Sequence alignment for CL0355

PF13690

C0QAL2_DESAH/42-139-----------------------------------------------------------VTG.VIGL...TGVT..NGTI
Q2LSM0_SYNAS/58-155-----------------------------------------------------------ISG.IIGL...TGDL..RGSL
E6VZI0_DESAO/42-139-----------------------------------------------------------VSG.LVGI...TGER..NGSV
C6BS03_DESAD/42-139-----------------------------------------------------------VTG.LVGI...TGDM..NGTI
D2R467_PIRSD/42-137-----------------------------------------------------------ISG.VIGL...SGNA..QGTV
D6SSH8_9DELT/45-145-----------------------------------------------------------VSG.IIGFSSKSGSA..KGSM
C4XHM1_DESMR/45-142-----------------------------------------------------------VSA.IIGF...TGDR..NGTM
D3PAK0_DEFDS/42-139-----------------------------------------------------------ISG.VIGL...TGQA..VGSV
D6SK93_9DELT/45-145-----------------------------------------------------------ISG.VIGFSSPNGKN..KGTM
D3PEX7_DEFDS/42-139-----------------------------------------------------------ISG.IIGL...SGQA..IGSV
Q2LXN3_SYNAS/42-139-----------------------------------------------------------VSG.IIGI...TGDA..TGSL
C7LN70_DESBD/42-139-----------------------------------------------------------VSA.LIGI...TGDK..KGTF
A5EYB3_DICNV/38-130-----------------------------------------------------------YTG.IIGI...SGPY..RGCV
C7LNA5_DESBD/45-145-----------------------------------------------------------VTG.VIGFSNPKGKS..RGTM
A1AUJ2_PELPD/55-152-----------------------------------------------------------ITG.MVGF...AGTY..SGVI
Q3A5A2_PELCD/40-137-----------------------------------------------------------VSG.LVGL...AGNY..RGML
Q1JZV2_DESAC/40-137-----------------------------------------------------------VSG.VIGL...AGTC..QGML
B5EEQ0_GEOBB/56-153-----------------------------------------------------------VTG.MVGL...AGTY..TGIL
A3ZPG3_9PLAN/42-140-----------------------------------------------------------VCG.VIGL...SGRA..QGVV
Q1JZV3_DESAC/42-139-----------------------------------------------------------ISG.MLGF...AGEI..QGML
B5EAE1_GEOBB/55-152-----------------------------------------------------------VTS.MVGL...AGSH..SGII
B5JV55_9GAMM/45-138-----------------------------------------------------------YSG.IIGI...SGER..KGSI
C4GMG1_9NEIS/44-136-----------------------------------------------------------FTG.VIAI...SGKN..QGVV
B3E1X0_GEOLS/45-149-----------------------------------------------------------VTG.IIGV...AGDR..VGYI
A4BED7_9GAMM/23-121-----------------------------------------------------------VSG.FIHL...NGLN.HKGSL
Q67P65_SYMTH/42-138-----------------------------------------------------------VTV.LIGV...VGRV..QGLV
Q01VJ9_SOLUE/45-142-----------------------------------------------------------VVS.FIGI...AGTW..AGTG
A0L9J3_MAGSM/47-145-----------------------------------------------------------ATA.LVGF...GGSV..KGGV
Q1QDT2_PSYCK/44-136-----------------------------------------------------------YSG.MIKI...SGPL..EGCV
Q1QDT3_PSYCK/43-135-----------------------------------------------------------YTG.VIGI...SGVQ..KGVV
A1AQJ7_PELPD/45-151-----------------------------------------------------------VTG.IVGI...AGDR..VGYI
Q6MIQ0_BDEBA/198-294-----------------------------------------------------------VSS.VVEI...KSQA.FQGHL
B5EFK5_GEOBB/45-152-----------------------------------------------------------VVG.IVGV...AGDR..VGYI
Q74GW2_GEOSL/55-154-----------------------------------------------------------ISG.MVGL...GGDF..SGMV
Q39Z94_GEOMG/55-154-----------------------------------------------------------ISG.MVGL...GGDC..TGMV
B2A030_OPITP/53-154-----------------------------------------------------------ILA.SVGF...IGAV..DGLI
B9L9J7_NAUPA/350-446-----------------------------------------------------------VTS.SLGF...YGDI..DGMV
Q0AX00_SYNWW/42-141-----------------------------------------------------------FTV.IIGF...TGGW..KGRF
Q3A8N0_PELCD/39-136-----------------------------------------------------------LSG.MIGL...AGDL..QGTL
Q74BI2_GEOSL/45-154-----------------------------------------------------------VVG.IVGV...AGDR..VGYI
B2TA19_BURPP/172-277-----------------------------------------------------------VFS.LIPL...ESAW.CRGYM
A0L8I4_MAGSM/41-138-----------------------------------------------------------ICA.VVGY...NQGL..EGSV
B5JMF4_9BACT/60-161-----------------------------------------------------------IAG.TVGF...IGNL..TGII
A6D9Z4_9PROT/349-445-----------------------------------------------------------IAS.SIGF...YGDL..DGVL
A0L8I3_MAGSM/42-139-----------------------------------------------------------YSA.VLGY...SGNL..RGSF
C3XNC2_9HELI/355-452-----------------------------------------------------------IMGAMIEF...EGDV..NGLV
Q1NQE4_9DELT/4-109-----------------------------------------------------------VSG.VITI...QAVG.LRGCL
Q127V6_POLSJ/52-143-----------------------------------------------------------FNG.LVTF...SGSH..NGHV
C5AC57_BURGB/173-274-----------------------------------------------------------VFS.LIAL...ESAW.CRGYM
A3DI29_CLOTH/43-141-----------------------------------------------------------VAC.VVNF...FGRI..KGKF
C6WXU1_METML/45-137-----------------------------------------------------------YTG.KIKV...SDGY..EGAL
Q1IMH8_KORVE/73-170-----------------------------------------------------------VTA.VVGI...AGEV..CGVL
B1ZR59_OPITP/59-160-----------------------------------------------------------VVG.TVGF...IGDA..NGLI
C9LVN2_9FIRM/180-280-----------------------------------------------------------IAV.IIGL...TGSP..MGRA
A9ALI9_BURM1/172-272-----------------------------------------------------------VFS.LIAL...ESAW.CRGYM
B5JQU3_9BACT/59-157-----------------------------------------------------------FAS.SVGF...AGEI..NGVC
B6BKX4_9PROT/356-452-----------------------------------------------------------IAS.SIGY...YGDM..DGMV
Q7MSR1_WOLSU/362-458-----------------------------------------------------------MGA.VISF...EGDI..SGML
A5GA23_GEOUR/174-273-----------------------------------------------------------IVA.AMDF...RGDI..NAHY
D5W843_BURSC/173-280-----------------------------------------------------------VFS.LIPL...EGTW.CRGYM
D2QZ65_PIRSD/52-150-----------------------------------------------------------VTG.LIGV...HGRV..SGFI
A4A0V0_9PLAN/54-152-----------------------------------------------------------VTG.IIGV...HGKV..SGFI
B9MMK6_ANATD/43-139-----------------------------------------------------------VVG.VLGI...MGEV..KGRV
C9Y7X5_9BURK/170-273-----------------------------------------------------------VST.IIPI...ESTW.CRGYM
D1B8E2_THEAS/46-146-----------------------------------------------------------VAA.LIGV...VGPS.VHGTV
D3KZT9_9BACT/47-147-----------------------------------------------------------AAA.LIGF...VTST.VNGTI
F0Q6I3_ACIAP/177-280-----------------------------------------------------------MFT.LIPM...ETPW.CRGFM
A0LDM6_MAGSM/43-140-----------------------------------------------------------VGG.LIRL...LGEN.EEGLV
B6BKU2_9PROT/237-335-----------------------------------------------------------ICA.VMHF...KGDL..EGFF
Q1IRG8_KORVE/48-143-----------------------------------------------------------IGA.CVQL...VGAW..EGAV
D1AZS0_SULD5/240-338-----------------------------------------------------------IIA.AMKF...KGDI..SGIF
A6C8I3_9PLAN/29-124-----------------------------------------------------------RSS.AIEV...NGPG..KGIV
Q39V86_GEOMG/174-272-----------------------------------------------------------VYA.TMDF...TGDI..SGRY
D2QXT3_PIRSD/39-134-----------------------------------------------------------LSG.CIQL...AGAW..QGAV
D2Z884_9BACT/46-146-----------------------------------------------------------CAS.LIGI...VGDG.IQGTI
C0Q915_DESAH/44-135-----------------------------------------------------------LAC.RLAF...TGDA..SGSL
D9SQS9_CLOC7/42-145-----------------------------------------------------------VGI.IIDL...FGGSTIHGKV
Q2W5X5_MAGSA/49-148-----------------------------------------------------------VTA.VVCT...DGPV..KLLI
E6M522_9ACTO/42-134-----------------------------------------------------------IYA.WIES...QGDK..QLRV
D6SK17_9DELT/49-148-----------------------------------------------------------LTS.LISV...NSSI..NMFF
Q2W334_MAGSA/49-148-----------------------------------------------------------VST.IVGT...AGPV..NLLI
Q0B010_SYNWW/905-1003-----------------------------------------------------------ITA.FITI...KGVV..RSYF
A8ZWB5_DESOH/47-151-----------------------------------------------------------YAV.AAPT...RGKI..NGVI
C1F3H6_ACIC5/53-147-----------------------------------------------------------MGA.RVAF...RGSP..SGQV
Q04RD4_LEPBJ/48-147-----------------------------------------------------------NCT.MVEF...KGEI..EGKL
B8FJT5_DESAA/44-137-----------------------------------------------------------YIA.NVGL...KNGG...LEV
Q2W3Y4_MAGSA/49-148-----------------------------------------------------------MTV.IAGL...GGPI..SLLI
C4Z452_EUBE2/81-174-----------------------------------------------------------FIG.CQIM...DGDI..DVFL
D6Z498_DESAT/44-140-----------------------------------------------------------IQA.NIAY...HGPE..SGSF
Q7MRT3_WOLSU/32-126-----------------------------------------------------------FIS.SIEI...LSSG.ERIPV
D4JQX1_9FIRM/184-279-----------------------------------------------------------TAV.IQEF...CGDF..NAVS
Q15PK9_PSEA6/48-152-----------------------------------------------------------YAV.CSEV...TGNL..DGVI
Q30Q99_SULDN/706-805-----------------------------------------------------------SYA.QIDL...YDTF..DGNV
A9EPA4_SORC5/41-133-----------------------------------------------------------PVS.TVEF...SAPG.FSGLL
B0TBE4_HELMI/187-279-----------------------------------------------------------RLV.FTTM...NGSY..DLFM

PF04509

P70872_BACCE/68-105--------------------------------------------------------------------------------
FLIY_BACSU/36-73--------------------------------------------------------------------------------
Q9HQW8_HALSA/277-314--------------------------------------------------------------------------------
O58223_PYRHO/115-152--------------------------------------------------------------------------------
Q97LH5_CLOAB/84-120--------------------------------------------------------------------------------
Q97LH6_CLOAB/210-248--------------------------------------------------------------------------------
O58224_PYRHO/106-143--------------------------------------------------------------------------------
CHEC_BACSU/10-47--------------------------------------------------------------------------------
O51614_BORBU/89-125--------------------------------------------------------------------------------
Q9KA56_BACHD/110-147--------------------------------------------------------------------------------
CHEC_BACSU/111-148--------------------------------------------------------------------------------
Q9L3K8_BACCE/245-282--------------------------------------------------------------------------------
Q97H00_CLOAB/41-78--------------------------------------------------------------------------------
Q9KA56_BACHD/10-47--------------------------------------------------------------------------------
Q97GZ6_CLOAB/104-141--------------------------------------------------------------------------------
O58223_PYRHO/18-55--------------------------------------------------------------------------------
Q9RPJ0_9FIRM/59-95--------------------------------------------------------------------------------
Q9KA45_BACHD/146-183--------------------------------------------------------------------------------
O29223_ARCFU/109-146--------------------------------------------------------------------------------
Q9L3K8_BACCE/25-62--------------------------------------------------------------------------------
CHEX_THEMA/84-120--------------------------------------------------------------------------------
Q97GZ6_CLOAB/9-46--------------------------------------------------------------------------------
Q9KDX3_BACHD/84-120--------------------------------------------------------------------------------
Q9HPJ6_HALSA/103-140--------------------------------------------------------------------------------
CHEC_THEMA/105-142--------------------------------------------------------------------------------
O85749_TREDN/83-119--------------------------------------------------------------------------------
O58224_PYRHO/6-43--------------------------------------------------------------------------------
Q48298_HALSI/105-142--------------------------------------------------------------------------------
Q97H00_CLOAB/138-175--------------------------------------------------------------------------------
Q9KUY1_VIBCH/84-120--------------------------------------------------------------------------------
O29223_ARCFU/13-50--------------------------------------------------------------------------------
FLIY_BACSU/133-170--------------------------------------------------------------------------------
Q9HQW8_HALSA/90-127--------------------------------------------------------------------------------

PF11813

E6XJW4_SHEP2/1-240----------MTTDTIVTSDDILLKLCHSVAHVLSSTSASHVSHAGMVQSIARTRLKPDLGC-FSIF---DGGF--SGLV
D7HKC4_VIBCL/5-231----------MKKNQIVTTEDILLMLCQSVSTVLTSATNSPIHYSAMVQKINKTSLKPDFGC-FVLF---DGGF--TGLV
Q5E4M5_VIBF1/5-229----------IRKSKIITTDDILLTLCRSMSGVLSKATQSSVTYSAMVQKITKTSLKPDFGC-FVLF---DGGF--SGLV
Q1ZGW0_9GAMM/1-226----------MAKTKTVTTDDVLLLLCNSVKSVLGKATNHPIHYSSMVQKINKTGLKPDIGC-FVLF---DGGF--SGLV
A8H431_SHEPA/1-234----------MQSTVSVTTDDILLKLCHSVSHVLFSTTHSQVSHAGMVQSITRTCLKPDLGC-FSIF---DGGF--SGLV
A1W514_ACISJ/4-228----------PSTSVVYGTEDVLVSLCNSVTRVLSVATQGPVHYSGMVQRITKTCLKPDIGC-FVLF---DGGF--SGLV
Q47BE9_DECAR/19-242----------HETPAVFGTEDILRSLCNSVTKVLTIATQSNIHYSGMVQRITKTCLKPDIGC-FVLF---DGGF--SGLV
A1WIM9_VEREI/4-227----------AEKATVYGTEDLLISLCSSVTRVLNVATHSQVHYSGMVQRIGRTCLKPDIGC-FVLF---DGGF--SGLV
Q3IIQ5_PSEHT/1-229----------MSKSKVISTDDILATLCHSVTGVLTSASGNSVSYSAMVQKITRTCMRPDIGC-FVLF---DGGF--TGLV
B1KDT0_SHEWM/29-261----------NKTSKIVKSDDILLKLCGSVANVLSQTTDSQVSHAAMVQSITRTSLKPDLGC-FSIF---DGGF--SGLV
Q1ZR43_PHOAS/1-226----------MRKLKTVTTDDILLKLCQSLSDVLSKATETDVSYSAMVQKINKTSLKPDIGC-FVLF---DGGF--TGLV
Q12N73_SHEDO/1-263----------MNSAQIVTTDDILLKLCHSVSHVLSSTSASQVTHAGMVQTINRTRLKPDLGC-FSIF---DGGF--SGLV
A4SR42_AERS4/6-232----------ADNDAVLTTEDVLLSLCHSVTGVLSAATQSQVRFSGMVQRISKTCLKPDIGC-FVLF---DGGF--SGLV
A1S654_SHEAM/1-228----------MSVTQIVTSEDILLKLCHSVSHVLSHTSGSRVTHAAMVQNISSTRLKPDLGC-FSIF---DGGF--SGLV
Q1Z1W0_PHOPR/1-224----------MKKNKIITTDDILLKLCQSISSVLSTATDSQINYSAMVQKINKTSLKPDIGC-FVLF---DGGF--TGLV
A1TSY3_ACIAC/28-254----------DKIAPTYGTEDLLISLCNSVTRVLSVATQTQLHYSGMVQRISKTCLRPDIGC-FVLF---DGGF--SGLV
A6CZL8_9VIBR/1-224----------MKKTKVITTEDILLKLCQSVSTVLTSATQSSVTYSAMVQKITKTTLKPDFGC-FVLF---DGGF--SGLV
A1K8E1_AZOSB/6-235----------HTHPVVFGTEDILRSLCDSVAKVLTVATGSRIHYASMVQRIHKTCLKPDIGC-FVLF---DGGF--SGLV
Q083E4_SHEFN/1-236----------MNSSSTVKNDDILLKLCHSVSHVLSSTSASHVSHAGMVQSISRTRLKPDLAC-FSIF---DGGF--SGLV

PF02154

FLIM_CAUCR/77-270RAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPGILAV---FRAEELDNYG
FLIM_TREPA/39-229YDFRRPDKFSKEQMRTLSLMHETFARLTTTSLSAQLRSMVHVHVASVDQLTYEEFIRSIPTPSTLAV---ITMDPLKGNA
FLIM_BORBU/49-240YDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAI---INMDPLKGSA
FLIM_ECOLI/38-231YDPNTQRRVVRERLQALEIINERFARHFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNL---IHLKPLRGTG
FLIM_BACSU/40-230YDFKRALRFSKDQIRSLTRIHDNFARLLTTHFSAQLRTYIHISVSSVDQVPYEEFIRSIPNMTILNL---FDVHPMEGRI
Q9Z6G1_VIBPA/37-229FDFSSQDRIVRGRMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNM---VRFRPLKGTA
O25675_HELPY/40-230YDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNV---FSMKPMGGTG

PF13690

C0QAL2_DESAH/42-139SVTFQGDCILNI......V...S.N...M..FG....EK....M...ES...LNS..EIADAVGELTNMISGQAR.....
Q2LSM0_SYNAS/58-155GLSFSEACIVRI......V...SNM...L...G....ES....L...TG...IDN..DVKDAVGEITNMISGVAR.....
E6VZI0_DESAO/42-139SLSFSRGCAVAI......V...KNM...L...G....EE....I...DD...IMQ..DVRDAVGELTNMISGQARA...G
C6BS03_DESAD/42-139SISFTKNCAVTI......V...K.N...M..LG....DD....V...QD...IVQ..DVQDAVGEITNMVSGQARA...G
D2R467_PIRSD/42-137VLSLDKKVALAA......A...S.V..LL...M...CEA....E...EI....NA..DVVDAVGELTNMVAGGAK.....
D6SSH8_9DELT/45-145SVTFSEASALGI......V...GSM...L...G....EE....Y...PE...VND..EVKDAVGEMTNMICGQAR.....
C4XHM1_DESMR/45-142ALSFTKKCAIFI......L...K.N...M..LG....DD....I...QD...IVQ..DIKETVGELTNMISGQSRA...N
D3PAK0_DEFDS/42-139VVSFPESLALKV......V...S.K..FI...G....EE....K...VD...IDD..DVIDAVGELINMIAGGAKK...I
D6SK93_9DELT/45-145SVSFTQSSVLGI......I...NNM...L...G....EN....Y...KE...VTN..EVTDAVGELTNMISGQARK...G
D3PEX7_DEFDS/42-139VISFPESLALKV......V...S.K..FM...G....IQ....K...LQ...ADD..DVVDAVGEIVNMIAGGAKK...I
Q2LXN3_SYNAS/42-139AISFSEDCICGI......V...GSM...L...G....ET....C...SE...TTK..EVLDAAGELTNMISGVAR.....
C7LN70_DESBD/42-139CISFDKNTAVHI......V...RHM...L...G....DA....I...ED...VVQ..DVQDAMGEITNMISGHARV...G
A5EYB3_DICNV/38-130YFTAPKVLLRHI......L...L.S...I...G....EN....D...NN....ES..SMLDLVGEIANTISGNAR.....
C7LNA5_DESBD/45-145SLTFTTASALGI......V...SAM...L...Y....EE....Q...SE...IND..VVTDAVGELTNMISGQAR.....
A1AUJ2_PELPD/55-152SIHCPVSLALRI......T...SSM...L...G....ME...CD...EV....NE..DLNDAIGEIANMLGGSVKQ...V
Q3A5A2_PELCD/40-137AIHVPNAVAMSI......T...S.K..FL..FM....EI....E...EI....DD..DVKDAIGELANMLAGSVKS...M
Q1JZV2_DESAC/40-137AIHTPDNVAKAI......T...S.S..FL...G....MD....V...DE...IND..DVTDAIGELANMLAGNIK.....
B5EEQ0_GEOBB/56-153SIHCPQEFALRI......T...S.N...M..LG....MD....V...EE...VGE..DVNDALGEIANMLGGYVKQ...I
A3ZPG3_9PLAN/42-140VVNLSQSVAIQA......A...AAM...L...M....MD....P...SEFDGLND..DVVDAVGEIANMVAGAAK.....
Q1JZV3_DESAC/42-139TIHCPQEVAFAI......T...S.A..LL...G....MD....V...DE...VDA..DVKDTVGEMANMILGGIKD...G
B5EAE1_GEOBB/55-152AIHCPKKLALLV......T...S.N...M..LG....MD....V...TE...VDE..DVNDAMGEIANMVGGDVKH...I
B5JV55_9GAMM/45-138YFTAPANCLRDI......L...A.A...M...G....EL....N...GE....TE..NLMDLVGEVANTLSGNAR.....
C4GMG1_9NEIS/44-136YFTAPKELLERL......L...V.L...I...G....EK....D...TS....EA..LMVDLVGEVANTIAGNAR.....
B3E1X0_GEOLS/45-149IVAADRATAQLV......A...REM...L...M....DD....E...PD....ED..SIRDAIGELINNIAGAFK.....
A4BED7_9GAMM/23-121AISFSSKALLLI......Y...RNM...L...G....EP....L...ET...LDD..SALDLAGEITNMVCGGAK.....
Q67P65_SYMTH/42-138LYGMSEETGRKL......V...S.A...M..TG....EE....V...TV...FDD..MCESAVAELGNVITGLAS.....
Q01VJ9_SOLUE/45-142SLSCSPQMACRI......C...S.QL.LM...T....ES....S...AV....NE..DVLDAVAELTNMIIGSVK.....
A0L9J3_MAGSM/47-145HLSCPMYVAAAL......A...G.S..FA...G....ER....Y...EDL..TNP..EAADGFGELCNMVAGGLQ.....
Q1QDT2_PSYCK/44-136YVSAPSTMLREV......I...K.V...M...G....EP....D...SS....MT..MMKDLLGEMANTISGNAR.....
Q1QDT3_PSYCK/43-135YFTATTALLSSI......L...D.S...M...G....EI....D...KS....ED..NLVDLAGEVANTVSGNAR.....
A1AQJ7_PELPD/45-151IIATDKKSAQIV......A...K.E..LL...M....VD....E...AE....DE..CIRDAVGELANNIAGAFK.....
Q6MIQ0_BDEBA/198-294CISFDKGSFLEV......V...SSM...L...M....EE....Q...TE...LNK..DNQDAVGEINNIIFGNAK.....
B5EFK5_GEOBB/45-152LFATEKGSAEQI......A...K.E..LM...M....MD....E...AD....DE..SINDAVGEVVNNIAGVFK.....
Q74GW2_GEOSL/55-154GIHIPIEFAKEA......T..AS.M...L...G....ME...LD...ELE..GED..DIHDAVGEITNMLAGEIKM...L
Q39Z94_GEOMG/55-154GIHIPEELAREA......T..AS.M...L..GM....EM....D...EIE..GDG..DVHDAMGELTNMLAGEVKM...I
B2A030_OPITP/53-154YLCLSDGYAKTI......S...S.S..LL...GMSLAEV....E...EA...GHE..VVNDALGEITNMTVGGFK.....
B9L9J7_NAUPA/350-446VLIFSEKLTKNI......S...R.I..LL...G....EE....A...KT....KE..ELHDIVAEFANIIVGNTK.....
Q0AX00_SYNWW/42-141FLDMGGETAMHV......A...S.T...L..TG....ES....Y...STF..AEE..EVLLSGAELGNIISGNAI.....
Q3A8N0_PELCD/39-136LIHLPDQAAIAI......T...N.A..FL...G....ME....L...SA...VDD..DVKDAVGELANMVAGGIKY...L
Q74BI2_GEOSL/45-154ILAAESTAAVTI......A...K.E..LL...M....LD....E...PD....EE..SIRDAIGELTNNIAGVFK.....
B2TA19_BURPP/172-277MMQAEETPILEL......LDRYQ.M...I...G....SE....R...HGE.ADFR..DLNSVLGEVTNLIWGSFK.....
A0L8I4_MAGSM/41-138RLSAPTAGALKV......A...G.A..LL...G....EE....R...DS...MDA..EMQDGFGEMANMVAGGIQ.....
B5JMF4_9BACT/60-161YIFMELPLAMEA......T...C.K..LL..DM....ED...GDIGSED....HE..LVNDAIGELTNMIVGTFK.....
A6D9Z4_9PROT/349-445ILIFSENLSKNI......S...K.I...L..IG....EE....F...KT....KE..ELVDMIGEFANIIVGNVKL...E
A0L8I3_MAGSM/42-139ALSAGEAGAMVL......A...S.A..LL...G....EE....R...SQ...MDD..EMEDAFCEMANMMAGGMQ.....
C3XNC2_9HELI/355-452ALCFSKAIVKEA......S...M.M..LL...G....EE....S...QS....DE..ELLDVICEFTNIIAGRSKA...V
Q1NQE4_9DELT/4-109VVGFSNSLILRA......V...A.N...M..FG....EK....M...RDV..VDD..EVVDAAGELTNIICGNYK.....
Q127V6_POLSJ/52-143IVSMPAKLVREI......L...L.L...Q...H....ET....D...LS....DS..NLLDAVGEIANTLAGNAR.....
C5AC57_BURGB/173-274MMQTDEQPMLDF......V...A.A...MH.PD....ER....A...PD....FR..DLNGVLGELTNLVWGAFKDRFLG
A3DI29_CLOTH/43-141LIDMERDLAFAL......A...K.N...I..KG....EDF..DP...ED....EP..MVLKPFQTLSKIIVNKAI.....
C6WXU1_METML/45-137YFSAPSAMLRHL......L...T.V...M...K....ET....N...QS....EE..NLLDVVGEIANTISGNAR.....
Q1IMH8_KORVE/73-170NFACDSCAARKI......A...ARM...L...G....ID....E...AE...AGD..QQFDAIGEICNMIAGNFK.....
B1ZR59_OPITP/59-160YLYLDLAFARLC......T..CH.LL.GM...T....EAE..LN...EA...GDE..VINDAIGEITNMTVGSFK.....
C9LVN2_9FIRM/180-280VVHMDTDTMRRF......A..LR.M...L..AM....DE....H...DDI..EED..EINDSVEEAANIIVGRGV.....
A9ALI9_BURM1/172-272LLQTSEQPLLDM......I...G.S...V..HR....ER....A...PD....FR..DVNGVLGELTNLVWGAFK.....
B5JQU3_9BACT/59-157YLFMTEKFAVRG......A...T.K...I..TG....LD....L...EDL..DDD..VIRDVCGELTNMFAGTFK.....
B6BKX4_9PROT/356-452VLVFPKEIAKKA......C...E.L...L..IG....EK....T...DD....EE..MILDTLAELVNIVGGKIK.....
Q7MSR1_WOLSU/362-458ALAFNQAIAKEA......A...L.M...M..LG....EE....A...NS....ST..ELLDVVSEFTNIIAGRSK.....
A5GA23_GEOUR/174-273LLSVSFAVQKKI......A...L.A..IL...K....EET..VE...NE...PQE..VLDDAVMELVNIICGNIA.....
D5W843_BURSC/173-280LMQAEEEPLLGMIERDRAA...R.D...A...G....RG...TT...QA...GFR..DLNNVLGELTNLIWGAFK.....
D2QZ65_PIRSD/52-150TVAMAERVAIHT......V...E.G..LL...Q....DR....Y...GA...LTP..QVVDGAGEITNIIVGGIK.....
A4A0V0_9PLAN/54-152TVNMSERLVIKA......V...E.G..LL...Q....DE....F...GK...LTS..QVVDGAGELTNIICGGIK.....
B9MMK6_ANATD/43-139IIGIDFKLSTYF......V...K.M...V...Y....DQ....D..IVT....NS..DILDVAYEIFNMIVGNTLVE..Y
C9Y7X5_9BURK/170-273MLQTEESALRQG......M...L.K..GF..SY....EGV..GG...EL...NFR..DLNNMLGETTNLIWGAFK.....
D1B8E2_THEAS/46-146ALMADMAGFSAY......V...K.A...M..TGG.MIEA....N...PE....DP..MSMSVIGELTNMTSGQAL.....
D3KZT9_9BACT/47-147GLLADEQAFSEI......V...T.T...M..SG....GA...VN...PDF..NDP..LAMSAFGELTNMISGQAF.....
F0Q6I3_ACIAP/177-280TLQTDAESLRRV......V...S.AGHTVF.SA....ED....G...AD....FR..NLNALLGELTNLIWGGFR.....
A0LDM6_MAGSM/43-140GISCNKRIASEL......V...S.R..IV...G....LS....V...DEL..LAE..DLIDGVAELTNMICGGMK.....
B6BKU2_9PROT/237-335TLVFPKDIAIIA......L...E.S..LL...G....ET....V...EEN..DLE..TLNDGVGEFCNIITGATK.....
Q1IRG8_KORVE/48-143RLDCSTGLAQLA......A...R.R..FL...A....KT....P...EDL..TID..DLRDTVGELTNMVAGSVK.....
D1AZS0_SULD5/240-338FLIFPKDLALIS......L...EAM...L...G....EP...VD...EE...DNA..AIVDGVAEFCNIITGAAKV...I
A6C8I3_9PLAN/29-124VVNLPRELVSRA......V...S.V...L..ID....EE....L...AD...DEH..VLTDFACELSNMIAGQAK.....
Q39V86_GEOMG/174-272FMGVTAATQKKI......A...K.A..IL...K....EPN..VD...NE...PKE..ILDDTVMEFVNVALGNIAA...K
D2QXT3_PIRSD/39-134ILDCSDEFAAQA......A...A.A...M..FG....LA....P...DAV..EPQ..DKIDTVAELVNMLGGNIK.....
D2Z884_9BACT/46-146VIMLDEGGFVST......V...T.A...M..SG....GMI..QP...NL...EDS..IAMSVVGELSNMVSGRAL.....
C0Q915_DESAH/44-135ILMAPEILMAEM......A...G.N..FM...G....EP....S...ENL..SED..HISGTLTEMLNMVCGNAL.....
D9SQS9_CLOC7/42-145IITMDKEIAQKI......I...G.F..LM..EG....ST....V...EE...IDQ..DAASALGEYANWITASAA.....
Q2W5X5_MAGSA/49-148AFSFQRVLLEHL......R...E.V...M...T....ADLNVLP...SE...REL..FLRETAGETVNFILGHAT.....
E6M522_9ACTO/42-134MLAMEDSTAKDL......T...RAM..YL..LG....ET....D...EV...TEE..DQRDAFGEIVNVIGGNMK.....
D6SK17_9DELT/49-148AFSFEKDLIFSI......L...R.Q...MT.QG....LDY..PE...EE...TPD..YLESAATEMLNIVVGNTAE...F
Q2W334_MAGSA/49-148AFSFAPPLLEHLLD..LVA...A.E...I...G....LD....D...RE...RPQ..FLLETAAETVNFIMGHAT.....
Q0B010_SYNWW/905-1003ILSVDEELGRYL......V...Q.A...M..TM....DE...IE...SGT..EED..FVEDVLAECANMILGNSI.....
A8ZWB5_DESOH/47-151LLHKYIETALTIGN.RLRH...H.M...LSEID....EH....E...EI....NE..EMQVALAEWGNTIIGNATR...F
C1F3H6_ACIC5/53-147RLCLSEASAQLL......A...AGF...L...G....ED....E...ESL..SPE..QTGLVVCELANMLCGSLL.....
Q04RD4_LEPBJ/48-147FLAMDGYTKLKL......L...P.M...V...A....KSF.HID...PT...IRA..DAPSILMEFANQICGLLI.....
B8FJT5_DESAA/44-137TIAGSAGLCEKI......A...S.A...M..FG....ED....R...EL...TQK..DVEDVFREAANIIMGNLI.....
Q2W3Y4_MAGSA/49-148AFSFEASLVQAL......Y...S.R...V...T....ADI.EVP...PG....EEDLYRRETAGEIVNTILGLCTI...D
C4Z452_EUBE2/81-174GIAGNDKELLKV......A...S.T...F..AQ....ED....I...KE...FDA..DAYDALCEFINVINGAYA.....
D6Z498_DESAT/44-140TLCLPRRLARNI......T...M.N..FL...G....VD....E...GEV..SEA..QMLDTAKETANMAVGSLL.....
Q7MRT3_WOLSU/32-126FLIIRPLLLQAL......A...N.R..LL...G....EK....E...PD....EA..TLIDLANELSNLVVGVAKV...I
D4JQX1_9FIRM/184-279AITADNKAAAVF......A...S.R...F...A....EE....E..ITD....MD..YANDAISEFLNLSNGLYNVN..I
Q15PK9_PSEA6/48-152MMHHYPETAISIGN..SVC...Q.S...M..FD....EK...YD...HQE..MTD..DLRNALAEWGNTIVGRSTD...L
Q30Q99_SULDN/706-805IMLFSDEIIEFM......S...S.A...LI.PK....NF....D...KTD..IAW..MSKELPSEVLNTIVGLSL.....
A9EPA4_SORC5/41-133ALSAHPGVFR..............A...M...T....GL....P...PA....LD..SVDDWMREVVNQLMGKVK.....
B0TBE4_HELMI/187-279GLAGEQDVIEQF......A...L.R...F...S....EG....L...GI...DDI..EMQDSLGEFLNVTCGLFL.....

PF04509

P70872_BACCE/68-105---------------------------------------------------------LELSAVQEAMNQMMGFAA-----
FLIY_BACSU/36-73---------------------------------------------------------MERDAIGEIGNISFGSSA-----
Q9HQW8_HALSA/277-314---------------------------------------------------------MAESAVSELGNITASGFI-----
O58223_PYRHO/115-152---------------------------------------------------------MVKSSFMEVGNILISAFA-----
Q97LH5_CLOAB/84-120---------------------------------------------------------MAQSAVSELTNMLTANAA-----
Q97LH6_CLOAB/210-248---------------------------------------------------------EILNVVAEFANIVGGNAC-----
O58224_PYRHO/106-143---------------------------------------------------------MGKSAIMEVGNILISVYT-----
CHEC_BACSU/10-47---------------------------------------------------------EQMDILREVGNIGAGHSA-----
O51614_BORBU/89-125---------------------------------------------------------MVAATLTEVGNIIAGNFV-----
Q9KA56_BACHD/110-147---------------------------------------------------------LSMSALKELGNILAGSYL-----
CHEC_BACSU/111-148---------------------------------------------------------MSSSALHELGNILAGSYL-----
Q9L3K8_BACCE/245-282---------------------------------------------------------EEKDVLGEIANISIGSAS-----
Q97H00_CLOAB/41-78---------------------------------------------------------IEKDLLGEIGNISMGSAS-----
Q9KA56_BACHD/10-47---------------------------------------------------------FHLDILKEIGNIGAGNAA-----
Q97GZ6_CLOAB/104-141---------------------------------------------------------LSSSVLCEIGNIISSSYM-----
O58223_PYRHO/18-55---------------------------------------------------------MSKSALLETFNIGASHAA-----
Q9RPJ0_9FIRM/59-95---------------------------------------------------------FVKSALGEIANIISGNAM-----
Q9KA45_BACHD/146-183---------------------------------------------------------MHISAVQEAMNQMMGSAS-----
O29223_ARCFU/109-146---------------------------------------------------------MVDSTLMEIGNILSSSFC-----
Q9L3K8_BACCE/25-62---------------------------------------------------------QECDILGEIANISFGSAS-----
CHEX_THEMA/84-120---------------------------------------------------------LALSAIGELGNMTAGKLA-----
Q97GZ6_CLOAB/9-46---------------------------------------------------------MQLDAIKEVVNIGSGNAA-----
Q9KDX3_BACHD/84-120---------------------------------------------------------IGWSAVQEFGNWVAGNTA-----
Q9HPJ6_HALSA/103-140---------------------------------------------------------MQESALKELMNILASGFL-----
CHEC_THEMA/105-142---------------------------------------------------------FSASALREIGNIMCGTYV-----
O85749_TREDN/83-119---------------------------------------------------------LARATITELANLITAQAV-----
O58224_PYRHO/6-43---------------------------------------------------------LYKDIFKEASNIAMSHAL-----
Q48298_HALSI/105-142---------------------------------------------------------MERSAIREVGNIMTSGFI-----
Q97H00_CLOAB/138-175---------------------------------------------------------IELSAVSEAMNQMIGSAA-----
Q9KUY1_VIBCH/84-120---------------------------------------------------------EVTDMVGEITNMVTGGAK-----
O29223_ARCFU/13-50---------------------------------------------------------MELDALKELGNIGVGKAA-----
FLIY_BACSU/133-170---------------------------------------------------------IHLSAVQEAMNQMMGSAA-----
Q9HQW8_HALSA/90-127---------------------------------------------------------VGAAALPEVANILTSGFV-----

PF11813

E6XJW4_SHEP2/1-240VINFSASAAIEI------------YRRYMLNMG----MP----E---SELAFSHTSDEVGNVMGELMNQILGDFI-----
D7HKC4_VIBCL/5-231VINFTAKAALEV------------YTNYMRNMG----MP----E---EELAVLHTSDEVGDVLGELMNQLVGDFT-----
Q5E4M5_VIBF1/5-229VTNFTKDAALEL------------YTKYMRNMG----MP----A---EELAILHTSDEVGDVLGELMNQIVGDFT-----
Q1ZGW0_9GAMM/1-226ILNFSAASALEI------------YQNYMLHMG----IP----E---NELAQSHTSDEVSDVMGELMNQMIGYFT-----
A8H431_SHEPA/1-234VINFSAPAAIEI------------YREYMLNMG----MP----E---SELAFSHTSDEVGNVMGELMNQILGDFI-----
A1W514_ACISJ/4-228IINFSAAAAMEI------------YERYMLSMG----MS----A---QELASSFTSDEVSNVMGELMNQVVGDFT-----
Q47BE9_DECAR/19-242VINFSAQAAMEL------------YESYMLHMG----MA----K---NELASSHTADEVSNVMGELMNQIVGDFT-----
A1WIM9_VEREI/4-227ILNFSAQAAMEL------------YANYLLNMG----MS----K---DDLASSYTSDEVSNVMGELMNQVVGDFT-----
Q3IIQ5_PSEHT/1-229ITNFTSQAAMEI------------YGDYMRNMG----MP----E---EEIAHSHLSDDVSNVLGELMNQIVGDFT-----
B1KDT0_SHEWM/29-261VINFSADAALEV------------YRGYMTHMG----MP----E---TEFAISHTSDEVGDVMGELMNQILGDFI-----
Q1ZR43_PHOAS/1-226VTNFTSQAAMEL------------YKEYMQRMG----IS----E---DELAVHHTSDEVANILGELMNQVVGDFT-----
Q12N73_SHEDO/1-263IINFSAEAAIEI------------YRRYMINMG----MP----E---TELAFTHTSDDVGNVMGELMNQILGDFI-----
A4SR42_AERS4/6-232VINFSASAAMEL------------YESYMLSMG----LS----K---EDLAISHTSDEVSNVMGELMNQIVGSFT-----
A1S654_SHEAM/1-228VINFSAASAVEI------------YRRYMLNMG----MP----E---SDLAFSHNSDEVGNVMGELMNQILGDFI-----
Q1Z1W0_PHOPR/1-224VSNFTQQAALEI------------YQAYMLKMG----IP----H---EDLAIHHTSDEVADVLGELINQTVGDFT-----
A1TSY3_ACIAC/28-254IINLTKEAAMEI------------YQSYLLSMG----MS----Q---DDLASSYTSDEVANVMGELMNQVVGDFT-----
A6CZL8_9VIBR/1-224VINFTSQAALEV------------YSNYMRHMG----MP----E---EELAIHHNADEVGDVLGELMNQLVGDFT-----
A1K8E1_AZOSB/6-235VINFSAAAAMEL------------YEQYMLNMG----MG----R---EGLATAFTSDEVGNVMGELMNQSVGDFT-----
Q083E4_SHEFN/1-236VINFSAAAAIEI------------YRRYMLNMG----MP----E---TELAFSHTSDDVSNVMGELMNQILGDFI-----

PF02154

FLIM_CAUCR/77-270LLTVDSNLIYSI------------VDVLLGGRRGTAAMR--------IEGRPYTT--IERVLVQRMIDVVLHDLKSAFEP
FLIM_TREPA/39-229VLEVDPSITFSI------------IDRLFGGTGQAAK..--------.VQRDLTD--IENSVMEGVIVRILANVRESWTQ
FLIM_BORBU/49-240IFEVDPTIAFAI------------VDRLFGGDGDTIKD.--------.KSRDLTE--IEQSVMESVIIRILANMREAWSQ
FLIM_ECOLI/38-231LVVFSPSLVFIA------------VDNLFGGDGRFPTK.--------VEGREFTH--TEQRVINRMLKLALEGYSDAWKA
FLIM_BACSU/40-230MMEVNPTIAYTM------------MDRVMGGIGISHN..--------.KVDSLTE--IETKIISNLFENALGNYKEAWQS
Q9Z6G1_VIBPA/37-229LITMEARLVFIL------------VENFFGGDGRFHAK.--------IEGREFTP--TERRIIQLLLKIVFEDYKEAWSP
O25675_HELPY/40-230VLEINPSIAFPM------------IDRLLGGKGSAYD..--------.QNREFSD--IELNLLDTILRQVMQILKEVWSP

PF13690

C0QAL2_DESAH/42-139.KELE.....DTGK.....I....FKA.AIPSVITGKN.HSI..SHY.............TN.GP.RIAIPFF-------
Q2LSM0_SYNAS/58-155.KKLE.....SEGF.....S....ITA.AIPTVVAGKS.HSI..VHV.............LG.GP.SIIIPFE-------
E6VZI0_DESAO/42-139LAER........GY.....V....FQG.STPTVIMGDG.HTI..SHM.............AK.TP.IMAIPFT-------
C6BS03_DESAD/42-139LAEQ........GL.....S....FSG.ATPSVIMGDN.HTI..THI.............AN.TP.IMAIPFT-------
D2R467_PIRSD/42-137.AKL.......EEY.....Q....LSI.SLPSVVTGTG.HEI..RFP.............SN.VT.PICVPFN-------
D6SSH8_9DELT/45-145.KDLV.....EMDM.....I....FEA.GTPSVVTGKN.HTI..RHV.............SE.RA.ILAIPLD-------
C4XHM1_DESMR/45-142LSQM........GI.....N....LQA.SIPTIILGDN.HTI..EHM.............KQ.CT.IVTTPFN-------
D3PAK0_DEFDS/42-139FTDR........GL.....K....FKI.SIPNVITGKG.HKI..KRP.............SN.VP.CIAVFFE-------
D6SK93_9DELT/45-145LAEI........GM.....Q....FEG.AIPTVVTGKD.HSI..RHV.............SS.SA.ILAIPFD-------
D3PEX7_DEFDS/42-139FTDK........GL.....K....FKI.SIPNVVTGKN.HKI..SRP.............ST.IP.CVVIYFT-------
Q2LXN3_SYNAS/42-139.TNLE.....KMGL.....Q....VYA.AIPSVVFGKN.HTL..RHI.............LN.SP.SIVIPFS-------
C7LN70_DESBD/42-139MVSM........GL.....K....LQG.STPSVIMGDN.HSI..SYR.............AS.AQ.AIAIPFS-------
A5EYB3_DICNV/38-130.SEY........GE.....T....FMI.SVPMVIQGTP.GEI..YLP.............KD.AR.SYVIPIT-------
C7LNA5_DESBD/45-145.KGLV.....GMGM.....I....FEG.AIPSVITGAG.HII..RHV.............ST.SA.ILAIPFE-------
A1AUJ2_PELPD/55-152LSKG........GL.....D....VKL.SIPTVISGED.YTV..NSL.............SD.MD.CVVIPFK-------
Q3A5A2_PELCD/40-137LTET........GS.....G....LKL.AIPSAISGTE.YEV..ECL.............SD.AE.GVIVPFS-------
Q1JZV2_DESAC/40-137.MVLD.....GAGK.....D....VTL.SIPSCIHGDE.YSM..DCV.............AD.AD.WVVVPFT-------
B5EEQ0_GEOBB/56-153LSKG........GL.....D....INL.SIPTVISGED.YTV..NSM.............AD.SD.CVIIPFT-------
A3ZPG3_9PLAN/42-140.AEL.......EEF.....E....LSI.SLPNVVVGSP.PDI..RFP.............SE.VH.AIAIPFE-------
Q1JZV3_DESAC/42-139FTEH........GV.....E....INL.AVPTVLAGRS.YRV..SGM.............DD.AS.WTTVPFY-------
B5EAE1_GEOBB/55-152FSPK........GA.....D....INL.SIPTVIYGSD.YAL..ESI.............SS.SD.ALVIPFL-------
B5JV55_9GAMM/45-138.QEF........GE.....R....FLI.SVPTVVCSKDNHRI..QLP.............KD.TR.SYIIPIE-------
C4GMG1_9NEIS/44-136.SEF........GE.....E....FEI.SVPIVLRGAP.DEI..LLP.............RK.DR.SFVIPIT-------
B3E1X0_GEOLS/45-149.TKY........HDQ..YGN....VAM.GLPLVVSGQL.RTV..TEPPEEG.....ASMNVQ.CK.GVTIPFT-------
A4BED7_9GAMM/23-121.QRLA.....SKGY.....E....FDL.TQPTLLSGSP.HSI..EHT.............PA.GP.VVTLPLH-------
Q67P65_SYMTH/42-138.GELE.....AAGY.....P....CKI.APPSVVMGKG.TAI..ST..............LS.IK.RLVIPLE-------
Q01VJ9_SOLUE/45-142.TDL........ES.....QL.GPLGL.SIPTVVFGRN.FKT..RSA.............GK.TE.WMSVTFE-------
A0L9J3_MAGSM/47-145.TRL........GEK..YGE....IAL.TPPTVITGTS.YAM..QYS.............TK.LS.SIKQYFK-------
Q1QDT2_PSYCK/44-136.TEF........GA.....D....FII.SPPKIIEGVP.SIP..YLP.............KD.RQ.SYVTPFT-------
Q1QDT3_PSYCK/43-135.HEF........GP.....E....FHI.SVPFVFKGSP.QSI..ILP.............KS.GR.SFIIPVS-------
A1AQJ7_PELPD/45-151.TKY........HEQ..YGS....VAL.GLPLVISGQL.RAI..SEPPEENE...VTSINVQ.CK.GVTIPFR-------
Q6MIQ0_BDEBA/198-294.AEI.......SSY.....G....VQM.TVPKVLLGSG.QNV..PCA.............QG.SA.GMMIPFA-------
B5EFK5_GEOBB/45-152.TKY........HEQ..YGS....VAL.GLPLVLSGRL.RPI..TDPPEQAA..SDGSMVVQ.CK.GVTIPFT-------
Q74GW2_GEOSL/55-154FSAN........NL.....T....VGL.STPSIISGSD.YTV..EVV.............SS.GA.AVVVPFN-------
Q39Z94_GEOMG/55-154FSAR........GM.....S....VCL.STPSVISGRE.YSV..EVV.............SS.GA.AVVVPFD-------
B2A030_OPITP/53-154.NTLC.....DVGY.....P....CKL.TLPAIVRGEN.LTI..ANV.............KG.AT.RHIFYFD-------
B9L9J7_NAUPA/350-446.TEFA.....KHDV.....Q....INM.TLPKVFDDLE.SLK..SLV.............AE.KK.AIEVKFY-------
Q0AX00_SYNWW/42-141.TDINN...NNPGL.....N....LRL.TPPSVFTGEG.LTM...FN.............VR.LS.SCSVLLQ-------
Q3A8N0_PELCD/39-136MPEN........TR.....D....IAL.AIPSVVRGKG.YSC..EAT.............GR.FE.RAGVVFE-------
Q74BI2_GEOSL/45-154.TKY........HEQ..YGN....VAL.GLPLIVSGML.RTV..AEGTSQDQSGGSSSMNVQ.CK.GVTIPFM-------
B2TA19_BURPP/172-277.NRY.......VGDADAWTR....SQV.QVPLLVNHKH.KYI..SFG.............SG.NP.QLCFTYW-------
A0L8I4_MAGSM/41-138.SRL........EA.....DL.GAIGM.TPPMVVRGNN.YEV..DGA.............TG.FE.VVHQLFT-------
B5JMF4_9BACT/60-161.NDLS.....NKGY.....E....CRM.TIPSILRGSN.FSI..EPA.............EV.AL.RRIFKFD-------
A6D9Z4_9PROT/349-445LEKH........DI.....D....INL.TLPKVFENLK.ELK..NIV.............IN.KQ.GIEVKFY-------
A0L8I3_MAGSM/42-139.SRM........ESL..LGP....VKL.STPMVIQGAG.HKV..RSE.............KH.YA.CISQDFS-------
C3XNC2_9HELI/355-452LSEH........NV.....S....IGI.SLPNAYKSED.EIA..STL.............SG.KQ.GVQVNLL-------
Q1NQE4_9DELT/4-109.ARCNEVVCNGNTY.....R....FDL.VTPQIVRGKG.VPV..VTG.............CD.AEPVLCIPFT-------
Q127V6_POLSJ/52-143.KAL........GP.....E....LQI.SVPIKLHGVQ.G.I..KAR.............VR.KH.PYVITLS-------
C5AC57_BURGB/173-274SSQI........PA.....A....SSV.QVPLLVNHKH.KYI..SFG.............SE.NP.QLCFKYR-------
A3DI29_CLOTH/43-141.EELNN....LYSA.....K....IEA.APPIVLKGKD.ALI..TVP.............K..VE.PVFVDCT-------
C6WXU1_METML/45-137.KYF........GE.....N....MVI.SIPEKIANLS.ENL..AQQ.............AR.SY.AYVIIIK-------
Q1IMH8_KORVE/73-170.SKLP.....GIGE.....K....CML.SVPTIVVGSN.YRL..RAL.............SG.KR.RLEYRCL-------
B1ZR59_OPITP/59-160.NGLC.....DAGY.....P....CKL.TIPSILHGSN.FTI..EPI.............ST.VT.RHVYHFD-------
C9LVN2_9FIRM/180-280.SKVND...IFRDK.....E....MRL.TPPGTISGAN.IRI..ANP.............K..LT.SFEVVAK-------
A9ALI9_BURM1/172-272.NRY.......LGDADALAR....HPV.QVPLVVNHKQ.KFI..SFG.............GD.CP.QLCFKYR-------
B5JQU3_9BACT/59-157.NKLA.....DLGL.....P....STL.TLPTVVQGKR.MAI..STA.............GT.AE.QYRFTFE-------
B6BKX4_9PROT/356-452.TLL........SDE..RIS....IDI.TLPRTYNDVD.SLL..EVI.............ES.RK.GVQVDLS-------
Q7MSR1_WOLSU/362-458.ALLS.....EDET.....T....ISI.SLPKTCKNFS.ELM..TTL.............GN.RQ.GVQIDLL-------
A5GA23_GEOUR/174-273.AKAA.....QRGK.....C....TEI.EPPLVFHPGP.GGI..EVP.............SG.EQ.GIVFPIH-------
D5W843_BURSC/173-280.DRFLGA..RNGRE.....A....SQV.QVPLLVNHKH.RYI..SFG.............SD.NP.QLRFQYR-------
D2QZ65_PIRSD/52-150.SSL.......AGT.....PW.AFSQI.TVPSVIIGGG.YQI..AYA.............KG.LE.FLCATFE-------
A4A0V0_9PLAN/54-152.SKL........AR.....SPWAFQGI.TVPSVIVGEG.YQM..AFA.............RG.LE.FVSATFE-------
B9MMK6_ANATD/43-139KKSY........NT.....I....LRP.TPPSIFLGDN.MLI..VSP.............K..IQ.RKKIEYA-------
C9Y7X5_9BURK/170-273.NRYIA....PVGT.....A....TQLAQVPIVINHAH.KYI..SFG.............SP.DP.QLCIRYS-------
D1B8E2_THEAS/46-146.MKV........EV....PG....LDI.TPPQLMAGEN.LKAIPTKK.............AD.VK.SFTLPFD-------
D3KZT9_9BACT/47-147.IKF.......NEK.....E....ISI.TPPQLLTGEF.IVA..VPSA...........EDA.VR.SFTIPFK-------
F0Q6I3_ACIAP/177-280.NRY........GTEGAGGT....FGV.QVPIIVNHLH.RYI..SFG.............TE.SP.QLCFKCQ-------
A0LDM6_MAGSM/43-140.TKA........EM....KH....LDL.SPPVAIIGGS.YIA..QWK.............TL.NG.SEVLTFL-------
B6BKU2_9PROT/237-335.TAF........DKK..DIK....VIF.DLPKTYNSLK.ATQ..GYI.............GE.NS.GVWIDMQ-------
Q1IRG8_KORVE/48-143.ALV........AQ.....P....THV.SLPSVADGAD.YDL..TVR.............GG.RV.LLQCPFE-------
D1AZS0_SULD5/240-338FSKK........EL.....K....VLF.ELPKTYLSMQ.AAL..ADT.............LG.SN.GVWIDMQ-------
A6C8I3_9PLAN/29-124.KAV.......DHM.....G....FQL.GHPTVIETEQ.IDT..LYP.............PE.AG.SRCGLFQ-------
Q39V86_GEOMG/174-272AAQS........GK.....S....MEI.APPEIIEAPD.G.I..QVP.............DG.HK.ALCFPVC-------
D2QXT3_PIRSD/39-134.SIL........PG.....P....SFL.ALPTVTAGED.YKI..EVP.............SA.TC.ESMIELG-------
D2Z884_9BACT/46-146.TQA........SL....PG....VDV.TPPQLITGAS.IKTVPSQS.............SD.II.SFTLPFS-------
C0Q915_DESAH/44-135.SKTD......SKV.....P....FEL.GIPRMMDTSE.I....SE..................N.QVFTIIE-------
D9SQS9_CLOC7/42-145.TQVQ.....EYGES..ISN....FKV.DIEANLDKSG.EKI..SCD.............GD.MP.FLSLGYL-------
Q2W5X5_MAGSA/49-148.ADLA.....EGGN.....V....IRL.SPPSVLD.EE.KNI..LRP.............KK.AI.FTTIEMT-------
E6M522_9ACTO/42-134.SIV........ED.....S....GNL.VLPKVEKEKP.TD...................QD.SP.LVSVNLN-------
D6SK17_9DELT/49-148FAPG........GE.....R....VTF.SPPIVIQEAR.NMI..RT..............QG.TT.FYSSVVQ-------
Q2W334_MAGSA/49-148.ADLV.....DEDA.....T....VTL.TPPVVLAGGR.S.I..HRP.............KG.AK.FYAVELA-------
Q0B010_SYNWW/905-1003.KLFP.....GISE.....L....VML.EVPVTLYSDQ.TAI..KH..............LQ.AD.IWTCDFL-------
A8ZWB5_DESOH/47-151LSDK........NL.....G....ITF.DPPYFITDTENLNS..LLA.............HA.SE.VISIPIH-------
C1F3H6_ACIC5/53-147.SQLE......SQE.....H....FDL.ATPQLDQDAP.P.....PP.............EQ.AP.VAAQSFE-------
Q04RD4_LEPBJ/48-147.SEIK.....LGRF.....E....TDL.LPPEILNHKL.IPV..DLE.............TY.RQ.YILIYFL-------
B8FJT5_DESAA/44-137.NEC........AF.....P....GEV.SPDIPVARKG.MDL..EDC.............KN.EH.DLNLFFE-------
Q2W3Y4_MAGSA/49-148FQNI........EE.....S....IAL.SPPVIIEDAR.C.I..HRP.............KN.AV.FASMRIR-------
C4Z452_EUBE2/81-174.TKL........GEN..DVE....VTL.HPPVFYKNTE.VTA...................E.DG.FYVVTFN-------
D6Z498_DESAT/44-140.GRVD......PGG.....E....ARL.HIPEAHLLDE.FSV..RE..............LL.EQ.PGVLLFN-------
Q7MRT3_WOLSU/32-126ASDE........GK.....D....FTI.STPQFLKIGK.FE.....P.............KS.EA.SLHFKTS-------
D4JQX1_9FIRM/184-279SETT........GK.....E....IGL.NPPETATSSA...V..SGI.............KS.KF.TLTIPVE-------
Q15PK9_PSEA6/48-152HSRY........SL.....E....YGF.SSPYFVEDLS.QMD..KYL.............KGVQQ.VVTVPIS-------
Q30Q99_SULDN/706-805.QYF........DKS..LKD....VKM.TPPLYLDNTD.LTK..ALK.............DA.KN.KFIQEIE-------
A9EPA4_SORC5/41-133.SRLA.....RFQI.....A....LHA.ELPQLRRASD.VAR..RYR.............GS.KQ.QFCYAFR-------
B0TBE4_HELMI/187-279.ASLS.....NQGI.....D....LEL.QPPTLCQEKA.LL...................RG.QT.LFRIPVH-------

PF04509

P70872_BACCE/68-105-TSM--------SEFFQ.DT----VDM-SPPTIKV---------------------------------------------
FLIY_BACSU/36-73-TAL--------STLLN.QK----VDI-TTPSVTV---------------------------------------------
Q9HQW8_HALSA/277-314-DQW--------ANALD.TT----IDI-STPSHVR---------------------------------------------
O58223_PYRHO/115-152-NAL--------SEFLG.IT----IEQ-TPPSLAI---------------------------------------------
Q97LH5_CLOAB/84-120-TNF--------EEDS..VN----IDI-STPALMY---------------------------------------------
Q97LH6_CLOAB/210-248-SMI--------NRENKIFG----MRI-APPTTIY---------------------------------------------
O58224_PYRHO/106-143-DIL--------SNLLG.EP----VSL-SPPKPAE---------------------------------------------
CHEC_BACSU/10-47-SAM--------AQLLN.RK----IDM-EVPFAKL---------------------------------------------
O51614_BORBU/89-125-TTL--------HAKG..FV----FDI-TPPAFIY---------------------------------------------
Q9KA56_BACHD/110-147-SAL--------ADFTK.LK----LYP-SVPGLSI---------------------------------------------
CHEC_BACSU/111-148-TAL--------ADLTK.LQ----LYP-SVPEVSL---------------------------------------------
Q9L3K8_BACCE/245-282-TVL--------STLLN.QP----VTI-STPNVEA---------------------------------------------
Q97H00_CLOAB/41-78-TAL--------STIIG.QK----VNI-TTPIVSV---------------------------------------------
Q9KA56_BACHD/10-47-TAL--------SQLLQ.KT----IDM-NVPNVHI---------------------------------------------
Q97GZ6_CLOAB/104-141-NAI--------SKFTN.LV----ITP-SVPAFSY---------------------------------------------
O58223_PYRHO/18-55-TAL--------SEMTG.KE----VNI-SVPDLKI---------------------------------------------
Q9RPJ0_9FIRM/59-95-TGL--------SQSH..LI----CDI-RPPKILE---------------------------------------------
Q9KA45_BACHD/146-183-TSM--------STIFN.KR----IDI-SPPGVNM---------------------------------------------
O29223_ARCFU/109-146-DAA--------AEMLG.IV----LLP-TPPSFGR---------------------------------------------
Q9L3K8_BACCE/25-62-TVL--------STILN.RQ----VSI-TAPRIEL---------------------------------------------
CHEX_THEMA/84-120-MKL--------EHLG..KH----VDI-TPPTVVS---------------------------------------------
Q97GZ6_CLOAB/9-46-TAL--------SQLLN.KK----IDM-TVPDINI---------------------------------------------
Q9KDX3_BACHD/84-120-TEL--------SKEA..CI----IDV-TPPVVNE---------------------------------------------
Q9HPJ6_HALSA/103-140-DGI--------ANSLG.IE----IIH-GPPTVYH---------------------------------------------
CHEC_THEMA/105-142-SAL--------ADFLG.FK----IDT-LPPQLVI---------------------------------------------
O85749_TREDN/83-119-TKL--------HDLG..FK----FDL-TPPALFT---------------------------------------------
O58224_PYRHO/6-43-TAL--------SQMIG.GP----IEM-EAPDVDI---------------------------------------------
Q48298_HALSI/105-142-DGW--------ANVLG.RT----IDI-STPQLIR---------------------------------------------
Q97H00_CLOAB/138-175-TSM--------ATMLL.RE----VNI-SPPVSKI---------------------------------------------
Q9KUY1_VIBCH/84-120-RIL--------AESG..FD----FDM-ATPVVVS---------------------------------------------
O29223_ARCFU/13-50-TSL--------SQMLG.RR----IEM-SVPEAVI---------------------------------------------
FLIY_BACSU/133-170-TSM--------STVFS.KK----IDI-SPPRVEL---------------------------------------------
Q9HQW8_HALSA/90-127-DVW--------AADDE.DT----IEI-EPPDRLE---------------------------------------------

PF11813

E6XJW4_SHEP2/1-240-NKI--------SK-----ELQTSISQ-SQPKMLTINKELTISIDANLDDAVARRVSFKTENNHIFYLEFAMDKTEFIKL
D7HKC4_VIBCL/5-231-NKV--------RK-----ELQTNITQ-NQPKMLSLNKQVLLSVDTNLDRPQARRVTFSTANNNIFYLELAMDKTEFIQL
Q5E4M5_VIBF1/5-229-GQI--------RK-----TLQTTISQ-NQPKMLSLNKQVILSVDTNLDRPQARRVTFTTENNHIFYLELAMDKTEFIQL
Q1ZGW0_9GAMM/1-226-SVI--------AQ-----EMQTSITQ-NQPKMLTINKQVQLSIDTNLDRPQARRVTFTTEKNNIFYLEMAMDKTEFIKL
A8H431_SHEPA/1-234-NKI--------SK-----ELQTTISQ-SQPKMLTINKELTISIDTNLNEAVARRVSFKTKNNHVFYLEFAMDKTEFIKL
A1W514_ACISJ/4-228-GKV--------RR-----ELQTHITQ-NQPKMLVLNQQVVLSVDANLDQPEARRVTFYTGSNNIFYLELAIDRTQFIKL
Q47BE9_DECAR/19-242-GTV--------AR-----ELQTHITQ-NQPKMLVINKQVMLSVDTNLDQPEARRVTFFTGRNNIFYLELAIDRTEFIKL
A1WIM9_VEREI/4-227-GKV--------RR-----EMQTHITQ-NQPKMLVLSKQVMLSVDANLDKPEARRVTFYTGNNHLFYLELAIDRTEFIKL
Q3IIQ5_PSEHT/1-229-SKV--------RE-----QLHTSITQ-NQPKMMAINKQVQISVDTTMDRPQARRVTFTTSKQNIFYLELAMDKTEFIKL
B1KDT0_SHEWM/29-261-SKV--------SK-----QLQTSINQ-SQPKMLTINKQLTISVDTNLDDAVARRVSFRTQNNHIFYLEFAMDKTEFIQL
Q1ZR43_PHOAS/1-226-GKI--------GR-----ELKVSITQ-NQPKMLALNKQILLSVDTNLDRPQARRVSFTTAKNNIFYLEFAMDKTEFIQL
Q12N73_SHEDO/1-263-GKV--------SK-----ELQTSISQ-SQPKMLTINKELTISIDANLDNPVARRVSFRTQSNHIFYLEFAMDNTEFIAS
A4SR42_AERS4/6-232-VKV--------GR-----DLQTHITQ-NQPKMLALNKQVMLSVDTNLDNPEARRVTFFTSRNNIFYLELAMDRTEFIRI
A1S654_SHEAM/1-228-GKV--------SK-----ELQTSISQ-SQPKMLTINKEITISIDANLDEPVIRRVSFMTESNHIFYLEFAMDKTEFVKT
Q1Z1W0_PHOPR/1-224-SKI--------RR-----ELQISITQ-NQPKMLALNKQIILSVDTNLDRPQARRVSFTTEKNNIFYLELAMDKTEFIQL
A1TSY3_ACIAC/28-254-GKV--------RR-----ELQTHITQ-NQPKMLALNKQVMLSVDANLDQPEARRVTFYTAKNHIFYLELAIDRTEFIKL
A6CZL8_9VIBR/1-224-NKV--------RK-----ELQTNITQ-NQPKMLSINKQVVLSVDTNLERPQARRVTFSTANNNIFYLEFAMDKTEFIQM
A1K8E1_AZOSB/6-235-GKI--------SR-----ELQTQITQ-NQPKMLALTKQVMLSVDTHLDRPEARRVSFYTGRNNIFYLELAIDRTEFIQL
Q083E4_SHEFN/1-236-GKI--------SK-----ELQTSISQ-SQPKMLVINKELTISVDTNLDNAVARRVSFKTENNHIFYLEFAMDKTEFIRS

PF02154

FLIM_CAUCR/77-270LHPV--------SFSLDRLE----TNP-PFAAIAR.PANAAILVKLRIDME---------DRGGRIELLLPYATLEPIRK
FLIM_TREPA/39-229VIDL--------RPRLGQIE----TNP-QFAQIVP.PSEMVVLVTLETKVG---------EEEGMMNFCIPYITIEPIIS
FLIM_BORBU/49-240VVDL--------RPRFGHIE----VNP-QFAQIVP.PTEMIILVTLEVKIG---------KVEGLMNFCLPYITIEPIVS
FLIM_ECOLI/38-231INPL--------EVEYVRSE----MQV-KFTNITTSPNDIVVNTPFHVEIG---------NLTGEFNICLPFSMIEPLRE
FLIM_BACSU/40-230IADI--------EPEMTEFE----VNP-QFVQMVS.PNETVVVISLNTQIG---------EISGVINLCIPHIVLEPLIP
Q9Z6G1_VIBPA/37-229VMGV--------EFEYLDSE----VNP-SMANIVS.PTEVIVVSSFHIEVD---------GGGGDFHVVMPYSMVEPIRE
O25675_HELPY/40-230VVEM--------FPTIDAKE----SSA-NVVQIVA.QNEISIMVVLEIIIG---------HSRGMMNICYPVISIESILS

PF13690

C0QAL2_DESAH/42-139--------------------------------------------------------------------------------
Q2LSM0_SYNAS/58-155--------------------------------------------------------------------------------
E6VZI0_DESAO/42-139--------------------------------------------------------------------------------
C6BS03_DESAD/42-139--------------------------------------------------------------------------------
D2R467_PIRSD/42-137--------------------------------------------------------------------------------
D6SSH8_9DELT/45-145--------------------------------------------------------------------------------
C4XHM1_DESMR/45-142--------------------------------------------------------------------------------
D3PAK0_DEFDS/42-139--------------------------------------------------------------------------------
D6SK93_9DELT/45-145--------------------------------------------------------------------------------
D3PEX7_DEFDS/42-139--------------------------------------------------------------------------------
Q2LXN3_SYNAS/42-139--------------------------------------------------------------------------------
C7LN70_DESBD/42-139--------------------------------------------------------------------------------
A5EYB3_DICNV/38-130--------------------------------------------------------------------------------
C7LNA5_DESBD/45-145--------------------------------------------------------------------------------
A1AUJ2_PELPD/55-152--------------------------------------------------------------------------------
Q3A5A2_PELCD/40-137--------------------------------------------------------------------------------
Q1JZV2_DESAC/40-137--------------------------------------------------------------------------------
B5EEQ0_GEOBB/56-153--------------------------------------------------------------------------------
A3ZPG3_9PLAN/42-140--------------------------------------------------------------------------------
Q1JZV3_DESAC/42-139--------------------------------------------------------------------------------
B5EAE1_GEOBB/55-152--------------------------------------------------------------------------------
B5JV55_9GAMM/45-138--------------------------------------------------------------------------------
C4GMG1_9NEIS/44-136--------------------------------------------------------------------------------
B3E1X0_GEOLS/45-149--------------------------------------------------------------------------------
A4BED7_9GAMM/23-121--------------------------------------------------------------------------------
Q67P65_SYMTH/42-138--------------------------------------------------------------------------------
Q01VJ9_SOLUE/45-142--------------------------------------------------------------------------------
A0L9J3_MAGSM/47-145--------------------------------------------------------------------------------
Q1QDT2_PSYCK/44-136--------------------------------------------------------------------------------
Q1QDT3_PSYCK/43-135--------------------------------------------------------------------------------
A1AQJ7_PELPD/45-151--------------------------------------------------------------------------------
Q6MIQ0_BDEBA/198-294--------------------------------------------------------------------------------
B5EFK5_GEOBB/45-152--------------------------------------------------------------------------------
Q74GW2_GEOSL/55-154--------------------------------------------------------------------------------
Q39Z94_GEOMG/55-154--------------------------------------------------------------------------------
B2A030_OPITP/53-154--------------------------------------------------------------------------------
B9L9J7_NAUPA/350-446--------------------------------------------------------------------------------
Q0AX00_SYNWW/42-141--------------------------------------------------------------------------------
Q3A8N0_PELCD/39-136--------------------------------------------------------------------------------
Q74BI2_GEOSL/45-154--------------------------------------------------------------------------------
B2TA19_BURPP/172-277--------------------------------------------------------------------------------
A0L8I4_MAGSM/41-138--------------------------------------------------------------------------------
B5JMF4_9BACT/60-161--------------------------------------------------------------------------------
A6D9Z4_9PROT/349-445--------------------------------------------------------------------------------
A0L8I3_MAGSM/42-139--------------------------------------------------------------------------------
C3XNC2_9HELI/355-452--------------------------------------------------------------------------------
Q1NQE4_9DELT/4-109--------------------------------------------------------------------------------
Q127V6_POLSJ/52-143--------------------------------------------------------------------------------
C5AC57_BURGB/173-274--------------------------------------------------------------------------------
A3DI29_CLOTH/43-141--------------------------------------------------------------------------------
C6WXU1_METML/45-137--------------------------------------------------------------------------------
Q1IMH8_KORVE/73-170--------------------------------------------------------------------------------
B1ZR59_OPITP/59-160--------------------------------------------------------------------------------
C9LVN2_9FIRM/180-280--------------------------------------------------------------------------------
A9ALI9_BURM1/172-272--------------------------------------------------------------------------------
B5JQU3_9BACT/59-157--------------------------------------------------------------------------------
B6BKX4_9PROT/356-452--------------------------------------------------------------------------------
Q7MSR1_WOLSU/362-458--------------------------------------------------------------------------------
A5GA23_GEOUR/174-273--------------------------------------------------------------------------------
D5W843_BURSC/173-280--------------------------------------------------------------------------------
D2QZ65_PIRSD/52-150--------------------------------------------------------------------------------
A4A0V0_9PLAN/54-152--------------------------------------------------------------------------------
B9MMK6_ANATD/43-139--------------------------------------------------------------------------------
C9Y7X5_9BURK/170-273--------------------------------------------------------------------------------
D1B8E2_THEAS/46-146--------------------------------------------------------------------------------
D3KZT9_9BACT/47-147--------------------------------------------------------------------------------
F0Q6I3_ACIAP/177-280--------------------------------------------------------------------------------
A0LDM6_MAGSM/43-140--------------------------------------------------------------------------------
B6BKU2_9PROT/237-335--------------------------------------------------------------------------------
Q1IRG8_KORVE/48-143--------------------------------------------------------------------------------
D1AZS0_SULD5/240-338--------------------------------------------------------------------------------
A6C8I3_9PLAN/29-124--------------------------------------------------------------------------------
Q39V86_GEOMG/174-272--------------------------------------------------------------------------------
D2QXT3_PIRSD/39-134--------------------------------------------------------------------------------
D2Z884_9BACT/46-146--------------------------------------------------------------------------------
C0Q915_DESAH/44-135--------------------------------------------------------------------------------
D9SQS9_CLOC7/42-145--------------------------------------------------------------------------------
Q2W5X5_MAGSA/49-148--------------------------------------------------------------------------------
E6M522_9ACTO/42-134--------------------------------------------------------------------------------
D6SK17_9DELT/49-148--------------------------------------------------------------------------------
Q2W334_MAGSA/49-148--------------------------------------------------------------------------------
Q0B010_SYNWW/905-1003--------------------------------------------------------------------------------
A8ZWB5_DESOH/47-151--------------------------------------------------------------------------------
C1F3H6_ACIC5/53-147--------------------------------------------------------------------------------
Q04RD4_LEPBJ/48-147--------------------------------------------------------------------------------
B8FJT5_DESAA/44-137--------------------------------------------------------------------------------
Q2W3Y4_MAGSA/49-148--------------------------------------------------------------------------------
C4Z452_EUBE2/81-174--------------------------------------------------------------------------------
D6Z498_DESAT/44-140--------------------------------------------------------------------------------
Q7MRT3_WOLSU/32-126--------------------------------------------------------------------------------
D4JQX1_9FIRM/184-279--------------------------------------------------------------------------------
Q15PK9_PSEA6/48-152--------------------------------------------------------------------------------
Q30Q99_SULDN/706-805--------------------------------------------------------------------------------
A9EPA4_SORC5/41-133--------------------------------------------------------------------------------
B0TBE4_HELMI/187-279--------------------------------------------------------------------------------

PF04509

P70872_BACCE/68-105--------------------------------------------------------------------------------
FLIY_BACSU/36-73--------------------------------------------------------------------------------
Q9HQW8_HALSA/277-314--------------------------------------------------------------------------------
O58223_PYRHO/115-152--------------------------------------------------------------------------------
Q97LH5_CLOAB/84-120--------------------------------------------------------------------------------
Q97LH6_CLOAB/210-248--------------------------------------------------------------------------------
O58224_PYRHO/106-143--------------------------------------------------------------------------------
CHEC_BACSU/10-47--------------------------------------------------------------------------------
O51614_BORBU/89-125--------------------------------------------------------------------------------
Q9KA56_BACHD/110-147--------------------------------------------------------------------------------
CHEC_BACSU/111-148--------------------------------------------------------------------------------
Q9L3K8_BACCE/245-282--------------------------------------------------------------------------------
Q97H00_CLOAB/41-78--------------------------------------------------------------------------------
Q9KA56_BACHD/10-47--------------------------------------------------------------------------------
Q97GZ6_CLOAB/104-141--------------------------------------------------------------------------------
O58223_PYRHO/18-55--------------------------------------------------------------------------------
Q9RPJ0_9FIRM/59-95--------------------------------------------------------------------------------
Q9KA45_BACHD/146-183--------------------------------------------------------------------------------
O29223_ARCFU/109-146--------------------------------------------------------------------------------
Q9L3K8_BACCE/25-62--------------------------------------------------------------------------------
CHEX_THEMA/84-120--------------------------------------------------------------------------------
Q97GZ6_CLOAB/9-46--------------------------------------------------------------------------------
Q9KDX3_BACHD/84-120--------------------------------------------------------------------------------
Q9HPJ6_HALSA/103-140--------------------------------------------------------------------------------
CHEC_THEMA/105-142--------------------------------------------------------------------------------
O85749_TREDN/83-119--------------------------------------------------------------------------------
O58224_PYRHO/6-43--------------------------------------------------------------------------------
Q48298_HALSI/105-142--------------------------------------------------------------------------------
Q97H00_CLOAB/138-175--------------------------------------------------------------------------------
Q9KUY1_VIBCH/84-120--------------------------------------------------------------------------------
O29223_ARCFU/13-50--------------------------------------------------------------------------------
FLIY_BACSU/133-170--------------------------------------------------------------------------------
Q9HQW8_HALSA/90-127--------------------------------------------------------------------------------

PF11813

E6XJW4_SHEP2/1-240DEFEYDEEF.DPDSLLEQHG....NNGASNDSDVSPWSKMKDKPAIAS...................LTTDANADDLLDQ
D7HKC4_VIBCL/5-231EEFDVQEDE.SPDDILAATQ......KQQKSHSVANHS..EED............................SASADLLDQ
Q5E4M5_VIBF1/5-229EEFEQEDEF.DADDLLDQHR.....SAKKEEKKTEPNQ.................................DFDDSLFDE
Q1ZGW0_9GAMM/1-226PNFERREKF.DADSIIDAEN.........NKKDAEPTPEVVMD............................STEQDLLDE
A8H431_SHEPA/1-234SEFEVDGDF.DLDELLAEHGQLLTTPKRAQPTKVQEHHHVKN.............................SDADDLLDE
A1W514_ACISJ/4-228YDFEPQDAP.DPDALMAQAA........APAPAAAPAS..ATD............................ADTEALLRS
Q47BE9_DECAR/19-242NDFEAREAP.DPDELIAQVN......AAAAPVSQPTTS.................................DEHDDLLKS
A1WIM9_VEREI/4-227YDFEAQEVP.DADALMAQAQ.......PLPPAPPPP....AGR............................DDTDALLKS
Q3IIQ5_PSEHT/1-229HDFDIVEAI.DPDDIIENEA......KQKAEKAKAKAEKEAED............................SDDDDFMAG
B1KDT0_SHEWM/29-261DEFDEDGEF.DPDDLLAEHS......NKEEKEPVSPWAKAASKESAT........................DEADDLLNE
Q1ZR43_PHOAS/1-226EEFE.QDTQ.DTDSIFESAK......LEQQKENAKNQT..LND............................INDQDLFDQ
Q12N73_SHEDO/1-263AEFEMDEEF.DPDSLLEQHGSSLAEHKKKANKARKASKKVASKPAAASPKKATLAVKPDRLNNPEVKGIVADDADDLLSE
A4SR42_AERS4/6-232HSDGMDEEELDPDALIAQTK....LAASKPTPVAAKVA.................................NEHDDLLDS
A1S654_SHEAM/1-228REFELDEEF.DPDFLIEQHG...........NTRSPWSQMAGKGIVA........................DDADDLLDE
Q1Z1W0_PHOPR/1-224EEFEQHQDI.DPDVIIENEK......KQKESNLTLVNQ.................................ADEQDLLDE
A1TSY3_ACIAC/28-254YDFEPQEAP.DPDALLAQAG......KGDQPASPPPAA..GAD............................SDTDDLLKS
A6CZL8_9VIBR/1-224EEFEIQPDE.CPDTIIEQAI......AAKKQRTDTKPE.................................NDNQDLLDE
A1K8E1_AZOSB/6-235NEFAADEAP.DPDALIEQAH.....AAGAGTADNAAPAEAAAD............................DDADALLKS
Q083E4_SHEFN/1-236ADFEMDEEF.DLDSLIETHG......KAAQVNTAKSKDVLNDPNIKGI.....................VVDDADDLLSE

PF02154

FLIM_CAUCR/77-270ML------------------------------------------------------------------------------
FLIM_TREPA/39-229KL------------------------------------------------------------------------------
FLIM_BORBU/49-240KL------------------------------------------------------------------------------
FLIM_ECOLI/38-231LL------------------------------------------------------------------------------
FLIM_BACSU/40-230KL------------------------------------------------------------------------------
Q9Z6G1_VIBPA/37-229LL------------------------------------------------------------------------------
O25675_HELPY/40-230KM------------------------------------------------------------------------------

PF13690

C0QAL2_DESAH/42-139---
Q2LSM0_SYNAS/58-155---
E6VZI0_DESAO/42-139---
C6BS03_DESAD/42-139---
D2R467_PIRSD/42-137---
D6SSH8_9DELT/45-145---
C4XHM1_DESMR/45-142---
D3PAK0_DEFDS/42-139---
D6SK93_9DELT/45-145---
D3PEX7_DEFDS/42-139---
Q2LXN3_SYNAS/42-139---
C7LN70_DESBD/42-139---
A5EYB3_DICNV/38-130---
C7LNA5_DESBD/45-145---
A1AUJ2_PELPD/55-152---
Q3A5A2_PELCD/40-137---
Q1JZV2_DESAC/40-137---
B5EEQ0_GEOBB/56-153---
A3ZPG3_9PLAN/42-140---
Q1JZV3_DESAC/42-139---
B5EAE1_GEOBB/55-152---
B5JV55_9GAMM/45-138---
C4GMG1_9NEIS/44-136---
B3E1X0_GEOLS/45-149---
A4BED7_9GAMM/23-121---
Q67P65_SYMTH/42-138---
Q01VJ9_SOLUE/45-142---
A0L9J3_MAGSM/47-145---
Q1QDT2_PSYCK/44-136---
Q1QDT3_PSYCK/43-135---
A1AQJ7_PELPD/45-151---
Q6MIQ0_BDEBA/198-294---
B5EFK5_GEOBB/45-152---
Q74GW2_GEOSL/55-154---
Q39Z94_GEOMG/55-154---
B2A030_OPITP/53-154---
B9L9J7_NAUPA/350-446---
Q0AX00_SYNWW/42-141---
Q3A8N0_PELCD/39-136---
Q74BI2_GEOSL/45-154---
B2TA19_BURPP/172-277---
A0L8I4_MAGSM/41-138---
B5JMF4_9BACT/60-161---
A6D9Z4_9PROT/349-445---
A0L8I3_MAGSM/42-139---
C3XNC2_9HELI/355-452---
Q1NQE4_9DELT/4-109---
Q127V6_POLSJ/52-143---
C5AC57_BURGB/173-274---
A3DI29_CLOTH/43-141---
C6WXU1_METML/45-137---
Q1IMH8_KORVE/73-170---
B1ZR59_OPITP/59-160---
C9LVN2_9FIRM/180-280---
A9ALI9_BURM1/172-272---
B5JQU3_9BACT/59-157---
B6BKX4_9PROT/356-452---
Q7MSR1_WOLSU/362-458---
A5GA23_GEOUR/174-273---
D5W843_BURSC/173-280---
D2QZ65_PIRSD/52-150---
A4A0V0_9PLAN/54-152---
B9MMK6_ANATD/43-139---
C9Y7X5_9BURK/170-273---
D1B8E2_THEAS/46-146---
D3KZT9_9BACT/47-147---
F0Q6I3_ACIAP/177-280---
A0LDM6_MAGSM/43-140---
B6BKU2_9PROT/237-335---
Q1IRG8_KORVE/48-143---
D1AZS0_SULD5/240-338---
A6C8I3_9PLAN/29-124---
Q39V86_GEOMG/174-272---
D2QXT3_PIRSD/39-134---
D2Z884_9BACT/46-146---
C0Q915_DESAH/44-135---
D9SQS9_CLOC7/42-145---
Q2W5X5_MAGSA/49-148---
E6M522_9ACTO/42-134---
D6SK17_9DELT/49-148---
Q2W334_MAGSA/49-148---
Q0B010_SYNWW/905-1003---
A8ZWB5_DESOH/47-151---
C1F3H6_ACIC5/53-147---
Q04RD4_LEPBJ/48-147---
B8FJT5_DESAA/44-137---
Q2W3Y4_MAGSA/49-148---
C4Z452_EUBE2/81-174---
D6Z498_DESAT/44-140---
Q7MRT3_WOLSU/32-126---
D4JQX1_9FIRM/184-279---
Q15PK9_PSEA6/48-152---
Q30Q99_SULDN/706-805---
A9EPA4_SORC5/41-133---
B0TBE4_HELMI/187-279---

PF04509

P70872_BACCE/68-105---
FLIY_BACSU/36-73---
Q9HQW8_HALSA/277-314---
O58223_PYRHO/115-152---
Q97LH5_CLOAB/84-120---
Q97LH6_CLOAB/210-248---
O58224_PYRHO/106-143---
CHEC_BACSU/10-47---
O51614_BORBU/89-125---
Q9KA56_BACHD/110-147---
CHEC_BACSU/111-148---
Q9L3K8_BACCE/245-282---
Q97H00_CLOAB/41-78---
Q9KA56_BACHD/10-47---
Q97GZ6_CLOAB/104-141---
O58223_PYRHO/18-55---
Q9RPJ0_9FIRM/59-95---
Q9KA45_BACHD/146-183---
O29223_ARCFU/109-146---
Q9L3K8_BACCE/25-62---
CHEX_THEMA/84-120---
Q97GZ6_CLOAB/9-46---
Q9KDX3_BACHD/84-120---
Q9HPJ6_HALSA/103-140---
CHEC_THEMA/105-142---
O85749_TREDN/83-119---
O58224_PYRHO/6-43---
Q48298_HALSI/105-142---
Q97H00_CLOAB/138-175---
Q9KUY1_VIBCH/84-120---
O29223_ARCFU/13-50---
FLIY_BACSU/133-170---
Q9HQW8_HALSA/90-127---

PF11813

E6XJW4_SHEP2/1-240LGL
D7HKC4_VIBCL/5-231LGI
Q5E4M5_VIBF1/5-229LGI
Q1ZGW0_9GAMM/1-226LGL
A8H431_SHEPA/1-234LGL
A1W514_ACISJ/4-228LGM
Q47BE9_DECAR/19-242LGM
A1WIM9_VEREI/4-227LGM
Q3IIQ5_PSEHT/1-229LGL
B1KDT0_SHEWM/29-261LGI
Q1ZR43_PHOAS/1-226LGI
Q12N73_SHEDO/1-263LGL
A4SR42_AERS4/6-232LGI
A1S654_SHEAM/1-228LGI
Q1Z1W0_PHOPR/1-224LGI
A1TSY3_ACIAC/28-254LGM
A6CZL8_9VIBR/1-224LGI
A1K8E1_AZOSB/6-235LGM
Q083E4_SHEFN/1-236LGL

PF02154

FLIM_CAUCR/77-270---
FLIM_TREPA/39-229---
FLIM_BORBU/49-240---
FLIM_ECOLI/38-231---
FLIM_BACSU/40-230---
Q9Z6G1_VIBPA/37-229---
O25675_HELPY/40-230---

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window