Sequence alignment for CL0354

PF09023

SSPC_STAA8/1-107MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSN-------HQLQKSICIRHGDDTSHNQY---------HILFIDTAHQR

PF09022

Q2G2R7_STAA8/1-105MEQIELFSIDKFKCN--SEAKYYLNIIEGEWHP-------QDLNDSPLKFILSTSDDSDY---------ICKYINTEHKQ
Q5HKF5_STAEQ/1-105MHNYNNINIVSDDSK--YQEICWFHTLEGIWHP-------VEVETSPLNITFNKEITPNY---------VCTLINEDSRK

PF02974

B9JDQ6_AGRRK/142-236--------------------.PTTASLSGGWQV......RQPDGKAMCDVTLTSETDKDG.TPKMSPGEDCPANI.ADLK
L0ET75_LIBCB/134-225--------------------ELSKGSLPGSWKV........SSGMVRCDMYLTLTNLGSG...LRGGTRNCYGK...LSL
D7A619_STAND/144-240--------------------.IRPADLAGAWDL......AETAGTPICRVELTDQPAGSD.TFKLTLGNVCAASV.IALA
B9JCF7_AGRRK/88-179--------------------DVTKESMVGSWKV........SNGGSSCDMFLTLTNLGSG...SRGGTRGCAGE...LTA
A8G881_SERP5/7-101--------------------LPSAQSLAGQWQV........ADAQQQCQIEFLASEQSATNGYPLIDRQNCLKKV.LTAE
B2IIP2_BEII9/58-161--------------------SPELAALGGQWDLVREGATTRPNERQTCRLTLSLRPMADQ.GLLLLLPSSCRKTMPIVAS
INH_PHOLL/31-125--------------------LPHASELKGVWQL........SDKHQQCDVLLTDHPLPEGSIWSLNGDNDCLAYM.FGEV
A8HSQ4_AZOC5/216-311--------------------LVRPEEIIGDWNL......ARVAGTPICRWTFLETPVPGG..FSVTAAPGCDGL..GGFV
D3UWD0_XENBS/7-99--------------------LPEPAELKGLWQL........SDGNQVCSIELTDTRLPEGSIWALKGDS.CLTEL.MGNP
D7A6A1_STAND/101-194--------------------..ARTQLAGTWKY......GWDNGQKSCKVTLSTDRGMSG..FAANADVDCPND...IFM
A7IJ58_XANP2/96-191--------------------SPAQGQLSGAWTF......AWDDGRNSCPLRLSTDRGLSG..LSAQADVSCPSE...IFM
F2IVD7_POLGS/89-181--------------------EIGRNDMLGGWKL........ASGADNCMLFMTLTTWTGG...YRANTRGCSDP..ALAG
W6RKX8_9RHIZ/82-170--------------------DVTKESMVGSWRV...........NGSCDMFLTLTNLGSG...SRGGTRGCVGE...LTA
Q4KBR9_PSEF5/33-125--------------------LADPSELVGHWQL.....QQAAAPAEGCTLDLLHNA.......ALGDGADCLSKW.LGEA
B8ENL7_METSB/40-136--------------------LDNPDAVLGQWDL......TLEGSNKACRLTFRAERVRGG..FYLGMPAGCRRGLAPLAN
OMP19_BRUA2/86-177--------------------DLTPGAVAGVWNA........SLGGQSCKIATPQTKYGQG...YRAGPLRCPGE...LAN
A8GE90_SERP5/35-130--------------------LLAPSALKGHWQL.....NDAEGKAAACEVELSDELIEGTNAYRFTASAQCLQPLALAEL
Q6NCK6_RHOPA/26-120--------------------..MKKDMVGQWEL......ATTERSKTCVVTLTSEPAAKG..LKLTLEPDCAKTLPFTKA
C5B0G7_METEA/96-186--------------------..GRSSVVGSWNA........TDAAGSCKVSLSSTPSLDL...YKASAAGCSNK..DLAK
OMP19_AGRFC/89-180--------------------DVTKESMVGNWRV........SNGGANCDMFLTLTNLGSG...SRGGTRGCSGE...LTA
A7ICM0_XANP2/55-153--------------------EIKVEEVVGEWDL......ARQAGTPVCRVTLLDQPAGNGRGKALAIASGCDPAL.LRFG
Q6D3G0_PECAS/7-101--------------------LPSASELSGAWQL........RGGEQHCEVVLHNTQLVDN.IWRLDGDAQCLKAL.LSDV
Q11CW1_CHESB/87-178--------------------PIEKNSLLGSWTV........NSGGSSCQMFLTLTKYGNS...SRGGTRGCSNE...LAN
Q3SVU0_NITWN/46-140--------------------...KKNMIGQWEL......STTERSRTCVVTLKGETAPQG..LKLDLEPGCVASLPFTKD
INH_PSESM/31-124--------------------LPNPAELSGQWRL.....SLQGKADDACELQLNTEAP......QLTGDVACAAKW.LHEP
G8PR93_PSEUV/107-201--------------------.VKADDMVGKWTV......YLNSGDRVCQLNLSTEPKDEG...FAASFNHCMDG..DLFF
INH_PSEAE/30-128--------------------LLSASDLAGQWTL......QQDEAPAICHLELRDSEVAEASGYDLGGDTACLTRW.LPSE
A8HUE1_AZOC5/101-195--------------------.GAKEALSGAWTL......AWDSGQHTCPVQLTTDRGMNG..LSARADVSCPSE...IFM
B9JTT1_AGRVS/79-170--------------------DFTKEQMVGNWRV........ANGQSSCDMFLTLTNLGGG...SRGGTRGCVGP...LTT
OMP19_RHILO/88-179--------------------DLSAAAVAGVWNA........SVSGQSCKIATPQTKFGAG...FRAGPLHCPAP...IDG
Q2K9N4_RHIEC/132-229--------------------LPTFRSLAGTWAM......QRPGGEKLCSVTLDGTLDTDG.HAPLSLSADCAANV.ARLK
B1LU92_METRJ/105-195--------------------...RSAVVGSWDA.......RDATGANCKVTLSSTPALDL...YRATASGCANK..DLAR
E0SC34_DICD3/24-118--------------------LPSAAELSGQWVL........SGAEQHCDIRL.NTDVLDGTTWKLAGDSVCLQKL.LPEA

PF09023

SSPC_STAA8/1-107IKFSS-IDNEEIIYILDYDDTQHILMQTSSKQGI-----GTSRPIVYER

PF09022

Q2G2R7_STAA8/1-105LTLYN-KNNSSIVIEIFIPNDNKILLTIMNTEAL-----GTSPRMTFIK
Q5HKF5_STAEQ/1-105IILSN-VDNPNIIIEMILINSKKLVFNAISKEGL-----GTSPKITFTK

PF02974

B9JDQ6_AGRRK/142-236LSLWA.MEGFGLV.LMGGDGSSL.SFDMQPDGSFKTSDEEEGEPMLL..
L0ET75_LIBCB/134-225MGYWD.VVGHQLV.LKDRNGNTIVSLNKVADNRFEGV.TKDNQPVSVSR
D7A619_STAND/144-240PDRWR.LDGGDLW.LLTAKGEGL.RFARQEDGGWEKVPPGDGEPLMLTR
B9JCF7_AGRRK/88-179MGSWA.VSGKQVL.LKDRDGNQIGSLYKTADSRYDGS.TASGQPISLSR
A8G881_SERP5/7-101VVGWR.PAPDGIA.LLQADGSTLAFFSRDGDV.YRNQPGADGGLTL..K
B2IIP2_BEII9/58-161INAWQPMTRHRID.FTDRNGATLMTFFSTADGRFEAV.GPDAENYAL..
INH_PHOLL/31-125PAGWR.PTPDGLT.ITDEQGSGLAFFAHEPDG.WFARF.ADGRELMIK.
A8HSQ4_AZOC5/216-311PKAWH.LEGGNVV.VTAATGNGLVRFARQEDGGWAKV.PERGRPLLMMR
D3UWD0_XENBS/7-99VEGWR.PTPDGIT.LTDDDGNSLAFFGHESEQ.WVAYL.VDGRELVM..
D7A6A1_STAND/101-194TKGWD.VWGNEIV.LQNHLGKVTARLQPAGSGQYDGVATGDGGKVTLTR
A7IJ58_XANP2/96-191TKGWD.MMGSDIV.LQNHQGKITARLQPSGPNHYVGLISESNQKVSLSR
F2IVD7_POLGS/89-181ISAWD.LNGKLVV.LKGAAGDQVAQLYASGGDRFSGQ.TATGRAISFSR
W6RKX8_9RHIZ/82-170MGSWE.VTGKQVI.LKDRSGNQIGSVYKTADNAFSGQ.TNTGQAISLSR
Q4KBR9_PSEF5/33-125AVGWF.PEPDGIA.ITGREGSKIIFFSRQKEGLYEARLKADG.LIVLQR
B8ENL7_METSB/40-136AAAWSLPGGEHLI.IGDVVGAPILDFALQPDGALAAI.SPAGENYKL..
OMP19_BRUA2/86-177LASWA.VNGKQLV.LYDANGGTVASLYSSGQGRFDGQ.TTGGQAVTLSR
A8GE90_SERP5/35-130PVAWR.PTPDGMT.LTNADGSMVAFLALTAPKRYEVIN.HHGKP.....
Q6NCK6_RHOPA/26-120IVAWD.VKGLDIVRLETADGDSVIDFTEVESGIFEGH..RDGEGIYIL.
C5B0G7_METEA/96-186VSAWD.FRDGEVY.LYQPGGTVTARL.RQAGGGLEGALSKSGAQLSMAR
OMP19_AGRFC/89-180MGSWE.VSGKMVL.FKNRSGDTIGRVYKSADARFDGT.TNSGQPLSLSR
A7ICM0_XANP2/55-153PVAWD.IEGGNIL.VRGDTDTAVIRFARQEDGGWART.PERGRPLLMNR
Q6D3G0_PECAS/7-101PAGWR.PTPDGIT.LTKEQGQSVAFFSKEKEG.YTLIL.PDGSTRTLHK
Q11CW1_CHESB/87-178MRAWD.LSGNQVV.MYDESGNTVARLYSSGGGRLDGT.TTGGTPVSVSR
Q3SVU0_NITWN/46-140IAAWT.VAGLDIVRLQTATGESVIDFTEVESGILEGR..RENDGIYILQ
INH_PSESM/31-124PAGWF.PTPDGLA.LTDNQGNRLIHLNRMDEQTYEARL.PGGELLILGR
G8PR93_PSEUV/107-201VSNWR.MKGQELV.LFDNFSRAKGSMRMTEWNRWEGQLASNSKPITIAR
INH_PSEAE/30-128PRAWR.PTPAGIA.LLERGGLTLMLLGRQGEGDYRVQK.GDGGQLVLRR
A8HUE1_AZOC5/101-195TKGWD.MMGSDIV.LQDHLGKVTARLQPAGPNAFIGTLVENNQAIALNR
B9JTT1_AGRVS/79-170MGAWD.VANKQLM.LKDRDGNVIGTLYKTADNRFNGS.TSAGQPVSLSR
OMP19_RHILO/88-179IKSWN.VAGKQLT.LYDENGGSLARLYSSGGSKFDGQ.TSNGQPISLTR
Q2K9N4_RHIEC/132-229LAVWN.IDGFGLT.LMSHDGSSL.SFDMRADGNFDKSREEGGKPLSLVR
B1LU92_METRJ/105-195VSAWD.FRDGEVY.LYQPGGSVAARL.RQGGGGLEGALTKSGAALALNR
E0SC34_DICD3/24-118PVGWR.PTPDGLT.LTQADGSAVAFFSRNRDR.YEHKL.VDGSVRTLKK

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window