VSPELVIDGAAALTQIGSSIDE---ANAAAGA..T-RAVL---PPGVDEVS-VALA
A0PMR0_MYCUA/1-93MS-----FL.I-------------ATPELFIRAATNLEAVGSAVNA---ANSAVSW..T-EKVA---AMAADEVS-GAVA
Q7TW48_MYCBO/1-94MS-----FV.I-------------VAPEALMSVASEVAGIGSALNA---ANAAAAAP.T-TGVL---AAAADEVS-AAMA
A0PVL1_MYCUA/1-95MS-----FV.N-------------VAPQQLSAAAAEVAGIGSAVST---ASRAAAAP.T-MGLL---AAGADEVS-VGIA
A0PMR7_MYCUA/1-94MS-----YV.L-------------TAPDLLASAATDVDGIAATLQV---ANSAAAAL.T-SGLL---AAAQDEVS-AAIA
A5U8I2_MYCTA/1-94MS-----FV.L-------------VSPETVAAVATDLKRIGASLAH---ENASAAAS.T-TAVV---SAAADEVS-TAVA

PF10817

Y2078_MYCTU/1-104-------MF---------------VDVELLHSGANESHYAGEHAHG---GADQLSRGPLLSGMF---GT-------FPVA
A0PX53_MYCUA/1-104-------MF---------------VDTGLLHLGGNESHRAGGHAQE---GADRLALGPLMSGMF---GD-------FAAA
Q73RU9_MYCPA/1-104-------MF---------------VDTDLLHSGGNQSHRAGGHARD---GADQLAGGTVASGMF---GD-------FAAA

PF06013

Q97MZ9_CLOAB/4-89KAFSSE-FD.QFAPQV.TQFAK-LVEQI----------------------------------GQQLKSASKTMQDTD-A-
A9B0A6_HERA2/4-89NEFVET-LQ.IMAQSV.AKFAA-KMTEI----------------------------------QNDIKVSMQQMADTD-N-
Q92FP7_LISIN/3-89DAFLTF-ME.LIEKYH.ADVKK-NYKKQ----------------------------------KKALTSLEDYVEDFE-N-
Q65FP7_BACLD/20-106DAFLSY-LE.LIIELN.ADMKD-ALKEH----------------------------------TAALDALEKHIDGFS-Q-
Q3EVF5_BACTI/10-96DAFLSY-LD.LIIQYN.SEMVE-AFEGH----------------------------------TKALKELDKSIQTYG-D-
A7GQF4_BACCN/5-91NAFLSY-LE.LLIQFN.TKMAE-ALEGH----------------------------------TKALKELDEHIQSFT-N-
A5IPF7_STAA9/6-92NKVKDV-LL.IMAKFQ.EELVQ-PMADH----------------------------------QKAIDNLSQNLAKYD-T-
Q2ESP2_BACTU/5-90NRFYAM-FN.DAKPLM.FNILQ-ELDKI----------------------------------AKELYHSAEKFREAD-T-
Q7CMD2_BACAN/4-89DRFYQM-FN.EAKPMM.FNILQ-ELDKI----------------------------------AVELERAAVKFREAD-E-
Q635B3_BACCZ/3-88QRFYQM-FN.ETKPQM.FNVFR-EFDKI----------------------------------AEELMHAAEKFRNAD-E-
A0RJQ0_BACAH/3-88EHFYQN-FN.EAKPKI.FTILM-EFDKI----------------------------------ADELEKAAKKFRKAD-E-
Q81TJ4_BACAN/3-88QNFYQM-FN.EAKPKI.FEVNN-LLDKI----------------------------------SEKLKHSAKKFREAD-Q-
A0RLV8_BACAH/3-88QHFVQM-FN.DAKPKA.FTSIN-SIVQV----------------------------------EEDLKRIAEKFRNTD-N-
A0RD24_BACAH/3-88QNFIQM-FN.NARPSA.FTAIN-ALVHV----------------------------------EEELKRIAEKFRVAD-S-
A0RGK4_BACAH/3-88LGFFDQ-LP.TLNKAC.ESYIT-HFKKI----------------------------------EEELIRIATKFETVD-N-
A9VP01_BACWK/3-88LSFYND-LP.TLTKAY.ESFNS-HLKNI----------------------------------EEELVRIALKFETTD-N-
Q63F57_BACCZ/5-90QNFFIS-FN.LSKGIL.DTYVD-KLEYI----------------------------------EKKLAQIAEKFRDTD-E-
A9VT14_BACWK/3-88DKFRAN-FS.DARQEM.LKYIP-ILEHI----------------------------------SADLKNIATNFRNAD-N-
Q81R67_BACAN/3-88AKFRGE-FI.QSKQAM.QQYIP-ILEGI----------------------------------STDLKRIADKFRNTD-N-
Q81R60_BACAN/6-91QHFYGE-YM.RSMRLM.ESYIR-NLQVT----------------------------------EKELRRIAQKFRQAD-E-
Q97LZ0_CLOAB/3-88TKFFGE-YQ.QWSKTM.TGYVQ-LLQQI----------------------------------SNELKGQAQKFRDAD-L-
Q63EA3_BACCZ/3-88MKFNTD-FR.DSSFKM.AQFII-ILEPL----------------------------------EKFLLDSANKFEQVD-N-
A9VNM9_BACWK/4-87DAVLNQ-SQ.YAGSML.ATITT-VLKEH----------------------------------SDSLRKAADRFEKAD-Q-
Q92FQ4_LISIN/4-89MRFDDQ-FE.QLKPKV.TEFAN-LMDQI----------------------------------NDQLEKTANAVEEHD-Q-
Q8ERJ1_OCEIH/4-89EKFDMQ-FQ.ELKPKV.QDFSQ-LMLDI----------------------------------ENQLVKTAEAVAQQD-E-
Q81HA0_BACCR/6-91EGFDQQ-FN.QLKPKV.QNFAQ-LLQEI----------------------------------NMQLNKTAEAVASHD-E-
A5IPF0_STAA9/3-88SRFEEQ-FQ.QLSPKV.EKFAQ-LLEEI----------------------------------KQQLNSTADAVQEQD-Q-
A3CR39_STRSV/3-88DSFEAQ-FN.ELSPKI.KEFAT-LLQDI----------------------------------NAQLIKVADIVEQTD-Q-
Q8E7D1_STRA3/3-88DSFEAQ-FN.ELSPKI.TQFAQ-LLEDI----------------------------------NQQLLKVADVVEQTD-S-
A2RMK4_LACLM/3-88QAYLEQ-YN.QLEQNV.RKFEE-LLESI----------------------------------NQQLNKYADTVEERD-A-
A4IKE4_GEOTN/4-89EAFIQQ-YQ.ELRPSF.EKMAV-LLNEV----------------------------------GQQLHNSATILEDTD-Q-
A8FGZ8_BACP2/4-89EAFADQ-YE.QLKPSF.IKMSD-LLTDV----------------------------------SNQLDQTANTLESTD-Q-
Q65FF4_BACLD/4-90RAFSEQ-YQ.ELRPSF.IKMAE-LLSDV----------------------------------SKQLHQTANTLESTD-Q-
Q5WK78_BACSK/4-89EAFIQQ-YD.ELKPSF.VRMGD-LLGEV----------------------------------SEQLRNSGRTLEETD-Q-
A5KPT5_9FIRM/4-89EAYRER-YE.SLRPAF.TQAEE-LLAEI----------------------------------SKALNTTAQNMENVD-E-
A3DD43_CLOTH/4-90EAYVEQ-FM.ALRKELETKLNQ-CLSDL----------------------------------ERSLTSVANALEQAD-K-
Q9KE84_BACHD/3-88QGFAAQ-WQ.DKRKHV.EELIQ-LYEEL----------------------------------GAQTDDIANVVETTD-Q-
Q97LY9_CLOAB/4-91DKFVDD-FQNNTMKLL.QNCVN-NLNNT----------------------------------GNSLKQIVEMFAETD-S-
Q97LY7_CLOAB/15-100DTFVSN-YD.GWKSNG.RRYVN-EIDRI----------------------------------ADELKNASERFREAD-R-
Q97MZ8_CLOAB/5-90REFQNT-YK.ILYQNM.NTYSD-ALDTL----------------------------------SKNLEQIAKSFNDAD-A-
Q97KJ1_CLOAB/6-91KEFDST-FP.GFYSAM.KKDCD-MLEEL----------------------------------IKELKLVKTSFESLD-T-
Q97MZ2_CLOAB/6-93EAFVNA-QFPNFKEGM.QRHCN-MIGEL----------------------------------IKELQETAKEFTKLD-N-
Q97M02_CLOAB/3-88DAFESK-YK.IIEKDI.QNIAK-KLDNI----------------------------------AWELNNTANTFEQAD-E-
Q9L0T5_STRCO/28-115KAFDDN-FD.EFTRGA.KDTLD-GLDGM----------------------------------GDYLTMAADKFEQID-D-
A6WCP9_KINRD/3-90VAFKDS-YD.EFNTGI.TQVLE-GLTGM----------------------------------SGYLNSAAQTLSDAD-S-
Q6ACE0_LEIXX/8-95GKFNDA-YT.KYTTSA.NTLIA-QLNEI----------------------------------QQFLTGTANAMRDLD-S-
A0QM17_MYCA1/4-89SDFRPA-WD.EWHQGA.KAVAT-LLSEH----------------------------------SQLLLRSLDLMLDHE-T-
A1T456_MYCVP/3-88SAYSPL-WA.EWLDGA.TTLVD-TLEEL----------------------------------SRKVAAAAAQYVDQD-G-
A5U9N3_MYCTA/6-91SAYGSA-WE.LWHRGA.GEVQL-GLSML----------------------------------AAAIAHAGAGYQHNE-T-
Q73SS3_MYCPA/16-101SAYAAA-WE.LWHRGA.REVQL-GLAML----------------------------------ARLVGQAGEAYASNE-A-
A0PX50_MYCUA/6-91SAFASA-WE.LWRRGA.GEVQF-GLSML----------------------------------AESVGQAGAGYQANE-A-
A3PWA4_MYCSJ/4-90TAFGTE-WD.KWHSGA.GQVVR-GLQTM----------------------------------SQWLTVAAKEYAKTD-E-
A0QTK0_MYCS2/4-90SAYSEQ-WD.KWHNGA.GQVIR-GLQAM----------------------------------SESLKASADSYSATD-Q-
A1SN44_NOCSJ/4-90TSFAAG-WA.EWARAA.DAVRR-GLELM----------------------------------GDLLEAADRDLVRAD-T-
Q5YN04_NOCFA/7-92DAYREG-WD.DMQDGA.MKAWD-ALTDL----------------------------------ASKLGVSASTLRDQD-T-
Q5YRS3_NOCFA/4-91SAYDES-WV.EWKQGA.DDIVA-ALDSS----------------------------------ASNLLDAANRYEMWD-A-
O86644_STRCO/7-92TAYGEI-QR.SSATEM.DQMCQ-KLARI----------------------------------AQLLDDSVIGYQDTD-K-
A8M600_SALAI/5-90TAYEAR-QA.QWRSAS.TSLET-MLRDI----------------------------------KLAVDDSAADYLDTE-K-
Q82K72_STRAW/7-92DAFDSK-LA.RWDKEA.NDIHT-ALTGI----------------------------------GHAVGTAGGTYMGGD-K-
ES6LX_MYCLE/3-88TAHEMF-IA.DLGRNF.QMIYE-QANSH----------------------------------GQKVQRASSSMADTD-R-
A0PSK7_MYCUA/2-87VACQEF-IT.QLGRNF.QVIYE-QANSH----------------------------------GQKVQAAGNNMAQTD-S-
Q5Z1J3_NOCFA/4-90EAFAQL-QR.TWQQNV.DQLNT-TLAGA----------------------------------GQLVSSGNSELQSTD-S-
A4T0V0_MYCGI/3-88VTYQAW-QA.QWNTAM.EELVR-AYRAM----------------------------------ASTHEMNTTSMAARD-Q-
A5U732_MYCTA/3-88ITYQGW-QT.QWNQAL.EDLVR-AYQSM----------------------------------SGTHESNTMAMLARD-G-
Q73TD4_MYCPA/3-88MTYQVW-QA.QWNEAM.ESLVR-AYQSM----------------------------------ASTHEANTMSMLARD-Q-
ESXR_MYCLE/3-88ISYQAW-QV.QWNQAT.EEMVR-AYHAM----------------------------------ANTHQNNTLAMLTRD-Q-
Q1B0C3_MYCSS/3-88QTYQAW-QQ.QWNQAL.EEATQ-AYQAM----------------------------------TQAHEQNTMNMMGRD-R-
Q1BFZ1_MYCSS/3-88EAYQAV-QA.RWDNTS.AELNA-ALQNL----------------------------------AQTISEAGSTMAQTE-A-
A5U9K3_MYCTA/3-88EAYQGV-QQ.KWDATA.TELNN-ALQNL----------------------------------ARTISEAGQAMASTE-G-
Q6NJ54_CORDI/3-88QAYNEA-QQ.QWDSSA.AELNT-ILSTI----------------------------------SNTVRQGNDRMSEVN-R-
Q8NST7_CORGL/3-88EAYSEA-QL.KWDRAA.AELNT-ILATI----------------------------------SNTVAQGAERMSDVN-R-
A3TFP5_9MICO/5-90QAFEDV-KR.KWNGEV.EDLNQ-LLLDI----------------------------------KTAVQTSKENYLAGE-L-
A3KJS8_STRAM/7-92DVYSEV-QA.KWDNAV.ENIKN-LLANH----------------------------------SGLLTEISSNYRYTE-Q-
A1SDG6_NOCSJ/5-90QAYTAA-KA.KWDGAM.QEMKG-LLQET----------------------------------SSTVVQSNAEYRAAD-Q-
A8LV95_SALAI/3-88AQYHVS-KA.VWNQSA.GQMTA-YLEQA----------------------------------RRTLLQISDNYGTTE-Q-
A8M3S3_SALAI/3-88VAYAQC-KQ.DWDQAA.AQMPV-LLGQA----------------------------------TRALDAIMAQYAGAE-R-
Q8G878_BIFLO/3-88TQFTAV-AE.QWRAAQ.QQMEA-SLESI----------------------------------QRSLTQASTVYADAE-I-
A1A0W4_BIFAA/3-88TQFTAV-AE.QWRAAQ.QQMEQ-SLESI----------------------------------QRALMQASTLYSETE-M-
Q5YBV2_9BIFI/3-88AQFNMV-AS.EWRRTQ.QQMEL-SLEAM----------------------------------QQALTQASTVYADAE-M-
A3TRR1_9MICO/4-89TQFHGV-VT.QWQGTQ.RQVQT-SLDSI----------------------------------GQVLAAAGAQYAETE-A-
A4AIC4_9ACTN/3-88TAFSTV-VT.DWKATQ.QRVEE-NLAAI----------------------------------NHALSQAGQQYAEIE-A-
A5CTX2_CLAM3/3-88TAFQGV-VA.EWKGTQ.QRVEE-ALASI----------------------------------NQALSAAARQYAEVE-E-
A6WE48_KINRD/3-88AGFQAL-SG.QWRGTQ.DRVRS-ALDDI----------------------------------QRALAQAGRQYADVE-S-
A1R3I1_ARTAT/3-88TNFQAL-VL.EWSLTQ.SKVEA-SLASI----------------------------------NMALSSAAASYVEVE-Q-
A0JT10_ARTS2/3-88TNFQGL-IT.EWTITQ.GKVEA-ALASI----------------------------------NTALASAAATYAQAE-Q-
A7B9U9_9ACTO/22-107VNFQAT-IT.QWQGIQ.AQTHD-ALDAI----------------------------------SSQMQVAASTYADAE-T-
A0LR18_ACIC1/3-88QRFEML-WA.EWQKSA.EGLHQ-ALTGI----------------------------------AQLLNQASINYAEAE-R-
A5UYZ8_ROSS1/3-88QQFESR-WE.EWSQRL.RTMMD-ELQNL----------------------------------ANGLRREAEEFESVD-R-
A7NL38_ROSCS/3-88QQFEAE-WD.QWTNRL.RNMME-ELQGL----------------------------------ANGLRREADEFESVD-R-
A5UYZ9_ROSS1/3-88QQFESQ-WE.QWCQKL.RTMME-ELQSL----------------------------------SNGLRREAEEFEAVD-R-
A5UZ07_ROSS1/3-89QQAEEV-WT.RLQAQF.APTIE-ALNQI----------------------------------ANRTERFTNALEEAG-R-
Q6NJ55_CORDI/4-89VSFDNL-MQ.RWDASA.KGLQD-ALQSI----------------------------------SDNIRGNATSFENVE-A-
A4QBS1_CORGB/4-89VSFDSL-MN.RWNSSA.RQLQE-ALASI----------------------------------SDNIRHNARSFENTE-A-
Q73S33_MYCPA/6-92ARFKEM-ID.RWNAES.VRLYH-ALHAI----------------------------------ADTIRHNAATLQDAG-Q-
ES6LY_MYCLE/5-91LTSHDT-MG.QINQAF.RHIVT-LLQDV----------------------------------RDQLGTAADRYEHQE-E-
A5WPW1_MYCTF/4-90ATSLDT-MA.QMNQAF.RNIVN-MLHGV----------------------------------RDGLVRDANNYEQQE-Q-
O05453_MYCTU/4-91VASHMT-AT.EITNEL.NKVLT-GGTRL----------------------------------AEGLVQAAALMEGHE-A-
A9B1N8_HERA2/5-91VAFQKE-MQADILPAV.QRLIN-AFQTA----------------------------------QSTTLEIKKVLQEAE-Q-
A9B0B5_HERA2/5-92VAFAKE-LDGEIYPTF.NRLIT-AFQTA----------------------------------QEVTLEVQKIFGQAE-E-
A9B2P0_HERA2/5-91KSFFNE-MQTSIFPTF.GKLKE-VLVTA----------------------------------QQVTLNVNSILREAE-T-
A9B726_HERA2/5-91VAFFGE-MDDSIFPAL.KRLQT-TLTSA----------------------------------SALTTQISQIFRQAE-E-
A9B720_HERA2/5-92QAFFAE-MNEHIFPAM.KRFQN-VLAVS----------------------------------GEVTKQISQIFRQAE-E-
A9B8D4_HERA2/5-92KAFANE-MQSNVFPAF.RRLTA-ALRES----------------------------------QAVTLQIKNLMRQAE-E-
A9AUV8_HERA2/5-92TACFKE-FHAEVVPAY.TRLSN-VLGEG----------------------------------QSTLQGIATLFRQAE-E-
A9AUW0_HERA2/5-92TACFKE-FHAEIVPAY.CKLQH-VFSES----------------------------------QTSLNQIAQLFHEAE-A-
A9B561_HERA2/5-92NACFQE-FDHVVKPAF.QRLLH-SLQGS----------------------------------VETTKAIRKIMADAE-A-
A9B6G5_HERA2/5-91TAFFHE-FQAEVDPAL.ERLRE-ALETA----------------------------------RDVAMAIHTGMRSAE-E-
Q5YRS2_NOCFA/6-91EAQRAA-HN.RWMAGA.EEMRE-NLDEL----------------------------------REVARRAHTNYTAAV-Q-
A8LV94_SALAI/5-90AGFNQA-MD.SWEAAF.QRVIN-ELIKM----------------------------------LDVMGTTTTGYLQAE-D-
A8M601_SALAI/3-88RSFEQV-KQ.QWALDQ.RRLQV-ALRET----------------------------------AAAVRTSGQGYGTTD-M-
Q5ARS9_EMENI/25-110ESFGQL-LA.KLSASV.YDIQR-VSADI----------------------------------ASTIDATASAYEDAE-S-
O86643_STRCO/16-101KEFDSV-QR.GVNQHL.KKLQD-NLVDL----------------------------------EEVMRMSVKGFTQHE-Q-
Q5YU75_NOCFA/7-92ERFAAG-YA.EVRGGL.SELLD-AMRDT----------------------------------TVALDTSAEAYLGLE-G-
A4T4Z6_MYCGI/5-91PAVQAA-LT.RFSEAA.HQQIQ-LLNEI----------------------------------SENIHTSGIEYDTAD-Q-
A4KMZ0_MYCTU/3-88TAAQAA-VV.RFQEAA.NKQKQ-KLDEI----------------------------------STNIRQAGVQYSRAD-E-
A0QNJ5_MYCS2/3-88TAAQAA-LA.RFHEAA.AKQVQ-ELNEI----------------------------------SANIHTSGTQYTSTD-E-
ESXB_MYCLE/3-88SAALGA-LG.RFDEAM.QDQIR-QLESI----------------------------------VDKLNRSGGNYTKTD-D-
A4FPH3_SACEN/3-88DVFRKL-MD.AFQENA.KKIND-KLNEL----------------------------------SENVKSSGQDYAQRE-E-
Q5Z1J2_NOCFA/6-93DAFNAF-ME.RYYFQA.DKLND-KLMET----------------------------------SEKLIKAGSSFADQD-T-
A3TFP6_9MICO/5-90GAFQNV-QN.AWTVQA.KDLVD-ILDNF----------------------------------RENLVANDKQYTADD-Q-

PF10824

A0PRC6_MYCUA/1-99TSFANA-EA-ARRAAA-NSMNT-TSSKL----------------------------------AAKLRTASSAYQGVD-EQ
A4KM90_MYCTU/1-100DTLNVY-LT-AHNALG-SSLHT-AGVDL----------------------------------AKSLRIAAKIYSEAD-EA
A4TFT9_MYCGI/10-109AAVGEF-QQ-AMLASG-TAVAE-HFTKH----------------------------------AEDLRAAAGRYVAGD-QG
A0R672_MYCS2/1-104WAVADA-VE-ARTAAG-GALRR-VSVEL----------------------------------SEKLRAAATNYDNTD-ST
A4KMY1_MYCTU/1-100DTLQEF-ET-TRSSTG-TGLQG-VTSGL----------------------------------ANNLLAAAGAYLKAD-DG
A4FPN7_SACEN/1-99LMIESV-EQ-NGVETL-RKAVD-AMREV----------------------------------ADNVRATAEEYQAVD-DD
A0PKF1_MYCUA/1-99DAGRDL-LE-LRRQCY-EQQAD-DHADI----------------------------------AQNPRTSAAMWDQHE-QD
A2VMP0_MYCTU/1-100DTLQEF-ET-TRSSTG-TGLQG-VTSGL----------------------------------ANNLLAAAGAYLKAD-DG
A5U9J3_MYCTA/1-100DTLQEF-ET-TRSSTG-TGLQG-VTSGL----------------------------------ANNLLAAAGAYLKAD-DG
Q744T9_MYCPA/1-99DAGREL-LE-LRRQCY-EQQAA-DHADL----------------------------------ADQLTVSAAMWEQHE-QE
A5TY98_MYCTA/1-99DTGREL-LE-LRKQCY-QQQAD-NHADI----------------------------------AQNLRTSAAMWEQHE-RA
A0Q8V7_MYCA1/1-99DAGREL-LE-LRRQCY-EQQAA-DHADL----------------------------------ADQLTVSAAMWEQHE-QE
A1KPV0_MYCBP/1-100DTLNVY-LT-AHNALG-SSLHT-AGVDL----------------------------------AKSLRIAAKIYSEAD-EA
A4TG17_MYCGI/35-139ASLREY-FG-RVSGYA-EQTGA-RRAGM----------------------------------AQNLMAAAGRYEGGD-AD
A0QNK5_MYCS2/1-100AAIGAA-GF-SRDAAA-AAMQG-VSTSL----------------------------------AEKLDEAATNYERTD-AA
A1TH04_MYCVP/1-103LAVTAA-ER-ARSTAG-AKIYE-IATDL----------------------------------EDRLRAAAALYDNVD-YQ
A2VMW8_MYCTU/1-99DTGREL-LE-LRKQCY-QQQAD-NHADI----------------------------------AQNLRTSAAMWEQHE-RA
A5U8T9_MYCTA/1-100DTLNVY-LT-AHNALG-SSLHT-AGVDL----------------------------------AKSLRIAAKIYSEAD-EA
C1AJ24_MYCBT/1-99DTGREL-LE-LRKQCY-QQQAD-NHADI----------------------------------AQNLRTSAAMWEQHE-RA
Q6MZ31_MYCUA/1-87RATVDA-VN-AREATL-REQEE-QHRAM----------------------------------ARQLRIAAARMEEMD-AE
A0QSQ2_MYCS2/3-102NAVRGA-LD-DLTGAM-RQWAT-AADEI----------------------------------AHLLRTSAGRYAAAD-DH
Y028_MYCBO/1-99DTGREL-LE-LRKQCY-QQQAD-NHADI----------------------------------AQNLRTSAAMWEQHE-RA
Y406_MYCLE/4-103DTLKMY-ED-AHRTLG-ESLHT-GGIDL----------------------------------ARVLRVAAAMYCDAD-EI
Y3645_MYCBO/1-100DTLNVY-LT-AHNALG-SSLHT-AGVDL----------------------------------AKSLRIAAKIYSEAD-EA
ESPC_MYCTU/1-100DTLNVY-LT-AHNALG-SSLHT-AGVDL----------------------------------AKSLRIAAKIYSEAD-EA
Y027_MYCTU/1-99DTGREL-LE-LRKQCY-QQQAD-NHADI----------------------------------AQNLRTSAAMWEQHE-RA
A4KN58_MYCTU/1-99DTGREL-LE-LRKQCY-QQQAD-NHADI----------------------------------AQNLRTSAAMWEQHE-RA
A3Q4D4_MYCSJ/1-100NALTGL-LG-ARQGTL-QTTAR-SGDKI----------------------------------AELLQKAAAAYDKGD-ER
A4TFR2_MYCGI/1-98AAFGEF-QT-ALQAAG-AHVAS-RYERH----------------------------------ADDLRDASQRYTSSD-QD
A0PW23_MYCUA/1-100NALSEF-EA-VRARAG-QALQG-VATGL----------------------------------SKDLNKALTAYVNTD-RA
Q5Z2J0_NOCFA/9-106TDFANA-WA-DLRTSG-DQIMA-ALTEL----------------------------------AEKLGVTAHTYQARD-EN
A1KEJ5_MYCBP/1-99DTGREL-LE-LRKQCY-QQQAD-NHADI----------------------------------AQNLRTSAAMWEQHE-RA
A2VM00_MYCTU/1-100DTLNVY-LT-AHNALG-SSLHT-AGVDL----------------------------------AKSLRIAAKIYSEAD-EA
A1UA43_MYCSK/1-103AAAAAA-EE-ARVKAC-AAVQS-VSEAF----------------------------------AGSLELAQAQYLTTD-AN
Q1B4R9_MYCSS/1-100NALTGL-LG-ARQGTL-QTTAR-SGDKI----------------------------------AELLQKAAAAYDKGD-ER
A0R2G1_MYCS2/1-98SAFDAA-HA-ARGGAM-GATQA-ASSKI----------------------------------SDLLRQAAQAYERGD-VT
A4T8Y2_MYCGI/1-99TALGGA-LG-SRARSL-TRTRS-VSETI----------------------------------SELLHQATLAYERGD-EQ
Q7TVH1_MYCBO/1-100DTLQEF-ET-TRSSTG-TGLQG-VTSGL----------------------------------ANNLLAAAGAYLKAD-DG
A1UQ32_MYCSK/1-99SAVSDL-MV-NRDAAL-LHHEH-THRSA----------------------------------AIGLRREAANFVTRD-EI
A1TDN8_MYCVP/1-99TALTGA-LG-SRSGTL-AGTRT-AGDTI----------------------------------SELLHQAALAYERGD-HR
A0QQE6_MYCS2/1-94SAVIAA-ET-ARRAAC-TRMNA-KSEEL----------------------------------AQKLGMARKLYDGTD-MQ
Q1BET9_MYCSS/1-103AAAAAA-EE-ARVKAC-AAVQS-VSEAF----------------------------------AGSLELAQAQYLTTD-AN
ESPF_MYCTU/1-100DTLQEF-ET-TRSSTG-TGLQG-VTSGL----------------------------------ANNLLAAAGAYLKAD-DG
A0R605_MYCS2/34-130PGFAKF-VD-IAHSQA-ERLRT-DLTGL----------------------------------RDRLRTAADVYERRD-HE
Q5YTI6_NOCFA/5-105LSFAAA-QV-LQAKDI-NDLAA-KYNDL----------------------------------SWKAFSAAALFENTD-GE
A4T505_MYCGI/1-96AACAAA-IT-TVLDDT-TSIAD-MARTF----------------------------------GADLRSAAETYEATD-DA
A3PTP9_MYCSJ/1-103EAAARA-EQ-ARADAC-AAMEF-MSTSL----------------------------------QESLLGAIAWYSRTD-SE
A5WU86_MYCTF/1-100DTLQEF-ET-TRSSTG-TGLQG-VTSGL----------------------------------ANNLLAAAGAYLKAD-DG
A1T2U3_MYCVP/1-103LAAQAA-GV-ARAKAG-VAVQV-MSEAF----------------------------------AANLDSAAANYSWTD-QD
A4TEX2_MYCGI/1-100ASLTRA-AA-AQSASL-GRLST-SVDAG----------------------------------RAAATSCAQAYDLSD-GD
A1T184_MYCVP/1-96AACNAA-RT-TVATEM-TKIAG-SARTY----------------------------------GADLRSAADRYDATD-ET
A1KQK0_MYCBP/1-100DTLQEF-ET-TRSSTG-TGLQG-VTSGL----------------------------------ANNLLAAAGAYLKAD-DG
A4T2V3_MYCGI/252-348AALKSA-EL-ARRSAA-EKMHL-ISTDL----------------------------------SAKLGSSATEYSHTE-QQ
A0QNI6_MYCS2/1-100AAVEAV-QH-ARRAAG-TGMVK-VSQEL----------------------------------ETKLDTAAGRYHRTD-ST
C1AI73_MYCBT/1-100DTLNVY-LT-AHNALG-SSLHT-AGVDL----------------------------------AKSLRIAAKIYSEAD-EA
A1UKB8_MYCSK/1-100NALTGL-LG-ARQGTL-QTTAR-SGDKI----------------------------------AELLQKAAAAYDKGD-ER

PF00823

A5WS31_MYCTF/7-165MSMAAA.AS-PYVGWL-STVAS-QAQLA----------------------------------AIQARAAATAFEAAL-AA
A5WSZ4_MYCTF/4-161DLMADA.VE-RYLQWL-SKHSS-QLKHA----------------------------------AWVINGLANAYNDTR-RK
C1AP76_MYCBT/5-162TSMASA.AA-PYVAWM-SATAV-HAELA----------------------------------GAQARLAIAAYEAAF-AA
Q1B0C5_MYCSS/11-168EQFVAT.HL-PMLAWM-TEVVA-KATVA----------------------------------AAAHAEVVASYETAV-IT
A4KDZ8_MYCTU/5-163VAMARA.VA-PYLGWL-ISATA-QAEQA----------------------------------AAQARVAVATFEAAR-AA
Q7TYL4_MYCBO/5-162MQLMEA.AK-PFVRWL-TDLCV-QLSEV----------------------------------ERQIHEIVRAYEWAH-HD
A0PW88_MYCUA/6-164LSMASA.FW-PYVTWT-SMVAT-QAREA----------------------------------ASQATLAVGAYETAL-AM
A5TZB4_MYCTA/5-163LSMAAA.AV-PYVAWM-RATAA-SAEQA----------------------------------AAQAVAAANAYESAY-AA
A4KG95_MYCTU/5-160TIMAAA.VA-PFRAWI-VTTAS-LAELV----------------------------------ADHISVVAGAYEAAH-AA
A4KLV7_MYCTU/4-161DLMADA.AG-RYLDWL-TKHSR-QILET----------------------------------AYVIDFLAYVYEETR-HK
Q7TWP0_MYCBO/5-163VAMAAA.AA-PYAGWL-SAAAA-SAESA----------------------------------AGQARAVVGVFEAAL-AA
Q7TYR8_MYCBO/6-167AAMVVA.AA-PYAGWL-AAAAA-RAGGA----------------------------------AVQAKAVAGAFEAAR-AA
A0Q926_MYCA1/8-164DRYVAA.HM-PYLAWL-QLAGA-LSAEA----------------------------------AAQHQGVATAYTAAL-AA
Q7D7Y7_MYCTU/18-176LSMVAA.AT-PYVAWL-SQAAA-RAEQA----------------------------------GMQAAAAAAAYEAAF-VM
A0PSL4_MYCUA/6-164RSMMSA.VA-PYVTWL-SAAAA-QTETA----------------------------------ASQARAAAAAYETAF-VM
A0PV61_MYCUA/6-164AAMSAA.AA-PHLAWL-SATAA-QAEQV----------------------------------GRQAAAAASAYEAAF-AG
A1KER7_MYCBP/2-160TQYVAA.HG-PYLAWL-EQTAI-NSAVT----------------------------------AAQHVAAAAAYCSAL-AA
Q854W2_9CAUD/132-282NASPK..VF-RHGTWL-INTAE-WAQKL----------------------------------ATNAEKCAGAFDTAQ-SE
Q743Z9_MYCPA/26-175SSMMAA.AA-PQLAWL-SGTAG-RAELA----------------------------------AGQALAAVSAYETAF-AE
Q7U053_MYCBO/7-165EAFVAA.YM-PFLAWL-IQASA-DCVEM----------------------------------AAQQHAVIEAYTAAV-EL
Q8VIY0_MYCTU/6-164AAMAAA.AA-PYAGFL-TTASA-QAQLA----------------------------------AGQAKAVASVFEAAK-AA
Q73UE8_MYCPA/5-162MAMLQS.VQ-PYLLWL-RETAQ-QSAQL----------------------------------ANSAEAAATAFGTVR-ST
A2VEZ8_MYCTU/8-166EWYVAA.HL-PYVAWL-TQASA-DAAGA----------------------------------AAQHEAAAAAYTTAL-AA
A5U1I2_MYCTA/5-163TAMAAA.AA-PYASWL-STAAT-RALSA----------------------------------AAQAKAAAAVYEAAR-AA
Q7TZA6_MYCBO/5-163VAMAAA.AA-PYAGWL-AAAAT-QAEQA----------------------------------ATQAQVMVAEFEAVR-LA
A4KED0_MYCTU/8-166AAMMAV.AT-QYLAWL-STAAA-QAEQA----------------------------------AAQAMAIATAFEAAL-AA
PPE58_MYCTU/4-170EWMADA.AL-RYLDWL-SKHSR-QILRT----------------------------------ARVIESLVMAYEETL-LR
A1UQ41_MYCSK/9-167AAMTMT.AQ-AFAGIL-GMAVA-WFEEA----------------------------------VVQATAIVDAYHLAK-TT
A5U0E2_MYCTA/6-164AAMANA.AG-PYASWL-TAAGA-QAELA----------------------------------ARQARAAAGAFEEAL-AG
A0PQL0_MYCUA/8-165ESYVAE.NI-RYKAWL-AEAAL-VCDEA----------------------------------AAALEAAAAAYSGAL-AE
A1KN13_MYCBP/11-169ELFVAA.YV-PYVAWL-VQASA-DSAAA----------------------------------AGEHEAAAAGYVCAL-AE
A0QE87_MYCA1/5-163AAVTAA.AA-TQVEWL-TATAE-QAAQT----------------------------------GAQLKAAATAYESAY-AM
A0PSJ9_MYCUA/6-164ITMAAA.AA-PYVTWI-NTTGV-QAEQA----------------------------------ATQAKLAAGAYETAS-AA
Q8VIZ3_MYCTU/6-164GLMVAA.AS-PYVAWM-SVTAG-QAELT----------------------------------AAQVRVAAAAYETAY-GL
A0PVU0_MYCUA/5-163TAMTQA.AA-PYAAWL-CTAAA-QSESA----------------------------------ASQAGAVATAFEAAR-TA
PPE45_MYCBO/5-163ASMVAA.VT-PYVAWL-SATAG-QAEQA----------------------------------GMQARAAAAAYELAF-AM
PPE36_MYCTU/6-163QALIQQ.TL-PYVQWL-TTTAE-HAHKT----------------------------------AIQLTAAANAYEQAR-AA
A0PQD0_MYCUA/8-166ASMVGA.SA-PYVAWL-RASAI-RAERT----------------------------------ASQARSAAAAYEAAF-VM
A0QCD6_MYCA1/11-169GAYLAA.HA-PYLAWL-VRAST-DSAAV----------------------------------AAQQEVAAAAYTAAL-AA
Q8VJK7_MYCTU/38-196VAMAGA.AA-PYVGWL-SAAAG-QAELS----------------------------------AGQATAAATAFEAAL-AA
A5U9K1_MYCTA/5-163DKALAA.AT-PMVVWL-QTAST-QAKTR----------------------------------AMQATAQAAAYTQAM-AT
Q8VJP8_MYCTU/8-150DRFVVA.HQ-PFRYWL-THAAT-VATAA----------------------------------AAAHETAAAGYTSAL-GG
Q0S9F2_RHOSR/145-302AAALAK.IT-PFTVWT-AECAE-LAADT----------------------------------AAKAGLEAGAYTTAA-LI
O33085_MYCLE/14-130VAPIAA.AK-PMITWL-.....-..QSA----------------------------------AEQTTTQAEAHRQAM-AS
A1KJY1_MYCBP/5-163AAMAAA.VA-PYLGWL-AAAAA-QAQRS----------------------------------ATQAAALVAEFEAVR-AA
A0PVS2_MYCUA/8-166ASMAAA.AA-PYATWL-AVANE-QARQT----------------------------------AAQARAAATAFETAF-AV
Q73WQ9_MYCPA/13-171AAMAAA.VE-PYVAWA-TGTAA-RAGQA----------------------------------AAQARAAAAAHEAAF-AA
A4KHR2_MYCTU/5-163SAMAAA.AA-PYAAWL-AAAAV-QAEQT----------------------------------AAQAAAMIAEFEAVK-TA
A0QM56_MYCA1/8-166ERYVAA.HA-PYLAWL-ERASA-NSAAV----------------------------------AAQQETAAAAYTAAL-AA
Q50175_MYCLE/23-181TRFVAA.HG-AYLVWL-EQTSI-NNAIT----------------------------------AKQHEIAAIAYSSAL-AA
A0PN58_MYCUA/4-162ELYVAA.HV-PYLMWL-MRASA-TSAQA----------------------------------AAQHEAAAAAYTTAL-AA
Q741D6_MYCPA/5-162TAITQA.VA-PYLAWL-DATAA-RARQT----------------------------------ATQATAAAGAYGLAL-AA
PPE03_MYCTU/6-164AAYVAA.HA-PYLAWL-MRASE-TSAEA----------------------------------AARHETVAAAYTTAV-AA
PPE28_MYCTU/7-165AAMVDA.AA-SYIGWL-STSAA-HAEGA----------------------------------AGLARAAVSVFEEAL-AA
P95182_MYCTU/5-163LAMAAA.AA-PYAGWL-TAAAA-QSAGA----------------------------------AGQARAVASIFEAAQ-AA
Q73TJ3_MYCPA/8-166ESYVAA.HA-PYLAWL-TQASA-DSAGA----------------------------------AARHEAAAAAYTAAL-AA
A0QM63_MYCA1/8-166ESYVGA.HA-PYLAWL-TKASA-DSAAV----------------------------------AAQHEVAATAYTTAL-AT
Q6MWX8_MYCTU/5-163AAMAAA.AA-PYAGWL-GSVAA-AAEAV----------------------------------AGQARVVVGVFEAAL-AA
A0PW45_MYCUA/5-163MAMIAA.AQ-PYLAWL-TYTSE-AAMHA----------------------------------GAQAAASAAAYEAAF-AM
A4KHL9_MYCTU/41-200DSMVAA.VL-PFVGWL-STTAT-LAEQA----------------------------------AMQARAAAAAFEAAF-AM
A0QNJ4_MYCS2/4-162ERAVAA.TM-PMITWL-QTTAA-QAQKR----------------------------------ALQASAQASSYSLAL-AT
A2VII8_MYCTU/5-163TLMVEA.VA-PYVAWM-RATAI-QAEQA----------------------------------ASQARAAAAAYETAF-AA
Q7U123_MYCBO/5-166AAMAAA.AA-PYLSWL-NAATA-RAEGA----------------------------------AAGAKAAAAVYEAAR-AA
A1KJJ9_MYCBP/5-163AAMAEA.VA-PYVAWM-SAAAA-QAEQA----------------------------------ATQARAAAAAFEAAF-AA
A0PSJ8_MYCUA/5-163LAMAAA.VA-PYVTWM-GATAT-QAAQA----------------------------------ATQATAAATAYETAF-AA
A5U0V4_MYCTA/5-163AAMAAA.AT-PYVGWL-AATAA-LAKET----------------------------------ATQARAAAEAFGTAF-AM
Q73ZT3_MYCPA/6-164IAMAAA.AA-PYVAWL-QATGA-QAEQA----------------------------------GAQAKLAAAAYETAF-AA
A0PMC1_MYCUA/5-163EAMANS.IW-PYVAWL-RATAA-ATEQS----------------------------------ASKARIAASAYEAAF-AA
A0QGS4_MYCA1/7-165ASMASA.VA-PYVGWM-STTAA-QAEEA----------------------------------ASQARAAAAAYEAAL-AA
Q7TY90_MYCBO/5-163LAMTRA.AS-PYVGWL-NTAAG-QAAQA----------------------------------AGQARLAASAFEATL-AA
Q73ZT6_MYCPA/6-164MSMLAA.VT-PYLAWL-TDTAT-RAEEA----------------------------------AAQANSAATAYEAAF-AM
A0PNL9_MYCUA/8-166AAMMAV.AT-QYMAWL-GAAAA-QAEQA----------------------------------AAQAAVTAGAFESAL-AA
A0PN64_MYCUA/11-169FQYVAA.HL-PYVAWL-LQASA-DGAGK----------------------------------AAEHEAAAVAYSGAL-AA
Q741X1_MYCPA/30-188LAMASA.FA-PYMAWM-AGAAG-RAAET----------------------------------AGQARLAVEVFEAAF-AM
A0PKJ5_MYCUA/5-163TAMAAV.AT-PHAGLL-QGLAG-QAEQA----------------------------------AAQARVVASAFEAVR-AA
Q73ZT2_MYCPA/5-163LAMASA.AA-PYVAWM-QQTAA-QAAET----------------------------------AAQATAAATAYETAF-AA
A4KH93_MYCTU/8-166AAMTGV.AA-SYARWL-TTAAA-QAEQA----------------------------------AGQAQAAVSAFEAAL-AA
A0QG97_MYCA1/5-163AAMIAA.IT-PYLTWM-RTTGA-QAEET----------------------------------ANNARAAAFAYETAF-AE
A0QE79_MYCA1/5-163LSMAGA.VM-PYVSWL-TAVAE-QCGRA----------------------------------AAQATAAASAFEAAY-AM
Q5Z3L3_NOCFA/10-167IAALSR.LV-GFTGWA-EQQGV-MAAAM----------------------------------GSKAAANATAYTVAS-LA
A0QLP3_MYCA1/8-166AAMMTV.AN-QYVSWL-SAAAA-QAEEV----------------------------------SHQASAIATAFEVAL-AA
A0PN14_MYCUA/8-166QCCIAA.YL-PYLSWL-MQASA-DSAAT----------------------------------AAAHQAAATAYTGAL-AA
A0PMG2_MYCUA/5-163TAMSAA.AA-PYVSWL-NAAAV-RAGEA----------------------------------ALQAKEVVSAFEAAR-AA
Q73ZT0_MYCPA/5-163TSMSAA.AA-PFIAWA-TTTAG-RAEQV----------------------------------ATQARLAAAAYETAF-AA
Q49944_MYCLE/6-163AALAER.VT-PYEKWL-TQNAA-SAELT----------------------------------ATQLTVAANAYETAF-TM
A0QKH5_MYCA1/5-162LAMTRA.LE-PYVDWL-RITAQ-QCQEI----------------------------------ATSVQTATAAFELTH-WT
PPE02_MYCTU/8-166AVYVAA.HT-PYLAWL-VQASA-NSAAM----------------------------------ATRQETAATAYGTAL-AA
A0PSS0_MYCUA/5-163AAMSAV.AA-PYASWL-SAAAA-QAAGT----------------------------------AGRASAAAAVFEAAQ-AA
A0PRN7_MYCUA/8-165QSYVDA.HV-PYLTWL-ATTSA-DYAAT----------------------------------AIEHEVAADAYAGAL-TA
A0PWN5_MYCUA/2-160HQWLAA.HG-PYLIWL-EQAAI-DSSVT----------------------------------AAQHRIAAAGYSSAV-AA
A0QI00_MYCA1/5-162TAMAAA.AA-PFIAWL-DGTAV-QAEQT----------------------------------AAQATAAAAAYDSVF-AA
A1UQ34_MYCSK/124-283TDVVRGHLI-KYANAL-ETSGQ-RADTV----------------------------------AEQANRHAQEVAQAR-SD
A0PMK0_MYCUA/5-163SLMGAA.AA-PYVAWL-GATAT-QAELA----------------------------------ANQARGAAVAYESAF-AA
Q73TD6_MYCPA/11-169EQYAAA.HL-PYLAWL-QQASA-DSAGA----------------------------------AAQQEVAATAYTTAL-AA
A1KPM4_MYCBP/6-164RMMAAQ.AA-RHTGWL-AAAAT-QAEGA----------------------------------ASQAQTMALAYEAAF-AA
A0PPB9_MYCUA/5-163AMMLEA.IT-PYVTWM-RSTAV-QAERA----------------------------------AKQAEAAVAAFEAAF-TG
Q73ZT5_MYCPA/6-164AKMSAA.VT-PYLEWL-HTTAT-QAEQA----------------------------------GAQANAAAAAYQAAF-AA
A0QFD7_MYCA1/8-166EQYVAA.HA-PYQAWL-LESAA-KSSTA----------------------------------ASLHETAAGAYTAAL-AA
A4TG23_MYCGI/4-162TQAQAA.FQ-PYLAWM-GTVIA-MAQQR----------------------------------AAAAAAQASAYSMAV-AT
A1KND1_MYCBP/5-163TSMLAM.SA-PYVEWL-ERTAA-QTKQT----------------------------------ATQARAAAAAFEQAH-AM
Q7TW98_MYCBO/5-163AAMAAA.AA-PYAGWL-SAAAA-RAAGA----------------------------------AAQAKAVASAFEAAR-AA
Q73TI1_MYCPA/8-166EAYVAA.HA-PYLAWL-DQSSA-DAAGE----------------------------------AAQHEIAASAYTVAL-AT
A0PML6_MYCUA/5-163AAMAAA.AA-PYAGWL-SAAAT-RALGA----------------------------------ATQAKAAAAVFESAQ-AA
A0PQG1_MYCUA/5-163LSMAAA.AQ-PLLAWL-SYTAE-SSALA----------------------------------AAQAAASVAAFETAF-AM
A4KM96_MYCTU/6-164ASMVAA.AT-PQVAWL-RSTAG-QAEQA----------------------------------GSQAVAAASAYEAAF-FA
A0PML7_MYCUA/5-163TAMAAA.AR-PYASWL-GTAAA-RAAVT----------------------------------AAQANAAAAVFEAAQ-AA
Q7TXX3_MYCBO/5-163LSMAAA.VQ-PYLVWL-TCTAE-SSALA----------------------------------AAQAMASAAAFETAF-AL
A2VIS4_MYCTU/5-162RTMAAA.AA-PYVAWM-SATAA-LAREA----------------------------------AAQASAAAAAYEAAF-AA
A1KFH6_MYCBP/5-163TAMTGA.AA-PYLGWL-SAAAA-QAQQA----------------------------------ATQTRLAAAAFEAAL-AA
A4T4Z7_MYCGI/14-171ERAVTA.AM-PMVLWL-RMLSL-QAHKR----------------------------------ALQASAQASSWTVAA-TG
A5WSZ8_MYCTF/5-162AFMTDA.AL-RYLKWL-SKHSK-RLWQT----------------------------------ANTIHHLANTYEDIR-QR
A0QJT0_MYCA1/5-163RAMAAG.AA-PYVGWL-HTTAE-RAQQT----------------------------------ATQARAAAAAYELAH-AM
A0QGQ3_MYCA1/5-163AAMAAA.AA-PYVAWL-SATSA-QARTA----------------------------------AEQATAAASAFESAF-AA
A0QJ03_MYCA1/5-150AALGDA.AA-RYIDWL-DGNAA-RGEQA----------------------------------AEGLTAAADAHRSAC-AA
O33009_MYCLE/8-166EAYVIA.YL-PYLGWL-RQASV-DSAVM----------------------------------AAHYETMATAYITTL-AM
A2VIS8_MYCTU/6-164ITMAAA.VA-PYVAWI-SVTAG-QAEQA----------------------------------GAQAKIAAGVYETAF-AA
A0PQA6_MYCUA/5-162TAMAQA.AA-PYAAWL-STTAA-QAELA----------------------------------SAQARAAVSAHAGAF-AA
A0QCD1_MYCA1/6-164VAMAGA.AA-PYFAWL-AEAGT-QAEEA----------------------------------AGQARAAAAAYEAAF-GA
Q741D8_MYCPA/8-166GSMAAA.AA-PYVAWL-SATAG-LAEQT----------------------------------AAQARAAAAAYEAAV-AA
A0PSK0_MYCUA/9-167ASMAAA.AA-PYVAWM-STTAA-QAEES----------------------------------AVQAAAAAAAYEAAF-SA
Q7TW99_MYCBO/7-165VRMGAA.VT-PYVEWL-TTTAA-QARQT----------------------------------ATQITAAATGFEQAF-AM
PPE37_MYCTU/8-166DRFVVA.HQ-PFRYWL-THAAT-VATAA----------------------------------AAAHETAAAGYTSAL-GG
A0PVR6_MYCUA/8-166ASYAAA.HQ-PYVAWL-MRNGA-EAEAM----------------------------------AAEHEAMAAAYCAAL-AA
Q73Y22_MYCPA/7-165VAMTAA.AA-PYVQWL-IIAAA-QAEVA----------------------------------ALQARLAALAFEGAL-VA
A0PQL2_MYCUA/8-166ASYVAA.HL-PYAAWL-TKASA-DYAVM----------------------------------AAEQEVVAAEYVAAL-AA
A0PRS9_MYCUA/5-163AAMLAA.TG-PFIGWL-EITGA-LASET----------------------------------ANQAAAAAAAYEQAY-AM
A5TZH9_MYCTA/2-160ESFAAA.CL-PYLSWL-TQASA-DCAAA----------------------------------AARLEAVTAAYAAAL-VA
Q79FJ7_MYCTU/5-163ASMTAA.AA-PYVAWM-SVTAV-RAEQA----------------------------------GAQAEAAAAAYEAAF-AA
SRA_MYCLE/6-164DMLASR.VS-TFVAWL-DGNAE-NAGLI----------------------------------ARVLHAVAYAFEEAR-AG
A1U9U3_MYCSK/8-166EQYVAA.HT-PYLAWL-AQASA-NSAAT----------------------------------AAQHETAAAAYTTAL-AT
Q73U78_MYCPA/14-172ASYVAA.HG-PYLAWL-TRASA-HSAAA----------------------------------AAQHETAGTAYTAAL-AA
A0PQA4_MYCUA/5-158VPVMRV.IA-PHWALL-TALAR-HANQT----------------------------------AVQAETAAQAYEQAA-AK
Q9CCQ9_MYCLE/7-165EMFVGS.CM-PFLAWL-MKAAA-DYMDV----------------------------------ATQQEVVAAAYAAAV-EA
Q745G2_MYCPA/8-168AASAAN.VT-MLNASL-HGLAG-WVDVK----------------------------------PAVVATAISAYQMAY-GS
A0QGS6_MYCA1/6-164LSMVSA.IT-PYVGWL-SAVAA-QAEET----------------------------------ASQGRAAAAAFEAAF-AM
A5WSZ5_MYCTF/1-158EWMADA.AL-RYLDWL-SKHSR-QILRT----------------------------------ARVIESLVMAYEETL-LR
A0PSP2_MYCUA/8-166ESCMAA.YL-PYLQWL-AQNST-VCGES----------------------------------AAQLEIVATAYISAL-AA
Q73V32_MYCPA/5-162DAMAFA.AA-RYLTWL-RATAE-QTKQT----------------------------------AMQARTAAAAYEQAY-AM
A0PM57_MYCUA/5-163VAMGTA.AA-SYLGWL-NAAAA-HAEQA----------------------------------AAQAEALVAEFAAAQ-SA
Q741E7_MYCPA/8-166EAFVAA.HV-PYLAWL-LQNST-NSTAA----------------------------------AREAETVAAAYTAAL-SA
A0PSL2_MYCUA/5-163ATMAQA.VE-PFMTWM-SVTAG-QAEHA----------------------------------ATQAQSAAAAFETAF-AA
A0PLH5_MYCUA/8-165QSYAAA.NE-RYLAWL-TQVSA-DYARQ----------------------------------ATLVDVVVAAYGAAV-AA
A0PL97_MYCUA/8-140QSYVDA.HV-PYLTWL-TKTSA-DYAVT----------------------------------AAEHEAAAGAYASAV-AA
A0PMF2_MYCUA/6-164AAMNAV.AT-PYAQFL-SAAST-QAAGA----------------------------------ASQAKAVAGAFEVAR-AA
Q5Z1M6_NOCFA/16-175RDVLEK.VT-GLRDWL-IEAAG-AAADH----------------------------------AAKAHAQAAAYEVAR-LA
A0PS83_MYCUA/8-165DDYVAA.HT-PYVVWL-DHAAI-VCQRA----------------------------------GAALQMMVAAYGDAL-AE

PF04740

YEEF_BACSU/2-210SNIKAF-YHD.HVGVA-DQWID-YIDMKIAFF.NSIAGAAEDKGL.SDAYIEESFLEHEL..ANANKKSKSIMSEQK-KA
YXID_BACSU/2-205DAIRTF-YEECHKPFL-LFFGI-FIDEYKKVL.KQTQHAISSVESNSHGMIAEAFLSHDA..RHGVKHAREVTEQLT-DA
A8FDL4_BACP2/2-210DNIKAF-YED.LALYT-DTYLD-FIDMQKAFL.DGVKGKLDDESLGGSTFIDEHFLDAQL..KQGIQNNKDMVKEQK-EA
Q65L45_BACLD/27-230DAIRNF-YKECHTPFL-QFFET-FIEEYQSAL.KKIKSALNSLEPQHNGYISQAFLDNEL..EQGVKDADRTTKRLV-SK
Q5WBP9_BACSK/1-209AAIKDY-FTTLHLPVL-LFFQQ-FIETHISQL.ETVKDNLLSYDGDANTLVRTEFLN.EV..KMDLNRVINYTRDSA-NI
Q5WJ65_BACSK/2-209EAIKDH-FATLHLPVL-AAFQL-FIGQYIEQL.KQIRSNLLNFES.SSALIREEFLA.DV..KNGLDRVERYAIADA-TA
Q4EUK8_LISMN/2-192DASKNY-YQMTYFPLC-DAIIE-AMDESEERLGQYIQDFHAEVDSSPDAKIDADGLY.EL..GKMIDRIESKKEALA-QR
Q65EU5_BACLD/2-205DAIRAF-YEECHTPFL-QFYDT-FIEEYSSTL.KKMKSALNSLEPNHNGFISQSFLEHEL..ENGLNAADRTTKHLV-SK
A0AGW3_LISW6/2-192DASKNY-YQMTYVPLC-KAILE-VMEESQERLRQYMDDFHDQVDSSPNARIDEEGLF.EL..GQQIDRLEAKKETLA-QR
Q9KAE5_BACHD/3-214EALLRN-YQELQLPAI-RAARA-FISSMKEMG.EKLRSLILSFEPSENGMVSEDFYRNQV..TRGYDRFEQFMEQNK-AE
Q92CG1_LISIN/1-200DASRAY-LQEAYKPVQ-QKALE-VNKLMTKILSEYIADAEAQFG..ANGMIDIQSIEMEY..KRSFNQVSDDEMREY-RD
Q8EMS0_OCEIH/2-205ESVRTF-YRETHLPLQ-QYVLD-MIDNYDLNL.RKIRMNLYQIEPSDTGWIDEEFLRRDM..EQSLKKAGNVTMSLT-DS
A0AFZ4_LISW6/5-192DSAKNY-LTTTFIPLA-NGIIL-ICESLEKAAKSFPKSYRNEVDGIS...LQEEILRNQI...NRLTILAQNIENIE-NA
A8FFY0_BACP2/2-205QAIKDF-YMECHIPFL-QFFQI-VIEEYSGAL.KKTKQALHAFESNPNGFISQSFIEQEL..DQGLKKAERTISDIV-SD
Q65NL2_BACLD/2-209DAIKAF-YRD.LSGVV-DGWLD-LTDMQIQFL.NGVSSAAENAGLSEDTFVDVQFLEQEL..ANVHIHSQNMVSAQQ-QE
Q5WD67_BACSK/2-203EALKNF-YANNHVPLL-SYWTM-ACQQVKIAT.AKMRMNALSFES.SDAVIDESFIEGEV..IPQLEKNQRRIQQHQ-DR
A7Z5G9_BACA2/2-210DNIKAF-FQD.HAGVT-DSWLN-LIDMKIAFL.NSISGKVSDAGL.ADSFVEESFLEHEL..THAKNTSQAIMQEQR-NE
Q9K9X1_BACHD/2-213KGVIYN-HAHVQLPTI-RSIRA-FLISFSDTL.EKIKSKINEYEPASNGSVSEDFWKNQL..PKAYDRYEETLEERE-AA
A0AFU0_LISW6/2-192ESSKNY-FQMTYIPLC-DTIIE-AMNESEERMKRYIQDFHDQVDPSPNAKIDADGLY.EL..GQMIDRIESKKEALY-QR
A7Z9J4_BACA2/3-210DNIKDF-FQG.QAEIA-DSWLT-LVSAQIAFL.NGISGDIKDQEL.SDTYVETSFLEHEL..PNADLKASEIVSAHK-AE
A0AEP1_LISW6/3-194QTAKAY-LNEVHGTVM-ILLIT-ALTQVREMVVEDIDRFQQDVDSAPTTKIDQIYIK.EL..KKKIEKNYSEFKIIH-ED
YQCG_BACSU/2-210NNIKSF-YED.QAGIA-DQWID-LIEMKISFL.TSIPGFLEDANL.SDAYIEETFLAHEL..ANAYTKSKSIMSEQK-KA
A7Z3I9_BACA2/2-210NNIKSF-FKD.HAGVT-DSWLD-LIDMKIAFL.TSLPGKVEDAGL.SNSHVEESFLEHEL..THALSKSKAIMEEQK-KD
Q92ER0_LISIN/6-207TAGKDL-FVNLVLPTI-EKVTS-ACDAIEHEL.NRYQSTNSIVS..GEGYLDEDILKQQIEAKKDMNTSIEKTVTIM-NM
O64023_BPSPB/2-210DNIKAF-YHD.HVGVT-DQWID-LIDMKIVFL.SSISAKLEDAKM.SDAYIEESFLEHEL..VNAYTKSKSIMSEQK-KA
Q4EV84_LISMN/2-201SASQSY-FASSYPSIA-QSILE-ALEESEERLAQYIREFGSQVDSSPSARIDAEILQ.EA..MAKVASLKRKEEDLH-RQ
Q65D27_BACLD/2-211NAIKEH-FSVLHLPVL-LYFQH-FIDQYIQNL.KDIKAKIRTYES.TEGFVKEEFLTHDV..KKGLTELKRQTNDTV-DS
Q8ELE0_OCEIH/2-205TAIRSF-YNDVHQPFL-TFLHQ-SMLEYKDSL.EAMKQEVQSFEPHQHGFISESFLENEL..DPSFDKAKQKTSYLT-DE
Q8YA28_LISMO/2-201STSKQY-FSSTYTSIC-QSIIE-ALDESEERLAQYIREFGSQVDSSPSARIDAEILQ.EA..MAKVSQLQRKEEDLH-RQ
Q8EL62_OCEIH/2-205SSIRAF-YKDIHAPLA-VYLEG-IVRDYHDIL.RQIQQLLYELDSSEHAYIDEDFLKSEM..ERQLKKAKEQTAQLT-DE
Q5WKM5_BACSK/2-210EAIKNH-FSQLHLPAL-RFFVT-YLEQYIEQL.GKMKNNLLNFEA.SNALLRQDFLTETI..PNGINRIKQNAEAST-EA
Q92CT5_LISIN/2-196SASKGY-YAATYLPLC-ASIKQ-ALHVSEESLRKYITDFHSQVDSSPSAKIDAEGLY.EL..DQKINRLENKLEHIQ-LE
Q65NH2_BACLD/2-205EAIRSF-YEECHTTFL-LFYES-FISDYKGLL.EKTKSALHSLEPNQNGFISQSFLENEL..HDGVSQAESLTGRLT-SK
Q8ERI3_OCEIH/3-199TNAKNY-FNDLHKTIL-VTFEH-LFTDLDDSLKKHLEMFQSRVDTSESAIIVSDYVK.DL..ELDIKEDWEKLSLEQ-DK
Q65H85_BACLD/2-209DNIKDF-YKG.QAEIV-DSWLK-LVEAQIAFF.NGVSGDIKDKKL.SDSYVEVSFLDHEL..KNADLKATEIVSGLK-LE

PF00934

A5WTG4_MYCTF/1-94ALFGAH-AQ-AYQTIS-AQAAT.FHAQF----------------------------------VQTLSAGAGAYANAE.AA
A5WKB5_MYCTF/1-94ALFGAQ-GQ-AYQAAS-AQAAA.FYAQF----------------------------------VQALSAGGGAYAAAE.AA
C1AQP8_MYCBT/1-94SIFGAY-GR-QCQVLS-AQASA.FHDEF----------------------------------VNLLKTGATAYRNTE.FA
A5WMC3_MYCTF/1-94SLFSGY-AR-DYQALS-AQMAR.FHQQF----------------------------------VQALTASVGSYAAAE.AA
Q79FU2_MYCTU/1-93ALFGSH-GQ-HYQAIS-AQVAA.YQQRF----------------------------------VLALSQAGSTYAVAE.AA
A4KGC0_MYCTU/11-104AHFAAH-AA-MYQSVS-ARAAA.IHDQF----------------------------------VATLASSASSYAATE.VA
A4KFE3_MYCTU/1-94ALFSSH-GQ-QYQAMS-AQAAA.FHARF----------------------------------VQALAGAMGAYAAAE.AA
PG46_MYCTU/1-94ALFGSY-AQ-SYQAFG-AQLSA.FHAQF----------------------------------VQSLTNGARSYVVAE.AT
PG34_MYCTU/1-94DLFGAH-AQ-AYQALS-AQAAL.FHEQF----------------------------------VHAMTAGAGAYAGAE.AA
A5WJ08_MYCTF/32-125ALFSSH-AQ-AYQAAS-AQAAA.FHAQV----------------------------------VRTLTVDAGAYVSAE.AA
A5U0D2_MYCTA/1-94ALFSAH-GR-AYQVAS-AQAAA.VHAQF----------------------------------VEALSAGAGAYASAE.AA
A0PVK0_MYCUA/1-94ELFGGF-GR-EYQAMG-ARVAL.LHDDF----------------------------------VRALTAGGSAYGQAE.AL
A5U7B2_MYCTA/2-95ALFSGH-GQ-DYQALS-AQLAV.FHERF----------------------------------VQALTGAAKGYAAAE.LA
A0PSY5_MYCUA/1-94ALFPGH-AL-DYQALS-TQVAA.FHTQF----------------------------------VEAVTGAGNAYAAAE.AA
Q7DAD0_MYCTU/1-94ALFSEY-AR-ECQEVL-KQAAA.FHGEF----------------------------------TRALAAAGAAYAQAE.AS
A4KGY4_MYCTU/1-94ELFGAH-GQ-EFQALS-AQASA.FHDRF----------------------------------VRALSAAAGWYVDAE.AA
A0PTY2_MYCUA/1-94ALFAAH-AQ-GYQSIS-TQMSA.MHDQL----------------------------------VQTLSASSASYAGAE.AS
A5WQ97_MYCTF/1-94GLFGAH-AR-QYQALS-VQVAA.FHEQF----------------------------------VQALTAAAGRYASTE.AA
A5U225_MYCTA/1-94SLFAAH-GQ-AYQAVS-AQMSA.FHAQF----------------------------------VQTFTAGAGAYASAE.AA
A5WKZ9_MYCTF/1-94ALFSSY-AR-DYQTLS-VQVTA.FHVQF----------------------------------AQTLTNAGQLYAVVD.VG
A0PN15_MYCUA/1-94ALFSDH-AL-QYQAVS-AEAVA.FHGRF----------------------------------VQALTGGVQMYAAAE.TA
A0PKU3_MYCUA/1-94ALFSFH-GQ-SYQTLG-AQAEA.FHAQF----------------------------------AQLMANGAGTYASAE.AA
A1KHM5_MYCBP/1-94SLFGAH-GQ-AYQAVS-AQMSA.FHAQF----------------------------------MQALTGAGGAYAAAE.AV
A0PN06_MYCUA/1-94AFFGAH-AQ-AYQALS-EQASA.FHLQF----------------------------------VQAMTAGAGAYAGAE.AV
Q73ZU4_MYCPA/1-94AQFAAY-AQ-MYQAVS-AQAAA.IHEAF----------------------------------VNTLSTSSVSYAATE.AA
Q79FE6_MYCTU/1-94ALFGAH-AQ-AYQALS-AHVAA.FHDQF----------------------------------VHTLTAGAGSYMAAE.AA
Q7U161_MYCBO/1-94ALFSAH-GR-DFQALS-ARAAA.FHHEF----------------------------------VQALAAGAGSYAVAE.IA
Q9L8K3_MYCMR/1-94HLFGAY-GQ-EFQALN-GRAAA.FHAEL----------------------------------VRLLNGGAASYLSAE.VV
A0PUM7_MYCUA/1-93QLFSAH-AQ-DYQTLA-GQAAA.FHEQF----------------------------------VQNLTASATSYFGID.AA
Q8VJ19_MYCTU/38-131SLFSGH-AV-SYQQVA-AQATA.LHDQF----------------------------------VQALTGAGGSYALTE.AA
A5TZR2_MYCTA/1-94AVFSSY-AQ-QYQALS-AAAAA.FHDQF----------------------------------VRALAAGAGAYAGAE.AA
Q79FP2_MYCTU/1-94TLFGSH-AR-EYQAIS-TQVAA.FHDRF----------------------------------AQTLSAAVGSYVSAE.AT
Q79G09_MYCTU/1-94ALFEAY-AQ-EYQALS-AQALA.FHDQF----------------------------------VQALNMGAVCYAAAE.TA
A0PST5_MYCUA/1-94SLLGTH-AQ-TCQTLS-AQVAA.FHRQL----------------------------------VAGLHSGAAAYTAAE.AV
A0PU40_MYCUA/1-94ACFEAQ-AE-AYRTFG-AHTAA.LHDQI----------------------------------VRALTAGAGGYSAVE.AA
A0PP63_MYCUA/1-94AAFWSA-AE-EFQELG-AQAAA.FHEQI----------------------------------VALLNTAAAAYAGAE.AT
A0PQV1_MYCUA/1-94ALFSSH-AQ-QYQSLS-VQVAA.YHDQF----------------------------------VRALAAGGASYSLAE.AA
PG36_MYCBO/1-94ALFGAQ-AQ-SYQAVS-AQAAA.FHDRF----------------------------------VQLLNAGGGSYASAE.IA
Q53504_MYCTU/1-94ALFGAH-GQ-AYQALS-AQAQA.FHAQF----------------------------------VQALTSGGGAYAAAE.AA
Q6MWW8_MYCTU/1-94ALFGMY-GL-EYQAIS-AQVAA.YHQQF----------------------------------VQTLRTGAASYMLAE.AT
A5U1B3_MYCTA/1-94ALFSAH-AG-QYQQLG-ARAAL.FHEQF----------------------------------VQALTGAASAYASAE.AT
A0PW15_MYCUA/1-94AVFSGH-AL-DYQALS-AQMAG.VHQRF----------------------------------VQALTASGSSYAAAE.AA
A0PVP7_MYCUA/1-94SLFADH-AQ-DYRTIS-LEANA.FHQQF----------------------------------WRSLSGAAASYSGAE.AA
A0PLN2_MYCUA/1-94SLFSSY-GH-AYQSLS-AQAAQ.FHSQF----------------------------------VQAMQAGAGSYATAE.AS
Q6MWX5_MYCTU/1-94ALFGQH-AQ-AYQALS-AQATI.FHDQF----------------------------------VQALTSGGNLYAAAE.SH
A5TZV8_MYCTA/1-93ALFGTH-AQ-EYQTVS-AQVAT.FHDRF----------------------------------VQTLSAAASSYVAAE.AV
A4KK43_MYCTU/1-95PLFTAY-GT-LYQQVS-AEAAA.VYDLF----------------------------------VKTLGVSAGTYAATE.AA
Q7U0H3_MYCBO/1-94MLFSMH-GE-LYKAIA-RQAHV.IHESF----------------------------------VQTLQTSKTSYWLTE.LA
Q73SD0_MYCPA/1-94ALFDAH-SQ-VYQALS-AQAAA.FHSQF----------------------------------VQLMNGGALQYAVTE.AA
A5U8I8_MYCTA/1-94ALFGGL-GL-EYQAIS-AQVAA.YHQRF----------------------------------VQALSTGAGAYASAE.AA
A1KEY0_MYCBP/1-94ALFSAY-GR-EYQAVV-KQAAA.FHSEF----------------------------------TRTLEAAGNAYAHAE.AA
A0PPR6_MYCUA/1-94SLFGSH-GQ-SFQAVS-LQAAA.FHERF----------------------------------LQTLFGGAAAYTAAE.AA
A0PW44_MYCUA/1-94ALFTAY-GT-YYQQVS-ADAQA.MHDMF----------------------------------VNTLGASAGTYGATE.NL
A0PVT8_MYCUA/1-94AVFSGH-GQ-AYQVLS-AQVAA.FHQRF----------------------------------VEALNAGAQSYVGAE.AA
A5WSR4_MYCTF/3-95ALFGTH-AQ-EYQALS-ARVAT.FHEQF----------------------------------VRSLTAAGSAYATAE.AA
A0PMJ9_MYCUA/1-94TQFATH-AA-MYQMVS-AKAAA.IHEHF----------------------------------AATSATSAASYLSTE.TA
A2VPQ0_MYCTU/1-93TQFRTH-AA-TYQTAS-AKAAV.IHEQF----------------------------------VTTLATSASSYADTE.AA
A4KFL9_MYCTU/1-94ARFTAH-TK-HYRVVS-KPAAL.VHGMF----------------------------------VALPAATADAYATTE.AV
A4KKS6_MYCTU/3-96VGFSAL-GS-EHAAIA-GEGVE.ELGRS----------------------------------GVAVGESGIGYAAGD.AV
A2VKU7_MYCTU/1-94RLFSDY-AT-HYQSLN-AQAAA.FHHSF----------------------------------VQTLNAAGGAYSSAE.AA
A5U3I5_MYCTA/1-94ALFSGH-AQ-AYQALS-AQAAL.FHEQF----------------------------------VRALTAGAGSYAAAE.AA
A0PML9_MYCUA/3-96TLFDNY-AQ-GYQAVS-RQTAA.FHDAF----------------------------------AQTLFAASDSYVRAE.AA
Q741T4_MYCPA/1-94AIFSAY-GT-QYQAIA-SEAQT.LLEQY----------------------------------SQTLGISSNSYGDTE.AV
A0PVP0_MYCUA/1-94GMFAAH-AQ-AYQALS-TQADL.FHAQF----------------------------------VQLLNSGASAYTGAE.AA
A5WSZ7_MYCTF/1-94GRILEH-MA-QYQQIS-SQALE.YLRGF----------------------------------SQGLAENAEAYRLAE.AQ
A2VJ92_MYCTU/1-94ALFARF-GQ-EYQAVS-AQASA.FHQQF----------------------------------VQTLNSASGSYAAAE.AT
A0PKS2_MYCUA/1-94SLFAGH-AQ-AYQSLG-GQVAA.FHQQF----------------------------------LEGLRGASGAYVAAE.AA
A1KH04_MYCBP/1-94SLFSGH-AQ-AYQTLG-TQAAA.FHERF----------------------------------IQALSTAAGAYGSAE.AA
A1KJL7_MYCBP/1-94TQFNFH-AA-MYQAVG-AQAIA.MNEAF----------------------------------VAMLGASADSYAATE.AA
A2VLI5_MYCTU/49-142ALFGAH-AR-SYQTLS-TQAAA.FHSRF----------------------------------VQALTTAAASYASVE.AA
A0PT39_MYCUA/1-94ELFGNH-AQ-QYQALS-AQMAR.FHDQF----------------------------------VRSLSGAAQTYARAE.AT
Q49943_MYCLE/2-95HFFSGH-GR-QYQAHA-SQGAT.NHQDL----------------------------------IQSLLTSSSAYAGTE.TA
A0PQY4_MYCUA/1-94ALFAGH-AR-EYHSLS-GHFGA.FNQQF----------------------------------VQALNSASGAYASAE.AQ
A0PU10_MYCUA/1-94ALFNAH-AE-QYQALS-VRVAE.FHESF----------------------------------TRALTAGSTAYATAE.AA
A2VKF6_MYCTU/1-94TFLVEY-AR-KYRQTI-AAAAV.VLEEF----------------------------------AHALTTGADKYATAE.AD
A0PQL4_MYCUA/3-96ALFEAH-GN-AYQTLG-AQTLA.LHEQF----------------------------------VKLMSGGAAQYAAAE.AA
A0PPD4_MYCUA/1-94ALLSSH-GA-QYQALS-AQAAQ.FHQGL----------------------------------MQLLNSAGGAYAGAE.AA
Q7D7A7_MYCTU/1-94ALFGAR-AQ-AYQAIS-AQAAL.FHDRF----------------------------------VQILQEGAAAYAMAE.AA
A1KLI5_MYCBP/1-94ALFSAH-AQ-EYQALS-AQAAA.FHDQF----------------------------------VHTLTAAARWYTATE.IA
Q9L8K4_MYCMR/1-94QVFGAY-GQ-EFQALN-AQAAA.FQAEF----------------------------------EGLLSGGAAAYVSAE.AL
A4KHS6_MYCTU/1-94ALFGAH-AR-AYQALS-AQAAM.FHEQF----------------------------------VRALAAGGNSYAVAE.AA
A5U308_MYCTA/1-94RLFGAY-GQ-QFQALN-ARAAT.FHAEF----------------------------------VSLLNGGAAAYTGAE.AA
A0PTJ3_MYCUA/1-94ALFSGH-GQ-AYQTLS-AQANA.FHAQF----------------------------------LQALTNAGGAYAAAE.VA
A0PVH2_MYCUA/1-95AGFSAV-GV-EHSAMA-TEGIE.ELGRS----------------------------------GVGVGEAGISYTVGDEAA
A1KKK5_MYCBP/1-94ALFGSH-AQ-GYQTLS-AQLAA.YHNQF----------------------------------VRALNAGAGSYASAE.AA
A5TYM6_MYCTA/39-132TLFGAY-GQ-QFQAIS-AQVAA.FHNEF----------------------------------TQRLAAAANAFVNAE.AT
A0PUM0_MYCUA/1-94HLFSEH-AE-DYQKVA-SQAVA.FHDRF----------------------------------VAQVNASAGGYASAE.AA
Q5Z3L2_NOCFA/2-87QHFNKA-AA-THDHSI-AQGILELHH..----------------------------------.......AANVLRMQLAT
A2VM07_MYCTU/1-94SQFAAH-AQ-LYQAIS-AEAMA.VQEQL----------------------------------ATTLGISAGSYAATE.AA
Q7D6Z7_MYCTU/10-103ALFANY-GR-EYQTLS-VRFAS.LDQQF----------------------------------AQALNSAAASYQTAE.AT
Q7VEQ9_MYCBO/1-94LFFSSH-GQ-QYQVQA-ARGTA.FHRKL----------------------------------VRTLANGALAYEEVE.IA
A0PT20_MYCUA/1-94ALFSGH-AL-DYQALS-TQMAG.FHQQF----------------------------------VTALNSAGASYAAAE.AA
A5WMF0_MYCTF/6-99ALFGAH-GQ-TYQVLS-AQAAA.FHSQF----------------------------------VQALSGGAQAYAAAE.AT
A0PVD2_MYCUA/1-81TVLSSH-GQ-GYQVLS-ARALE.FHTRL----------------------------------AQALSAGAGAYSGAE.AS
A0PUN3_MYCUA/1-78A.....-..-......-...ST.FHTQF----------------------------------VRALNLSGGAYAAAD.VA
Q73ZT7_MYCPA/1-94ARFAQH-GQ-AFQAVS-AEAAA.IHEMF----------------------------------VTTLQTSAGSYAATE.AA
A0PRQ0_MYCUA/1-94SFFAAH-GQ-AYQTMA-GQVAA.FHTEF----------------------------------QQALAQAGNAYVQAE.AA
A0PPD7_MYCUA/2-95RMFGAY-AQ-EFQTLS-ARMEQ.FYTDC----------------------------------VRALLTGAGAYSGAE.AA
A0PLN3_MYCUA/1-94AMFDAQ-GQ-AYQLLS-ARAAA.FHEQF----------------------------------LQALSGGGASYAAGE.AA
Q9L8K5_MYCMR/1-94QLFGAH-GQ-EFQVVS-AQLRG.FHDQL----------------------------------VRLMRAGAAAYASVE.AT
A0PSJ0_MYCUA/1-94ALFSGH-GQ-AYQQIS-TRVAE.FHAQF----------------------------------ERVFAAGVQAYSGAE.AA
A0PSI6_MYCUA/1-94ALFDGH-AQ-AYQLIG-AQAAE.FHERF----------------------------------VRAMAAGAASYATAE.AA
A0PNR1_MYCUA/1-94AVFCAH-AQ-DYQALS-AEATQ.FQTRF----------------------------------VSALSNAGSAYAAAE.AA
A0PVM5_MYCUA/1-94ALFGGH-AQ-EYQALV-ARAEA.FHQQF----------------------------------VQLMTTGAGSYAAAE.AA
A0PTY1_MYCUA/1-94ALFGWH-AQ-TYQSLS-AQATS.FHDQF----------------------------------VQTVASSGTSYWSAE.AT
A5U9E1_MYCTA/1-94QLFGRY-GQ-EFQTVS-NQLAA.FHTEF----------------------------------VRTLNRGAAAYLNTE.SA
A0PVS1_MYCUA/1-94ARFSAH-AQ-LYQMVS-AQAVA.IHDRF----------------------------------VAALAAGAQSYEAAE.AA
Q7D879_MYCTU/1-94AMLGAY-AR-DFQGIS-AQIAG.FHNQF----------------------------------VGALRGGAAAYASAE.AA
A0PR61_MYCUA/1-94AQFSGH-GL-AYQQLS-TQVGV.FSDQF----------------------------------VAALSASASGYSAAE.AA
A5U1M1_MYCTA/1-95ALLSAH-AQ-GYQQLS-RQMMTAFHDQF----------------------------------VQALRASADAYATAE.AS
A0PS20_MYCUA/1-94SLFSGH-GQ-AYQRLA-NQLMA.FHDQF----------------------------------AQALTAGASAYTGAE.AT
A0PVW6_MYCUA/1-94ALFTGH-AQ-AYQWLG-AQAGA.FHSQF----------------------------------IQALTGSGSAYAAAE.AA
A0PMQ8_MYCUA/1-94ALFSSH-GE-IYQRLS-SQLST.FHDQF----------------------------------AAALNTSANSYASAE.AN
A3PSJ4_MYCSJ/1-93ATFAAE-GA-ETLALN-TFAQE.ELSRA----------------------------------GAAFTEISGIYAAVD.AA
Q79FJ9_MYCTU/3-96ALFATH-GQ-AYQELS-AHAVA.FHEQF----------------------------------VQLMSAGAAQYASAE.AA
A0PLN5_MYCUA/1-94ALFSGH-GQ-AYQAIS-AQAAA.FHDQF----------------------------------LRALTGAGGAYAAAE.AA
A2VG56_MYCTU/1-94ALFGAH-AR-EYQAAA-AQAAA.YHEQF----------------------------------VHRLSAAATSYAVTE.VT
A0PRW2_MYCUA/1-94SLFGAH-AY-NYQVLS-AKAAE.FHDRF----------------------------------VEILQTSAQAYGSTE.AT
A1KEU5_MYCBP/1-94ALFSGH-AQ-AYQALS-AQAAA.FHQQF----------------------------------VQTLAGGAGAYAAAE.AQ
P71664_MYCTU/1-94ALFSGH-AQ-TYQALR-TQAAA.FHQQI----------------------------------VQTLTSTAGAYASAE.AA
Q73WT4_MYCPA/1-94AQFSAY-GT-WYQQVS-AQAKA.IHQTL----------------------------------VQNLDTNADSYGATE.AA
A0PNH3_MYCUA/1-94ALINSH-GL-GYQSIS-QQTTA.FHDRF----------------------------------VQTVNAAAASYTTTD.LT
A0PPN9_MYCUA/1-95TLFCGY-AR-DYQNLS-TQLAS.FHQQF----------------------------------LQALTGSANSYTAAE.AA
A0PV62_MYCUA/1-94AQFAAH-AR-VYQAIS-AQAAA.VQDEL----------------------------------VTVLGISAGSYAATE.AA
A0PL58_MYCUA/1-94AHFAAH-GA-MCQTLS-AQAQA.IYEMF----------------------------------VTTLQACGGSYAETE.AA
A0PVM4_MYCUA/1-94SLFAGY-GQ-AYQSIS-LQANA.FQAQF----------------------------------IQAINGAGGAYVAAE.AA
Q744A0_MYCPA/1-94ARFSRH-GL-AFQEVS-AQAAQ.LRDQF----------------------------------ATTLGISAGSYAAAE.IA
Q79FB3_MYCTU/1-94ALFGMH-GQ-AYQALS-VQASA.FHQQF----------------------------------VQALTAGAYSYASAE.AA
A1KI31_MYCBP/1-94SLFSGN-AQ-AYQALS-AQAAA.FHQQF----------------------------------VRALSSAAGSYAAAE.AA
A0PM18_MYCUA/1-93ALFVAH-GR-EYESLS-AQVAL.FHRRF----------------------------------VQMLAAASGGYAEAE.AA
A0PMR0_MYCUA/1-93SWFGGF-AQ-EHQTAT-AQAGA.FHERF----------------------------------LQTLAASAASYEHAE.AA
Q7TW48_MYCBO/1-94ALFGAH-AQ-EYQRLS-AQAAG.FHAQF----------------------------------VQALNAGVNSYASAE.AA
A0PVL1_MYCUA/1-95ALFADH-AQ-EYEVVL-EEFLDGLQGGS----------------------------------GRTLDAAAKAYASAE.AA
A0PMR7_MYCUA/1-94KVFSAY-GQ-EYQAAI-AQASA.FHTEF----------------------------------TRALAAAGAAYAQAE.AA
A5U8I2_MYCTA/1-94ALFSQH-AQ-GYQAAA-AQVAA.FHSRF----------------------------------VQALTAGAGAYAFAE.AA

PF10817

Y2078_MYCTU/1-104QTFHDA-VGAAHAQQM-RNLHA-HRQALITV-------------------------------GEKARHAATGFTDMDDGN
A0PX53_MYCUA/1-104DAFRNS-VHSAHAQHV-RNLQA-HQEALTAV-------------------------------GSNAHLAAKGFTAMDGHN
Q73RU9_MYCPA/1-104DAFHSA-VVVAHEQHV-QNLQA-HSETLTGV-------------------------------GTKAHHAANGFTNMDQQN

PF06013

Q97MZ9_CLOAB/4-89--------------------------------------------------------------------------------
A9B0A6_HERA2/4-89--------------------------------------------------------------------------------
Q92FP7_LISIN/3-89--------------------------------------------------------------------------------
Q65FP7_BACLD/20-106--------------------------------------------------------------------------------
Q3EVF5_BACTI/10-96--------------------------------------------------------------------------------
A7GQF4_BACCN/5-91--------------------------------------------------------------------------------
A5IPF7_STAA9/6-92--------------------------------------------------------------------------------
Q2ESP2_BACTU/5-90--------------------------------------------------------------------------------
Q7CMD2_BACAN/4-89--------------------------------------------------------------------------------
Q635B3_BACCZ/3-88--------------------------------------------------------------------------------
A0RJQ0_BACAH/3-88--------------------------------------------------------------------------------
Q81TJ4_BACAN/3-88--------------------------------------------------------------------------------
A0RLV8_BACAH/3-88--------------------------------------------------------------------------------
A0RD24_BACAH/3-88--------------------------------------------------------------------------------
A0RGK4_BACAH/3-88--------------------------------------------------------------------------------
A9VP01_BACWK/3-88--------------------------------------------------------------------------------
Q63F57_BACCZ/5-90--------------------------------------------------------------------------------
A9VT14_BACWK/3-88--------------------------------------------------------------------------------
Q81R67_BACAN/3-88--------------------------------------------------------------------------------
Q81R60_BACAN/6-91--------------------------------------------------------------------------------
Q97LZ0_CLOAB/3-88--------------------------------------------------------------------------------
Q63EA3_BACCZ/3-88--------------------------------------------------------------------------------
A9VNM9_BACWK/4-87--------------------------------------------------------------------------------
Q92FQ4_LISIN/4-89--------------------------------------------------------------------------------
Q8ERJ1_OCEIH/4-89--------------------------------------------------------------------------------
Q81HA0_BACCR/6-91--------------------------------------------------------------------------------
A5IPF0_STAA9/3-88--------------------------------------------------------------------------------
A3CR39_STRSV/3-88--------------------------------------------------------------------------------
Q8E7D1_STRA3/3-88--------------------------------------------------------------------------------
A2RMK4_LACLM/3-88--------------------------------------------------------------------------------
A4IKE4_GEOTN/4-89--------------------------------------------------------------------------------
A8FGZ8_BACP2/4-89--------------------------------------------------------------------------------
Q65FF4_BACLD/4-90--------------------------------------------------------------------------------
Q5WK78_BACSK/4-89--------------------------------------------------------------------------------
A5KPT5_9FIRM/4-89--------------------------------------------------------------------------------
A3DD43_CLOTH/4-90--------------------------------------------------------------------------------
Q9KE84_BACHD/3-88--------------------------------------------------------------------------------
Q97LY9_CLOAB/4-91--------------------------------------------------------------------------------
Q97LY7_CLOAB/15-100--------------------------------------------------------------------------------
Q97MZ8_CLOAB/5-90--------------------------------------------------------------------------------
Q97KJ1_CLOAB/6-91--------------------------------------------------------------------------------
Q97MZ2_CLOAB/6-93--------------------------------------------------------------------------------
Q97M02_CLOAB/3-88--------------------------------------------------------------------------------
Q9L0T5_STRCO/28-115--------------------------------------------------------------------------------
A6WCP9_KINRD/3-90--------------------------------------------------------------------------------
Q6ACE0_LEIXX/8-95--------------------------------------------------------------------------------
A0QM17_MYCA1/4-89--------------------------------------------------------------------------------
A1T456_MYCVP/3-88--------------------------------------------------------------------------------
A5U9N3_MYCTA/6-91--------------------------------------------------------------------------------
Q73SS3_MYCPA/16-101--------------------------------------------------------------------------------
A0PX50_MYCUA/6-91--------------------------------------------------------------------------------
A3PWA4_MYCSJ/4-90--------------------------------------------------------------------------------
A0QTK0_MYCS2/4-90--------------------------------------------------------------------------------
A1SN44_NOCSJ/4-90--------------------------------------------------------------------------------
Q5YN04_NOCFA/7-92--------------------------------------------------------------------------------
Q5YRS3_NOCFA/4-91--------------------------------------------------------------------------------
O86644_STRCO/7-92--------------------------------------------------------------------------------
A8M600_SALAI/5-90--------------------------------------------------------------------------------
Q82K72_STRAW/7-92--------------------------------------------------------------------------------
ES6LX_MYCLE/3-88--------------------------------------------------------------------------------
A0PSK7_MYCUA/2-87--------------------------------------------------------------------------------
Q5Z1J3_NOCFA/4-90--------------------------------------------------------------------------------
A4T0V0_MYCGI/3-88--------------------------------------------------------------------------------
A5U732_MYCTA/3-88--------------------------------------------------------------------------------
Q73TD4_MYCPA/3-88--------------------------------------------------------------------------------
ESXR_MYCLE/3-88--------------------------------------------------------------------------------
Q1B0C3_MYCSS/3-88--------------------------------------------------------------------------------
Q1BFZ1_MYCSS/3-88--------------------------------------------------------------------------------
A5U9K3_MYCTA/3-88--------------------------------------------------------------------------------
Q6NJ54_CORDI/3-88--------------------------------------------------------------------------------
Q8NST7_CORGL/3-88--------------------------------------------------------------------------------
A3TFP5_9MICO/5-90--------------------------------------------------------------------------------
A3KJS8_STRAM/7-92--------------------------------------------------------------------------------
A1SDG6_NOCSJ/5-90--------------------------------------------------------------------------------
A8LV95_SALAI/3-88--------------------------------------------------------------------------------
A8M3S3_SALAI/3-88--------------------------------------------------------------------------------
Q8G878_BIFLO/3-88--------------------------------------------------------------------------------
A1A0W4_BIFAA/3-88--------------------------------------------------------------------------------
Q5YBV2_9BIFI/3-88--------------------------------------------------------------------------------
A3TRR1_9MICO/4-89--------------------------------------------------------------------------------
A4AIC4_9ACTN/3-88--------------------------------------------------------------------------------
A5CTX2_CLAM3/3-88--------------------------------------------------------------------------------
A6WE48_KINRD/3-88--------------------------------------------------------------------------------
A1R3I1_ARTAT/3-88--------------------------------------------------------------------------------
A0JT10_ARTS2/3-88--------------------------------------------------------------------------------
A7B9U9_9ACTO/22-107--------------------------------------------------------------------------------
A0LR18_ACIC1/3-88--------------------------------------------------------------------------------
A5UYZ8_ROSS1/3-88--------------------------------------------------------------------------------
A7NL38_ROSCS/3-88--------------------------------------------------------------------------------
A5UYZ9_ROSS1/3-88--------------------------------------------------------------------------------
A5UZ07_ROSS1/3-89--------------------------------------------------------------------------------
Q6NJ55_CORDI/4-89--------------------------------------------------------------------------------
A4QBS1_CORGB/4-89--------------------------------------------------------------------------------
Q73S33_MYCPA/6-92--------------------------------------------------------------------------------
ES6LY_MYCLE/5-91--------------------------------------------------------------------------------
A5WPW1_MYCTF/4-90--------------------------------------------------------------------------------
O05453_MYCTU/4-91--------------------------------------------------------------------------------
A9B1N8_HERA2/5-91--------------------------------------------------------------------------------
A9B0B5_HERA2/5-92--------------------------------------------------------------------------------
A9B2P0_HERA2/5-91--------------------------------------------------------------------------------
A9B726_HERA2/5-91--------------------------------------------------------------------------------
A9B720_HERA2/5-92--------------------------------------------------------------------------------
A9B8D4_HERA2/5-92--------------------------------------------------------------------------------
A9AUV8_HERA2/5-92--------------------------------------------------------------------------------
A9AUW0_HERA2/5-92--------------------------------------------------------------------------------
A9B561_HERA2/5-92--------------------------------------------------------------------------------
A9B6G5_HERA2/5-91--------------------------------------------------------------------------------
Q5YRS2_NOCFA/6-91--------------------------------------------------------------------------------
A8LV94_SALAI/5-90--------------------------------------------------------------------------------
A8M601_SALAI/3-88--------------------------------------------------------------------------------
Q5ARS9_EMENI/25-110--------------------------------------------------------------------------------
O86643_STRCO/16-101--------------------------------------------------------------------------------
Q5YU75_NOCFA/7-92--------------------------------------------------------------------------------
A4T4Z6_MYCGI/5-91--------------------------------------------------------------------------------
A4KMZ0_MYCTU/3-88--------------------------------------------------------------------------------
A0QNJ5_MYCS2/3-88--------------------------------------------------------------------------------
ESXB_MYCLE/3-88--------------------------------------------------------------------------------
A4FPH3_SACEN/3-88--------------------------------------------------------------------------------
Q5Z1J2_NOCFA/6-93--------------------------------------------------------------------------------
A3TFP6_9MICO/5-90--------------------------------------------------------------------------------

PF10824

A0PRC6_MYCUA/1-99A-------------------------------------GESLDK------------------------------------
A4KM90_MYCTU/1-100W-------------------------------------RKAIDG------------------------------------
A4TFT9_MYCGI/10-109S-------------------------------------AAAIHG------------------------------------
A0R672_MYCS2/1-104E-------------------------------------AGNIDT------------------------------------
A4KMY1_MYCTU/1-100L-------------------------------------AGVIDK------------------------------------
A4FPN7_SACEN/1-99N-------------------------------------SSMLGE------------------------------------
A0PKF1_MYCUA/1-99A-------------------------------------AHDFGG------------------------------------
A2VMP0_MYCTU/1-100L-------------------------------------AGVIDK------------------------------------
A5U9J3_MYCTA/1-100L-------------------------------------AGVIDK------------------------------------
Q744T9_MYCPA/1-99A-------------------------------------ADKFGS------------------------------------
A5TY98_MYCTA/1-99A-------------------------------------SRSLGN------------------------------------
A0Q8V7_MYCA1/1-99A-------------------------------------ADKFGS------------------------------------
A1KPV0_MYCBP/1-100W-------------------------------------RKAIDG------------------------------------
A4TG17_MYCGI/35-139G-------------------------------------AQSISA------------------------------------
A0QNK5_MYCS2/1-100K-------------------------------------AGDLDG------------------------------------
A1TH04_MYCVP/1-103N-------------------------------------GRDVSA------------------------------------
A2VMW8_MYCTU/1-99A-------------------------------------SRSLGN------------------------------------
A5U8T9_MYCTA/1-100W-------------------------------------RKAIDG------------------------------------
C1AJ24_MYCBT/1-99A-------------------------------------SRSLGN------------------------------------
Q6MZ31_MYCUA/1-87N-------------------------------------RAALTI------------------------------------
A0QSQ2_MYCS2/3-102A-------------------------------------AARVGG------------------------------------
Y028_MYCBO/1-99A-------------------------------------SRSLGN------------------------------------
Y406_MYCLE/4-103C-------------------------------------GSDIKS------------------------------------
Y3645_MYCBO/1-100W-------------------------------------RKAIDG------------------------------------
ESPC_MYCTU/1-100W-------------------------------------RKAIDG------------------------------------
Y027_MYCTU/1-99A-------------------------------------SRSLGN------------------------------------
A4KN58_MYCTU/1-99A-------------------------------------SRSLGN------------------------------------
A3Q4D4_MYCSJ/1-100S-------------------------------------AGKLKA------------------------------------
A4TFR2_MYCGI/1-98G-------------------------------------AQRVGA------------------------------------
A0PW23_MYCUA/1-100G-------------------------------------VEILDQ------------------------------------
Q5Z2J0_NOCFA/9-106N-------------------------------------AGAIQN------------------------------------
A1KEJ5_MYCBP/1-99A-------------------------------------SRSLGN------------------------------------
A2VM00_MYCTU/1-100W-------------------------------------RKAIDG------------------------------------
A1UA43_MYCSK/1-103A-------------------------------------RDELDG------------------------------------
Q1B4R9_MYCSS/1-100S-------------------------------------AGKLKA------------------------------------
A0R2G1_MYCS2/1-98A-------------------------------------ADDLKK------------------------------------
A4T8Y2_MYCGI/1-99G-------------------------------------GDAIRA------------------------------------
Q7TVH1_MYCBO/1-100L-------------------------------------AGVIDK------------------------------------
A1UQ32_MYCSK/1-99N-------------------------------------AENLRV------------------------------------
A1TDN8_MYCVP/1-99G-------------------------------------AEAIRT------------------------------------
A0QQE6_MYCS2/1-94E-------------------------------------EQKLDD------------------------------------
Q1BET9_MYCSS/1-103A-------------------------------------RDELDG------------------------------------
ESPF_MYCTU/1-100L-------------------------------------AGVIDK------------------------------------
A0R605_MYCS2/34-130A-------------------------------------GGALDS------------------------------------
Q5YTI6_NOCFA/5-105N-------------------------------------AGQLNV------------------------------------
A4T505_MYCGI/1-96S-------------------------------------AARVDG------------------------------------
A3PTP9_MYCSJ/1-103S-------------------------------------WDELDG------------------------------------
A5WU86_MYCTF/1-100L-------------------------------------AGVIDK------------------------------------
A1T2U3_MYCVP/1-103S-------------------------------------GSNIDG------------------------------------
A4TEX2_MYCGI/1-100A-------------------------------------ASRLAG------------------------------------
A1T184_MYCVP/1-96S-------------------------------------GRAIDG------------------------------------
A1KQK0_MYCBP/1-100L-------------------------------------AGVIDK------------------------------------
A4T2V3_MYCGI/252-348N-------------------------------------ADAVDR------------------------------------
A0QNI6_MYCS2/1-100M-------------------------------------GDALDE------------------------------------
C1AI73_MYCBT/1-100W-------------------------------------RKAIDG------------------------------------
A1UKB8_MYCSK/1-100S-------------------------------------AGKLKA------------------------------------

PF00823

A5WS31_MYCTF/7-165TVHPTAVTANRVSLAS..LIAANVLGQNTPA.......IAATEF.DY.LEMWAQDVAAMVGYHAGAKSVAA---------
A5WSZ4_MYCTF/4-161VVPPEEIAANREERRR..LIASNVAGVNAPA.......IADLDA.QY.DQYRARNVAVMNAYVSWTRSALS---------
C1AP76_MYCBT/5-162TVPPPVIAANRAQLMV..LIATNIFGQNTPA.......IMMTEA.QY.MEMWAQDAAAMYGYAGSSATASR---------
Q1B0C5_MYCSS/11-168MPTMAELINNHVVHGI..LVTTNFFGVNTIP.......IGLNEA.DY.VRMWNQAGDVMAGWDGASTGAAD---------
A4KDZ8_MYCTU/5-163TVHPAIVAANRAVLVS..LVSSNLLGFNAPA.......IAATEA.AY.ERMWAQDVAAMVGYHAGASAAVS---------
Q7TYL4_MYCBO/5-162MVPLAQIYNNRAERQI..LIDNNALGQFTAQ.......IADLDQ.EY.DDFWDEDGEVMRDYRLRVSDALS---------
A0PW88_MYCUA/6-164TVPPPVVAANRVQLAT..LTATNFFGQNSPA.......IAATEA.AY.SEMWAQDALAMYDYAANSASACA---------
A5TZB4_MYCTA/5-163TVPPTVIAANRRTMLS..LVKTNVFGQNTPA.......IATSEA.QY.GEMWAQDIVAMEGYAGASAAASQ---------
A4KG95_MYCTU/5-160HVPLPVIETNRLTRLA..LATTNIFGIHTPA.......IFALDA.LY.AQYWSQDGEAMNLYATMAAAAAR---------
A4KLV7_MYCTU/4-161VVPPATIANNREEVHR..LIASNVAGVNTPA.......IAGLDA.QY.QQYRAQNIAVMNDYQSTARFILA---------
Q7TWP0_MYCBO/5-163TVDPFVIAANRSRLVS..LALSNLFGQNTPA.......IAAAEF.DY.ELMWAQDVAAMLGYHTGASAAAE---------
Q7TYR8_MYCBO/6-167MVDPVVVAANRSAFVQ..LVLSNVFGQNAPA.......IAAAEA.TY.EQMWAADVAAMVGYHGGASAAAA---------
A0Q926_MYCA1/8-164MPTLPELAANHATHAA..LVATNFFGVNTIP.......IAVNEA.DY.ARMWTQAATTMTTYQA.TTEAVQ---------
Q7D7Y7_MYCTU/18-176TVPPPVITANRVLVMT..LIATNFFGQNSAA.......IAVAEA.QY.AEMWAQDAVAMYGYAAASASASR---------
A0PSL4_MYCUA/6-164TVPPPVIAANRVLLMA..LVATNFFGQNTPA.......IAATEA.QY.MEMWAQDAAAMYSYAGSSAPATE---------
A0PV61_MYCUA/6-164MVPPAVVAANRAMLAT..LVATNLFGQNTPA.......IAVVEA.EY.AKMWAQDANAMYQYAATAAAAAD---------
A1KER7_MYCBP/2-160MPTPAELAANHAIHGV..LIATNFFGINTVP.......IALNEA.DY.VRMWLQAADTMAAYQAVADAATV---------
Q854W2_9CAUD/132-282TPTPDELGTAKLAAQM..SAFSPVMGIIAAM..............KY.QELRNKAIEAGAKYQTSVEGSLN---------
Q743Z9_MYCPA/26-175TVPPPVIAANRALLLQ..LLATNFLGQNTPA.......IADVEA.QY.GEMWAQDTAAMYGYALASAAAST---------
Q7U053_MYCBO/7-165MPTQVELAANQIKLAV..LVATNFFGINTIP.......IAINEA.EY.VEMWVRAATTMATYSTVSRSALS---------
Q8VIY0_MYCTU/6-164IVPPAAVAANREAFLA..LIRSNWLGLNAPW.......IAAVES.LY.EEYWAADVAAMTGYHAGASQAAA---------
Q73UE8_MYCPA/5-162VVHPSVVSANRTRLAQ..LLATNRFGTNTAA.......IAETEN.EY.QTMWANNSAALSRYQAASSQATS---------
A2VEZ8_MYCTU/8-166MPTLAELAANHVIHTV..LVATNFFGINTIP.......ITLNEA.DY.VRMWLQAAAVMGLYQAASGAALA---------
A5U1I2_MYCTA/5-163TVDPLLVAANRHQLVS..LVLSNLFGQNAPA.......IAATEA.AY.EQLWAADVAAMVSYHSGASAVAA---------
Q7TZA6_MYCBO/5-163MVQPALVAANRSGLIS..LVISNLFGQNAPA.......IAAAEA.AY.EEMWALDVSAMAAYHSGASAVAV---------
A4KED0_MYCTU/8-166TVQPAVVAANRGLMQL..LAATNWFGQNAPA.......LMDVEA.AY.EQMWALDVAAMAGYHFDASAAVA---------
PPE58_MYCTU/4-170VVPPATIANNREEVRR..LIASNVAGGKHSSNRRPRGTIRAVPGRKYPSNGPLSKLDPICAIEAAPMAGAA---------
A1UQ41_MYCSK/9-167MVPGPVSDQNLVDTEA..LVATNFIGQNSPA.......IAALVA.EY.ERQWIQNATIMSSYQGVVTAALG---------
A5U0E2_MYCTA/6-164VVHPAVVQANRVRTWL..LAVSNVFGQNAPA.......IAAMES.TY.EQMWAQDVAVMAGYHAASSAAAA---------
A0PQL0_MYCUA/8-165MPTLTELAENHTVHEV..SVAMNFFGVNVAP.......IALNEA.DY.VRMWIQAAGVMGVYQACSTAALA---------
A1KN13_MYCBP/11-169MPTLPELAANHLTHAV..LVATNFFGINTIP.......IALNEA.DY.VRMWVQAATVMSAYEAVVGAALV---------
A0QE87_MYCA1/5-163TVPPSVVAANRSRLAS..LVATNLLGQNTPA.......IAATEV.AY.GEMWAQDVAAMYGYAGAAQAASR---------
A0PSJ9_MYCUA/6-164TVPPPVIAANRALLMA..LIATNIFGQNTPA.......IAAAEA.QY.LEMWAQDAAAMYAYAGTAAAASA---------
Q8VIZ3_MYCTU/6-164TVPPPVIAENRAELMI..LIATNLLGQNTPA.......IAVNEA.EY.GEMWAQDAAAMFGYAAATATATE---------
A0PVU0_MYCUA/5-163IVSPVIINANRALTAL..LANTNFFGLNFPA.......IAAAEG.LY.EEMWAQDVAVMSGYHATVSEIWS---------
PPE45_MYCBO/5-163TVPPPVVVANRALLVA..LVATNFFGQNTPA.......IAATEA.QY.AEMWAQDAAAMYAYAGSAAIATE---------
PPE36_MYCTU/6-163MVPPAMVRANRVQTTV..LKAINWFGQFSTR.......IADKEA.DY.EQMWFQDALVMENYWEAVQEAIQ---------
A0PQD0_MYCUA/8-166TVPPPVVAANRVLLTT..LIVTNFFGQNTPA.......IAVTEA.QY.AEMWAQDAAAMYGYAASSATATR---------
A0QCD6_MYCA1/11-169MPTLPELAANHAAHAV..LTATNFFGVNTIP.......IAVNEA.DY.ARMWVQAATVMGTYQDVAAAALA---------
Q8VJK7_MYCTU/38-196TVHPAAVTANRVLLGA..LVATNILGQNTPA.......IAATEF.DY.VEMWAQDVGAMVGYHAGAAAVAE---------
A5U9K1_MYCTA/5-163TPSLPEIAANHITQAV..LTATNFFGINTIP.......IALTEM.DYFIRMWNQAALAMEVYQAETAVNTL---------
Q8VJP8_MYCTU/8-150MPTLAELAVDFTSRPD..MPTTS................ALLSS.AT.SRM.VAIGCLMPML......TTS---------
Q0S9F2_RHOSR/145-302MPSIPEIVAVKTAK....ATAYSTGGALNGT.......AAAAEA.AD.RAMDIRAGLVMEGYEAASNILAL---------
O33085_MYCLE/14-130TPGMAVITENHITQAI..LATINFFGINMAP.......IAFTEAGDF.ICMRTQTALAMNSYQAETLLNTA---------
A1KJY1_MYCBP/5-163MVQPALVAANRSDLVS..LVFSNFFGQNAPA.......IAAIEA.AY.EQMWAIDVSVMSAYHAGASAVAS---------
A0PVS2_MYCUA/8-166VVPPPLIAANRSQVAS..LVVANVLGQNTPA.......IETLQA.EY.AEMWAQDAAVMYQYSAASEAAST---------
Q73WQ9_MYCPA/13-171TVPPHVVAANRIQLAT..LIATNFFGQNAPA.......IAATES.CY.AEMWAQDATAMYGYAAASSAATT---------
A4KHR2_MYCTU/5-163VVQPMLVAANRADLVS..LVMSNLFGQNAPA.......IAAIEA.TY.EQMWAADVSAMSAYHAGASAIAS---------
A0QM56_MYCA1/8-166MPTLPELAGNHATHAA..LVATNFFGVNTIP.......IAVNEA.DY.ARMWVQAATTMSTYQAVAGTAVA---------
Q50175_MYCLE/23-181MPTLAELTANRATRGF..LIATNFFGINTIP.......IALNEA.DY.VRMWVQAADTMATYQAISEAVTA---------
A0PN58_MYCUA/4-162MPTMPELAANHVIHGV..LMATNFFGINTIP.......IAANEA.DY.VRMWIQAATTMSTYQAVSAAAVA---------
Q741D6_MYCPA/5-162VVAPHVIAANRLRRIS..LAEANCLGQLSPA.......VADADA.DY.ERMWAQDAAAMYAYARASAGVWK---------
PPE03_MYCTU/6-164MPTLVELAANHTLHGV..LVATNFFGINTIP.......IALNEA.DY.ARMWTQAASTMATYQAVAEAAVA---------
PPE28_MYCTU/7-165TVHPAMVAANRAQVAS..LVASNLFGQNAPA.......IAALES.LY.ECMWAQDAAAMAGYYVGASAVAT---------
P95182_MYCTU/5-163TVLPAAVAANRDAFVQ..LVMTNLFGQNAPL.......IAAAEG.VY.EEMWAADVAAMSGYYSGASAIAA---------
Q73TJ3_MYCPA/8-166MPTLGELAANHATHAA..LQATNFFGINTIP.......IAVNEA.DY.ARMWVQAATTMTTYQAVSTAAVA---------
A0QM63_MYCA1/8-166MPTLPELAANHAVHAT..LVATNFFGVNTVP.......IAVNEA.DY.ARMWTQAATTMSTYHAVSTAAVA---------
Q6MWX8_MYCTU/5-163TVDPALVAANRARLVA..LAVSNLLGQNTPA.......IAAAEA.EY.ELMWAADVAAMAGYHSGASAAAA---------
A0PW45_MYCUA/5-163TVPPPVVAANRSLLAA..LVATNFLGINTPA.......IMATEA.LY.AEMWAQDAGAMYGYAAASSTSGS---------
A4KHL9_MYCTU/41-200TVPPPAIAANRTLLMT..LVDTNWFGQNTPA.......IATTES.QY.AEMWAQDAAAMYGYASAAAPATV---------
A0QNJ4_MYCS2/4-162TPPLPEIEQNHITHGV..LEATNFLGINTVP.......IALNEM.DYFVRMWNQAAGAMDVYHAETTVNLL---------
A2VII8_MYCTU/5-163IVPPPLIAANRARLTS..LVTHNVFGQNTAS.......IAATEA.QY.AEMWAQDAMAMYGYAGSSATATK---------
Q7U123_MYCBO/5-166TAHPALVAANRNQLLS..LVLSNLFGQNLPA.......IAATEA.SY.EQLWAQDVAAMVGYHGGASTVAS---------
A1KJJ9_MYCBP/5-163TVPPPLIAANRASLMQ..LISTNVFGQNTSA.......IAAAEA.QY.GEMWAQDSAAMYAYAGSSASASA---------
A0PSJ8_MYCUA/5-163HVPPVEIAANRAQLAM..LVATNLFGQNTAA.......IAAAES.QY.AEMWAQDATAMDGYASSSAAASE---------
A5U0V4_MYCTA/5-163TVPPSLVAANRSRLMS..LVAANILGQNSAA.......IAATQA.EY.AEMWAQDAAVMYSYEGASAAASA---------
Q73ZT3_MYCPA/6-164TVPPPVIAANRALLAT..LVATNMLGQNTPA.......IAATEA.HY.MEMWAQDAAAMYAYAASSASAAQ---------
A0PMC1_MYCUA/5-163TVPPPQIAANRAELTG..LISTNVVGQNSAA.......IAAAEA.QY.GEMWSQDAATMYAYAASCATATS---------
A0QGS4_MYCA1/7-165SVPPPLIAANRMQVSQ..LQATNVLGQNTPL.......IAQLEA.QY.GEYWAQDAAAMYSYAGQSASASK---------
Q7TY90_MYCBO/5-163TVSPAMVAANRTRLAS..LVAANLLGQNAPA.......IAAAEA.EY.EQIWAQDVAAMFGYHSAASAVAT---------
Q73ZT6_MYCPA/6-164TVPPAVVAANRAQLAM..LVATNVFGQNTPA.......IATTEA.EY.GQMWAQDAAAMNGYAVASTAATR---------
A0PNL9_MYCUA/8-166TVQPAVVTANRGLMQV..LAATNWLGFNTPA.......IIDIEA.AY.EQMWALDVAAMAAYHAEASAAAS---------
A0PN64_MYCUA/11-169MPTLTELGANHALHGV..LVATNFFGLNAIP.......IALNEA.DY.VRMWVQAATTMGLYQATAGAALA---------
Q741X1_MYCPA/30-188TVPPPAVAANRVQLAT..LIATNFFGQNAAA.......IAATEA.EY.AEMWAQDAAAMYEYAAGSAAACA---------
A0PKJ5_MYCUA/5-163TVHPALVAANRAQFVS..LALSNIFGQNAPA.......IAAVET.DY.EEMWAQDVTAMVGYHSTSSAAAE---------
Q73ZT2_MYCPA/5-163HVPPAVITENRALLAQ..LVATNIFGQNTAA.......IAANEA.QY.GEFWAQDATAMDTYFAASATAAN---------
A4KH93_MYCTU/8-166TVHPGAVSANRGRLRS..LVASNLLGQNAPA.......IAAVEA.VY.EQMWAADVAAMLGYHGEASAVAL---------
A0QG97_MYCA1/5-163TVPPPVVTANRTLLAQ..LVATNILGQNTPA.......IATTEA.EY.AEMWARDAAAMYGYAGAAAAATR---------
A0QE79_MYCA1/5-163TVPPPLIAANRARLLA..LVQSNIFGQNTPA.......IMATEA.EY.SEMWAQDATAMYGYAANSASASA---------
Q5Z3L3_NOCFA/10-167MPSLPEILATNAAV....VASANPAGAVSGA.......FEAAEL.AK.HAMDLRAALVMETYEAATTAVVT---------
A0QLP3_MYCA1/8-166TVQPAVVAANRALVQA..LAATNWLGQNTPA.......IADIEA.AY.EQMWASDVAAMFGYHADASAAVA---------
A0PN14_MYCUA/8-166MPTLGELAANHATHAV..LVATNFFGLNTIP.......IALNEV.DY.VRMWIQAATTMSVYQAVAADALL---------
A0PMG2_MYCUA/5-163MIHPLAVAANRNALVQ..LVLTNLFGQNAPA.......IAAAEG.SY.EQMWAADVAAMLGYHGGASAAAS---------
Q73ZT0_MYCPA/5-163TVPPPVIAANRSLLMT..LIATNILGQNTAA.......IAAAEA.EY.AEMWAQDAAAMYAYAAASAAATE---------
Q49944_MYCLE/6-163TVPPLMVFVNRAQACL..LIMSNIFGQNSTA.......IAEKEA.EY.TEMWIQDATAMTSYQASVLEAVG---------
A0QKH5_MYCA1/5-162VVHPSLVAANRARLAM..LLATNFFGINYPA.......IAETEA.EY.HAMWVNNSAAMYRYAATSATAVR---------
PPE02_MYCTU/8-166MPTLAELGANHALHGV..LMATNFFGINTIP.......IALNES.DY.ARMWIQAATTMASYQAVSTAAVA---------
A0PSS0_MYCUA/5-163IVHPAMVAANRNELVA..LVISNLFGQNAPA.......IAATEA.VY.EQLWAQDVAVMAGYHAGVSAIAQ---------
A0PRN7_MYCUA/8-165MPTLAELAANRTTHTA..LVATNFFGLNTVP.......ITVNEA.DY.ARMWVQAATTMGAYQVILGTALA---------
A0PWN5_MYCUA/2-160MPTLAELAANHAIHGV..LVVTNFFGINAIP.......IALNEA.DY.VRMWVQAAETMTTYQAVSEVAAA---------
A0QI00_MYCA1/5-162TVPPPVIAANRALLAS..LIATNVLGQNTPA.......IAATEA.HY.AEMWAQDAAAMYAYAGASAVATR---------
A1UQ34_MYCSK/124-283IPSPDAFQAMNHQLQT..LAQANAQTGGMYA.......VPLANAVEQKAQMEAQTAQGFGGYYASTEATTA---------
A0PMK0_MYCUA/5-163TVPPALILENRLQLVT..LIATNIFGQNTPA.......IATTEA.EY.GEMWAQDAAAMYGYAGSAAMLAE---------
Q73TD6_MYCPA/11-169MPTLAELAANHTIHGV..LLATNFFGINTIP.......IAVNEA.DY.ARMWVQAATTMGTYQAVAGSALA---------
A1KPM4_MYCBP/6-164TVHPALVAANRALVAW..LAGSNVFGQNTPA.......IAAAEA.IY.EQMWAQDVVAMLNYHAVASAVGA---------
A0PPB9_MYCUA/5-163VVPPPLIASNRMQLMT..LMARNIYGQYTAE.......IASLEA.QY.AEMWAQDARAMYTYAGSSASATK---------
Q73ZT5_MYCPA/6-164TVPPAVVAANRTQLAN..LVAGNIFGQNAGL.......IAANEA.QY.GDMWAQDAAAMTGYASASNAATQ---------
A0QFD7_MYCA1/8-166MPTLGELATNHAVHGA..LVATNFFGINTIP.......IAVNEA.DY.ARMWVQAATTMSTYQAVSQSALA---------
A4TG23_MYCGI/4-162TPSLGEIAENHITHAV..LQATNFLGVNTVP.......IAVNEF.QYFVEMWNRAAGVMESYASATGVNTT---------
A1KND1_MYCBP/5-163TVPPALVTANRAELKA..LIASNLLGQNTAA.......IAAIEA.QY.AEMWAQDAAAMYGYATTSAAARQ---------
Q7TW98_MYCBO/5-163TVHPLLVAANRNAFAQ..LVMSNWFGLNAPL.......IAAVEG.AY.EQMWAADVAAMVGYHSGASAAAE---------
Q73TI1_MYCPA/8-166MPTLPELATNHATHAA..LVATNFFGINTIP.......IALNEA.DY.ARMWVQAATTMSTYQTVSTSTLA---------
A0PML6_MYCUA/5-163TVHPELVLANRNQLVS..LVLSNLFGQNAPA.......IAATES.TY.EELWAQDVAATVGYHGGASAVAA---------
A0PQG1_MYCUA/5-163TVPPAEVAANRARLAA..LMATNIFGQNVPA.......IAATEA.RY.GEMWAQDASAMYGYAASCAGAVR---------
A4KM96_MYCTU/6-164TVPPPEIAANRALLMA..LLATNFLGQNTAA.......IAATEA.QY.AEMWAQDAAAMYGYAGASAAATQ---------
A0PML7_MYCUA/5-163TAHPELVAANRNQLVS..LVVSNLFGQNAPA.......IASTEA.AY.DQLWAQDVAAMAGYHSGASAVAA---------
Q7TXX3_MYCBO/5-163TVPPAEVVANRALLAE..LTATNILGQNVSA.......IAATEA.RY.GEMWAQDASAMYGYAAASAVAAR---------
A2VIS4_MYCTU/5-162TVPPPVVAANRAELAV..LAATNIFGQNTGA.......IAAAEA.RY.AEMWAQDAAAMYGYAGSSSVATQ---------
A1KFH6_MYCBP/5-163TVHPAIISANRALFVS..LVVSNLLGQNAPA.......IAATEA.AY.EQMWAQDVAAMFGYHAGASAAVS---------
A4T4Z7_MYCGI/14-171TPQLPEIELNHVTNAT..LHATNFLGVNGIP.......IALNEA.DY.IRMWNQAAAVMTAYETETVLNTT---------
A5WSZ8_MYCTF/5-162VVPPAAIEDNREEVRR..LIASDITGENAPA.......IAELDE.QY.QSYGDTNVQAMNLYAERAQTLLS---------
A0QJT0_MYCA1/5-163TVPPAAVAANRTQLAA..LVATNFFGQNTAA.......IAATEA.QY.AEYWAQDAAAMYAYSASSAAAAQ---------
A0QGQ3_MYCA1/5-163VVPPAEIATNRARLAM..LSASNVFGQNSAA.......IAAAEA.EY.GQMWAQDAAAMFGYASASAAATR---------
A0QJ03_MYCA1/5-150MVPPPVIAGNRTHRLA..LVSANCLGQHSPA.......IAEVDT.AY.ERMWARNAAAMYAYADASAAAVT---------
O33009_MYCLE/8-166MPTLAELAANRTAHTV..LVTTNFFGINTIP.......IARNEI.DY.VRMWVEAAIAMGTYQEVSTVVVD---------
A2VIS8_MYCTU/6-164TVPPPVIEANRALLMS..LVATNIFGQNTPA.......IAATEA.HY.AEMWAQDAAAMYGYAGSSATASQ---------
A0PQA6_MYCUA/5-162TVPPPVIAANRAHLAA..LIATNLLGQNSPA.......IATTEA.NY.EQMWAQDAAAMYGYAGACASATR---------
A0QCD1_MYCA1/6-164TVPPAVVTANRALFAQ..LVASNILGQNTAA.......IGEAEG.AY.AEMWAQDAAAMYGYAAASSGATR---------
Q741D8_MYCPA/8-166TVPPAVVAANRSLLAT..LLQTNILGQNDAA.......IAATED.EY.GQMWAQDVAAMFSYAAASESAGE---------
A0PSK0_MYCUA/9-167TVAPTVITANRAQLMV..LVATNVLGQNTPT.......IAAVEA.QY.CEMWAQDAMAMYGYAGSSAAATR---------
Q7TW99_MYCBO/7-165TVPPPAIMANRAQVLS..LIATNFFGQNTAA.......IAALET.QY.AEMWEQDATAMYDYAATSAAART---------
PPE37_MYCTU/8-166MPTLAELAANHAMHGA..LVTTNFFGVNTIP.......IALNEA.DY.LRMWIQAATVMSHYQAVAHESVA---------
A0PVR6_MYCUA/8-166MPTMGELAENHLTHGV..LLGTNFLGINTVP.......IAVNEA.DY.ERMWVQAATTMSAYDAASTVFAA---------
Q73Y22_MYCPA/7-165TVPLPAVLANRARLLV..LIATNFFGQNTAA.......IAQTEL.EY.VEMWLRDVAAMLGYHAGAQSAAQ---------
A0PQL2_MYCUA/8-166MPTLAELAGNHATHAV..LLGTNFFGINTIP.......IALNEA.DY.ARMWVQAATVMSVYQAGSTAALA---------
A0PRS9_MYCUA/5-163TVPPIVVAANRALLVA..LVASNIFGQNTAA.......IEATEA.EY.AEMWAQDAGAMYDYAATSAMATA---------
A5TZH9_MYCTA/2-160MPTLAELAANHATHGA..MVATNFFGINTIP.......IAVNEA.DY.VRMWLQAATTMATYQAVADSAVR---------
Q79FJ7_MYCTU/5-163TVPPPVIEANRAQLMA..LIATNVLGQNAPA.......IAATEA.QY.AEMWSQDAMAMYGYAGASAAATQ---------
SRA_MYCLE/6-164MVPLLTVLGNIIHTMA..LKAINWFGQVSTT.......VAALEA.DY.DLMWVQNSTAMTTYRDTVLRETG---------
A1U9U3_MYCSK/8-166MPTLGELAANHATHAV..LLATNFLGINTIP.......IAVNEA.DY.VRMWIQAATSMSTYQAVAGAAVA---------
Q73U78_MYCPA/14-172MPTLPELAANHAVHGA..LVATNFFGINTIP.......IAVNEA.DY.ARMWVQAAGTMATYQAVSTAAVA---------
A0PQA4_MYCUA/5-158MTSAQLIAPNRMMRKW..LSANNFLGQASPV.......IAELEA.EY.DRVWVHCADAVHDFAGAPAISPR---------
Q9CCQ9_MYCLE/7-165MPTQFELAANRVVRGV..LMATNFFGVNTIP.......IALNEE.EY.VQMWVRAATTMATYSAISQSALA---------
Q745G2_MYCPA/8-168MRPAPECIANRTETATDYGINPLVLGALTPR.......IASLEL.EYYGSMWPNNSAVGASYGAVLTALAE---------
A0QGS6_MYCA1/6-164TVPPPVIAANRVLLAT..LVATNFFGQNTPA.......IAATEA.QY.MEMWAQDAAAMYGYAAASQTAST---------
A5WSZ5_MYCTF/1-158VVPPATIANNREEVRR..LIASNVAGVNTPA.......IADLEA.QY.EQYRAENIQAMDRYLSWTRFALS---------
A0PSP2_MYCUA/8-166MPTLTELAANHTTHAV..LLGTNFFGINTIP.......IALNEA.DY.VRMWVQAATTMGVYDAISAVALG---------
Q73V32_MYCPA/5-162TVPPPVIAANRTLLAS..LVATNIMGQNTAA.......IADTEA.QY.ADFWAQDTAAMAGYSASSTAATQ---------
A0PM57_MYCUA/5-163MVQPFLLAANRSSLVS..LVLSNLFGQNAPA.......IEAVEA.EY.EQMWALDVSTMATYHAGASAAAA---------
Q741E7_MYCPA/8-166MPTLEQLATNHAVFAQ..LVATNFFGVNTIP.......IAQNEI.EY.LQMWLQAATTMAIYEAVSETAMT---------
A0PSL2_MYCUA/5-163VVPPPLIATNLAELTQ..ALQTNMFGLNNGV.......IAQLEA.QY.AEMWAQDASAMYNYAASSALATK---------
A0PLH5_MYCUA/8-165MPSLVELAANHTVHAV..LSATNFFGVNTIP.......IAVNEM.DY.VRMWVQAAAVMGTYQMITQGELL---------
A0PL97_MYCUA/8-140MPTLAELTANRTTHAA..LVATNFF.LDSTP.......SP..........................SRSTK---------
A0PMF2_MYCUA/6-164MIHPLEVLANRNVFVQ..LIRTNLFGLNAPA.......IMAAEG.QY.EQMWAQDVAAMVSYHGGASSAAA---------
Q5Z1M6_NOCFA/16-175MPDGGELAALAEAKRMLEAMTAGLGAPIRAV.......AAETDA.DA.DVAKAAASRVMRAYEAATEPLAM---------
A0PS83_MYCUA/8-165MPTMAELQENHAVHGV..LVATNFFGLNGVP.......IAVNEA.DY.VRMWIQAAGVMGVYESCTSAALL---------

PF04740

YEEF_BACSU/2-210M..KDILNDIDDILPLDLFSTETFKDELADANDKRKKTLEKLDALDEDLKTEYALSEPNEQFIKSDFQKLQEAT.GKGKN
YXID_BACSU/2-205V..NRQTSAIDHIVSLPTVNDSFFRMETEQAERLISDTLNKLFQFDGQQTQALEAAKSDFQTMKKYIDQLETMY.TGPKI
A8FDL4_BACP2/2-210L..STIFDDISDLIELNVFSSKEVNEHLDDANKKRKDAIEALHKIDHELKTEYAKSEAIEKHLATFYAKMMAAT.GKGKN
Q65L45_BACLD/27-230T..NATIAKVSHIVDLPELDDSNFHENYSKALKEINQTIEKLHTFDREQTNTIKAAENDLETMQRYIARLEKMY.TGPKI
Q5WBP9_BACSK/1-209I..NSAYESVSDLIHTGRWESSALTDKAREARDQLKDTEDHLEETDQNNQTVLETSKATLEHLEALVRKVEGWT.TKEAM
Q5WJ65_BACSK/2-209I..ESIRASIADLLPLPPFSMEPVLRYAQQGKDHVRITAERLGNLDEANDTVLASAKSTLQELTTVVSQVANWT.SGGVI
Q4EUK8_LISMN/2-192M..NSGTEG..........QMQNYRSQLAIAYKQ.ENILEKYLSFEQSHASFFDHLIDLVQAVQQTIRELQSNIQFNS..
Q65EU5_BACLD/2-205A..NATIAKVSHIVDLPDLNDSGFHEQNQKALKEISTTLEKLHAFDREQTNALKTAENDLETMQRYMARLEKMY.TGPKI
A0AGW3_LISW6/2-192M..NVGTEG..........QMQIYRSQLSKAYKK.ENIVEKYLAFEQSHTDFFAHISDLVQNIQQTIRELQSNIQFNH..
Q9KAE5_BACHD/3-214V..DAIAASVSHIIDLGKLDIRHVQDRVDDARKHANDTVEGLYELDHEGMRLMRELQRDMAELKAILKKVTEWTVSGGAL
Q92CG1_LISIN/1-200L..NNLIQEANEFTYFQSSNLGFFEELHHDALTEITNIRMKLEDFETKWNVELSKAEKLQKELDWMLTQV.....NDNKI
Q8EMS0_OCEIH/2-205V..NRSLSSIRDIVSIPNLDDQEFHENIRRSRKHVLDTVDKMYDFDQNASNILDNQYGDIKNVNKYMSELNGLL.VNRDI
A0AFZ4_LISW6/5-192L....KATPLSPL.......LKHFSETLQNSKQEVQKQLVKLLSFDPVSGQLFIEVEGLIDNVERGLKEVNSGKSFNA..
A8FFY0_BACP2/2-205V..NQAIGRVNHIVHLPHVDESTFQQSYQKAWLETSKTIGLLHAFDREQTSALNETKSALHTMKQYIDTLSKMF.TGPKI
Q65NL2_BACLD/2-209L..SNILGQIDDLISLQPFSSDEIKQQLDAANQNRKDTIKAVEDLDGLLKREYSASEHIQQMIQTDYSALIDAT.GKGKN
Q5WD67_BACSK/2-203I..NGVVDSVSDIVSLPKIDTSAIQTGIHEAKQHAMNTVEKLYAFDYAQSAAVDQLISLMAPISSFVAGLNGAI.ESGV.
A7Z5G9_BACA2/2-210M..KGILDEISDIIHLDVFSTEDVDQKLESADKKRNDTIHKLGKLDHDLTKEYAETEANEHFIQADFQQLQNAT.GKGKN
Q9K9X1_BACHD/2-213I..NQATAEVSHILHLGKLQTGDVYNSVDSARKHADTVLEGLYDLDQAGVELMAQVRTKMEELKATIRQVLDWTMTGGVT
A0AFU0_LISW6/2-192M..NSSTEG..........QMQVYRYQLATAYKQ.ENILEKYLAFEQSHRAFFDHLTDLVQGIQQTVRELQSNIQFDS..
A7Z9J4_BACA2/3-210I..DSILSGISDIIHLDTYTLDDYADKMGDAQKTRRDTITAVDTLDESLTAEYQNLESLDNAVLSKYSVLMQAT.SNGKS
A0AEP1_LISW6/3-194I..NKTVNRLNDLVPNAVPSKTAIKASKDNFIQNINLLNTHLDNYDERKRGGINEVKKIFKQIESILI............
YQCG_BACSU/2-210M..KDILNDINDILPLDLFSTETFKNELSSAEKKRKEAIEKMDEVDQNLTSEYGLSEANEQMIQADYQALMNAT.AKGKS
A7Z3I9_BACA2/2-210M..RSILGEIDDIISLDLFSTESTDQKLSSADKKRSETIHKLDKLDHDLTKEYTETEANEQFIQADFEQLQNAT.GTGKS
Q92ER0_LISIN/6-207IMKTSLIRALFDAAQDCKRELNQMSDVLQQDIEELQKKLEKLYEFDGQTKNLFTSSLDEMKLAMQGVLILNNTTVN....
O64023_BPSPB/2-210M..KDILNDINDILPLEIFSTEDFKDKLSSADDKREKTIDKINKLDEDLKTEYAETEQNEQFIQQDFKKLQEST.GKGKN
Q4EV84_LISMN/2-201L..TAPNTK.PDMQQVYVVQARSAHTQLLQAIEK.EDILERYIAFEQSHAQFFSALTELIHSTGRAVQELKQNVTFHE..
Q65D27_BACLD/2-211I..NDEVDKISHLIGGGSISLASFNEHISEAKKHVNNTVSDLKELDRDANSILKQSSNSIAQLSKLTEKVNTWS.KGGAI
Q8ELE0_OCEIH/2-205T..NQILTSISDIMYLSPLDDSAFQHNIEKGKQKIDHVIQDLHELDSKHASKLQQTKDDISTLKSYLSEMSSRL.RNGSI
Q8YA28_LISMO/2-201L..TAPNTK.PDMQQVYAVKSRSVHTQLLKAIEQ.ENILEKYLAFEQSHGQFFSALDELIRATARAVQELLHHVSFND..
Q8EL62_OCEIH/2-205T..NDILRSVRDIIHLSDVSDDQFIHSVEKTESKVNKTIEKLHQFDQEATHKLTTTENDVDLLENYLSDIQSLT.KDRQL
Q5WKM5_BACSK/2-210I..NSACASIQDLVHTGTFTMDGVQSWADMLKQHAQDTADRLEELDAENINLANEAEATLTELMQSTEKVINWT.TGGPI
Q92CT5_LISIN/2-196L..SSMTAVSRQG......EINALQTQIFANYKK.EQLLEKFLDFERAHSHFFQELSDLARAINRGVRDIQANISFNS..
Q65NH2_BACLD/2-205A..NQTMATVSHIVDLPDLDDSAVNENAKKAQRQISETLEKLHTFDREQTNALKAAREDLDTMKQYIQQLEKMY.TGPKI
Q8ERI3_OCEIH/3-199V..RETMNSVSDI.......TSAIHPNYYPPEADKDDVIKIITNLEQELNSFTSVGQEEISSIEDLLNQVATTIENAGTV
Q65H85_BACLD/2-209M..DKIIASISDIVDLDNWTLDDYIDKMSKAQTTRQNTIDAVNKLDESLKTEYTNLQALDSAVLGKYSGLMEAT.SHGKT

PF00934

A5WTG4_MYCTF/1-94N-------------------------------------------------------------------------------
A5WKB5_MYCTF/1-94A-------------------------------------------------------------------------------
C1AQP8_MYCBT/1-94N-------------------------------------------------------------------------------
A5WMC3_MYCTF/1-94N-------------------------------------------------------------------------------
Q79FU2_MYCTU/1-93S-------------------------------------------------------------------------------
A4KGC0_MYCTU/11-104N-------------------------------------------------------------------------------
A4KFE3_MYCTU/1-94N-------------------------------------------------------------------------------
PG46_MYCTU/1-94S-------------------------------------------------------------------------------
PG34_MYCTU/1-94D-------------------------------------------------------------------------------
A5WJ08_MYCTF/32-125N-------------------------------------------------------------------------------
A5U0D2_MYCTA/1-94G-------------------------------------------------------------------------------
A0PVK0_MYCUA/1-94N-------------------------------------------------------------------------------
A5U7B2_MYCTA/2-95N-------------------------------------------------------------------------------
A0PSY5_MYCUA/1-94N-------------------------------------------------------------------------------
Q7DAD0_MYCTU/1-94N-------------------------------------------------------------------------------
A4KGY4_MYCTU/1-94N-------------------------------------------------------------------------------
A0PTY2_MYCUA/1-94N-------------------------------------------------------------------------------
A5WQ97_MYCTF/1-94V-------------------------------------------------------------------------------
A5U225_MYCTA/1-94A-------------------------------------------------------------------------------
A5WKZ9_MYCTF/1-94N-------------------------------------------------------------------------------
A0PN15_MYCUA/1-94N-------------------------------------------------------------------------------
A0PKU3_MYCUA/1-94N-------------------------------------------------------------------------------
A1KHM5_MYCBP/1-94N-------------------------------------------------------------------------------
A0PN06_MYCUA/1-94N-------------------------------------------------------------------------------
Q73ZU4_MYCPA/1-94N-------------------------------------------------------------------------------
Q79FE6_MYCTU/1-94A-------------------------------------------------------------------------------
Q7U161_MYCBO/1-94A-------------------------------------------------------------------------------
Q9L8K3_MYCMR/1-94N-------------------------------------------------------------------------------
A0PUM7_MYCUA/1-93L-------------------------------------------------------------------------------
Q8VJ19_MYCTU/38-131N-------------------------------------------------------------------------------
A5TZR2_MYCTA/1-94N-------------------------------------------------------------------------------
Q79FP2_MYCTU/1-94N-------------------------------------------------------------------------------
Q79G09_MYCTU/1-94N-------------------------------------------------------------------------------
A0PST5_MYCUA/1-94N-------------------------------------------------------------------------------
A0PU40_MYCUA/1-94N-------------------------------------------------------------------------------
A0PP63_MYCUA/1-94A-------------------------------------------------------------------------------
A0PQV1_MYCUA/1-94S-------------------------------------------------------------------------------
PG36_MYCBO/1-94N-------------------------------------------------------------------------------
Q53504_MYCTU/1-94A-------------------------------------------------------------------------------
Q6MWW8_MYCTU/1-94N-------------------------------------------------------------------------------
A5U1B3_MYCTA/1-94N-------------------------------------------------------------------------------
A0PW15_MYCUA/1-94N-------------------------------------------------------------------------------
A0PVP7_MYCUA/1-94N-------------------------------------------------------------------------------
A0PLN2_MYCUA/1-94N-------------------------------------------------------------------------------
Q6MWX5_MYCTU/1-94T-------------------------------------------------------------------------------
A5TZV8_MYCTA/1-93N-------------------------------------------------------------------------------
A4KK43_MYCTU/1-95N-------------------------------------------------------------------------------
Q7U0H3_MYCBO/1-94N-------------------------------------------------------------------------------
Q73SD0_MYCPA/1-94N-------------------------------------------------------------------------------
A5U8I8_MYCTA/1-94A-------------------------------------------------------------------------------
A1KEY0_MYCBP/1-94N-------------------------------------------------------------------------------
A0PPR6_MYCUA/1-94S-------------------------------------------------------------------------------
A0PW44_MYCUA/1-94N-------------------------------------------------------------------------------
A0PVT8_MYCUA/1-94N-------------------------------------------------------------------------------
A5WSR4_MYCTF/3-95N-------------------------------------------------------------------------------
A0PMJ9_MYCUA/1-94N-------------------------------------------------------------------------------
A2VPQ0_MYCTU/1-93N-------------------------------------------------------------------------------
A4KFL9_MYCTU/1-94N-------------------------------------------------------------------------------
A4KKS6_MYCTU/3-96A-------------------------------------------------------------------------------
A2VKU7_MYCTU/1-94N-------------------------------------------------------------------------------
A5U3I5_MYCTA/1-94S-------------------------------------------------------------------------------
A0PML9_MYCUA/3-96A-------------------------------------------------------------------------------
Q741T4_MYCPA/1-94N-------------------------------------------------------------------------------
A0PVP0_MYCUA/1-94N-------------------------------------------------------------------------------
A5WSZ7_MYCTF/1-94N-------------------------------------------------------------------------------
A2VJ92_MYCTU/1-94I-------------------------------------------------------------------------------
A0PKS2_MYCUA/1-94N-------------------------------------------------------------------------------
A1KH04_MYCBP/1-94N-------------------------------------------------------------------------------
A1KJL7_MYCBP/1-94N-------------------------------------------------------------------------------
A2VLI5_MYCTU/49-142N-------------------------------------------------------------------------------
A0PT39_MYCUA/1-94G-------------------------------------------------------------------------------
Q49943_MYCLE/2-95N-------------------------------------------------------------------------------
A0PQY4_MYCUA/1-94S-------------------------------------------------------------------------------
A0PU10_MYCUA/1-94N-------------------------------------------------------------------------------
A2VKF6_MYCTU/1-94N-------------------------------------------------------------------------------
A0PQL4_MYCUA/3-96N-------------------------------------------------------------------------------
A0PPD4_MYCUA/1-94N-------------------------------------------------------------------------------
Q7D7A7_MYCTU/1-94N-------------------------------------------------------------------------------
A1KLI5_MYCBP/1-94N-------------------------------------------------------------------------------
Q9L8K4_MYCMR/1-94N-------------------------------------------------------------------------------
A4KHS6_MYCTU/1-94T-------------------------------------------------------------------------------
A5U308_MYCTA/1-94S-------------------------------------------------------------------------------
A0PTJ3_MYCUA/1-94N-------------------------------------------------------------------------------
A0PVH2_MYCUA/1-95A-------------------------------------------------------------------------------
A1KKK5_MYCBP/1-94N-------------------------------------------------------------------------------
A5TYM6_MYCTA/39-132N-------------------------------------------------------------------------------
A0PUM0_MYCUA/1-94N-------------------------------------------------------------------------------
Q5Z3L2_NOCFA/2-87H-------------------------------------------------------------------------------
A2VM07_MYCTU/1-94N-------------------------------------------------------------------------------
Q7D6Z7_MYCTU/10-103G-------------------------------------------------------------------------------
Q7VEQ9_MYCBO/1-94N-------------------------------------------------------------------------------
A0PT20_MYCUA/1-94S-------------------------------------------------------------------------------
A5WMF0_MYCTF/6-99N-------------------------------------------------------------------------------
A0PVD2_MYCUA/1-81S-------------------------------------------------------------------------------
A0PUN3_MYCUA/1-78N-------------------------------------------------------------------------------
Q73ZT7_MYCPA/1-94N-------------------------------------------------------------------------------
A0PRQ0_MYCUA/1-94G-------------------------------------------------------------------------------
A0PPD7_MYCUA/2-95N-------------------------------------------------------------------------------
A0PLN3_MYCUA/1-94A-------------------------------------------------------------------------------
Q9L8K5_MYCMR/1-94A-------------------------------------------------------------------------------
A0PSJ0_MYCUA/1-94N-------------------------------------------------------------------------------
A0PSI6_MYCUA/1-94N-------------------------------------------------------------------------------
A0PNR1_MYCUA/1-94A-------------------------------------------------------------------------------
A0PVM5_MYCUA/1-94N-------------------------------------------------------------------------------
A0PTY1_MYCUA/1-94N-------------------------------------------------------------------------------
A5U9E1_MYCTA/1-94N-------------------------------------------------------------------------------
A0PVS1_MYCUA/1-94N-------------------------------------------------------------------------------
Q7D879_MYCTU/1-94N-------------------------------------------------------------------------------
A0PR61_MYCUA/1-94N-------------------------------------------------------------------------------
A5U1M1_MYCTA/1-95A-------------------------------------------------------------------------------
A0PS20_MYCUA/1-94N-------------------------------------------------------------------------------
A0PVW6_MYCUA/1-94N-------------------------------------------------------------------------------
A0PMQ8_MYCUA/1-94A-------------------------------------------------------------------------------
A3PSJ4_MYCSJ/1-93N-------------------------------------------------------------------------------
Q79FJ9_MYCTU/3-96N-------------------------------------------------------------------------------
A0PLN5_MYCUA/1-94N-------------------------------------------------------------------------------
A2VG56_MYCTU/1-94I-------------------------------------------------------------------------------
A0PRW2_MYCUA/1-94N-------------------------------------------------------------------------------
A1KEU5_MYCBP/1-94V-------------------------------------------------------------------------------
P71664_MYCTU/1-94N-------------------------------------------------------------------------------
Q73WT4_MYCPA/1-94N-------------------------------------------------------------------------------
A0PNH3_MYCUA/1-94A-------------------------------------------------------------------------------
A0PPN9_MYCUA/1-95N-------------------------------------------------------------------------------
A0PV62_MYCUA/1-94N-------------------------------------------------------------------------------
A0PL58_MYCUA/1-94N-------------------------------------------------------------------------------
A0PVM4_MYCUA/1-94S-------------------------------------------------------------------------------
Q744A0_MYCPA/1-94N-------------------------------------------------------------------------------
Q79FB3_MYCTU/1-94A-------------------------------------------------------------------------------
A1KI31_MYCBP/1-94N-------------------------------------------------------------------------------
A0PM18_MYCUA/1-93N-------------------------------------------------------------------------------
A0PMR0_MYCUA/1-93N-------------------------------------------------------------------------------
Q7TW48_MYCBO/1-94N-------------------------------------------------------------------------------
A0PVL1_MYCUA/1-95S-------------------------------------------------------------------------------
A0PMR7_MYCUA/1-94N-------------------------------------------------------------------------------
A5U8I2_MYCTA/1-94N-------------------------------------------------------------------------------

PF10817

Y2078_MYCTU/1-104AAELKAVVCSCAT-------------------------------------------------------------------
A0PX53_MYCUA/1-104AQALQAVRWGAVT-------------------------------------------------------------------
Q73RU9_MYCPA/1-104ATEMRALRPSSSP-------------------------------------------------------------------

PF06013

Q97MZ9_CLOAB/4-89-------------
A9B0A6_HERA2/4-89-------------
Q92FP7_LISIN/3-89-------------
Q65FP7_BACLD/20-106-------------
Q3EVF5_BACTI/10-96-------------
A7GQF4_BACCN/5-91-------------
A5IPF7_STAA9/6-92-------------
Q2ESP2_BACTU/5-90-------------
Q7CMD2_BACAN/4-89-------------
Q635B3_BACCZ/3-88-------------
A0RJQ0_BACAH/3-88-------------
Q81TJ4_BACAN/3-88-------------
A0RLV8_BACAH/3-88-------------
A0RD24_BACAH/3-88-------------
A0RGK4_BACAH/3-88-------------
A9VP01_BACWK/3-88-------------
Q63F57_BACCZ/5-90-------------
A9VT14_BACWK/3-88-------------
Q81R67_BACAN/3-88-------------
Q81R60_BACAN/6-91-------------
Q97LZ0_CLOAB/3-88-------------
Q63EA3_BACCZ/3-88-------------
A9VNM9_BACWK/4-87-------------
Q92FQ4_LISIN/4-89-------------
Q8ERJ1_OCEIH/4-89-------------
Q81HA0_BACCR/6-91-------------
A5IPF0_STAA9/3-88-------------
A3CR39_STRSV/3-88-------------
Q8E7D1_STRA3/3-88-------------
A2RMK4_LACLM/3-88-------------
A4IKE4_GEOTN/4-89-------------
A8FGZ8_BACP2/4-89-------------
Q65FF4_BACLD/4-90-------------
Q5WK78_BACSK/4-89-------------
A5KPT5_9FIRM/4-89-------------
A3DD43_CLOTH/4-90-------------
Q9KE84_BACHD/3-88-------------
Q97LY9_CLOAB/4-91-------------
Q97LY7_CLOAB/15-100-------------
Q97MZ8_CLOAB/5-90-------------
Q97KJ1_CLOAB/6-91-------------
Q97MZ2_CLOAB/6-93-------------
Q97M02_CLOAB/3-88-------------
Q9L0T5_STRCO/28-115-------------
A6WCP9_KINRD/3-90-------------
Q6ACE0_LEIXX/8-95-------------
A0QM17_MYCA1/4-89-------------
A1T456_MYCVP/3-88-------------
A5U9N3_MYCTA/6-91-------------
Q73SS3_MYCPA/16-101-------------
A0PX50_MYCUA/6-91-------------
A3PWA4_MYCSJ/4-90-------------
A0QTK0_MYCS2/4-90-------------
A1SN44_NOCSJ/4-90-------------
Q5YN04_NOCFA/7-92-------------
Q5YRS3_NOCFA/4-91-------------
O86644_STRCO/7-92-------------
A8M600_SALAI/5-90-------------
Q82K72_STRAW/7-92-------------
ES6LX_MYCLE/3-88-------------
A0PSK7_MYCUA/2-87-------------
Q5Z1J3_NOCFA/4-90-------------
A4T0V0_MYCGI/3-88-------------
A5U732_MYCTA/3-88-------------
Q73TD4_MYCPA/3-88-------------
ESXR_MYCLE/3-88-------------
Q1B0C3_MYCSS/3-88-------------
Q1BFZ1_MYCSS/3-88-------------
A5U9K3_MYCTA/3-88-------------
Q6NJ54_CORDI/3-88-------------
Q8NST7_CORGL/3-88-------------
A3TFP5_9MICO/5-90-------------
A3KJS8_STRAM/7-92-------------
A1SDG6_NOCSJ/5-90-------------
A8LV95_SALAI/3-88-------------
A8M3S3_SALAI/3-88-------------
Q8G878_BIFLO/3-88-------------
A1A0W4_BIFAA/3-88-------------
Q5YBV2_9BIFI/3-88-------------
A3TRR1_9MICO/4-89-------------
A4AIC4_9ACTN/3-88-------------
A5CTX2_CLAM3/3-88-------------
A6WE48_KINRD/3-88-------------
A1R3I1_ARTAT/3-88-------------
A0JT10_ARTS2/3-88-------------
A7B9U9_9ACTO/22-107-------------
A0LR18_ACIC1/3-88-------------
A5UYZ8_ROSS1/3-88-------------
A7NL38_ROSCS/3-88-------------
A5UYZ9_ROSS1/3-88-------------
A5UZ07_ROSS1/3-89-------------
Q6NJ55_CORDI/4-89-------------
A4QBS1_CORGB/4-89-------------
Q73S33_MYCPA/6-92-------------
ES6LY_MYCLE/5-91-------------
A5WPW1_MYCTF/4-90-------------
O05453_MYCTU/4-91-------------
A9B1N8_HERA2/5-91-------------
A9B0B5_HERA2/5-92-------------
A9B2P0_HERA2/5-91-------------
A9B726_HERA2/5-91-------------
A9B720_HERA2/5-92-------------
A9B8D4_HERA2/5-92-------------
A9AUV8_HERA2/5-92-------------
A9AUW0_HERA2/5-92-------------
A9B561_HERA2/5-92-------------
A9B6G5_HERA2/5-91-------------
Q5YRS2_NOCFA/6-91-------------
A8LV94_SALAI/5-90-------------
A8M601_SALAI/3-88-------------
Q5ARS9_EMENI/25-110-------------
O86643_STRCO/16-101-------------
Q5YU75_NOCFA/7-92-------------
A4T4Z6_MYCGI/5-91-------------
A4KMZ0_MYCTU/3-88-------------
A0QNJ5_MYCS2/3-88-------------
ESXB_MYCLE/3-88-------------
A4FPH3_SACEN/3-88-------------
Q5Z1J2_NOCFA/6-93-------------
A3TFP6_9MICO/5-90-------------

PF10824

A0PRC6_MYCUA/1-99-------------
A4KM90_MYCTU/1-100-------------
A4TFT9_MYCGI/10-109-------------
A0R672_MYCS2/1-104-------------
A4KMY1_MYCTU/1-100-------------
A4FPN7_SACEN/1-99-------------
A0PKF1_MYCUA/1-99-------------
A2VMP0_MYCTU/1-100-------------
A5U9J3_MYCTA/1-100-------------
Q744T9_MYCPA/1-99-------------
A5TY98_MYCTA/1-99-------------
A0Q8V7_MYCA1/1-99-------------
A1KPV0_MYCBP/1-100-------------
A4TG17_MYCGI/35-139-------------
A0QNK5_MYCS2/1-100-------------
A1TH04_MYCVP/1-103-------------
A2VMW8_MYCTU/1-99-------------
A5U8T9_MYCTA/1-100-------------
C1AJ24_MYCBT/1-99-------------
Q6MZ31_MYCUA/1-87-------------
A0QSQ2_MYCS2/3-102-------------
Y028_MYCBO/1-99-------------
Y406_MYCLE/4-103-------------
Y3645_MYCBO/1-100-------------
ESPC_MYCTU/1-100-------------
Y027_MYCTU/1-99-------------
A4KN58_MYCTU/1-99-------------
A3Q4D4_MYCSJ/1-100-------------
A4TFR2_MYCGI/1-98-------------
A0PW23_MYCUA/1-100-------------
Q5Z2J0_NOCFA/9-106-------------
A1KEJ5_MYCBP/1-99-------------
A2VM00_MYCTU/1-100-------------
A1UA43_MYCSK/1-103-------------
Q1B4R9_MYCSS/1-100-------------
A0R2G1_MYCS2/1-98-------------
A4T8Y2_MYCGI/1-99-------------
Q7TVH1_MYCBO/1-100-------------
A1UQ32_MYCSK/1-99-------------
A1TDN8_MYCVP/1-99-------------
A0QQE6_MYCS2/1-94-------------
Q1BET9_MYCSS/1-103-------------
ESPF_MYCTU/1-100-------------
A0R605_MYCS2/34-130-------------
Q5YTI6_NOCFA/5-105-------------
A4T505_MYCGI/1-96-------------
A3PTP9_MYCSJ/1-103-------------
A5WU86_MYCTF/1-100-------------
A1T2U3_MYCVP/1-103-------------
A4TEX2_MYCGI/1-100-------------
A1T184_MYCVP/1-96-------------
A1KQK0_MYCBP/1-100-------------
A4T2V3_MYCGI/252-348-------------
A0QNI6_MYCS2/1-100-------------
C1AI73_MYCBT/1-100-------------
A1UKB8_MYCSK/1-100-------------

PF00823

A5WS31_MYCTF/7-165-------------
A5WSZ4_MYCTF/4-161-------------
C1AP76_MYCBT/5-162-------------
Q1B0C5_MYCSS/11-168-------------
A4KDZ8_MYCTU/5-163-------------
Q7TYL4_MYCBO/5-162-------------
A0PW88_MYCUA/6-164-------------
A5TZB4_MYCTA/5-163-------------
A4KG95_MYCTU/5-160-------------
A4KLV7_MYCTU/4-161-------------
Q7TWP0_MYCBO/5-163-------------
Q7TYR8_MYCBO/6-167-------------
A0Q926_MYCA1/8-164-------------
Q7D7Y7_MYCTU/18-176-------------
A0PSL4_MYCUA/6-164-------------
A0PV61_MYCUA/6-164-------------
A1KER7_MYCBP/2-160-------------
Q854W2_9CAUD/132-282-------------
Q743Z9_MYCPA/26-175-------------
Q7U053_MYCBO/7-165-------------
Q8VIY0_MYCTU/6-164-------------
Q73UE8_MYCPA/5-162-------------
A2VEZ8_MYCTU/8-166-------------
A5U1I2_MYCTA/5-163-------------
Q7TZA6_MYCBO/5-163-------------
A4KED0_MYCTU/8-166-------------
PPE58_MYCTU/4-170-------------
A1UQ41_MYCSK/9-167-------------
A5U0E2_MYCTA/6-164-------------
A0PQL0_MYCUA/8-165-------------
A1KN13_MYCBP/11-169-------------
A0QE87_MYCA1/5-163-------------
A0PSJ9_MYCUA/6-164-------------
Q8VIZ3_MYCTU/6-164-------------
A0PVU0_MYCUA/5-163-------------
PPE45_MYCBO/5-163-------------
PPE36_MYCTU/6-163-------------
A0PQD0_MYCUA/8-166-------------
A0QCD6_MYCA1/11-169-------------
Q8VJK7_MYCTU/38-196-------------
A5U9K1_MYCTA/5-163-------------
Q8VJP8_MYCTU/8-150-------------
Q0S9F2_RHOSR/145-302-------------
O33085_MYCLE/14-130-------------
A1KJY1_MYCBP/5-163-------------
A0PVS2_MYCUA/8-166-------------
Q73WQ9_MYCPA/13-171-------------
A4KHR2_MYCTU/5-163-------------
A0QM56_MYCA1/8-166-------------
Q50175_MYCLE/23-181-------------
A0PN58_MYCUA/4-162-------------
Q741D6_MYCPA/5-162-------------
PPE03_MYCTU/6-164-------------
PPE28_MYCTU/7-165-------------
P95182_MYCTU/5-163-------------
Q73TJ3_MYCPA/8-166-------------
A0QM63_MYCA1/8-166-------------
Q6MWX8_MYCTU/5-163-------------
A0PW45_MYCUA/5-163-------------
A4KHL9_MYCTU/41-200----