Sequence alignment for CL0359

PF01348

MATK_HORVD/363-488MKKFDTIVPATLLIGYLSKAQFCTGS........GHPISKPIWTDLSDWDILDRFGRICRNLFHYHSGSSKKRTLY.RLK
Q02718_PODAN/556-712NNRLYFYVPVRDIINKLEKAGFIKTYTSANGREKLAPNAITKWIFLDHRSILLRYNAVIRGLLNYYSFVDNKIAFHSIVN
AI1M_YEAST/602-759TTRPIINAPIRDIINKLATNGYCKHNKN...GRMGVPTRVGRWTYEEPRTIINNYKALGRGILNYYKLATNYKRLRERIY
AI2M_YEAST/638-781HTSLVVNAPIRSIVMKLNKHGYCSH.G.....ILGKPRGVGRLIHEEMKTILMHYLAVGRGIMNYYRLATNFTTLRGRIT
YMC6_SCHPO/585-715SGFILLSAPMDRIAKKLRETGLMLN.........HKGRSVIRWLPLDVRQIIGLANSIIRGYDNYYSFVHNRGRFATYVY
Q02717_PODAN/553-707TTSTVMNAPISKLVTKLADKGIVIWKSKALNEDNLIPQPILKWVNLPIRDIILRYKMIWNGYINYYSFADNKPRLV.LIY
D7KRD4_ARALL/382-502..KLDSKIPISSIIGSLAKDKFCNVL........GHPISKATWTDSSDSDILNRFVRICRNISHYYSGSSKKKNLY.RIK

PF08388

Q8DMT0_THEEB/344-422---------VKAFLKKI.RD.TL.R---------------ELRT.ATQEIVIDTLNPIIRGWANYHKGQ.VSKETFNRVD
Q118Z9_TRIEI/28-106---------IKTHYRKL.AD.IC.D---------------KYKN.ASTKALITKLNPVIKGWANYFSAI.VSKSTFSKLD
Q8TH39_METAC/313-391---------KKSMQQEI.HN.WRMH---------------LKPD.LTLEDLSHMYNPIVRGWVNYYGLF.YKSELYCVL.
Q92V78_RHIME/332-411---------LNAFKRRV.RQ.LTRR---------------S.GG.RSMAEVAERLRVYVLGWKAYFRLA.QTPRLFKELE
A1T776_MYCVP/353-435---------MVRLREKV.RE.RTGR---------------NRVG.FDIRDVIAVLNPILRGWGNYFRTG.NAADKFRQID
Q1XA93_PARBD/411-489---------VLAFLDNI.RN.IF.I---------------KSQN.LNAYTLMKKLNPFLIKWCNYYNLG.NSFHSRNTVK
A6TN43_ALKMQ/221-299---------INKVTQTI.SE.LI.H---------------NSRT.VQQEQLIYRINEVTRGWANYHHSV.CSKKAFALMD
A6WZI3_OCHA4/335-414---------VKRLRGKL.KA.QFRA---------------G.RG.RAIDATIKDLAPILRGWTAYFKLA.DVKGTFEEMD
Q5L096_GEOKA/288-367---------IRRMKQRI.RT.MTSR---------------S.KP.IPMPERIEQLNQYILGWCGYFSLA.ETPSVFKELD
A6L278_BACV8/349-427---------QKRFCEKI.RK.TI.E---------------ANKC.VKQKSLIMMLNPIIKGWGNYYKYG.TSANVFHRMD
Q121L7_POLSJ/346-425---------VKAFYAKVKKE.IV.E---------------SLSK.VPVETLIKRLNPILKGWAQYHKGT.VAKQIFSKVD
Q6LJ59_PHOPR/129-208---------LQRFKQKL.KS.LTKR---------------N.SG.KPLLEIIKGLNPVLRGFSNYFRIA.NCKRELKVIA
A8MI91_ALKOO/292-371---------IERFKDKV.RS.KTKR---------------N.AG.RKLEDIIKDLNPVIRGWINYYRIA.NIKKLVEKLM
Q67R28_SYMTH/286-365---------LKRVKDKL.RT.LTDR---------------N.RS.QSMEDRIRCLNAYLRGWVGYYALS.DARSAFERLE
A6L5N4_BACV8/347-425---------LKKFMQKI.RG.II.D---------------SNKG.SKQESLIRLLNPVITGWVNYYKNC.VASDTFRKAD
A4XCB1_SALTO/367-443---------IRSLKAKV.RA.LTRR---------------TSQ..QDLGTVLTRLNLVAHGWANYFRHA.VAKNVFSMLD
A5VHP4_LACRD/329-408---------QQRVKKAL.RL.LTKR---------------N.RG.ISLTRMFEEIQRKMRGWLQYYSIG.KLTDFIQRLD
Q119D3_TRIEI/365-444---------IKAHYQRL.AS.EI.D---------------KFKSCKSQIDLIKGLNPIITGWSNYYSKV.NSAKTFKELD
Q8TM71_METAC/31-109---------QREVIKKI.SD.AI.H---------------KAKA.WDQDRLIRDLNPIIRGWTQYHNHT.VSSEIFSKLD
Q7NP80_GLOVI/345-423---------IKTHTEKL.RR.II.H---------------KHKA.QPQSFLIEHLNPIIRGWTHFFSKV.VSGATFKKLD
Q10VN2_TRIEI/308-393---------VKEFLTLI.RG.WL.K---------------AHPT.STQEAVIANLNSIIRGWGNYYRHG.VSQRIFSYVD
A0L945_MAGSM/330-405---------RTSLLGRL.KE.VFKH---------------LRS..QPTEWVVNTINPILRGWVSYFRIG.NSSRSFNFVR
Q1XGB6_PHYPA/398-476---------RWRFLEDI.RR.AI.Q---------------FSKG.KAAYQLIITLVPKIVGWGHYFKYS.ECNNIFRRLD
Q82RB7_STRAW/349-427---------LQRARKRI.ST.TA.R---------------ENSG.SPTESLVRALSPFVRGWSTYYRTV.CSKETFNLLD
A4VKJ2_PSEU5/358-436---------VSAFYRKV.RE.II.K---------------GSGA.LTQDALIGQLNPVLKGWAQYHSTV.VAKQTFSKLD
A1BAQ8_PARDP/313-391---------LKSFRRRV.RN.WGLQ---------------RRSD.KGLIDLARMFNRQIEGWIGYFRCF.YKSALYSTL.
B4SCG3_PELPB/311-390---------LRHMRQTI.RR.WKLQ---------------LKNS.LELADLSAQFNPILRGWKNYYTRF.YGSAMAPVW.
Q10VN3_TRIEI/334-413---------IRSHYCHI.AE.VI.D---------------KYKS.ASQAVLIRKLNPIVKSWVNYYSKLFVSKKIFQDLD
A1BGI0_CHLPD/311-387---------LKTMRRTI.RS.WHLQ---------------LKSD.KQIEELSKAIDPVLRGWKNYFCRF.NASAMKPVW.
A4FC41_SACEN/223-301---------LNKISREV.RS.WRLH---------------LRTG.HTFAALARRINPVVRGWMQYYGAF.YRSALHPFL.
Q92Y56_RHIME/377-468---------AANLRHKV.KQ.LTQR---------------DSIS.VSLGEKLRGVNAITSGWANYYRYCVGAGRVFVALD
Q3B1V7_PELLD/340-418---------IKAHLTKV.RG.II.K---------------AKKT.IKQVDLIGLLNPVLRGWANYHRHS.VAKDVFARND
Q89TI6_BRADU/98-173---------VLRIKRKV.SE.LLTP---------------GNK..GAWPEVQARLNRLLRGWSAYFSYG.SLATAHQAVD
A5CZB8_PELTS/292-371---------IKKFKDRI.RE.LTPR---------------N.HG.MSLKEMIKRLNPVLRGWANYFRVA.NCKKLFAQLM
Q2LRA6_SYNAS/211-289---------RKEINREI.CR.RHIQ---------------LKND.KTLDDLSNMFKAKIRGWIAYYGRF.YPSEIGWIW.
Q01P79_SOLUE/337-416---------LDRFKRRI.RE.ITGR---------------A.KG.VSMKTTMEELAPYMRGWRSYFGFC.ETPEVLIGLT
Q8YJX0_NOSS1/384-462---------LKIHAQKI.GK.LI.D---------------EHKA.VPQSDLIAHLNPVIRGWTNYYSCV.VSKRIFNQAD
Q81ZI4_NITEU/301-380---------LANFKHRV.RQ.LTGR---------------S.WG.VSMEYRLEKLGQYLRGWFGYYGIS.QYYRPIPELD
Q024N3_SOLUE/339-417---------VRKERRKL.HE.MTDS---------------HQCF.KPIPVLIGELNRHRKGWANYFSFG.YPISVYYELD
Q2SF99_HAHCH/347-425---------TKAFLTKC.RD.VI.N---------------ANKS.AKQENLIHRLNPIIRGWVNYHKHQ.VASDAFARVD
Q0VRW5_ALCBS/345-423---------VKRFLAEV.KS.VL.D---------------THKT.MPAWWIVKTLNPKIRGWANYHRHV.VSKATFNYVD
Q0RWF2_RHOSR/343-419---------LRSLKDKI.RA.VTSR---------------LSQ..QPPRDVLIRLNRIMRGWSNYFRYA.VAKSVLQSLA
Q2JAX6_FRASC/343-420---------MQHARDRI.RE.ITGR---------------SRLL.LNPEAVVRELNLFLRGWAGYFRYG.YSARRLAMIR
Q7UY81_RHOBA/354-431---------HQKMVDTI.RR.LTPR---------------KSG..QSLEATIVQINRVTVGWFSYFRHC..TWNIFDKYD
A6TTG9_ALKMQ/237-315---------NKLFRAKI.KA.LKIH---------------KKTG.CKIDMIAQWINPIVRGWINYFGKY.NASAIKYTL.
Q11ZP2_POLSJ/335-414---------LDTFKQRI.RL.ITKR---------------V.GG.KGMVQIAEQMKEYLPGWKSYFRLA.QTPQTFKDLD
A4YPB0_BRASO/18-96---------TSCFTHHI.GS.CGRR---------------SGRG.LA..QIIEKLSLYLKGWRGYFGFC.ETPSVLRKLD
A4G3U3_HERAR/349-427---------VKTFYEKL.RN.VV.S---------------DNLG.AKQVNLIGLLNPMLRGWSQYHSPV.VAKETFSRID
Q1D1V6_MYXXD/324-399---------VTEVLRRV.RH.VLRD---------------SRA..LAVQSAVVEVNAIVRGWVNYFRWG.NSYQALDRVK
A6TKY0_ALKMQ/313-390---------IKSFMDKI.KK.L..R---------------KNSY.LSLTELAEKMNPIIRGWANYFDKF.TASKV.HAIL
A6X7I7_OCHA4/354-431---------AKGFVRKL.TE.TLSG---------------NHS..VSTVDMIAGLNRQLVGWAAFYKFTDFTAYVFRRID
A6TVZ8_ALKMQ/227-305---------LKKITRKI.KE.TI.R---------------INIM.QKQEILIYRLNQIIRGWCNYHNHV.CAKKTFQTLD
B4S5R5_PROA2/311-390---------LKAMRQTI.RG.WHIQ---------------LRCD.RNLQELAARFNAVLRGWHCYYGKF.HGSAMSVIW.
Q89BF9_BRADU/341-418---------VRRLLRQV.HD.RTTR---------------QWYP.DSPENTVAVINRFLRGWCGYFDQG.PVVETYNLIR
A9BGC0_PETMO/340-419---------IKEFKKKL.KG.ETKR---------------S.SG.RSMAYRLSRIKQIITGWTNYYGIA.NMKSVAGSLD
Q5ZWK4_LEGPH/357-435---------VKALKLKV.KT.MI.T---------------KLCT.AKQEEVIGVLNPIIRGWANYHHHI.VAKETFTKVD
A5G3H6_GEOUR/335-414---------AARLKANL.KT.IFRR---------------G.RG.QNIQTTVEETTPKLRGWLNYFRYA.EVKGIFEELD
A6TNL0_ALKMQ/222-301---------IKSLIRKC.SI.IILK---------------EGKA.STQSELIRRLNLVLKGWTNYHKHA.VASHAFSYIN
A9B272_HERA2/344-422---------QRTFLATI.RA.TI.K---------------ANMA.LDAEKLIRLLNPIISGWTAYHHHV.VSKAVFQSMG
Q0S063_RHOSR/344-424---------VRHARERI.RE.LTDR---------------SRLL.LPTEVVVQDLNLFLNGWAAYFKYG.NSAHRFGVIR
B4S633_PROA2/313-392---------GKRIRQEV.RS.WKLH---------------LRSD.KALEDLARMFNAHIRGWVNYYSVF.YKSALYPTL.
A5FDH6_FLAJ1/334-413---------YGKLKDRL.KE.ITNR---------------S.NG.MGYEKIKELLRYYLQGWISYFKLA.DMSNKIKRID
Q877J2_PSESM/334-413---------LQVFKHRI.RG.LTPR---------------S.GG.RSLPQVVENLRPYLLGWKAYFGLS.QAPGLWKSLD
Q1LRT7_RALME/348-426---------AQAFYRKV.KE.VI.S---------------ANKT.VKQEVIIRLLNPMLRGWAQYHSPV.VAKEAFSKMQ
Q8A4I2_BACTN/337-416---------KNKMKSKL.KE.LTSR---------------S.NG.WGYEKRKQKLKDYIRGWIAYFCLA.QMKRLCIETD
Q24WW9_DESHY/303-382---------IRKLKDKI.RE.VTGR---------------S.NG.MGIEERKTKLNQVVRGWTNYFKLA.DAKSQLKEID
Q5ZTU1_LEGPH/340-418---------IKSVQMKI.KE.TV.K---------------KGYG.WKGSELISALNPIIKGWANYHRKV.VSKATFSELD
A8KXN1_FRASN/320-396---------VASFSREM.RD.LRLH---------------RRTN.LTLDQLAADINPKVAGWLEYFTMF.YPSVVLPIG.
Q8YLU0_NOSS1/360-436---------TSSIKAKV.KE.VMKD---------------SC...FTLEERIDKCGAIVRGWRNYHRFCDMSQHNLWAIA
Q8TMH8_METAC/132-210---------IESITQKI.KN.IV.S---------------KAKA.WTQEELIKTLNPIIRGWANYHRHI.VAKNAFKKLD
Q73IV1_WOLPM/33-111---------IKQHTFAI.KH.KL.R---------------EMRG.APQEVIIRNLNPINRGWSQYYSSV.VSCKIFSSLD
A0LB55_MAGSM/355-433---------ISNLLEKV.RE.II.K---------------SHKS.STAGGLILLLNPIIRGWANYHRHV.VSGRVFARVD
Q1XGD2_PHYPA/395-473---------IMSLKWKI.KN.VF.S---------------ENIG.LSPYQMIKLVNPILHGWGNYFGIG.NFLRTFSLLD
A0LN71_SYNFM/335-414---------VDRMKAKL.RE.QFRM---------------G.RG.RNIRRVIEELTPVLRGWVNYFRLS.EVKGNFEELD
Q8A4Z2_BACTN/144-223---------KEKFKRKV.KS.LTRR---------------S.NS.MGYAQRKEILWQTFRGWIGYFKYA.DMRSLLIPLD
A0L6Q1_MAGSM/246-325---------SKSLRQTI.RREWKLQ---------------ARSQ.HSIEELARRLNPVITGWINYYGRF.CRSEMHSVL.
Q2FSK1_METHJ/343-421---------IAAIIDKV.RV.II.K---------------SAKA.WKQEDLIKALNPVIKGWAMYHRTV.SASMTFGKLD
Q8A4I4_BACTN/315-393---------MKRINETM.RS.WHLN---------------RHSN.LTLEHLASDINPIVRGWMTYYGKF.YPTRLKWFM.
Q12UG1_METBU/382-460---------IKKVTEKI.SN.TI.K---------------DGKT.WTQEDLISKLNPIITGWSNYHQGV.ASKETFSLID
Q97DG3_CLOAB/341-420---------VKKFKAKI.KA.ITAR---------------S.NA.LNIENRIIKLRQCIIGWLNYFGIA.EMTKLAKKLD
A4VK83_PSEU5/236-310---------LKRMRQTV.RR.WRLN---------------SQTH.VTLADVARLYNPVIQGWWHYYGSF.YRTSMLGIF.
B1WUX9_CYAA5/411-490---------LKKHHEKL.RK.IV.R---------------SEKA.SKQEVLIRKLNSVIRGWTNFYSTV.CSKDSFETQD
H7C6G6_BRADU/312-386---------LKEMRARI.RG.WRLP---------------QHSP.LPLEDIARSLSPVLRGWDQYYGRF.YPTELR.RLY
K9VRU2_9CYAN/350-428---------VKLFLREI.RE.WL.K---------------TNKH.ASPEAVIQYLNPRIRGWGNYYKHG.VSSEVFSYVD
Q07XH3_SHEFN/53-128---------...FLSNL.RE.LI.K---------------KHAT.IPVNDLIKLINPKLRGWANYYRHC.VAKQVFGYVG
Q327G1_SHIDS/276-351---------MRKITETI.KK.WRIH---------------RSTA.ESLLDFARRYNAIVRGWIEYYGKF.WSRNFNYRLW
Q5P2A1_AROAE/198-269---------.TAMRQKT.RK.LNYR---------------NRTD.LSLADIARLHNPLLRGWLEYYGKF.CRSAMYPVL.
Q81CU7_BACCR/354-431---------.QKAKKKI.GD.TL.R---------------VMRG.QPIGEIIRVLNPIIRGYGQYWKHV.VSKKIFGTMD
Q8DN10_STRR6/196-267---------VRRFKLKL.KK.LTQR---------------K.WS.IDLTRRIEQLNLSIRGWINYFSLG.NMKSIVASID
Q92VS5_RHIME/317-391---------LKSMRATI.KS.LNIP---------------RQTP.GTLAEIAKQLNPLLRGWIAYYGRY..SRSALSTLA
Q9JWR9_BACHD/287-360---------VKRLKQRI.RE.LTSR---------------RH.S.MKMSDRLRRLNRYLTGWLGYYQLV.DTPSILAQID
Q9X2X8_BACAN/356-434---------VKKAKEKI.SE.IF.K---------------SHRG.RSIGQLIRKLNPVITGIANYWSPV.VAKVIYGDID
U5L565_9BACI/302-378---------.QRLETKL.LK.LTNR---------------N.WG.VSMTYRILKINQLIQGWGNYFKVG.DIKSYAEDID

PF01348

MATK_HORVD/363-488YILRLSCARTLARKHKS-------.T-----------VRTFMQR-----LG..............SAFL.EEFFTEEEQV
Q02718_PODAN/556-712FLIHHSCAKTIARKLNL-------PN-----------RAQAFNK-----FGRYLT...APGEGKLKPMELFTLDSFKKTT
AI1M_YEAST/602-759YVLYYSCVLTLASKYRL-------KT-----------MSKTIKK-----FGYNLNI..IENDKLIANFPRNTFDNIKKIE
AI2M_YEAST/638-781YILFYSCCLTLARKFKL-------NT-----------VKKVILK-----FG...........KVLVDPHSKVSFSIDD.F
YMC6_SCHPO/585-715FIIKDCVLRTLAHKLSL-------GT-----------RMKVIKK-----FG..............PDLSIYDYNSRDENN
Q02717_PODAN/553-707WILRKSLAKTLATKLKL-------GT-----------VRKVYLK-----FGVNLRFEILGTDNKSIEFTKGNLLPTPKNF
D7KRD4_ARALL/382-502YILRLCCVKTLARKHKS-------.T-----------VRAFLKR-----LG..............SGLL.EEFLTGEDQV

PF08388

Q8DMT0_THEEB/344-422FATWHKLWRWARRRHPN.......KP...........AQWVKDK.....YF-----------------------------
Q118Z9_TRIEI/28-106MLLWKRIGQWAMRRHPN.......KL...........AKWVKKK.....YF-----------------------------
Q8TH39_METAC/313-391KHMNRALTRWALRKYKK....................LSGHKRRA..RY.W-----------------------------
Q92V78_RHIME/332-411EWMRHRVRAIQLKHWKR.......GK..........TTYKALLA.....KG-----------------------------
A1T776_MYCVP/353-435HYVTRRLKELLIKKRGR....................NLRAGQADQWTEEW-----------------------------
Q1XA93_PARBD/411-489NAIYHLIWKWAHNKHKK.......WG...........KKLIAKT.....YL-----------------------------
A6TN43_ALKMQ/221-299HRIWEMLWKWAKRRHPN.......KN...........KHWIKDK.....YW-----------------------------
A6WZI3_OCHA4/335-414GWVHRKLRATLWRQWTK.......PA..........ARARNLMQ.....RG-----------------------------
Q5L096_GEOKA/288-367GWIRRRLRMCQWKEWKL.......PR..........TRVRKLQS.....LG-----------------------------
A6L278_BACV8/349-427WEIFKKIWQWARRRHPQ.......KC...........KGWVKDK.....YF-----------------------------
Q121L7_POLSJ/346-425SLIYWRLMRWGMRTHPR.......KT...........AGWVYGH.....YW-----------------------------
Q6LJ59_PHOPR/129-208CWLRRRLRSIQLKLWKK.......PQ..........RLHRWLKQ.....QG-----------------------------
A8MI91_ALKOO/292-371GWIRRRLRMIKLKQWKT.......YK..........AMHKDMRK.....EG-----------------------------
Q67R28_SYMTH/286-365GWLKRRLRACVWRQWKR.......VR..........TRFRELRA.....LG-----------------------------
A6L5N4_BACV8/347-425YLIFEKLWQWATRRHPK.......KG...........KYWIADR.....YF-----------------------------
A4XCB1_SALTO/367-443NFIWKRVIRMLIARHRW....................SWTDVRR.....HF-----------------------------
A5VHP4_LACRD/329-408KWLRARIRQYIWKQWKK.......LK..........TKVTNLQK.....LG-----------------------------
Q119D3_TRIEI/365-444HLLTLKLIAWGKSRHHH.......KS...........IKETIKK.....YF-----------------------------
Q8TM71_METAC/31-109DTVYNMLISWAKRRHSN.......KG...........LTWIMTK.....YW-----------------------------
Q7NP80_GLOVI/345-423RTLYMQLKAWATSHHRN.......QS...........QKWLARK.....YW-----------------------------
Q10VN2_TRIEI/308-393HEIWKSLWQWSLRRHSKRVGKQKGKG...........KEWVRKK.....YF-----------------------------
A0L945_MAGSM/330-405NWVERKMRRHLMRARV.....................RRGFGWN.....RW-----------------------------
Q1XGB6_PHYPA/398-476HDIFQKIRAWVYRRHPT.......WG...........RDKIKQK.....YF-----------------------------
Q82RB7_STRAW/349-427AHTFEVLKRWAMRRHRR.......KP...........WGWIKRR.....YW-----------------------------
A4VKJ2_PSEU5/358-436SLIFWRLWRWAKRRHPR.......KS...........ADWIRKK.....YF-----------------------------
A1BAQ8_PARDP/313-391RLIDAHLVRWVMRKYKR....................FKQRPRQA..RL.W-----------------------------
B4SCG3_PELPB/311-390QHMNYYLAHWMMRKYKQ....................LSGHKTRA..SRKL-----------------------------
Q10VN3_TRIEI/334-413NLIFQKLWGWAKRRHPN.......QN...........NHWIYQK.....YW-----------------------------
A1BGI0_CHLPD/311-387HHVNLYLTRWLMRKYQK....................YAGRLKR....A.V-----------------------------
A4FC41_SACEN/223-301QRINAYLMRWIRKKYKR....................LRQSKKAK..AC.W-----------------------------
Q92Y56_RHIME/377-468WYIGLRLYCWLHKKRPK.......ATPSELWGSKQPSRRRATRR.....VW-----------------------------
Q3B1V7_PELLD/340-418HEVWSMLWKWAKRRHPN.......KG...........LRWIMDK.....YF-----------------------------
Q89TI6_BRADU/98-173RHVFDRVLAFLRRRHK.....................TPGRGVR.....RF-----------------------------
A5CZB8_PELTS/292-371EWIRRRLRMKQMKEWKS.......WR..........PLHKALRR.....RG-----------------------------
Q2LRA6_SYNAS/211-289KNINGYLIRCVRRKYKR....................FASHKKQA..RC.Y-----------------------------
Q01P79_SOLUE/337-416RWVRLRLRAAMWRQWKT.......PR..........RRRAALLE.....LG-----------------------------
Q8YJX0_NOSS1/384-462TTLFSQLKAWAEHRHPN.......KS...........SRWSCQK.....YW-----------------------------
Q81ZI4_NITEU/301-380EWIRRRVRMCYWKQWRW.......AR..........TKIRHLLD.....LG-----------------------------
Q024N3_SOLUE/339-417RYVQGRLIQHLQRRSQR.......PY..........RPPQGES.......W-----------------------------
Q2SF99_HAHCH/347-425AQLWHALWRWARRRHSK.......KG...........KRWIASR.....YW-----------------------------
Q0VRW5_ALCBS/345-423YRIWKMLWQWCRRRHLN.......RR...........KRWVKNK.....YF-----------------------------
Q0RWF2_RHOSR/343-419IFVWHRIARWWIRLHRW....................SWTDLRR.....HL-----------------------------
Q2JAX6_FRASC/343-420RFAQVRLARFVRARHRR....................SMGFGWR.....VL-----------------------------
Q7UY81_RHOBA/354-431GMVRKRLRRQLLKRHRR.......N...........PQRLCRTH.....RW-----------------------------
A6TTG9_ALKMQ/237-315DCVERRIVKWAMCKFKN....................FRGHRRRA...EKW-----------------------------
Q11ZP2_POLSJ/335-414SWTRHRLRAIQLKHWRV.......GT..........TVYSRLRS.....LG-----------------------------
A4YPB0_BRASO/18-96EWIRRRLRAVVWTQWKH.......GR..........TRFDELQR.....RG-----------------------------
A4G3U3_HERAR/349-427HLLFWRLMRWAKRRHPK.......KN...........ADWIRQR.....YW-----------------------------
Q1D1V6_MYXXD/324-399HHVELKVRRFAAKRAK.....................RGGFGWK.....RW-----------------------------
A6TKY0_ALKMQ/313-390SCVNLSLARWMMKKSKR......YKN...........KFMAALR.....RL-----------------------------
A6X7I7_OCHA4/354-431HVVFWKMAHWLGHKYRS....................RIKPLMR.....KW-----------------------------
A6TVZ8_ALKMQ/227-305KNIFRYLWLWAKRRHPM.......KP...........KKWRKSK.....YF-----------------------------
B4S5R5_PROA2/311-390RHMNMYLARWLMRKYKH....................LAGHKTRA..TKAL-----------------------------
Q89BF9_BRADU/341-418QYVDRRLRHWLVQRTGA....................RGRGFNR.....YS-----------------------------
A9BGC0_PETMO/340-419GWLRRRIRMCIWKEWKK.......IK..........TKHENLVK.....LG-----------------------------
Q5ZWK4_LEGPH/357-435HFIWRSLRCWACRRHPN.......KN...........LRWVKQR.....YY-----------------------------
A5G3H6_GEOUR/335-414GWLRRKLRRILWKQWKR.......PK..........TRAKKLMR.....RG-----------------------------
A6TNL0_ALKMQ/222-301NILYLLLQRWVKHRHPN.......KN...........QWWRLHR.....YW-----------------------------
A9B272_HERA2/344-422HAIYQALWRWAKRRHAN.......KP...........KRWIKEK.....YF-----------------------------
Q0S063_RHOSR/344-424EYVRMRMALFIGKRHKR.......SR..........SFGWHVVA.....YA-----------------------------
B4S633_PROA2/313-392RHIDRKLTLWATRKFKR....................LKGHRRRA..THVL-----------------------------
A5FDH6_FLAJ1/334-413EWLRFRIRMLIWKSWKK.......IS..........TKYNNLKK.....IG-----------------------------
Q877J2_PSESM/334-413GWIRRRLRAIQLKQWKT.......GK..........TTYRELRK.....LG-----------------------------
Q1LRT7_RALME/348-426SRVFRALLWWTKRRHRG.......KN...........AEWVRKK.....YF-----------------------------
Q8A4I2_BACTN/337-416EWLRRRIRMCIWKSWKN.......AK..........TRVANLKK.....CG-----------------------------
Q24WW9_DESHY/303-382EWMRSRIRMVAWKQWKR.......IR..........SRYDYLKK.....AG-----------------------------
Q5ZTU1_LEGPH/340-418NYIYQETFRWTMRKFSG.......HN...........RYKAMDR.....YF-----------------------------
A8KXN1_FRASN/320-396TRIDSHLVRWARKKYKR....................LTRSERR....A.W-----------------------------
Q8YLU0_NOSS1/360-436YWTWKFIRKQGRYNRDQ....................TNQVIHR.....AF-----------------------------
Q8TMH8_METAC/132-210HYLWRVTWQWGKRRHPN.......KG...........HKWVASK.....YW-----------------------------
Q73IV1_WOLPM/33-111NTIHRKLWKWAVFRHPN.......KG...........KCWIKRK.....YF-----------------------------
A0LB55_MAGSM/355-433HAIWQAIWAWAVRRHPK.......KS...........KKWVRSK.....YF-----------------------------
Q1XGD2_PHYPA/395-473HWIWHRSWRYLHRKFSK.......TP...........RPRLVSR.....FY-----------------------------
A0LN71_SYNFM/335-414EWIRRKFRCIIWRQWKR.......TY..........TRAKNMMK.....CG-----------------------------
Q8A4Z2_BACTN/144-223QWYRRHLRMCIWKCWKR.......VK..........TRFSNLQK.....CG-----------------------------
A0L6Q1_MAGSM/246-325DRINTALAFWAMRKFKK....................LRGHKTRA..HK.W-----------------------------
Q2FSK1_METHJ/343-421WVVRNMLWRWAKRRHNN.......KG...........KRWIARK.....YW-----------------------------
Q8A4I4_BACTN/315-393QTLNGRLARWVMCKFER....................YRHRFYPA..QE.W-----------------------------
Q12UG1_METBU/382-460FKIWNILWKWAKRRHPM.......KS...........RTWIAHK.....YW-----------------------------
Q97DG3_CLOAB/341-420EWTRRRLRMCYWKQWKK.......VK..........TKYDNLRK.....FG-----------------------------
A4VK83_PSEU5/236-310QHIDRALERWARRKYKA....................LHRRKRR.......-----------------------------
B1WUX9_CYAA5/411-490HLLFSCLVRWAKRRHPR......IKS...........WNKVKNK.....YW-----------------------------
H7C6G6_BRADU/312-386EYFDERLGAWLRCKYKQ.......LKG.........HRGR...........-----------------------------
K9VRU2_9CYAN/350-428HQIFQAIWKWSLSRHPN.......KG...........KKWVAGK.....YF-----------------------------
Q07XH3_SHEFN/53-128HKLFYSLWHWAVRRHPT.......KS...........KTWVALK.....YF-----------------------------
Q327G1_SHIDS/276-351SAMQSRLLKWMQSKYRL.......SN...........RKAQR.........-----------------------------
Q5P2A1_AROAE/198-269RHFNKTLVAWAMKKYRR.......LK...........GHK...........-----------------------------
Q81CU7_BACCR/354-431SYIYWRIGKHLRQLHPK.......KS...........WKWIYAR.....YY-----------------------------
Q8DN10_STRR6/196-267ERLRTRLRVIIWKQWKK.......KS...........RR............-----------------------------
Q92VS5_RHIME/317-391DYVNQKLRAWIRRKFKR....................FQSHKTR.......-----------------------------
Q9JWR9_BACHD/287-360AWIRRRLRMIRWKEWKT.......TS..........ARQK...........-----------------------------
Q9X2X8_BACAN/356-434SYVHKKVMHHLKYKHHR.......KG...........ARWINKK.....YF-----------------------------
U5L565_9BACI/302-378KHIRRRLRACLWKQWKK......IKT...........KYKNLRK.......-----------------------------

PF01348

MATK_HORVD/363-488............FSLMFTKTTLFSFS
Q02718_PODAN/556-712SLLKS...YVTNPVDPFTITNWSLRT
AI1M_YEAST/602-759NHGMFMYMSEAKVTDPFEYIDSIKYM
AI2M_YEAST/638-781KIRHKMNMTDSNYTPD.EILDRYKYM
YMC6_SCHPO/585-715..K.......PKLITQLFKPSWKVNV
Q02717_PODAN/553-707KGK.......TNFVDNLKVVEWSLRT
D7KRD4_ARALL/382-502............LSLIFPRSYYA...

PF08388

Q8DMT0_THEEB/344-422--------------------------
Q118Z9_TRIEI/28-106--------------------------
Q8TH39_METAC/313-391--------------------------
Q92V78_RHIME/332-411--------------------------
A1T776_MYCVP/353-435--------------------------
Q1XA93_PARBD/411-489--------------------------
A6TN43_ALKMQ/221-299--------------------------
A6WZI3_OCHA4/335-414--------------------------
Q5L096_GEOKA/288-367--------------------------
A6L278_BACV8/349-427--------------------------
Q121L7_POLSJ/346-425--------------------------
Q6LJ59_PHOPR/129-208--------------------------
A8MI91_ALKOO/292-371--------------------------
Q67R28_SYMTH/286-365--------------------------
A6L5N4_BACV8/347-425--------------------------
A4XCB1_SALTO/367-443--------------------------
A5VHP4_LACRD/329-408--------------------------
Q119D3_TRIEI/365-444--------------------------
Q8TM71_METAC/31-109--------------------------
Q7NP80_GLOVI/345-423--------------------------
Q10VN2_TRIEI/308-393--------------------------
A0L945_MAGSM/330-405--------------------------
Q1XGB6_PHYPA/398-476--------------------------
Q82RB7_STRAW/349-427--------------------------
A4VKJ2_PSEU5/358-436--------------------------
A1BAQ8_PARDP/313-391--------------------------
B4SCG3_PELPB/311-390--------------------------
Q10VN3_TRIEI/334-413--------------------------
A1BGI0_CHLPD/311-387--------------------------
A4FC41_SACEN/223-301--------------------------
Q92Y56_RHIME/377-468--------------------------
Q3B1V7_PELLD/340-418--------------------------
Q89TI6_BRADU/98-173--------------------------
A5CZB8_PELTS/292-371--------------------------
Q2LRA6_SYNAS/211-289--------------------------
Q01P79_SOLUE/337-416--------------------------
Q8YJX0_NOSS1/384-462--------------------------
Q81ZI4_NITEU/301-380--------------------------
Q024N3_SOLUE/339-417--------------------------
Q2SF99_HAHCH/347-425--------------------------
Q0VRW5_ALCBS/345-423--------------------------
Q0RWF2_RHOSR/343-419--------------------------
Q2JAX6_FRASC/343-420--------------------------
Q7UY81_RHOBA/354-431--------------------------
A6TTG9_ALKMQ/237-315--------------------------
Q11ZP2_POLSJ/335-414--------------------------
A4YPB0_BRASO/18-96--------------------------
A4G3U3_HERAR/349-427--------------------------
Q1D1V6_MYXXD/324-399--------------------------
A6TKY0_ALKMQ/313-390--------------------------
A6X7I7_OCHA4/354-431--------------------------
A6TVZ8_ALKMQ/227-305--------------------------
B4S5R5_PROA2/311-390--------------------------
Q89BF9_BRADU/341-418--------------------------
A9BGC0_PETMO/340-419--------------------------
Q5ZWK4_LEGPH/357-435--------------------------
A5G3H6_GEOUR/335-414--------------------------
A6TNL0_ALKMQ/222-301--------------------------
A9B272_HERA2/344-422--------------------------
Q0S063_RHOSR/344-424--------------------------
B4S633_PROA2/313-392--------------------------
A5FDH6_FLAJ1/334-413--------------------------
Q877J2_PSESM/334-413--------------------------
Q1LRT7_RALME/348-426--------------------------
Q8A4I2_BACTN/337-416--------------------------
Q24WW9_DESHY/303-382--------------------------
Q5ZTU1_LEGPH/340-418--------------------------
A8KXN1_FRASN/320-396--------------------------
Q8YLU0_NOSS1/360-436--------------------------
Q8TMH8_METAC/132-210--------------------------
Q73IV1_WOLPM/33-111--------------------------
A0LB55_MAGSM/355-433--------------------------
Q1XGD2_PHYPA/395-473--------------------------
A0LN71_SYNFM/335-414--------------------------
Q8A4Z2_BACTN/144-223--------------------------
A0L6Q1_MAGSM/246-325--------------------------
Q2FSK1_METHJ/343-421--------------------------
Q8A4I4_BACTN/315-393--------------------------
Q12UG1_METBU/382-460--------------------------
Q97DG3_CLOAB/341-420--------------------------
A4VK83_PSEU5/236-310--------------------------
B1WUX9_CYAA5/411-490--------------------------
H7C6G6_BRADU/312-386--------------------------
K9VRU2_9CYAN/350-428--------------------------
Q07XH3_SHEFN/53-128--------------------------
Q327G1_SHIDS/276-351--------------------------
Q5P2A1_AROAE/198-269--------------------------
Q81CU7_BACCR/354-431--------------------------
Q8DN10_STRR6/196-267--------------------------
Q92VS5_RHIME/317-391--------------------------
Q9JWR9_BACHD/287-360--------------------------
Q9X2X8_BACAN/356-434--------------------------
U5L565_9BACI/302-378--------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window