Sequence alignment for CL0355

PF13690

C0QAL2_DESAH/42-139------------------------------------------------------------VTGVIGL...TGVT..NGTI
Q2LSM0_SYNAS/58-155------------------------------------------------------------ISGIIGL...TGDL..RGSL
E6VZI0_DESAO/42-139------------------------------------------------------------VSGLVGI...TGER..NGSV
C6BS03_DESAD/42-139------------------------------------------------------------VTGLVGI...TGDM..NGTI
D2R467_PIRSD/42-137------------------------------------------------------------ISGVIGL...SGNA..QGTV
C4XHM1_DESMR/45-142------------------------------------------------------------VSAIIGF...TGDR..NGTM
D3PAK0_DEFDS/42-139------------------------------------------------------------ISGVIGL...TGQA..VGSV
D3PEX7_DEFDS/42-139------------------------------------------------------------ISGIIGL...SGQA..IGSV
Q2LXN3_SYNAS/42-139------------------------------------------------------------VSGIIGI...TGDA..TGSL
C7LN70_DESBD/42-139------------------------------------------------------------VSALIGI...TGDK..KGTF
A5EYB3_DICNV/38-130------------------------------------------------------------YTGIIGI...SGPY..RGCV
C7LNA5_DESBD/45-145------------------------------------------------------------VTGVIGFSNPKGKS..RGTM
A1AUJ2_PELPD/55-152------------------------------------------------------------ITGMVGF...AGTY..SGVI
Q3A5A2_PELCD/40-137------------------------------------------------------------VSGLVGL...AGNY..RGML
B5EEQ0_GEOBB/56-153------------------------------------------------------------VTGMVGL...AGTY..TGIL
B5EAE1_GEOBB/55-152------------------------------------------------------------VTSMVGL...AGSH..SGII
B3E1X0_GEOLS/45-149------------------------------------------------------------VTGIIGV...AGDR..VGYI
Q67P65_SYMTH/42-138------------------------------------------------------------VTVLIGV...VGRV..QGLV
Q01VJ9_SOLUE/45-142------------------------------------------------------------VVSFIGI...AGTW..AGTG
A0L9J3_MAGSM/47-145------------------------------------------------------------ATALVGF...GGSV..KGGV
A1AQJ7_PELPD/45-151------------------------------------------------------------VTGIVGI...AGDR..VGYI
Q6MIQ0_BDEBA/198-294------------------------------------------------------------VSSVVEI...KSQA.FQGHL
B5EFK5_GEOBB/45-152------------------------------------------------------------VVGIVGV...AGDR..VGYI
Q74GW2_GEOSL/55-154------------------------------------------------------------ISGMVGL...GGDF..SGMV
Q39Z94_GEOMG/55-154------------------------------------------------------------ISGMVGL...GGDC..TGMV
B2A030_OPITP/53-154------------------------------------------------------------ILASVGF...IGAV..DGLI
B9L9J7_NAUPA/350-446------------------------------------------------------------VTSSLGF...YGDI..DGMV
Q0AX00_SYNWW/42-141------------------------------------------------------------FTVIIGF...TGGW..KGRF
Q3A8N0_PELCD/39-136------------------------------------------------------------LSGMIGL...AGDL..QGTL
Q74BI2_GEOSL/45-154------------------------------------------------------------VVGIVGV...AGDR..VGYI
A0L8I4_MAGSM/41-138------------------------------------------------------------ICAVVGY...NQGL..EGSV
A0L8I3_MAGSM/42-139------------------------------------------------------------YSAVLGY...SGNL..RGSF
Q127V6_POLSJ/52-143------------------------------------------------------------FNGLVTF...SGSH..NGHV
C5AC57_BURGB/173-274------------------------------------------------------------VFSLIAL...ESAW.CRGYM
A3DI29_CLOTH/43-141------------------------------------------------------------VACVVNF...FGRI..KGKF
C6WXU1_METML/45-137------------------------------------------------------------YTGKIKV...SDGY..EGAL
Q1IMH8_KORVE/73-170------------------------------------------------------------VTAVVGI...AGEV..CGVL
B1ZR59_OPITP/59-160------------------------------------------------------------VVGTVGF...IGDA..NGLI
C9LVN2_SELS3/180-280------------------------------------------------------------IAVIIGL...TGSP..MGRA
Q7MSR1_WOLSU/362-458------------------------------------------------------------MGAVISF...EGDI..SGML
A5GA23_GEOUR/174-273------------------------------------------------------------IVAAMDF...RGDI..NAHY
D2QZ65_PIRSD/52-150------------------------------------------------------------VTGLIGV...HGRV..SGFI
D1B8E2_THEAS/46-146------------------------------------------------------------VAALIGV...VGPS.VHGTV
A0LDM6_MAGSM/43-140------------------------------------------------------------VGGLIRL...LGEN.EEGLV
Q1IRG8_KORVE/48-143------------------------------------------------------------IGACVQL...VGAW..EGAV
D1AZS0_SULD5/240-338------------------------------------------------------------IIAAMKF...KGDI..SGIF
Q39V86_GEOMG/174-272------------------------------------------------------------VYATMDF...TGDI..SGRY
D2QXT3_PIRSD/39-134------------------------------------------------------------LSGCIQL...AGAW..QGAV
C0Q915_DESAH/44-135------------------------------------------------------------LACRLAF...TGDA..SGSL
D9SQS9_CLOC7/42-145------------------------------------------------------------VGIIIDL...FGGSTIHGKV
Q2W5X5_MAGSA/49-148------------------------------------------------------------VTAVVCT...DGPV..KLLI
Q2W334_MAGSA/49-148------------------------------------------------------------VSTIVGT...AGPV..NLLI
Q0B010_SYNWW/905-1003------------------------------------------------------------ITAFITI...KGVV..RSYF
A8ZWB5_DESOH/47-151------------------------------------------------------------YAVAAPT...RGKI..NGVI
C1F3H6_ACIC5/53-147------------------------------------------------------------MGARVAF...RGSP..SGQV
B8FJT5_DESAA/44-137------------------------------------------------------------YIANVGL...KNGG...LEV
Q2W3Y4_MAGSA/49-148------------------------------------------------------------MTVIAGL...GGPI..SLLI
C4Z452_EUBE2/81-174------------------------------------------------------------FIGCQIM...DGDI..DVFL
D6Z498_DESAT/44-140------------------------------------------------------------IQANIAY...HGPE..SGSF
Q7MRT3_WOLSU/32-126------------------------------------------------------------FISSIEI...LSSG.ERIPV
D4JQX1_9FIRM/184-279------------------------------------------------------------TAVIQEF...CGDF..NAVS
Q15PK9_PSEA6/48-152------------------------------------------------------------YAVCSEV...TGNL..DGVI
Q30Q99_SULDN/706-805------------------------------------------------------------SYAQIDL...YDTF..DGNV
A9EPA4_SORC5/41-133------------------------------------------------------------PVSTVEF...SAPG.FSGLL
B0TBE4_HELMI/187-279------------------------------------------------------------RLVFTTM...NGSY..DLFM
B4EGV3_BURCJ/172-273------------------------------------------------------------VFSLIAL...ESAW.CRGYM
Q13SF0_BURXL/172-276------------------------------------------------------------VFSLIPL...ESAW.CRGYM
Q8F2A0_LEPIN/49-146------------------------------------------------------------.CTMVEF...KGEI..EGKL

PF04509

FLIY_BACSU/36-73--------------------------------------------------------------------------------
Q9HQW8_HALSA/277-314--------------------------------------------------------------------------------
Q97LH5_CLOAB/84-120--------------------------------------------------------------------------------
Q97LH6_CLOAB/210-248--------------------------------------------------------------------------------
CHEC_BACSU/10-47--------------------------------------------------------------------------------
O51614_BORBU/89-125--------------------------------------------------------------------------------
Q9KA56_BACHD/110-147--------------------------------------------------------------------------------
CHEC_BACSU/111-148--------------------------------------------------------------------------------
Q97H00_CLOAB/41-78--------------------------------------------------------------------------------
Q9KA56_BACHD/10-47--------------------------------------------------------------------------------
Q97GZ6_CLOAB/104-141--------------------------------------------------------------------------------
Q9KA45_BACHD/146-183--------------------------------------------------------------------------------
O29223_ARCFU/109-146--------------------------------------------------------------------------------
CHEX_THEMA/84-120--------------------------------------------------------------------------------
Q97GZ6_CLOAB/9-46--------------------------------------------------------------------------------
Q9KDX3_BACHD/84-120--------------------------------------------------------------------------------
Q9HPJ6_HALSA/103-140--------------------------------------------------------------------------------
CHEC_THEMA/105-142--------------------------------------------------------------------------------
Q97H00_CLOAB/138-175--------------------------------------------------------------------------------
Q9KUY1_VIBCH/84-120--------------------------------------------------------------------------------
O29223_ARCFU/13-50--------------------------------------------------------------------------------
FLIY_BACSU/133-170--------------------------------------------------------------------------------
Q9HQW8_HALSA/90-127--------------------------------------------------------------------------------
F7IW81_TREDE/84-118--------------------------------------------------------------------------------
Q24YC8_DESHY/85-120--------------------------------------------------------------------------------
Q81FG1_BACCR/122-158--------------------------------------------------------------------------------
Q81FG1_BACCR/26-61--------------------------------------------------------------------------------
W0JYJ1_9EURY/105-141--------------------------------------------------------------------------------

PF11813

B8CMN3_SHEPW/4-233-------------TQDSVTTDDILRKLCISVSHVLSSTTNSQITHAGMVQSITRTCLKPDLGCFSIF---DGGF--SGLV
A9C1W2_DELAS/8-228-------------..IVHGTEDVLISLCNSVSRVLQVATQCQIQYSGMVQRITKTSLKPDIGCFVLV---DGGF--SGLV
D4ZJR2_SHEVD/4-233-------------TPQIITTDDILIKLCNSVSHVLSSTTASQVTHAAMVQSITRTCLKPDLGCFSIF---DGGF--SGLV
A3QE37_SHELP/2-230-------------TSQVISSDDILLKLCHSVCRVLTSTTGSQVSHAAMVQSITKTCLKPDLGCFSIF---DGGF--SGLV
A0KGQ0_AERHH/8-232-------------NDTVLTTEDVLLSLCHSVTDVLSAATQSQVRFSGMVQRISKTCLKPDIGCFVLF---DGGF--SGLV
A1W514_ACISJ/6-228-------------TSVVYGTEDVLVSLCNSVTRVLSVATQGPVHYSGMVQRITKTCLKPDIGCFVLF---DGGF--SGLV
Q87Q81_VIBPA/3-226-------------KNKVVTTEDILLKLCQSVSGVLTSATSSQVNYSAMVQKINKTSLKPDFGCFVLF---DGGF--TGLV
Q5E4M5_VIBF1/7-229-------------KSKIITTDDILLTLCRSMSGVLSKATQSSVTYSAMVQKITKTSLKPDFGCFVLF---DGGF--SGLV
A1TSY3_ACIAC/32-254-------------..PTYGTEDLLISLCNSVTRVLSVATQTQLHYSGMVQRISKTCLRPDIGCFVLF---DGGF--SGLV
Q083E4_SHEFN/3-236-------------SSSTVKNDDILLKLCHSVSHVLSSTSASHVSHAGMVQSISRTRLKPDLACFSIF---DGGF--SGLV
A1S654_SHEAM/3-228-------------VTQIVTSEDILLKLCHSVSHVLSHTSGSRVTHAAMVQNISSTRLKPDLGCFSIF---DGGF--SGLV
Q6LRC8_PHOPR/3-224-------------KNKIITTDDILLKLCQSISSVLSTATDSQINYSAMVQKINKTSLKPDIGCFVLF---DGGF--TGLV
A1K8E1_AZOSB/8-235-------------HPVVFGTEDILRSLCDSVAKVLTVATGSRIHYASMVQRIHKTCLKPDIGCFVLF---DGGF--SGLV
Q47BE9_DECAR/21-242-------------TPAVFGTEDILRSLCNSVTKVLTIATQSNIHYSGMVQRITKTCLKPDIGCFVLF---DGGF--SGLV
Q3IIQ5_PSEHT/3-229-------------KSKVISTDDILATLCHSVTGVLTSASGNSVSYSAMVQKITRTCMRPDIGCFVLF---DGGF--TGLV
D3RRT0_ALLVD/3-223-------------KTKAISTDDVLLMLCTSVKKVLSVATQTQINYSPMVQKITRTCLRPDIGCFVLF---DGSF--SGLV
W0E402_MARPU/3-226-------------KPKTISTDDILVMLCSSVTKVLSTATGNQIGYSPMVQKITRTCLRPDIGCFVLF---DGGF--SGLV
M4U6M3_9GAMM/3-226-------------KTKTVTTDDVLLLLCNSVKSVLGKATNHPIHYSSMVQKINKTGLKPDIGCFVLF---DGGF--SGLV
Q12N73_SHEDO/3-263-------------SAQIVTTDDILLKLCHSVSHVLSSTSASQVTHAGMVQTINRTRLKPDLGCFSIF---DGGF--SGLV
A1WIM9_VEREI/6-227-------------KATVYGTEDLLISLCSSVTRVLNVATHSQVHYSGMVQRIGRTCLKPDIGCFVLF---DGGF--SGLV
Q8EEX0_SHEON/3-242-------------TNTIVNSDDILLKLCHSVAHVLSSTSASHVSHAGMVQSIARTRLKPDLGCFSIF---DGGF--SGLV

PF02154

FLIM_CAUCR/77-270RAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPGILAV---FRAEELDNYG
FLIM_TREPA/39-229YDFRRPDKFSKEQMRTLSLMHETFARLTTTSLSAQLRSMVHVHVASVDQLTYEEFIRSIPTPSTLAV---ITMDPLKGNA
FLIM_BORBU/49-240YDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAI---INMDPLKGSA
FLIM_ECOLI/38-231YDPNTQRRVVRERLQALEIINERFARHFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNL---IHLKPLRGTG
FLIM_BACSU/40-230YDFKRALRFSKDQIRSLTRIHDNFARLLTTHFSAQLRTYIHISVSSVDQVPYEEFIRSIPNMTILNL---FDVHPMEGRI
O25675_HELPY/40-230YDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNV---FSMKPMGGTG
B7VL12_VIBSL/37-229FDFSSQDRIVRGRMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNM---VRFRPLKGTA

PF13690

C0QAL2_DESAH/42-139SVTFQGDCILNI.....V.S.N..M..FG....EK....M.ES.LNS..EIADAVGELTNMISGQAR......KELE..D
Q2LSM0_SYNAS/58-155GLSFSEACIVRI.....V.SNM..L...G....ES....L.TG.IDN..DVKDAVGEITNMISGVAR......KKLE..S
E6VZI0_DESAO/42-139SLSFSRGCAVAI.....V.KNM..L...G....EE....I.DD.IMQ..DVRDAVGELTNMISGQARA...GLAER....
C6BS03_DESAD/42-139SISFTKNCAVTI.....V.K.N..M..LG....DD....V.QD.IVQ..DVQDAVGEITNMVSGQARA...GLAEQ....
D2R467_PIRSD/42-137VLSLDKKVALAA.....A.S.V.LL...M...CEA....E.EI..NA..DVVDAVGELTNMVAGGAK......AKL....
C4XHM1_DESMR/45-142ALSFTKKCAIFI.....L.K.N..M..LG....DD....I.QD.IVQ..DIKETVGELTNMISGQSRA...NLSQM....
D3PAK0_DEFDS/42-139VVSFPESLALKV.....V.S.K.FI...G....EE....K.VD.IDD..DVIDAVGELINMIAGGAKK...IFTDR....
D3PEX7_DEFDS/42-139VISFPESLALKV.....V.S.K.FM...G....IQ....K.LQ.ADD..DVVDAVGEIVNMIAGGAKK...IFTDK....
Q2LXN3_SYNAS/42-139AISFSEDCICGI.....V.GSM..L...G....ET....C.SE.TTK..EVLDAAGELTNMISGVAR......TNLE..K
C7LN70_DESBD/42-139CISFDKNTAVHI.....V.RHM..L...G....DA....I.ED.VVQ..DVQDAMGEITNMISGHARV...GMVSM....
A5EYB3_DICNV/38-130YFTAPKVLLRHI.....L.L.S..I...G....EN....D.NN..ES..SMLDLVGEIANTISGNAR......SEY....
C7LNA5_DESBD/45-145SLTFTTASALGI.....V.SAM..L...Y....EE....Q.SE.IND..VVTDAVGELTNMISGQAR......KGLV..G
A1AUJ2_PELPD/55-152SIHCPVSLALRI.....T.SSM..L...G....ME...CD.EV..NE..DLNDAIGEIANMLGGSVKQ...VLSKG....
Q3A5A2_PELCD/40-137AIHVPNAVAMSI.....T.S.K.FL..FM....EI....E.EI..DD..DVKDAIGELANMLAGSVKS...MLTET....
B5EEQ0_GEOBB/56-153SIHCPQEFALRI.....T.S.N..M..LG....MD....V.EE.VGE..DVNDALGEIANMLGGYVKQ...ILSKG....
B5EAE1_GEOBB/55-152AIHCPKKLALLV.....T.S.N..M..LG....MD....V.TE.VDE..DVNDAMGEIANMVGGDVKH...IFSPK....
B3E1X0_GEOLS/45-149IVAADRATAQLV.....A.REM..L...M....DD....E.PD..ED..SIRDAIGELINNIAGAFK......TKY....
Q67P65_SYMTH/42-138LYGMSEETGRKL.....V.S.A..M..TG....EE....V.TV.FDD..MCESAVAELGNVITGLAS......GELE..A
Q01VJ9_SOLUE/45-142SLSCSPQMACRI.....C.S.QLLM...T....ES....S.AV..NE..DVLDAVAELTNMIIGSVK......TDL....
A0L9J3_MAGSM/47-145HLSCPMYVAAAL.....A.G.S.FA...G....ER....Y.EDLTNP..EAADGFGELCNMVAGGLQ......TRL....
A1AQJ7_PELPD/45-151IIATDKKSAQIV.....A.K.E.LL...M....VD....E.AE..DE..CIRDAVGELANNIAGAFK......TKY....
Q6MIQ0_BDEBA/198-294CISFDKGSFLEV.....V.SSM..L...M....EE....Q.TE.LNK..DNQDAVGEINNIIFGNAK......AEI....
B5EFK5_GEOBB/45-152LFATEKGSAEQI.....A.K.E.LM...M....MD....E.AD..DE..SINDAVGEVVNNIAGVFK......TKY....
Q74GW2_GEOSL/55-154GIHIPIEFAKEA.....TAS.M..L...G....ME...LD.ELEGED..DIHDAVGEITNMLAGEIKM...LFSAN....
Q39Z94_GEOMG/55-154GIHIPEELAREA.....TAS.M..L..GM....EM....D.EIEGDG..DVHDAMGELTNMLAGEVKM...IFSAR....
B2A030_OPITP/53-154YLCLSDGYAKTI.....S.S.S.LL...GMSLAEV....E.EA.GHE..VVNDALGEITNMTVGGFK......NTLC..D
B9L9J7_NAUPA/350-446VLIFSEKLTKNI.....S.R.I.LL...G....EE....A.KT..KE..ELHDIVAEFANIIVGNTK......TEFA..K
Q0AX00_SYNWW/42-141FLDMGGETAMHV.....A.S.T..L..TG....ES....Y.STFAEE..EVLLSGAELGNIISGNAI......TDINNNN
Q3A8N0_PELCD/39-136LIHLPDQAAIAI.....T.N.A.FL...G....ME....L.SA.VDD..DVKDAVGELANMVAGGIKY...LMPEN....
Q74BI2_GEOSL/45-154ILAAESTAAVTI.....A.K.E.LL...M....LD....E.PD..EE..SIRDAIGELTNNIAGVFK......TKY....
A0L8I4_MAGSM/41-138RLSAPTAGALKV.....A.G.A.LL...G....EE....R.DS.MDA..EMQDGFGEMANMVAGGIQ......SRL....
A0L8I3_MAGSM/42-139ALSAGEAGAMVL.....A.S.A.LL...G....EE....R.SQ.MDD..EMEDAFCEMANMMAGGMQ......SRM....
Q127V6_POLSJ/52-143IVSMPAKLVREI.....L.L.L..Q...H....ET....D.LS..DS..NLLDAVGEIANTLAGNAR......KAL....
C5AC57_BURGB/173-274MMQTDEQPMLDF.....V.A.A..MH.PD....ER....A.PD..FR..DLNGVLGELTNLVWGAFKDRFLGSSQI....
A3DI29_CLOTH/43-141LIDMERDLAFAL.....A.K.N..I..KG....EDF..DP.ED..EP..MVLKPFQTLSKIIVNKAI......EELNN.L
C6WXU1_METML/45-137YFSAPSAMLRHL.....L.T.V..M...K....ET....N.QS..EE..NLLDVVGEIANTISGNAR......KYF....
Q1IMH8_KORVE/73-170NFACDSCAARKI.....A.ARM..L...G....ID....E.AE.AGD..QQFDAIGEICNMIAGNFK......SKLP..G
B1ZR59_OPITP/59-160YLYLDLAFARLC.....TCH.LLGM...T....EAE..LN.EA.GDE..VINDAIGEITNMTVGSFK......NGLC..D
C9LVN2_SELS3/180-280VVHMDTDTMRRF.....ALR.M..L..AM....DE....H.DDIEED..EINDSVEEAANIIVGRGV......SKVNDIF
Q7MSR1_WOLSU/362-458ALAFNQAIAKEA.....A.L.M..M..LG....EE....A.NS..ST..ELLDVVSEFTNIIAGRSK......ALLS..E
A5GA23_GEOUR/174-273LLSVSFAVQKKI.....A.L.A.IL...K....EET..VE.NE.PQE..VLDDAVMELVNIICGNIA......AKAA..Q
D2QZ65_PIRSD/52-150TVAMAERVAIHT.....V.E.G.LL...Q....DR....Y.GA.LTP..QVVDGAGEITNIIVGGIK......SSL....
D1B8E2_THEAS/46-146ALMADMAGFSAY.....V.K.A..M..TGG.MIEA....N.PE..DP..MSMSVIGELTNMTSGQAL......MKV....
A0LDM6_MAGSM/43-140GISCNKRIASEL.....V.S.R.IV...G....LS....V.DELLAE..DLIDGVAELTNMICGGMK......TKA....
Q1IRG8_KORVE/48-143RLDCSTGLAQLA.....A.R.R.FL...A....KT....P.EDLTID..DLRDTVGELTNMVAGSVK......ALV....
D1AZS0_SULD5/240-338FLIFPKDLALIS.....L.EAM..L...G....EP...VD.EE.DNA..AIVDGVAEFCNIITGAAKV...IFSKK....
Q39V86_GEOMG/174-272FMGVTAATQKKI.....A.K.A.IL...K....EPN..VD.NE.PKE..ILDDTVMEFVNVALGNIAA...KAAQS....
D2QXT3_PIRSD/39-134ILDCSDEFAAQA.....A.A.A..M..FG....LA....P.DAVEPQ..DKIDTVAELVNMLGGNIK......SIL....
C0Q915_DESAH/44-135ILMAPEILMAEM.....A.G.N.FM...G....EP....S.ENLSED..HISGTLTEMLNMVCGNAL......SKTD...
D9SQS9_CLOC7/42-145IITMDKEIAQKI.....I.G.F.LM..EG....ST....V.EE.IDQ..DAASALGEYANWITASAA......TQVQ..E
Q2W5X5_MAGSA/49-148AFSFQRVLLEHL.....R.E.V..M...T....ADLNVLP.SE.REL..FLRETAGETVNFILGHAT......ADLA..E
Q2W334_MAGSA/49-148AFSFAPPLLEHLLD.LVA.A.E..I...G....LD....D.RE.RPQ..FLLETAAETVNFIMGHAT......ADLV..D
Q0B010_SYNWW/905-1003ILSVDEELGRYL.....V.Q.A..M..TM....DE...IE.SGTEED..FVEDVLAECANMILGNSI......KLFP..G
A8ZWB5_DESOH/47-151LLHKYIETALTIGNRLRH.H.M..LSEID....EH....E.EI..NE..EMQVALAEWGNTIIGNATR...FLSDK....
C1F3H6_ACIC5/53-147RLCLSEASAQLL.....A.AGF..L...G....ED....E.ESLSPE..QTGLVVCELANMLCGSLL......SQLE...
B8FJT5_DESAA/44-137TIAGSAGLCEKI.....A.S.A..M..FG....ED....R.EL.TQK..DVEDVFREAANIIMGNLI......NEC....
Q2W3Y4_MAGSA/49-148AFSFEASLVQAL.....Y.S.R..V...T....ADI.EVP.PG..EEDLYRRETAGEIVNTILGLCTI...DFQNI....
C4Z452_EUBE2/81-174GIAGNDKELLKV.....A.S.T..F..AQ....ED....I.KE.FDA..DAYDALCEFINVINGAYA......TKL....
D6Z498_DESAT/44-140TLCLPRRLARNI.....T.M.N.FL...G....VD....E.GEVSEA..QMLDTAKETANMAVGSLL......GRVD...
Q7MRT3_WOLSU/32-126FLIIRPLLLQAL.....A.N.R.LL...G....EK....E.PD..EA..TLIDLANELSNLVVGVAKV...IASDE....
D4JQX1_9FIRM/184-279AITADNKAAAVF.....A.S.R..F...A....EE....EITD..MD..YANDAISEFLNLSNGLYNVN..ISETT....
Q15PK9_PSEA6/48-152MMHHYPETAISIGN.SVC.Q.S..M..FD....EK...YD.HQEMTD..DLRNALAEWGNTIVGRSTD...LHSRY....
Q30Q99_SULDN/706-805IMLFSDEIIEFM.....S.S.A..LI.PK....NF....D.KTDIAW..MSKELPSEVLNTIVGLSL......QYF....
A9EPA4_SORC5/41-133ALSAHPGVFR...........A..M...T....GL....P.PA..LD..SVDDWMREVVNQLMGKVK......SRLA..R
B0TBE4_HELMI/187-279GLAGEQDVIEQF.....A.L.R..F...S....EG....L.GI.DDI..EMQDSLGEFLNVTCGLFL......ASLS..N
B4EGV3_BURCJ/172-273LLQTSEQPLLDM.....L.G.G..TR.DG....GR....A.PD..FR..DVNSVLGELTNLVWGAFK......NRY....
Q13SF0_BURXL/172-276MMQAEETPILDL.....L.D.RHQM..ID....NTQ..RG.EA.DFR..DLNSVLGEVTNLIWGSFR......NRY....
Q8F2A0_LEPIN/49-146FLAMDGYTKLKL.....L.P.M..V...A....KSF.HID.PT.VRA..DAPSILMEFANQICGLLI......TEIK..L

PF04509

FLIY_BACSU/36-73-------------------------------------------------MERDAIGEIGNISFGSSA------TALSTLL
Q9HQW8_HALSA/277-314-------------------------------------------------MAESAVSELGNITASGFI------DQWANAL
Q97LH5_CLOAB/84-120-------------------------------------------------MAQSAVSELTNMLTANAA------TNFEEDS
Q97LH6_CLOAB/210-248-------------------------------------------------EILNVVAEFANIVGGNAC------SMINREN
CHEC_BACSU/10-47-------------------------------------------------EQMDILREVGNIGAGHSA------SAMAQLL
O51614_BORBU/89-125-------------------------------------------------MVAATLTEVGNIIAGNFV------TTLHAKG
Q9KA56_BACHD/110-147-------------------------------------------------LSMSALKELGNILAGSYL------SALADFT
CHEC_BACSU/111-148-------------------------------------------------MSSSALHELGNILAGSYL------TALADLT
Q97H00_CLOAB/41-78-------------------------------------------------IEKDLLGEIGNISMGSAS------TALSTII
Q9KA56_BACHD/10-47-------------------------------------------------FHLDILKEIGNIGAGNAA------TALSQLL
Q97GZ6_CLOAB/104-141-------------------------------------------------LSSSVLCEIGNIISSSYM------NAISKFT
Q9KA45_BACHD/146-183-------------------------------------------------MHISAVQEAMNQMMGSAS------TSMSTIF
O29223_ARCFU/109-146-------------------------------------------------MVDSTLMEIGNILSSSFC------DAAAEML
CHEX_THEMA/84-120-------------------------------------------------LALSAIGELGNMTAGKLA------MKLEHLG
Q97GZ6_CLOAB/9-46-------------------------------------------------MQLDAIKEVVNIGSGNAA------TALSQLL
Q9KDX3_BACHD/84-120-------------------------------------------------IGWSAVQEFGNWVAGNTA------TELSKEA
Q9HPJ6_HALSA/103-140-------------------------------------------------MQESALKELMNILASGFL------DGIANSL
CHEC_THEMA/105-142-------------------------------------------------FSASALREIGNIMCGTYV------SALADFL
Q97H00_CLOAB/138-175-------------------------------------------------IELSAVSEAMNQMIGSAA------TSMATML
Q9KUY1_VIBCH/84-120-------------------------------------------------EVTDMVGEITNMVTGGAK------RILAESG
O29223_ARCFU/13-50-------------------------------------------------MELDALKELGNIGVGKAA------TSLSQML
FLIY_BACSU/133-170-------------------------------------------------IHLSAVQEAMNQMMGSAA------TSMSTVF
Q9HQW8_HALSA/90-127-------------------------------------------------VGAAALPEVANILTSGFV------DVWAADD
F7IW81_TREDE/84-118-------------------------------------------------.ARATITELANLITAQAV------TKLHDLG
Q24YC8_DESHY/85-120-------------------------------------------------FVKSALGEIANIISGNAM------TGLSQSQ
Q81FG1_BACCR/122-158-------------------------------------------------LELSAVQEAMNQMMGFAA------TSMSEFF
Q81FG1_BACCR/26-61-------------------------------------------------.ECDILGEIANISFGSAS------TVLSTIL
W0JYJ1_9EURY/105-141-------------------------------------------------MERSAIREVGNIMTSGFI------DGWANVL

PF11813

B8CMN3_SHEPW/4-233VINFSAPAAIEI-----YREYMLNMGMPE----SE----LAFSHTSD--EVGNVMGELMNQMLGDFI------NKISKEL
A9C1W2_DELAS/8-228IINFSAAAAMEL-----YRSYMLSMGMGE----DD----LATSYTSD--DVSNVMGELMNQVVGDFT------SKVQREL
D4ZJR2_SHEVD/4-233VINFSAPAAIEI-----YRSYMKQMGMPE----SE----LAFSHTSD--EVGDVLGELMNQILGNFI------SKVNKQL
A3QE37_SHELP/2-230VINFSAPAAVEI-----YQAYMKQMGMPE----SE----LAFSHTSD--EVGDVMGELMNQILGDFI------VKVNKEL
A0KGQ0_AERHH/8-232VINFSASAAMEL-----YESYMLSMGLSK----ED----LAISHTSD--EVSNVMGELMNQIVGSFT------VKVGRDL
A1W514_ACISJ/6-228IINFSAAAAMEI-----YERYMLSMGMSA----QE----LASSFTSD--EVSNVMGELMNQVVGDFT------GKVRREL
Q87Q81_VIBPA/3-226VINFTAKAALEI-----YTNYMRNMGMPE----EE----LAISHTSD--EVADVLGELMNQLVGDFT------NKIRKEL
Q5E4M5_VIBF1/7-229VTNFTKDAALEL-----YTKYMRNMGMPA----EE----LAILHTSD--EVGDVLGELMNQIVGDFT------GQIRKTL
A1TSY3_ACIAC/32-254IINLTKEAAMEI-----YQSYLLSMGMSQ----DD----LASSYTSD--EVANVMGELMNQVVGDFT------GKVRREL
Q083E4_SHEFN/3-236VINFSAAAAIEI-----YRRYMLNMGMPE----TE----LAFSHTSD--DVSNVMGELMNQILGDFI------GKISKEL
A1S654_SHEAM/3-228VINFSAASAVEI-----YRRYMLNMGMPE----SD----LAFSHNSD--EVGNVMGELMNQILGDFI------GKVSKEL
Q6LRC8_PHOPR/3-224VSNFTQQAALEI-----YQAYMLKMGIPQ----ED----LAIHHTSD--EVADVLGELMNQTVGDFT------SKIRREL
A1K8E1_AZOSB/8-235VINFSAAAAMEL-----YEQYMLNMGMGR----EG----LATAFTSD--EVGNVMGELMNQSVGDFT------GKISREL
Q47BE9_DECAR/21-242VINFSAQAAMEL-----YESYMLHMGMAK----NE----LASSHTAD--EVSNVMGELMNQIVGDFT------GTVAREL
Q3IIQ5_PSEHT/3-229ITNFTSQAAMEI-----YGDYMRNMGMPE----EE----IAHSHLSD--DVSNVLGELMNQIVGDFT------SKVREQL
D3RRT0_ALLVD/3-223IINFSAPSAMEL-----YRAYMMSMGMPE----SE----LATQHTSE--EVGNMLGELMNQIVGDFT------GNVGSEL
W0E402_MARPU/3-226IINFSSQAAMEI-----YRSYMTNMGISE----SE----LATVHTSD--EVANMLGELMNQIVGDFT------GNVGRDL
M4U6M3_9GAMM/3-226ILNFSAASALEI-----YQNYMLHMGIPE----NE----LAQSHTSD--EVSDVMGELMNQMIGYFT------SVIAQEM
Q12N73_SHEDO/3-263IINFSAEAAIEI-----YRRYMINMGMPE----TE----LAFTHTSD--DVGNVMGELMNQILGDFI------GKVSKEL
A1WIM9_VEREI/6-227ILNFSAQAAMEL-----YANYLLNMGMSK----DD----LASSYTSD--EVSNVMGELMNQVVGDFT------GKVRREM
Q8EEX0_SHEON/3-242VINFSAPAAIEI-----YRRYMLNMGMPE----EE----LAFSHTSD--EVGNVMGELMNQILGDFI------NKISKEL

PF02154

FLIM_CAUCR/77-270LLTVDSNLIYSI-----V---DVLLGGRR----GTAAMRIEGRPYTT--IERVLVQRMIDVVLHDLKSAFEPLHPVSFSL
FLIM_TREPA/39-229VLEVDPSITFSI-----I---DRLFGGTG----QAAK...VQRDLTD--IENSVMEGVIVRILANVRESWTQVIDLRPRL
FLIM_BORBU/49-240IFEVDPTIAFAI-----V---DRLFGGDG----DTIKD..KSRDLTE--IEQSVMESVIIRILANMREAWSQVVDLRPRF
FLIM_ECOLI/38-231LVVFSPSLVFIA-----V---DNLFGGDG----RFPTK.VEGREFTH--TEQRVINRMLKLALEGYSDAWKAINPLEVEY
FLIM_BACSU/40-230MMEVNPTIAYTM-----M---DRVMGGIG----ISHN...KVDSLTE--IETKIISNLFENALGNYKEAWQSIADIEPEM
O25675_HELPY/40-230VLEINPSIAFPM-----I---DRLLGGKG----SAYD...QNREFSD--IELNLLDTILRQVMQILKEVWSPVVEMFPTI
B7VL12_VIBSL/37-229LITMEARLVFIL-----V---ENFFGGDG----RFHAK.IEGREFTP--TERRIIQLLLKIVFEDYKEAWSPVMGVEFEY

PF13690

C0QAL2_DESAH/42-139TGK.....I...FKAAI-PSVITGKN.HSI..SHY.............TN.GPRIAIPFF--------------------
Q2LSM0_SYNAS/58-155EGF.....S...ITAAI-PTVVAGKS.HSI..VHV.............LG.GPSIIIPFE--------------------
E6VZI0_DESAO/42-139.GY.....V...FQGST-PTVIMGDG.HTI..SHM.............AK.TPIMAIPFT--------------------
C6BS03_DESAD/42-139.GL.....S...FSGAT-PSVIMGDN.HTI..THI.............AN.TPIMAIPFT--------------------
D2R467_PIRSD/42-137EEY.....Q...LSISL-PSVVTGTG.HEI..RFP.............SN.VTPICVPFN--------------------
C4XHM1_DESMR/45-142.GI.....N...LQASI-PTIILGDN.HTI..EHM.............KQ.CTIVTTPFN--------------------
D3PAK0_DEFDS/42-139.GL.....K...FKISI-PNVITGKG.HKI..KRP.............SN.VPCIAVFFE--------------------
D3PEX7_DEFDS/42-139.GL.....K...FKISI-PNVVTGKN.HKI..SRP.............ST.IPCVVIYFT--------------------
Q2LXN3_SYNAS/42-139MGL.....Q...VYAAI-PSVVFGKN.HTL..RHI.............LN.SPSIVIPFS--------------------
C7LN70_DESBD/42-139.GL.....K...LQGST-PSVIMGDN.HSI..SYR.............AS.AQAIAIPFS--------------------
A5EYB3_DICNV/38-130.GE.....T...FMISV-PMVIQGTP.GEI..YLP.............KD.ARSYVIPIT--------------------
C7LNA5_DESBD/45-145MGM.....I...FEGAI-PSVITGAG.HII..RHV.............ST.SAILAIPFE--------------------
A1AUJ2_PELPD/55-152.GL.....D...VKLSI-PTVISGED.YTV..NSL.............SD.MDCVVIPFK--------------------
Q3A5A2_PELCD/40-137.GS.....G...LKLAI-PSAISGTE.YEV..ECL.............SD.AEGVIVPFS--------------------
B5EEQ0_GEOBB/56-153.GL.....D...INLSI-PTVISGED.YTV..NSM.............AD.SDCVIIPFT--------------------
B5EAE1_GEOBB/55-152.GA.....D...INLSI-PTVIYGSD.YAL..ESI.............SS.SDALVIPFL--------------------
B3E1X0_GEOLS/45-149.HDQ..YGN...VAMGL-PLVVSGQL.RTV..TEPPEEG.....ASMNVQ.CKGVTIPFT--------------------
Q67P65_SYMTH/42-138AGY.....P...CKIAP-PSVVMGKG.TAI..ST..............LS.IKRLVIPLE--------------------
Q01VJ9_SOLUE/45-142.ES.....QLGPLGLSI-PTVVFGRN.FKT..RSA.............GK.TEWMSVTFE--------------------
A0L9J3_MAGSM/47-145.GEK..YGE...IALTP-PTVITGTS.YAM..QYS.............TK.LSSIKQYFK--------------------
A1AQJ7_PELPD/45-151.HEQ..YGS...VALGL-PLVISGQL.RAI..SEPPEENE...VTSINVQ.CKGVTIPFR--------------------
Q6MIQ0_BDEBA/198-294SSY.....G...VQMTV-PKVLLGSG.QNV..PCA.............QG.SAGMMIPFA--------------------
B5EFK5_GEOBB/45-152.HEQ..YGS...VALGL-PLVLSGRL.RPI..TDPPEQAA..SDGSMVVQ.CKGVTIPFT--------------------
Q74GW2_GEOSL/55-154.NL.....T...VGLST-PSIISGSD.YTV..EVV.............SS.GAAVVVPFN--------------------
Q39Z94_GEOMG/55-154.GM.....S...VCLST-PSVISGRE.YSV..EVV.............SS.GAAVVVPFD--------------------
B2A030_OPITP/53-154VGY.....P...CKLTL-PAIVRGEN.LTI..ANV.............KG.ATRHIFYFD--------------------
B9L9J7_NAUPA/350-446HDV.....Q...INMTL-PKVFDDLE.SLK..SLV.............AE.KKAIEVKFY--------------------
Q0AX00_SYNWW/42-141PGL.....N...LRLTP-PSVFTGEG.LTM...FN.............VR.LSSCSVLLQ--------------------
Q3A8N0_PELCD/39-136.TR.....D...IALAI-PSVVRGKG.YSC..EAT.............GR.FERAGVVFE--------------------
Q74BI2_GEOSL/45-154.HEQ..YGN...VALGL-PLIVSGML.RTV..AEGTSQDQSGGSSSMNVQ.CKGVTIPFM--------------------
A0L8I4_MAGSM/41-138.EA.....DLGAIGMTP-PMVVRGNN.YEV..DGA.............TG.FEVVHQLFT--------------------
A0L8I3_MAGSM/42-139.ESL..LGP...VKLST-PMVIQGAG.HKV..RSE.............KH.YACISQDFS--------------------
Q127V6_POLSJ/52-143.GP.....E...LQISV-PIKLHGVQ.G.I..KAR.............VR.KHPYVITLS--------------------
C5AC57_BURGB/173-274.PA.....A...SSVQV-PLLVNHKH.KYI..SFG.............SE.NPQLCFKYR--------------------
A3DI29_CLOTH/43-141YSA.....K...IEAAP-PIVLKGKD.ALI..TVP.............K..VEPVFVDCT--------------------
C6WXU1_METML/45-137.GE.....N...MVISI-PEKIANLS.ENL..AQQ.............AR.SYAYVIIIK--------------------
Q1IMH8_KORVE/73-170IGE.....K...CMLSV-PTIVVGSN.YRL..RAL.............SG.KRRLEYRCL--------------------
B1ZR59_OPITP/59-160AGY.....P...CKLTI-PSILHGSN.FTI..EPI.............ST.VTRHVYHFD--------------------
C9LVN2_SELS3/180-280RDK.....E...MRLTP-PGTISGAN.IRI..ANP.............K..LTSFEVVAK--------------------
Q7MSR1_WOLSU/362-458DET.....T...ISISL-PKTCKNFS.ELM..TTL.............GN.RQGVQIDLL--------------------
A5GA23_GEOUR/174-273RGK.....C...TEIEP-PLVFHPGP.GGI..EVP.............SG.EQGIVFPIH--------------------
D2QZ65_PIRSD/52-150AGT.....PWAFSQITV-PSVIIGGG.YQI..AYA.............KG.LEFLCATFE--------------------
D1B8E2_THEAS/46-146.EV....PG...LDITP-PQLMAGEN.LKAIPTKK.............AD.VKSFTLPFD--------------------
A0LDM6_MAGSM/43-140.EM....KH...LDLSP-PVAIIGGS.YIA..QWK.............TL.NGSEVLTFL--------------------
Q1IRG8_KORVE/48-143.AQ.....P...THVSL-PSVADGAD.YDL..TVR.............GG.RVLLQCPFE--------------------
D1AZS0_SULD5/240-338.EL.....K...VLFEL-PKTYLSMQ.AAL..ADT.............LG.SNGVWIDMQ--------------------
Q39V86_GEOMG/174-272.GK.....S...MEIAP-PEIIEAPD.G.I..QVP.............DG.HKALCFPVC--------------------
D2QXT3_PIRSD/39-134.PG.....P...SFLAL-PTVTAGED.YKI..EVP.............SA.TCESMIELG--------------------
C0Q915_DESAH/44-135SKV.....P...FELGI-PRMMDTSE.I....SE..................NQVFTIIE--------------------
D9SQS9_CLOC7/42-145YGES..ISN...FKVDI-EANLDKSG.EKI..SCD.............GD.MPFLSLGYL--------------------
Q2W5X5_MAGSA/49-148GGN.....V...IRLSP-PSVLD.EE.KNI..LRP.............KK.AIFTTIEMT--------------------
Q2W334_MAGSA/49-148EDA.....T...VTLTP-PVVLAGGR.S.I..HRP.............KG.AKFYAVELA--------------------
Q0B010_SYNWW/905-1003ISE.....L...VMLEV-PVTLYSDQ.TAI..KH..............LQ.ADIWTCDFL--------------------
A8ZWB5_DESOH/47-151.NL.....G...ITFDP-PYFITDTENLNS..LLA.............HA.SEVISIPIH--------------------
C1F3H6_ACIC5/53-147SQE.....H...FDLAT-PQLDQDAP.P.....PP.............EQ.APVAAQSFE--------------------
B8FJT5_DESAA/44-137.AF.....P...GEVSP-DIPVARKG.MDL..EDC.............KN.EHDLNLFFE--------------------
Q2W3Y4_MAGSA/49-148.EE.....S...IALSP-PVIIEDAR.C.I..HRP.............KN.AVFASMRIR--------------------
C4Z452_EUBE2/81-174.GEN..DVE...VTLHP-PVFYKNTE.VTA...................E.DGFYVVTFN--------------------
D6Z498_DESAT/44-140PGG.....E...ARLHI-PEAHLLDE.FSV..RE..............LL.EQPGVLLFN--------------------
Q7MRT3_WOLSU/32-126.GK.....D...FTIST-PQFLKIGK.FE.....P.............KS.EASLHFKTS--------------------
D4JQX1_9FIRM/184-279.GK.....E...IGLNP-PETATSSA...V..SGI.............KS.KFTLTIPVE--------------------
Q15PK9_PSEA6/48-152.SL.....E...YGFSS-PYFVEDLS.QMD..KYL.............KGVQQVVTVPIS--------------------
Q30Q99_SULDN/706-805.DKS..LKD...VKMTP-PLYLDNTD.LTK..ALK.............DA.KNKFIQEIE--------------------
A9EPA4_SORC5/41-133FQI.....A...LHAEL-PQLRRASD.VAR..RYR.............GS.KQQFCYAFR--------------------
B0TBE4_HELMI/187-279QGI.....D...LELQP-PTLCQEKA.LL...................RG.QTLFRIPVH--------------------
B4EGV3_BURCJ/172-273LGDAEALAR...HPVQV-PLVVNHKQ.KFI..SFG.............GD.CPQLCFKYR--------------------
Q13SF0_BURXL/172-276VGDADAWAR...SQVQV-PLLVNHKH.KYI..SFG.............SG.NPQLCFTY.--------------------
Q8F2A0_LEPIN/49-146GRF.....K...TDLLP-PEMLNHKL.IPV..DLE.............TY.RQYILIYF.--------------------

PF04509

FLIY_BACSU/36-73N.Q-----K---VDITT-PSVTV---------------------------------------------------------
Q9HQW8_HALSA/277-314D.T-----T---IDIST-PSHVR---------------------------------------------------------
Q97LH5_CLOAB/84-120..V-----N---IDIST-PALMY---------------------------------------------------------
Q97LH6_CLOAB/210-248KIF-----G---MRIAP-PTTIY---------------------------------------------------------
CHEC_BACSU/10-47N.R-----K---IDMEV-PFAKL---------------------------------------------------------
O51614_BORBU/89-125..F-----V---FDITP-PAFIY---------------------------------------------------------
Q9KA56_BACHD/110-147K.L-----K---LYPSV-PGLSI---------------------------------------------------------
CHEC_BACSU/111-148K.L-----Q---LYPSV-PEVSL---------------------------------------------------------
Q97H00_CLOAB/41-78G.Q-----K---VNITT-PIVSV---------------------------------------------------------
Q9KA56_BACHD/10-47Q.K-----T---IDMNV-PNVHI---------------------------------------------------------
Q97GZ6_CLOAB/104-141N.L-----V---ITPSV-PAFSY---------------------------------------------------------
Q9KA45_BACHD/146-183N.K-----R---IDISP-PGVNM---------------------------------------------------------
O29223_ARCFU/109-146G.I-----V---LLPTP-PSFGR---------------------------------------------------------
CHEX_THEMA/84-120..K-----H---VDITP-PTVVS---------------------------------------------------------
Q97GZ6_CLOAB/9-46N.K-----K---IDMTV-PDINI---------------------------------------------------------
Q9KDX3_BACHD/84-120..C-----I---IDVTP-PVVNE---------------------------------------------------------
Q9HPJ6_HALSA/103-140G.I-----E---IIHGP-PTVYH---------------------------------------------------------
CHEC_THEMA/105-142G.F-----K---IDTLP-PQLVI---------------------------------------------------------
Q97H00_CLOAB/138-175L.R-----E---VNISP-PVSKI---------------------------------------------------------
Q9KUY1_VIBCH/84-120..F-----D---FDMAT-PVVVS---------------------------------------------------------
O29223_ARCFU/13-50G.R-----R---IEMSV-PEAVI---------------------------------------------------------
FLIY_BACSU/133-170S.K-----K---IDISP-PRVEL---------------------------------------------------------
Q9HQW8_HALSA/90-127E.D-----T---IEIEP-PDRLE---------------------------------------------------------
F7IW81_TREDE/84-118..F-----K---FDLTP-PALF.---------------------------------------------------------
Q24YC8_DESHY/85-120..V-----V---CDIRP-PKIL.---------------------------------------------------------
Q81FG1_BACCR/122-158Q.D-----T---VDMSP-PTIK.---------------------------------------------------------
Q81FG1_BACCR/26-61N.R-----Q---VSITA-PRIE.---------------------------------------------------------
W0JYJ1_9EURY/105-141G.R-----T---IDIST-PQLI.---------------------------------------------------------

PF11813

B8CMN3_SHEPW/4-233QTS---------ISQSQ-PKMLTINKELTISVDTNLDEAVARRVSFKTQN-NHIFYLEFAMDKTEFIKLT.DFDADEDFD
A9C1W2_DELAS/8-228QTY---------ITQSQ-PKMIRLNKQVNLSVDANLDSPEARRVTFYTGN-NNIFYLELAMDRTEFIKVV.DFEPQERPD
D4ZJR2_SHEVD/4-233QTS---------INQSQ-PKMLTINKELTISIDTNLDEAVARRVSFRTQN-NHIFYLEFAMDKTEFIQLN.DFDAEEEFD
A3QE37_SHELP/2-230QTS---------INQSQ-PKMLTINKELTISIDTNLDEAVARRVAFKTAR-NHIFYLEYAMDKTEFIKLA.DFEHEED.D
A0KGQ0_AERHH/8-232QTH---------ITQNQ-PKMLALNKQVMLSVDTNLDSPESRRVTFFTAR-NNIFYLELAMDKTEFIRIHNDGMDQEELD
A1W514_ACISJ/6-228QTH---------ITQNQ-PKMLVLNQQVVLSVDANLDQPEARRVTFYTGS-NNIFYLELAIDRTQFIKLY.DFEPQDAPD
Q87Q81_VIBPA/3-226QTN---------ITQNQ-PKMLALNKQVILQVDTNLDRPQARRVTFSTAN-NNIFYLELAMDKTEFIQLE.EFEIAEDEN
Q5E4M5_VIBF1/7-229QTT---------ISQNQ-PKMLSLNKQVILSVDTNLDRPQARRVTFTTEN-NHIFYLELAMDKTEFIQLE.EFEQEDEFD
A1TSY3_ACIAC/32-254QTH---------ITQNQ-PKMLALNKQVMLSVDANLDQPEARRVTFYTAK-NHIFYLELAIDRTEFIKLY.DFEPQEAPD
Q083E4_SHEFN/3-236QTS---------ISQSQ-PKMLVINKELTISVDTNLDNAVARRVSFKTEN-NHIFYLEFAMDKTEFIRSA.DFEMDEEFD
A1S654_SHEAM/3-228QTS---------ISQSQ-PKMLTINKEITISIDANLDEPVIRRVSFMTES-NHIFYLEFAMDKTEFVKTR.EFELDEEFD
Q6LRC8_PHOPR/3-224QIS---------ITQNQ-PKMLALNKQIILSVDTNLDRPQARRVSFTTEK-NNIFYLELAMDKTEFIQLE.EFEQHQDID
A1K8E1_AZOSB/8-235QTQ---------ITQNQ-PKMLALTKQVMLSVDTHLDRPEARRVSFYTGR-NNIFYLELAIDRTEFIQLN.EFAADEAPD
Q47BE9_DECAR/21-242QTH---------ITQNQ-PKMLVINKQVMLSVDTNLDQPEARRVTFFTGR-NNIFYLELAIDRTEFIKLN.DFEAREAPD
Q3IIQ5_PSEHT/3-229HTS---------ITQNQ-PKMMAINKQVQISVDTTMDRPQARRVTFTTSK-QNIFYLELAMDKTEFIKLH.DFDIVEAID
D3RRT0_ALLVD/3-223LVS---------INQNQ-PKMLTINKEVVVSIDTNLDRAQARRVSFSTAN-RNVFYMELAMDRTEFIQLH.DFE.REEID
W0E402_MARPU/3-226QVS---------INQNQ-PKMLTINKEVMVSIDTNLDRPQARRVAFTTAR-RNVFYMELAMDKTEFLKLH.DFE.REEVD
M4U6M3_9GAMM/3-226QTS---------ITQNQ-PKMLTINKQVQLSIDTNLDRPQARRVTFTTEK-NNIFYLEMAMDKTEFIKLP.NFERREKFD
Q12N73_SHEDO/3-263QTS---------ISQSQ-PKMLTINKELTISIDANLDNPVARRVSFRTQS-NHIFYLEFAMDNTEFIASA.EFEMDEEFD
A1WIM9_VEREI/6-227QTH---------ITQNQ-PKMLVLSKQVMLSVDANLDKPEARRVTFYTGN-NHLFYLELAIDRTEFIKLY.DFEAQEVPD
Q8EEX0_SHEON/3-242QTS---------ISQSQ-PKMLTINKELTISIDANLDEAVARRVSFKTEN-NHIFYLEFAMDKTEFIKLD.EFEYDEEFD

PF02154

FLIM_CAUCR/77-270DRLETNPPF---AAIAR.PANAAILVKLRIDMEDR-------------GG-RIELLLPYATLEPIRKML-----------
FLIM_TREPA/39-229GQIETNPQF---AQIVP.PSEMVVLVTLETKVGEE-------------EG-MMNFCIPYITIEPIISKL-----------
FLIM_BORBU/49-240GHIEVNPQF---AQIVP.PTEMIILVTLEVKIGKV-------------EG-LMNFCLPYITIEPIVSKL-----------
FLIM_ECOLI/38-231VRSEMQVKF---TNITTSPNDIVVNTPFHVEIGNL-------------TG-EFNICLPFSMIEPLRELL-----------
FLIM_BACSU/40-230TEFEVNPQF---VQMVS.PNETVVVISLNTQIGEI-------------SG-VINLCIPHIVLEPLIPKL-----------
O25675_HELPY/40-230DAKESSANV---VQIVA.QNEISIMVVLEIIIGHS-------------RG-MMNICYPVISIESILSKM-----------
B7VL12_VIBSL/37-229LDSEVNPSM---ANIVS.PTEVIVVSSFHIEVDGG-------------GG-DFHVVMPYSMVEPIRELL-----------

PF13690

C0QAL2_DESAH/42-139------------------------------------------------------------------------
Q2LSM0_SYNAS/58-155------------------------------------------------------------------------
E6VZI0_DESAO/42-139------------------------------------------------------------------------
C6BS03_DESAD/42-139------------------------------------------------------------------------
D2R467_PIRSD/42-137------------------------------------------------------------------------
C4XHM1_DESMR/45-142------------------------------------------------------------------------
D3PAK0_DEFDS/42-139------------------------------------------------------------------------
D3PEX7_DEFDS/42-139------------------------------------------------------------------------
Q2LXN3_SYNAS/42-139------------------------------------------------------------------------
C7LN70_DESBD/42-139------------------------------------------------------------------------
A5EYB3_DICNV/38-130------------------------------------------------------------------------
C7LNA5_DESBD/45-145------------------------------------------------------------------------
A1AUJ2_PELPD/55-152------------------------------------------------------------------------
Q3A5A2_PELCD/40-137------------------------------------------------------------------------
B5EEQ0_GEOBB/56-153------------------------------------------------------------------------
B5EAE1_GEOBB/55-152------------------------------------------------------------------------
B3E1X0_GEOLS/45-149------------------------------------------------------------------------
Q67P65_SYMTH/42-138------------------------------------------------------------------------
Q01VJ9_SOLUE/45-142------------------------------------------------------------------------
A0L9J3_MAGSM/47-145------------------------------------------------------------------------
A1AQJ7_PELPD/45-151------------------------------------------------------------------------
Q6MIQ0_BDEBA/198-294------------------------------------------------------------------------
B5EFK5_GEOBB/45-152------------------------------------------------------------------------
Q74GW2_GEOSL/55-154------------------------------------------------------------------------
Q39Z94_GEOMG/55-154------------------------------------------------------------------------
B2A030_OPITP/53-154------------------------------------------------------------------------
B9L9J7_NAUPA/350-446------------------------------------------------------------------------
Q0AX00_SYNWW/42-141------------------------------------------------------------------------
Q3A8N0_PELCD/39-136------------------------------------------------------------------------
Q74BI2_GEOSL/45-154------------------------------------------------------------------------
A0L8I4_MAGSM/41-138------------------------------------------------------------------------
A0L8I3_MAGSM/42-139------------------------------------------------------------------------
Q127V6_POLSJ/52-143------------------------------------------------------------------------
C5AC57_BURGB/173-274------------------------------------------------------------------------
A3DI29_CLOTH/43-141------------------------------------------------------------------------
C6WXU1_METML/45-137------------------------------------------------------------------------
Q1IMH8_KORVE/73-170------------------------------------------------------------------------
B1ZR59_OPITP/59-160------------------------------------------------------------------------
C9LVN2_SELS3/180-280------------------------------------------------------------------------
Q7MSR1_WOLSU/362-458------------------------------------------------------------------------
A5GA23_GEOUR/174-273------------------------------------------------------------------------
D2QZ65_PIRSD/52-150------------------------------------------------------------------------
D1B8E2_THEAS/46-146------------------------------------------------------------------------
A0LDM6_MAGSM/43-140------------------------------------------------------------------------
Q1IRG8_KORVE/48-143------------------------------------------------------------------------
D1AZS0_SULD5/240-338------------------------------------------------------------------------
Q39V86_GEOMG/174-272------------------------------------------------------------------------
D2QXT3_PIRSD/39-134------------------------------------------------------------------------
C0Q915_DESAH/44-135------------------------------------------------------------------------
D9SQS9_CLOC7/42-145------------------------------------------------------------------------
Q2W5X5_MAGSA/49-148------------------------------------------------------------------------
Q2W334_MAGSA/49-148------------------------------------------------------------------------
Q0B010_SYNWW/905-1003------------------------------------------------------------------------
A8ZWB5_DESOH/47-151------------------------------------------------------------------------
C1F3H6_ACIC5/53-147------------------------------------------------------------------------
B8FJT5_DESAA/44-137------------------------------------------------------------------------
Q2W3Y4_MAGSA/49-148------------------------------------------------------------------------
C4Z452_EUBE2/81-174------------------------------------------------------------------------
D6Z498_DESAT/44-140------------------------------------------------------------------------
Q7MRT3_WOLSU/32-126------------------------------------------------------------------------
D4JQX1_9FIRM/184-279------------------------------------------------------------------------
Q15PK9_PSEA6/48-152------------------------------------------------------------------------
Q30Q99_SULDN/706-805------------------------------------------------------------------------
A9EPA4_SORC5/41-133------------------------------------------------------------------------
B0TBE4_HELMI/187-279------------------------------------------------------------------------
B4EGV3_BURCJ/172-273------------------------------------------------------------------------
Q13SF0_BURXL/172-276------------------------------------------------------------------------
Q8F2A0_LEPIN/49-146------------------------------------------------------------------------

PF04509

FLIY_BACSU/36-73------------------------------------------------------------------------
Q9HQW8_HALSA/277-314------------------------------------------------------------------------
Q97LH5_CLOAB/84-120------------------------------------------------------------------------
Q97LH6_CLOAB/210-248------------------------------------------------------------------------
CHEC_BACSU/10-47------------------------------------------------------------------------
O51614_BORBU/89-125------------------------------------------------------------------------
Q9KA56_BACHD/110-147------------------------------------------------------------------------
CHEC_BACSU/111-148------------------------------------------------------------------------
Q97H00_CLOAB/41-78------------------------------------------------------------------------
Q9KA56_BACHD/10-47------------------------------------------------------------------------
Q97GZ6_CLOAB/104-141------------------------------------------------------------------------
Q9KA45_BACHD/146-183------------------------------------------------------------------------
O29223_ARCFU/109-146------------------------------------------------------------------------
CHEX_THEMA/84-120------------------------------------------------------------------------
Q97GZ6_CLOAB/9-46------------------------------------------------------------------------
Q9KDX3_BACHD/84-120------------------------------------------------------------------------
Q9HPJ6_HALSA/103-140------------------------------------------------------------------------
CHEC_THEMA/105-142------------------------------------------------------------------------
Q97H00_CLOAB/138-175------------------------------------------------------------------------
Q9KUY1_VIBCH/84-120------------------------------------------------------------------------
O29223_ARCFU/13-50------------------------------------------------------------------------
FLIY_BACSU/133-170------------------------------------------------------------------------
Q9HQW8_HALSA/90-127------------------------------------------------------------------------
F7IW81_TREDE/84-118------------------------------------------------------------------------
Q24YC8_DESHY/85-120------------------------------------------------------------------------
Q81FG1_BACCR/122-158------------------------------------------------------------------------
Q81FG1_BACCR/26-61------------------------------------------------------------------------
W0JYJ1_9EURY/105-141------------------------------------------------------------------------

PF11813

B8CMN3_SHEPW/4-233LDDLLAEHG.......QATAEKKPQSAVNAAK........................ETQMSSADDLFDELGI
A9C1W2_DELAS/8-228PDALMAQT.........AASAPAAAPAPAAS.............................TDTDELLKSLGM
D4ZJR2_SHEVD/4-233PDDLLAEHG.......QNNKSKATPLTKVSDN........................KSMTDEADDLLNELGI
A3QE37_SHELP/2-230PDALLAQHG.......QGSQAADPSWSAAVNS........................AVVVDDSDDLMKELGI
A0KGQ0_AERHH/8-232PDALIAQTK.....REAAQPAPAATPVA................................NDHDDLLDSLGI
A1W514_ACISJ/6-228PDALMAQA.........AAPAPAAAPASATD.............................ADTEALLRSLGM
Q87Q81_VIBPA/3-226PDDILEAAR.....KNMAEKESESSNSK................................DDADDLLSQLGL
Q5E4M5_VIBF1/7-229ADDLLDQHR.....SAKKEEKKTEPNQ.................................DFDDSLFDELGI
A1TSY3_ACIAC/32-254PDALLAQAG........KGDQPASPPPAAGAD............................SDTDDLLKSLGM
Q083E4_SHEFN/3-236LDSLIETHG.......KAAQVNTAKSKDVLND....................PNIKGIVVDDADDLLSELGL
A1S654_SHEAM/3-228PDFLIEQHG...........NTRSPWSQMAGK........................GIVADDADDLLDELGI
Q6LRC8_PHOPR/3-224PDVIIENT...........KTQNESNLTLVNQ............................TTEQDLLDELGI
A1K8E1_AZOSB/8-235PDALIEQAH.....AAGAGTADNAAPAEAAAD............................DDADALLKSLGM
Q47BE9_DECAR/21-242PDELIAQVN........AAAAPVSQPTTS...............................DEHDDLLKSLGM
Q3IIQ5_PSEHT/3-229PDDIIENEA.....KQKAEKAKAKAEKEAED.............................SDDDDFMAGLGL
D3RRT0_ALLVD/3-223PDRIVDEAG.......QRETLASTSNQTLVDQ................................SLLDELGL
W0E402_MARPU/3-226PDRILAEQK....QGDGSVKSGAPQQSALVDT................................DLLEELGL
M4U6M3_9GAMM/3-226ADSIIDAE.........NNKKDAEPTPEVVMD............................STEQDLLDELGL
Q12N73_SHEDO/3-263PDSLLEQHGSSLAEHKKKANKARKASKKVASKPAAASPKKATLAVKPDRLNNPEVKGIVADDADDLLSELGL
A1WIM9_VEREI/6-227ADALMAQ..........AQPLPPAPPPPAGR.............................DDTDALLKSLGM
Q8EEX0_SHEON/3-242PDSLLEQHG..MSGAQASNADSITPWSRIADKPAISQ...................QYTNMDADDLLDELGI

PF02154

FLIM_CAUCR/77-270------------------------------------------------------------------------
FLIM_TREPA/39-229------------------------------------------------------------------------
FLIM_BORBU/49-240------------------------------------------------------------------------
FLIM_ECOLI/38-231------------------------------------------------------------------------
FLIM_BACSU/40-230------------------------------------------------------------------------
O25675_HELPY/40-230------------------------------------------------------------------------
B7VL12_VIBSL/37-229------------------------------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window