Sequence alignment for CL0353

PF00965

Q29AK5_DROPS/26-197DACSCM.P.SHPQTH--FCKA------DY...........VVQLRV....LR-----KSDTIDPG............KTT
Q1RLX2_DANRE/24-203EACSCS.P.VHPQQA--FCNA------DV...........VIRAKV....VG-----KKEVDSGNDIYGNP....IKRIQ
A7SSJ2_NEMVE/18-205KACVCKMG.SHPQDK--FCQA------DF...........VVRGRVESGPVE-----GYITYPPQSRGFRHWPKQRDVLV
TIMP2_CAVPO/25-203DACSCS.P.VHPQQA--FCNA------DV...........VIRAKA....VS-----EKEVDSGNDIYGNP....IKRIQ
Q4T4E9_TETNG/25-214EACSCA.P.VHPQQA--FCNA------DVGDTRAARGMWKMIRAKV....VG-----EQEVNSGNDIYGNP....IKRIQ
TIMP3_BOVIN/22-194EACTCS.P.SHPQDA--FCNS------DI...........VIRAKV....VG-----KKLLKEGPF..........GTMV
TIMP_DROME/26-197DACSCM.P.SHPQTH--FAQA------DY...........VVQLRV....LR-----KSDTIEPG............RTT
Q4W7T6_ORYLA/25-203EACSCS.P.AHPQQA--VCNS------DV...........VIRAKL....VG-----RQEVDAGNDIYGNT....IKRIK
A7RL40_NEMVE/15-176NAA............--....------.............TIKGKI....LG-----KIRKEGPG............MKS
A7SSJ1_NEMVE/20-204DDCICASPHGHPQDV--FCSS------DY...........ALRGLV....TS-----GPKKETIKIMQPPDKPLTRNVLS
Q9GPJ2_CRAGI/21-203HSCMCD.F.THPQNN--FCSA------DF...........VIKATI....VK-----EELKFGDESMGIPFP..LQKNYT
TIMP1_MOUSE/23-199KACSCA.P.PHPQTA--FCNS------DL...........VIRAKF....MG-----SPEINETT...........LYQR
TIMP3_SCYTO/25-197EACTCM.P.NHPQEA--FCNS------DI...........VIRAKV....VG-----KKLLKDGPF..........GTMR
Q6NUX9_DANRE/22-200GACSCS.P.EHPQQA--YCNA------DV...........VIRAKV....VG-----RKEVVTGNDAYGYP....IKMIR
Q4SGL4_TETNG/26-203EACSCS.P.AHPQQA--FCNA------DV...........VIRAKL....VE-----RQEVDVGNDIYGNP....VKQIK
Q962H0_CUCFR/19-179DAQCAGCSVKHPQHH--FCDA------TF...........VMKVTI....ID-----VILDRQGGD..............
Q6DMR2_CRAGI/21-205HSCMCD.I.THPQNK--FCSA------DF...........VIKATI....VR-----EDLEFANNADDIPFP..LMKNYT
TIMP4_RAT/28-207EACSCA.P.AHPQQH--VCHS------AL...........VIRAKI....SS-----EKVVPASEDPADTQ.....KMIR
Q16IW9_AEDAE/30-198EACSCL.P.EHAQTA--YCDA------EY...........VIVAQV....LR-----KSNRKHND............NNV
TIMP1_HUMAN/22-199RACTCV.P.PHPQTA--FCNS------DL...........VIRAKF....VG-----TPEVNQTT...........LYQR
Q4JF88_TAKRU/25-197EGCSCA.L.THPQDA--FCNP------DI...........VIRAKV....VG-----KKLLRDGPF..........GTMR
Q2I6A9_NOTVI/24-202EACSCA.P.QHPQTA--FCHS------QI...........VVRGRI....VG-----IEKMNTENRTDEVP.....SLLR
A7RH10_NEMVE/102-260RAAAST.G.GHPPRI--LTFQ------EV...........TIKRLL....RG-----KS.....................
Q64HW8_ONCMY/25-203EACSCS.P.AHPQQA--FCNA------DV...........VIRAKV....VG-----KKVVEAGNDVYGNT....IKRIK
Q7ZTB0_TAKRU/28-207EGCSCL.P.AHPQQL--FCSS------EI...........VIRAKI....SG-----EKIVSPSNNSSPYM.....KMIQ

PF01759

SFRP1_MOUSE/200-299-------------EH..LCAS......EF-----------ALRMKI----KE.....VKKEN......--------GDKK
CO5_HUMAN/1550-1661-------------QT..ACKPE....IAY-----------AYKVSI----TS.....ITVEN......--------VFVK
NET1_HUMAN/488-594-------------KK..YCKK......DY-----------AVQIHI----LK.....ADKAG......--------DWWK
Q7ZWR8_XENLA/379-484-------------SH..YCAN......QF-----------VVTGTV----NS.....LTQGDS....E--------KSLL
Q1RMV2_BOVIN/310-413-------------SN..YCSS......NF-----------VLAGTV----IT.....TIPRG......--------GSLH
Q9NL28_CIOIN/535-642-------------AK..YCKM......EY-----------AVMVRV----TG.....KIRIG......--------RRTS
A6MK21_CALJA/94-204-------------DK..ACEPG....VDY-----------VYKTRL----VK.....IQLSN......--------DFDE
CO3_RAT/1534-1644-------------DK..ACEPG....VDY-----------VYKTKL----TT.....IELSD......--------DFDE
Q3SX29_BOVIN/186-287-------------ET..LCKN......DF-----------ALKIKV----KE.....ITYINR....D--------TKII
Q9YIA6_CYPCA/1030-1140-------------NK..ACEGG....MDY-----------VYKATV----VG.....MNQTM......--------HSDI
Q91588_9PIPI/1460-1570-------------NM..GCAPG....VDF-----------VYKATL----TE.....VQPSD......--------NFDN
Q90633_CHICK/1523-1633-------------DL..ACKPG....VDY-----------VYKVKV----VA.....TEETP......--------SHDN
Q3L2T4_MACEU/1523-1632-------------EE..ACEPG....VDY-----------VYKVKV----DK.....IKQSD......--------SYDE
Q4RSD5_TETNG/491-599-------------KL..FCAAE....YDY-----------VLVVKV----MS.....AHDKG......--------SHAE
Q4S5G7_TETNG/453-556-------------NS..FCKS......DF-----------VILGRV----TE.....LTEEQ......--------ESGH
CO3_EPTBU/1496-1605-------------GN..ACRA......EY-----------VFIIGV----TK.....VTKTA......--------SYIN
A0A9Q8_9ASCI/181-286-------------KR..FCRK......SI-----------VYEALV----IS.....VAEEG......--------EWIK
Q4S4Z9_TETNG/252-355-------------SN..YCSS......NF-----------VITGTV----IT.....AVMRG......--------GSMY
Q9YIA9_CYPCA/1513-1623-------------NR..ACEAG....MDY-----------VYKVKV----VG.....MDLKQ......--------DADI
NET3_MOUSE/457-570-------------KK..FCRK......DY-----------AVQVAV----GA....RGEARG......--------SWTR
ATL5_HUMAN/364-467-------------LH..YCGS......DF-----------VFQARV----LG.....HHHQA......--------QETR
Q99KX9_MOUSE/254-364-------------EK..ACKPE....TAY-----------AYKVRI----TS.....ATEEN......--------VFVK
Q6VPV1_PIG/1548-1659-------------ET..ACKPE....IAY-----------VYKVKI----IA.....MTEES......--------AFVK
A7SBN2_NEMVE/182-284-------------RR..FCLS......DY-----------AIRARV----DS.....EVHKN......--------GHQQ
Q0V9H1_XENTR/485-591-------------RK..YCKK......DY-----------VLRAQL----LS.....MEKSG......--------EWWQ
Q7ZXM6_XENLA/190-291-------------EN..LCKN......DF-----------ALKIKV----KE.....IAYING....D--------TKII
Q9W6G1_PROAT/775-885-------------NE..ACDPG....RDY-----------VYKVKF----LA.....VNISA......--------SYDH
Q4S019_TETNG/1311-1428-------------AK..ACETQQFNKIDY-----------VYKVRV----QD.....FAEGL......--------STDI
Q32N13_XENLA/188-292-------------QKTYLKNN.....YNY-----------VIRAKV----KE.....VKVKC......--------HDAT
Q7SZG2_TAKRU/1574-1684-------------QH..ACFIP...TVDY-----------AYIVEV----FN.....ISMKS......--------NFEV
A7SHI5_NEMVE/436-545-------------KR..FCRK......DF-----------ALKVTV----VR.....VEKKLP....N--------SWVR
Q4S5B2_TETNG/454-562-------------KL..FCTMN....YAY-----------VLKVKV----LS.....AHDKG......--------SHAE
O08570_MESAU/127-229-------------TX..FRNN.....YNY-----------VIRAKV----KE.....VKAKC......--------HDVT
CO3_RABIT/597-707-------------DK..ACEPG....LDY-----------VYKTKL----VQ.....VERAD......--------DFDE
Q4SVH8_TETNG/1716-1828-------------TF..ACSS.....LHH-----------VFKVKV----AN.....VSQS.......--------YYDS
SFRP1_CHICK/200-299-------------EH..LCAS......EF-----------ALKMTI----KE.....VKKENG....D--------KVII
Q4RGB2_TETNG/197-297-------------EH..MCAS......EF-----------AFKTKI----KE.....VKRENR....D--------RKVI
Q969A4_BRABE/1602-1713-------------EK..ACND.....LDY-----------AFRVIV----ME.....VRQEG......--------SFDR
Q6UAQ6_CTEID/1510-1620-------------VK..ACEAG....MDY-----------VYKVTV----VG.....MDLAH......--------DSDI
Q91741_XENLA/1554-1664-------------TF..ACYSP...RVVF-----------GYRVMV----EN.....IAEQD......--------AFIV
Q2HJB6_BOVIN/340-444-------------SH..FCNS......DL-----------VVTGMI----KS.....MVRGP.....G--------EGLT
Q52L01_XENLA/302-405-------------SN..YCSS......NF-----------VITGTI----IT.....TVSRG......--------GSVY
Q95YK2_CIOSA/556-663-------------GK..FCRM......GY-----------AVVVQV----TG.....KLTLR......--------RKTR
Q0VEM1_MOUSE/517-624-------------KA..FCGMK....YSY-----------VLKIKI----LS.....AHDKG......--------SHAE
Q6P4R1_HUMAN/1615-1725-------------KF..ACYYP...RVEY-----------GFQVKV----LR.....EDSRA......--------AFRL
SFRP5_HUMAN/195-296-------------EQ..MCSS......DF-----------VVKMRI----KE.....IKIENG....D--------RKLI
Q32PN6_DANRE/181-281-------------DH..MCAS......EF-----------AIKTKI----QE.....VKRENM....D--------RKVT
Q9DDV9_ONCMY/1553-1662-------------DK..ACESH....MDY-----------VFKASM----VN.....ATLES......--------YTDT
Q98977_ONCMY/1484-1594-------------DK..ACEAG....MDY-----------VFKASL----VN.....ATLES......--------YTDT
Q4S9P7_TETNG/197-299-------------TY..VKNN.....YNY-----------VIRARV----KE.....VRNRG......--------LEPT
Q4RZT6_TETNG/1515-1632-------------AK..SCETTPTSKIDF-----------VYKVRV----ER.....FTADL......--------STDV
Q66IT1_XENLA/372-477-------------SH..YCAN......QF-----------VVTGTV----NA.....LTQGDS....E--------KSLL
Q3KQ69_XENLA/197-296-------------EH..MCAS......DF-----------ALKVSI----RE.....VKKENG....D--------RKLL
O42203_DANRE/487-595-------------KK..YCKK......DF-----------AVQVHV----LK.....GDKAG......--------EWWK
NET3_CHICK/465-571-------------KK..YCKK......DY-----------VVQVNI----LE.....METVA......--------NWAK
CO32_AUSSU/1522-1632-------------QK..ACAPN....VDY-----------VYKAKL----LR.....IEEKD......--------GNDI
A7SX91_NEMVE/256-359-------------AH..FCIS......QH-----------VILARI----TK.....IRSNK......--------QRTV
CO3_BOVIN/1532-1642-------------DK..ACEPG....VDY-----------VYKTRL----IQ.....KKLED......--------DFDE
Q59JG2_HEMPU/509-616-------------NK..YCKK......DY-----------VLHAHV----LS.....REMED......--------EWVK
PCOC1_MOUSE/353-457-------------SN..FCSS......SL-----------VVTGTV----KT.....MVRGP.....G--------EGLT
CO3_LAMJA/1543-1654-------------EA..ACVAG....IDY-----------AYVGIV----DN.....RTEVG......--------SFVY
A5PMP6_DANRE/1549-1662-------------AA..VCNG.....LHH-----------AYRVKL----IS.....ISQS.......--------HYYQ
Q4RJA3_TETNG/792-902-------------SN..A...K....TDF-----------VYKVQV----DD.....FYEDL......--------STDV
UNC6_CAEEL/491-597-------------KK..FCKR......DH-----------AVQMVV----VS.....REMVD......--------GWAK
A3KNP6_DANRE/185-285-------------DQ..MCAS......EF-----------AIKTKI----KE.....VKIDNL....D--------RKVI
Q70TF5_ONCMY/1595-1705-------------EH..ACYSP...TVDY-----------GFIVQV----IS.....MSVKS......--------NFEL
Q8AYN9_CYPCA/1560-1672-------------ND..MCKES....MNY-----------AFKVLI----ES.....SEAGG......--------DFVT
NET5_HUMAN/361-468-------------RR..YCQQ......DH-----------VLRAQV----LA.....SEAAG.....P--------AWQR
A5PM87_DANRE/316-419-------------SH..YCSS......NF-----------VITATL----IS.....AAMRE......--------QSVL
Q6GZK1_ORYLA/191-291-------------EN..ICAS......EF-----------ALKAKI----KE.....VKQENM....D--------RKVI
Q98TS6_ANAMI/1526-1643-------------AK..VCETELNNKIDF-----------AYRVGL----EE.....FTDGL......--------STDI
Q9W6E0_DANRE/199-303-------------QKTYSKNN.....YNY-----------VIRARV----KE.....IRIRN......--------HDLS
Q9IBH1_ORYLA/1522-1639-------------SK..ICESTESSKIEY-----------AYKVLV----ED.....VVQKP......--------SIDI
Q8WPD8_CIOIN/1602-1707-------------DE..GCSA......KY-----------VYKVRV----IG.....VREDS......--------VFVN
O44344_STRPU/1565-1680-------------GT..ACASH....SSY-----------ALKIRI----DE.....VEIKE......--------GFRI
Q76KI4_TRISC/1564-1675-------------DF..ACYSP...IVDY-----------AYTVRV----LN.....ISSAG......--------SFDN
Q4SXM5_TETNG/1606-1718-------------SE..TCRPQ....IRY-----------AYKVMV----KS.....SAAEG......--------DFMT
Q32SK9_DANRE/482-590-------------KK..YCKK......DY-----------AVQVSV----LD.....METVG......--------DWAK
Q4RHV3_TETNG/135-245-------------QH..ACFVP...TVDY-----------AYVVEV----LN.....VSMKS......--------NFEL
Q076D6_CHICK/1536-1646-------------DF..ACYSP...RVDY-----------ALVVRV----LS.....QSEIG......--------AFVA
Q4SKX3_TETNG/205-306-------------EH..YCAS......DF-----------ALKMKI----KE.....VKKEKG....D--------RKLI
Q8MX24_ANCCA/29-132-------------KL..LCQS......QF-----------VTHAKV----TK.....KRIDG......--------YFIY
Q0IGC3_AEDAE/141-257-------------NK..FCKR......DY-----------AIMAKV----TG.....RTTSSNKHVPR--------DEVR
Q9I933_CYPCA/1566-1681-------------RY..ACYSP...GVDY-----------AYVIKV----LN.....SSTDH......--------VFMY
Q32SK8_DANRE/445-554-------------KV..FCNAK....YAY-----------AVKVRV----LG.....AHDKG......--------SHAE
Q1PHQ2_SACKO/484-590-------------NK..YCKK......DY-----------AVQANI----LS.....REQTT......--------DWVK
NET5_MOUSE/314-431-------------QR..YCQQ......DY-----------VLHAQV----SASSSQPSEAVG.....P--------EWWR
Q4SF52_TETNG/897-1011-------------ELLFYLKN.....VSS-----------VLKVQV----RG.....MERSG......--------PWWQ
Q3L5A8_GADMO/75-188-------------DK..ACDAEV..KIDY-----------VYKVTM----ES.....YVDHN......--------STDV
O96659_HIRME/495-600-------------VK..YCKR......DY-----------AIHAQV----TS.....REIIG......--------EWAK
A4IGU5_XENTR/180-281-------------QN..YCSS......DF-----------ALKINI----RS.....VSTLEG....D--------VMVV
SFRP4_HUMAN/188-289-------------AT..YLSKN....YSY-----------VIHAKI----KA.....VQRSG.....C--------NEVT
PCOC2_MOUSE/308-411-------------SN..YCSS......NF-----------VLAGTV----IT.....TVTRG......--------GSLH
Q8I7P1_9CNID/1611-1718-------------GL..FCTT.....YDY-----------AFKGKL----LI.....IDEED......--------QWLH
Q9IBG9_ORYLA/1588-1699-------------EH..ACFYP...VVDY-----------AYIVTV----NS.....VSLKS......--------NFEL
CO3_ONCMY/1507-1621-------------DK..ACGAG....LDY-----------VYKATV----VD.....SKLTT......--------HTDT
Q62238_MOUSE/465-575-------------RF..ACYYP...RVEY-----------GFTVKV----LR.....EDGRA......--------AFRL
CO3_NAJKA/1513-1623-------------EK..ACETN....VDY-----------VYKTKL----LR.....IEEQD......--------GNDI
Q3MU73_DANRE/1522-1632-------------IK..ACEPH....LDY-----------IYKAKL----VK.....MDLKQ......--------DSDI
Q9NFW6_BRAFL/441-548-------------KN..YCKS......GY-----------VIQCSI----LS.....REILG......--------EWTK
Q9I932_CYPCA/1587-1697-------------EY..ACFHT...NIEY-----------AFEVIV----NS.....VTEES......--------NFML
Q5NKN5_CARRO/1605-1719-------------DR..ACVD.....HDY-----------VWKGTV----ES.....KRKEN......--------GFRY
PCOC1_HUMAN/330-434-------------SN..FCAS......SL-----------VVTATV----KS.....MVREP.....G--------EGLA

PF00965

Q29AK5_DROPS/26-197YKVHIKRTYK----------ATPEARRMLRDGRLATPNSDSM............CGIR.LDLG..K-VYIIAG..R----
Q1RLX2_DANRE/24-203YEIKQIKMFK----------GPDR.....HIDVVFTAPSSAV............CGVTNLDTNGKK-EYLISG..K----
A7SSJ2_NEMVE/18-205HVVMVTQIFK----------GAGLVSKAGKPVAKQPEEGNPLVHNVKIYADRSPCPGW.LRAG..T-DYLLAG...----
TIMP2_CAVPO/25-203YEIKQIKMFK----------GPEK.....DIEFIYTAPSSAV............CGVS.LDVGGKK-EYLIAG..K----
Q4T4E9_TETNG/25-214YEVKQVKMFK----------GPNQ.....DVEAVLTAPVSAV............CGVT.LDASGRK-EYLISG..K----
TIMP3_BOVIN/22-194YTIKQMKMYR----------GFTK...MPHVQYIHTEASESL............CGLK.LEVN.KY-QYLLTG..R----
TIMP_DROME/26-197YKVHIKRTYK----------ATSEARRMLRDGRLSTPQDDAM............CGIN.LDLG..K-VYIVAG..R----
Q4W7T6_ORYLA/25-203YDVKQIKMFK----------GPSH.....DIDAVYTAPSSSL............CGVS.MDTTGKK-EYLITG..K----
A7RL40_NEMVE/15-176AAVSVSHVFK----------GLNQLLTSENAEVFGQIVFQVRLYY......PVNCP...LDVQEGS-QYLFTG..V----
A7SSJ1_NEMVE/20-204YIVEIREVYR----------GGQIIRRTTGLQHRNTTLL..LPSEVRITTDDNACAAI.LPLN..T-EQLIAG...----
Q9GPJ2_CRAGI/21-203VQFKKRDIFK----------GSSLLGSSDTLVIKTSGTPWN.............CGET.FTLN..K-EYVISG...----
TIMP1_MOUSE/23-199YKIKMTKMLK----------GFKAVGNAADIRYAYTPVMESL............CGYAHKSQNRSE-EFLITG..R----
TIMP3_SCYTO/25-197YTIKQMKMYR----------GFSK...MQQVQYIYTEAAESL............CGVR.LQVN.KF-QYLITG..R----
Q6NUX9_DANRE/22-200YDVKQLKMFK----------GPNG.....EIDTIFTGPSSAL............CGVN.LESNGKQ-EYLITG..N----
Q4SGL4_TETNG/26-203FGVKQIKMFK----------GPTQ.....DIEAIYTPPSSAM............CGVS.LQANG.K-EYLITG..K----
Q962H0_CUCFR/19-179.KLINAEINR----------SWKKGPSSGDFQFYAPSSF...............CGAT.FDSG..D-TYVVTGTKE----
Q6DMR2_CRAGI/21-205VQYKNTDIYK----------GSSLLGSSDTLVIKTSGTPWN.............CGET.FTLN..K-EYVISG...----
TIMP4_RAT/28-207YEIKQIKMFK----------GFEK...AKDIQYVYTPFDSSL............CGVK.LETNSQK-QYLLTG..Q----
Q16IW9_AEDAE/30-198YKIAIKKEYK----------MSPRAQKMLKQGKLITPSTDSM............CGIQ.LEVN..Q-LYAIAA..R----
TIMP1_HUMAN/22-199YEIKMTKMYK----------GFQALGDAADIRFVYTPAMESV............CGYFHRSHNRSE-EFLIAG..K----
Q4JF88_TAKRU/25-197YTVKQMKMYK----------GFDK...VQHVQHIYTDASESL............CGVK.FDIN.KY-QYLITG..R----
Q2I6A9_NOTVI/24-202LQIKVSKVFK----------GFDL...KPELEYLYTPIHESL............CGYSHPSNNKSE-EFLFSG..N----
A7RH10_NEMVE/102-260.KVNKTKGFE----------KFTKNLLTRYNARVYTAPK.................VK.LEPN..K-AYLVAG..K----
Q64HW8_ONCMY/25-203YDIKQIKMFK----------GPDR.....DIDAIFTAPSSAV............CGVT.LETNGNK-EYLFTG..K----
Q7ZTB0_TAKRU/28-207YEIKMIKMFK----------GFDK...AKDIQYVYTPVFSSL............CGVK.LDYNNKA-GYLLSG..S----

PF01759

SFRP1_MOUSE/200-299IVPKKKKPLK....LG....PIKK.KELKRLVLFLKNG.ADCP-----------CHQL-DN..LSH.NFLIMG.......
CO5_HUMAN/1550-1661YKATLLDIYK....TG.....EAVAEKDSEITFIKKV.....T-----------CTNA-EL.VKGR.QYLIMGKEALQIK
NET1_HUMAN/488-594FTVNIISVYK....QG....TSRI.RRGDQSLWIRSRD.IACK-----------CPKI-KP...LK.KYLLLGNAED...
Q7ZWR8_XENLA/379-484ATVTIIKTFK....VEG...L.SIQESGKTMSIKVINE.CP.K-----------CPIL-KK...GS.SYLFMGE......
Q1RMV2_BOVIN/310-413ATVSIINIYK....EGN...L.AIQQAGKNMSAKVLVV.CK.Q-----------CPLL-RR...GL.NYIIMGQ......
Q9NL28_CIOIN/535-642ITYQVLRVFK....RGG...M.RLKKKEMIDIQVRDRV.LQCL-----------CPRL-RV...NR.TYLLLGKY....A
A6MK21_CALJA/94-204YVMAIEQIIK....SG....TDEV.QVGQQRTFISPI.....K-----------CREA-LKLEKGK.LYLMWGLSSDFWG
CO3_RAT/1534-1644YIMTIEQVIK....SG....SDEV.QAGQERRFISHV.....K-----------CRNA-LKLQKGK.QYLMWGLSSDLWG
Q3SX29_BOVIN/186-287LETKSKTIYKLNGVSE.........KDLKKSVLWLKDS.LQCT-----------CEEM-ND..INA.PYLVMG.......
Q9YIA6_CYPCA/1030-1140YDMKVEKVVK....EG....TDVN.VEGKVRPFFARP.....S-----------CREY-LGLLEGK.SYLIMGKSVDLPE
Q91588_9PIPI/1460-1570YVMTIKKVIK....QG....TDED.PEDKTRNFISHI.....K-----------CRKA-LNMQLNR.DYLIWGVTGDLWR
Q90633_CHICK/1523-1633YIMSILTVIK....MG....TDEN.PGGSNRTFVSHK.....Q-----------CRDA-LSLQKGQ.DYLVWGLASDLWV
Q3L2T4_MACEU/1523-1632YQMLIKQVIK....SG....SDEN.AQGKIQTFISHV.....K-----------CRDA-LLLKEGK.DYLIWGISSDLW.
Q4RSD5_TETNG/491-599VEVKVKKVLH....QNA...GMKI.RRGSATLYPESWTEQGCT-----------CPIL-NP...GS.EYVVAGHQ.....
Q4S5G7_TETNG/453-556ALVTVEEILK....DEK..MGLRFFGKEPLEVTLLNMD.WNCP-----------CPNI-TT..ANE.QLVVMG.......
CO3_EPTBU/1496-1605INAALKTVLK....KGM...DQAI.NVGARRSFVIPM.....H-----------CGKN-LNVSPGD.IYLVMGMHNAHWR
A0A9Q8_9ASCI/181-286YTIDVTKIRK....KKQ...NRKFVKGRQV.LRARGTHIKPCN-----------CTKL-LL.GAGK.KYLIF........
Q4S4Z9_TETNG/252-355ATVSIINVYK....EGN...L.AIQQAGKTMSTKIVIL.CK.K-----------CPFV-RR...GL.NYVFTGQ......
Q9YIA9_CYPCA/1513-1623YDLEVEQVLK....EG....TDVD.VEGKRRPFLARP.....T-----------CRNH-LGLVEGK.SYLIMGRSVDLPD
NET3_MOUSE/457-570FPVAVLAVFR....SGE...E.RARRGSSA.LWVPTLD.AACG-----------CPRL-LP...GR.RYLLLGGGPGAAA
ATL5_HUMAN/364-467YEVRIQLVYK...........NRSPLRAREYVWAPGH....CP-----------CPML-AP...HR.DYLMAVQRLVSP.
Q99KX9_MOUSE/254-364YTATLLVTYK....TG.....EAA.DENSEVTFIKKM.....S-----------CTNA-N.LVKGK.QYLIMGKEVLQIK
Q6VPV1_PIG/1548-1659YTASLLDVYK....AG.....EAVAEKGSEITFIKKT.....T-----------CTNA-N.LEKGK.QYLIMGKEALQIK
A7SBN2_NEMVE/182-284LRVRVSTRYK....SGA...V....RITKRQLLELRGRELTCN-----------CSQV-LP...SK.VYLIIGKE.....
Q0V9H1_XENTR/485-591FTATVLTVYR....QRR...V.PIRRGDQP.LWVPDHD.LACD-----------CLRV-QV...GK.SYLIIGND....E
Q7ZXM6_XENLA/190-291PETKGKTIYKLNGVTE.........RDLKKTVLWLKDG.LQCT-----------CDEM-ND..INA.PYLVMG.......
Q9W6G1_PROAT/775-885YTAEILEVIK....AGS...DDA..QKGSQKIFITHS.....N-----------CREI-LSLKIDK.QYLVKGHITDLWN
Q4S019_TETNG/1311-1428YTVQVLDVIK....EGN...NDVA.PKGKQRIFLGYP.....H-----------CRAA-LDLKKDK.NYLIMGASRDIHM
Q32N13_XENLA/188-292AIVEVKEILK....SSL...V.NI.PKDTVTLYTNSG....CL-----------CPQL-VA...NE.EYIIMGYE.....
Q7SZG2_TAKRU/1574-1684YETRLKDVLR....THG...DVSV.KVDSVRVFLKRG.....Q-----------CKAN-LD..LGK.EYLIMGKDGSTRD
A7SHI5_NEMVE/436-545ATVNINTLFK....RSR...TRRVRRGDGY.VWIKKRD.FRCR-----------CPKL-KP...GR.SYFIAGNL....R
Q4S5B2_TETNG/454-562VEVKVQKVLS....QNT...KVKI.QRGRATLYPESWTARGCT-----------CPIL-NP...GG.EYLVAGHS.....
O08570_MESAU/127-229AVVEVKEILK....ASL...V.NI.PRDTVNLYTTSG....CL-----------CPPL-HV...NE.EYIIMGYE.....
CO3_RABIT/597-707YLMVVENTIK....SG....SDEV.QAGQPAPFISHI.....K-----------CRDA-LKLKDGK.HYLMWGLSSDPVG
Q4SVH8_TETNG/1716-1828YEMEILQVIK....LGV...EPGV.QPGHRRFFMAHG.....G-----------CRDG-LELKLGS.QYLIMGPKEDRWS
SFRP1_CHICK/200-299P..RKRKALKLGPIRK.........KNLKKLVLLLKNG.ADCP-----------CHQL-DN..LGH.HFLIMG.......
Q4RGB2_TETNG/197-297L.HRRKKTLKAGGLKK.........KELKSLVLYLKNG.ADCP-----------CQQL-DQ..LGH.HYLVMG.......
Q969A4_BRABE/1602-1713ISMIVESPIK....KG....LDDV.FDGEERVFWKRK.....T-----------CSGL-Q.LVEGT.TYLLMGKDGTKYT
Q6UAQ6_CTEID/1510-1620YHLKVDQVLK....EG....TDED.VEGRVRLFLARP.....S-----------CRED-LGLVKGK.SYLIMGKSTDLPK
Q91741_XENLA/1554-1664YTARILEVLQ....RNS...DEDI.KPEDTRLFYQPM.....S-----------CKMR-LA..KET.EYLIMGQDGVTKN
Q2HJB6_BOVIN/340-444ATVNVTGVYK....TGG...L.DLPSPPTDTLLKFYVP.CK.Q-----------CPPM-KK...GI.SYLLMGQ......
Q52L01_XENLA/302-405ATVSIINVYK....EGT...L.AIQQAGKNMSAKITVV.CK.Q-----------CPMV-RR...GL.NYIIMGQ......
Q95YK2_CIOSA/556-663FTLQLHKTYK....RGV...V.RFRKKERVDVEVRDRI.VHCL-----------CPKL-QV...KK.TYLLIGKY....N
Q0VEM1_MOUSE/517-624VNVKIKKVL.....KST...KLKI.LRGKRTLYPESWTNRGCT-----------CPIL-NP...GL.EYLVAGHE.....
Q6P4R1_HUMAN/1615-1725FETKITQVLH....FTK...DVKA.AANQMRNFLVRA.....S-----------CRLR-LE..PGK.EYLIMGLDGATYD
SFRP5_HUMAN/195-296GAQKKKKLLKPGPLKR.........KDTKRLVLHMKNG.AGCP-----------CPQL-DS..LAG.SFLVMG.......
Q32PN6_DANRE/181-281L.QKKKRTIKMGTLKK.........KDLKKLTLYLKNG.ADCP-----------CTQL-DN..TRN.TYLIMG.......
Q9DDV9_ONCMY/1553-1662YLMEIKMIIK....EG....TDLV.LEGGKRLFLAHP.....S-----------CREA-LDLKEGQ.SYLLIGDTADLI.
Q98977_ONCMY/1484-1594YLMEIKRIIK....EG....TDLL.LNGEKRLFLAHP.....S-----------CRKA-LDLEEGQ.SYLLMGDTAALIQ
Q4S9P7_TETNG/197-299AVVDVKEVLK....SSL...V.NI.PKETHTLYYSSS....CL-----------CPPL-AI...GE.EYLIMGYE.....
Q4RZT6_TETNG/1515-1632YSMRILEVIK....EGN...TDVA.PQGKQRPFLSYP.....H-----------CRES-LNLTKGK.TYLLMGSSKDIHG
Q66IT1_XENLA/372-477ATVTIIKTYK....VEG...L.SIQGSGKTMSIKVINE.CP.K-----------CPIL-KK...GS.SYLFMGE......
Q3KQ69_XENLA/197-296L..RKKKALKKGPIQK.........KDWAELVLYLKNG.ANCP-----------CHQL-DQ..LKG.QFLVLG.......
O42203_DANRE/487-595FTINIISVYK....QGG...H.RIRRGDQL.LWVRAKD.VACK-----------CPKI-KP...GR.KYLLMGSDEE..E
NET3_CHICK/465-571FTINILSVYK....CRD...E.RVKRGDNF.LWIHLKD.LSCK-----------CPKI-QI...SK.KYLVMGIS....E
CO32_AUSSU/1522-1632YVMDVLEVIK....GG....TDRN.PQAKARQYVSQR.....K-----------CQEA-LNLNLNN.DYLIWGLSSDLWP
A7SX91_NEMVE/256-359YYADVLAAYK...........GRLSEPAEMLIRVPGG...KCP-----------CPPL-RV...GE.NYVLMGSMRTT..
CO3_BOVIN/1532-1642YIMVIENIIK....SG....SDEV.QVKQERKFISHI.....K-----------CREA-LKLKEGA.HYLVWGVSSDLWG
Q59JG2_HEMPU/509-616FTVNVVTVYK....RGE...Q.RIRRGNTF.LYVRQRD.LTCK-----------CPKI-RL...RH.RYLILGDED...D
PCOC1_MOUSE/353-457VTVSLLGVYK....TGG...L.DLPSPPSGTSLKLYVP.CR.Q-----------MPPM-KK...GA.SYLLMGQ......
CO3_LAMJA/1543-1654YTVNIQTVIK....SGQ...DQAI.QPKATRLFIVTR.....S-----------CDGR-LGMETPR.QYLLMGRKGETKD
A5PMP6_DANRE/1549-1662YEMEIVQVIK....EGT...EEGL.NEKERRMFLSHA.....S-----------CRTR-LNLKEGQ.EYLVIGPITDVWN
Q4RJA3_TETNG/792-902YTMSILESIK....EGS...YDVG.PQGKQRVFLGFP.....N-----------CRKS-IGLVKGK.TYLIMGLSTDIYK
UNC6_CAEEL/491-597YKIVVESVFK....RGT...E.NMQRGETS.LWISPQG.VICK-----------CPKL-RV...GR.RYLLLGKN....D
A3KNP6_DANRE/185-285L.QKRRKLVRAGSMKK.........QDLKKLVLYLKSG.AHCP-----------CQQL-EN..LEN.HYLIMG.......
Q70TF5_ONCMY/1595-1705YTTNVTQVLR....ATG...DVKL.EESKVRVLAKRL.....Q-----------CKGQ-LE..TGK.TYLIMGKDGSTTD
Q8AYN9_CYPCA/1560-1672YKAKVKAVLM....KGQ...TDDL.KTDSEIDLVKKA.....T-----------CSST-N.FEVGK.QYLIMTAESIKIR
NET5_HUMAN/361-468LAVRVLAVYK....QRA...Q.PVRRGDQD.AWVPRAD.LTCG-----------CLRL-QP...GT.DYLLLGSAVG...
A5PM87_DANRE/316-419ATFSIMHLYK....EGN...L.AIQQAGKTMSTKVTVL.CK.Q-----------CPLV-RR...GL.NYIVMGQ......
Q6GZK1_ORYLA/191-291L.QRRKRMVKQGNLKK.........RDLKKLTLYLKNG.ANCP-----------CQQL-EN..LEN.QYLIMG.......
Q98TS6_ANAMI/1526-1643YKVRVLQVIK....EGS...KDVG.PLNKERTLLSYP.....H-----------CRDP-LDLRTGN.NYLIMGASTDIYR
Q9W6E0_DANRE/199-303AIVEVKEVLK....SSL...V.NI.PRDTVTLYYNSG....CL-----------CPPL-TA...ND.EYIIMGYE.....
Q9IBH1_ORYLA/1522-1639YAMRVQDSIK....EGS...TDVG.PRGKLRPFLSYP.....H-----------CRDA-LNLQKGK.TYLIMGSSRDIHK
Q8WPD8_CIOIN/1602-1707LDAVIEDVYR....SG....SDNV.QNGTVRTFVIRND.CHAS-----------CRDT-DE......DLRLLRNNIPAKD
O44344_STRPU/1565-1680CKFTVLNPIK....TG....DEDVPHQAQRQLFINEG....CD-----------CPKV-KGRNIGG.TFLLVGQKSLKYT
Q76KI4_TRISC/1564-1675YQVSIADRLK....MSN..KDDDV.KIGEVRHFLSQR.....S-----------CKFQ-LK..EGD.EYLVMGQDGTTSD
Q4SXM5_TETNG/1606-1718YAATVVEVLK....NSDK.ELEAV.SSGTPVELVKRA.....T-----------CTSV-E.IQENQ.QYLLMGSGGSEIR
Q32SK9_DANRE/482-590FSVSLMSVYK....SRG...D.PLKRGDHM.LWVHMKD.LACK-----------CPRI-HM...GK.RFLILGST....E
Q4RHV3_TETNG/135-245YEARVKDVLR....NHE...DIGV.MEGSIRVFAKRR.....Q-----------CKVQ-LD..LRK.DYLIMGKDGSTRD
Q076D6_CHICK/1536-1646FETEIKEVLL....EGQ...DTAV.APGERRRLLVRK.....S-----------CPLR-LQ..LHN.IYLVMGGSGRTRD
Q4SKX3_TETNG/205-306AAQKKKKVLKLGALRK.........KDLKKLTLYIKNG.ANCP-----------CSQL-DS..LGS.NFLIMG.......
Q8MX24_ANCCA/29-132YDLEHKEVYK............PKDRKIPIELFSWREK.ENCG-----------VPDL-EE...GK.EYLIGGKVTDY..
Q0IGC3_AEDAE/141-257FNLQVQTVFK....STNPLLATSSQRKSSVGLLVPSKN.LDCR-----------CPSI-KI...NK.SYLILGM.....D
Q9I933_CYPCA/1566-1681YTTLITDVLQ....TGL...LDSGIQKHATRQMILRL.....S-----------CDE.-LELKKEV.HYLIMGQNDAISV
Q32SK8_DANRE/445-554VDVKILKVLW....DNT...RLRL.SRGSRTLYPESWMSRGCT-----------CPVL-FP...GGLEYLVVGHE.....
Q1PHQ2_SACKO/484-590FTINVMTVYK....KGQ...N.KIRRGDQI.LYVHNRD.LTCK-----------CPKL-RL...GR.KYLIIGND....N
NET5_MOUSE/314-431LAVHVLAVFK....QRA...W.PVRRGGQE.AWVPRAD.LICG-----------CLRL-RP...GA.DYLLLGRAAQTHD
Q4SF52_TETNG/897-1011FSIAVQTVFR....EGS...ASRVRKGPHS.LWVPDRD.LRCG-----------CPAL-HV...GR.TFLLIGTVEGERA
Q3L5A8_GADMO/75-188YMMRINQVIK....EG....SDKE.PSGKLRTFIGYS.....H-----------CRET-LNLKTNA.SYLIMGTVKNAQK
O96659_HIRME/495-600FSVQVFSVFK....KSK...D.RLRRGEDT.VWVSTKD.LNCR-----------CPRL-RV...KQ.SYLVVGK.....D
A4IGU5_XENTR/180-281PEARSRTVYKSKGWSD.........EELRKTVLWLSDG.DNCL-----------CQDI-HE..PGA.TVLVLG.......
SFRP4_HUMAN/188-289TVVDVKEIFK....SS......SPIPRTQVPLITNSS....CQ-----------CPHI-LP...HQ.DVLIMC.......
PCOC2_MOUSE/308-411ATVSIISIYR....EGN...L.AIQQAGKNMSVKLTVV.CR.Q-----------CPLL-RR...GL.NYIIMGQ......
Q8I7P1_9CNID/1611-1718LTFEVVEVYK....ESV...TKKITKKTARIVYSKKI...SCD-----------CPVF-AG.KIDR.HFLIMGKDVG...
Q9IBG9_ORYLA/1588-1699YKANIANVLK....SSG...DLLVKKENSVRVFAKRL.....Q-----------CKGQ-LE..VGN.QYLIMGKDGSTTD
CO3_ONCMY/1507-1621YTVKIDLVIK....PG....TDEG.VEGKNRDFMGLA.....Y-----------CREA-LGLMQGK.TYMIMGKSEDLHR
Q62238_MOUSE/465-575FESKITQVLH....FRT...DTMA.SIGQTRNFLSRT.....S-----------CRLR-LE..PNK.EYLIMGMDGETSD
CO3_NAJKA/1513-1623YVMDVLEVIK....QG....TDEN.PRAKTHQYISQR.....K-----------CQEA-LNLKVND.DYLIWGSRSDLLP
Q3MU73_DANRE/1522-1632YHMKVEKTVK....EG....TDPD.VEGKVKPFLARP.....S-----------CRVS-LGLVEGK.SYLIMGNSVDLPT
Q9NFW6_BRAFL/441-548FTINVGTIFK....REQ...SLKLRRGDQY.MYVRQSD.LQCK-----------CPKL-RL...GR.KYLLMGSV....D
Q9I932_CYPCA/1587-1697YSATVTVVLR....YTG...DLSV.SADSTRVFAKRK.....H-----------CKSD-LK..EGK.TYLIMGNDGPTKD
Q5NKN5_CARRO/1605-1719ISFRVTSVFK....EGIE.QKQNI.LHTSKDLMVRDS....CS-----------VADL-DI...QQ.EYVIMGRDGAQFK
PCOC1_HUMAN/330-434VTVSLIGAYK....TGG...L.DLPSPPTGASLKFYVP.CK.Q-----------CPPM-KK...GV.SYLLMGQ......

PF00965

Q29AK5_DROPS/26-197----MP.....TL..NVCSYYKEYTKMTITERHGFSGGYGKSCN.CTVS.......PCFGQQCLR....HREYSDGCKWS
Q1RLX2_DANRE/24-203----AEANGKMHV..TLCDLIMPWESMSATQKKSLSQRYQMGCD.CKIT.......RCATFPCE......ISAPEECLWT
A7SSJ2_NEMVE/18-205----LVDDGKLFI..SSCHWTSPWQQVTQAQRLGVQSVYGESCR.CRVT.......SCS...........FLGPGGLILD
TIMP2_CAVPO/25-203----AEGDGKMHI..TLCDFIVPWDTLSTTQKKSLNHRYQMGCE.CKIT.......RCPMIPCY......ISSPDECLWM
Q4T4E9_TETNG/25-214----EEGGGRVHV..TLCDYIMPWEALSAAQKKGLSQRYQMGCE.CKIV.......RCPSLPCE......VSAPEECLWT
TIMP3_BOVIN/22-194----VY.DGKMYT..GLCNFVERWDQLTLSQRKGLNYRYHLGCN.CKIK.......SCYYLPCF......VTSKNECLWT
TIMP_DROME/26-197----MP.....TL..NICSYYKEYTRMTITERHGFSGGYAKATN.CTVT.......PCFGERCFK....GRNYADTCKWS
Q4W7T6_ORYLA/25-203----LETDGTMHV..TLCDFIDQWDAMTATQKKNLIQRYESSCD.CKIT.......HCTSIPCV......LSSPTECLWT
A7RL40_NEMVE/15-176----ITVNGELHT..SSCSWHAPWDKLTLTQTKGVQTVYKRNCG.CRVDCQRWWLPGC............RSCDDRDPWG
A7SSJ1_NEMVE/20-204----YSDGARLEV..FSCNWVEPWGNLTVSQQIAVKRYYGRHCA.CRTS.......LCS...........LLDPLGTLLD
Q9GPJ2_CRAGI/21-203----FVSDGEFFT..NNCQWNPEYLTLEPHQRRGIRYMYEQGCN.CTIH.......HCRGENCDFP..QSLNPDQTCIWP
TIMP1_MOUSE/23-199----LR.NGNLHI..SACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVF.......PCLSIPCK......LESDTHCLWT
TIMP3_SCYTO/25-197----VF.DGEVYT..GVCNFIVPWDRLTLSQRKGLNHRYQYGCN.CKIK.......PCYYLPCF......VTAKNECFWT
Q6NUX9_DANRE/22-200----LNSNGTLRI..NLCDYIESWESLSLTQKKSLGPRYQMGCD.CKIV.......QCPIIPCS......ISEPVECLWT
Q4SGL4_TETNG/26-203----LNADGTLHV..TLCDFIELWESTSATQKKSLTQRYEMGCD.CKIT.......RCTSIPCL......ISSPSECLWT
Q962H0_CUCFR/19-179----ETSDGRRYWLHGSCDYMIKWDDMSDQQKAGFKGGYKARCGECQIA.......ESLTAASVKV..EDIAANDYPLAT
Q6DMR2_CRAGI/21-205----FVSDGEFFT..NHCQWNPEYLSLKPHQRRGLRHMYGQGCG.CTVH.......YCRGDACDGDFPKSLNPNQACIWP
TIMP4_RAT/28-207----ILSDGKVFI..HLCNYIEPWEDLSLVQRESLNHHYHQNCG.CQIT.......TCYAVPCT......ISAPDECLWT
Q16IW9_AEDAE/30-198----DI.....HV..GLCNFVRKYSDLTIVEKRGLAGIYRKGCS.CQIK.......PCFSGEC.......NMTIGACNWT
TIMP1_HUMAN/22-199----LQ.DGLLHI..TTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVF.......PCLSIPCK......LQSGTHCLWT
Q4JF88_TAKRU/25-197----VY.DDKVYT..GLCNFNERWERLSLAQKKGFNHRYQLGCN.CRIK.......PCHYLPCF......VTSKNECLWT
Q2I6A9_NOTVI/24-202----IV.NDMVMI..SVCGFNSPISKLTPSQKRGLTHMYKTGCG.CEIV.......PCNG.PCA......VTKPNQCLWT
A7RH10_NEMVE/102-260----VI.DGRLWI..SYCNLHTEWDHLSKSQLGGLKKYYQQGCNKCKVQ.......LCFSASQCE....RMTAPDRCMWQ
Q64HW8_ONCMY/25-203----LETDGTMHV..TLCDFIESWEAMSATQKKSLTQRYESGCK.CKII.......RCTSIPCT......ISAPEECLWT
Q7ZTB0_TAKRU/28-207----MWRDGRISV..GQCDLVESWDNLSLSQKKNLNYRYQIGCE.CRIN.......TCYTVPCV......STGENECLWT

PF01759

SFRP1_MOUSE/200-299....RKVKSQYLL--...TAIHKW.DKKNKEFKNFMK-------------------------------------------
CO5_HUMAN/1550-1661Y..NFSFRYIYPL--DSLTWIEYWPRDTTCSSCQAFL-------------------------------------------
NET1_HUMAN/488-594....SPDQSGIVA--DKSSLVIQWRDTWARRLRKFQQ-------------------------------------------
Q7ZWR8_XENLA/379-484....VNAEGQGRI--VPESFVIAHKAAQHQILTAISK-------------------------------------------
Q1RMV2_BOVIN/310-413....VGEDGRGKI--MPNSFIMMFKTKNQKLLDALKN-------------------------------------------
Q9NL28_CIOIN/535-642...RSDGNLRMTI--DKNSVIISWLNKYKKMLRRVAK-------------------------------------------
A6MK21_CALJA/94-204....EKPNISYII--GKDTWVEHWPEEDECQDEENQK-------------------------------------------
CO3_RAT/1534-1644....EKPNTSYII--GKDTWVEHWPEAEERQDQKNQK-------------------------------------------
Q3SX29_BOVIN/186-287....QKLGGELVI--...TSVKRW.QKGQREFKRISR-------------------------------------------
Q9YIA6_CYPCA/1030-1140....LRGSLQYVF--GEQTWVEYWPTREESQTREHRE-------------------------------------------
Q91588_9PIPI/1460-1570....QPDGYSYII--GKDTWMEWWPNERECQQRENQD-------------------------------------------
Q90633_CHICK/1523-1633....TGSRFSYLI--SKDTWLEAWPLEESCQDADLQP-------------------------------------------
Q3L2T4_MACEU/1523-1632....KMKELNYII--GKDTWVELWPQEDECQDEEYQK-------------------------------------------
Q4RSD5_TETNG/491-599....DWKTGRPVV--NTKSLVKPWRSSLGRKFLHILR-------------------------------------------
Q4S5G7_TETNG/453-556....DVHNGMAVL--QPDSFV...TLSSARKIRKLRE-------------------------------------------
CO3_EPTBU/1496-1605....NSDRTQYVL--TSDTWFEKFPLESVCRLPSPPA-------------------------------------------
A0A9Q8_9ASCI/181-286....SSYSKPFIL--DPSDSVLPWRDGYQNKLNRYTK-------------------------------------------
Q4S4Z9_TETNG/252-355....VDEDGRGKI--APHHFVMAFKTKNQKGLNVLKN-------------------------------------------
Q9YIA9_CYPCA/1513-1623....LGGSLQYIF--GEQTWIEYWPTRKESQTQEHRD-------------------------------------------
NET3_MOUSE/457-570G.STAGRGQGLSA--ARGSLVLPWRDAWTRRLRRLQR-------------------------------------------
ATL5_HUMAN/364-467....DGTQDQLLL--PHAGYARPWSPAEDSRIRLTAR-------------------------------------------
Q99KX9_MOUSE/254-364H..NFSFKYIYPL--DSSTWIEYWPTDTTCPSCQAFV-------------------------------------------
Q6VPV1_PIG/1548-1659H..NFNFKYIYPL--DSSTWIEYWPTDTACPSCQTFL-------------------------------------------
A7SBN2_NEMVE/182-284....DKHRRVLFV--DGMVSALEW.DVDGKKMARMIR-------------------------------------------
Q0V9H1_XENTR/485-591...ESPDPARLIL--DKNSLALPWRDVWGHKLRRFQQ-------------------------------------------
Q7ZXM6_XENLA/190-291....QKLGGELVI--...TSVKRW.QKGQQKFKRITR-------------------------------------------
Q9W6G1_PROAT/775-885....LQKEMAYVI--GKNTLLEWWPNDVECQDIQYQK-------------------------------------------
Q4S019_TETNG/1311-1428DREEKMYQ..YAL--GEKTWVEYWPTEAECKTVQHRP-------------------------------------------
Q32N13_XENLA/188-292....DKERTRLLL--VEGSLAEKWRDRLAKKVKRWDQ-------------------------------------------
Q7SZG2_TAKRU/1574-1684....SRGMIQYLL--ESNTWVERKPLPINCGKSAHRP-------------------------------------------
A7SHI5_NEMVE/436-545...GQSRKRSIVL--NGRSVVLPWNEKLLKRIYRFIK-------------------------------------------
Q4S5B2_TETNG/454-562....DRKQGRLLV--NMKSFVKPWKASLGRKVLTLLK-------------------------------------------
O08570_MESAU/127-229....DEERSRLLL--VEGTIVEKWKDRXGXKVKRWDM-------------------------------------------
CO3_RABIT/597-707....EKPNTSYII--GKDTWVEFWPEKEECQDEENQK-------------------------------------------
Q4SVH8_TETNG/1716-1828I.DSSTNQFLYML--GKDTWVERWPTPAECSSTGSLP-------------------------------------------
SFRP1_CHICK/200-299....RQVKTQHLL--...TAIYKW.DKKNKEFKKFMK-------------------------------------------
Q4RGB2_TETNG/197-297....RRVEQHFLL--...TGIHKW.DKSSKEFRKAIK-------------------------------------------
Q969A4_BRABE/1602-1713D.EQGFDSFRYVI--TEQSFVAEWPTGAKAERKKFKR-------------------------------------------
Q6UAQ6_CTEID/1510-1620....LGGSLQYIL--GEKNWVEYWPTREESQMKKYRD-------------------------------------------
Q91741_XENLA/1554-1664....EHGHIRYIL--EKNFWVEELPGEQKCAATRYRN-------------------------------------------
Q2HJB6_BOVIN/340-444....VDKNRGPIL--PPESFVVLHRPTQHQILTNLSR-------------------------------------------
Q52L01_XENLA/302-405....VDEDGRAKV--LPSNYVMTFKTKNQKILNTLKN-------------------------------------------
Q95YK2_CIOSA/556-663...RSGGEPRLAI--DKGTIVMEWKNKYKRRLRSLQR-------------------------------------------
Q0VEM1_MOUSE/517-624....DVRTGKLIV--NMKSFVQHWKPALGRRVMHILK-------------------------------------------
Q6P4R1_HUMAN/1615-1725....LEGHPQYLL--DSNSWIEEMPSERLCRSTRQRA-------------------------------------------
SFRP5_HUMAN/195-296....RKVDGQLLL--...MAVYRW.DKKNKEMKFAVK-------------------------------------------
Q32PN6_DANRE/181-281....RKVDKQYLL--...TGIHKW.DKSNREFKKTMK-------------------------------------------
Q9DDV9_ONCMY/1553-1662....QSVTDRYVL--GERTWIEYWPTSDECNMQDQEK-------------------------------------------
Q98977_ONCMY/1484-1594....SGDRFEYVL--GERTWIESWPTSDECSIQGPTR-------------------------------------------
Q4S9P7_TETNG/197-299....NEERSRLLL--IDGSIAQKWKDKMTRKIKRWDQ-------------------------------------------
Q4RZT6_TETNG/1515-1632GEKGEAFQ..YVL--GERTWVEYWPTQEECQTEEHTE-------------------------------------------
Q66IT1_XENLA/372-477....VNAEGQGRI--VPESFVIGYKVAQHQFLTAISK-------------------------------------------
Q3KQ69_XENLA/197-296....RKAKAQHLL--...TAIHKW.DKTNREFNRFMR-------------------------------------------
O42203_DANRE/487-595...DSRGQSGVVA--DRGSLLIPWKDLWARRLRKFQQ-------------------------------------------
NET3_CHICK/465-571...NSTDRPGLMA--DKNSLVIQWRDAWTRRLRKLQR-------------------------------------------
CO32_AUSSU/1522-1632....MKNDISYLI--TKNTWIERWPNEDECQDEEFQN-------------------------------------------
A7SX91_NEMVE/256-359....SKGKTRMRL--TPKNFVREWSLEFNSKVEDYKR-------------------------------------------
CO3_BOVIN/1532-1642....EKPKISYII--GKDTWVELWPEAEECQDEENQK-------------------------------------------
Q59JG2_HEMPU/509-616...SSSKRDGIVV--DNKSIVLKWRDEWDMRMRKFQR-------------------------------------------
PCOC1_MOUSE/353-457....VEENRGPIL--PPESFVVLYRSNQDQILNNLSK-------------------------------------------
CO3_LAMJA/1543-1654....RNDRFQYVL--DASSWVEQWPVDEKCNQPNVQT-------------------------------------------
A5PMP6_DANRE/1549-1662AGSTVSNKYVYTL--GKETWVERWPDESECGSTLQKK-------------------------------------------
Q4RJA3_TETNG/792-902DEKNQMYQ..YVL--GERTWIEYWPTVAECQTDEYRP-------------------------------------------
UNC6_CAEEL/491-597...SDHERDGLMV--NPQTVLVEWEDDIMDKVLRFSK-------------------------------------------
A3KNP6_DANRE/185-285....RSVGKQYVL--...TGIHKW.DNSSKDFKKTIK-------------------------------------------
Q70TF5_ONCMY/1595-1705....SNGQMQYLL--ESKTWIEQVPNEKKCQGSKNRP-------------------------------------------
Q8AYN9_CYPCA/1560-1672M..NRGYKYKFPL--DSRAWVDWWPLDTDCRDDACIQ-------------------------------------------
NET5_HUMAN/361-468....DPDPTRLIL--DRHGLALPWRPRWARPLKRLQQ-------------------------------------------
A5PM87_DANRE/316-419....TDEHGQGVI--SPYNFVMLFKTKKQQDLAVLKN-------------------------------------------
Q6GZK1_ORYLA/191-291....RKVDKQFLL--...TGIHKW.DKSSKEFKKIMK-------------------------------------------
Q98TS6_ANAMI/1526-1643DDQAQSHQ..YVL--GERTWIEYWPTDKQCQTEEYRR-------------------------------------------
Q9W6E0_DANRE/199-303....NEERSRLLL--IDRSIAQKWKEKIGRKVKRWDQ-------------------------------------------
Q9IBH1_ORYLA/1522-1639DEKQLTYQ..YVL--GERTWIEYWPTAEECQGDEHRA-------------------------------------------
Q8WPD8_CIOIN/1602-1707T..RLFKEGRVLL--ITGSLIERR....QNRNRLLQT-------------------------------------------
O44344_STRPU/1565-1680T.EQGEERYRYVY--GPTSKLEFWPATRKARNAAVFD-------------------------------------------
Q76KI4_TRISC/1564-1675....TSRKMQYLL--DVKSWVEAIPPEDICELRKYRS-------------------------------------------
Q4SXM5_TETNG/1606-1718L..ERSFRYRLPL--DSEALLELWPTD..CGSPECLD-------------------------------------------
Q32SK9_DANRE/482-590G.TANPERPGLQA--DKNSLVIQWRDIWTRRLRKFQR-------------------------------------------
Q4RHV3_TETNG/135-245....SRGMMLYLL--ESNTWVEMKPPQDSCKKSANRN-------------------------------------------
Q076D6_CHICK/1536-1646....PEGRPQFLL--GPHSWLEEVPSPGRCKATRLRG-------------------------------------------
Q4SKX3_TETNG/205-306....RKVDQQLLL--...MSIHKW.DKKSKELKFAIK-------------------------------------------
Q8MX24_ANCCA/29-132....GDGDLVISV--SRCDLLRNW.TDVSGEEKKLLG-------------------------------------------
Q0IGC3_AEDAE/141-257...SKQNPDSLVL--GPKTIIIEWKDDWNRRLRRFQQ-------------------------------------------
Q9I933_CYPCA/1566-1681L.NNDGQHFRYVL--NNDMWIEKMPEEKNCKATKNRA-------------------------------------------
Q32SK8_DANRE/445-554....DVRKGRPVV--NMKSIVKPWRASLSRKVHQLLK-------------------------------------------
Q1PHQ2_SACKO/484-590...KNPNQNGLLA--DHKSYVIPWRDDWNRRMRKFQR-------------------------------------------
NET5_MOUSE/314-431D..DNYDPARLIL--NRHGLALPWRPRWARPLRRLQQ-------------------------------------------
Q4SF52_TETNG/897-1011...WGPEESRLVA--DRSTLALQWREHWGHKLRGFRG-------------------------------------------
Q3L5A8_GADMO/75-188...VGRNQYEYLL--GEQSWIEYWPTPLECQNPKYGS-------------------------------------------
O96659_HIRME/495-600...SSSSRGGIIL--DQTSLVVPWSEQQALRIKQITK-------------------------------------------
A4IGU5_XENTR/180-281....HRADDRLVI--...SWVRKW.QKSEKETKRFSR-------------------------------------------
SFRP4_HUMAN/188-289....YEWRSRMML--LENCLVEKWRDQLSKRSIQWEE-------------------------------------------
PCOC2_MOUSE/308-411....VGEDGRGKI--MPNSFVKMFKNKNQKPMNALKN-------------------------------------------
Q8I7P1_9CNID/1611-1718....LRGSSKVVL--GHNVFVKEW..PMNDPVDFFKK-------------------------------------------
Q9IBG9_ORYLA/1588-1699....TDGKMQYLL--ESDTWVEKMPSAEDCKKSFNKN-------------------------------------------
CO3_ONCMY/1507-1621VEDKGLLQYKYVL--GEQTWIEYWPSQQECTSRDYRE-------------------------------------------
Q62238_MOUSE/465-575....NKGDPQYLL--DSNTWIEEMPSEQMCKSTRHRA-------------------------------------------
CO3_NAJKA/1513-1623....TKDKISYII--TKNTWIERWPHEDECQEEEFQK-------------------------------------------
Q3MU73_DANRE/1522-1632....LGGSLQYII--GEQTWIEYWPTSDESKSAEHRD-------------------------------------------
Q9NFW6_BRAFL/441-548...SNNNREGLTL--DYRSTSIPWRNRWGKRLRRLQR-------------------------------------------
Q9I932_CYPCA/1587-1697....LNGNMQYLL--DSKTWVEEKLSPSTCRASVNKG-------------------------------------------
Q5NKN5_CARRO/1605-1719DEDTGILLYRYIL--DQSTSIFKWTRISVAENKQLTK-------------------------------------------
PCOC1_HUMAN/330-434....VEENRGPVL--PPESFVVLHRPNQDQILTNLSK-------------------------------------------

PF00965

Q29AK5_DROPS/26-197PFGKCERDYSACMPHVTHT.VNGSISRCRW
Q1RLX2_DANRE/24-203DW.VTEKIIHGRQSDHYAC.IKRGDGSCAW
A7SSJ2_NEMVE/18-205SH.........CSEGYLYC..GEHGLSCAW
TIMP2_CAVPO/25-203DW.VTEKSINGHQAKFFAC.IKRSDGSCAW
Q4T4E9_TETNG/25-214DL.VLEKLVYGRQANHYAC.IKRADRSCSW
TIMP3_BOVIN/22-194DM.FSNFGYPGYQSKHYAC.IRQKGGYCSW
TIMP_DROME/26-197PFGKCETNYSACMPHKVQT.VNGVISRCRW
Q4W7T6_ORYLA/25-203DW.VIEKTVKGEQAKHYAC.IKRNDDSCAW
A7RL40_NEMVE/15-176RE.....IVSSCTYGHMYCALSNDWEKCSW
A7SSJ1_NEMVE/20-204FE.........CAREHLYCRLRRDGATCGW
Q9GPJ2_CRAGI/21-203GS....YNTNDCYAKYGFC.LPDIFGVCYW
TIMP1_MOUSE/23-199DQ.VLVGSE.DYQSRHFAC.LPRNPGLCTW
TIMP3_SCYTO/25-197DM.LSDQGYMGHQAKHYVC.IRQKEGYCSW
Q6NUX9_DANRE/22-200DW.VLEGTVQGTQAQHYTC.VKRSDSSCAW
Q4SGL4_TETNG/26-203DW.VMEKAVYGQQAKHFAC.IKRSDDSCAW
Q962H0_CUCFR/19-179TY....................WTPTGCYY
Q6DMR2_CRAGI/21-205GS....YNTNDCYAKYGFC.LPDVVGVCNW
TIMP4_RAT/28-207DW.LLERKLYGYQAQHYVC.MKHVDGICSW
Q16IW9_AEDAE/30-198PWASCETDYGSCIPTRGYL.IDGSPAKCHW
TIMP1_HUMAN/22-199DQ.LLQGSEKGFQSRHLAC.LPREPGLCTW
Q4JF88_TAKRU/25-197DM.LSNLGYPGYQSRHYAC.IQQKEGYCSW
Q2I6A9_NOTVI/24-202DA.LMSRSWVAHQALHLSC.IGKTNGECIW
A7RH10_NEMVE/102-260ME..IGNPTEDCYVKASAC..KKVGDRCMW
Q64HW8_ONCMY/25-203DW.VMEKSHSGPQAQHFAC.INRSDGSCAW
Q7ZTB0_TAKRU/28-207DW.LLDNSLNGEQARQYAC.IRRSDTTCSW

PF01759

SFRP1_MOUSE/200-299------------------------------
CO5_HUMAN/1550-1661------------------------------
NET1_HUMAN/488-594------------------------------
Q7ZWR8_XENLA/379-484------------------------------
Q1RMV2_BOVIN/310-413------------------------------
Q9NL28_CIOIN/535-642------------------------------
A6MK21_CALJA/94-204------------------------------
CO3_RAT/1534-1644------------------------------
Q3SX29_BOVIN/186-287------------------------------
Q9YIA6_CYPCA/1030-1140------------------------------
Q91588_9PIPI/1460-1570------------------------------
Q90633_CHICK/1523-1633------------------------------
Q3L2T4_MACEU/1523-1632------------------------------
Q4RSD5_TETNG/491-599------------------------------
Q4S5G7_TETNG/453-556------------------------------
CO3_EPTBU/1496-1605------------------------------
A0A9Q8_9ASCI/181-286------------------------------
Q4S4Z9_TETNG/252-355------------------------------
Q9YIA9_CYPCA/1513-1623------------------------------
NET3_MOUSE/457-570------------------------------
ATL5_HUMAN/364-467------------------------------
Q99KX9_MOUSE/254-364------------------------------
Q6VPV1_PIG/1548-1659------------------------------
A7SBN2_NEMVE/182-284------------------------------
Q0V9H1_XENTR/485-591------------------------------
Q7ZXM6_XENLA/190-291------------------------------
Q9W6G1_PROAT/775-885------------------------------
Q4S019_TETNG/1311-1428------------------------------
Q32N13_XENLA/188-292------------------------------
Q7SZG2_TAKRU/1574-1684------------------------------
A7SHI5_NEMVE/436-545------------------------------
Q4S5B2_TETNG/454-562------------------------------
O08570_MESAU/127-229------------------------------
CO3_RABIT/597-707------------------------------
Q4SVH8_TETNG/1716-1828------------------------------
SFRP1_CHICK/200-299------------------------------
Q4RGB2_TETNG/197-297------------------------------
Q969A4_BRABE/1602-1713------------------------------
Q6UAQ6_CTEID/1510-1620------------------------------
Q91741_XENLA/1554-1664------------------------------
Q2HJB6_BOVIN/340-444------------------------------
Q52L01_XENLA/302-405------------------------------
Q95YK2_CIOSA/556-663------------------------------
Q0VEM1_MOUSE/517-624------------------------------
Q6P4R1_HUMAN/1615-1725------------------------------
SFRP5_HUMAN/195-296------------------------------
Q32PN6_DANRE/181-281------------------------------
Q9DDV9_ONCMY/1553-1662------------------------------
Q98977_ONCMY/1484-1594------------------------------
Q4S9P7_TETNG/197-299------------------------------
Q4RZT6_TETNG/1515-1632------------------------------
Q66IT1_XENLA/372-477------------------------------
Q3KQ69_XENLA/197-296------------------------------
O42203_DANRE/487-595------------------------------
NET3_CHICK/465-571------------------------------
CO32_AUSSU/1522-1632------------------------------
A7SX91_NEMVE/256-359------------------------------
CO3_BOVIN/1532-1642------------------------------
Q59JG2_HEMPU/509-616------------------------------
PCOC1_MOUSE/353-457------------------------------
CO3_LAMJA/1543-1654------------------------------
A5PMP6_DANRE/1549-1662------------------------------
Q4RJA3_TETNG/792-902------------------------------
UNC6_CAEEL/491-597------------------------------
A3KNP6_DANRE/185-285------------------------------
Q70TF5_ONCMY/1595-1705------------------------------
Q8AYN9_CYPCA/1560-1672------------------------------
NET5_HUMAN/361-468------------------------------
A5PM87_DANRE/316-419------------------------------
Q6GZK1_ORYLA/191-291------------------------------
Q98TS6_ANAMI/1526-1643------------------------------
Q9W6E0_DANRE/199-303------------------------------
Q9IBH1_ORYLA/1522-1639------------------------------
Q8WPD8_CIOIN/1602-1707------------------------------
O44344_STRPU/1565-1680------------------------------
Q76KI4_TRISC/1564-1675------------------------------
Q4SXM5_TETNG/1606-1718------------------------------
Q32SK9_DANRE/482-590------------------------------
Q4RHV3_TETNG/135-245------------------------------
Q076D6_CHICK/1536-1646------------------------------
Q4SKX3_TETNG/205-306------------------------------
Q8MX24_ANCCA/29-132------------------------------
Q0IGC3_AEDAE/141-257------------------------------
Q9I933_CYPCA/1566-1681------------------------------
Q32SK8_DANRE/445-554------------------------------
Q1PHQ2_SACKO/484-590------------------------------
NET5_MOUSE/314-431------------------------------
Q4SF52_TETNG/897-1011------------------------------
Q3L5A8_GADMO/75-188------------------------------
O96659_HIRME/495-600------------------------------
A4IGU5_XENTR/180-281------------------------------
SFRP4_HUMAN/188-289------------------------------
PCOC2_MOUSE/308-411------------------------------
Q8I7P1_9CNID/1611-1718------------------------------
Q9IBG9_ORYLA/1588-1699------------------------------
CO3_ONCMY/1507-1621------------------------------
Q62238_MOUSE/465-575------------------------------
CO3_NAJKA/1513-1623------------------------------
Q3MU73_DANRE/1522-1632------------------------------
Q9NFW6_BRAFL/441-548------------------------------
Q9I932_CYPCA/1587-1697------------------------------
Q5NKN5_CARRO/1605-1719------------------------------
PCOC1_HUMAN/330-434------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window