Sequence alignment for CL0361

PF00096

LOLA1_DROME/791-814--------------------Y------E----------------------------------------------------
ZNF91_HUMAN/238-260--------------------Y------K----------------------------------------------------
ZNF17_HUMAN/442-464--------------------Y------E----------------------------------------------------
SDC1_CAEEL/268-290--------------------Y------F----------------------------------------------------
ZN592_HUMAN/1043-1069--------------------Y------T----------------------------------------------------
SDC1_CAEEL/652-674--------------------V------V----------------------------------------------------
SDC1_CAEEL/145-168--------------------Y------M----------------------------------------------------
SDC1_CAEEL/117-139--------------------L------T----------------------------------------------------
ZEP1_HUMAN/959-982--------------------F------E----------------------------------------------------
SDC1_CAEEL/233-254--------------------S------S----------------------------------------------------
MZF1_HUMAN/412-434--------------------F------V----------------------------------------------------
ZSC22_HUMAN/352-374--------------------Y------K----------------------------------------------------
EVI1_HUMAN/217-239--------------------I------K----------------------------------------------------
EVI1_HUMAN/21-44--------------------Y------R----------------------------------------------------
EVI1_HUMAN/131-154--------------------Y------E----------------------------------------------------
EVI1_HUMAN/790-812--------------------F------K----------------------------------------------------
EVI1_HUMAN/761-784--------------------Y------R----------------------------------------------------
ZN239_MOUSE/6-28--------------------Y------K----------------------------------------------------
EVI1_HUMAN/75-97--------------------Q------E----------------------------------------------------
INSM1_HUMAN/441-464--------------------H------L----------------------------------------------------
ZNF76_HUMAN/285-309--------------------Y------T----------------------------------------------------
ADR1_YEAST/104-126--------------------F------V----------------------------------------------------
KRUH_DROME/299-321--------------------F------E----------------------------------------------------
P43_XENBO/45-69--------------------W------K----------------------------------------------------
ZFA_MOUSE/513-536--------------------Y------E----------------------------------------------------
P43_XENBO/220-245--------------------L------P----------------------------------------------------
SUHW_DROME/319-341--------------------F------P----------------------------------------------------
SUHW_DROAN/221-243--------------------H------V----------------------------------------------------
ZG29_XENLA/62-84--------------------F------V----------------------------------------------------
TYY1_HUMAN/296-320--------------------I------A----------------------------------------------------
RGM1_YEAST/19-44--------------------Y------R----------------------------------------------------
ZO2_XENLA/34-59--------------------Y------S----------------------------------------------------
TF3A_ANAAE/12-36--------------------F------I----------------------------------------------------
ZFA_MOUSE/570-593--------------------H------Q----------------------------------------------------
ESCA_DROME/344-366--------------------F------S----------------------------------------------------
GP_DUGBA/768-790--------------------C------V----------------------------------------------------
SUHW_DROME/523-545--------------------F------P----------------------------------------------------
ZG8_XENLA/146-168--------------------F------T----------------------------------------------------
ZG28_XENLA/174-196--------------------F------T----------------------------------------------------
CTCF_CHICK/555-577--------------------F------V----------------------------------------------------
CI_DROME/451-476--------------------T------N----------------------------------------------------
TERM_DROME/323-346--------------------L------H----------------------------------------------------
IKZF1_MOUSE/488-512--------------------F------E----------------------------------------------------
TRA1_CAEEL/337-362--------------------Y------S----------------------------------------------------
INSM1_HUMAN/367-390--------------------Y------E----------------------------------------------------
ZNF76_HUMAN/225-249--------------------Y------K----------------------------------------------------
GP_PHV/549-571--------------------M------V----------------------------------------------------
HUNB_DROME/269-291--------------------L------Q----------------------------------------------------
XFIN_XENLA/1276-1298--------------------Y------G----------------------------------------------------
XFIN_XENLA/1044-1066--------------------Y------K----------------------------------------------------
CF2_DROME/429-451--------------------F------R----------------------------------------------------
ZEB1_CHICK/268-292--------------------Y------E----------------------------------------------------
P43_XENBO/106-130--------------------L------K----------------------------------------------------
TF3A_ANAAE/72-97--------------------C------K----------------------------------------------------
ZG5_XENLA/185-207--------------------F------I----------------------------------------------------
SUHW_DROME/290-313--------------------I------N----------------------------------------------------
ZG44_XENLA/5-27--------------------F------A----------------------------------------------------
BNC1_HUMAN/720-743--------------------F------Q----------------------------------------------------
ZFA_MOUSE/542-564--------------------F------K----------------------------------------------------
IKZF1_MOUSE/200-223--------------------H------K----------------------------------------------------
SRYC_DROME/358-380--------------------Y------Q----------------------------------------------------
YKQ8_CAEEL/51-74--------------------F------R----------------------------------------------------
ZEP2_RAT/1818-1842--------------------Y------V----------------------------------------------------
TSH_DROME/466-490--------------------L------K----------------------------------------------------
ZFA_MOUSE/456-479--------------------H------K----------------------------------------------------
P43_XENBO/163-187--------------------Y------R----------------------------------------------------
HUNB_DROME/240-262--------------------Y------K----------------------------------------------------
ZG52_XENLA/61-83--------------------Y------T----------------------------------------------------
YKQ8_CAEEL/78-102--------------------Y------K----------------------------------------------------
ZFP60_MOUSE/484-506--------------------F------E----------------------------------------------------
ZO28_XENLA/62-84--------------------Y------M----------------------------------------------------
KLF9_RAT/203-225--------------------F------R----------------------------------------------------
TRA1_CAEEL/306-331--------------------Y------K----------------------------------------------------
BNC1_HUMAN/928-951--------------------I------T----------------------------------------------------
TF3A_ANAAE/219-244--------------------Y------R----------------------------------------------------
P43_XENBO/75-100--------------------H------S----------------------------------------------------
TSH_DROME/354-378--------------------F------R----------------------------------------------------
YL57_CAEEL/26-49--------------------Y------L----------------------------------------------------
ZFA_MOUSE/393-415--------------------Y------R----------------------------------------------------
ACE2_YEAST/603-627--------------------F------E----------------------------------------------------
ZG46_XENLA/258-280--------------------Y------K----------------------------------------------------
ZBT48_HUMAN/319-342--------------------F------E----------------------------------------------------
TYY1_HUMAN/383-407--------------------Y------V----------------------------------------------------
XFIN_XENLA/503-525--------------------H------K----------------------------------------------------
SRYB_DROME/171-195--------------------I------P----------------------------------------------------
SRYD_DROME/194-217--------------------Q------E----------------------------------------------------
SRYD_DROME/251-273--------------------K------Q----------------------------------------------------
ESCA_DROME/370-392--------------------C------K----------------------------------------------------
DISC_DROME/92-115--------------------V------Q----------------------------------------------------
SUHW_DROAN/349-373--------------------Y------A----------------------------------------------------
ZTF1_CAEEL/213-235--------------------Y------A----------------------------------------------------
SUHW_DROME/596-619--------------------T------D----------------------------------------------------
KRUP_DROME/222-244--------------------F------T----------------------------------------------------
ZG46_XENLA/146-168--------------------Y------V----------------------------------------------------
SDC3_CAEEL/2117-2141--------------------D------D----------------------------------------------------
PACC_YEAST/182-206--------------------L------N----------------------------------------------------
KRUP_DROME/306-328--------------------Y------T----------------------------------------------------
ZFA_MOUSE/684-707--------------------Y------Q----------------------------------------------------
TTKB_DROME/538-561--------------------Y------P----------------------------------------------------
TF3A_ANAAE/104-128--------------------Y------V----------------------------------------------------
CKR1_CHICK/169-191--------------------H------K----------------------------------------------------
ZO71_XENLA/289-311--------------------Y------S----------------------------------------------------
SRYC_DROME/470-493--------------------F------K----------------------------------------------------
ZNF76_HUMAN/165-189--------------------F------R----------------------------------------------------
ZG3_XENLA/6-28--------------------F------M----------------------------------------------------
SUHW_DROME/380-402--------------------M------S----------------------------------------------------
FZF1_YEAST/12-36--------------------Y------K----------------------------------------------------
SNAI1_MOUSE/236-259--------------------Y------Q----------------------------------------------------
CF2_DROME/366-388--------------------H------K----------------------------------------------------
SRYD_DROME/223-245--------------------H------I----------------------------------------------------
ZFP59_MOUSE/270-292--------------------F------Q----------------------------------------------------
ESCA_DROME/426-449--------------------Y------S----------------------------------------------------
TSH_DROME/533-557--------------------L------T----------------------------------------------------
SAS3_YEAST/301-323--------------------F------I----------------------------------------------------
HUNB_DROME/733-757--------------------F------K----------------------------------------------------
TF3A_ANAAE/161-187--------------------Y------P----------------------------------------------------
GP_HANTB/541-563--------------------M------V----------------------------------------------------
TF3A_RANPI/73-98--------------------C------K----------------------------------------------------
ZFP59_MOUSE/438-459--------------------F------Q----------------------------------------------------
ZFA_MOUSE/713-736--------------------H------C----------------------------------------------------
FZF1_YEAST/72-94--------------------K------A----------------------------------------------------
INSM1_HUMAN/469-492--------------------F------P----------------------------------------------------
XFIN_XENLA/276-298--------------------F------R----------------------------------------------------
SFP1_YEAST/598-623--------------------F------K----------------------------------------------------
SRYC_DROME/299-321--------------------Y------R----------------------------------------------------
EGR1_HUMAN/396-418--------------------F------A----------------------------------------------------
CF2_DROME/401-423--------------------Y------T----------------------------------------------------
RPH1_YEAST/738-763--------------------H------S----------------------------------------------------
HUNB_DROME/325-349--------------------Y------R----------------------------------------------------
SRYD_DROME/405-428--------------------G------F----------------------------------------------------
ZFP59_MOUSE/326-348--------------------F------E----------------------------------------------------
HUNB_DROME/705-727--------------------Y------E----------------------------------------------------
ZO10_XENLA/1-23--------------------F------S----------------------------------------------------
SUHW_DROME/553-577--------------------F------S----------------------------------------------------
ZG32_XENLA/34-56--------------------F------V----------------------------------------------------
ZFP27_MOUSE/457-479--------------------Y------V----------------------------------------------------
FZF1_YEAST/155-179--------------------L------Q----------------------------------------------------
SRYC_DROME/414-436--------------------Y------R----------------------------------------------------
ZNF10_HUMAN/517-539--------------------Y------K----------------------------------------------------
YO14_CAEEL/280-304--------------------F------Y----------------------------------------------------
CF2_DROME/74-97--------------------H------Y----------------------------------------------------
CF2_DROME/485-508--------------------Y------T----------------------------------------------------
ZG52_XENLA/6-27--------------------F------T----------------------------------------------------
ESCA_DROME/309-331--------------------Y------Q----------------------------------------------------
P43_XENBO/136-160--------------------S------V----------------------------------------------------
ZFH1_DROME/383-407--------------------F------G----------------------------------------------------
SRYD_DROME/279-301--------------------Y------Q----------------------------------------------------
ESCA_DROME/398-420--------------------F------S----------------------------------------------------
ZFX_HUMAN/488-510--------------------I------E----------------------------------------------------
RGM1_YEAST/50-73--------------------F------Q----------------------------------------------------
SAS2_YEAST/101-123--------------------F------V----------------------------------------------------
ZO6_XENLA/6-29--------------------F------I----------------------------------------------------
ZFP60_MOUSE/344-366--------------------F------E----------------------------------------------------
RAD18_YEAST/188-210--------------------A------Q----------------------------------------------------
ZFP59_MOUSE/493-515--------------------F------E----------------------------------------------------
ZEP2_RAT/1790-1812--------------------Y------I----------------------------------------------------
ZFA_MOUSE/656-678--------------------F------R----------------------------------------------------
ZFP60_MOUSE/428-450--------------------Y------Q----------------------------------------------------
IKZF1_MOUSE/144-166--------------------F------Q----------------------------------------------------
ZO61_XENLA/62-84--------------------F------T----------------------------------------------------
ZN131_HUMAN/356-378--------------------F------E----------------------------------------------------
ZN12_MICSA/106-129--------------------Y------R----------------------------------------------------
XFIN_XENLA/136-158--------------------H------H----------------------------------------------------
ZFH1_DROME/628-651--------------------L------R----------------------------------------------------
RME1_YEAST/256-281--------------------L------N----------------------------------------------------
XFIN_XENLA/326-348--------------------Y------S----------------------------------------------------
HUNB_DROME/297-319--------------------F------Q----------------------------------------------------
ZG5A_XENLA/90-112--------------------F------S----------------------------------------------------
ZTF1_CAEEL/102-125--------------------Y------Y----------------------------------------------------
SP1_HUMAN/626-650--------------------H------I----------------------------------------------------
SRYD_DROME/308-330--------------------I------I----------------------------------------------------
REP2_SCHPO/175-197--------------------L------I----------------------------------------------------
ACE2_YEAST/633-657--------------------Y------S----------------------------------------------------
SUHW_DROME/413-435--------------------Y------M----------------------------------------------------
GLI1_HUMAN/235-260--------------------T------D----------------------------------------------------
TRA1_CAEEL/276-300--------------------N------K----------------------------------------------------
P43_XENBO/251-275--------------------H------R----------------------------------------------------
ADR1_YEAST/132-155--------------------Y------P----------------------------------------------------
SNAI1_XENLA/232-255--------------------Y------Q----------------------------------------------------
ZO20_XENLA/174-196--------------------F------M----------------------------------------------------
TTKB_DROME/508-531--------------------Y------R----------------------------------------------------
P43_XENBO/191-213--------------------L------Q----------------------------------------------------
ZG58_XENLA/174-196--------------------F------V----------------------------------------------------
GLI1_XENLA/283-310--------------------F------V----------------------------------------------------
PACC_YEAST/146-171--------------------L------Y----------------------------------------------------
MST2_SCHPO/132-154--------------------Y------I----------------------------------------------------
GLAS_DROME/493-515--------------------F------R----------------------------------------------------
BRLA_EMENI/350-375--------------------H------V----------------------------------------------------
P43_XENBO/15-39--------------------F------R----------------------------------------------------
ZNF76_HUMAN/345-368--------------------Y------T----------------------------------------------------
SNT2_SCHPO/888-910--------------------W------A----------------------------------------------------
TF3A_ANAAE/134-158--------------------F------K----------------------------------------------------
YL57_CAEEL/344-367--------------------D------H----------------------------------------------------
SNAI_DROME/362-385--------------------Y------A----------------------------------------------------

PF13894

A0NH35_ANOGA/1015-1038--------------------F......L----------------------------------------------------
A0NCH1_ANOGA/354-376--------------------V......T----------------------------------------------------
A4GZJ4_CAEEL/282-307--------------------F......A----------------------------------------------------
Q965P0_CAEEL/61-84--------------------F......N----------------------------------------------------
A8NSN6_COPC7/29-54--------------------I......D----------------------------------------------------
A8PGF1_COPC7/259-282--------------------P......L----------------------------------------------------
D2HAN7_AILME/599-622--------------------W......Q----------------------------------------------------
Q6GQ25_XENLA/587-610--------------------W......Q----------------------------------------------------
B8A455_DANRE/542-565--------------------W......L----------------------------------------------------
B2W740_PYRTR/11-34--------------------C......H----------------------------------------------------
Q8NIT8_NEUCS/230-253--------------------L......F----------------------------------------------------
A7EJ96_SCLS1/202-225--------------------L......F----------------------------------------------------
A8XJQ5_CAEBR/42-65--------------------F......K----------------------------------------------------
C3Z212_BRAFL/346-369--------------------C......R----------------------------------------------------
Q291B0_DROPS/1510-1533--------------------N......A----------------------------------------------------
B8MUF5_TALSN/21-47--------------------Y......K----------------------------------------------------
C5FKT3_ARTOC/84-107--------------------Y......L----------------------------------------------------
B6Q1Z1_PENMQ/146-169--------------------L......M----------------------------------------------------
B0WV05_CULQU/271-291--------------------Y......S----------------------------------------------------
LIN13_CAEEL/1140-1163--------------------L......M----------------------------------------------------
A1CPF7_ASPCL/67-95--------------------I......Y----------------------------------------------------
B2W6Q2_PYRTR/443-469--------------------M......I----------------------------------------------------
B0WBK5_CULQU/233-256--------------------L......F----------------------------------------------------
Q1RQ13_CIOIN/211-233--------------------R......M----------------------------------------------------
A8PFE0_BRUMA/212-236--------------------L......S----------------------------------------------------
B7PY09_IXOSC/14-37--------------------Y......K----------------------------------------------------
C3Y329_BRAFL/3520-3543--------------------Y......H----------------------------------------------------
B5DW36_DROPS/17-40--------------------F......K----------------------------------------------------
Q6CKJ9_KLULA/242-265--------------------F......V----------------------------------------------------
C4R4F4_PICPG/228-251--------------------Y......H----------------------------------------------------
A5E1B3_LODEL/342-365--------------------Y......P----------------------------------------------------
B0W9I5_CULQU/77-100--------------------F......V----------------------------------------------------
C4YDT8_CANAW/367-391--------------------M......K----------------------------------------------------
A3GFQ2_PICST/418-441--------------------F......C----------------------------------------------------
D3ZQP1_RAT/309-332--------------------F......P----------------------------------------------------
B0X5U5_CULQU/513-536--------------------F......F----------------------------------------------------
A2R6U4_ASPNC/549-574--------------------F......K----------------------------------------------------
Q7S4J1_NEUCR/544-568--------------------H......K----------------------------------------------------
Q17FQ4_AEDAE/276-299--------------------Y......Q----------------------------------------------------
B0XGW2_CULQU/146-169--------------------R......R----------------------------------------------------
A5AFF5_VITVI/646-669--------------------Y......E----------------------------------------------------
C5WV18_SORBI/125-148--------------------H......E----------------------------------------------------
P93718_PETHY/490-513--------------------H......A----------------------------------------------------
Q9FZE3_ARATH/9-32--------------------F......L----------------------------------------------------
O81013_ARATH/49-72--------------------H......F----------------------------------------------------
Q9FH19_ARATH/342-365--------------------H......V----------------------------------------------------
B6TUR2_MAIZE/56-79--------------------F......V----------------------------------------------------
Q9C538_ARATH/750-773--------------------Y......Q----------------------------------------------------
B8BNW0_ORYSI/202-227--------------------Y......M----------------------------------------------------
Q9LIB0_ARATH/272-295--------------------Y......R----------------------------------------------------
B9SFT1_RICCO/264-287--------------------Y......E----------------------------------------------------
D3B524_POLPA/660-686--------------------F......E----------------------------------------------------
Q4S7E8_TETNG/3067-3090--------------------Y......K----------------------------------------------------
D3YV32_MOUSE/144-167--------------------Y......E----------------------------------------------------
Q0UJG2_PHANO/219-242--------------------Y......E----------------------------------------------------
B9F9M3_ORYSJ/90-113--------------------A......E----------------------------------------------------
B8PDV2_POSPM/261-284--------------------C......K----------------------------------------------------
A8QCV2_BRUMA/110-133--------------------F......K----------------------------------------------------
B0W1F2_CULQU/55-78--------------------F......K----------------------------------------------------
B0WIX6_CULQU/541-564--------------------F......K----------------------------------------------------
D4D5V1_TRIVH/13-38--------------------F......P----------------------------------------------------
B2AUE7_PODAN/663-686--------------------F......A----------------------------------------------------
B4J0M2_DROGR/211-234--------------------F......K----------------------------------------------------
B6HX35_PENCW/210-235--------------------F......K----------------------------------------------------
B0W9W2_CULQU/276-299--------------------F......R----------------------------------------------------
C9SHV9_VERA1/258-281--------------------F......H----------------------------------------------------
B0W0M9_CULQU/1111-1134--------------------F......N----------------------------------------------------
A8MY94_HUMAN/109-134--------------------I......P----------------------------------------------------
D3ZQP1_RAT/733-756--------------------R......K----------------------------------------------------
Q9NVH8_HUMAN/341-364--------------------H......T----------------------------------------------------
A7EWF7_SCLS1/32-57--------------------H......L----------------------------------------------------
Q4S7T0_TETNG/254-277--------------------C......T----------------------------------------------------
Q17J87_AEDAE/269-292--------------------A......T----------------------------------------------------
B9GEM8_POPTR/144-167--------------------P......T----------------------------------------------------
B4MP67_DROWI/774-800--------------------V......E----------------------------------------------------
Q4S7E8_TETNG/3266-3289--------------------R......D----------------------------------------------------
C6LR00_GIAIB/6-29--------------------F......T----------------------------------------------------
B0WWV9_CULQU/174-197--------------------Y......T----------------------------------------------------
C9SFF6_VERA1/7-30--------------------H......P----------------------------------------------------
B0X9I8_CULQU/657-680--------------------T......Q----------------------------------------------------
A1DB40_NEOFI/968-991--------------------E......P----------------------------------------------------
ZB99_ENCCU/103-126--------------------F......G----------------------------------------------------
C3Y329_BRAFL/1089-1112--------------------Y......Q----------------------------------------------------
C3Y329_BRAFL/1782-1805--------------------Y......N----------------------------------------------------
C3Y329_BRAFL/1926-1949--------------------H......K----------------------------------------------------
C3Y329_BRAFL/1351-1374--------------------H......K----------------------------------------------------
C3Y9C8_BRAFL/33-57--------------------Y......C----------------------------------------------------
B4MUG7_DROWI/836-859--------------------Y......K----------------------------------------------------
SPR4_CAEEL/1022-1045--------------------L......K----------------------------------------------------
A8XE56_CAEBR/1256-1279--------------------I......K----------------------------------------------------
SPR4_CAEEL/1261-1284--------------------L......K----------------------------------------------------
B0WGK0_CULQU/145-168--------------------Y......K----------------------------------------------------
B0WWY3_CULQU/276-299--------------------L......Q----------------------------------------------------
B0WIX2_CULQU/324-347--------------------L......K----------------------------------------------------
C3Y329_BRAFL/1533-1556--------------------L......K----------------------------------------------------
Q335Q3_CHICK/298-323--------------------L......K----------------------------------------------------
B4PTC6_DROYA/256-279--------------------Y......K----------------------------------------------------
D2A5X4_TRICA/1149-1173--------------------F......K----------------------------------------------------
Q0IHR5_XENTR/425-448--------------------G......K----------------------------------------------------
B2B4J5_PODAN/315-339--------------------F......K----------------------------------------------------
B0X0S3_CULQU/4-27--------------------I......K----------------------------------------------------
A7MAY9_BOVIN/748-771--------------------L......T----------------------------------------------------
LIN13_CAEEL/1628-1651--------------------L......T----------------------------------------------------
A8WM54_CAEBR/1663-1686--------------------L......T----------------------------------------------------
A8Q8S1_BRUMA/338-364--------------------Q......N----------------------------------------------------
B1MTH1_CALMO/494-517--------------------F......R----------------------------------------------------
Q4TI39_TETNG/62-85--------------------Y......S----------------------------------------------------
Q1RLJ0_CIOIN/89-111--------------------Y......K----------------------------------------------------
A8QFN6_BRUMA/137-160--------------------I......L----------------------------------------------------
B7P2H2_IXOSC/22-45--------------------C......A----------------------------------------------------
Q9N5H8_CAEEL/137-165--------------------L......R----------------------------------------------------
C7F7U7_NASVI/331-351--------------------E......S----------------------------------------------------
Q4RER3_TETNG/1118-1141--------------------F......R----------------------------------------------------
B4MUG7_DROWI/360-383--------------------F......R----------------------------------------------------
B0W8E6_CULQU/277-300--------------------Y......N----------------------------------------------------
Q28BY5_XENTR/137-160--------------------Y......E----------------------------------------------------
B4KAQ7_DROMO/87-110--------------------L......G----------------------------------------------------
Q0CC56_ASPTN/205-227--------------------F......S----------------------------------------------------
Q5TPX2_ANOGA/236-256--------------------H......L----------------------------------------------------
B7PGT2_IXOSC/509-532--------------------C......V----------------------------------------------------
B4JJZ6_DROGR/2097-2122--------------------Y......G----------------------------------------------------
Q95UR7_SCHAM/277-300--------------------Y......E----------------------------------------------------
B0EKT6_ENTDS/350-373--------------------S......E----------------------------------------------------
Q2MHN3_MOUSE/974-997--------------------F......C----------------------------------------------------
B0W328_CULQU/277-300--------------------F......C----------------------------------------------------
B3KTX8_HUMAN/145-168--------------------F......C----------------------------------------------------
LIN13_CAEEL/2065-2095--------------------S......C----------------------------------------------------
A0NFD1_ANOGA/206-226--------------------S......L----------------------------------------------------
A7E543_SCLS1/388-411--------------------V......V----------------------------------------------------
B4P2L1_DROYA/1833-1856--------------------Q......K----------------------------------------------------
B0WCG2_CULQU/124-147--------------------Y......Q----------------------------------------------------
Q4V5B5_DROME/225-250--------------------F......K----------------------------------------------------
B4KAQ7_DROMO/150-175--------------------M......Q----------------------------------------------------
D2HFW9_AILME/74-97--------------------C......Q----------------------------------------------------
Q28J29_XENTR/108-131--------------------Y......Q----------------------------------------------------
A8XE56_CAEBR/389-412--------------------V......P----------------------------------------------------
B7P2H6_IXOSC/304-327--------------------F......P----------------------------------------------------
B0WHH3_CULQU/311-334--------------------V......Q----------------------------------------------------
Q26816_9TRYP/1447-1470--------------------V......Q----------------------------------------------------
A9V4I1_MONBE/4-27--------------------F......S----------------------------------------------------
Q0USV6_PHANO/218-241--------------------F......P----------------------------------------------------
A8X6T9_CAEBR/133-155--------------------S......V----------------------------------------------------
Q17Q26_AEDAE/208-234--------------------Q......S----------------------------------------------------
C7Z4W1_NECH7/365-388--------------------F......Q----------------------------------------------------
B4JJZ6_DROGR/1249-1273--------------------Y......H----------------------------------------------------
B4L6C6_DROMO/1465-1489--------------------H......K----------------------------------------------------
Q29IM1_DROPS/1596-1621--------------------Y......V----------------------------------------------------
B4NDK7_DROWI/1436-1460--------------------Y......T----------------------------------------------------
Q16V67_AEDAE/96-119--------------------V......T----------------------------------------------------
B4PZ76_DROYA/1477-1501--------------------F......T----------------------------------------------------
B3MS97_DROAN/1482-1506--------------------F......V----------------------------------------------------
B7QAQ8_IXOSC/115-138--------------------F......V----------------------------------------------------
SPR4_CAEEL/709-732--------------------F......Q----------------------------------------------------
Q179L1_AEDAE/57-80--------------------F......R----------------------------------------------------
A8Q4A3_BRUMA/250-275--------------------Y......R----------------------------------------------------
A8NTJ4_BRUMA/76-101--------------------Y......E----------------------------------------------------
Q17BB1_AEDAE/357-380--------------------Y......I----------------------------------------------------
A8NJE7_BRUMA/178-203--------------------Y......N----------------------------------------------------
A8NJE7_BRUMA/265-290--------------------F......E----------------------------------------------------
A8PDW7_BRUMA/76-101--------------------Y......E----------------------------------------------------
B8P8R6_POSPM/464-489--------------------Y......T----------------------------------------------------
C5JNN0_AJEDS/636-661--------------------F......T----------------------------------------------------
B3KPI7_HUMAN/359-384--------------------Y......K----------------------------------------------------
A8PHZ8_BRUMA/199-222--------------------F......A----------------------------------------------------
B7PT82_IXOSC/268-291--------------------F......A----------------------------------------------------
D4DIS5_TRIVH/539-564--------------------H......P----------------------------------------------------
A2Q8N5_ASPNC/262-289--------------------W......R----------------------------------------------------
A2R8Y6_ASPNC/231-256--------------------I......K----------------------------------------------------
C5JNN0_AJEDS/256-281--------------------F......A----------------------------------------------------
D2A5X4_TRICA/2707-2730--------------------T......Q----------------------------------------------------
B6H9V8_PENCW/591-614--------------------V......S----------------------------------------------------
B4P2L1_DROYA/1963-1994--------------------S......Y----------------------------------------------------
Q5C1C8_SCHJA/88-118--------------------L......Y----------------------------------------------------
Q16E65_AEDAE/222-244--------------------I......Q----------------------------------------------------
A8QHH7_BRUMA/326-349--------------------L......Q----------------------------------------------------
Q22677_CAEEL/175-198--------------------L......Q----------------------------------------------------
B7PT82_IXOSC/472-495--------------------Y......R----------------------------------------------------
B0WGJ8_CULQU/315-338--------------------L......W----------------------------------------------------
Q23521_CAEEL/227-252--------------------E......A----------------------------------------------------
Q0UBT1_PHANO/39-62--------------------E......Y----------------------------------------------------
A8X3B2_CAEBR/218-241--------------------Y......S----------------------------------------------------
Q2MHN3_MOUSE/563-586--------------------W......Q----------------------------------------------------
B7PT82_IXOSC/79-102--------------------Y......V----------------------------------------------------
B4NEY7_DROWI/49-74--------------------L......T----------------------------------------------------
A4RV11_OSTLU/566-590--------------------I......T----------------------------------------------------
B8P7K4_POSPM/360-385--------------------W......P----------------------------------------------------
Q16E65_AEDAE/158-180--------------------T......M----------------------------------------------------
A8X3M6_CAEBR/56-79--------------------F......Q----------------------------------------------------
B0W8E6_CULQU/171-193--------------------K......E----------------------------------------------------
B7QFA3_IXOSC/459-482--------------------H......G----------------------------------------------------
A8WFP9_CAEEL/43-66--------------------Y......K----------------------------------------------------
B9IJ27_POPTR/141-164--------------------W......K----------------------------------------------------
B8PJS0_POSPM/397-420--------------------Y......P----------------------------------------------------
C7ZEG0_NECH7/215-243--------------------Y......V----------------------------------------------------
Q8NIT8_NEUCS/665-688--------------------N......P----------------------------------------------------
B8MTG3_TALSN/141-164--------------------K......K----------------------------------------------------
Q7SBI5_NEUCR/18-41--------------------Y......N----------------------------------------------------
Q2H4N8_CHAGB/181-206--------------------F......K----------------------------------------------------
B2ADT0_PODAN/465-490--------------------H......S----------------------------------------------------
B4FJJ7_MAIZE/365-388--------------------Y......T----------------------------------------------------
B9WL25_CANDC/111-136--------------------Y......V----------------------------------------------------
Q6CG89_YARLI/310-335--------------------Y......P----------------------------------------------------
C5DGN9_LACTC/388-411--------------------Y......R----------------------------------------------------
B8PBF4_POSPM/444-470--------------------F......V----------------------------------------------------
B8P3E6_POSPM/464-489--------------------Y......A----------------------------------------------------
B6IJ73_CAEBR/540-563--------------------D......A----------------------------------------------------
C4Y6B6_CLAL4/387-408--------------------S......V----------------------------------------------------
C6H3W8_AJECH/145-170--------------------W......P----------------------------------------------------
C5JCK2_AJEDS/184-207--------------------E......S----------------------------------------------------
A2QZ26_ASPNC/265-290--------------------C......H----------------------------------------------------
B8PGG2_POSPM/411-434--------------------V......C----------------------------------------------------
B8P7K6_POSPM/358-383--------------------F......P----------------------------------------------------
B8PFE1_POSPM/193-217--------------------H......P----------------------------------------------------
B2B3H8_PODAN/146-172--------------------Y......E----------------------------------------------------
Q0U4H7_PHANO/206-230--------------------M......T----------------------------------------------------
B8PDT3_POSPM/359-383--------------------F......A----------------------------------------------------
B8PGH5_POSPM/360-383--------------------H......R----------------------------------------------------
A2Q9X2_ASPNC/33-68--------------------H......A----------------------------------------------------
A6SQB5_BOTFB/8-33--------------------F......H----------------------------------------------------
A7MAY9_BOVIN/991-1014--------------------W......T----------------------------------------------------
Q17JG0_AEDAE/104-127--------------------F......T----------------------------------------------------
B0W0M9_CULQU/772-795--------------------W......Q----------------------------------------------------
Q23458_CAEEL/176-200--------------------I......Q----------------------------------------------------
B2WDJ9_PYRTR/240-267--------------------L......H----------------------------------------------------
B4IGX3_DROSE/164-187--------------------L......E----------------------------------------------------
A8PHZ8_BRUMA/790-813--------------------F......R----------------------------------------------------
B0WBK5_CULQU/621-644--------------------F......R----------------------------------------------------
B0W7B5_CULQU/333-356--------------------F......R----------------------------------------------------
B3MBJ5_DROAN/449-472--------------------F......Y----------------------------------------------------
Q6BL20_DEBHA/191-214--------------------F......P----------------------------------------------------
Q16IT5_AEDAE/317-340--------------------H......K----------------------------------------------------
Q3UQJ9_MOUSE/1174-1196--------------------T......K----------------------------------------------------
C6HLC4_AJECH/295-315--------------------C......P----------------------------------------------------
Q00069_ASCIM/209-229--------------------T......L----------------------------------------------------
TREF1_HUMAN/1086-1109--------------------F......P----------------------------------------------------
B0W0M9_CULQU/661-685--------------------Y......Q----------------------------------------------------
B0WNG4_CULQU/278-301--------------------S......F----------------------------------------------------
B4H0E8_DROPE/716-739--------------------I......N----------------------------------------------------
B4PD05_DROYA/166-189--------------------M......L----------------------------------------------------
B3M9W0_DROAN/172-195--------------------I......L----------------------------------------------------
Q2KTB9_RAT/449-472--------------------I......L----------------------------------------------------
B3LGU7_YEAS1/263-283--------------------K......E----------------------------------------------------
C5M624_CANTT/182-202--------------------R......Q----------------------------------------------------
Q9U8F6_NASVI/113-141--------------------Q......A----------------------------------------------------
C3Y329_BRAFL/2571-2594--------------------Y......T----------------------------------------------------
B7PX18_IXOSC/9-32--------------------Y......S----------------------------------------------------
Q17NH5_AEDAE/329-352--------------------Y......S----------------------------------------------------
A8NSX1_BRUMA/311-336--------------------Y......E----------------------------------------------------
Q4SH15_TETNG/142-165--------------------Y......E----------------------------------------------------
Q1RLH5_CIOIN/826-849--------------------Y......Q----------------------------------------------------
D4AIT5_ARTBC/244-267--------------------C......Y----------------------------------------------------
Q29K07_DROPS/273-297--------------------P......I----------------------------------------------------
Q2U4K7_ASPOR/40-67--------------------Y......A----------------------------------------------------
A5XCD8_DANRE/176-199--------------------Y......P----------------------------------------------------
Q1LYB3_DANRE/1116-1141--------------------Y......N----------------------------------------------------
B3DM60_XENTR/599-625--------------------Y......L----------------------------------------------------
Q7PMA2_ANOGA/187-210--------------------Y......A----------------------------------------------------
C3Y329_BRAFL/2902-2925--------------------Y......Q----------------------------------------------------
Q28CN1_XENTR/165-189--------------------Y......Y----------------------------------------------------
Q63HJ5_HUMAN/843-866--------------------Y......Y----------------------------------------------------
B0WCG2_CULQU/250-273--------------------Y......Y----------------------------------------------------
Q5JZ68_HUMAN/77-100--------------------Y......S----------------------------------------------------
Q63HJ5_HUMAN/1968-1991--------------------Y......K----------------------------------------------------
B0W0M6_CULQU/2170-2195--------------------Y......K----------------------------------------------------
Q17PX0_AEDAE/339-364--------------------Y......K----------------------------------------------------
B4P2L1_DROYA/121-144--------------------Y......S----------------------------------------------------
B7P757_IXOSC/198-222--------------------F......K----------------------------------------------------
C3ZMX9_BRAFL/310-336--------------------F......D----------------------------------------------------
Q1RLD7_CIOIN/296-319--------------------Y......Y----------------------------------------------------
C3ZIR0_BRAFL/173-196--------------------Y......Y----------------------------------------------------
D2HTR1_AILME/701-724--------------------Y......Y----------------------------------------------------
A1L2T7_XENLA/567-590--------------------F......Y----------------------------------------------------
Q4RGT6_TETNG/1353-1376--------------------Y......R----------------------------------------------------
A8PHZ8_BRUMA/567-590--------------------Y......I----------------------------------------------------
B0W110_CULQU/17-40--------------------H......R----------------------------------------------------
D2HU52_AILME/78-101--------------------Y......E----------------------------------------------------
B1MTH1_CALMO/590-613--------------------Y......V----------------------------------------------------
Q1RLJ0_CIOIN/186-209--------------------Y......V----------------------------------------------------
B3RVK9_TRIAD/79-110--------------------Y......Y----------------------------------------------------
A5WW46_DANRE/90-119--------------------Y......C----------------------------------------------------
Q63HJ5_HUMAN/600-623--------------------Y......K----------------------------------------------------
Q4RGT6_TETNG/1438-1461--------------------F......K----------------------------------------------------
B8N6D7_ASPFN/350-377--------------------Y......Y----------------------------------------------------
B7PMW3_IXOSC/253-276--------------------L......T----------------------------------------------------
B6VBU2_9PELO/55-78--------------------I......S----------------------------------------------------
B2AF61_PODAN/11-39--------------------Y......V----------------------------------------------------
Q63HJ5_HUMAN/1265-1288--------------------L......K----------------------------------------------------
Q2HB25_CHAGB/3-26--------------------L......I----------------------------------------------------
Q5XHE5_XENLA/214-237--------------------F......Y----------------------------------------------------
Q29IM1_DROPS/2831-2856--------------------F......V----------------------------------------------------
A8WK33_CAEBR/165-188--------------------F......K----------------------------------------------------
Q63HJ5_HUMAN/1767-1791--------------------K......K----------------------------------------------------
B7FI33_MEDTR/15-38--------------------H......K----------------------------------------------------
B4P2L1_DROYA/523-546--------------------L......K----------------------------------------------------
A4RV11_OSTLU/411-439--------------------R......K----------------------------------------------------
YQ23_CAEEL/76-99--------------------L......K----------------------------------------------------
Q21777_CAEEL/465-488--------------------I......P----------------------------------------------------
A8WLH8_CAEBR/8-31--------------------L......N----------------------------------------------------
Q9W458_DROME/481-504--------------------L......N----------------------------------------------------
B0W532_CULQU/322-345--------------------V......C----------------------------------------------------
Q6C318_YARLI/766-789--------------------V......V----------------------------------------------------
Q21777_CAEEL/305-330--------------------F......A----------------------------------------------------
B0WHH3_CULQU/255-278--------------------F......M----------------------------------------------------
A8WN61_CAEBR/255-278--------------------F......M----------------------------------------------------
C3ZMX9_BRAFL/810-835--------------------N......R----------------------------------------------------
D4DIS5_TRIVH/263-286--------------------WT....GR----------------------------------------------------
B6HS71_PENCW/329-354--------------------W......A----------------------------------------------------
Q335Q3_CHICK/214-238--------------------V......A----------------------------------------------------
Q4V6W7_DROME/53-76--------------------F......H----------------------------------------------------
B2ANP6_PODAN/176-199--------------------F......E----------------------------------------------------
CP190_DROME/505-528--------------------A......L----------------------------------------------------
Q17H68_AEDAE/476-500--------------------R......I----------------------------------------------------
B3P5W3_DROER/191-214--------------------A......L----------------------------------------------------
A9VAV7_MONBE/252-277--------------------L......I----------------------------------------------------
Q7PW75_ANOGA/254-277--------------------Y......A----------------------------------------------------
B7Z7W1_HUMAN/212-234--------------------F......R----------------------------------------------------
B5DIB7_DROPS/203-226--------------------Y......E----------------------------------------------------
B4HMS2_DROSE/553-576--------------------F......V----------------------------------------------------
B4MIQ8_DROWI/152-175--------------------F......A----------------------------------------------------
Q7Q9G1_ANOGA/544-569--------------------F......H----------------------------------------------------
B4QAK8_DROSI/27-50--------------------H......I----------------------------------------------------
Q63HJ5_HUMAN/1470-1493--------------------Y......Q----------------------------------------------------
B4MP67_DROWI/844-867--------------------Y......Y----------------------------------------------------
C3YL46_BRAFL/138-163--------------------F......A----------------------------------------------------
A8PAW1_BRUMA/152-177--------------------H......K----------------------------------------------------
Q4P8M7_USTMA/447-471--------------------Y......I----------------------------------------------------
A8PQ02_BRUMA/394-420--------------------V......R----------------------------------------------------
Q16LR6_AEDAE/226-249--------------------Y......E----------------------------------------------------
Q16H34_AEDAE/471-492--------------------G......R----------------------------------------------------
Q16XS5_AEDAE/383-406--------------------T......K----------------------------------------------------
B0WAD2_CULQU/278-301--------------------T......K----------------------------------------------------
Q4SSB4_TETNG/21-46--------------------T......P----------------------------------------------------
A9UWL3_MONBE/105-128--------------------V......E----------------------------------------------------
D2A5X4_TRICA/2873-2896--------------------Y......I----------------------------------------------------
Q6NL58_DROME/230-253--------------------K......T----------------------------------------------------
A8Q597_BRUMA/193-218--------------------F......D----------------------------------------------------
C7DZJ6_DANRE/1106-1129--------------------I......L----------------------------------------------------
B4H8M8_DROPE/482-506--------------------Y.....AT----------------------------------------------------
C4R2A2_PICPG/269-297--------------------Y......R----------------------------------------------------
C1C3A0_9MAXI/262-285--------------------W......T----------------------------------------------------
Q63HJ5_HUMAN/2025-2048--------------------Y......S----------------------------------------------------
A8PZ56_BRUMA/367-390--------------------Y......T----------------------------------------------------
Q8T078_DROME/38-61--------------------K......R----------------------------------------------------
MEP1_CAEBR/436-459--------------------S......R----------------------------------------------------
B7P493_IXOSC/180-203--------------------K......P----------------------------------------------------
Q17PX0_AEDAE/1035-1058--------------------Y......R----------------------------------------------------
D3ZVE0_RAT/521-544--------------------C......P----------------------------------------------------
D2A5C6_TRICA/170-193--------------------F......S----------------------------------------------------
Q8K1J0_MOUSE/466-489--------------------H......S----------------------------------------------------
Q4RER3_TETNG/684-707--------------------L......R----------------------------------------------------
D3ZDK1_RAT/751-773--------------------L......K----------------------------------------------------
B5DNG6_DROPS/1081-1104--------------------L......K----------------------------------------------------
B0WNK1_CULQU/238-260--------------------C......K----------------------------------------------------
C9SVS1_VERA1/16-39--------------------S......S----------------------------------------------------
B0W0M9_CULQU/435-458--------------------C......G----------------------------------------------------
JING_DROME/1150-1173--------------------C......Y----------------------------------------------------
A8Q593_BRUMA/551-574--------------------N......Y----------------------------------------------------
B4KQA3_DROMO/183-206--------------------V......A----------------------------------------------------
A0DJ35_PARTE/113-136--------------------A......L----------------------------------------------------
MEP1_CAEBR/728-751--------------------F......Q----------------------------------------------------
B0XFC7_CULQU/6-28--------------------F......V----------------------------------------------------
Q0UJG2_PHANO/72-94--------------------W......E----------------------------------------------------
B4H6B3_DROPE/17-40--------------------L......G----------------------------------------------------
A8XLK5_CAEBR/246-269--------------------L......Q----------------------------------------------------
Q63HJ5_HUMAN/108-131--------------------F......Q----------------------------------------------------
B4J7R5_DROGR/110-133--------------------M......Q----------------------------------------------------
A8X359_CAEBR/123-146--------------------H......F----------------------------------------------------
B4LQ32_DROVI/724-746--------------------F......R----------------------------------------------------
C5FFW2_ARTOC/135-161--------------------F......Q----------------------------------------------------
Q1RLD7_CIOIN/401-424--------------------H......K----------------------------------------------------
B0W1Z9_CULQU/250-273--------------------H......P----------------------------------------------------
C4VB14_NOSCE/202-225--------------------H......Q----------------------------------------------------
B2B6W3_PODAN/998-1023--------------------H......K----------------------------------------------------
B4MQM1_DROWI/1117-1140--------------------H......L----------------------------------------------------
B8LQV8_PICSI/242-265--------------------C......R----------------------------------------------------
B4I9G7_DROSE/164-187--------------------Q......E----------------------------------------------------
B0W4X9_CULQU/220-245--------------------F......K----------------------------------------------------
Q95Q03_CAEEL/18-41--------------------F......L----------------------------------------------------
Q6RG13_AEDAE/474-497--------------------F......S----------------------------------------------------
C7ZKR5_NECH7/156-184--------------------F......T----------------------------------------------------
B0D109_LACBS/214-237--------------------F......P----------------------------------------------------
A2AB19_HUMAN/384-406--------------------F......G----------------------------------------------------
B7FVA6_PHATC/653-676--------------------F......S----------------------------------------------------
Q63HJ5_HUMAN/2191-2214--------------------L......H----------------------------------------------------
B4L6C6_DROMO/2746-2769--------------------F......Y----------------------------------------------------
Q4RGT6_TETNG/326-349--------------------F......Q----------------------------------------------------
C1BS33_9MAXI/229-252--------------------F......Q----------------------------------------------------
B0W533_CULQU/643-672--------------------FLLLRGEI----------------------------------------------------
D3BTR4_POLPA/105-130--------------------F......Q----------------------------------------------------
B0WGK0_CULQU/264-287--------------------H......F----------------------------------------------------
B4Q650_DROSI/467-490--------------------F......N----------------------------------------------------
B0W108_CULQU/527-550--------------------F......K----------------------------------------------------
B0WGK9_CULQU/296-319--------------------F......K----------------------------------------------------
B4MRW9_DROWI/90-113--------------------F......K----------------------------------------------------
B4JZV9_DROGR/1563-1589--------------------F......I----------------------------------------------------
B3DJB3_DANRE/131-154--------------------F......N----------------------------------------------------
Q4SUB0_TETNG/263-286--------------------F......V----------------------------------------------------
B2VW94_PYRTR/375-398--------------------F......Q----------------------------------------------------
A8E7N7_DANRE/460-483--------------------K......V----------------------------------------------------
Q5DCC8_SCHJA/112-135--------------------F......V----------------------------------------------------
LIN13_CAEEL/1252-1274--------------------F......Q----------------------------------------------------
A5YSS0_9EURY/906-929--------------------W......Q----------------------------------------------------
B9IBW5_POPTR/82-104--------------------R......V----------------------------------------------------
Q4QA93_LEIMA/509-532--------------------N......Y----------------------------------------------------
D0NG91_PHYIT/46-71--------------------I......T----------------------------------------------------
B7Q138_IXOSC/182-205--------------------V......V----------------------------------------------------
B4H5M3_DROPE/640-663--------------------F......N----------------------------------------------------
B4PIP4_DROYA/20-43--------------------F......C----------------------------------------------------
B4G562_DROPE/522-545--------------------V......P----------------------------------------------------
A1C9Y2_ASPCL/52-79--------------------M......R----------------------------------------------------
C5FVZ2_ARTOC/47-74--------------------M......R----------------------------------------------------
C9SPQ8_VERA1/54-81--------------------M......R----------------------------------------------------
A3LUZ4_PICST/29-52--------------------P......P----------------------------------------------------
B5XEI2_SALSA/96-121--------------------F......R----------------------------------------------------
ZN511_HUMAN/80-105--------------------F......A----------------------------------------------------
C1BVR7_9MAXI/71-96--------------------F......P----------------------------------------------------
A9NZ35_PICSI/79-104--------------------L......P----------------------------------------------------
B6T5I8_MAIZE/75-100--------------------V......F----------------------------------------------------
Q0WRF4_ARATH/69-94--------------------I......S----------------------------------------------------
A9RJY5_PHYPA/55-80--------------------I......F----------------------------------------------------
Q16M02_AEDAE/317-340--------------------F......G----------------------------------------------------
Q29K07_DROPS/331-355--------------------F......F----------------------------------------------------
A6SS34_BOTFB/300-329--------------------C......K----------------------------------------------------
B2AFE8_PODAN/135-158--------------------Y......F----------------------------------------------------
Q2GQ76_CHAGB/138-161--------------------Y......F----------------------------------------------------
A1CY68_NEOFI/417-440--------------------Y......Q----------------------------------------------------
Q7S0H2_NEUCR/141-164--------------------Y......H----------------------------------------------------
B6HMK5_PENCW/341-369--------------------Y......I----------------------------------------------------
Q21907_CAEEL/225-248--------------------M......E----------------------------------------------------
A8XMJ6_CAEBR/51-74--------------------F......S----------------------------------------------------
A8PBU8_BRUMA/209-232--------------------Y......P----------------------------------------------------
Q68CP0_HUMAN/140-163--------------------F......C----------------------------------------------------
SPR4_CAEEL/585-608--------------------F......C----------------------------------------------------
B4KIA8_DROMO/381-404--------------------F......V----------------------------------------------------
A8QGU5_BRUMA/468-491--------------------F......K----------------------------------------------------
B0W0M6_CULQU/1774-1797--------------------L......E----------------------------------------------------
B6Q1Z1_PENMQ/122-143--------------------L......W----------------------------------------------------
A8PZ56_BRUMA/687-710--------------------L......A----------------------------------------------------
B0X272_CULQU/8-31--------------------L......N----------------------------------------------------
B0WXW3_CULQU/241-264--------------------S......K----------------------------------------------------
PACC_CANDC/215-240--------------------F......K----------------------------------------------------
C4MAN3_ENTHI/163-186--------------------P......Y----------------------------------------------------
B4NDK7_DROWI/2381-2409--------------------Y......V----------------------------------------------------
B4NDK7_DROWI/2655-2680--------------------Y......H----------------------------------------------------
B8CDT5_THAPS/254-277--------------------C......Q----------------------------------------------------
Q01C34_OSTTA/388-411--------------------E......D----------------------------------------------------
B0W5F0_CULQU/309-332--------------------V......A----------------------------------------------------
O44318_LIMPO/95-118--------------------V......A----------------------------------------------------
B0W1Z9_CULQU/348-371--------------------V......Q----------------------------------------------------
Q0CSD9_ASPTN/177-202--------------------Y......Q----------------------------------------------------
B7PPH0_IXOSC/38-61--------------------T......A----------------------------------------------------
Q4H2H5_CIOIN/194-219--------------------H......R----------------------------------------------------
B4JJZ6_DROGR/2499-2522--------------------W......V----------------------------------------------------
B4MAE2_DROVI/2557-2580--------------------W......L----------------------------------------------------
B4L6C6_DROMO/2670-2693--------------------W......I----------------------------------------------------
B4H2Q1_DROPE/240-263--------------------F......I----------------------------------------------------
C3Y3L4_BRAFL/1717-1740--------------------H......V----------------------------------------------------
B0XGE6_CULQU/92-115--------------------H......P----------------------------------------------------
C3Y633_BRAFL/249-285--------------------W......P----------------------------------------------------
A7SD00_NEMVE/687-710--------------------Y......H----------------------------------------------------
B2W7K3_PYRTR/763-786--------------------Y......D----------------------------------------------------
A8QGU5_BRUMA/382-405--------------------P......Q----------------------------------------------------
Q4RQV6_TETNG/716-742--------------------Y......L----------------------------------------------------
B6HS71_PENCW/111-139--------------------F......P----------------------------------------------------
Q5NDD4_CUCSA/222-245--------------------E......Q----------------------------------------------------
Q0IHR5_XENTR/384-409--------------------Y......K----------------------------------------------------
D2HVZ5_AILME/160-185--------------------F......K----------------------------------------------------
D2A5X4_TRICA/2269-2294--------------------Y......V----------------------------------------------------
B0W0M6_CULQU/2407-2432--------------------Y......I----------------------------------------------------
Q17PW8_AEDAE/1609-1632--------------------Y......M----------------------------------------------------
A2A7F4_MOUSE/667-692--------------------Y......P----------------------------------------------------
B4J256_DROGR/1013-1036--------------------E......L----------------------------------------------------
B2B451_PODAN/634-658--------------------T......L----------------------------------------------------
Q28CN1_XENTR/624-649--------------------T......L----------------------------------------------------
A9T6Q6_PHYPA/895-918--------------------Y......L----------------------------------------------------
A9TUJ1_PHYPA/13-36--------------------L......A----------------------------------------------------
Q6C595_YARLI/256-283--------------------Y......V----------------------------------------------------
Q6C1K3_YARLI/405-433--------------------L......S----------------------------------------------------
B3LIH7_YEAS1/178-201--------------------Y......H----------------------------------------------------
Q6CY73_KLULA/413-436--------------------Y......K----------------------------------------------------
B0WBK5_CULQU/300-323--------------------T......V----------------------------------------------------
B2WID5_PYRTR/11-39--------------------F......P----------------------------------------------------
B8PFF3_POSPM/238-261--------------------I......K----------------------------------------------------
Q5KEF6_CRYNJ/271-294--------------------P......M----------------------------------------------------
Q6CDF4_YARLI/235-258--------------------P......E----------------------------------------------------
D2A5C6_TRICA/84-107--------------------L......I----------------------------------------------------
A9U0C1_PHYPA/351-376--------------------L......V----------------------------------------------------
A7EJ95_SCLS1/436-460--------------------L......S----------------------------------------------------
Q8T078_DROME/306-329--------------------V......I----------------------------------------------------
Q5DB66_SCHJA/51-76--------------------P......V----------------------------------------------------
A6S972_BOTFB/94-119--------------------V......K----------------------------------------------------
A7F8A3_SCLS1/33-58--------------------V......K----------------------------------------------------
B0WTK3_CULQU/627-650--------------------K......R----------------------------------------------------
C4QZH0_PICPG/26-51--------------------F......R----------------------------------------------------
Q5TRK2_ANOGA/368-392--------------------W......I----------------------------------------------------
C1G1Q4_PARBD/341-364--------------------A......H----------------------------------------------------
C4JQ24_UNCRE/276-299--------------------N......Y----------------------------------------------------
B7Q3Z8_IXOSC/337-362--------------------Y......D----------------------------------------------------
A7MAY9_BOVIN/807-830--------------------Y......R----------------------------------------------------
D3ZDK1_RAT/839-862--------------------F......R----------------------------------------------------
Q04072_STRPU/157-180--------------------F......I----------------------------------------------------
Q21777_CAEEL/630-653--------------------W......T----------------------------------------------------
Q16IT5_AEDAE/256-279--------------------Y......T----------------------------------------------------
Q1RLD7_CIOIN/117-140--------------------L......R----------------------------------------------------
Q1LYB3_DANRE/1383-1408--------------------F......H----------------------------------------------------
B4JJZ6_DROGR/2710-2734--------------------F......A----------------------------------------------------
B4NDK7_DROWI/2989-3013--------------------F......A----------------------------------------------------
B4PZ76_DROYA/2957-2981--------------------F......A----------------------------------------------------
B4L6C6_DROMO/2552-2577--------------------F......V----------------------------------------------------
Q1PQI9_DROMI/259-282--------------------T......R----------------------------------------------------
B5E0E0_DROPS/422-445--------------------P......V----------------------------------------------------
B7Q473_IXOSC/15-38--------------------I......V----------------------------------------------------
Q16V67_AEDAE/162-185--------------------F......N----------------------------------------------------
B9H6A0_POPTR/21-44--------------------I......R----------------------------------------------------
Q8S3S4_ORYSJ/66-89--------------------L......K----------------------------------------------------
C6LR00_GIAIB/301-324--------------------F......I----------------------------------------------------
B4H9Y9_DROPE/180-204--------------------F......V----------------------------------------------------
B0WSE4_CULQU/266-288--------------------F......R----------------------------------------------------
D0MTJ1_PHYIT/349-372--------------------F......T----------------------------------------------------
Q3MN16_HUMAN/67-92--------------------F......R----------------------------------------------------
B8CDT5_THAPS/483-505--------------------Y......R----------------------------------------------------
B0W0M6_CULQU/1861-1884--------------------L......I----------------------------------------------------
Q6FRY7_CANGA/380-405--------------------F......I----------------------------------------------------
C9SSA5_VERA1/431-456--------------------F......A----------------------------------------------------
A2A7F4_MOUSE/1355-1380--------------------F......A----------------------------------------------------
C4JP57_UNCRE/24-47--------------------F......A----------------------------------------------------
B0WIX2_CULQU/384-406--------------------F......A----------------------------------------------------
B0WYD2_CULQU/357-380--------------------Y......R----------------------------------------------------
Q16M02_AEDAE/372-395--------------------F......R----------------------------------------------------
D2GVM0_AILME/983-1006--------------------F......K----------------------------------------------------
B0W104_CULQU/424-447--------------------Y......G----------------------------------------------------
A6R961_AJECN/23-46--------------------Y......E----------------------------------------------------
YQ23_CAEEL/183-206--------------------H......I----------------------------------------------------
B2ALK3_PODAN/2-25--------------------Y......E----------------------------------------------------
A5E526_LODEL/45-68--------------------V......E----------------------------------------------------
Q16IT5_AEDAE/224-247--------------------H......V----------------------------------------------------
Q5TRK0_ANOGA/385-411--------------------H......T----------------------------------------------------
B0WYD2_CULQU/302-325--------------------F......E----------------------------------------------------
B0W111_CULQU/2-25--------------------F......Q----------------------------------------------------
B4JMZ7_DROGR/392-415--------------------F......Q----------------------------------------------------
C4A0F0_BRAFL/24-47--------------------L......Q----------------------------------------------------
B0WHQ7_CULQU/387-410--------------------K......I----------------------------------------------------
B7PK44_IXOSC/259-282--------------------V......Q----------------------------------------------------
Q16IT5_AEDAE/171-194--------------------L......N----------------------------------------------------
A0NGG6_ANOGA/87-110--------------------T......E----------------------------------------------------
B0W7A7_CULQU/70-98--------------------F......S----------------------------------------------------
B7PMJ7_IXOSC/18-49--------------------F......C----------------------------------------------------
Q4SET0_TETNG/21-45--------------------F......E----------------------------------------------------
A5AFF5_VITVI/260-282--------------------H......I----------------------------------------------------
A3BLW8_ORYSJ/113-136--------------------F......P----------------------------------------------------
C5Z2J4_SORBI/64-87--------------------H......P----------------------------------------------------
D3YV79_MOUSE/231-254--------------------L......I----------------------------------------------------
C7DZJ6_DANRE/870-893--------------------K......I----------------------------------------------------
B7XJK2_ENTBH/98-121--------------------Y......I----------------------------------------------------
Q4SZW5_TETNG/733-756--------------------A......E----------------------------------------------------
YNC3_CAEEL/207-229--------------------V......L----------------------------------------------------
C3Z1C5_BRAFL/354-377--------------------Y......N----------------------------------------------------
C3Z1C6_BRAFL/142-165--------------------H......S----------------------------------------------------
C3XUM2_BRAFL/465-488--------------------F......Q----------------------------------------------------
C3YHB2_BRAFL/112-135--------------------Y......R----------------------------------------------------
A8E7N7_DANRE/430-453--------------------T......V----------------------------------------------------
O17862_CAEEL/191-218--------------------H......E----------------------------------------------------
B4LL71_DROVI/425-448--------------------V......L----------------------------------------------------
Q0IEG5_AEDAE/185-208--------------------L......L----------------------------------------------------
Q09620_CAEEL/12-35--------------------P......I----------------------------------------------------
C3ZIR0_BRAFL/700-723--------------------Q......L----------------------------------------------------
B3DMQ2_DROME/201-224--------------------S......I----------------------------------------------------
ATBP_DROME/321-346--------------------Y......V----------------------------------------------------
Q29CH7_DROPS/183-206--------------------F......T----------------------------------------------------
D2A5X3_TRICA/1593-1616--------------------F......R----------------------------------------------------
Q0CEM1_ASPTN/234-261--------------------F......V----------------------------------------------------
B4HAN4_DROPE/798-821--------------------T......S----------------------------------------------------
Q16VZ0_AEDAE/441-463--------------------T......E----------------------------------------------------
B4L6C6_DROMO/2297-2325--------------------Y......A----------------------------------------------------
B4PZ76_DROYA/2346-2374--------------------F......A----------------------------------------------------
Q29IM1_DROPS/2582-2610--------------------F......E----------------------------------------------------
B8NZS4_POSPM/309-335--------------------Y......R----------------------------------------------------
O49591_ARATH/26-49--------------------L......T----------------------------------------------------
A8PAN0_BRUMA/81-106--------------------Y......K----------------------------------------------------
B8PAZ1_POSPM/152-176--------------------Y......K----------------------------------------------------
B8NZM2_POSPM/476-500--------------------Y......Q----------------------------------------------------
B2ABK1_PODAN/296-326--------------------Y......Q----------------------------------------------------
B0WRI3_CULQU/313-336--------------------V......R----------------------------------------------------
B6HEV4_PENCW/231-254--------------------Y......I----------------------------------------------------
D2A5X4_TRICA/2040-2063--------------------F......R----------------------------------------------------
B3MS97_DROAN/2658-2683--------------------F......R----------------------------------------------------
B4PZ76_DROYA/2616-2641--------------------Y......R----------------------------------------------------
D3ZVE0_RAT/177-200--------------------L......R----------------------------------------------------
Q4S665_TETNG/262-285--------------------L......K----------------------------------------------------
B3RRP5_TRIAD/73-98--------------------T......S----------------------------------------------------
Q7PW31_ANOGA/236-259--------------------H......H----------------------------------------------------
B0W532_CULQU/566-588--------------------W.......----------------------------------------------------
B0W533_CULQU/509-532--------------------V......L----------------------------------------------------
B0X5Z6_CULQU/198-221--------------------F......R----------------------------------------------------

PF12171

Q7QEH9_ANOGA/476-502-------------------TF------R----------------------------------------------------
Q5TTY0_ANOGA/628-654-------------------TY------N----------------------------------------------------
Q4WWC2_ASPFU/200-226-------------------QF------E----------------------------------------------------
Q4WHR8_ASPFU/70-96-------------------EK------S----------------------------------------------------
Q8IKJ3_PLAF7/53-79-------------------QF------K----------------------------------------------------
A5DEF9_PICGU/49-75-------------------YY------D----------------------------------------------------
Q6BQQ0_DEBHA/25-51-------------------RF------Y----------------------------------------------------
Q0UAS9_PHANO/270-296-------------------GF------W----------------------------------------------------
Q29G74_DROPS/3-29-------------------QF------T----------------------------------------------------
A5DJE8_PICGU/264-290-------------------PL------Y----------------------------------------------------
Q293S4_DROPS/309-335-------------------KH------Y----------------------------------------------------
Q29G74_DROPS/68-94-------------------SS------Y----------------------------------------------------
Q29A02_DROPS/400-426-------------------SN------F----------------------------------------------------
Q6BPR8_DEBHA/273-299-------------------EV------Y----------------------------------------------------
Q870N3_NEUCS/91-117-------------------EM------T----------------------------------------------------
Q582U2_TRYB2/320-346-------------------KR------S----------------------------------------------------
Q7RIP5_PLAYO/126-152-------------------GY------Y----------------------------------------------------
Q59UL8_CANAL/337-363-------------------EF------E----------------------------------------------------
Q5YEU6_BIGNA/3-31-------------------RF------Y----------------------------------------------------
Q55IZ7_CRYNB/367-393-------------------IF------E----------------------------------------------------
Q0IFY4_AEDAE/56-82-------------------QF------Y----------------------------------------------------
Q54VV0_DICDI/96-122-------------------GF------Y----------------------------------------------------
Q5KJJ3_CRYNJ/261-287-------------------GI------W----------------------------------------------------
Q2U5B2_ASPOR/305-331-------------------YF------E----------------------------------------------------
A5DW84_LODEL/48-74-------------------QY------Y----------------------------------------------------
Q57Z90_HUMAN/827-853-------------------GF------F----------------------------------------------------
Q6C2A2_YARLI/287-313-------------------EL------F----------------------------------------------------
A7TFN5_VANPO/48-74-------------------QH------Y----------------------------------------------------
ZMAT3_HUMAN/245-271-------------------QF------Y----------------------------------------------------
Q7S3X8_NEUCR/318-344-------------------VL------E----------------------------------------------------
Q176C4_AEDAE/317-343-------------------DL------Y----------------------------------------------------
Q54GN9_DICDI/72-98-------------------KF------E----------------------------------------------------
Q6NUW2_DANRE/80-106-------------------VA------Y----------------------------------------------------
O62360_CAEEL/315-341-------------------LP------Y----------------------------------------------------
Q292H8_DROPS/200-226-------------------QL------I----------------------------------------------------
Q4RMB3_TETNG/60-86-------------------QH------Y----------------------------------------------------
A8BB65_GIAIC/58-84-------------------MH------F----------------------------------------------------
ZN593_HUMAN/60-86-------------------LH------R----------------------------------------------------
A4QNW1_DANRE/833-859-------------------GF------Y----------------------------------------------------
A4QP17_DANRE/136-164-------------------NF------Y----------------------------------------------------
A7AR58_BABBO/309-335-------------------YF------P----------------------------------------------------
A7TM74_VANPO/361-387-------------------IY------E----------------------------------------------------
A2AN61_MOUSE/604-630-------------------RP------F----------------------------------------------------
Q2QQ93_ORYSJ/309-335-------------------EL------Y----------------------------------------------------
Q7S2D3_NEUCR/29-55-------------------KL------V----------------------------------------------------
Q9W0X8_DROME/312-338-------------------DL------Y----------------------------------------------------
Q5KL91_CRYNJ/58-84-------------------QH------Y----------------------------------------------------
Q9SJL4_ARATH/57-83-------------------QF------Y----------------------------------------------------
Q4X9H0_PLACH/26-52-------------------QF------K----------------------------------------------------
Q6FLX1_CANGA/48-74-------------------QH------Y----------------------------------------------------
Q4PB66_USTMA/383-409-------------------AW------D----------------------------------------------------
Q8SSM0_ENCCU/179-205-------------------PF------N----------------------------------------------------
JJJ1_YEAST/337-363-------------------IY------E----------------------------------------------------
A7AT41_BABBO/70-96-------------------AP------Y----------------------------------------------------
Q2HH90_CHAGB/49-75-------------------RN------Y----------------------------------------------------
Q4N239_THEPA/59-86-------------------VS------Y----------------------------------------------------
Q4P5I8_USTMA/61-87-------------------LF------Y----------------------------------------------------
Q4T408_TETNG/465-491-------------------GF------Y----------------------------------------------------
Q7ZZ49_DANRE/53-79-------------------YS------L----------------------------------------------------
A0DPA0_PARTE/59-85-------------------QY------Y----------------------------------------------------
Q5DDM6_SCHJA/51-77-------------------QF------F----------------------------------------------------
Q4SQE0_TETNG/196-222-------------------DL------Y----------------------------------------------------
Q18037_CAEEL/70-96-------------------PL------Y----------------------------------------------------
PRP9_YEAST/279-305-------------------GI------Y----------------------------------------------------
Z231_ENCCU/55-81-------------------HF------Y----------------------------------------------------
ZMAT3_MOUSE/147-173-------------------ND------Y----------------------------------------------------
C5PFT8_COCP7/46-72-------------------QY------Y----------------------------------------------------
Q55EN0_DICDI/722-749-------------------QI------I----------------------------------------------------
Q6CQ57_KLULA/344-370-------------------IY------E----------------------------------------------------
Q4SLK6_TETNG/45-71-------------------HL------S----------------------------------------------------
ZMAT4_BOVIN/144-170-------------------DR------Y----------------------------------------------------
Q5I094_XENTR/66-92-------------------AT------Y----------------------------------------------------
A6RA79_AJECN/90-116-------------------EK------A----------------------------------------------------
A0DLK5_PARTE/243-269-------------------PH------Y----------------------------------------------------
Q4E5J1_TRYCC/13-39-------------------AF------Y----------------------------------------------------
Q4SJL2_TETNG/244-270-------------------KF------Y----------------------------------------------------
Q2H3Q5_CHAGB/22-50-------------------SF------Y----------------------------------------------------
Q4QDW6_LEIMA/18-44-------------------SF------Y----------------------------------------------------
Q54EG2_DICDI/456-482-------------------KY------Y----------------------------------------------------
Q5CUH6_CRYPI/74-101-------------------KF------K----------------------------------------------------
Q4E2J2_TRYCC/320-346-------------------KL------N----------------------------------------------------
Q17FL5_AEDAE/69-95-------------------SL------Y----------------------------------------------------
ZN830_DANRE/47-73-------------------QL------M----------------------------------------------------
A8B9I4_GIAIC/27-53-------------------CL------R----------------------------------------------------
Q4PBS4_USTMA/93-119-------------------PD------K----------------------------------------------------
Q1RLA2_CIOIN/312-338-------------------EL------Y----------------------------------------------------
Q59YK2_CANAL/268-294-------------------KL------F----------------------------------------------------
A0CIK9_PARTE/301-327-------------------VF------F----------------------------------------------------
Q5JLF0_ORYSJ/43-70-------------------QY------V----------------------------------------------------
Q9VX08_DROME/68-94-------------------SV------Y----------------------------------------------------
A7SMU1_NEMVE/58-84-------------------QF------Y----------------------------------------------------
Q9LEN7_CICAR/3-29-------------------QN------K----------------------------------------------------
Q4Q9L8_LEIMA/321-347-------------------VF------N----------------------------------------------------
Q015T5_OSTTA/211-237-------------------AY------V----------------------------------------------------
Q8IH78_DROME/301-327-------------------QY------Y----------------------------------------------------
Q9SJL4_ARATH/137-163-------------------QF------N----------------------------------------------------
A7ATF0_BABBO/97-123-------------------GF------Y----------------------------------------------------
A7F0C9_SCLS1/39-65-------------------KW------Y----------------------------------------------------
A7RTE1_NEMVE/298-324-------------------QF------Y----------------------------------------------------
MU185_SCHPO/269-295-------------------PI------M----------------------------------------------------
Q86ZK1_PODAS/49-75-------------------QH------Y----------------------------------------------------
Q16M83_AEDAE/53-79-------------------QL------T----------------------------------------------------
Q0U7N1_PHANO/50-76-------------------QH------Y----------------------------------------------------
Q5XGS1_XENLA/60-86-------------------QH------Y----------------------------------------------------
Q9VEF0_DROME/321-347-------------------VH------I----------------------------------------------------
BUD20_SCHPO/55-81-------------------QH------Y----------------------------------------------------
Q17L08_AEDAE/394-420-------------------KY------Y----------------------------------------------------
A2EI42_TRIVA/279-305-------------------EW------F----------------------------------------------------
Q5ARM0_EMENI/294-320-------------------HI------E----------------------------------------------------
Q8I158_DROPS/218-244-------------------PF------Y----------------------------------------------------
Q7EZL0_ORYSJ/94-120-------------------QF------Y----------------------------------------------------
A5E2D1_LODEL/294-320-------------------SL------Y----------------------------------------------------
Q5B9R2_EMENI/112-138-------------------RY------Y----------------------------------------------------
Q23MN1_TETTS/59-85-------------------QY------Y----------------------------------------------------
A6ST71_BOTFB/103-129-------------------SY------H----------------------------------------------------
ZN830_XENLA/44-70-------------------HL------S----------------------------------------------------
Q4DXJ0_TRYCC/67-93-------------------TF------A----------------------------------------------------
A3LQT9_PICST/334-360-------------------VY------E----------------------------------------------------
Q6CEI7_YARLI/299-325-------------------IW------E----------------------------------------------------
A2QSF5_ASPNC/213-239-------------------KH------Y----------------------------------------------------
Q75E64_ASHGO/334-360-------------------IY------D----------------------------------------------------
Q0U7P4_PHANO/313-339-------------------HY------E----------------------------------------------------
Q6PBI1_DANRE/23-49-------------------QH------Y----------------------------------------------------
Q9C911_ARATH/307-333-------------------QL------Y----------------------------------------------------
ZN593_DICDI/59-85-------------------QN------Y----------------------------------------------------
Q86B18_DICDI/136-162-------------------NY------Y----------------------------------------------------
Q7SXB6_DANRE/224-250-------------------RP------F----------------------------------------------------
A2DYJ8_TRIVA/267-293-------------------KF------Y----------------------------------------------------
SAP61_SCHPO/242-268-------------------AF------Y----------------------------------------------------
A3LZB0_PICST/289-315-------------------EV------Y----------------------------------------------------
A6R6K6_AJECN/46-72-------------------RH------Y----------------------------------------------------
Q6FNA1_CANGA/284-310-------------------IY------Y----------------------------------------------------
Q16QC5_AEDAE/315-341-------------------PF------F----------------------------------------------------
Q29JJ2_DROPS/58-84-------------------QF------Y----------------------------------------------------
Q6C988_YARLI/43-69-------------------QF------Y----------------------------------------------------
Q6FP17_CANGA/362-388-------------------IY------D----------------------------------------------------
Q5BW97_SCHJA/120-146-------------------SF------Y----------------------------------------------------
Q7S4W2_NEUCR/49-75-------------------RH------Y----------------------------------------------------
A7RQ90_NEMVE/279-305-------------------QY------Y----------------------------------------------------
Q6BVL1_DEBHA/48-74-------------------QY------Y----------------------------------------------------

PF12874

B6KBH5_TOXGO/215-240--------------------F------Q---.------------------------------------------------
ZMAT3_HUMAN/246-270--------------------F------Y---.------------------------------------------------
Q4WWC2_ASPFU/201-225--------------------F------E---.------------------------------------------------
Q8IH78_DROME/239-263--------------------R------T---.------------------------------------------------
C1E4I6_MICSR/103-127--------------------Y------E---.------------------------------------------------
B9IFT9_POPTR/52-76--------------------Y------E---.------------------------------------------------
B3S6Z2_TRIAD/81-105--------------------Y------Y---.------------------------------------------------
Z385B_MOUSE/360-384--------------------F------H---.------------------------------------------------
A5WV30_DANRE/319-343--------------------H------Y---.------------------------------------------------
Q8S8S8_ARATH/95-119--------------------W------F---.------------------------------------------------
Q8H6R5_PONTR/36-60--------------------P------V---.------------------------------------------------
A5AFF5_VITVI/1032-1056--------------------R------T---.------------------------------------------------
C1G8P3_PARBD/92-116--------------------K------S---.------------------------------------------------
Q4P204_USTMA/128-152--------------------L------E---.------------------------------------------------
B4LGR5_DROVI/253-277--------------------Y------H---.------------------------------------------------
B6U265_MAIZE/419-443--------------------L------V---.------------------------------------------------
Q29KR4_DROPS/494-518--------------------L------Y---.------------------------------------------------
B7Q5C0_IXOSC/746-770--------------------K------I---.------------------------------------------------
B9G3M7_ORYSJ/268-292--------------------Y------Y---.------------------------------------------------
Q18037_CAEEL/71-95--------------------L------Y---.------------------------------------------------
ZMAT3_HUMAN/70-94--------------------L------Y---.------------------------------------------------
Q4RW00_TETNG/158-182--------------------I------S---.------------------------------------------------
Q67UQ0_ORYSJ/224-248--------------------W------S---.------------------------------------------------
ZFHX4_CHICK/695-719--------------------F------R---.------------------------------------------------
B4F8C1_MAIZE/192-216--------------------A------P---.------------------------------------------------
A9UN71_DROME/40-64--------------------L------N---.------------------------------------------------
A5BU19_VITVI/6-30--------------------W------A---.------------------------------------------------
Q5C3I7_SCHJA/11-35--------------------Y------R---.------------------------------------------------
ZMAT1_XENTR/223-247--------------------K------Y---.------------------------------------------------
A6ZXU1_YEAS7/280-304--------------------I------Y---.------------------------------------------------
O82231_ARATH/370-394--------------------V------W---.------------------------------------------------
B3LW17_DROAN/320-344--------------------F------A---.------------------------------------------------
A3BYY1_ORYSJ/176-200--------------------W------S---.------------------------------------------------
B4FTM2_MAIZE/297-321--------------------S------Y---.------------------------------------------------
B7FVC6_PHATC/980-1004--------------------F------R---.------------------------------------------------
Q4UEZ1_THEAN/55-79--------------------V------E---.------------------------------------------------
B9GH74_POPTR/294-318--------------------W------T---.------------------------------------------------
B2GUK9_XENTR/172-196--------------------L------Y---.------------------------------------------------
ZMAT4_BOVIN/14-38--------------------S------Y---.------------------------------------------------
Q4SKX5_TETNG/257-281--------------------Y------S---.------------------------------------------------
B3MSY7_DROAN/311-335--------------------F------H---.------------------------------------------------
ZN346_HUMAN/73-97--------------------T------Q---.------------------------------------------------
B5FYA4_TAEGU/168-192--------------------K------F---.------------------------------------------------
B3NEP7_DROER/160-184--------------------F------H---.------------------------------------------------
A2YT99_ORYSI/143-167--------------------L------L---.------------------------------------------------
Q6C2A9_YARLI/35-59--------------------F------Y---.------------------------------------------------
A5C9S0_VITVI/187-211--------------------F------W---.------------------------------------------------
A6R1M5_AJECN/330-354--------------------F------E---.------------------------------------------------
Q69P59_ORYSJ/155-179--------------------W------S---.------------------------------------------------
B4HVF7_DROSE/199-223--------------------Y------Y---.------------------------------------------------
Q84RJ5_ARATH/213-237--------------------F------W---.------------------------------------------------
A3BYY2_ORYSJ/218-242--------------------L------I---.------------------------------------------------
A9UM17_XENLA/274-298--------------------Y------V---.------------------------------------------------
B4MGB8_DROVI/281-305--------------------L------T---.------------------------------------------------
Q5APP1_CANAL/55-79--------------------L------E---.------------------------------------------------
A7E7B8_SCLS1/54-78--------------------F------E---.------------------------------------------------
A8P3U0_BRUMA/294-318--------------------F------Y---.------------------------------------------------
Q4SZX1_TETNG/32-56--------------------Y------Q---.------------------------------------------------
ZN346_MOUSE/134-158--------------------H------C---.------------------------------------------------
B9RFH7_RICCO/83-107--------------------Y------Y---.------------------------------------------------
Q4SQD0_TETNG/1-25--------------------K------T---.------------------------------------------------
B4KKQ9_DROMO/629-653--------------------Y------Y---.------------------------------------------------
A8BQ93_GIAIC/374-398--------------------L------F---.------------------------------------------------
A4HHA1_LEIBR/161-185--------------------E------Q---.------------------------------------------------
B4M422_DROVI/355-378--------------------T------F---.------------------------------------------------
C4JBJ4_MAIZE/533-557--------------------F------Y---.------------------------------------------------
Q8SXJ5_DROME/283-307--------------------Y------W---.------------------------------------------------
B4GMZ8_DROPE/296-320--------------------F------R---.------------------------------------------------
B0WTB0_CULQU/88-112--------------------L------Y---.------------------------------------------------
B4F7C6_RAT/145-169--------------------R------Y---.------------------------------------------------
O64571_ARATH/85-109--------------------W------F---.------------------------------------------------
A3C5W8_ORYSJ/194-218--------------------L------Y---.------------------------------------------------
A9RB22_PHYPA/177-201--------------------W------N---.------------------------------------------------
Q0U7P4_PHANO/314-338--------------------Y------E---.------------------------------------------------
ZN346_DANRE/117-141--------------------K------A---.------------------------------------------------
B4PBY0_DROYA/315-339--------------------L------Y---.------------------------------------------------
Z385B_MOUSE/34-58--------------------S------F---.------------------------------------------------
B4K566_DROMO/337-361--------------------Y------R---.------------------------------------------------
C3YMZ5_BRAFL/5-29--------------------L------Y---.------------------------------------------------
C4M599_ENTHI/69-93--------------------Y------Y---.------------------------------------------------
B9RX76_RICCO/326-350--------------------W------N---.------------------------------------------------
A9ULH3_XENTR/151-175--------------------D------Y---.------------------------------------------------
Q17L08_AEDAE/190-214--------------------L------D---.------------------------------------------------
B2RXS3_MOUSE/785-809--------------------K------Q---.------------------------------------------------
Q7PYV1_ANOGA/67-91--------------------L------Y---.------------------------------------------------
B4FE91_MAIZE/427-451--------------------W------G---.------------------------------------------------
C0NRC2_AJECG/191-215--------------------W------E---.------------------------------------------------
A2BGG2_DANRE/378-402--------------------L------R---.------------------------------------------------
A6ZXT2_YEAS7/66-90--------------------L------V---.------------------------------------------------
B3LXE1_DROAN/322-346--------------------Y------H---.------------------------------------------------
B8MAT8_TALSN/253-277--------------------I------W---.------------------------------------------------
Q94HR5_ORYSJ/278-302--------------------L------T---.------------------------------------------------
Q4QDW6_LEIMA/19-43--------------------F------Y---.------------------------------------------------
SAP61_SCHPO/243-267--------------------F------Y---.------------------------------------------------
Q580U5_TRYB2/55-79--------------------P------S---.------------------------------------------------
C4J970_MAIZE/199-223--------------------W------S---.------------------------------------------------
ZN346_XENLA/400-424--------------------F------S---.------------------------------------------------
B8BB40_ORYSI/229-253--------------------W------S---.------------------------------------------------
Q4V8W9_DANRE/27-51--------------------K------F---.------------------------------------------------
A9V6C8_MONBE/133-157--------------------F------Y---.------------------------------------------------
B6H9D4_PENCW/13-37--------------------W------V---.------------------------------------------------
Q4V8W9_DANRE/158-182--------------------L------T---.------------------------------------------------
B7FRV3_PHATC/200-224--------------------S------Y---.------------------------------------------------
A5E2D1_LODEL/295-319--------------------L------Y---.------------------------------------------------
B8BWM0_THAPS/308-332--------------------T------Y---.------------------------------------------------
ZN346_XENLA/95-119--------------------K------C---.------------------------------------------------
B4JE80_DROGR/514-538--------------------L------M---.------------------------------------------------
B4HWT1_DROSE/533-557--------------------P------M---.------------------------------------------------
A5C9S0_VITVI/96-120--------------------X------W---.------------------------------------------------
B0WBY3_CULQU/321-345--------------------L------Y---.------------------------------------------------
Q5BW97_SCHJA/121-145--------------------F------Y---.------------------------------------------------
A1CM28_ASPCL/406-430--------------------F------T---.------------------------------------------------
Q2F5Z3_BOMMO/189-213--------------------L------Y---.------------------------------------------------
Q4TFH0_TETNG/64-88--------------------Y------S---.------------------------------------------------
B0D0A4_LACBS/71-95--------------------F------T---.------------------------------------------------
C1EBK7_MICSR/301-325--------------------L------Y---.------------------------------------------------
B3RS99_TRIAD/158-182--------------------I------Y---.------------------------------------------------
Q23JA5_TETTS/306-330--------------------F------Y---.------------------------------------------------
B4NET1_DROWI/121-145--------------------L------S---.------------------------------------------------
Q54GN9_DICDI/73-97--------------------F------E---.------------------------------------------------
A5DJE8_PICGU/265-289--------------------L------Y---.------------------------------------------------
B4P0S1_DROYA/465-489--------------------F------Y---.------------------------------------------------
B9WHC0_CANDC/416-441--------------------Y------N---.------------------------------------------------
A2YT99_ORYSI/46-70--------------------L------T---.------------------------------------------------
A7RQ90_NEMVE/52-76--------------------Y------I---.------------------------------------------------
Q9VGR8_DROME/573-597--------------------Y------W---.------------------------------------------------
B6JW10_SCHJY/229-253--------------------I------F---.------------------------------------------------
C4QVN0_PICPG/54-78--------------------Y------D---.------------------------------------------------
A7RG76_NEMVE/20-44--------------------V------Y---.------------------------------------------------
Q29GZ8_DROPS/528-550--------------------Y------Y---.------------------------------------------------
C0P658_MAIZE/242-266--------------------W------V---.------------------------------------------------
A9JST7_DANRE/77-101--------------------K------C---.------------------------------------------------
A4S878_OSTLU/97-121--------------------P------H---.------------------------------------------------
Z385C_HUMAN/221-245--------------------L------Y---.------------------------------------------------
B8AAR8_ORYSI/94-118--------------------W------F---.------------------------------------------------
Q2F5Z3_BOMMO/270-294--------------------L------Y---.------------------------------------------------
A4I4E7_LEIIN/161-185--------------------K------E---.------------------------------------------------
C5L1U6_PERM5/99-123--------------------F------L---.------------------------------------------------
ZMAT1_HUMAN/56-80--------------------K------F---.------------------------------------------------
Q109V1_ORYSJ/139-163--------------------F------W---.------------------------------------------------
C5M3Y8_CANTT/327-351--------------------F------E---.------------------------------------------------
A3BE51_ORYSJ/334-358--------------------L------W---.------------------------------------------------
A3BYY1_ORYSJ/308-332--------------------W------V---.------------------------------------------------
A5DEF9_PICGU/50-74--------------------Y------D---.------------------------------------------------
A9VAE8_MONBE/371-395--------------------L------H---.------------------------------------------------
Q29AF2_DROPS/328-352--------------------F------H---.------------------------------------------------
ZN346_DANRE/180-204--------------------R------F---.------------------------------------------------
B3S237_TRIAD/260-284--------------------F------T---.------------------------------------------------
B9SJB7_RICCO/132-156--------------------R------V---.------------------------------------------------
B9HN84_POPTR/373-397--------------------V------T---.------------------------------------------------
A8PTD6_BRUMA/5-29--------------------Q------W---.------------------------------------------------
Q7S3X8_NEUCR/319-343--------------------L------E---.------------------------------------------------
Q2GS44_CHAGB/88-112--------------------R------A---.------------------------------------------------
B9STT6_RICCO/209-233--------------------W------S---.------------------------------------------------
Q4XLH6_PLACH/54-78--------------------F------E---.------------------------------------------------
B6SGD7_MAIZE/64-88--------------------F------Y---.------------------------------------------------
Q7QGK0_ANOGA/83-107--------------------F------H---.------------------------------------------------
Q582U2_TRYB2/321-345--------------------R------S---.------------------------------------------------
B8BHK4_ORYSI/228-252--------------------V------R---.------------------------------------------------
B3S8D2_TRIAD/554-578--------------------K------F---.------------------------------------------------
A3LZB0_PICST/290-314--------------------V------Y---.------------------------------------------------
ZMAT1_HUMAN/121-145--------------------K------F---.------------------------------------------------
A2YT99_ORYSI/235-259--------------------I------I---.------------------------------------------------
B9RX77_RICCO/251-275--------------------W------T---.------------------------------------------------
B4Q9R2_DROSI/477-501--------------------F------Y---.------------------------------------------------
B4F8C1_MAIZE/290-314--------------------K------I---.------------------------------------------------
B4H133_DROPE/218-242--------------------K------E---.------------------------------------------------
B3P0F7_DROER/385-409--------------------F------H---.------------------------------------------------
B4FE91_MAIZE/249-273--------------------W------S---.------------------------------------------------
B6UCD9_MAIZE/36-60--------------------P------I---.------------------------------------------------
A7RRM2_NEMVE/192-216--------------------F------Y---.------------------------------------------------
B9STT6_RICCO/343-367--------------------F------W---.------------------------------------------------
Q16QC5_AEDAE/229-253--------------------F------M---.------------------------------------------------
Q5C382_SCHJA/121-145--------------------F------T---.------------------------------------------------
Q7S742_NEUCR/26-50--------------------W------Y---.------------------------------------------------
C5FJD4_ARTOC/95-119--------------------F------Y---.------------------------------------------------
B4FE91_MAIZE/196-220--------------------L------S---.------------------------------------------------
A4HEC3_LEIBR/322-346--------------------F------N---.------------------------------------------------
YJVF_SCHPO/68-94--------------------F------Y---Q------------------------------------------------
B4NET1_DROWI/312-336--------------------L------T---.------------------------------------------------
C5DR32_ZYGRC/65-89--------------------L------V---.------------------------------------------------
B3LXS7_DROAN/245-269--------------------F------D---.------------------------------------------------
A8XZP3_CAEBR/384-408--------------------L------K---.------------------------------------------------
B9QQ05_TOXGO/382-406--------------------Y------T---.------------------------------------------------
B4M0Z5_DROVI/331-355--------------------F------H---.------------------------------------------------
Q4E2J2_TRYCC/321-345--------------------L------N---.------------------------------------------------
B9RX76_RICCO/249-273--------------------W------V---.------------------------------------------------
B0EGW2_ENTDS/68-92--------------------F------Y---.------------------------------------------------
C5LSG1_PERM5/85-109--------------------Y------Y---.------------------------------------------------
ZN346_MOUSE/185-209--------------------K------F---.------------------------------------------------
B8BF99_ORYSI/164-188--------------------W------G---.------------------------------------------------
A9SHF2_PHYPA/134-159--------------------L------K---.------------------------------------------------
B4GMN2_DROPE/219-243--------------------F------Y---.------------------------------------------------
B5DNF8_DROPS/134-158--------------------Y------H---.------------------------------------------------
A6RFN9_AJECN/65-91--------------------Y------K---N------------------------------------------------
Q69P59_ORYSJ/415-439--------------------Y------F---.------------------------------------------------
B6HEZ3_PENCW/308-332--------------------F------E---.------------------------------------------------
A7RQ90_NEMVE/118-142--------------------T------H---.------------------------------------------------
B3RS34_TRIAD/3-27--------------------S------V---.------------------------------------------------
B9GH74_POPTR/470-494--------------------W------R---.------------------------------------------------
Z385C_MOUSE/77-101--------------------I------S---.------------------------------------------------
C4V8W2_NOSCE/159-183--------------------L------I---.------------------------------------------------
A8PKW3_BRUMA/341-365--------------------F------R---.------------------------------------------------
Q69P58_ORYSJ/288-312--------------------L------S---.------------------------------------------------
B4HWT1_DROSE/623-647--------------------F------Y---.------------------------------------------------
C4YR79_CANAW/269-293--------------------L------F---.------------------------------------------------
Q1RL81_CIOIN/167-191--------------------W------H---.------------------------------------------------
Q4S9C2_TETNG/381-405--------------------F------Y---.------------------------------------------------
Q5CRF6_CRYPI/334-358--------------------Y------S---.------------------------------------------------
B9HN84_POPTR/468-492--------------------W------W---.------------------------------------------------
Q5ARM0_EMENI/295-319--------------------I------E---.------------------------------------------------
O64571_ARATH/154-178--------------------W------F---.------------------------------------------------
C4LWB5_ENTHI/352-376--------------------Y------Y---.------------------------------------------------
C1EIE1_MICSR/172-196--------------------H------R---.------------------------------------------------
B4M0K5_DROVI/342-366--------------------Q------R---.------------------------------------------------
B2VWQ1_PYRTR/82-106--------------------K------V---.------------------------------------------------
B6Q556_PENMQ/72-96--------------------K------T---.------------------------------------------------
B2WHT3_PYRTR/250-274--------------------I------W---.------------------------------------------------
Q6YX02_ORYSJ/86-110--------------------L------G---.------------------------------------------------
Q7ZZ44_DANRE/34-58--------------------L------Y---.------------------------------------------------
C5LSG1_PERM5/32-56--------------------W------H---.------------------------------------------------
C5LQW5_PERM5/229-254--------------------W------W---.------------------------------------------------
B4FQZ1_MAIZE/79-103--------------------A------W---.------------------------------------------------
A8XTK0_CAEBR/153-177--------------------Y------Y---.------------------------------------------------
C4LYX8_ENTHI/53-77--------------------Y------Q---.------------------------------------------------
Q9FNP6_ARATH/464-488--------------------Y------I---.------------------------------------------------
Q8SX40_DROME/397-421--------------------F------H---.------------------------------------------------
B9H6T1_POPTR/86-110--------------------W------S---.------------------------------------------------
Q9FNP6_ARATH/702-726--------------------V------W---.------------------------------------------------
B0WZH2_CULQU/437-461--------------------T------I---.------------------------------------------------
B0WL11_CULQU/52-76--------------------L------T---.------------------------------------------------
A7RJ77_NEMVE/418-442--------------------Y------V---.------------------------------------------------
A2A5E7_MOUSE/42-66--------------------T------L---.------------------------------------------------
A2EKF0_TRIVA/73-97--------------------W------V---.------------------------------------------------
B4R6Q1_DROSI/69-93--------------------V------Y---.------------------------------------------------
C4M2V0_ENTHI/301-325--------------------W------C---.------------------------------------------------
Q5C382_SCHJA/11-35--------------------F------L---.------------------------------------------------
B4H133_DROPE/289-313--------------------Y------Y---.------------------------------------------------
A3LZB0_PICST/433-458--------------------Y------N---.------------------------------------------------
C0P658_MAIZE/308-332--------------------W------N---.------------------------------------------------
B4NET1_DROWI/389-413--------------------Y------Y---.------------------------------------------------
A8J846_CHLRE/257-281--------------------F------E---.------------------------------------------------
B9RX76_RICCO/476-500--------------------W------N---.------------------------------------------------
Z385D_HUMAN/80-104--------------------I------S---.------------------------------------------------
B0DAI2_LACBS/314-338--------------------W------E---.------------------------------------------------
A7TH30_VANPO/80-104--------------------F------Y---.------------------------------------------------
B7G055_PHATC/409-433--------------------W------R---.------------------------------------------------
B9RX75_RICCO/313-337--------------------W------I---.------------------------------------------------
C5KS73_PERM5/148-172--------------------T------V---.------------------------------------------------
Q16VV5_AEDAE/41-65--------------------L------Y---.------------------------------------------------
Q5KMT0_CRYNJ/65-89--------------------L------A---.------------------------------------------------
B5RSS5_DEBHA/330-354--------------------F------E---.------------------------------------------------
B9S303_RICCO/37-61--------------------P------V---.------------------------------------------------
B7PQE6_IXOSC/189-213--------------------F------M---.------------------------------------------------
B0WTK3_CULQU/301-325--------------------Y------W---.------------------------------------------------
B6TYA2_MAIZE/282-306--------------------V------W---.------------------------------------------------
Q4TB69_TETNG/115-139--------------------H------V---.------------------------------------------------
Q4S950_TETNG/354-378--------------------L------Q---.------------------------------------------------
A5B0X8_VITVI/594-618--------------------R------A---.------------------------------------------------
A0DLK5_PARTE/244-268--------------------H------Y---.------------------------------------------------
B9RX75_RICCO/234-257--------------------W------T---.------------------------------------------------
ZN830_MOUSE/51-75--------------------L------S---.------------------------------------------------
Q55JG7_CRYNB/94-118--------------------F------Y---.------------------------------------------------
Q586K6_TRYB2/27-51--------------------V------V---.------------------------------------------------
B0WUZ5_CULQU/141-163--------------------F------T---.------------------------------------------------
ZMAT1_XENTR/61-85--------------------T------F---.------------------------------------------------
A5B0X8_VITVI/431-455--------------------R------T---.------------------------------------------------
B4JE80_DROGR/597-621--------------------Y------Y---.------------------------------------------------
B7PQE6_IXOSC/64-88--------------------L------C---.------------------------------------------------
A9UNU5_MONBE/72-96--------------------Y------E---.------------------------------------------------
C5L3J8_PERM5/353-377--------------------F------S---.------------------------------------------------
A4S878_OSTLU/45-69--------------------P------R---.------------------------------------------------
C4Y405_CLAL4/265-289--------------------I------F---.------------------------------------------------
B8CDH8_THAPS/129-153--------------------F------Y---.------------------------------------------------
Q55CK7_DICDI/279-303--------------------L------F---.------------------------------------------------
B9SJB7_RICCO/37-61--------------------A------Y---.------------------------------------------------
A7RL73_NEMVE/31-55--------------------Y------T---.------------------------------------------------
A8XTK0_CAEBR/200-224--------------------Y------R---.------------------------------------------------
B4NB08_DROWI/306-330--------------------Y------S---.------------------------------------------------
Q9FNP7_ARATH/313-337--------------------A------W---.------------------------------------------------
B0YCU3_ASPFC/422-446--------------------F------T---.------------------------------------------------
A7RQ90_NEMVE/196-220--------------------Y------T---.------------------------------------------------
A5DJE8_PICGU/403-428--------------------Y------D---.------------------------------------------------
Q170B1_AEDAE/873-897--------------------H------Q---.------------------------------------------------
B9RX76_RICCO/949-973--------------------W------Q---.------------------------------------------------
Q6BPR8_DEBHA/274-298--------------------V------Y---.------------------------------------------------
B6A9C8_CRYMR/299-323--------------------Y------Y---.------------------------------------------------
B4JYX2_DROGR/390-414--------------------F------L---.------------------------------------------------
B4L7M9_DROMO/172-196--------------------F------H---.------------------------------------------------
A2DA83_TRIVA/53-77--------------------L------E---.------------------------------------------------
SAP62_SCHPO/54-78--------------------F------E---.------------------------------------------------
A3BYY1_ORYSJ/252-276--------------------W------I---.------------------------------------------------
B9RX77_RICCO/23-47--------------------W------T---.------------------------------------------------
C1N5T0_MICPC/171-194--------------------R------.---.------------------------------------------------
C3YMZ5_BRAFL/117-141--------------------F------L---.------------------------------------------------
C5L6I9_PERM5/21-45--------------------W------K---.------------------------------------------------
B4LZG0_DROVI/310-335--------------------E------R---.------------------------------------------------
C5MGT4_CANTT/263-287--------------------I------F---.------------------------------------------------
B0EPX1_ENTDS/63-87--------------------L------Y---.------------------------------------------------
A8QBW4_MALGO/267-291--------------------I------W---.------------------------------------------------
Q54VV0_DICDI/97-121--------------------F------Y---.------------------------------------------------
B9GH74_POPTR/372-396--------------------W------T---.------------------------------------------------
B9RX75_RICCO/551-575--------------------W------R---.------------------------------------------------
Q23RJ7_TETTS/75-99--------------------L------K---.------------------------------------------------
Q9FNP6_ARATH/297-321--------------------L------L---.------------------------------------------------
Q7QGK0_ANOGA/176-200--------------------T------F---.------------------------------------------------
Q4PB66_USTMA/384-408--------------------W------D---.------------------------------------------------
B0XFV6_CULQU/423-447--------------------H------A---.------------------------------------------------
A2QJC1_ASPNC/220-244--------------------W------E---.------------------------------------------------
C1EIA3_MICSR/913-937--------------------P------K---.------------------------------------------------
B4M0K8_DROVI/386-410--------------------F------Y---.------------------------------------------------
C1MPY0_MICPC/106-130--------------------W------D---.------------------------------------------------
Q6C2A2_YARLI/288-312--------------------L------F---.------------------------------------------------
C4XWG5_CLAL4/333-357--------------------Y------E---.------------------------------------------------
B9RX77_RICCO/103-127--------------------L------I---.------------------------------------------------
A5B8B1_VITVI/424-448--------------------L------I---.------------------------------------------------
C3Y243_BRAFL/963-987--------------------K------I---.------------------------------------------------
C3ZEF1_BRAFL/160-184--------------------Y------Y---.------------------------------------------------
B9RX77_RICCO/347-371--------------------W------W---.------------------------------------------------
B9RX77_RICCO/175-199--------------------W------T---.------------------------------------------------
Z385C_MOUSE/297-321--------------------F------H---.------------------------------------------------
A7T2Q3_NEMVE/62-86--------------------F------H---.------------------------------------------------
Q6C7S9_YARLI/39-63--------------------F------E---.------------------------------------------------
Q2U5B2_ASPOR/306-330--------------------F------E---.------------------------------------------------
A7AUL0_BABBO/54-78--------------------L------E---.------------------------------------------------
O64571_ARATH/224-248--------------------W------F---.------------------------------------------------
Q4STD2_TETNG/317-341--------------------F------Y---.------------------------------------------------
C1BU26_9MAXI/277-301--------------------F------T---.------------------------------------------------
A7AR58_BABBO/310-334--------------------F------P---.------------------------------------------------
MU185_SCHPO/270-294--------------------I------M---.------------------------------------------------
Q1RLA2_CIOIN/313-337--------------------L------Y---.------------------------------------------------
C0P658_MAIZE/177-201--------------------W------R---.------------------------------------------------
A0CIK9_PARTE/302-326--------------------F------F---.------------------------------------------------
C0P658_MAIZE/350-374--------------------W------G---.------------------------------------------------
B3MS65_DROAN/69-93--------------------V------Y---.------------------------------------------------
Q1RLE6_CIOIN/65-89--------------------Y------Y---.------------------------------------------------
Q6FMS8_CANGA/25-49--------------------F------Y---.------------------------------------------------
B4NJW2_DROWI/63-87--------------------Y------H---.------------------------------------------------
STPAP_RAT/16-40--------------------F------R---.------------------------------------------------
A8PKW3_BRUMA/296-320--------------------F------Y---.------------------------------------------------
B9MWW2_POPTR/290-314--------------------W------T---.------------------------------------------------
B9GH74_POPTR/534-558--------------------W------Q---.------------------------------------------------
Q0CBC9_ASPTN/312-336--------------------F------D---.------------------------------------------------
Q4PBS4_USTMA/94-118--------------------D------K---.------------------------------------------------
ZMAT1_XENTR/125-149--------------------K------F---.------------------------------------------------
Q5BVZ3_SCHJA/193-217--------------------F------Y---.------------------------------------------------
A8N6P2_COPC7/75-99--------------------M------T---.------------------------------------------------
Q23U22_TETTS/26-50--------------------F------Y---.------------------------------------------------
B9RLP0_RICCO/273-297--------------------L------Y---.------------------------------------------------
C4QYP7_PICPG/265-289--------------------F------E---.------------------------------------------------
C3YMZ5_BRAFL/66-90--------------------D------Y---.------------------------------------------------
C5KZK3_PERM5/69-93--------------------W------L---.------------------------------------------------
Q3LVY8_BIGNA/48-72--------------------F------K---.------------------------------------------------
C4R555_PICPG/270-294--------------------V------F---.------------------------------------------------
Q9FNP7_ARATH/267-290--------------------S------F---.------------------------------------------------
B4LZG1_DROVI/319-343--------------------F------R---.------------------------------------------------
B9SMZ5_RICCO/192-216--------------------W------S---.------------------------------------------------
Q4SPY2_TETNG/150-174--------------------Y------P---.------------------------------------------------
Q6BPR8_DEBHA/421-446--------------------Y------E---.------------------------------------------------
B4JLK3_DROGR/291-315--------------------Y------Y---.------------------------------------------------
C4JBJ4_MAIZE/423-447--------------------W------S---.------------------------------------------------
B6AIA4_CRYMR/54-78--------------------I------E---.------------------------------------------------
Q1RL91_CIOIN/857-881--------------------Y------K---.------------------------------------------------
B2B675_PODAN/250-274--------------------V------W---.------------------------------------------------
Q4V8W9_DANRE/111-135--------------------K------Y---.------------------------------------------------
A8PYP7_MALGO/63-87--------------------F------Y---.------------------------------------------------
B0WUU3_CULQU/233-257--------------------Y------Y---.------------------------------------------------
C5M698_CANTT/92-116--------------------F------F---.------------------------------------------------
Q0UAS9_PHANO/271-295--------------------F------W---.------------------------------------------------
B3NEP7_DROER/303-327--------------------Y------Y---.------------------------------------------------
Q01A69_OSTTA/509-533--------------------R------T---.------------------------------------------------
B4NKZ6_DROWI/327-351--------------------H------Q---.------------------------------------------------
Q7QGK0_ANOGA/18-42--------------------F------H---.------------------------------------------------
A8Q0H9_BRUMA/51-75--------------------F------Y---.------------------------------------------------
A5ABL9_ASPNC/75-99--------------------T------T---.------------------------------------------------
Q7Q167_ANOGA/318-342--------------------L------Y---.------------------------------------------------
B5DXP2_DROPS/12-36--------------------F------H---.------------------------------------------------
B5DXH0_DROPS/307-331--------------------F------R---.------------------------------------------------
Q4S9C2_TETNG/148-172--------------------A------S---.------------------------------------------------
A4RW02_OSTLU/101-125--------------------W------R---.------------------------------------------------
Q4P183_USTMA/296-320--------------------I------W---.------------------------------------------------
A5DJ70_PICGU/55-79--------------------L------E---.------------------------------------------------
B3LXH0_DROAN/286-310--------------------F------E---.------------------------------------------------
A8Q0Y9_MALGO/353-377--------------------W------D---.------------------------------------------------
B7PBQ8_IXOSC/83-107--------------------F------E---.------------------------------------------------
B9RX75_RICCO/455-479--------------------W------I---.------------------------------------------------
Q6CEI7_YARLI/300-324--------------------W------E---.------------------------------------------------
B3RL33_TRIAD/84-108--------------------Y------A---.------------------------------------------------

PF13912

Q6QI63_RAT/176-202-------------------VF------L----------------------------------------------------
Q7PW75_ANOGA/686-712-------------------DS------K----------------------------------------------------
Q7PW75_ANOGA/1151-1177-------------------PK------Y----------------------------------------------------
D2KMS9_DANRE/91-117-------------------LY------Q----------------------------------------------------
D2KMS9_DANRE/456-482-------------------LH------T----------------------------------------------------
FOG1_DANRE/34-60-------------------GA------T----------------------------------------------------
FOG1_DANRE/167-193-------------------RT------F----------------------------------------------------
B4Q650_DROSI/280-306-------------------QL------I----------------------------------------------------
B4Q650_DROSI/602-628-------------------KK------Y----------------------------------------------------
Q4S661_TETNG/8-34-------------------IH------I----------------------------------------------------
Q4S661_TETNG/401-427-------------------AF------C----------------------------------------------------
A5GFU9_PIG/30-56-------------------IH------I----------------------------------------------------
A5GFU9_PIG/424-450-------------------TF------H----------------------------------------------------
B5DFF6_RAT/29-56-------------------VH------R----------------------------------------------------
D2GWM2_AILME/148-174-------------------VF------P----------------------------------------------------
A2BE84_DANRE/47-75-------------------LL------T----------------------------------------------------
C3XQD1_BRAFL/46-72-------------------IL------E----------------------------------------------------
ZN574_XENTR/98-124-------------------HY------E----------------------------------------------------
Q1RLR5_DANRE/47-75-------------------LL------T----------------------------------------------------
Q4H2I9_CIOIN/68-94-------------------IF------Q----------------------------------------------------
B4QUV3_DROSI/306-333-------------------YY------N----------------------------------------------------
Q4RJI8_TETNG/55-82-------------------VH------K----------------------------------------------------
Q9C538_ARATH/192-218-------------------LF------K----------------------------------------------------
C5Y1I0_SORBI/262-289-------------------PR------E----------------------------------------------------
E4F1_DANRE/35-61-------------------IH------K----------------------------------------------------
B9GEM8_POPTR/67-93-------------------YR------V----------------------------------------------------
B9GEM8_POPTR/435-461-------------------SF------Q----------------------------------------------------
B9RLS0_RICCO/380-406-------------------RF------E----------------------------------------------------
C0PPD2_MAIZE/94-120-------------------RY------E----------------------------------------------------
C0PPD2_MAIZE/153-179-------------------TH------R----------------------------------------------------
A2CE94_DANRE/39-67-------------------LL------T----------------------------------------------------
ZN423_DANRE/75-101-------------------IF------T----------------------------------------------------
A2XJH1_ORYSI/88-114-------------------QH------G----------------------------------------------------
A7MD94_DANRE/44-72-------------------LL------T----------------------------------------------------
Q3S409_CALVI/80-106-------------------DR------Y----------------------------------------------------
Q9VNI5_DROME/64-90-------------------IY------E----------------------------------------------------
B0WBE1_CULQU/683-709-------------------VF------K----------------------------------------------------
Q9D7X0_MOUSE/94-122-------------------LL------T----------------------------------------------------
C5XD44_SORBI/154-180-------------------VH------Q----------------------------------------------------
Q3UXX7_MOUSE/189-215-------------------GK------Y----------------------------------------------------
Q4T3M3_TETNG/1379-1405-------------------MY------E----------------------------------------------------
ZAT2_ARATH/64-90-------------------AR------P----------------------------------------------------
C5X031_SORBI/183-209-------------------VH------R----------------------------------------------------
C4J8V9_MAIZE/93-119-------------------EF------R----------------------------------------------------
B9R9U7_RICCO/156-182-------------------KY------K----------------------------------------------------
C6TAQ4_SOYBN/126-152-------------------VY------E----------------------------------------------------
B9GDY3_ORYSJ/117-143-------------------KH------C----------------------------------------------------
Q7SYC8_DANRE/74-100-------------------IF------E----------------------------------------------------
Q6K9W9_ORYSJ/231-257-------------------VH------E----------------------------------------------------
Q4T246_TETNG/144-170-------------------GR------F----------------------------------------------------
A2WWT8_ORYSI/42-68-------------------VF------E----------------------------------------------------
O04176_BRACM/89-115-------------------GY------K----------------------------------------------------
A7J146_BRACI/90-116-------------------TH------K----------------------------------------------------
D2HPB1_AILME/96-124-------------------LL------T----------------------------------------------------
C5WVL8_SORBI/99-125-------------------RF------R----------------------------------------------------
Q9FH19_ARATH/410-436-------------------DH------V----------------------------------------------------
C3ZBH5_BRAFL/1794-1820-------------------VY------T----------------------------------------------------
Q174R3_AEDAE/151-177-------------------IF------E----------------------------------------------------
B1Q4T8_BRUGY/91-117-------------------SY------K----------------------------------------------------
Q28BY5_XENTR/395-421-------------------PY------T----------------------------------------------------
B7PA98_IXOSC/8-34-------------------TH------L----------------------------------------------------
Q4S2L0_TETNG/438-464-------------------TY------T----------------------------------------------------
C3YFG6_BRAFL/7-32-------------------IH------I----------------------------------------------------
Q4U314_SILLA/339-365-------------------VH------E----------------------------------------------------
Q7S3X8_NEUCR/511-537-------------------TH------L----------------------------------------------------
B7P106_IXOSC/39-65-------------------IL------I----------------------------------------------------
A2WWT4_ORYSI/58-84-------------------VF------E----------------------------------------------------
C5WV17_SORBI/105-131-------------------SH------L----------------------------------------------------
C0ITH8_CICAR/151-177-------------------MH------E----------------------------------------------------
B0WRI3_CULQU/211-237-------------------VT------R----------------------------------------------------
D0E8G8_XENLA/68-94-------------------IY------T----------------------------------------------------
Q6JX07_NICBE/92-118-------------------VY------K----------------------------------------------------
D3YZL3_MOUSE/68-94-------------------IF------E----------------------------------------------------
B3NFC5_DROER/16-42-------------------TL------I----------------------------------------------------
D3ZQM2_RAT/46-72-------------------VH------S----------------------------------------------------
ZAT12_ARATH/38-64-------------------VF------T----------------------------------------------------
B9SGZ2_RICCO/71-98-------------------RY------E----------------------------------------------------
O22089_PETHY/44-70-------------------IF------E----------------------------------------------------
A0JMG7_DANRE/187-213-------------------IF------E----------------------------------------------------
A4ICD3_LEIIN/446-472-------------------TH------V----------------------------------------------------
Q9SI97_ARATH/33-59-------------------VF------A----------------------------------------------------

PF12756

A0CL87_PARTE/113-210---------------------------S---N------------------------------------------------
A0DBC5_PARTE/118-217---------------------------P---E------------------------------------------------
A1CEM1_ASPCL/167-266---------------------------R---.------------------------------------------------
A2E134_TRIVA/91-184---------------------------E---.------------------------------------------------
A2EY84_TRIVA/123-220---------------------------D---I------------------------------------------------
A2FY49_TRIVA/125-222---------------------------D---I------------------------------------------------
A3GG06_PICST/172-274---------------------------T---.------------------------------------------------
A3KN09_BOVIN/173-269---------------------------I---.------------------------------------------------
A3KN09_BOVIN/300-405---------------------------S---A------------------------------------------------
A3LSH1_PICST/204-303---------------------------H---.------------------------------------------------
A4HID1_LEIBR/23-127---------------------------E---F------------------------------------------------
A5ABL9_ASPNC/169-268---------------------------R---.------------------------------------------------
A5DAA7_PICGU/158-261---------------------------T---.------------------------------------------------
A5DF85_PICGU/192-291---------------------------H---.------------------------------------------------
A5DWN8_LODEL/185-287---------------------------S---.------------------------------------------------
A5E0D9_LODEL/215-313---------------------------T---.------------------------------------------------
A5KAJ8_PLAVS/220-318---------------------------P---Q------------------------------------------------
A6RA79_AJECN/222-321---------------------------H---.------------------------------------------------
A6SNU3_BOTFB/200-299---------------------------R---.------------------------------------------------
A6ZLK6_YEAS7/163-264---------------------------Q---.------------------------------------------------
A7A1R2_YEAS7/187-286---------------------------E---.------------------------------------------------
A7APW5_BABBO/142-238---------------------------M---.------------------------------------------------
A7RG08_NEMVE/117-213---------------------------T---.------------------------------------------------
A7RG08_NEMVE/247-352---------------------------L---A------------------------------------------------
A7S1H2_NEMVE/149-250---------------------------Q---.------------------------------------------------
A7TGF8_VANPO/203-302---------------------------E---.------------------------------------------------
A7TKJ2_VANPO/177-278---------------------------Q---.------------------------------------------------
A8BRD6_GIAIC/206-307---------------------------E---.------------------------------------------------
A8N6P2_COPC7/179-281---------------------------D---.------------------------------------------------
A8Q2J7_BRUMA/162-262---------------------------V---.------------------------------------------------
A8QF85_BRUMA/360-456---------------------------Q---.------------------------------------------------
A8XW76_CAEBR/166-267---------------------------S---.------------------------------------------------
A9NWN9_PICSI/191-296---------------------------C---.------------------------------------------------
A9RG33_PHYPA/170-274---------------------------D---.------------------------------------------------
A9UNU5_MONBE/187-285---------------------------D---.------------------------------------------------
B0D0A4_LACBS/171-273---------------------------Q---.------------------------------------------------
B0ERX1_ENTDS/148-249---------------------------H---.------------------------------------------------
B0WTB0_CULQU/173-276---------------------------N---N------------------------------------------------
B0XA93_CULQU/169-265---------------------------G---.------------------------------------------------
B0XA93_CULQU/309-411---------------------------P---T------------------------------------------------
B2APT6_PODAN/147-246---------------------------Q---.------------------------------------------------
B2ART8_PODAN/234-333---------------------------T---.------------------------------------------------
B2VWQ1_PYRTR/200-299---------------------------D---.------------------------------------------------
B3MF27_DROAN/150-246---------------------------E---.------------------------------------------------
B3MF27_DROAN/304-406---------------------------S---I------------------------------------------------
B3MS65_DROAN/189-292---------------------------E---R------------------------------------------------
B3NP05_DROER/307-409---------------------------S---I------------------------------------------------
B3RL33_TRIAD/157-258---------------------------D---.------------------------------------------------
B4GDG5_DROPE/303-405---------------------------S---L------------------------------------------------
B4LK38_DROVI/302-404---------------------------A---I------------------------------------------------
B5X107_SALSA/262-363---------------------------D---.------------------------------------------------
B6AAZ0_CRYMR/102-201---------------------------Y---.------------------------------------------------
B6GWU8_PENCW/169-268---------------------------R---.------------------------------------------------
B6K092_SCHJY/107-202---------------------------S---.------------------------------------------------
B6K4Y2_SCHJY/191-290---------------------------D---.------------------------------------------------
B6Q556_PENMQ/175-274---------------------------K---.------------------------------------------------
B6QKD2_PENMQ/49-147---------------------------K---.------------------------------------------------
B6TYD5_MAIZE/177-281---------------------------S---.------------------------------------------------
B7G5C8_PHATC/162-261---------------------------Q---.------------------------------------------------
B7PQC6_IXOSC/101-215---------------------------I---V------------------------------------------------
B7QL67_IXOSC/146-247---------------------------C---.------------------------------------------------
B8BZ28_THAPS/187-286---------------------------Q---.------------------------------------------------
B8LT33_TALSN/26-124---------------------------R---.------------------------------------------------
B9WMM6_CANDC/202-301---------------------------H---.------------------------------------------------
C1BP60_9MAXI/172-268---------------------------G---.------------------------------------------------
C1BP60_9MAXI/309-414---------------------------G---A------------------------------------------------
C3Z2W9_BRAFL/169-272---------------------------A---.------------------------------------------------
C3Z2W9_BRAFL/306-410---------------------------Q---A------------------------------------------------
C3ZHE1_BRAFL/219-322---------------------------E---K------------------------------------------------
C4JG26_UNCRE/105-204---------------------------R---.------------------------------------------------
C4QVW4_PICPG/173-272---------------------------E---.------------------------------------------------
C4QYN6_PICPG/199-297---------------------------A---.------------------------------------------------
C4XX48_CLAL4/158-261---------------------------T---.------------------------------------------------
C4Y3F6_CLAL4/193-292---------------------------M---.------------------------------------------------
C5DRY2_ZYGRC/178-277---------------------------D---.------------------------------------------------
C5E1G3_ZYGRC/156-255---------------------------E---.------------------------------------------------
C5E366_LACTC/159-260---------------------------V---.------------------------------------------------
C5G0T2_ARTOC/196-295---------------------------Q---.------------------------------------------------
C5LQU6_PERM5/115-214---------------------------T---.------------------------------------------------
O49591_ARATH/201-305---------------------------C---.------------------------------------------------
YJVF_SCHPO/209-308---------------------------D---.------------------------------------------------
Q0U3Z2_PHANO/85-179---------------------------Q---.------------------------------------------------
Q0UNZ0_PHANO/197-296---------------------------D---.------------------------------------------------
Q16VY7_AEDAE/306-408---------------------------P---T------------------------------------------------
Q2GS44_CHAGB/226-325---------------------------T---.------------------------------------------------
Q2H8Q4_CHAGB/112-207---------------------------E---.------------------------------------------------
Q2ULX1_ASPOR/130-229---------------------------R---.------------------------------------------------
Q4N636_THEPA/125-221---------------------------K---.------------------------------------------------
Q4PBS4_USTMA/225-328---------------------------E---.------------------------------------------------
Q52KN1_XENLA/159-255---------------------------V---.------------------------------------------------
Q52KN1_XENLA/286-391---------------------------S---A------------------------------------------------
Q54Q44_DICDI/210-306---------------------------I---.------------------------------------------------
Q54Q44_DICDI/363-471---------------------------T---A------------------------------------------------
Q584W8_TRYB2/25-125---------------------------D---F------------------------------------------------
Q5BC55_EMENI/163-262---------------------------H---.------------------------------------------------
Q5CFB4_CRYHO/107-206---------------------------Y---.------------------------------------------------
Q5KMT0_CRYNJ/155-257---------------------------D---.------------------------------------------------
Q6BY84_DEBHA/193-292---------------------------Y---.------------------------------------------------
Q6BZ58_DEBHA/168-271---------------------------T---.------------------------------------------------
Q6CFB1_YARLI/172-271---------------------------D---.------------------------------------------------
Q6CLN1_KLULA/167-266---------------------------E---.------------------------------------------------
Q6CPG1_KLULA/171-270---------------------------E---.------------------------------------------------
Q6FRR7_CANGA/185-284---------------------------T---.------------------------------------------------
Q6V945_GIBZA/53-150---------------------------Q---.------------------------------------------------
Q757G3_ASHGO/167-265---------------------------D---.------------------------------------------------
Q758B7_ASHGO/153-253---------------------------A---.------------------------------------------------
Q7PYV1_ANOGA/170-273---------------------------R---N------------------------------------------------
Q7PZE9_ANOGA/170-266---------------------------G---.------------------------------------------------
Q7PZE9_ANOGA/302-405---------------------------T---T------------------------------------------------
Q7SYJ7_DANRE/285-390---------------------------C---A------------------------------------------------
Q7ZXY8_XENLA/243-344---------------------------D---.------------------------------------------------
YLM7_SCHPO/96-192---------------------------Q---.------------------------------------------------

PF13909

A0JMC9_DANRE/108-131--------------------A------A----------------------------------------------------
A6QLD7_BOVIN/106-129--------------------I------P----------------------------------------------------
Q0P4U5_XENTR/106-129--------------------A------A----------------------------------------------------
A4QP16_DANRE/108-131--------------------L------M----------------------------------------------------
Q4SJ09_TETNG/112-136--------------------A------S----------------------------------------------------
Q4RGT6_TETNG/39-63--------------------Y------Q----------------------------------------------------
Q4RGT6_TETNG/357-380--------------------Y------K----------------------------------------------------
Q4RGT6_TETNG/985-1009--------------------F------F----------------------------------------------------
Q4RGT6_TETNG/1107-1131--------------------Y------H----------------------------------------------------
Q4RGT6_TETNG/1955-1979--------------------Y------K----------------------------------------------------
Q4RGT6_TETNG/2125-2148--------------------L------R----------------------------------------------------
ZN462_HUMAN/108-132--------------------F------Q----------------------------------------------------
ZN462_HUMAN/470-493--------------------Y------K----------------------------------------------------
ZN462_HUMAN/1515-1539--------------------Y------K----------------------------------------------------
ZN462_HUMAN/2083-2107--------------------Y------K----------------------------------------------------
B1AWL2_MOUSE/917-941--------------------Y------R----------------------------------------------------
B7PWK2_IXOSC/264-288--------------------H------D----------------------------------------------------
B7PWK2_IXOSC/348-372--------------------Y------R----------------------------------------------------
B7PWK2_IXOSC/636-660--------------------F------K----------------------------------------------------
B7PWK2_IXOSC/761-785--------------------F------M----------------------------------------------------
B7PWK2_IXOSC/999-1023--------------------Y------K----------------------------------------------------
B7PWK2_IXOSC/1076-1100--------------------Y------K----------------------------------------------------
B7PWK2_IXOSC/1275-1299--------------------Y------P----------------------------------------------------
C3Y329_BRAFL/1145-1169--------------------F------K----------------------------------------------------
C3Y329_BRAFL/2491-2514--------------------I------N----------------------------------------------------
C3Y329_BRAFL/2968-2991--------------------Y------I----------------------------------------------------
SPR4_CAEEL/1053-1077--------------------Y------A----------------------------------------------------
B4MUH3_DROWI/135-159--------------------N------E----------------------------------------------------
B4MUH3_DROWI/319-343--------------------Y------Q----------------------------------------------------
B4MUH3_DROWI/551-575--------------------F------E----------------------------------------------------
Q2MHN3_MOUSE/446-470--------------------L------K----------------------------------------------------
Q2MHN3_MOUSE/752-777--------------------H------R----------------------------------------------------
A8PHZ8_BRUMA/500-523--------------------F------A----------------------------------------------------
A8PHZ8_BRUMA/595-618--------------------L------R----------------------------------------------------
A8PHZ8_BRUMA/818-841--------------------Y------S----------------------------------------------------
A8XE56_CAEBR/1022-1046--------------------S------I----------------------------------------------------
A8XE56_CAEBR/1287-1310--------------------F------V----------------------------------------------------
B4JA49_DROGR/288-312--------------------Y------H----------------------------------------------------
B4MRW9_DROWI/36-60--------------------Y------K----------------------------------------------------
B4P2L1_DROYA/552-576--------------------F------R----------------------------------------------------
B4P2L1_DROYA/2201-2225--------------------H------K----------------------------------------------------
B3MNH1_DROAN/1662-1686--------------------Y------E----------------------------------------------------
B3MNH1_DROAN/2009-2033--------------------H------Q----------------------------------------------------
B0W108_CULQU/560-586--------------------I------T----------------------------------------------------
B4JA46_DROGR/2053-2077--------------------Q------Q----------------------------------------------------
B7P493_IXOSC/210-234--------------------L------Q----------------------------------------------------
B7P493_IXOSC/470-494--------------------L------N----------------------------------------------------
B4I058_DROSE/457-481--------------------L------L----------------------------------------------------
B3NN32_DROER/822-846--------------------L------M----------------------------------------------------
B4G892_DROPE/900-920--------------------E------H----------------------------------------------------
Q9VK42_DROME/1986-2010--------------------Q------K----------------------------------------------------
Q9NZF0_HUMAN/97-121--------------------Y------C----------------------------------------------------
B4NCU0_DROWI/35-60--------------------Y------Q----------------------------------------------------
B0WCG2_CULQU/153-176--------------------Y------Q----------------------------------------------------
B3KPL9_HUMAN/273-297--------------------I------C----------------------------------------------------
D3ZVE0_RAT/581-605--------------------L------S----------------------------------------------------
D3ZVE0_RAT/723-747--------------------F------L----------------------------------------------------
B3DLY6_XENTR/107-131--------------------Y------V----------------------------------------------------
Q5BWG4_SCHJA/47-71--------------------Y------Q----------------------------------------------------
Q4RFH6_TETNG/118-142--------------------Y------L----------------------------------------------------
Q8N2Y6_HUMAN/70-94--------------------Y------Q----------------------------------------------------
C7TYR1_SCHJA/377-402--------------------Y------S----------------------------------------------------
B0W0M6_CULQU/1802-1826--------------------H------Q----------------------------------------------------
B0W0M6_CULQU/2470-2494--------------------Y------R----------------------------------------------------
B0W0M6_CULQU/2807-2832--------------------K------R----------------------------------------------------
D0UGE5_SALSA/106-130--------------------Y------L----------------------------------------------------
Q7QIY3_ANOGA/1517-1540--------------------Y------K----------------------------------------------------
B4Q650_DROSI/394-418--------------------Y------R----------------------------------------------------
D3ZV33_RAT/474-498--------------------T------I----------------------------------------------------
A8WN61_CAEBR/321-344--------------------R------K----------------------------------------------------
Q4TAJ1_TETNG/302-326--------------------N------F----------------------------------------------------
A5D8R5_DANRE/113-137--------------------Y------L----------------------------------------------------
A8PZ56_BRUMA/396-420--------------------Y------Q----------------------------------------------------

PF13913

Q5TVV1_ANOGA/349-373--------------------G------L---T------------------------------------------------
ZC21B_HUMAN/14-38--------------------E------L---F------------------------------------------------
ZC21A_BOVIN/14-38--------------------E------L---L------------------------------------------------
ZC21A_DANRE/13-37--------------------E------L---V------------------------------------------------
A0D772_PARTE/16-40--------------------K------T---L------------------------------------------------
A0D772_PARTE/88-112--------------------S------L---E------------------------------------------------
A0D772_PARTE/240-264--------------------A------L---V------------------------------------------------
A0D772_PARTE/282-306--------------------E------L---V------------------------------------------------
A0D772_PARTE/485-509--------------------D------L---I------------------------------------------------
A4II57_XENTR/7-31--------------------E------L---K------------------------------------------------
B3S1Z1_TRIAD/12-36--------------------E------F---A------------------------------------------------
A0BI04_PARTE/35-59--------------------E------L---E------------------------------------------------
Q4T3R5_TETNG/1-25--------------------E------L---V------------------------------------------------
B5DY39_DROPS/216-240--------------------G------T---S------------------------------------------------
B3NYH6_DROER/222-246--------------------G------T---A------------------------------------------------
B4LXR7_DROVI/219-243--------------------G------T---K------------------------------------------------
B7YZI7_DROME/250-274--------------------Q------L---T------------------------------------------------
B3MD64_DROAN/241-265--------------------D------L---T------------------------------------------------
Q17HT4_AEDAE/209-233--------------------G------L---V------------------------------------------------
B0WL51_CULQU/30-54--------------------G------M---A------------------------------------------------
B4NFE6_DROWI/297-321--------------------G------T---E------------------------------------------------
A7SCJ1_NEMVE/2-26--------------------G------L---V------------------------------------------------
A0BPA2_PARTE/18-42--------------------D------L---E------------------------------------------------
ZN474_BOVIN/162-186--------------------Q------L---L------------------------------------------------
ZN474_BOVIN/281-305--------------------Q------L---V------------------------------------------------
Q22W47_TETTS/1074-1098--------------------S------M---L------------------------------------------------
Q22W47_TETTS/1316-1340--------------------V------L---V------------------------------------------------
Q22W47_TETTS/1368-1392--------------------D------L---V------------------------------------------------
ZC21C_RAT/378-402--------------------E------L---G------------------------------------------------
D0NJC1_PHYIT/328-352--------------------Q------M---E------------------------------------------------
C3XR94_BRAFL/2-26--------------------N------L---T------------------------------------------------
B7PKC9_IXOSC/144-168--------------------N------Q---E------------------------------------------------
A9VC46_MONBE/24-48--------------------Q------L---H------------------------------------------------
ZC21C_MACFA/385-409--------------------Q------L---G------------------------------------------------
Q4DZW2_TRYCC/500-524--------------------P------L---M------------------------------------------------
C9ZU86_TRYB9/474-498--------------------P------L---L------------------------------------------------
B4J546_DROGR/189-213--------------------E------L---S------------------------------------------------
B4KUA9_DROMO/257-281--------------------Q------L---L------------------------------------------------
Q4QJB7_LEIMA/494-518--------------------P------M---Q------------------------------------------------
A2DFG0_TRIVA/216-240--------------------D------R---V------------------------------------------------
A9UUD0_MONBE/507-531--------------------T------L---M------------------------------------------------
B0WFX3_CULQU/56-80--------------------E------L---Q------------------------------------------------
A2DDQ6_TRIVA/317-341--------------------N------R---V------------------------------------------------
A4H4C7_LEIBR/498-522--------------------P------M---Q------------------------------------------------
A2DCT4_TRIVA/353-377--------------------E------L---V------------------------------------------------
A2G025_TRIVA/191-215--------------------D------R---Q------------------------------------------------
C3Y249_BRAFL/296-320--------------------S------L---V------------------------------------------------
C3Y249_BRAFL/360-384--------------------R------T---V------------------------------------------------
C1N5S1_MICPC/567-591--------------------K------L---T------------------------------------------------
A4HNQ7_LEIBR/99-123--------------------N------L---H------------------------------------------------
A0E7F3_PARTE/259-284--------------------K------L---Y------------------------------------------------
Q22FZ1_TETTS/1345-1370--------------------Q------L---F------------------------------------------------
B4L4C9_DROMO/16-40--------------------E------L---Q------------------------------------------------
B4MCV5_DROVI/16-40--------------------E------L---K------------------------------------------------
A0CCZ1_PARTE/398-423--------------------D------L---Q------------------------------------------------
Q23G89_TETTS/565-590--------------------N------L---E------------------------------------------------
C5KY37_PERM5/133-157--------------------R------M---V------------------------------------------------
Q4CZP9_TRYCC/394-419--------------------P------L---R------------------------------------------------
A7SW12_NEMVE/136-160--------------------Q------T---V------------------------------------------------
A7SW12_NEMVE/403-427--------------------N------M---L------------------------------------------------
A7SW12_NEMVE/632-656--------------------S------T---V------------------------------------------------
C6LWB9_GIAIB/210-234--------------------G------R---V------------------------------------------------
C6LWB9_GIAIB/330-354--------------------G------R---V------------------------------------------------
D2V1Q0_NAEGR/80-104--------------------S------L---N------------------------------------------------
D2V1Q0_NAEGR/313-337--------------------S------R---V------------------------------------------------
D2V1Q0_NAEGR/382-406--------------------E------R---A------------------------------------------------
D2V1Q0_NAEGR/449-473--------------------H------R---V------------------------------------------------
Q38BB2_TRYB2/94-118--------------------N------L---H------------------------------------------------
B6DTK8_9EUGL/177-201--------------------R------R---E------------------------------------------------
ZN474_HUMAN/220-244--------------------R------T---V------------------------------------------------
ZN474_HUMAN/283-307--------------------Q------L---V------------------------------------------------
A4I482_LEIIN/241-265--------------------E------L---E------------------------------------------------
Q1RL46_CIOIN/441-465--------------------P------F---V------------------------------------------------
A4HH62_LEIBR/245-269--------------------P------L---E------------------------------------------------
Q22MG0_TETTS/91-115--------------------T------Y---E------------------------------------------------
A4I8G9_LEIIN/131-155--------------------A------L---S------------------------------------------------
A4I8G9_LEIIN/464-488--------------------D------L---V------------------------------------------------
D0AAP9_TRYB9/450-474--------------------E------L---P------------------------------------------------
A0BQ29_PARTE/191-216--------------------E------L---I------------------------------------------------
A0D235_PARTE/9-34--------------------E------L---I------------------------------------------------
A4HKY8_LEIBR/181-205--------------------S------L---A------------------------------------------------
A4HKY8_LEIBR/514-538--------------------K------F---V------------------------------------------------
D0A5S6_TRYB9/389-414--------------------P------L---K------------------------------------------------
B3S813_TRIAD/83-107--------------------Q------L---V------------------------------------------------
Q4DWN4_TRYCC/191-215--------------------M------L---V------------------------------------------------
D2V0X3_NAEGR/490-514--------------------T------E---R------------------------------------------------
A0BJ34_PARTE/111-135--------------------A------L---V------------------------------------------------
A8BKJ5_GIAIC/107-131--------------------S------R---E------------------------------------------------
A8XNV4_CAEBR/16-40--------------------P------T---V------------------------------------------------
A8XNV4_CAEBR/88-112--------------------L------M---V------------------------------------------------
D2HAR5_AILME/6-30--------------------P------T---V------------------------------------------------
D2GZX7_AILME/382-406--------------------E------L---G------------------------------------------------
D0NEA9_PHYIT/340-364--------------------N------M---E------------------------------------------------
D0NEA9_PHYIT/424-448--------------------T------L---V------------------------------------------------
C6LPS8_GIAIB/136-160--------------------G------R---I------------------------------------------------
C1N8C4_MICPC/6-30--------------------R------L---L------------------------------------------------
C1N8C4_MICPC/111-135--------------------V------L---R------------------------------------------------
A0EFR9_PARTE/7-31--------------------Q------Y---E------------------------------------------------
A9SXU7_PHYPA/74-98--------------------T------L---T------------------------------------------------
D2VLG1_NAEGR/218-242--------------------S------L---V------------------------------------------------
D0N855_PHYIT/585-609--------------------G------M---E------------------------------------------------
B9Q6J7_TOXGO/439-463--------------------K------L---L------------------------------------------------
B9Q6J7_TOXGO/1000-1024--------------------P------T---A------------------------------------------------
A0C1Z5_PARTE/50-74--------------------P------K---E------------------------------------------------
Q568L6_DANRE/321-345--------------------P------E---T------------------------------------------------
Q568L6_DANRE/368-392--------------------H------M---V------------------------------------------------
Q01B39_OSTTA/34-58--------------------A------L---V------------------------------------------------
Q247Z8_TETTS/496-521--------------------E------Q---F------------------------------------------------
B5YP21_THAPS/32-60--------------------E------T---I------------------------------------------------
D0NT76_PHYIT/53-77--------------------G------R---V------------------------------------------------
B3NTK5_DROER/605-629--------------------D------I---V------------------------------------------------

PF13465

ZN486_HUMAN/168-193-------------------NSKRH...K...R.R.HT...----------------------------------------
C3Y5N9_BRAFL/492-517-------------------NFQSH...L...W.S.HD...----------------------------------------
C3Y5N9_BRAFL/642-667-------------------VLLLH...A...A.K.HY...----------------------------------------
C3Y5N9_BRAFL/701-726-------------------NMRSH...M...K.S.HS...----------------------------------------
C3Y5N9_BRAFL/908-933-------------------ALINH...K...N.N.HK...----------------------------------------
C3Y5N9_BRAFL/1509-1534-------------------RLLKH...K...A.M.HS...----------------------------------------
C3Y5N9_BRAFL/1565-1590-------------------DLKVH...K...Q.K.HG...----------------------------------------
C3Y5N9_BRAFL/1710-1735-------------------DLTQH...S...R.C.HG...----------------------------------------
C3Y5N9_BRAFL/1822-1845-------------------DIEQH...T...R.M.HK...----------------------------------------
C3Y5N9_BRAFL/2160-2186-------------------FLQVH...M...S.SRHR...----------------------------------------
C3Y5N6_BRAFL/2472-2497-------------------TLRTH...M...R.I.HS...----------------------------------------
C3Y5N6_BRAFL/2500-2525-------------------NLNTH...M...Q.F.HK...----------------------------------------
B4LSE1_DROVI/978-1006-------------------NLRKH...IVKTG.K.HP...----------------------------------------
Q17I36_AEDAE/547-572-------------------YVSKH...I...S.K.KT...----------------------------------------
Q17I36_AEDAE/709-735-------------------NLNLH...M...R.W.HS...----------------------------------------
C9JV94_HUMAN/189-214-------------------SVRRH...M...V.M.HS...----------------------------------------
B4JE27_DROGR/815-840-------------------NLKNH...I...A.T.VH...----------------------------------------
B4P6G0_DROYA/936-964-------------------NLRKH...IIKTG.K.HP...----------------------------------------
B4NB09_DROWI/246-271-------------------SLVRH...H...Y.T.HT...----------------------------------------
B4IIG8_DROSE/638-663-------------------RLAQH...Q...A.E.VH...----------------------------------------
B4IIG8_DROSE/709-740-------------------DLVYH...R...I.F.HTRS.----------------------------------------
D2HPL2_AILME/1017-1043-------------------ALELH..IK...R.K.HT...----------------------------------------
C3Y3Q4_BRAFL/924-949-------------------ELAEH...M...K.L.HI...----------------------------------------
Q5T0T3_HUMAN/464-490-------------------NLDRH...M...Q.T.HH...----------------------------------------
D2HT61_AILME/925-953-------------------LLYRH...F...D.Q.HI...----------------------------------------
B4M0K3_DROVI/332-358-------------------TRTRH...E...Q.VRHI...----------------------------------------
Q8CCP9_MOUSE/216-241-------------------DIQIY...E...R.I.HT...----------------------------------------
Q8CCP9_MOUSE/244-269-------------------HRTKH...Q...R.I.HT...----------------------------------------
B5DPM3_DROPS/803-828-------------------ELTRH...Y...R.K.HT...----------------------------------------
B7QDL7_IXOSC/281-306-------------------QLRLH...T...F.R.HQ...----------------------------------------
Q7PWB5_ANOGA/939-967-------------------NLRKHVIST...A.K.HK...----------------------------------------
Q27GU0_CAEEL/587-612-------------------MLNSH...M...K.S.HT...----------------------------------------
B4NKU8_DROWI/172-197-------------------YLKLH...L...L.R.HT...----------------------------------------
B4NKU8_DROWI/228-253-------------------SKVVH...E...R.T.HT...----------------------------------------
Q16FS5_AEDAE/123-151-------------------NLRKH...VISTS.K.HK...----------------------------------------
Q4RMA1_TETNG/725-751-------------------ELLMH...R...K.T.HS...----------------------------------------
Q2A130_HUMAN/419-444-------------------SLRVH...Q...Q.F.LT...----------------------------------------
C3ZL56_BRAFL/166-191-------------------MLSRH...M...R.T.HT...----------------------------------------
Q9VGR9_DROME/285-309-------------------LLRRH...Q...L.K.HT...----------------------------------------
C4WXH9_ACYPI/38-64-------------------SLKLH...T...K.NVHL...----------------------------------------
D2A615_TRICA/169-196-------------------NLRRH...K...S.YNHL...----------------------------------------
D2A615_TRICA/362-390-------------------NLTRH...I...K.SVHK...----------------------------------------
A8WZ67_CAEBR/128-153-------------------QLQTH...S...L.Q.HV...----------------------------------------
B0X845_CULQU/202-227-------------------GLKGH...V...K.R.TH...----------------------------------------
B0X845_CULQU/257-282-------------------TLRQH...M...L.V.HT...----------------------------------------
C3XUG1_BRAFL/351-375-------------------DIESH...L...A.S.KH...----------------------------------------
C3XUG1_BRAFL/478-504-------------------EILKH...V...D.W.HE...----------------------------------------
Q95UR8_SCHAM/391-416-------------------HLEYH...L...R.N.HS...----------------------------------------
B0X0R8_CULQU/239-264-------------------HLEYH...M...R.N.HD...----------------------------------------
B0X0R8_CULQU/267-292-------------------MLNSH...M...K.S.HS...----------------------------------------
O18327_BOMMO/31-56-------------------NLRRH...L...R.V.HT...----------------------------------------
B6DCI8_SELML/257-285-------------------NLRKH...I...K.VAHL...----------------------------------------
C3ZCI8_BRAFL/46-74-------------------HLRSH...F...K.R.HHS..----------------------------------------
B6ILE7_CAEBR/111-136-------------------DRRRH...V...L.F.HL...----------------------------------------
B4GTY9_DROPE/163-188-------------------YLEEH...V...A.T.HT...----------------------------------------
A8X4P7_CAEBR/267-292-------------------SLKTH...Q...L.I.HT...----------------------------------------
B7PIW0_IXOSC/428-454-------------------ALERH...V...ANV.HN...----------------------------------------
B4H5Z4_DROPE/372-397-------------------VFDEH...M...R.K.HV...----------------------------------------
Q65XX7_CAEEL/75-103-------------------SLQFH...V...D.S.EHI..----------------------------------------
Q0KG18_PLADU/548-574-------------------DFWEH...S...R.S.HI...----------------------------------------
Q45TD4_NASVI/353-378-------------------MLNSH...L...K.S.HS...----------------------------------------
Q45TD4_NASVI/693-718-------------------MHSVH...M...G.Y.HG...----------------------------------------
B4DM04_HUMAN/36-61-------------------HMERH...K...R.T.HS...----------------------------------------
B4KJP4_DROMO/725-751-------------------GLSQH...I...K.GYHL...----------------------------------------
C3Z3Y6_BRAFL/29-54-------------------KFDIH...M...T.N.HT...----------------------------------------
D2BGQ7_DEHSV/54-80-------------------LSRID...R...K.D.NV...----------------------------------------
B6JXI3_SCHJY/130-155-------------------HLARH...N...R.I.HM...----------------------------------------
B0X7A1_CULQU/220-245-------------------NLKYH...M...N.L.HT...----------------------------------------
D2A5C7_TRICA/167-196-------------------GLKRH...Q...R.G.HRVV.----------------------------------------
A8QCF0_BRUMA/224-250-------------------RFQEH...S...V.T.HI...----------------------------------------
A8PSF9_BRUMA/132-156-------------------ELDYH...A...K.Q.HS...----------------------------------------
D2HCL5_AILME/531-560-------------------SLSAH...M...S.L.QH...----------------------------------------
C3ZY15_BRAFL/99-125-------------------NLAQH...M...K.KVHK...----------------------------------------
A8X4P5_CAEBR/36-61-------------------YLYSH...L...R.R.HS...----------------------------------------
Q4RZB6_TETNG/590-615-------------------DCKKH...I...R.V.HT...----------------------------------------
D3J922_9DIPT/94-119-------------------HLEYH...L...R.N.HQ...----------------------------------------
B4PAD9_DROYA/635-660-------------------GLRQH...N...I.T.HS...----------------------------------------
C1M0Z0_SCHMA/245-268-------------------LLMSH...M...K.R.HI...----------------------------------------
A2CF18_MOUSE/89-114-------------------GRQRH...Q...I.K.HN...----------------------------------------
Q4R869_MACFA/163-190-------------------QLQCH...I...ENV.HT...----------------------------------------
Q4R869_MACFA/223-249-------------------DVETH...F...R.TCHE...----------------------------------------
Q19807_CAEEL/281-308-------------------AYMRH...A...A.S.HN...----------------------------------------
Q19807_CAEEL/311-337-------------------ELMRH...T...Q.T.HT...----------------------------------------
B3LZJ1_DROAN/264-290-------------------ELQEH...C...A.T.HP...----------------------------------------
Q3V2G0_MOUSE/57-82-------------------YPQWH...E...R.I.HT...----------------------------------------
B4KY04_DROMO/729-753-------------------RLDSH...M...R.KKHT...----------------------------------------
D2HQG8_AILME/621-647-------------------ELLTH...R...K.E.HQ...----------------------------------------
B0XEJ1_CULQU/238-263-------------------KCERH...V...R.D.VH...----------------------------------------
O44720_CAEEL/224-249-------------------NLNRH...R...K.I.HS...----------------------------------------
O44720_CAEEL/252-280-------------------RLQEH...L...Y.T.HL...----------------------------------------
B0XUY9_ASPFC/38-63-------------------HRSRH...E...R.S.HT...----------------------------------------
A8WRV0_CAEBR/303-329-------------------KLRKH...M...K.M.SH...----------------------------------------
Q29EW8_DROPS/622-646-------------------RLESH...I...A.K.MH...----------------------------------------
C8Z2G2_PARTP/312-337-------------------MLNSH...E...K.S.HS...----------------------------------------
C4Y0F7_CLAL4/93-120-------------------ALISH...C...R.T.HT...----------------------------------------
Q1HQJ4_AEDAE/218-244-------------------TLDRH...I...K.KIHF...----------------------------------------
B8XJD6_EPIBA/286-311-------------------MLNSH...R...E.S.HS...----------------------------------------
B4JJM0_DROGR/170-195-------------------SLKRH...M...I.I.HT...----------------------------------------
B0WHQ5_CULQU/350-376-------------------ELFEH...K...K.Q.FR...----------------------------------------
B0WHQ5_CULQU/435-460-------------------ILAKH...S...A.K.HP...----------------------------------------
B0WIF5_CULQU/318-345-------------------ELRTH...E...R.CQHS...----------------------------------------
Q16SQ7_AEDAE/717-746-------------------KLVNH...M...Q.V.HRS..----------------------------------------
B7QI19_IXOSC/542-567-------------------QLRSH...L...Y.I.HR...----------------------------------------
B4IEF4_DROSE/345-370-------------------NLDRH...T...K.N.HG...----------------------------------------
C3XTT5_BRAFL/572-600-------------------NLRKHILKS...K.K.HE...----------------------------------------
A7S9P2_NEMVE/562-587-------------------YLKAH...L...R.I.HT...----------------------------------------
A8XN82_CAEBR/442-467-------------------AVMTH...E...R.V.HT...----------------------------------------
B7XCJ2_GASAC/35-67-------------------VLLEH...L...K.T.HSGKS----------------------------------------
A5DLM3_PICGU/158-185-------------------HLARH...N...R.I.HT...----------------------------------------
C6JW60_ACYPI/179-204-------------------MLQSH...L...K.S.HS...----------------------------------------
C6JW60_ACYPI/545-570-------------------MYSMH...M...G.F.HS...----------------------------------------
B7WNA2_CAEEL/413-438-------------------AVTIH...E...R.V.HT...----------------------------------------
A8XPR2_CAEBR/339-365-------------------ELMRH...C...Q.T.HA...----------------------------------------
A8WS90_CAEBR/300-326-------------------KLEAH...L...N.L.HP...----------------------------------------
B4NLT6_DROWI/36-64-------------------NLWRH...E...R.R.HRQ..----------------------------------------
B0WAV3_CULQU/214-240-------------------AWNRH...I...K.KIHF...----------------------------------------
Q20709_CAEEL/484-506-------------------AMEEH...K...R.D.EH...----------------------------------------
D4ACS2_RAT/534-563-------------------SLSAH...M...K.L.HH...----------------------------------------
A8PJF0_BRUMA/38-64-------------------DMRTY...M...I.N.HD...----------------------------------------
SPR3_CAEEL/275-302-------------------SLWRH...F...R.H.HI...----------------------------------------
A2WLN2_ORYSI/165-188-------------------DWKAH...S...K.V.C....----------------------------------------
D2SM16_DROCP/38-63-------------------HLEYH...T...R.K.HK...----------------------------------------
D3DWS4_HUMAN/121-146-------------------SLGRH...L...L.I.HS...----------------------------------------
B0CWQ2_LACBS/44-69-------------------HLNRH...L...R.S.HT...----------------------------------------
B4UT12_OTOGA/218-244-------------------EVDVH...F...R.MIHE...----------------------------------------
B4UT12_OTOGA/247-272-------------------AFQQH...Y...M.R.HQ...----------------------------------------
B4ME14_DROVI/489-514-------------------VLQKH...I...R.A.HT...----------------------------------------
Q7Q5B0_ANOGA/452-477-------------------AYDDH...L...R.K.HI...----------------------------------------
Q170B3_AEDAE/215-240-------------------KRQGH...Y...R.KVHD...----------------------------------------
B0X2S1_CULQU/37-63-------------------NLKRH...I...E.QMHM...----------------------------------------
B4JVC8_DROGR/257-281-------------------AMRQH...Q...R.I.TH...----------------------------------------
Q2T9Q4_BOVIN/417-443-------------------DVDAH...F...R.AYHG...----------------------------------------
ATBP_DROGR/368-393-------------------RMELH...R...V.V.HS...----------------------------------------
Z518B_HUMAN/176-201-------------------EFQRH...L...V.K.HT...----------------------------------------
C7ZP87_NECH7/43-67-------------------HLRRH...Q...A.T.H....----------------------------------------
B6GZI2_PENCW/31-56-------------------HMKRH...A...L.T.HH...----------------------------------------
Q7Q704_ANOGA/486-511-------------------ILRRH...E...T.T.HA...----------------------------------------
A6ZY10_YEAS7/188-215-------------------HLARH...N...R.I.HT...----------------------------------------
A8Q9Q4_BRUMA/314-337-------------------SFRNH...K...Q.T.HE...----------------------------------------
Q3Z7R8_DEHE1/43-70-------------------RVEKH...D...T.TTMS...----------------------------------------
C5GLY3_AJEDR/134-158-------------------NRRMH...M...I.T.HQ...----------------------------------------
B4GP26_DROPE/271-303-------------------AFSRH...L...R.E.HT...----------------------------------------
B0D6U7_LACBS/443-468-------------------NLKDH...V...K.I.HL...----------------------------------------
B3KU17_HUMAN/197-222-------------------SPKNH...Q...E.N.YF...----------------------------------------
D3SJ61_DEHSG/41-70-------------------VSRVE...K...N.D.TTK..----------------------------------------
B4KPH3_DROMO/470-496-------------------EVYEH...V...R.KVHL...----------------------------------------
Z518A_HUMAN/248-273-------------------ELQKH...L...H.I.HS...----------------------------------------
B9WB05_CANDC/230-257-------------------NLATH...K...S.T.HLK..----------------------------------------
C3XQK7_BRAFL/378-402-------------------SLLQH...R...R.L.HD...----------------------------------------
A0NE47_ANOGA/173-198-------------------GLRRH...S...Y.Y.RH...----------------------------------------
Q9LIV0_ORYSJ/349-377-------------------NLDKH...V...KAV.HE...----------------------------------------
B3NN72_DROER/565-591-------------------TLRRH...M...R.K.EC...----------------------------------------
B0WBK7_CULQU/334-360-------------------SLAEH...K...W.HVHR...----------------------------------------
B4J604_DROGR/860-888-------------------DLVRH...F...Y.DDHK...----------------------------------------
A5JYT9_CAEEL/287-313-------------------ALNTH...M...K.K.HI...----------------------------------------
B6HWU0_PENCW/300-326-------------------HLERH...T...R.N.HL...----------------------------------------
A2QMC6_ASPNC/73-100-------------------HLYRH...Q...L.N.HT...----------------------------------------
B4M184_DROVI/277-309-------------------AYTRH...L...R.E.HT...----------------------------------------
A1YGC0_PANPA/667-694-------------------SVKIH...H...K.N.MH...----------------------------------------
Q16WW2_AEDAE/220-248-------------------NLKDS...L...R.Y.HMV..----------------------------------------
C4V7P9_NOSCE/296-329-------------------GLNYH...I...KYV.HT...----------------------------------------
B4FJN4_MAIZE/67-95-------------------NLTKH...V...K.ACHD...----------------------------------------
Q7Q1J4_ANOGA/124-149-------------------LLLHH...Y...R.NVHN...----------------------------------------

PF09237

Q7QGK8_ANOGA/312-365-------------------GYVTFFFRY----------------------------------------------------
GAGA_DROME/319-372-------------------PKAKRAKHP----------------------------------------------------
Q17MR3_AEDAE/275-328-------------------DGTAVIDTK----------------------------------------------------

PF02892

ZBED4_HUMAN/561-609-------------------SKLWNHFSI----------------------------------------------------
ZBED4_HUMAN/459-506-------------------SEVWHHFSL----------------------------------------------------
ZBED4_HUMAN/118-166-------------------SPAWKHFFI----------------------------------------------------
ZBED4_HUMAN/288-336-------------------SAVWKHFYL----------------------------------------------------
O24423_SOLLC/299-349-------------------DAAWDYATP----------------------------------------------------
O24423_SOLLC/200-250-------------------DDAWQHATP----------------------------------------------------
Q7XH06_ORYSJ/402-447-------------------DYVWNHGER----------------------------------------------------
Q9LRP0_ARATH/133-180-------------------DPGWEHGIA----------------------------------------------------
Q9LRP0_ARATH/11-58-------------------DPGWEHGVA----------------------------------------------------
Q94LV8_ORYSJ/29-78-------------------DPAWAHCFC----------------------------------------------------
Q852A8_ORYSJ/25-74-------------------DPAWKHCQM----------------------------------------------------
O81190_ARATH/24-74-------------------DIAWSYVIQ----------------------------------------------------
Q9M305_ARATH/27-76-------------------DLAWNYVRE----------------------------------------------------
O23355_ARATH/16-63-------------------DNAWKHCEI----------------------------------------------------
Q8L717_ARATH/16-65-------------------DNAWKHCEI----------------------------------------------------
Q9SKV9_ARATH/37-84-------------------DPVKKYAQP----------------------------------------------------
Q19902_CAEEL/4-44-------------------INLYSLPTD----------------------------------------------------
Q9VAF2_DROME/120-161-------------------NKLWAHFIR----------------------------------------------------
Q9VAF2_DROME/6-47-------------------FKALAHFHR----------------------------------------------------
ENV11_YEAST/87-132-------------------AKFWSHFLA----------------------------------------------------
O82332_ARATH/62-107-------------------SYVWDHFSR----------------------------------------------------
O65237_ARATH/49-94-------------------SWVWDHFTK----------------------------------------------------
O48647_ORYSA/143-191-------------------SKAWEHFTT----------------------------------------------------
Q9VM61_DROME/6-48-------------------SNVWQYFYK----------------------------------------------------
Q94513_DROME/7-58-------------------SNVWQHYDI----------------------------------------------------
Q9XWZ9_CAEEL/186-230-------------------HPVWDFFKD----------------------------------------------------
O96084_DROVI/33-82-------------------SVYWRYFGF----------------------------------------------------
ZBED1_HUMAN/23-72-------------------SKVWKYFGF----------------------------------------------------
Q21374_CAEEL/4-47-------------------SRVWDYFLK----------------------------------------------------
Q9VEP0_DROME/6-47-------------------SEIWCFFRA----------------------------------------------------
Q9XIM5_ARATH/34-81-------------------ALCWDEFTS----------------------------------------------------
O23600_ARATH/421-469-------------------SDVWKEFRP----------------------------------------------------
Q9S9W0_ARATH/38-83-------------------SDMWDYFTL----------------------------------------------------
Q9SI73_ARATH/54-102-------------------AACWKNFDR----------------------------------------------------
Q9ZPF6_ARATH/108-159-------------------ADCWEHFTL----------------------------------------------------
Q9S7T4_ARATH/45-96-------------------SDVWNHFTV----------------------------------------------------
O24134_TOBAC/145-191-------------------SLVWNFFTQ----------------------------------------------------
Q38743_ANTMA/129-173-------------------ATVWKWFSK----------------------------------------------------
Q19787_CAEEL/126-170-------------------AKVWRYFDE----------------------------------------------------
O96691_BACRY/27-74-------------------SFVWNILSE----------------------------------------------------
Q9XWZ9_CAEEL/353-396-------------------SEIWEHYKC----------------------------------------------------

PF05605

B9I3F4_POPTR/43-96------------------AYF------P----------------------------------------------------
DI197_ARATH/41-94------------------AEF------M----------------------------------------------------
C0PIR5_MAIZE/63-116------------------PEF------P----------------------------------------------------
F1SP03_PIG/76-137------------------QSF------T----------------------------------------------------
Q4TZT2_GOSHI/42-95------------------EEF------P----------------------------------------------------
B9MZZ9_POPTR/35-88------------------AEY------L----------------------------------------------------
C6T0D8_SOYBN/37-90------------------AEF------L----------------------------------------------------
E9FW83_DAPPU/76-137------------------QSF------S----------------------------------------------------
B4NA68_DROWI/76-137------------------QSF------T----------------------------------------------------
Q6J0N0_ORYLA/131-192------------------YTF------T----------------------------------------------------
DI192_ARATH/45-98------------------VEY------P----------------------------------------------------
B9NH25_POPTR/12-65------------------AKY------L----------------------------------------------------
C5XJD3_SORBI/54-107------------------EYF------P----------------------------------------------------
A7SGR5_NEMVE/76-137------------------QSF------T----------------------------------------------------
Q7KT86_DROME/76-139------------------NCF------T----------------------------------------------------
F0ZDS1_DICPU/325-378------------------ENV------K----------------------------------------------------
B4MCR4_DROVI/76-136------------------DSF------T----------------------------------------------------
C6TJ79_SOYBN/33-84------------------CDF------R----------------------------------------------------
D8QZV5_SELML/43-95------------------TDF------A----------------------------------------------------
DI192_ORYSJ/52-105------------------EAY------N----------------------------------------------------
B9SAX0_RICCO/49-102------------------AEY------P----------------------------------------------------
C0P4E3_MAIZE/52-105------------------DEL------L----------------------------------------------------
B3TLS9_ELAGV/43-96------------------LDF------P----------------------------------------------------
Q9W4V2_DROME/99-152------------------DSF------T----------------------------------------------------
B7E5F9_ORYSJ/60-113------------------PDV------A----------------------------------------------------
D8SWT1_SELML/39-92------------------PDF------A----------------------------------------------------
B7P2G0_IXOSC/26-81------------------ETA------P----------------------------------------------------
E2BIQ4_HARSA/91-152------------------QSL------T----------------------------------------------------
B9I9N5_POPTR/37-90------------------TEY------P----------------------------------------------------
B4FRH9_MAIZE/49-102------------------SDF------P----------------------------------------------------
D7KAY8_ARALL/33-86------------------EEF------A----------------------------------------------------
E0VYN0_PEDHC/76-137------------------QAY------T----------------------------------------------------
D7M5F4_ARALL/56-109------------------EEY------A----------------------------------------------------
A9NRR0_PICSI/43-96------------------ADF------T----------------------------------------------------
E2B3G1_HARSA/95-148------------------DLF------F----------------------------------------------------
Q0IMP6_ORYSJ/39-92------------------AEV------A----------------------------------------------------
D3B6G1_POLPA/495-556------------------ATF------K----------------------------------------------------
D8SWM4_SELML/55-106------------------TEY------S----------------------------------------------------
B8AWQ7_ORYSI/40-93------------------PEF------A----------------------------------------------------
B4JJE5_DROGR/60-120------------------DSF------T----------------------------------------------------
A9NNC1_PICSI/39-92------------------AEF------T----------------------------------------------------
A9RX96_PHYPA/18-71------------------AEF------S----------------------------------------------------
Q84ZW5_ORYSI/35-88------------------EYI------P----------------------------------------------------
A9RX94_PHYPA/15-69------------------AEF------P----------------------------------------------------
A9NZE0_PICSI/37-89------------------VDF------H----------------------------------------------------
D5AD63_PICSI/42-95------------------PDF------S----------------------------------------------------
D7U2E3_VITVI/42-95------------------VEF------P----------------------------------------------------
D4P881_LINUS/39-92------------------AEF------L----------------------------------------------------
D6W7D8_TRICA/77-138------------------QSY------T----------------------------------------------------
A9SS49_PHYPA/43-96------------------AEF------S----------------------------------------------------
B0WIV3_CULQU/74-135------------------QSF------T----------------------------------------------------
C6T3G5_SOYBN/42-95------------------TAY------P----------------------------------------------------
F2D7R3_HORVD/39-92------------------DEL------E----------------------------------------------------
B7QDE6_IXOSC/75-136------------------QSF------T----------------------------------------------------
Q6J0N1_DANRE/132-193------------------STF------T----------------------------------------------------
B7FME8_MEDTR/44-97------------------PDF------P----------------------------------------------------

PF15269

E7FF07_DANRE/14-67KERKPKKPHYIPRPWGKPYNY------K----------------------------------------------------
ZN750_DANRE/5-58QGRKPKKPHYIPRPPGKPFKY------Q----------------------------------------------------

PF12907

A6MZL5_ORYSI/1-40-------------------NI------Q----------------------------------------------------
B8CDP1_THAPS/41-82-------------------AY------I----------------------------------------------------
B0YEW9_ASPFC/36-74-------------------DI------I----------------------------------------------------
B6K9E6_TOXGO/37-75-------------------SI------K----------------------------------------------------
C5L3K4_PERM5/40-78-------------------TL------M----------------------------------------------------
A5JZJ9_PLAVS/36-74-------------------NV------I----------------------------------------------------
C5LL36_PERM5/36-69-------------------KM------T----------------------------------------------------
C1N1U6_MICPC/37-76-------------------NI------Q----------------------------------------------------
B9HMX2_POPTR/26-65-------------------SI------Q----------------------------------------------------
B6K6M8_SCHJY/34-72-------------------TV------I----------------------------------------------------
C1FFR1_MICSR/37-76-------------------SI------Q----------------------------------------------------
A8HPM7_CHLRE/37-76-------------------NI------K----------------------------------------------------
B7FQP9_PHATC/41-72-------------------AF------I----------------------------------------------------

PF11931

Q757U7_ASHGO/318-527LRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNRE.................M....................ATI
Q6BPR8_DEBHA/322-517EFDEFKVRFLGEKLNDYRSPTISNAERKAALTDRERIA........................................ET
A5DJE8_PICGU/306-499LFEEFKARKLCEALAETLTNTITNVDRQTALTEREKQI........................................EG
Q0UAS9_PHANO/330-517AEREFRIKKLAAAMQTERSDTKVNVERKQGMTERERQQ..........................................
Q5KJJ3_CRYNJ/329-512ALLTF......PPIPQLLSDSRNEVERKMALTAREREQ..........................................
SF3A3_MOUSE/321-500AFLEAQIYEYVEILGEQRQLTHENVQRKQARTGEEREE..........................................
A7EM87_SCLS1/308-497AEREYRIRRLAAAMTQERSDTRVNIERKQGMTERERQM..........................................
Q4DZ62_TRYCC/344-537SKTAEELEWERKHLQEEFLQSVEEARKKSATTVEGSVA..........................................
Q5AUL5_EMENI/312-501AEREHRVRSLARVLINERQATKINVERRQGMTERERQM..........................................
Q9P736_NEUCS/307-496AEREYRIKKLASAMKTERDDTRVNVERRQGMTERERQQ..........................................
Q7R8D2_PLAYO/329-569AKYEYLIENYKILLNKIFQKTIQNMQRKQAFTIEEIEKRQKNEKINEKKNEKNKISNDHLLSISDNLVNDIQHVENVENI
Q59YK2_CANAL/310-512PWLEYFIEKLCQVLAPELEYTRAQVEKLSNLSERELQLDR...............Q.V..................QHDI
Q6C2A2_YARLI/346-547AHLE....ELAEFLKSTIDSTVANLERKQALTNSERQAEIA............AQQ.DQ...............DRLTDE
A5K6W2_PLAVS/371-630AKCEYLIEMYKNVLSKIFQKTIQRIQRKQAFSVDELQKRKKAEKKNDHFLSLRDRGGMYGAEEFDE..RGDFPHLYNSHT
Q6FNA1_CANGA/320-515FRAEFKLHVYVSCMREEFENTKEYVDRKMAFTNKERLEEM...............E.K.................LTQEY
Q10DW3_ORYSJ/326-506ALMEVKMRRLCELLDEIIVRTKENAEKKLTLTYEEMEA..........................................
Q4P183_USTMA/361-564AREEAVIRALATQLAVIRADTKSNVERKAALTDRERQAEA..............EA.A.................EEELN
A5E2D1_LODEL/396-573VLSERE..RLIELKRTEDLENELTAVEDSDFSGSDNDG..........................................
A3LZB0_PICST/335-529DLQEHINTELGKFLSNYKEATIQNTERKSAMTERERLIE......................................NTT
A7TQD9_VANPO/315-516YFIEFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEI...............D.R.................MTEVY
A8WYD7_CAEBR/321-500AQTEGHIMAMAEILAEERTGTRENVERKQARSAGEVEE..........................................
Q00TY4_OSTTA/336-514ARKESQCAEALRLLGKQLDATRTNVEKKSTLSLAELQA..........................................
Q4Q7B2_LEIMA/416-622SRTLEELENDREVAEQEFLDSLEEVRKNSADTMEGTVAHA..............AE.YN................LKLAL
A6ZXU1_YEAS7/315-529VYSEYKLHRYLKYLKDEFSRTRSFVERKLAFTANERMAEM...............D.I.................LTQKY
Q7QBN1_ANOGA/307-483AQLEYKIAKLADLVDDQIYETKINLQRKQARYT...............................................
Q6CIR1_KLULA/319-529LMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEEL...............E.K.................LQEQY
A0BHR1_PARTE/51-236AYLEVAILQYKDTLQQQLNDTMNLVRKKQSRRYEENED..........................................
Q5DFZ0_SCHJA/331-515AALEARIYRLSELVKEHREATIENVQRRQARIGFERDE..........................................
Q8I2R0_PLAF7/343-588ARCEYLIQLYANILNKIIQRTIQNIQRKQAYTIDEIQKKKYKEEEQEDEKKRKKEYHLLSLMDHNN.NELNNQNILLQDL
Q295L4_DROPS/322-502AQLEALLYKYAELLSEQRAATKENVQRKQARTGGERDD..........................................
A7AWA7_BABBO/340-533AYMEYMIQQYKQFLANTIEKTIEFIEKRESRNSKELEE........................................SQ
Q7YZ45_CRYPV/279-492ARKEFFVSKFSQLLSVQRREAIDHVNKLQSSTREELEIDKQLE........MENSG.LETL...........ITELNDCL
Q8SUY4_ENCCU/234-369SEAESLVLKSLAILEKERKHSISLLSRRKKQTKS..............................................
Q3LWI3_BIGNA/267-418LLSMSKITKICKTLKKNKTDLVSLYEKQKKVFFEKNSS..........................................
Q4UCY7_THEAN/343-533AFKEFIIQSYRDVLASTIQKTVEFVQKRESRTVKELEN..........................................
Q55CK7_DICDI/343-533TMFEYKINRLSEYLSDQIESTKENVLKKQSRSYTEVVD..........................................
SAP61_SCHPO/296-491ARIEFLIKKLTSLLDDVRKDTRENVVRRQTLTAAERLAE......................................VEA

PF06220

WBP4_MOUSE/8-44-----------------QPKK------F----------------------------------------------------
RU1C_ARATH/1-38-----------------MPRY------Y----------------------------------------------------
RU1C_CAEEL/1-38-----------------MPKY------Y----------------------------------------------------
RU1C_YEAST/1-38-----------------MTRY------Y----------------------------------------------------
RU1C_SCHPO/1-38-----------------MPRY------L----------------------------------------------------
RU1C_PLAF7/1-38-----------------MPKY------Y----------------------------------------------------
YNS7_SCHPO/8-44-----------------IPKY------Y----------------------------------------------------
RU1C_HUMAN/1-38-----------------MPKF------Y----------------------------------------------------
Q8IPW7_DROME/3-39-----------------GKSY------Y----------------------------------------------------
Q9HEK5_NEUCS/1-38-----------------MPKF------F----------------------------------------------------
Q8SR72_ENCCU/1-38-----------------MPRY------F----------------------------------------------------

PF08209

C8ZIY2_YEAS8/67-99----------------SSQYI------H----------------------------------------------------
SGF11_CANAL/95-124----------------TSRYF------R----------------------------------------------------
A9RK45_PHYPA/893-922----------------TKARV------P----------------------------------------------------
SGF11_DROSI/102-134----------------KPMDC------T----------------------------------------------------
AT7L3_DANRE/80-112----------------KNKEC------V----------------------------------------------------
SG111_DROWI/116-148----------------KTAKC------C----------------------------------------------------
B9HNC7_POPTR/82-114----------------ANEVF------D----------------------------------------------------
SGF11_PICST/71-100----------------ASRYF------S----------------------------------------------------
SGF11_AEDAE/94-126----------------KAIDC------S----------------------------------------------------
Q4PD44_USTMA/95-127----------------NNPLF------E----------------------------------------------------
B6Q2K2_PENMQ/191-223----------------DYPTI------K----------------------------------------------------
SGF11_ASHGO/72-104----------------ASVYF------R----------------------------------------------------
D3BEH2_POLPA/162-193----------------ALVLV------V----------------------------------------------------
B3S8N8_TRIAD/115-147----------------KSLEV------S----------------------------------------------------
C5DIC9_LACTC/66-98----------------SSIYF------H----------------------------------------------------
B2W5Z8_PYRTR/1052-1084----------------YIPWH------T----------------------------------------------------
C4R2D9_PICPG/91-121----------------DTEYF------T----------------------------------------------------
C3YL49_BRAFL/83-115----------------KQYEC------E----------------------------------------------------
SGF11_SCHPO/68-100----------------NVPYY------S----------------------------------------------------
SGF11_DEBHA/69-98----------------TSKYF------Q----------------------------------------------------
B6K4N7_SCHJY/67-99----------------TVPYY------N----------------------------------------------------
B0CPA4_LACBS/109-141----------------GTAFL------D----------------------------------------------------
Q5KH30_CRYNJ/121-151----------------GNAFF------D----------------------------------------------------
SGF11_CANGA/67-99----------------SSQYF------Y----------------------------------------------------
D0N3C8_PHYIT/53-84----------------DSVFV------S----------------------------------------------------
B5Y4P9_PHATC/145-177----------------PKELV------A----------------------------------------------------
C1FHG8_MICSR/173-205----------------SKEAT------T----------------------------------------------------
SGF11_VANPO/64-96----------------SSQYF------H----------------------------------------------------
A8PBW2_BRUMA/63-95----------------KNMDV------I----------------------------------------------------
A8JIK2_CHLRE/145-177----------------ATDIV------T----------------------------------------------------
Q6CGL5_YARLI/100-132----------------DSQYF------E----------------------------------------------------
A2Y3K0_ORYSI/106-138----------------AADLV------D----------------------------------------------------
D2VLX0_NAEGR/90-123----------------TRTHV------V----------------------------------------------------

PF07776

A7UV01_ANOGA/9-76---------------------------R----------------------------------------------------
Q9VGL1_DROME/5-76---------------------------N----------------------------------------------------
Q9VYG4_DROME/5-80---------------------------M----------------------------------------------------
ZN276_HUMAN/78-164---------------------------H----------------------------------------------------
Q29ND0_DROPS/6-81---------------------------L----------------------------------------------------
Q29IN3_DROPS/2-81---------------------------I----------------------------------------------------
Q28WY1_DROPS/10-81---------------------------I----------------------------------------------------
Q296L3_DROPS/6-84---------------------------L----------------------------------------------------
Q28ZV2_DROPS/21-102---------------------------T----------------------------------------------------
Q293S4_DROPS/4-78---------------------------E----------------------------------------------------
Q29J43_DROPS/21-101---------------------------V----------------------------------------------------
Q295I6_DROPS/3-85---------------------------T----------------------------------------------------
Q172A9_AEDAE/36-109---------------------------Q----------------------------------------------------
Q17J41_AEDAE/18-90---------------------------L----------------------------------------------------
Q5TSD0_ANOGA/15-94---------------------------I----------------------------------------------------
Q9VEW6_DROME/16-90---------------------------L----------------------------------------------------
Q17BB2_AEDAE/4-80---------------------------S----------------------------------------------------
Q17Q26_AEDAE/11-84---------------------------M----------------------------------------------------
Q16LJ9_AEDAE/12-89---------------------------Y----------------------------------------------------
Q8T3Y6_DROME/4-81---------------------------T----------------------------------------------------
Q17H01_AEDAE/9-82---------------------------V----------------------------------------------------
Q5TPX0_ANOGA/12-86---------------------------I----------------------------------------------------
Q7PSS4_ANOGA/5-78---------------------------F----------------------------------------------------
Q0IFU7_AEDAE/4-77---------------------------V----------------------------------------------------
Q7Q764_ANOGA/4-76---------------------------K----------------------------------------------------
Q16XL6_AEDAE/6-82---------------------------I----------------------------------------------------
Q16UU9_AEDAE/69-144---------------------------F----------------------------------------------------
Q16IT5_AEDAE/11-81---------------------------G----------------------------------------------------
Q17FQ3_AEDAE/16-94---------------------------I----------------------------------------------------
Q7PE48_ANOGA/10-85---------------------------A----------------------------------------------------
Q9W3T3_DROME/13-95---------------------------L----------------------------------------------------
A0APC7_DROSI/1-89---------------------------M----------------------------------------------------
Q17ES4_AEDAE/9-86---------------------------T----------------------------------------------------
Q9VDQ6_DROME/10-92---------------------------L----------------------------------------------------
Q9U1J8_DROME/16-94---------------------------T----------------------------------------------------
Q29GX8_DROPS/7-88---------------------------C----------------------------------------------------
Q16U61_AEDAE/101-172---------------------------F----------------------------------------------------
Q29BJ8_DROPS/19-99---------------------------I----------------------------------------------------
Q17L68_AEDAE/12-105---------------------------M----------------------------------------------------
Q7QGF1_ANOGA/29-103---------------------------K----------------------------------------------------
Q17BA3_AEDAE/91-169---------------------------C----------------------------------------------------
Q4RZ79_TETNG/4-78---------------------------A----------------------------------------------------
Q7PZF0_ANOGA/11-96---------------------------V----------------------------------------------------
Q8T092_DROME/6-82---------------------------S----------------------------------------------------
Q293X8_DROPS/4-78---------------------------F----------------------------------------------------
Q16L11_AEDAE/6-87---------------------------V----------------------------------------------------
A0NGY9_ANOGA/14-91---------------------------F----------------------------------------------------
Q95RA7_DROME/41-116---------------------------Q----------------------------------------------------
Q16TP6_AEDAE/7-79---------------------------S----------------------------------------------------
Q16V18_AEDAE/51-126---------------------------Y----------------------------------------------------
Q9VBN9_DROME/46-125---------------------------C----------------------------------------------------
Q16TP8_AEDAE/49-124---------------------------A----------------------------------------------------
Q7Q2A4_ANOGA/17-101---------------------------Y----------------------------------------------------
A0NBW7_ANOGA/15-87---------------------------V----------------------------------------------------
Q17JD7_AEDAE/2-72---------------------------I----------------------------------------------------
O96395_DROME/20-95---------------------------N----------------------------------------------------
Q17FQ4_AEDAE/25-91---------------------------I----------------------------------------------------
Q17GH4_AEDAE/30-111---------------------------Q----------------------------------------------------
Q17H35_AEDAE/96-172---------------------------V----------------------------------------------------
Q16MQ6_AEDAE/5-79---------------------------Q----------------------------------------------------
PHYL_DROME/28-97---------------------------T----------------------------------------------------
A2VEG0_DROME/80-155---------------------------C----------------------------------------------------
Q17I37_AEDAE/16-86---------------------------V----------------------------------------------------
Q17MD3_AEDAE/10-83---------------------------Q----------------------------------------------------
Q16K79_AEDAE/10-91---------------------------I----------------------------------------------------
Q16G18_AEDAE/7-79---------------------------V----------------------------------------------------
Q17PD2_AEDAE/5-79---------------------------Q----------------------------------------------------
Q16YV7_AEDAE/147-222---------------------------F----------------------------------------------------
Q17EK1_AEDAE/5-79---------------------------C----------------------------------------------------
A0NBZ7_ANOGA/18-102---------------------------W----------------------------------------------------
Q17H96_AEDAE/12-89---------------------------V----------------------------------------------------
Q16SB8_AEDAE/44-121---------------------------F----------------------------------------------------
Q16ES4_AEDAE/19-91---------------------------L----------------------------------------------------
Q173P4_AEDAE/173-244---------------------------I----------------------------------------------------
Q174L0_AEDAE/17-95---------------------------C----------------------------------------------------
Q16MP6_AEDAE/212-285---------------------------S----------------------------------------------------
Q9W137_DROME/3-77---------------------------V----------------------------------------------------
Q17JM9_AEDAE/19-93---------------------------F----------------------------------------------------
Q16IP3_AEDAE/12-92---------------------------V----------------------------------------------------
Q8SZ92_DROME/17-102---------------------------P----------------------------------------------------
Q17G83_AEDAE/137-213---------------------------C----------------------------------------------------
Q16YH3_AEDAE/5-78---------------------------N----------------------------------------------------
Q9VGQ6_DROME/7-83---------------------------I----------------------------------------------------
Q9VIS9_DROME/28-108---------------------------W----------------------------------------------------
Q170M9_AEDAE/12-99---------------------------L----------------------------------------------------
Q16GR5_AEDAE/13-97---------------------------Y----------------------------------------------------
Q296H7_DROPS/6-79---------------------------I----------------------------------------------------
Q16LN4_AEDAE/36-103---------------------------L----------------------------------------------------
Q171F5_AEDAE/7-112---------------------------V----------------------------------------------------
Q17FB1_AEDAE/20-106---------------------------L----------------------------------------------------
Q29BM8_DROPS/14-88---------------------------L----------------------------------------------------
Q17MM2_AEDAE/4-82---------------------------T----------------------------------------------------
Q4V5B7_DROME/13-89---------------------------I----------------------------------------------------
A0NE47_ANOGA/7-75---------------------------V----------------------------------------------------
Q16GR6_AEDAE/13-97---------------------------I----------------------------------------------------
Q7JW60_DROME/21-102---------------------------K----------------------------------------------------
Q295U2_DROPS/12-90---------------------------S----------------------------------------------------
Q17JX0_AEDAE/4-85---------------------------R----------------------------------------------------

PF04419

Q4WNN0_ASPFU/1-37---------------------------M----------------------------------------------------
C5P8K7_COCP7/1-37---------------------------M----------------------------------------------------
A1CCH0_ASPCL/1-34---------------------------M----------------------------------------------------
A2I456_MACHI/1-41---------------------------M----------------------------------------------------
A2YHJ0_ORYSI/3-36---------------------------G----------------------------------------------------
A4HUF3_LEIIN/3-41---------------------------S----------------------------------------------------
A4RZ85_OSTLU/3-37---------------------------G----------------------------------------------------
A4S433_OSTLU/1-37---------------------------M----------------------------------------------------
A5AXN0_VITVI/245-281---------------------------I----------------------------------------------------
A5JZQ1_PLAVS/1-35---------------------------M----------------------------------------------------
A5WW23_DANRE/1-38---------------------------M----------------------------------------------------
A6RTA6_BOTFB/1-38---------------------------M----------------------------------------------------
A7RLR9_NEMVE/1-39---------------------------M----------------------------------------------------
A7RQF4_NEMVE/1-38---------------------------M----------------------------------------------------
A7TH18_VANPO/1-36---------------------------M----------------------------------------------------
A8BVJ6_GIAIC/1-39---------------------------M----------------------------------------------------
A8XJE4_CAEBR/1-38---------------------------M----------------------------------------------------
A8Y1E8_CAEBR/1-43---------------------------M----------------------------------------------------
B9FID9_ORYSJ/19-53---------------------------C----------------------------------------------------
Y2309_ARATH/3-37---------------------------G----------------------------------------------------
SERF1_MOUSE/1-38---------------------------M----------------------------------------------------
Q013U6_OSTTA/23-66---------------------------M----------------------------------------------------
Q0IT26_ORYSJ/1-35---------------------------M----------------------------------------------------
Q1RL63_CIOIN/1-36---------------------------M----------------------------------------------------
Q4DJ29_TRYCC/1-37---------------------------M----------------------------------------------------
Q4PAY1_USTMA/1-34---------------------------M----------------------------------------------------
Q4XL55_PLACH/4-36---------------------------G----------------------------------------------------
Q553T6_DICDI/3-38---------------------------S----------------------------------------------------
Q5B540_EMENI/1-37---------------------------M----------------------------------------------------
Q5BT45_SCHJA/1-37---------------------------M----------------------------------------------------
Q5CHK6_CRYHO/4-37---------------------------G----------------------------------------------------
Q5CQG7_CRYPI/6-43---------------------------M----------------------------------------------------
Q5KLR0_CRYNJ/1-35---------------------------M----------------------------------------------------
Q66M64_BRUMA/1-38---------------------------M----------------------------------------------------
Q7PNM0_ANOGA/1-41---------------------------M----------------------------------------------------
Q7SG18_NEUCR/3-36---------------------------G----------------------------------------------------
Q8GXU7_ARATH/1-36---------------------------M----------------------------------------------------
Q9C2J3_NEUCS/1-37---------------------------M----------------------------------------------------
YIN2_SCHPO/1-34---------------------------M----------------------------------------------------
ZN706_HUMAN/1-38---------------------------M----------------------------------------------------

PF00096

LOLA1_DROME/791-814--------------------------------------------------------------------------------
ZNF91_HUMAN/238-260--------------------------------------------------------------------------------
ZNF17_HUMAN/442-464--------------------------------------------------------------------------------
SDC1_CAEEL/268-290--------------------------------------------------------------------------------
ZN592_HUMAN/1043-1069--------------------------------------------------------------------------------
SDC1_CAEEL/652-674--------------------------------------------------------------------------------
SDC1_CAEEL/145-168--------------------------------------------------------------------------------
SDC1_CAEEL/117-139--------------------------------------------------------------------------------
ZEP1_HUMAN/959-982--------------------------------------------------------------------------------
SDC1_CAEEL/233-254--------------------------------------------------------------------------------
MZF1_HUMAN/412-434--------------------------------------------------------------------------------
ZSC22_HUMAN/352-374--------------------------------------------------------------------------------
EVI1_HUMAN/217-239--------------------------------------------------------------------------------
EVI1_HUMAN/21-44--------------------------------------------------------------------------------
EVI1_HUMAN/131-154--------------------------------------------------------------------------------
EVI1_HUMAN/790-812--------------------------------------------------------------------------------
EVI1_HUMAN/761-784--------------------------------------------------------------------------------
ZN239_MOUSE/6-28--------------------------------------------------------------------------------
EVI1_HUMAN/75-97--------------------------------------------------------------------------------
INSM1_HUMAN/441-464--------------------------------------------------------------------------------
ZNF76_HUMAN/285-309--------------------------------------------------------------------------------
ADR1_YEAST/104-126--------------------------------------------------------------------------------
KRUH_DROME/299-321--------------------------------------------------------------------------------
P43_XENBO/45-69--------------------------------------------------------------------------------
ZFA_MOUSE/513-536--------------------------------------------------------------------------------
P43_XENBO/220-245--------------------------------------------------------------------------------
SUHW_DROME/319-341--------------------------------------------------------------------------------
SUHW_DROAN/221-243--------------------------------------------------------------------------------
ZG29_XENLA/62-84--------------------------------------------------------------------------------
TYY1_HUMAN/296-320--------------------------------------------------------------------------------
RGM1_YEAST/19-44--------------------------------------------------------------------------------
ZO2_XENLA/34-59--------------------------------------------------------------------------------
TF3A_ANAAE/12-36--------------------------------------------------------------------------------
ZFA_MOUSE/570-593--------------------------------------------------------------------------------
ESCA_DROME/344-366--------------------------------------------------------------------------------
GP_DUGBA/768-790--------------------------------------------------------------------------------
SUHW_DROME/523-545--------------------------------------------------------------------------------
ZG8_XENLA/146-168--------------------------------------------------------------------------------
ZG28_XENLA/174-196--------------------------------------------------------------------------------
CTCF_CHICK/555-577--------------------------------------------------------------------------------
CI_DROME/451-476--------------------------------------------------------------------------------
TERM_DROME/323-346--------------------------------------------------------------------------------
IKZF1_MOUSE/488-512--------------------------------------------------------------------------------
TRA1_CAEEL/337-362--------------------------------------------------------------------------------
INSM1_HUMAN/367-390--------------------------------------------------------------------------------
ZNF76_HUMAN/225-249--------------------------------------------------------------------------------
GP_PHV/549-571--------------------------------------------------------------------------------
HUNB_DROME/269-291--------------------------------------------------------------------------------
XFIN_XENLA/1276-1298--------------------------------------------------------------------------------
XFIN_XENLA/1044-1066--------------------------------------------------------------------------------
CF2_DROME/429-451--------------------------------------------------------------------------------
ZEB1_CHICK/268-292--------------------------------------------------------------------------------
P43_XENBO/106-130--------------------------------------------------------------------------------
TF3A_ANAAE/72-97--------------------------------------------------------------------------------
ZG5_XENLA/185-207--------------------------------------------------------------------------------
SUHW_DROME/290-313--------------------------------------------------------------------------------
ZG44_XENLA/5-27--------------------------------------------------------------------------------
BNC1_HUMAN/720-743--------------------------------------------------------------------------------
ZFA_MOUSE/542-564--------------------------------------------------------------------------------
IKZF1_MOUSE/200-223--------------------------------------------------------------------------------
SRYC_DROME/358-380--------------------------------------------------------------------------------
YKQ8_CAEEL/51-74--------------------------------------------------------------------------------
ZEP2_RAT/1818-1842--------------------------------------------------------------------------------
TSH_DROME/466-490--------------------------------------------------------------------------------
ZFA_MOUSE/456-479--------------------------------------------------------------------------------
P43_XENBO/163-187--------------------------------------------------------------------------------
HUNB_DROME/240-262--------------------------------------------------------------------------------
ZG52_XENLA/61-83--------------------------------------------------------------------------------
YKQ8_CAEEL/78-102--------------------------------------------------------------------------------
ZFP60_MOUSE/484-506--------------------------------------------------------------------------------
ZO28_XENLA/62-84--------------------------------------------------------------------------------
KLF9_RAT/203-225--------------------------------------------------------------------------------
TRA1_CAEEL/306-331--------------------------------------------------------------------------------
BNC1_HUMAN/928-951--------------------------------------------------------------------------------
TF3A_ANAAE/219-244--------------------------------------------------------------------------------
P43_XENBO/75-100--------------------------------------------------------------------------------
TSH_DROME/354-378--------------------------------------------------------------------------------
YL57_CAEEL/26-49--------------------------------------------------------------------------------
ZFA_MOUSE/393-415--------------------------------------------------------------------------------
ACE2_YEAST/603-627--------------------------------------------------------------------------------
ZG46_XENLA/258-280--------------------------------------------------------------------------------
ZBT48_HUMAN/319-342--------------------------------------------------------------------------------
TYY1_HUMAN/383-407--------------------------------------------------------------------------------
XFIN_XENLA/503-525--------------------------------------------------------------------------------
SRYB_DROME/171-195--------------------------------------------------------------------------------
SRYD_DROME/194-217--------------------------------------------------------------------------------
SRYD_DROME/251-273--------------------------------------------------------------------------------
ESCA_DROME/370-392--------------------------------------------------------------------------------
DISC_DROME/92-115--------------------------------------------------------------------------------
SUHW_DROAN/349-373--------------------------------------------------------------------------------
ZTF1_CAEEL/213-235--------------------------------------------------------------------------------
SUHW_DROME/596-619--------------------------------------------------------------------------------
KRUP_DROME/222-244--------------------------------------------------------------------------------
ZG46_XENLA/146-168--------------------------------------------------------------------------------
SDC3_CAEEL/2117-2141--------------------------------------------------------------------------------
PACC_YEAST/182-206--------------------------------------------------------------------------------
KRUP_DROME/306-328--------------------------------------------------------------------------------
ZFA_MOUSE/684-707--------------------------------------------------------------------------------
TTKB_DROME/538-561--------------------------------------------------------------------------------
TF3A_ANAAE/104-128--------------------------------------------------------------------------------
CKR1_CHICK/169-191--------------------------------------------------------------------------------
ZO71_XENLA/289-311--------------------------------------------------------------------------------
SRYC_DROME/470-493--------------------------------------------------------------------------------
ZNF76_HUMAN/165-189--------------------------------------------------------------------------------
ZG3_XENLA/6-28--------------------------------------------------------------------------------
SUHW_DROME/380-402--------------------------------------------------------------------------------
FZF1_YEAST/12-36--------------------------------------------------------------------------------
SNAI1_MOUSE/236-259--------------------------------------------------------------------------------
CF2_DROME/366-388--------------------------------------------------------------------------------
SRYD_DROME/223-245--------------------------------------------------------------------------------
ZFP59_MOUSE/270-292--------------------------------------------------------------------------------
ESCA_DROME/426-449--------------------------------------------------------------------------------
TSH_DROME/533-557--------------------------------------------------------------------------------
SAS3_YEAST/301-323--------------------------------------------------------------------------------
HUNB_DROME/733-757--------------------------------------------------------------------------------
TF3A_ANAAE/161-187--------------------------------------------------------------------------------
GP_HANTB/541-563--------------------------------------------------------------------------------
TF3A_RANPI/73-98--------------------------------------------------------------------------------
ZFP59_MOUSE/438-459--------------------------------------------------------------------------------
ZFA_MOUSE/713-736--------------------------------------------------------------------------------
FZF1_YEAST/72-94--------------------------------------------------------------------------------
INSM1_HUMAN/469-492--------------------------------------------------------------------------------
XFIN_XENLA/276-298--------------------------------------------------------------------------------
SFP1_YEAST/598-623--------------------------------------------------------------------------------
SRYC_DROME/299-321--------------------------------------------------------------------------------
EGR1_HUMAN/396-418--------------------------------------------------------------------------------
CF2_DROME/401-423--------------------------------------------------------------------------------
RPH1_YEAST/738-763--------------------------------------------------------------------------------
HUNB_DROME/325-349--------------------------------------------------------------------------------
SRYD_DROME/405-428--------------------------------------------------------------------------------
ZFP59_MOUSE/326-348--------------------------------------------------------------------------------
HUNB_DROME/705-727--------------------------------------------------------------------------------
ZO10_XENLA/1-23--------------------------------------------------------------------------------
SUHW_DROME/553-577--------------------------------------------------------------------------------
ZG32_XENLA/34-56--------------------------------------------------------------------------------
ZFP27_MOUSE/457-479--------------------------------------------------------------------------------
FZF1_YEAST/155-179--------------------------------------------------------------------------------
SRYC_DROME/414-436--------------------------------------------------------------------------------
ZNF10_HUMAN/517-539--------------------------------------------------------------------------------
YO14_CAEEL/280-304--------------------------------------------------------------------------------
CF2_DROME/74-97--------------------------------------------------------------------------------
CF2_DROME/485-508--------------------------------------------------------------------------------
ZG52_XENLA/6-27--------------------------------------------------------------------------------
ESCA_DROME/309-331--------------------------------------------------------------------------------
P43_XENBO/136-160--------------------------------------------------------------------------------
ZFH1_DROME/383-407--------------------------------------------------------------------------------
SRYD_DROME/279-301--------------------------------------------------------------------------------
ESCA_DROME/398-420--------------------------------------------------------------------------------
ZFX_HUMAN/488-510--------------------------------------------------------------------------------
RGM1_YEAST/50-73--------------------------------------------------------------------------------
SAS2_YEAST/101-123--------------------------------------------------------------------------------
ZO6_XENLA/6-29--------------------------------------------------------------------------------
ZFP60_MOUSE/344-366--------------------------------------------------------------------------------
RAD18_YEAST/188-210--------------------------------------------------------------------------------
ZFP59_MOUSE/493-515--------------------------------------------------------------------------------
ZEP2_RAT/1790-1812--------------------------------------------------------------------------------
ZFA_MOUSE/656-678--------------------------------------------------------------------------------
ZFP60_MOUSE/428-450--------------------------------------------------------------------------------
IKZF1_MOUSE/144-166--------------------------------------------------------------------------------
ZO61_XENLA/62-84--------------------------------------------------------------------------------
ZN131_HUMAN/356-378--------------------------------------------------------------------------------
ZN12_MICSA/106-129--------------------------------------------------------------------------------
XFIN_XENLA/136-158--------------------------------------------------------------------------------
ZFH1_DROME/628-651--------------------------------------------------------------------------------
RME1_YEAST/256-281--------------------------------------------------------------------------------
XFIN_XENLA/326-348--------------------------------------------------------------------------------
HUNB_DROME/297-319--------------------------------------------------------------------------------
ZG5A_XENLA/90-112--------------------------------------------------------------------------------
ZTF1_CAEEL/102-125--------------------------------------------------------------------------------
SP1_HUMAN/626-650--------------------------------------------------------------------------------
SRYD_DROME/308-330--------------------------------------------------------------------------------
REP2_SCHPO/175-197--------------------------------------------------------------------------------
ACE2_YEAST/633-657--------------------------------------------------------------------------------
SUHW_DROME/413-435--------------------------------------------------------------------------------
GLI1_HUMAN/235-260--------------------------------------------------------------------------------
TRA1_CAEEL/276-300--------------------------------------------------------------------------------
P43_XENBO/251-275--------------------------------------------------------------------------------
ADR1_YEAST/132-155--------------------------------------------------------------------------------
SNAI1_XENLA/232-255--------------------------------------------------------------------------------
ZO20_XENLA/174-196--------------------------------------------------------------------------------
TTKB_DROME/508-531--------------------------------------------------------------------------------
P43_XENBO/191-213--------------------------------------------------------------------------------
ZG58_XENLA/174-196--------------------------------------------------------------------------------
GLI1_XENLA/283-310--------------------------------------------------------------------------------
PACC_YEAST/146-171--------------------------------------------------------------------------------
MST2_SCHPO/132-154--------------------------------------------------------------------------------
GLAS_DROME/493-515--------------------------------------------------------------------------------
BRLA_EMENI/350-375--------------------------------------------------------------------------------
P43_XENBO/15-39--------------------------------------------------------------------------------
ZNF76_HUMAN/345-368--------------------------------------------------------------------------------
SNT2_SCHPO/888-910--------------------------------------------------------------------------------
TF3A_ANAAE/134-158--------------------------------------------------------------------------------
YL57_CAEEL/344-367--------------------------------------------------------------------------------
SNAI_DROME/362-385--------------------------------------------------------------------------------

PF13894

A0NH35_ANOGA/1015-1038--------------------------------------------------------------------------------
A0NCH1_ANOGA/354-376--------------------------------------------------------------------------------
A4GZJ4_CAEEL/282-307--------------------------------------------------------------------------------
Q965P0_CAEEL/61-84--------------------------------------------------------------------------------
A8NSN6_COPC7/29-54--------------------------------------------------------------------------------
A8PGF1_COPC7/259-282--------------------------------------------------------------------------------
D2HAN7_AILME/599-622--------------------------------------------------------------------------------
Q6GQ25_XENLA/587-610--------------------------------------------------------------------------------
B8A455_DANRE/542-565--------------------------------------------------------------------------------
B2W740_PYRTR/11-34--------------------------------------------------------------------------------
Q8NIT8_NEUCS/230-253--------------------------------------------------------------------------------
A7EJ96_SCLS1/202-225--------------------------------------------------------------------------------
A8XJQ5_CAEBR/42-65--------------------------------------------------------------------------------
C3Z212_BRAFL/346-369--------------------------------------------------------------------------------
Q291B0_DROPS/1510-1533--------------------------------------------------------------------------------
B8MUF5_TALSN/21-47--------------------------------------------------------------------------------
C5FKT3_ARTOC/84-107--------------------------------------------------------------------------------
B6Q1Z1_PENMQ/146-169--------------------------------------------------------------------------------
B0WV05_CULQU/271-291--------------------------------------------------------------------------------
LIN13_CAEEL/1140-1163--------------------------------------------------------------------------------
A1CPF7_ASPCL/67-95--------------------------------------------------------------------------------
B2W6Q2_PYRTR/443-469--------------------------------------------------------------------------------
B0WBK5_CULQU/233-256--------------------------------------------------------------------------------
Q1RQ13_CIOIN/211-233--------------------------------------------------------------------------------
A8PFE0_BRUMA/212-236--------------------------------------------------------------------------------
B7PY09_IXOSC/14-37--------------------------------------------------------------------------------
C3Y329_BRAFL/3520-3543--------------------------------------------------------------------------------
B5DW36_DROPS/17-40--------------------------------------------------------------------------------
Q6CKJ9_KLULA/242-265--------------------------------------------------------------------------------
C4R4F4_PICPG/228-251--------------------------------------------------------------------------------
A5E1B3_LODEL/342-365--------------------------------------------------------------------------------
B0W9I5_CULQU/77-100--------------------------------------------------------------------------------
C4YDT8_CANAW/367-391--------------------------------------------------------------------------------
A3GFQ2_PICST/418-441--------------------------------------------------------------------------------
D3ZQP1_RAT/309-332--------------------------------------------------------------------------------
B0X5U5_CULQU/513-536--------------------------------------------------------------------------------
A2R6U4_ASPNC/549-574--------------------------------------------------------------------------------
Q7S4J1_NEUCR/544-568--------------------------------------------------------------------------------
Q17FQ4_AEDAE/276-299--------------------------------------------------------------------------------
B0XGW2_CULQU/146-169--------------------------------------------------------------------------------
A5AFF5_VITVI/646-669--------------------------------------------------------------------------------
C5WV18_SORBI/125-148--------------------------------------------------------------------------------
P93718_PETHY/490-513--------------------------------------------------------------------------------
Q9FZE3_ARATH/9-32--------------------------------------------------------------------------------
O81013_ARATH/49-72--------------------------------------------------------------------------------
Q9FH19_ARATH/342-365--------------------------------------------------------------------------------
B6TUR2_MAIZE/56-79--------------------------------------------------------------------------------
Q9C538_ARATH/750-773--------------------------------------------------------------------------------
B8BNW0_ORYSI/202-227--------------------------------------------------------------------------------
Q9LIB0_ARATH/272-295--------------------------------------------------------------------------------
B9SFT1_RICCO/264-287--------------------------------------------------------------------------------
D3B524_POLPA/660-686--------------------------------------------------------------------------------
Q4S7E8_TETNG/3067-3090--------------------------------------------------------------------------------
D3YV32_MOUSE/144-167--------------------------------------------------------------------------------
Q0UJG2_PHANO/219-242--------------------------------------------------------------------------------
B9F9M3_ORYSJ/90-113--------------------------------------------------------------------------------
B8PDV2_POSPM/261-284--------------------------------------------------------------------------------
A8QCV2_BRUMA/110-133--------------------------------------------------------------------------------
B0W1F2_CULQU/55-78--------------------------------------------------------------------------------
B0WIX6_CULQU/541-564--------------------------------------------------------------------------------
D4D5V1_TRIVH/13-38--------------------------------------------------------------------------------
B2AUE7_PODAN/663-686--------------------------------------------------------------------------------
B4J0M2_DROGR/211-234--------------------------------------------------------------------------------
B6HX35_PENCW/210-235--------------------------------------------------------------------------------
B0W9W2_CULQU/276-299--------------------------------------------------------------------------------
C9SHV9_VERA1/258-281--------------------------------------------------------------------------------
B0W0M9_CULQU/1111-1134--------------------------------------------------------------------------------
A8MY94_HUMAN/109-134--------------------------------------------------------------------------------
D3ZQP1_RAT/733-756--------------------------------------------------------------------------------
Q9NVH8_HUMAN/341-364--------------------------------------------------------------------------------
A7EWF7_SCLS1/32-57--------------------------------------------------------------------------------
Q4S7T0_TETNG/254-277--------------------------------------------------------------------------------
Q17J87_AEDAE/269-292--------------------------------------------------------------------------------
B9GEM8_POPTR/144-167--------------------------------------------------------------------------------
B4MP67_DROWI/774-800--------------------------------------------------------------------------------
Q4S7E8_TETNG/3266-3289--------------------------------------------------------------------------------
C6LR00_GIAIB/6-29--------------------------------------------------------------------------------
B0WWV9_CULQU/174-197--------------------------------------------------------------------------------
C9SFF6_VERA1/7-30--------------------------------------------------------------------------------
B0X9I8_CULQU/657-680--------------------------------------------------------------------------------
A1DB40_NEOFI/968-991--------------------------------------------------------------------------------
ZB99_ENCCU/103-126--------------------------------------------------------------------------------
C3Y329_BRAFL/1089-1112--------------------------------------------------------------------------------
C3Y329_BRAFL/1782-1805--------------------------------------------------------------------------------
C3Y329_BRAFL/1926-1949--------------------------------------------------------------------------------
C3Y329_BRAFL/1351-1374--------------------------------------------------------------------------------
C3Y9C8_BRAFL/33-57--------------------------------------------------------------------------------
B4MUG7_DROWI/836-859--------------------------------------------------------------------------------
SPR4_CAEEL/1022-1045--------------------------------------------------------------------------------
A8XE56_CAEBR/1256-1279--------------------------------------------------------------------------------
SPR4_CAEEL/1261-1284--------------------------------------------------------------------------------
B0WGK0_CULQU/145-168--------------------------------------------------------------------------------
B0WWY3_CULQU/276-299--------------------------------------------------------------------------------
B0WIX2_CULQU/324-347--------------------------------------------------------------------------------
C3Y329_BRAFL/1533-1556--------------------------------------------------------------------------------
Q335Q3_CHICK/298-323--------------------------------------------------------------------------------
B4PTC6_DROYA/256-279--------------------------------------------------------------------------------
D2A5X4_TRICA/1149-1173--------------------------------------------------------------------------------
Q0IHR5_XENTR/425-448--------------------------------------------------------------------------------
B2B4J5_PODAN/315-339--------------------------------------------------------------------------------
B0X0S3_CULQU/4-27--------------------------------------------------------------------------------
A7MAY9_BOVIN/748-771--------------------------------------------------------------------------------
LIN13_CAEEL/1628-1651--------------------------------------------------------------------------------
A8WM54_CAEBR/1663-1686--------------------------------------------------------------------------------
A8Q8S1_BRUMA/338-364--------------------------------------------------------------------------------
B1MTH1_CALMO/494-517--------------------------------------------------------------------------------
Q4TI39_TETNG/62-85--------------------------------------------------------------------------------
Q1RLJ0_CIOIN/89-111--------------------------------------------------------------------------------
A8QFN6_BRUMA/137-160--------------------------------------------------------------------------------
B7P2H2_IXOSC/22-45--------------------------------------------------------------------------------
Q9N5H8_CAEEL/137-165--------------------------------------------------------------------------------
C7F7U7_NASVI/331-351--------------------------------------------------------------------------------
Q4RER3_TETNG/1118-1141--------------------------------------------------------------------------------
B4MUG7_DROWI/360-383--------------------------------------------------------------------------------
B0W8E6_CULQU/277-300--------------------------------------------------------------------------------
Q28BY5_XENTR/137-160--------------------------------------------------------------------------------
B4KAQ7_DROMO/87-110--------------------------------------------------------------------------------
Q0CC56_ASPTN/205-227--------------------------------------------------------------------------------
Q5TPX2_ANOGA/236-256--------------------------------------------------------------------------------
B7PGT2_IXOSC/509-532--------------------------------------------------------------------------------
B4JJZ6_DROGR/2097-2122--------------------------------------------------------------------------------
Q95UR7_SCHAM/277-300--------------------------------------------------------------------------------
B0EKT6_ENTDS/350-373--------------------------------------------------------------------------------
Q2MHN3_MOUSE/974-997--------------------------------------------------------------------------------
B0W328_CULQU/277-300--------------------------------------------------------------------------------
B3KTX8_HUMAN/145-168--------------------------------------------------------------------------------
LIN13_CAEEL/2065-2095--------------------------------------------------------------------------------
A0NFD1_ANOGA/206-226--------------------------------------------------------------------------------
A7E543_SCLS1/388-411--------------------------------------------------------------------------------
B4P2L1_DROYA/1833-1856--------------------------------------------------------------------------------
B0WCG2_CULQU/124-147--------------------------------------------------------------------------------
Q4V5B5_DROME/225-250--------------------------------------------------------------------------------
B4KAQ7_DROMO/150-175--------------------------------------------------------------------------------
D2HFW9_AILME/74-97--------------------------------------------------------------------------------
Q28J29_XENTR/108-131--------------------------------------------------------------------------------
A8XE56_CAEBR/389-412--------------------------------------------------------------------------------
B7P2H6_IXOSC/304-327--------------------------------------------------------------------------------
B0WHH3_CULQU/311-334--------------------------------------------------------------------------------
Q26816_9TRYP/1447-1470--------------------------------------------------------------------------------
A9V4I1_MONBE/4-27--------------------------------------------------------------------------------
Q0USV6_PHANO/218-241--------------------------------------------------------------------------------
A8X6T9_CAEBR/133-155--------------------------------------------------------------------------------
Q17Q26_AEDAE/208-234--------------------------------------------------------------------------------
C7Z4W1_NECH7/365-388--------------------------------------------------------------------------------
B4JJZ6_DROGR/1249-1273--------------------------------------------------------------------------------
B4L6C6_DROMO/1465-1489--------------------------------------------------------------------------------
Q29IM1_DROPS/1596-1621--------------------------------------------------------------------------------
B4NDK7_DROWI/1436-1460--------------------------------------------------------------------------------
Q16V67_AEDAE/96-119--------------------------------------------------------------------------------
B4PZ76_DROYA/1477-1501--------------------------------------------------------------------------------
B3MS97_DROAN/1482-1506--------------------------------------------------------------------------------
B7QAQ8_IXOSC/115-138--------------------------------------------------------------------------------
SPR4_CAEEL/709-732--------------------------------------------------------------------------------
Q179L1_AEDAE/57-80--------------------------------------------------------------------------------
A8Q4A3_BRUMA/250-275--------------------------------------------------------------------------------
A8NTJ4_BRUMA/76-101--------------------------------------------------------------------------------
Q17BB1_AEDAE/357-380--------------------------------------------------------------------------------
A8NJE7_BRUMA/178-203--------------------------------------------------------------------------------
A8NJE7_BRUMA/265-290--------------------------------------------------------------------------------
A8PDW7_BRUMA/76-101--------------------------------------------------------------------------------
B8P8R6_POSPM/464-489--------------------------------------------------------------------------------
C5JNN0_AJEDS/636-661--------------------------------------------------------------------------------
B3KPI7_HUMAN/359-384--------------------------------------------------------------------------------
A8PHZ8_BRUMA/199-222--------------------------------------------------------------------------------
B7PT82_IXOSC/268-291--------------------------------------------------------------------------------
D4DIS5_TRIVH/539-564--------------------------------------------------------------------------------
A2Q8N5_ASPNC/262-289--------------------------------------------------------------------------------
A2R8Y6_ASPNC/231-256--------------------------------------------------------------------------------
C5JNN0_AJEDS/256-281--------------------------------------------------------------------------------
D2A5X4_TRICA/2707-2730--------------------------------------------------------------------------------
B6H9V8_PENCW/591-614--------------------------------------------------------------------------------
B4P2L1_DROYA/1963-1994--------------------------------------------------------------------------------
Q5C1C8_SCHJA/88-118--------------------------------------------------------------------------------
Q16E65_AEDAE/222-244--------------------------------------------------------------------------------
A8QHH7_BRUMA/326-349--------------------------------------------------------------------------------
Q22677_CAEEL/175-198--------------------------------------------------------------------------------
B7PT82_IXOSC/472-495--------------------------------------------------------------------------------
B0WGJ8_CULQU/315-338--------------------------------------------------------------------------------
Q23521_CAEEL/227-252--------------------------------------------------------------------------------
Q0UBT1_PHANO/39-62--------------------------------------------------------------------------------
A8X3B2_CAEBR/218-241--------------------------------------------------------------------------------
Q2MHN3_MOUSE/563-586--------------------------------------------------------------------------------
B7PT82_IXOSC/79-102--------------------------------------------------------------------------------
B4NEY7_DROWI/49-74--------------------------------------------------------------------------------
A4RV11_OSTLU/566-590--------------------------------------------------------------------------------
B8P7K4_POSPM/360-385--------------------------------------------------------------------------------
Q16E65_AEDAE/158-180--------------------------------------------------------------------------------
A8X3M6_CAEBR/56-79--------------------------------------------------------------------------------
B0W8E6_CULQU/171-193--------------------------------------------------------------------------------
B7QFA3_IXOSC/459-482--------------------------------------------------------------------------------
A8WFP9_CAEEL/43-66--------------------------------------------------------------------------------
B9IJ27_POPTR/141-164--------------------------------------------------------------------------------
B8PJS0_POSPM/397-420--------------------------------------------------------------------------------
C7ZEG0_NECH7/215-243--------------------------------------------------------------------------------
Q8NIT8_NEUCS/665-688--------------------------------------------------------------------------------
B8MTG3_TALSN/141-164--------------------------------------------------------------------------------
Q7SBI5_NEUCR/18-41--------------------------------------------------------------------------------
Q2H4N8_CHAGB/181-206--------------------------------------------------------------------------------
B2ADT0_PODAN/465-490--------------------------------------------------------------------------------
B4FJJ7_MAIZE/365-388--------------------------------------------------------------------------------
B9WL25_CANDC/111-136--------------------------------------------------------------------------------
Q6CG89_YARLI/310-335--------------------------------------------------------------------------------
C5DGN9_LACTC/388-411--------------------------------------------------------------------------------
B8PBF4_POSPM/444-470--------------------------------------------------------------------------------
B8P3E6_POSPM/464-489--------------------------------------------------------------------------------
B6IJ73_CAEBR/540-563--------------------------------------------------------------------------------
C4Y6B6_CLAL4/387-408--------------------------------------------------------------------------------
C6H3W8_AJECH/145-170--------------------------------------------------------------------------------
C5JCK2_AJEDS/184-207--------------------------------------------------------------------------------
A2QZ26_ASPNC/265-290--------------------------------------------------------------------------------
B8PGG2_POSPM/411-434--------------------------------------------------------------------------------
B8P7K6_POSPM/358-383--------------------------------------------------------------------------------
B8PFE1_POSPM/193-217--------------------------------------------------------------------------------
B2B3H8_PODAN/146-172--------------------------------------------------------------------------------
Q0U4H7_PHANO/206-230--------------------------------------------------------------------------------
B8PDT3_POSPM/359-383--------------------------------------------------------------------------------
B8PGH5_POSPM/360-383--------------------------------------------------------------------------------
A2Q9X2_ASPNC/33-68--------------------------------------------------------------------------------
A6SQB5_BOTFB/8-33--------------------------------------------------------------------------------
A7MAY9_BOVIN/991-1014--------------------------------------------------------------------------------
Q17JG0_AEDAE/104-127--------------------------------------------------------------------------------
B0W0M9_CULQU/772-795--------------------------------------------------------------------------------
Q23458_CAEEL/176-200--------------------------------------------------------------------------------
B2WDJ9_PYRTR/240-267--------------------------------------------------------------------------------
B4IGX3_DROSE/164-187--------------------------------------------------------------------------------
A8PHZ8_BRUMA/790-813--------------------------------------------------------------------------------
B0WBK5_CULQU/621-644--------------------------------------------------------------------------------
B0W7B5_CULQU/333-356--------------------------------------------------------------------------------
B3MBJ5_DROAN/449-472--------------------------------------------------------------------------------
Q6BL20_DEBHA/191-214--------------------------------------------------------------------------------
Q16IT5_AEDAE/317-340--------------------------------------------------------------------------------
Q3UQJ9_MOUSE/1174-1196--------------------------------------------------------------------------------
C6HLC4_AJECH/295-315--------------------------------------------------------------------------------
Q00069_ASCIM/209-229--------------------------------------------------------------------------------
TREF1_HUMAN/1086-1109--------------------------------------------------------------------------------
B0W0M9_CULQU/661-685--------------------------------------------------------------------------------
B0WNG4_CULQU/278-301--------------------------------------------------------------------------------
B4H0E8_DROPE/716-739--------------------------------------------------------------------------------
B4PD05_DROYA/166-189--------------------------------------------------------------------------------
B3M9W0_DROAN/172-195--------------------------------------------------------------------------------
Q2KTB9_RAT/449-472--------------------------------------------------------------------------------
B3LGU7_YEAS1/263-283--------------------------------------------------------------------------------
C5M624_CANTT/182-202--------------------------------------------------------------------------------
Q9U8F6_NASVI/113-141--------------------------------------------------------------------------------
C3Y329_BRAFL/2571-2594--------------------------------------------------------------------------------
B7PX18_IXOSC/9-32--------------------------------------------------------------------------------
Q17NH5_AEDAE/329-352--------------------------------------------------------------------------------
A8NSX1_BRUMA/311-336--------------------------------------------------------------------------------
Q4SH15_TETNG/142-165--------------------------------------------------------------------------------
Q1RLH5_CIOIN/826-849--------------------------------------------------------------------------------
D4AIT5_ARTBC/244-267--------------------------------------------------------------------------------
Q29K07_DROPS/273-297--------------------------------------------------------------------------------
Q2U4K7_ASPOR/40-67--------------------------------------------------------------------------------
A5XCD8_DANRE/176-199--------------------------------------------------------------------------------
Q1LYB3_DANRE/1116-1141--------------------------------------------------------------------------------
B3DM60_XENTR/599-625--------------------------------------------------------------------------------
Q7PMA2_ANOGA/187-210--------------------------------------------------------------------------------
C3Y329_BRAFL/2902-2925--------------------------------------------------------------------------------
Q28CN1_XENTR/165-189--------------------------------------------------------------------------------
Q63HJ5_HUMAN/843-866--------------------------------------------------------------------------------
B0WCG2_CULQU/250-273--------------------------------------------------------------------------------
Q5JZ68_HUMAN/77-100--------------------------------------------------------------------------------
Q63HJ5_HUMAN/1968-1991--------------------------------------------------------------------------------
B0W0M6_CULQU/2170-2195--------------------------------------------------------------------------------
Q17PX0_AEDAE/339-364--------------------------------------------------------------------------------
B4P2L1_DROYA/121-144--------------------------------------------------------------------------------
B7P757_IXOSC/198-222--------------------------------------------------------------------------------
C3ZMX9_BRAFL/310-336--------------------------------------------------------------------------------
Q1RLD7_CIOIN/296-319--------------------------------------------------------------------------------
C3ZIR0_BRAFL/173-196--------------------------------------------------------------------------------
D2HTR1_AILME/701-724--------------------------------------------------------------------------------
A1L2T7_XENLA/567-590--------------------------------------------------------------------------------
Q4RGT6_TETNG/1353-1376--------------------------------------------------------------------------------
A8PHZ8_BRUMA/567-590--------------------------------------------------------------------------------
B0W110_CULQU/17-40--------------------------------------------------------------------------------
D2HU52_AILME/78-101--------------------------------------------------------------------------------
B1MTH1_CALMO/590-613--------------------------------------------------------------------------------
Q1RLJ0_CIOIN/186-209--------------------------------------------------------------------------------
B3RVK9_TRIAD/79-110--------------------------------------------------------------------------------
A5WW46_DANRE/90-119--------------------------------------------------------------------------------
Q63HJ5_HUMAN/600-623--------------------------------------------------------------------------------
Q4RGT6_TETNG/1438-1461--------------------------------------------------------------------------------
B8N6D7_ASPFN/350-377--------------------------------------------------------------------------------
B7PMW3_IXOSC/253-276--------------------------------------------------------------------------------
B6VBU2_9PELO/55-78--------------------------------------------------------------------------------
B2AF61_PODAN/11-39--------------------------------------------------------------------------------
Q63HJ5_HUMAN/1265-1288--------------------------------------------------------------------------------
Q2HB25_CHAGB/3-26--------------------------------------------------------------------------------
Q5XHE5_XENLA/214-237--------------------------------------------------------------------------------
Q29IM1_DROPS/2831-2856--------------------------------------------------------------------------------
A8WK33_CAEBR/165-188--------------------------------------------------------------------------------
Q63HJ5_HUMAN/1767-1791--------------------------------------------------------------------------------
B7FI33_MEDTR/15-38--------------------------------------------------------------------------------
B4P2L1_DROYA/523-546--------------------------------------------------------------------------------
A4RV11_OSTLU/411-439--------------------------------------------------------------------------------
YQ23_CAEEL/76-99--------------------------------------------------------------------------------
Q21777_CAEEL/465-488--------------------------------------------------------------------------------
A8WLH8_CAEBR/8-31--------------------------------------------------------------------------------
Q9W458_DROME/481-504--------------------------------------------------------------------------------
B0W532_CULQU/322-345--------------------------------------------------------------------------------
Q6C318_YARLI/766-789--------------------------------------------------------------------------------
Q21777_CAEEL/305-330--------------------------------------------------------------------------------
B0WHH3_CULQU/255-278--------------------------------------------------------------------------------
A8WN61_CAEBR/255-278--------------------------------------------------------------------------------
C3ZMX9_BRAFL/810-835--------------------------------------------------------------------------------
D4DIS5_TRIVH/263-286--------------------------------------------------------------------------------
B6HS71_PENCW/329-354--------------------------------------------------------------------------------
Q335Q3_CHICK/214-238--------------------------------------------------------------------------------
Q4V6W7_DROME/53-76--------------------------------------------------------------------------------
B2ANP6_PODAN/176-199--------------------------------------------------------------------------------
CP190_DROME/505-528--------------------------------------------------------------------------------
Q17H68_AEDAE/476-500--------------------------------------------------------------------------------
B3P5W3_DROER/191-214--------------------------------------------------------------------------------
A9VAV7_MONBE/252-277--------------------------------------------------------------------------------
Q7PW75_ANOGA/254-277--------------------------------------------------------------------------------
B7Z7W1_HUMAN/212-234--------------------------------------------------------------------------------
B5DIB7_DROPS/203-226--------------------------------------------------------------------------------
B4HMS2_DROSE/553-576--------------------------------------------------------------------------------
B4MIQ8_DROWI/152-175--------------------------------------------------------------------------------
Q7Q9G1_ANOGA/544-569--------------------------------------------------------------------------------
B4QAK8_DROSI/27-50--------------------------------------------------------------------------------
Q63HJ5_HUMAN/1470-1493--------------------------------------------------------------------------------
B4MP67_DROWI/844-867--------------------------------------------------------------------------------
C3YL46_BRAFL/138-163--------------------------------------------------------------------------------
A8PAW1_BRUMA/152-177--------------------------------------------------------------------------------
Q4P8M7_USTMA/447-471--------------------------------------------------------------------------------
A8PQ02_BRUMA/394-420--------------------------------------------------------------------------------
Q16LR6_AEDAE/226-249--------------------------------------------------------------------------------
Q16H34_AEDAE/471-492--------------------------------------------------------------------------------
Q16XS5_AEDAE/383-406--------------------------------------------------------------------------------
B0WAD2_CULQU/278-301--------------------------------------------------------------------------------
Q4SSB4_TETNG/21-46--------------------------------------------------------------------------------
A9UWL3_MONBE/105-128--------------------------------------------------------------------------------
D2A5X4_TRICA/2873-2896--------------------------------------------------------------------------------
Q6NL58_DROME/230-253--------------------------------------------------------------------------------
A8Q597_BRUMA/193-218--------------------------------------------------------------------------------
C7DZJ6_DANRE/1106-1129--------------------------------------------------------------------------------
B4H8M8_DROPE/482-506--------------------------------------------------------------------------------
C4R2A2_PICPG/269-297--------------------------------------------------------------------------------
C1C3A0_9MAXI/262-285--------------------------------------------------------------------------------
Q63HJ5_HUMAN/2025-2048--------------------------------------------------------------------------------
A8PZ56_BRUMA/367-390--------------------------------------------------------------------------------
Q8T078_DROME/38-61--------------------------------------------------------------------------------
MEP1_CAEBR/436-459--------------------------------------------------------------------------------
B7P493_IXOSC/180-203--------------------------------------------------------------------------------
Q17PX0_AEDAE/1035-1058--------------------------------------------------------------------------------
D3ZVE0_RAT/521-544--------------------------------------------------------------------------------
D2A5C6_TRICA/170-193--------------------------------------------------------------------------------
Q8K1J0_MOUSE/466-489--------------------------------------------------------------------------------
Q4RER3_TETNG/684-707--------------------------------------------------------------------------------
D3ZDK1_RAT/751-773--------------------------------------------------------------------------------
B5DNG6_DROPS/1081-1104--------------------------------------------------------------------------------
B0WNK1_CULQU/238-260--------------------------------------------------------------------------------
C9SVS1_VERA1/16-39--------------------------------------------------------------------------------
B0W0M9_CULQU/435-458--------------------------------------------------------------------------------
JING_DROME/1150-1173--------------------------------------------------------------------------------
A8Q593_BRUMA/551-574--------------------------------------------------------------------------------
B4KQA3_DROMO/183-206--------------------------------------------------------------------------------
A0DJ35_PARTE/113-136--------------------------------------------------------------------------------
MEP1_CAEBR/728-751--------------------------------------------------------------------------------
B0XFC7_CULQU/6-28--------------------------------------------------------------------------------
Q0UJG2_PHANO/72-94--------------------------------------------------------------------------------
B4H6B3_DROPE/17-40--------------------------------------------------------------------------------
A8XLK5_CAEBR/246-269--------------------------------------------------------------------------------
Q63HJ5_HUMAN/108-131--------------------------------------------------------------------------------
B4J7R5_DROGR/110-133--------------------------------------------------------------------------------
A8X359_CAEBR/123-146--------------------------------------------------------------------------------
B4LQ32_DROVI/724-746--------------------------------------------------------------------------------
C5FFW2_ARTOC/135-161--------------------------------------------------------------------------------
Q1RLD7_CIOIN/401-424--------------------------------------------------------------------------------
B0W1Z9_CULQU/250-273--------------------------------------------------------------------------------
C4VB14_NOSCE/202-225--------------------------------------------------------------------------------
B2B6W3_PODAN/998-1023--------------------------------------------------------------------------------
B4MQM1_DROWI/1117-1140--------------------------------------------------------------------------------
B8LQV8_PICSI/242-265--------------------------------------------------------------------------------
B4I9G7_DROSE/164-187--------------------------------------------------------------------------------
B0W4X9_CULQU/220-245--------------------------------------------------------------------------------
Q95Q03_CAEEL/18-41--------------------------------------------------------------------------------
Q6RG13_AEDAE/474-497--------------------------------------------------------------------------------
C7ZKR5_NECH7/156-184--------------------------------------------------------------------------------
B0D109_LACBS/214-237--------------------------------------------------------------------------------
A2AB19_HUMAN/384-406--------------------------------------------------------------------------------
B7FVA6_PHATC/653-676--------------------------------------------------------------------------------
Q63HJ5_HUMAN/2191-2214--------------------------------------------------------------------------------
B4L6C6_DROMO/2746-2769--------------------------------------------------------------------------------
Q4RGT6_TETNG/326-349--------------------------------------------------------------------------------
C1BS33_9MAXI/229-252--------------------------------------------------------------------------------
B0W533_CULQU/643-672--------------------------------------------------------------------------------
D3BTR4_POLPA/105-130--------------------------------------------------------------------------------
B0WGK0_CULQU/264-287--------------------------------------------------------------------------------
B4Q650_DROSI/467-490--------------------------------------------------------------------------------
B0W108_CULQU/527-550--------------------------------------------------------------------------------
B0WGK9_CULQU/296-319--------------------------------------------------------------------------------
B4MRW9_DROWI/90-113--------------------------------------------------------------------------------
B4JZV9_DROGR/1563-1589--------------------------------------------------------------------------------
B3DJB3_DANRE/131-154--------------------------------------------------------------------------------
Q4SUB0_TETNG/263-286--------------------------------------------------------------------------------
B2VW94_PYRTR/375-398--------------------------------------------------------------------------------
A8E7N7_DANRE/460-483--------------------------------------------------------------------------------
Q5DCC8_SCHJA/112-135--------------------------------------------------------------------------------
LIN13_CAEEL/1252-1274--------------------------------------------------------------------------------
A5YSS0_9EURY/906-929--------------------------------------------------------------------------------
B9IBW5_POPTR/82-104--------------------------------------------------------------------------------
Q4QA93_LEIMA/509-532--------------------------------------------------------------------------------
D0NG91_PHYIT/46-71--------------------------------------------------------------------------------
B7Q138_IXOSC/182-205--------------------------------------------------------------------------------
B4H5M3_DROPE/640-663--------------------------------------------------------------------------------
B4PIP4_DROYA/20-43--------------------------------------------------------------------------------
B4G562_DROPE/522-545--------------------------------------------------------------------------------
A1C9Y2_ASPCL/52-79--------------------------------------------------------------------------------
C5FVZ2_ARTOC/47-74--------------------------------------------------------------------------------
C9SPQ8_VERA1/54-81--------------------------------------------------------------------------------
A3LUZ4_PICST/29-52--------------------------------------------------------------------------------
B5XEI2_SALSA/96-121--------------------------------------------------------------------------------
ZN511_HUMAN/80-105--------------------------------------------------------------------------------
C1BVR7_9MAXI/71-96--------------------------------------------------------------------------------
A9NZ35_PICSI/79-104--------------------------------------------------------------------------------
B6T5I8_MAIZE/75-100--------------------------------------------------------------------------------
Q0WRF4_ARATH/69-94--------------------------------------------------------------------------------
A9RJY5_PHYPA/55-80--------------------------------------------------------------------------------
Q16M02_AEDAE/317-340--------------------------------------------------------------------------------
Q29K07_DROPS/331-355--------------------------------------------------------------------------------
A6SS34_BOTFB/300-329--------------------------------------------------------------------------------
B2AFE8_PODAN/135-158--------------------------------------------------------------------------------
Q2GQ76_CHAGB/138-161--------------------------------------------------------------------------------
A1CY68_NEOFI/417-440--------------------------------------------------------------------------------
Q7S0H2_NEUCR/141-164--------------------------------------------------------------------------------
B6HMK5_PENCW/341-369--------------------------------------------------------------------------------
Q21907_CAEEL/225-248--------------------------------------------------------------------------------
A8XMJ6_CAEBR/51-74--------------------------------------------------------------------------------
A8PBU8_BRUMA/209-232--------------------------------------------------------------------------------
Q68CP0_HUMAN/140-163--------------------------------------------------------------------------------
SPR4_CAEEL/585-608--------------------------------------------------------------------------------
B4KIA8_DROMO/381-404--------------------------------------------------------------------------------
A8QGU5_BRUMA/468-491--------------------------------------------------------------------------------
B0W0M6_CULQU/1774-1797--------------------------------------------------------------------------------
B6Q1Z1_PENMQ/122-143--------------------------------------------------------------------------------
A8PZ56_BRUMA/687-710--------------------------------------------------------------------------------
B0X272_CULQU/8-31--------------------------------------------------------------------------------
B0WXW3_CULQU/241-264--------------------------------------------------------------------------------
PACC_CANDC/215-240--------------------------------------------------------------------------------
C4MAN3_ENTHI/163-186--------------------------------------------------------------------------------
B4NDK7_DROWI/2381-2409--------------------------------------------------------------------------------
B4NDK7_DROWI/2655-2680--------------------------------------------------------------------------------
B8CDT5_THAPS/254-277--------------------------------------------------------------------------------
Q01C34_OSTTA/388-411--------------------------------------------------------------------------------
B0W5F0_CULQU/309-332--------------------------------------------------------------------------------
O44318_LIMPO/95-118--------------------------------------------------------------------------------
B0W1Z9_CULQU/348-371--------------------------------------------------------------------------------
Q0CSD9_ASPTN/177-202--------------------------------------------------------------------------------
B7PPH0_IXOSC/38-61--------------------------------------------------------------------------------
Q4H2H5_CIOIN/194-219--------------------------------------------------------------------------------
B4JJZ6_DROGR/2499-2522--------------------------------------------------------------------------------
B4MAE2_DROVI/2557-2580--------------------------------------------------------------------------------
B4L6C6_DROMO/2670-2693--------------------------------------------------------------------------------
B4H2Q1_DROPE/240-263--------------------------------------------------------------------------------
C3Y3L4_BRAFL/1717-1740--------------------------------------------------------------------------------
B0XGE6_CULQU/92-115--------------------------------------------------------------------------------
C3Y633_BRAFL/249-285--------------------------------------------------------------------------------
A7SD00_NEMVE/687-710--------------------------------------------------------------------------------
B2W7K3_PYRTR/763-786--------------------------------------------------------------------------------
A8QGU5_BRUMA/382-405--------------------------------------------------------------------------------
Q4RQV6_TETNG/716-742--------------------------------------------------------------------------------
B6HS71_PENCW/111-139--------------------------------------------------------------------------------
Q5NDD4_CUCSA/222-245--------------------------------------------------------------------------------
Q0IHR5_XENTR/384-409--------------------------------------------------------------------------------
D2HVZ5_AILME/160-185--------------------------------------------------------------------------------
D2A5X4_TRICA/2269-2294--------------------------------------------------------------------------------
B0W0M6_CULQU/2407-2432--------------------------------------------------------------------------------
Q17PW8_AEDAE/1609-1632--------------------------------------------------------------------------------
A2A7F4_MOUSE/667-692--------------------------------------------------------------------------------
B4J256_DROGR/1013-1036--------------------------------------------------------------------------------
B2B451_PODAN/634-658--------------------------------------------------------------------------------
Q28CN1_XENTR/624-649--------------------------------------------------------------------------------
A9T6Q6_PHYPA/895-918--------------------------------------------------------------------------------
A9TUJ1_PHYPA/13-36--------------------------------------------------------------------------------
Q6C595_YARLI/256-283--------------------------------------------------------------------------------
Q6C1K3_YARLI/405-433--------------------------------------------------------------------------------
B3LIH7_YEAS1/178-201--------------------------------------------------------------------------------
Q6CY73_KLULA/413-436--------------------------------------------------------------------------------
B0WBK5_CULQU/300-323--------------------------------------------------------------------------------
B2WID5_PYRTR/11-39--------------------------------------------------------------------------------
B8PFF3_POSPM/238-261--------------------------------------------------------------------------------
Q5KEF6_CRYNJ/271-294--------------------------------------------------------------------------------
Q6CDF4_YARLI/235-258--------------------------------------------------------------------------------
D2A5C6_TRICA/84-107--------------------------------------------------------------------------------
A9U0C1_PHYPA/351-376--------------------------------------------------------------------------------
A7EJ95_SCLS1/436-460--------------------------------------------------------------------------------
Q8T078_DROME/306-329--------------------------------------------------------------------------------
Q5DB66_SCHJA/51-76--------------------------------------------------------------------------------
A6S972_BOTFB/94-119--------------------------------------------------------------------------------
A7F8A3_SCLS1/33-58--------------------------------------------------------------------------------
B0WTK3_CULQU/627-650--------------------------------------------------------------------------------
C4QZH0_PICPG/26-51--------------------------------------------------------------------------------
Q5TRK2_ANOGA/368-392--------------------------------------------------------------------------------
C1G1Q4_PARBD/341-364--------------------------------------------------------------------------------
C4JQ24_UNCRE/276-299--------------------------------------------------------------------------------
B7Q3Z8_IXOSC/337-362--------------------------------------------------------------------------------
A7MAY9_BOVIN/807-830--------------------------------------------------------------------------------
D3ZDK1_RAT/839-862--------------------------------------------------------------------------------
Q04072_STRPU/157-180--------------------------------------------------------------------------------
Q21777_CAEEL/630-653--------------------------------------------------------------------------------
Q16IT5_AEDAE/256-279--------------------------------------------------------------------------------
Q1RLD7_CIOIN/117-140--------------------------------------------------------------------------------
Q1LYB3_DANRE/1383-1408--------------------------------------------------------------------------------
B4JJZ6_DROGR/2710-2734--------------------------------------------------------------------------------
B4NDK7_DROWI/2989-3013--------------------------------------------------------------------------------
B4PZ76_DROYA/2957-2981--------------------------------------------------------------------------------
B4L6C6_DROMO/2552-2577--------------------------------------------------------------------------------
Q1PQI9_DROMI/259-282--------------------------------------------------------------------------------
B5E0E0_DROPS/422-445--------------------------------------------------------------------------------
B7Q473_IXOSC/15-38--------------------------------------------------------------------------------
Q16V67_AEDAE/162-185--------------------------------------------------------------------------------
B9H6A0_POPTR/21-44--------------------------------------------------------------------------------
Q8S3S4_ORYSJ/66-89--------------------------------------------------------------------------------
C6LR00_GIAIB/301-324--------------------------------------------------------------------------------
B4H9Y9_DROPE/180-204--------------------------------------------------------------------------------
B0WSE4_CULQU/266-288--------------------------------------------------------------------------------
D0MTJ1_PHYIT/349-372--------------------------------------------------------------------------------
Q3MN16_HUMAN/67-92--------------------------------------------------------------------------------
B8CDT5_THAPS/483-505--------------------------------------------------------------------------------
B0W0M6_CULQU/1861-1884--------------------------------------------------------------------------------
Q6FRY7_CANGA/380-405--------------------------------------------------------------------------------
C9SSA5_VERA1/431-456--------------------------------------------------------------------------------
A2A7F4_MOUSE/1355-1380--------------------------------------------------------------------------------
C4JP57_UNCRE/24-47--------------------------------------------------------------------------------
B0WIX2_CULQU/384-406--------------------------------------------------------------------------------
B0WYD2_CULQU/357-380--------------------------------------------------------------------------------
Q16M02_AEDAE/372-395--------------------------------------------------------------------------------
D2GVM0_AILME/983-1006--------------------------------------------------------------------------------
B0W104_CULQU/424-447--------------------------------------------------------------------------------
A6R961_AJECN/23-46--------------------------------------------------------------------------------
YQ23_CAEEL/183-206--------------------------------------------------------------------------------
B2ALK3_PODAN/2-25--------------------------------------------------------------------------------
A5E526_LODEL/45-68--------------------------------------------------------------------------------
Q16IT5_AEDAE/224-247--------------------------------------------------------------------------------
Q5TRK0_ANOGA/385-411--------------------------------------------------------------------------------
B0WYD2_CULQU/302-325--------------------------------------------------------------------------------
B0W111_CULQU/2-25--------------------------------------------------------------------------------
B4JMZ7_DROGR/392-415--------------------------------------------------------------------------------
C4A0F0_BRAFL/24-47--------------------------------------------------------------------------------
B0WHQ7_CULQU/387-410--------------------------------------------------------------------------------
B7PK44_IXOSC/259-282--------------------------------------------------------------------------------
Q16IT5_AEDAE/171-194--------------------------------------------------------------------------------
A0NGG6_ANOGA/87-110--------------------------------------------------------------------------------
B0W7A7_CULQU/70-98--------------------------------------------------------------------------------
B7PMJ7_IXOSC/18-49--------------------------------------------------------------------------------
Q4SET0_TETNG/21-45--------------------------------------------------------------------------------
A5AFF5_VITVI/260-282--------------------------------------------------------------------------------
A3BLW8_ORYSJ/113-136--------------------------------------------------------------------------------
C5Z2J4_SORBI/64-87--------------------------------------------------------------------------------
D3YV79_MOUSE/231-254--------------------------------------------------------------------------------
C7DZJ6_DANRE/870-893--------------------------------------------------------------------------------
B7XJK2_ENTBH/98-121--------------------------------------------------------------------------------
Q4SZW5_TETNG/733-756--------------------------------------------------------------------------------
YNC3_CAEEL/207-229--------------------------------------------------------------------------------
C3Z1C5_BRAFL/354-377--------------------------------------------------------------------------------
C3Z1C6_BRAFL/142-165--------------------------------------------------------------------------------
C3XUM2_BRAFL/465-488--------------------------------------------------------------------------------
C3YHB2_BRAFL/112-135--------------------------------------------------------------------------------
A8E7N7_DANRE/430-453--------------------------------------------------------------------------------
O17862_CAEEL/191-218--------------------------------------------------------------------------------
B4LL71_DROVI/425-448--------------------------------------------------------------------------------
Q0IEG5_AEDAE/185-208--------------------------------------------------------------------------------
Q09620_CAEEL/12-35--------------------------------------------------------------------------------
C3ZIR0_BRAFL/700-723--------------------------------------------------------------------------------
B3DMQ2_DROME/201-224--------------------------------------------------------------------------------
ATBP_DROME/321-346--------------------------------------------------------------------------------
Q29CH7_DROPS/183-206--------------------------------------------------------------------------------
D2A5X3_TRICA/1593-1616--------------------------------------------------------------------------------
Q0CEM1_ASPTN/234-261--------------------------------------------------------------------------------
B4HAN4_DROPE/798-821--------------------------------------------------------------------------------
Q16VZ0_AEDAE/441-463--------------------------------------------------------------------------------
B4L6C6_DROMO/2297-2325--------------------------------------------------------------------------------
B4PZ76_DROYA/2346-2374--------------------------------------------------------------------------------
Q29IM1_DROPS/2582-2610--------------------------------------------------------------------------------
B8NZS4_POSPM/309-335--------------------------------------------------------------------------------
O49591_ARATH/26-49--------------------------------------------------------------------------------
A8PAN0_BRUMA/81-106--------------------------------------------------------------------------------
B8PAZ1_POSPM/152-176--------------------------------------------------------------------------------
B8NZM2_POSPM/476-500--------------------------------------------------------------------------------
B2ABK1_PODAN/296-326--------------------------------------------------------------------------------
B0WRI3_CULQU/313-336--------------------------------------------------------------------------------
B6HEV4_PENCW/231-254--------------------------------------------------------------------------------
D2A5X4_TRICA/2040-2063--------------------------------------------------------------------------------
B3MS97_DROAN/2658-2683--------------------------------------------------------------------------------
B4PZ76_DROYA/2616-2641--------------------------------------------------------------------------------
D3ZVE0_RAT/177-200--------------------------------------------------------------------------------
Q4S665_TETNG/262-285--------------------------------------------------------------------------------
B3RRP5_TRIAD/73-98--------------------------------------------------------------------------------
Q7PW31_ANOGA/236-259--------------------------------------------------------------------------------
B0W532_CULQU/566-588--------------------------------------------------------------------------------
B0W533_CULQU/509-532--------------------------------------------------------------------------------
B0X5Z6_CULQU/198-221--------------------------------------------------------------------------------

PF12171

Q7QEH9_ANOGA/476-502--------------------------------------------------------------------------------
Q5TTY0_ANOGA/628-654--------------------------------------------------------------------------------
Q4WWC2_ASPFU/200-226--------------------------------------------------------------------------------
Q4WHR8_ASPFU/70-96--------------------------------------------------------------------------------
Q8IKJ3_PLAF7/53-79--------------------------------------------------------------------------------
A5DEF9_PICGU/49-75--------------------------------------------------------------------------------
Q6BQQ0_DEBHA/25-51--------------------------------------------------------------------------------
Q0UAS9_PHANO/270-296--------------------------------------------------------------------------------
Q29G74_DROPS/3-29--------------------------------------------------------------------------------
A5DJE8_PICGU/264-290--------------------------------------------------------------------------------
Q293S4_DROPS/309-335--------------------------------------------------------------------------------
Q29G74_DROPS/68-94--------------------------------------------------------------------------------
Q29A02_DROPS/400-426--------------------------------------------------------------------------------
Q6BPR8_DEBHA/273-299--------------------------------------------------------------------------------
Q870N3_NEUCS/91-117--------------------------------------------------------------------------------
Q582U2_TRYB2/320-346--------------------------------------------------------------------------------
Q7RIP5_PLAYO/126-152--------------------------------------------------------------------------------
Q59UL8_CANAL/337-363--------------------------------------------------------------------------------
Q5YEU6_BIGNA/3-31--------------------------------------------------------------------------------
Q55IZ7_CRYNB/367-393--------------------------------------------------------------------------------
Q0IFY4_AEDAE/56-82--------------------------------------------------------------------------------
Q54VV0_DICDI/96-122--------------------------------------------------------------------------------
Q5KJJ3_CRYNJ/261-287--------------------------------------------------------------------------------
Q2U5B2_ASPOR/305-331--------------------------------------------------------------------------------
A5DW84_LODEL/48-74--------------------------------------------------------------------------------
Q57Z90_HUMAN/827-853--------------------------------------------------------------------------------
Q6C2A2_YARLI/287-313--------------------------------------------------------------------------------
A7TFN5_VANPO/48-74--------------------------------------------------------------------------------
ZMAT3_HUMAN/245-271--------------------------------------------------------------------------------
Q7S3X8_NEUCR/318-344--------------------------------------------------------------------------------
Q176C4_AEDAE/317-343--------------------------------------------------------------------------------
Q54GN9_DICDI/72-98--------------------------------------------------------------------------------
Q6NUW2_DANRE/80-106--------------------------------------------------------------------------------
O62360_CAEEL/315-341--------------------------------------------------------------------------------
Q292H8_DROPS/200-226--------------------------------------------------------------------------------
Q4RMB3_TETNG/60-86--------------------------------------------------------------------------------
A8BB65_GIAIC/58-84--------------------------------------------------------------------------------
ZN593_HUMAN/60-86--------------------------------------------------------------------------------
A4QNW1_DANRE/833-859--------------------------------------------------------------------------------
A4QP17_DANRE/136-164--------------------------------------------------------------------------------
A7AR58_BABBO/309-335--------------------------------------------------------------------------------
A7TM74_VANPO/361-387--------------------------------------------------------------------------------
A2AN61_MOUSE/604-630--------------------------------------------------------------------------------
Q2QQ93_ORYSJ/309-335--------------------------------------------------------------------------------
Q7S2D3_NEUCR/29-55--------------------------------------------------------------------------------
Q9W0X8_DROME/312-338--------------------------------------------------------------------------------
Q5KL91_CRYNJ/58-84--------------------------------------------------------------------------------
Q9SJL4_ARATH/57-83--------------------------------------------------------------------------------
Q4X9H0_PLACH/26-52--------------------------------------------------------------------------------
Q6FLX1_CANGA/48-74--------------------------------------------------------------------------------
Q4PB66_USTMA/383-409--------------------------------------------------------------------------------
Q8SSM0_ENCCU/179-205--------------------------------------------------------------------------------
JJJ1_YEAST/337-363--------------------------------------------------------------------------------
A7AT41_BABBO/70-96--------------------------------------------------------------------------------
Q2HH90_CHAGB/49-75--------------------------------------------------------------------------------
Q4N239_THEPA/59-86--------------------------------------------------------------------------------
Q4P5I8_USTMA/61-87--------------------------------------------------------------------------------
Q4T408_TETNG/465-491--------------------------------------------------------------------------------
Q7ZZ49_DANRE/53-79--------------------------------------------------------------------------------
A0DPA0_PARTE/59-85--------------------------------------------------------------------------------
Q5DDM6_SCHJA/51-77--------------------------------------------------------------------------------
Q4SQE0_TETNG/196-222--------------------------------------------------------------------------------
Q18037_CAEEL/70-96--------------------------------------------------------------------------------
PRP9_YEAST/279-305--------------------------------------------------------------------------------
Z231_ENCCU/55-81--------------------------------------------------------------------------------
ZMAT3_MOUSE/147-173--------------------------------------------------------------------------------
C5PFT8_COCP7/46-72--------------------------------------------------------------------------------
Q55EN0_DICDI/722-749--------------------------------------------------------------------------------
Q6CQ57_KLULA/344-370--------------------------------------------------------------------------------
Q4SLK6_TETNG/45-71--------------------------------------------------------------------------------
ZMAT4_BOVIN/144-170--------------------------------------------------------------------------------
Q5I094_XENTR/66-92--------------------------------------------------------------------------------
A6RA79_AJECN/90-116--------------------------------------------------------------------------------
A0DLK5_PARTE/243-269--------------------------------------------------------------------------------
Q4E5J1_TRYCC/13-39--------------------------------------------------------------------------------
Q4SJL2_TETNG/244-270--------------------------------------------------------------------------------
Q2H3Q5_CHAGB/22-50--------------------------------------------------------------------------------
Q4QDW6_LEIMA/18-44--------------------------------------------------------------------------------
Q54EG2_DICDI/456-482--------------------------------------------------------------------------------
Q5CUH6_CRYPI/74-101--------------------------------------------------------------------------------
Q4E2J2_TRYCC/320-346--------------------------------------------------------------------------------
Q17FL5_AEDAE/69-95--------------------------------------------------------------------------------
ZN830_DANRE/47-73--------------------------------------------------------------------------------
A8B9I4_GIAIC/27-53--------------------------------------------------------------------------------
Q4PBS4_USTMA/93-119--------------------------------------------------------------------------------
Q1RLA2_CIOIN/312-338--------------------------------------------------------------------------------
Q59YK2_CANAL/268-294--------------------------------------------------------------------------------
A0CIK9_PARTE/301-327--------------------------------------------------------------------------------
Q5JLF0_ORYSJ/43-70--------------------------------------------------------------------------------
Q9VX08_DROME/68-94--------------------------------------------------------------------------------
A7SMU1_NEMVE/58-84--------------------------------------------------------------------------------
Q9LEN7_CICAR/3-29--------------------------------------------------------------------------------
Q4Q9L8_LEIMA/321-347--------------------------------------------------------------------------------
Q015T5_OSTTA/211-237--------------------------------------------------------------------------------
Q8IH78_DROME/301-327--------------------------------------------------------------------------------
Q9SJL4_ARATH/137-163--------------------------------------------------------------------------------
A7ATF0_BABBO/97-123--------------------------------------------------------------------------------
A7F0C9_SCLS1/39-65--------------------------------------------------------------------------------
A7RTE1_NEMVE/298-324--------------------------------------------------------------------------------
MU185_SCHPO/269-295--------------------------------------------------------------------------------
Q86ZK1_PODAS/49-75--------------------------------------------------------------------------------
Q16M83_AEDAE/53-79--------------------------------------------------------------------------------
Q0U7N1_PHANO/50-76--------------------------------------------------------------------------------
Q5XGS1_XENLA/60-86--------------------------------------------------------------------------------
Q9VEF0_DROME/321-347--------------------------------------------------------------------------------
BUD20_SCHPO/55-81--------------------------------------------------------------------------------
Q17L08_AEDAE/394-420--------------------------------------------------------------------------------
A2EI42_TRIVA/279-305--------------------------------------------------------------------------------
Q5ARM0_EMENI/294-320--------------------------------------------------------------------------------
Q8I158_DROPS/218-244--------------------------------------------------------------------------------
Q7EZL0_ORYSJ/94-120--------------------------------------------------------------------------------
A5E2D1_LODEL/294-320--------------------------------------------------------------------------------
Q5B9R2_EMENI/112-138--------------------------------------------------------------------------------
Q23MN1_TETTS/59-85--------------------------------------------------------------------------------
A6ST71_BOTFB/103-129--------------------------------------------------------------------------------
ZN830_XENLA/44-70--------------------------------------------------------------------------------
Q4DXJ0_TRYCC/67-93--------------------------------------------------------------------------------
A3LQT9_PICST/334-360--------------------------------------------------------------------------------
Q6CEI7_YARLI/299-325--------------------------------------------------------------------------------
A2QSF5_ASPNC/213-239--------------------------------------------------------------------------------
Q75E64_ASHGO/334-360--------------------------------------------------------------------------------
Q0U7P4_PHANO/313-339--------------------------------------------------------------------------------
Q6PBI1_DANRE/23-49--------------------------------------------------------------------------------
Q9C911_ARATH/307-333--------------------------------------------------------------------------------
ZN593_DICDI/59-85--------------------------------------------------------------------------------
Q86B18_DICDI/136-162--------------------------------------------------------------------------------
Q7SXB6_DANRE/224-250--------------------------------------------------------------------------------
A2DYJ8_TRIVA/267-293--------------------------------------------------------------------------------
SAP61_SCHPO/242-268--------------------------------------------------------------------------------
A3LZB0_PICST/289-315--------------------------------------------------------------------------------
A6R6K6_AJECN/46-72--------------------------------------------------------------------------------
Q6FNA1_CANGA/284-310--------------------------------------------------------------------------------
Q16QC5_AEDAE/315-341--------------------------------------------------------------------------------
Q29JJ2_DROPS/58-84--------------------------------------------------------------------------------
Q6C988_YARLI/43-69--------------------------------------------------------------------------------
Q6FP17_CANGA/362-388--------------------------------------------------------------------------------
Q5BW97_SCHJA/120-146--------------------------------------------------------------------------------
Q7S4W2_NEUCR/49-75--------------------------------------------------------------------------------
A7RQ90_NEMVE/279-305--------------------------------------------------------------------------------
Q6BVL1_DEBHA/48-74--------------------------------------------------------------------------------

PF12874

B6KBH5_TOXGO/215-240--------------------------------------------------------------------------------
ZMAT3_HUMAN/246-270--------------------------------------------------------------------------------
Q4WWC2_ASPFU/201-225--------------------------------------------------------------------------------
Q8IH78_DROME/239-263--------------------------------------------------------------------------------
C1E4I6_MICSR/103-127--------------------------------------------------------------------------------
B9IFT9_POPTR/52-76--------------------------------------------------------------------------------
B3S6Z2_TRIAD/81-105--------------------------------------------------------------------------------
Z385B_MOUSE/360-384--------------------------------------------------------------------------------
A5WV30_DANRE/319-343--------------------------------------------------------------------------------
Q8S8S8_ARATH/95-119--------------------------------------------------------------------------------
Q8H6R5_PONTR/36-60--------------------------------------------------------------------------------
A5AFF5_VITVI/1032-1056--------------------------------------------------------------------------------
C1G8P3_PARBD/92-116--------------------------------------------------------------------------------
Q4P204_USTMA/128-152--------------------------------------------------------------------------------
B4LGR5_DROVI/253-277--------------------------------------------------------------------------------
B6U265_MAIZE/419-443--------------------------------------------------------------------------------
Q29KR4_DROPS/494-518--------------------------------------------------------------------------------
B7Q5C0_IXOSC/746-770--------------------------------------------------------------------------------
B9G3M7_ORYSJ/268-292--------------------------------------------------------------------------------
Q18037_CAEEL/71-95--------------------------------------------------------------------------------
ZMAT3_HUMAN/70-94--------------------------------------------------------------------------------
Q4RW00_TETNG/158-182--------------------------------------------------------------------------------
Q67UQ0_ORYSJ/224-248--------------------------------------------------------------------------------
ZFHX4_CHICK/695-719--------------------------------------------------------------------------------
B4F8C1_MAIZE/192-216--------------------------------------------------------------------------------
A9UN71_DROME/40-64--------------------------------------------------------------------------------
A5BU19_VITVI/6-30--------------------------------------------------------------------------------
Q5C3I7_SCHJA/11-35--------------------------------------------------------------------------------
ZMAT1_XENTR/223-247--------------------------------------------------------------------------------
A6ZXU1_YEAS7/280-304--------------------------------------------------------------------------------
O82231_ARATH/370-394--------------------------------------------------------------------------------
B3LW17_DROAN/320-344--------------------------------------------------------------------------------
A3BYY1_ORYSJ/176-200--------------------------------------------------------------------------------
B4FTM2_MAIZE/297-321--------------------------------------------------------------------------------
B7FVC6_PHATC/980-1004--------------------------------------------------------------------------------
Q4UEZ1_THEAN/55-79--------------------------------------------------------------------------------
B9GH74_POPTR/294-318--------------------------------------------------------------------------------
B2GUK9_XENTR/172-196--------------------------------------------------------------------------------
ZMAT4_BOVIN/14-38--------------------------------------------------------------------------------
Q4SKX5_TETNG/257-281--------------------------------------------------------------------------------
B3MSY7_DROAN/311-335--------------------------------------------------------------------------------
ZN346_HUMAN/73-97--------------------------------------------------------------------------------
B5FYA4_TAEGU/168-192--------------------------------------------------------------------------------
B3NEP7_DROER/160-184--------------------------------------------------------------------------------
A2YT99_ORYSI/143-167--------------------------------------------------------------------------------
Q6C2A9_YARLI/35-59--------------------------------------------------------------------------------
A5C9S0_VITVI/187-211--------------------------------------------------------------------------------
A6R1M5_AJECN/330-354--------------------------------------------------------------------------------
Q69P59_ORYSJ/155-179--------------------------------------------------------------------------------
B4HVF7_DROSE/199-223--------------------------------------------------------------------------------
Q84RJ5_ARATH/213-237--------------------------------------------------------------------------------
A3BYY2_ORYSJ/218-242--------------------------------------------------------------------------------
A9UM17_XENLA/274-298--------------------------------------------------------------------------------
B4MGB8_DROVI/281-305--------------------------------------------------------------------------------
Q5APP1_CANAL/55-79--------------------------------------------------------------------------------
A7E7B8_SCLS1/54-78--------------------------------------------------------------------------------
A8P3U0_BRUMA/294-318--------------------------------------------------------------------------------
Q4SZX1_TETNG/32-56--------------------------------------------------------------------------------
ZN346_MOUSE/134-158--------------------------------------------------------------------------------
B9RFH7_RICCO/83-107--------------------------------------------------------------------------------
Q4SQD0_TETNG/1-25--------------------------------------------------------------------------------
B4KKQ9_DROMO/629-653--------------------------------------------------------------------------------
A8BQ93_GIAIC/374-398--------------------------------------------------------------------------------
A4HHA1_LEIBR/161-185--------------------------------------------------------------------------------
B4M422_DROVI/355-378--------------------------------------------------------------------------------
C4JBJ4_MAIZE/533-557--------------------------------------------------------------------------------
Q8SXJ5_DROME/283-307--------------------------------------------------------------------------------
B4GMZ8_DROPE/296-320--------------------------------------------------------------------------------
B0WTB0_CULQU/88-112--------------------------------------------------------------------------------
B4F7C6_RAT/145-169--------------------------------------------------------------------------------
O64571_ARATH/85-109--------------------------------------------------------------------------------
A3C5W8_ORYSJ/194-218--------------------------------------------------------------------------------
A9RB22_PHYPA/177-201--------------------------------------------------------------------------------
Q0U7P4_PHANO/314-338--------------------------------------------------------------------------------
ZN346_DANRE/117-141--------------------------------------------------------------------------------
B4PBY0_DROYA/315-339--------------------------------------------------------------------------------
Z385B_MOUSE/34-58--------------------------------------------------------------------------------
B4K566_DROMO/337-361--------------------------------------------------------------------------------
C3YMZ5_BRAFL/5-29--------------------------------------------------------------------------------
C4M599_ENTHI/69-93--------------------------------------------------------------------------------
B9RX76_RICCO/326-350--------------------------------------------------------------------------------
A9ULH3_XENTR/151-175--------------------------------------------------------------------------------
Q17L08_AEDAE/190-214--------------------------------------------------------------------------------
B2RXS3_MOUSE/785-809--------------------------------------------------------------------------------
Q7PYV1_ANOGA/67-91--------------------------------------------------------------------------------
B4FE91_MAIZE/427-451--------------------------------------------------------------------------------
C0NRC2_AJECG/191-215--------------------------------------------------------------------------------
A2BGG2_DANRE/378-402--------------------------------------------------------------------------------
A6ZXT2_YEAS7/66-90--------------------------------------------------------------------------------
B3LXE1_DROAN/322-346--------------------------------------------------------------------------------
B8MAT8_TALSN/253-277--------------------------------------------------------------------------------
Q94HR5_ORYSJ/278-302--------------------------------------------------------------------------------
Q4QDW6_LEIMA/19-43--------------------------------------------------------------------------------
SAP61_SCHPO/243-267--------------------------------------------------------------------------------
Q580U5_TRYB2/55-79--------------------------------------------------------------------------------
C4J970_MAIZE/199-223--------------------------------------------------------------------------------
ZN346_XENLA/400-424--------------------------------------------------------------------------------
B8BB40_ORYSI/229-253--------------------------------------------------------------------------------
Q4V8W9_DANRE/27-51--------------------------------------------------------------------------------
A9V6C8_MONBE/133-157--------------------------------------------------------------------------------
B6H9D4_PENCW/13-37--------------------------------------------------------------------------------
Q4V8W9_DANRE/158-182--------------------------------------------------------------------------------
B7FRV3_PHATC/200-224--------------------------------------------------------------------------------
A5E2D1_LODEL/295-319--------------------------------------------------------------------------------
B8BWM0_THAPS/308-332--------------------------------------------------------------------------------
ZN346_XENLA/95-119--------------------------------------------------------------------------------
B4JE80_DROGR/514-538--------------------------------------------------------------------------------
B4HWT1_DROSE/533-557--------------------------------------------------------------------------------
A5C9S0_VITVI/96-120--------------------------------------------------------------------------------
B0WBY3_CULQU/321-345--------------------------------------------------------------------------------
Q5BW97_SCHJA/121-145--------------------------------------------------------------------------------
A1CM28_ASPCL/406-430--------------------------------------------------------------------------------
Q2F5Z3_BOMMO/189-213--------------------------------------------------------------------------------
Q4TFH0_TETNG/64-88--------------------------------------------------------------------------------
B0D0A4_LACBS/71-95--------------------------------------------------------------------------------
C1EBK7_MICSR/301-325--------------------------------------------------------------------------------
B3RS99_TRIAD/158-182--------------------------------------------------------------------------------
Q23JA5_TETTS/306-330--------------------------------------------------------------------------------
B4NET1_DROWI/121-145--------------------------------------------------------------------------------
Q54GN9_DICDI/73-97--------------------------------------------------------------------------------
A5DJE8_PICGU/265-289--------------------------------------------------------------------------------
B4P0S1_DROYA/465-489--------------------------------------------------------------------------------
B9WHC0_CANDC/416-441--------------------------------------------------------------------------------
A2YT99_ORYSI/46-70--------------------------------------------------------------------------------
A7RQ90_NEMVE/52-76--------------------------------------------------------------------------------
Q9VGR8_DROME/573-597--------------------------------------------------------------------------------
B6JW10_SCHJY/229-253--------------------------------------------------------------------------------
C4QVN0_PICPG/54-78--------------------------------------------------------------------------------
A7RG76_NEMVE/20-44--------------------------------------------------------------------------------
Q29GZ8_DROPS/528-550--------------------------------------------------------------------------------
C0P658_MAIZE/242-266--------------------------------------------------------------------------------
A9JST7_DANRE/77-101--------------------------------------------------------------------------------
A4S878_OSTLU/97-121--------------------------------------------------------------------------------
Z385C_HUMAN/221-245--------------------------------------------------------------------------------
B8AAR8_ORYSI/94-118--------------------------------------------------------------------------------
Q2F5Z3_BOMMO/270-294--------------------------------------------------------------------------------
A4I4E7_LEIIN/161-185--------------------------------------------------------------------------------
C5L1U6_PERM5/99-123--------------------------------------------------------------------------------
ZMAT1_HUMAN/56-80--------------------------------------------------------------------------------
Q109V1_ORYSJ/139-163--------------------------------------------------------------------------------
C5M3Y8_CANTT/327-351--------------------------------------------------------------------------------
A3BE51_ORYSJ/334-358--------------------------------------------------------------------------------
A3BYY1_ORYSJ/308-332--------------------------------------------------------------------------------
A5DEF9_PICGU/50-74--------------------------------------------------------------------------------
A9VAE8_MONBE/371-395--------------------------------------------------------------------------------
Q29AF2_DROPS/328-352--------------------------------------------------------------------------------
ZN346_DANRE/180-204--------------------------------------------------------------------------------
B3S237_TRIAD/260-284--------------------------------------------------------------------------------
B9SJB7_RICCO/132-156--------------------------------------------------------------------------------
B9HN84_POPTR/373-397--------------------------------------------------------------------------------
A8PTD6_BRUMA/5-29--------------------------------------------------------------------------------
Q7S3X8_NEUCR/319-343--------------------------------------------------------------------------------
Q2GS44_CHAGB/88-112--------------------------------------------------------------------------------
B9STT6_RICCO/209-233--------------------------------------------------------------------------------
Q4XLH6_PLACH/54-78--------------------------------------------------------------------------------
B6SGD7_MAIZE/64-88--------------------------------------------------------------------------------
Q7QGK0_ANOGA/83-107--------------------------------------------------------------------------------
Q582U2_TRYB2/321-345--------------------------------------------------------------------------------
B8BHK4_ORYSI/228-252--------------------------------------------------------------------------------
B3S8D2_TRIAD/554-578--------------------------------------------------------------------------------
A3LZB0_PICST/290-314--------------------------------------------------------------------------------
ZMAT1_HUMAN/121-145--------------------------------------------------------------------------------
A2YT99_ORYSI/235-259--------------------------------------------------------------------------------
B9RX77_RICCO/251-275--------------------------------------------------------------------------------
B4Q9R2_DROSI/477-501--------------------------------------------------------------------------------
B4F8C1_MAIZE/290-314--------------------------------------------------------------------------------
B4H133_DROPE/218-242--------------------------------------------------------------------------------
B3P0F7_DROER/385-409--------------------------------------------------------------------------------
B4FE91_MAIZE/249-273--------------------------------------------------------------------------------
B6UCD9_MAIZE/36-60--------------------------------------------------------------------------------
A7RRM2_NEMVE/192-216--------------------------------------------------------------------------------
B9STT6_RICCO/343-367--------------------------------------------------------------------------------
Q16QC5_AEDAE/229-253--------------------------------------------------------------------------------
Q5C382_SCHJA/121-145--------------------------------------------------------------------------------
Q7S742_NEUCR/26-50--------------------------------------------------------------------------------
C5FJD4_ARTOC/95-119--------------------------------------------------------------------------------
B4FE91_MAIZE/196-220--------------------------------------------------------------------------------
A4HEC3_LEIBR/322-346--------------------------------------------------------------------------------
YJVF_SCHPO/68-94--------------------------------------------------------------------------------
B4NET1_DROWI/312-336--------------------------------------------------------------------------------
C5DR32_ZYGRC/65-89--------------------------------------------------------------------------------
B3LXS7_DROAN/245-269--------------------------------------------------------------------------------
A8XZP3_CAEBR/384-408--------------------------------------------------------------------------------
B9QQ05_TOXGO/382-406--------------------------------------------------------------------------------
B4M0Z5_DROVI/331-355--------------------------------------------------------------------------------
Q4E2J2_TRYCC/321-345--------------------------------------------------------------------------------
B9RX76_RICCO/249-273--------------------------------------------------------------------------------
B0EGW2_ENTDS/68-92--------------------------------------------------------------------------------
C5LSG1_PERM5/85-109--------------------------------------------------------------------------------
ZN346_MOUSE/185-209--------------------------------------------------------------------------------
B8BF99_ORYSI/164-188--------------------------------------------------------------------------------
A9SHF2_PHYPA/134-159--------------------------------------------------------------------------------
B4GMN2_DROPE/219-243--------------------------------------------------------------------------------
B5DNF8_DROPS/134-158--------------------------------------------------------------------------------
A6RFN9_AJECN/65-91--------------------------------------------------------------------------------
Q69P59_ORYSJ/415-439--------------------------------------------------------------------------------
B6HEZ3_PENCW/308-332--------------------------------------------------------------------------------
A7RQ90_NEMVE/118-142--------------------------------------------------------------------------------
B3RS34_TRIAD/3-27--------------------------------------------------------------------------------
B9GH74_POPTR/470-494--------------------------------------------------------------------------------
Z385C_MOUSE/77-101--------------------------------------------------------------------------------
C4V8W2_NOSCE/159-183--------------------------------------------------------------------------------
A8PKW3_BRUMA/341-365--------------------------------------------------------------------------------
Q69P58_ORYSJ/288-312--------------------------------------------------------------------------------
B4HWT1_DROSE/623-647--------------------------------------------------------------------------------
C4YR79_CANAW/269-293--------------------------------------------------------------------------------
Q1RL81_CIOIN/167-191--------------------------------------------------------------------------------
Q4S9C2_TETNG/381-405--------------------------------------------------------------------------------
Q5CRF6_CRYPI/334-358--------------------------------------------------------------------------------
B9HN84_POPTR/468-492--------------------------------------------------------------------------------
Q5ARM0_EMENI/295-319--------------------------------------------------------------------------------
O64571_ARATH/154-178--------------------------------------------------------------------------------
C4LWB5_ENTHI/352-376--------------------------------------------------------------------------------
C1EIE1_MICSR/172-196--------------------------------------------------------------------------------
B4M0K5_DROVI/342-366--------------------------------------------------------------------------------
B2VWQ1_PYRTR/82-106--------------------------------------------------------------------------------
B6Q556_PENMQ/72-96--------------------------------------------------------------------------------
B2WHT3_PYRTR/250-274--------------------------------------------------------------------------------
Q6YX02_ORYSJ/86-110--------------------------------------------------------------------------------
Q7ZZ44_DANRE/34-58--------------------------------------------------------------------------------
C5LSG1_PERM5/32-56--------------------------------------------------------------------------------
C5LQW5_PERM5/229-254--------------------------------------------------------------------------------
B4FQZ1_MAIZE/79-103--------------------------------------------------------------------------------
A8XTK0_CAEBR/153-177--------------------------------------------------------------------------------
C4LYX8_ENTHI/53-77--------------------------------------------------------------------------------
Q9FNP6_ARATH/464-488--------------------------------------------------------------------------------
Q8SX40_DROME/397-421--------------------------------------------------------------------------------
B9H6T1_POPTR/86-110--------------------------------------------------------------------------------
Q9FNP6_ARATH/702-726--------------------------------------------------------------------------------
B0WZH2_CULQU/437-461--------------------------------------------------------------------------------
B0WL11_CULQU/52-76--------------------------------------------------------------------------------
A7RJ77_NEMVE/418-442--------------------------------------------------------------------------------
A2A5E7_MOUSE/42-66--------------------------------------------------------------------------------
A2EKF0_TRIVA/73-97--------------------------------------------------------------------------------
B4R6Q1_DROSI/69-93--------------------------------------------------------------------------------
C4M2V0_ENTHI/301-325--------------------------------------------------------------------------------
Q5C382_SCHJA/11-35--------------------------------------------------------------------------------
B4H133_DROPE/289-313--------------------------------------------------------------------------------
A3LZB0_PICST/433-458--------------------------------------------------------------------------------
C0P658_MAIZE/308-332--------------------------------------------------------------------------------
B4NET1_DROWI/389-413--------------------------------------------------------------------------------
A8J846_CHLRE/257-281--------------------------------------------------------------------------------
B9RX76_RICCO/476-500--------------------------------------------------------------------------------
Z385D_HUMAN/80-104--------------------------------------------------------------------------------
B0DAI2_LACBS/314-338--------------------------------------------------------------------------------
A7TH30_VANPO/80-104--------------------------------------------------------------------------------
B7G055_PHATC/409-433--------------------------------------------------------------------------------
B9RX75_RICCO/313-337--------------------------------------------------------------------------------
C5KS73_PERM5/148-172--------------------------------------------------------------------------------
Q16VV5_AEDAE/41-65--------------------------------------------------------------------------------
Q5KMT0_CRYNJ/65-89--------------------------------------------------------------------------------
B5RSS5_DEBHA/330-354--------------------------------------------------------------------------------
B9S303_RICCO/37-61--------------------------------------------------------------------------------
B7PQE6_IXOSC/189-213--------------------------------------------------------------------------------
B0WTK3_CULQU/301-325--------------------------------------------------------------------------------
B6TYA2_MAIZE/282-306--------------------------------------------------------------------------------
Q4TB69_TETNG/115-139--------------------------------------------------------------------------------
Q4S950_TETNG/354-378--------------------------------------------------------------------------------
A5B0X8_VITVI/594-618--------------------------------------------------------------------------------
A0DLK5_PARTE/244-268--------------------------------------------------------------------------------
B9RX75_RICCO/234-257--------------------------------------------------------------------------------
ZN830_MOUSE/51-75--------------------------------------------------------------------------------
Q55JG7_CRYNB/94-118--------------------------------------------------------------------------------
Q586K6_TRYB2/27-51--------------------------------------------------------------------------------
B0WUZ5_CULQU/141-163--------------------------------------------------------------------------------
ZMAT1_XENTR/61-85--------------------------------------------------------------------------------
A5B0X8_VITVI/431-455--------------------------------------------------------------------------------
B4JE80_DROGR/597-621--------------------------------------------------------------------------------
B7PQE6_IXOSC/64-88--------------------------------------------------------------------------------
A9UNU5_MONBE/72-96--------------------------------------------------------------------------------
C5L3J8_PERM5/353-377--------------------------------------------------------------------------------
A4S878_OSTLU/45-69--------------------------------------------------------------------------------
C4Y405_CLAL4/265-289--------------------------------------------------------------------------------
B8CDH8_THAPS/129-153--------------------------------------------------------------------------------
Q55CK7_DICDI/279-303--------------------------------------------------------------------------------
B9SJB7_RICCO/37-61--------------------------------------------------------------------------------
A7RL73_NEMVE/31-55--------------------------------------------------------------------------------
A8XTK0_CAEBR/200-224--------------------------------------------------------------------------------
B4NB08_DROWI/306-330--------------------------------------------------------------------------------
Q9FNP7_ARATH/313-337--------------------------------------------------------------------------------
B0YCU3_ASPFC/422-446--------------------------------------------------------------------------------
A7RQ90_NEMVE/196-220--------------------------------------------------------------------------------
A5DJE8_PICGU/403-428--------------------------------------------------------------------------------
Q170B1_AEDAE/873-897--------------------------------------------------------------------------------
B9RX76_RICCO/949-973--------------------------------------------------------------------------------
Q6BPR8_DEBHA/274-298--------------------------------------------------------------------------------
B6A9C8_CRYMR/299-323--------------------------------------------------------------------------------
B4JYX2_DROGR/390-414--------------------------------------------------------------------------------
B4L7M9_DROMO/172-196--------------------------------------------------------------------------------
A2DA83_TRIVA/53-77--------------------------------------------------------------------------------
SAP62_SCHPO/54-78--------------------------------------------------------------------------------
A3BYY1_ORYSJ/252-276--------------------------------------------------------------------------------
B9RX77_RICCO/23-47--------------------------------------------------------------------------------
C1N5T0_MICPC/171-194--------------------------------------------------------------------------------
C3YMZ5_BRAFL/117-141--------------------------------------------------------------------------------
C5L6I9_PERM5/21-45--------------------------------------------------------------------------------
B4LZG0_DROVI/310-335--------------------------------------------------------------------------------
C5MGT4_CANTT/263-287--------------------------------------------------------------------------------
B0EPX1_ENTDS/63-87--------------------------------------------------------------------------------
A8QBW4_MALGO/267-291--------------------------------------------------------------------------------
Q54VV0_DICDI/97-121--------------------------------------------------------------------------------
B9GH74_POPTR/372-396--------------------------------------------------------------------------------
B9RX75_RICCO/551-575--------------------------------------------------------------------------------
Q23RJ7_TETTS/75-99--------------------------------------------------------------------------------
Q9FNP6_ARATH/297-321--------------------------------------------------------------------------------
Q7QGK0_ANOGA/176-200--------------------------------------------------------------------------------
Q4PB66_USTMA/384-408--------------------------------------------------------------------------------
B0XFV6_CULQU/423-447--------------------------------------------------------------------------------
A2QJC1_ASPNC/220-244--------------------------------------------------------------------------------
C1EIA3_MICSR/913-937--------------------------------------------------------------------------------
B4M0K8_DROVI/386-410--------------------------------------------------------------------------------
C1MPY0_MICPC/106-130--------------------------------------------------------------------------------
Q6C2A2_YARLI/288-312--------------------------------------------------------------------------------
C4XWG5_CLAL4/333-357--------------------------------------------------------------------------------
B9RX77_RICCO/103-127--------------------------------------------------------------------------------
A5B8B1_VITVI/424-448--------------------------------------------------------------------------------
C3Y243_BRAFL/963-987--------------------------------------------------------------------------------
C3ZEF1_BRAFL/160-184--------------------------------------------------------------------------------
B9RX77_RICCO/347-371--------------------------------------------------------------------------------
B9RX77_RICCO/175-199--------------------------------------------------------------------------------
Z385C_MOUSE/297-321--------------------------------------------------------------------------------
A7T2Q3_NEMVE/62-86--------------------------------------------------------------------------------
Q6C7S9_YARLI/39-63--------------------------------------------------------------------------------
Q2U5B2_ASPOR/306-330--------------------------------------------------------------------------------
A7AUL0_BABBO/54-78--------------------------------------------------------------------------------
O64571_ARATH/224-248--------------------------------------------------------------------------------
Q4STD2_TETNG/317-341--------------------------------------------------------------------------------
C1BU26_9MAXI/277-301--------------------------------------------------------------------------------
A7AR58_BABBO/310-334--------------------------------------------------------------------------------
MU185_SCHPO/270-294--------------------------------------------------------------------------------
Q1RLA2_CIOIN/313-337--------------------------------------------------------------------------------
C0P658_MAIZE/177-201--------------------------------------------------------------------------------
A0CIK9_PARTE/302-326--------------------------------------------------------------------------------
C0P658_MAIZE/350-374--------------------------------------------------------------------------------
B3MS65_DROAN/69-93--------------------------------------------------------------------------------
Q1RLE6_CIOIN/65-89--------------------------------------------------------------------------------
Q6FMS8_CANGA/25-49--------------------------------------------------------------------------------
B4NJW2_DROWI/63-87--------------------------------------------------------------------------------
STPAP_RAT/16-40--------------------------------------------------------------------------------
A8PKW3_BRUMA/296-320--------------------------------------------------------------------------------
B9MWW2_POPTR/290-314--------------------------------------------------------------------------------
B9GH74_POPTR/534-558--------------------------------------------------------------------------------
Q0CBC9_ASPTN/312-336--------------------------------------------------------------------------------
Q4PBS4_USTMA/94-118--------------------------------------------------------------------------------
ZMAT1_XENTR/125-149--------------------------------------------------------------------------------
Q5BVZ3_SCHJA/193-217--------------------------------------------------------------------------------
A8N6P2_COPC7/75-99--------------------------------------------------------------------------------
Q23U22_TETTS/26-50--------------------------------------------------------------------------------
B9RLP0_RICCO/273-297--------------------------------------------------------------------------------
C4QYP7_PICPG/265-289--------------------------------------------------------------------------------
C3YMZ5_BRAFL/66-90--------------------------------------------------------------------------------
C5KZK3_PERM5/69-93--------------------------------------------------------------------------------
Q3LVY8_BIGNA/48-72--------------------------------------------------------------------------------
C4R555_PICPG/270-294--------------------------------------------------------------------------------
Q9FNP7_ARATH/267-290--------------------------------------------------------------------------------
B4LZG1_DROVI/319-343--------------------------------------------------------------------------------
B9SMZ5_RICCO/192-216--------------------------------------------------------------------------------
Q4SPY2_TETNG/150-174--------------------------------------------------------------------------------
Q6BPR8_DEBHA/421-446--------------------------------------------------------------------------------
B4JLK3_DROGR/291-315--------------------------------------------------------------------------------
C4JBJ4_MAIZE/423-447--------------------------------------------------------------------------------
B6AIA4_CRYMR/54-78--------------------------------------------------------------------------------
Q1RL91_CIOIN/857-881--------------------------------------------------------------------------------
B2B675_PODAN/250-274--------------------------------------------------------------------------------
Q4V8W9_DANRE/111-135--------------------------------------------------------------------------------
A8PYP7_MALGO/63-87--------------------------------------------------------------------------------
B0WUU3_CULQU/233-257--------------------------------------------------------------------------------
C5M698_CANTT/92-116--------------------------------------------------------------------------------
Q0UAS9_PHANO/271-295--------------------------------------------------------------------------------
B3NEP7_DROER/303-327--------------------------------------------------------------------------------
Q01A69_OSTTA/509-533--------------------------------------------------------------------------------
B4NKZ6_DROWI/327-351--------------------------------------------------------------------------------
Q7QGK0_ANOGA/18-42--------------------------------------------------------------------------------
A8Q0H9_BRUMA/51-75--------------------------------------------------------------------------------
A5ABL9_ASPNC/75-99--------------------------------------------------------------------------------
Q7Q167_ANOGA/318-342--------------------------------------------------------------------------------
B5DXP2_DROPS/12-36--------------------------------------------------------------------------------
B5DXH0_DROPS/307-331--------------------------------------------------------------------------------
Q4S9C2_TETNG/148-172--------------------------------------------------------------------------------
A4RW02_OSTLU/101-125--------------------------------------------------------------------------------
Q4P183_USTMA/296-320--------------------------------------------------------------------------------
A5DJ70_PICGU/55-79--------------------------------------------------------------------------------
B3LXH0_DROAN/286-310--------------------------------------------------------------------------------
A8Q0Y9_MALGO/353-377--------------------------------------------------------------------------------
B7PBQ8_IXOSC/83-107--------------------------------------------------------------------------------
B9RX75_RICCO/455-479--------------------------------------------------------------------------------
Q6CEI7_YARLI/300-324--------------------------------------------------------------------------------
B3RL33_TRIAD/84-108--------------------------------------------------------------------------------

PF13912

Q6QI63_RAT/176-202--------------------------------------------------------------------------------
Q7PW75_ANOGA/686-712--------------------------------------------------------------------------------
Q7PW75_ANOGA/1151-1177--------------------------------------------------------------------------------
D2KMS9_DANRE/91-117--------------------------------------------------------------------------------
D2KMS9_DANRE/456-482--------------------------------------------------------------------------------
FOG1_DANRE/34-60--------------------------------------------------------------------------------
FOG1_DANRE/167-193--------------------------------------------------------------------------------
B4Q650_DROSI/280-306--------------------------------------------------------------------------------
B4Q650_DROSI/602-628--------------------------------------------------------------------------------
Q4S661_TETNG/8-34--------------------------------------------------------------------------------
Q4S661_TETNG/401-427--------------------------------------------------------------------------------
A5GFU9_PIG/30-56--------------------------------------------------------------------------------
A5GFU9_PIG/424-450--------------------------------------------------------------------------------
B5DFF6_RAT/29-56--------------------------------------------------------------------------------
D2GWM2_AILME/148-174--------------------------------------------------------------------------------
A2BE84_DANRE/47-75--------------------------------------------------------------------------------
C3XQD1_BRAFL/46-72--------------------------------------------------------------------------------
ZN574_XENTR/98-124--------------------------------------------------------------------------------
Q1RLR5_DANRE/47-75--------------------------------------------------------------------------------
Q4H2I9_CIOIN/68-94--------------------------------------------------------------------------------
B4QUV3_DROSI/306-333--------------------------------------------------------------------------------
Q4RJI8_TETNG/55-82--------------------------------------------------------------------------------
Q9C538_ARATH/192-218--------------------------------------------------------------------------------
C5Y1I0_SORBI/262-289--------------------------------------------------------------------------------
E4F1_DANRE/35-61--------------------------------------------------------------------------------
B9GEM8_POPTR/67-93--------------------------------------------------------------------------------
B9GEM8_POPTR/435-461--------------------------------------------------------------------------------
B9RLS0_RICCO/380-406--------------------------------------------------------------------------------
C0PPD2_MAIZE/94-120--------------------------------------------------------------------------------
C0PPD2_MAIZE/153-179--------------------------------------------------------------------------------
A2CE94_DANRE/39-67--------------------------------------------------------------------------------
ZN423_DANRE/75-101--------------------------------------------------------------------------------
A2XJH1_ORYSI/88-114--------------------------------------------------------------------------------
A7MD94_DANRE/44-72--------------------------------------------------------------------------------
Q3S409_CALVI/80-106--------------------------------------------------------------------------------
Q9VNI5_DROME/64-90--------------------------------------------------------------------------------
B0WBE1_CULQU/683-709--------------------------------------------------------------------------------
Q9D7X0_MOUSE/94-122--------------------------------------------------------------------------------
C5XD44_SORBI/154-180--------------------------------------------------------------------------------
Q3UXX7_MOUSE/189-215--------------------------------------------------------------------------------
Q4T3M3_TETNG/1379-1405--------------------------------------------------------------------------------
ZAT2_ARATH/64-90--------------------------------------------------------------------------------
C5X031_SORBI/183-209--------------------------------------------------------------------------------
C4J8V9_MAIZE/93-119--------------------------------------------------------------------------------
B9R9U7_RICCO/156-182--------------------------------------------------------------------------------
C6TAQ4_SOYBN/126-152--------------------------------------------------------------------------------
B9GDY3_ORYSJ/117-143--------------------------------------------------------------------------------
Q7SYC8_DANRE/74-100--------------------------------------------------------------------------------
Q6K9W9_ORYSJ/231-257--------------------------------------------------------------------------------
Q4T246_TETNG/144-170--------------------------------------------------------------------------------
A2WWT8_ORYSI/42-68--------------------------------------------------------------------------------
O04176_BRACM/89-115--------------------------------------------------------------------------------
A7J146_BRACI/90-116--------------------------------------------------------------------------------
D2HPB1_AILME/96-124--------------------------------------------------------------------------------
C5WVL8_SORBI/99-125--------------------------------------------------------------------------------
Q9FH19_ARATH/410-436--------------------------------------------------------------------------------
C3ZBH5_BRAFL/1794-1820--------------------------------------------------------------------------------
Q174R3_AEDAE/151-177--------------------------------------------------------------------------------
B1Q4T8_BRUGY/91-117--------------------------------------------------------------------------------
Q28BY5_XENTR/395-421--------------------------------------------------------------------------------
B7PA98_IXOSC/8-34--------------------------------------------------------------------------------
Q4S2L0_TETNG/438-464--------------------------------------------------------------------------------
C3YFG6_BRAFL/7-32--------------------------------------------------------------------------------
Q4U314_SILLA/339-365--------------------------------------------------------------------------------
Q7S3X8_NEUCR/511-537--------------------------------------------------------------------------------
B7P106_IXOSC/39-65--------------------------------------------------------------------------------
A2WWT4_ORYSI/58-84--------------------------------------------------------------------------------
C5WV17_SORBI/105-131--------------------------------------------------------------------------------
C0ITH8_CICAR/151-177--------------------------------------------------------------------------------
B0WRI3_CULQU/211-237--------------------------------------------------------------------------------
D0E8G8_XENLA/68-94--------------------------------------------------------------------------------
Q6JX07_NICBE/92-118--------------------------------------------------------------------------------
D3YZL3_MOUSE/68-94--------------------------------------------------------------------------------
B3NFC5_DROER/16-42--------------------------------------------------------------------------------
D3ZQM2_RAT/46-72--------------------------------------------------------------------------------
ZAT12_ARATH/38-64--------------------------------------------------------------------------------
B9SGZ2_RICCO/71-98--------------------------------------------------------------------------------
O22089_PETHY/44-70--------------------------------------------------------------------------------
A0JMG7_DANRE/187-213--------------------------------------------------------------------------------
A4ICD3_LEIIN/446-472--------------------------------------------------------------------------------
Q9SI97_ARATH/33-59--------------------------------------------------------------------------------

PF12756

A0CL87_PARTE/113-210--------------------------------------------------------------------------------
A0DBC5_PARTE/118-217--------------------------------------------------------------------------------
A1CEM1_ASPCL/167-266--------------------------------------------------------------------------------
A2E134_TRIVA/91-184--------------------------------------------------------------------------------
A2EY84_TRIVA/123-220--------------------------------------------------------------------------------
A2FY49_TRIVA/125-222--------------------------------------------------------------------------------
A3GG06_PICST/172-274--------------------------------------------------------------------------------
A3KN09_BOVIN/173-269--------------------------------------------------------------------------------
A3KN09_BOVIN/300-405--------------------------------------------------------------------------------
A3LSH1_PICST/204-303--------------------------------------------------------------------------------
A4HID1_LEIBR/23-127--------------------------------------------------------------------------------
A5ABL9_ASPNC/169-268--------------------------------------------------------------------------------
A5DAA7_PICGU/158-261--------------------------------------------------------------------------------
A5DF85_PICGU/192-291--------------------------------------------------------------------------------
A5DWN8_LODEL/185-287--------------------------------------------------------------------------------
A5E0D9_LODEL/215-313--------------------------------------------------------------------------------
A5KAJ8_PLAVS/220-318--------------------------------------------------------------------------------
A6RA79_AJECN/222-321--------------------------------------------------------------------------------
A6SNU3_BOTFB/200-299--------------------------------------------------------------------------------
A6ZLK6_YEAS7/163-264--------------------------------------------------------------------------------
A7A1R2_YEAS7/187-286--------------------------------------------------------------------------------
A7APW5_BABBO/142-238--------------------------------------------------------------------------------
A7RG08_NEMVE/117-213--------------------------------------------------------------------------------
A7RG08_NEMVE/247-352--------------------------------------------------------------------------------
A7S1H2_NEMVE/149-250--------------------------------------------------------------------------------
A7TGF8_VANPO/203-302--------------------------------------------------------------------------------
A7TKJ2_VANPO/177-278--------------------------------------------------------------------------------
A8BRD6_GIAIC/206-307--------------------------------------------------------------------------------
A8N6P2_COPC7/179-281--------------------------------------------------------------------------------
A8Q2J7_BRUMA/162-262--------------------------------------------------------------------------------
A8QF85_BRUMA/360-456--------------------------------------------------------------------------------
A8XW76_CAEBR/166-267--------------------------------------------------------------------------------
A9NWN9_PICSI/191-296--------------------------------------------------------------------------------
A9RG33_PHYPA/170-274--------------------------------------------------------------------------------
A9UNU5_MONBE/187-285--------------------------------------------------------------------------------
B0D0A4_LACBS/171-273--------------------------------------------------------------------------------
B0ERX1_ENTDS/148-249--------------------------------------------------------------------------------
B0WTB0_CULQU/173-276--------------------------------------------------------------------------------
B0XA93_CULQU/169-265--------------------------------------------------------------------------------
B0XA93_CULQU/309-411--------------------------------------------------------------------------------
B2APT6_PODAN/147-246--------------------------------------------------------------------------------
B2ART8_PODAN/234-333--------------------------------------------------------------------------------
B2VWQ1_PYRTR/200-299--------------------------------------------------------------------------------
B3MF27_DROAN/150-246--------------------------------------------------------------------------------
B3MF27_DROAN/304-406--------------------------------------------------------------------------------
B3MS65_DROAN/189-292--------------------------------------------------------------------------------
B3NP05_DROER/307-409--------------------------------------------------------------------------------
B3RL33_TRIAD/157-258--------------------------------------------------------------------------------
B4GDG5_DROPE/303-405--------------------------------------------------------------------------------
B4LK38_DROVI/302-404--------------------------------------------------------------------------------
B5X107_SALSA/262-363--------------------------------------------------------------------------------
B6AAZ0_CRYMR/102-201--------------------------------------------------------------------------------
B6GWU8_PENCW/169-268--------------------------------------------------------------------------------
B6K092_SCHJY/107-202--------------------------------------------------------------------------------
B6K4Y2_SCHJY/191-290--------------------------------------------------------------------------------
B6Q556_PENMQ/175-274--------------------------------------------------------------------------------
B6QKD2_PENMQ/49-147--------------------------------------------------------------------------------
B6TYD5_MAIZE/177-281--------------------------------------------------------------------------------
B7G5C8_PHATC/162-261--------------------------------------------------------------------------------
B7PQC6_IXOSC/101-215--------------------------------------------------------------------------------
B7QL67_IXOSC/146-247--------------------------------------------------------------------------------
B8BZ28_THAPS/187-286--------------------------------------------------------------------------------
B8LT33_TALSN/26-124--------------------------------------------------------------------------------
B9WMM6_CANDC/202-301--------------------------------------------------------------------------------
C1BP60_9MAXI/172-268--------------------------------------------------------------------------------
C1BP60_9MAXI/309-414--------------------------------------------------------------------------------
C3Z2W9_BRAFL/169-272--------------------------------------------------------------------------------
C3Z2W9_BRAFL/306-410--------------------------------------------------------------------------------
C3ZHE1_BRAFL/219-322--------------------------------------------------------------------------------
C4JG26_UNCRE/105-204--------------------------------------------------------------------------------
C4QVW4_PICPG/173-272--------------------------------------------------------------------------------
C4QYN6_PICPG/199-297--------------------------------------------------------------------------------
C4XX48_CLAL4/158-261--------------------------------------------------------------------------------
C4Y3F6_CLAL4/193-292--------------------------------------------------------------------------------
C5DRY2_ZYGRC/178-277--------------------------------------------------------------------------------
C5E1G3_ZYGRC/156-255--------------------------------------------------------------------------------
C5E366_LACTC/159-260--------------------------------------------------------------------------------
C5G0T2_ARTOC/196-295--------------------------------------------------------------------------------
C5LQU6_PERM5/115-214--------------------------------------------------------------------------------
O49591_ARATH/201-305--------------------------------------------------------------------------------
YJVF_SCHPO/209-308--------------------------------------------------------------------------------
Q0U3Z2_PHANO/85-179--------------------------------------------------------------------------------
Q0UNZ0_PHANO/197-296--------------------------------------------------------------------------------
Q16VY7_AEDAE/306-408--------------------------------------------------------------------------------
Q2GS44_CHAGB/226-325--------------------------------------------------------------------------------
Q2H8Q4_CHAGB/112-207--------------------------------------------------------------------------------
Q2ULX1_ASPOR/130-229--------------------------------------------------------------------------------
Q4N636_THEPA/125-221--------------------------------------------------------------------------------
Q4PBS4_USTMA/225-328--------------------------------------------------------------------------------
Q52KN1_XENLA/159-255--------------------------------------------------------------------------------
Q52KN1_XENLA/286-391--------------------------------------------------------------------------------
Q54Q44_DICDI/210-306--------------------------------------------------------------------------------
Q54Q44_DICDI/363-471--------------------------------------------------------------------------------
Q584W8_TRYB2/25-125--------------------------------------------------------------------------------
Q5BC55_EMENI/163-262--------------------------------------------------------------------------------
Q5CFB4_CRYHO/107-206--------------------------------------------------------------------------------
Q5KMT0_CRYNJ/155-257--------------------------------------------------------------------------------
Q6BY84_DEBHA/193-292--------------------------------------------------------------------------------
Q6BZ58_DEBHA/168-271--------------------------------------------------------------------------------
Q6CFB1_YARLI/172-271--------------------------------------------------------------------------------
Q6CLN1_KLULA/167-266--------------------------------------------------------------------------------
Q6CPG1_KLULA/171-270--------------------------------------------------------------------------------
Q6FRR7_CANGA/185-284--------------------------------------------------------------------------------
Q6V945_GIBZA/53-150--------------------------------------------------------------------------------
Q757G3_ASHGO/167-265--------------------------------------------------------------------------------
Q758B7_ASHGO/153-253--------------------------------------------------------------------------------
Q7PYV1_ANOGA/170-273--------------------------------------------------------------------------------
Q7PZE9_ANOGA/170-266--------------------------------------------------------------------------------
Q7PZE9_ANOGA/302-405--------------------------------------------------------------------------------
Q7SYJ7_DANRE/285-390--------------------------------------------------------------------------------
Q7ZXY8_XENLA/243-344--------------------------------------------------------------------------------
YLM7_SCHPO/96-192--------------------------------------------------------------------------------

PF13909

A0JMC9_DANRE/108-131--------------------------------------------------------------------------------
A6QLD7_BOVIN/106-129--------------------------------------------------------------------------------
Q0P4U5_XENTR/106-129--------------------------------------------------------------------------------
A4QP16_DANRE/108-131--------------------------------------------------------------------------------
Q4SJ09_TETNG/112-136--------------------------------------------------------------------------------
Q4RGT6_TETNG/39-63--------------------------------------------------------------------------------
Q4RGT6_TETNG/357-380--------------------------------------------------------------------------------
Q4RGT6_TETNG/985-1009--------------------------------------------------------------------------------
Q4RGT6_TETNG/1107-1131--------------------------------------------------------------------------------
Q4RGT6_TETNG/1955-1979--------------------------------------------------------------------------------
Q4RGT6_TETNG/2125-2148--------------------------------------------------------------------------------
ZN462_HUMAN/108-132--------------------------------------------------------------------------------
ZN462_HUMAN/470-493--------------------------------------------------------------------------------
ZN462_HUMAN/1515-1539--------------------------------------------------------------------------------
ZN462_HUMAN/2083-2107--------------------------------------------------------------------------------
B1AWL2_MOUSE/917-941--------------------------------------------------------------------------------
B7PWK2_IXOSC/264-288--------------------------------------------------------------------------------
B7PWK2_IXOSC/348-372--------------------------------------------------------------------------------
B7PWK2_IXOSC/636-660--------------------------------------------------------------------------------
B7PWK2_IXOSC/761-785--------------------------------------------------------------------------------
B7PWK2_IXOSC/999-1023--------------------------------------------------------------------------------
B7PWK2_IXOSC/1076-1100--------------------------------------------------------------------------------
B7PWK2_IXOSC/1275-1299--------------------------------------------------------------------------------
C3Y329_BRAFL/1145-1169--------------------------------------------------------------------------------
C3Y329_BRAFL/2491-2514--------------------------------------------------------------------------------
C3Y329_BRAFL/2968-2991--------------------------------------------------------------------------------
SPR4_CAEEL/1053-1077--------------------------------------------------------------------------------
B4MUH3_DROWI/135-159--------------------------------------------------------------------------------
B4MUH3_DROWI/319-343--------------------------------------------------------------------------------
B4MUH3_DROWI/551-575--------------------------------------------------------------------------------
Q2MHN3_MOUSE/446-470--------------------------------------------------------------------------------
Q2MHN3_MOUSE/752-777--------------------------------------------------------------------------------
A8PHZ8_BRUMA/500-523--------------------------------------------------------------------------------
A8PHZ8_BRUMA/595-618--------------------------------------------------------------------------------
A8PHZ8_BRUMA/818-841--------------------------------------------------------------------------------
A8XE56_CAEBR/1022-1046--------------------------------------------------------------------------------
A8XE56_CAEBR/1287-1310--------------------------------------------------------------------------------
B4JA49_DROGR/288-312--------------------------------------------------------------------------------
B4MRW9_DROWI/36-60--------------------------------------------------------------------------------
B4P2L1_DROYA/552-576--------------------------------------------------------------------------------
B4P2L1_DROYA/2201-2225--------------------------------------------------------------------------------
B3MNH1_DROAN/1662-1686--------------------------------------------------------------------------------
B3MNH1_DROAN/2009-2033--------------------------------------------------------------------------------
B0W108_CULQU/560-586--------------------------------------------------------------------------------
B4JA46_DROGR/2053-2077--------------------------------------------------------------------------------
B7P493_IXOSC/210-234--------------------------------------------------------------------------------
B7P493_IXOSC/470-494--------------------------------------------------------------------------------
B4I058_DROSE/457-481--------------------------------------------------------------------------------
B3NN32_DROER/822-846--------------------------------------------------------------------------------
B4G892_DROPE/900-920--------------------------------------------------------------------------------
Q9VK42_DROME/1986-2010--------------------------------------------------------------------------------
Q9NZF0_HUMAN/97-121--------------------------------------------------------------------------------
B4NCU0_DROWI/35-60--------------------------------------------------------------------------------
B0WCG2_CULQU/153-176--------------------------------------------------------------------------------
B3KPL9_HUMAN/273-297--------------------------------------------------------------------------------
D3ZVE0_RAT/581-605--------------------------------------------------------------------------------
D3ZVE0_RAT/723-747--------------------------------------------------------------------------------
B3DLY6_XENTR/107-131--------------------------------------------------------------------------------
Q5BWG4_SCHJA/47-71--------------------------------------------------------------------------------
Q4RFH6_TETNG/118-142--------------------------------------------------------------------------------
Q8N2Y6_HUMAN/70-94--------------------------------------------------------------------------------
C7TYR1_SCHJA/377-402--------------------------------------------------------------------------------
B0W0M6_CULQU/1802-1826--------------------------------------------------------------------------------
B0W0M6_CULQU/2470-2494--------------------------------------------------------------------------------
B0W0M6_CULQU/2807-2832--------------------------------------------------------------------------------
D0UGE5_SALSA/106-130--------------------------------------------------------------------------------
Q7QIY3_ANOGA/1517-1540--------------------------------------------------------------------------------
B4Q650_DROSI/394-418--------------------------------------------------------------------------------
D3ZV33_RAT/474-498--------------------------------------------------------------------------------
A8WN61_CAEBR/321-344--------------------------------------------------------------------------------
Q4TAJ1_TETNG/302-326--------------------------------------------------------------------------------
A5D8R5_DANRE/113-137--------------------------------------------------------------------------------
A8PZ56_BRUMA/396-420--------------------------------------------------------------------------------

PF13913

Q5TVV1_ANOGA/349-373--------------------------------------------------------------------------------
ZC21B_HUMAN/14-38--------------------------------------------------------------------------------
ZC21A_BOVIN/14-38--------------------------------------------------------------------------------
ZC21A_DANRE/13-37--------------------------------------------------------------------------------
A0D772_PARTE/16-40--------------------------------------------------------------------------------
A0D772_PARTE/88-112--------------------------------------------------------------------------------
A0D772_PARTE/240-264--------------------------------------------------------------------------------
A0D772_PARTE/282-306--------------------------------------------------------------------------------
A0D772_PARTE/485-509--------------------------------------------------------------------------------
A4II57_XENTR/7-31--------------------------------------------------------------------------------
B3S1Z1_TRIAD/12-36--------------------------------------------------------------------------------
A0BI04_PARTE/35-59--------------------------------------------------------------------------------
Q4T3R5_TETNG/1-25--------------------------------------------------------------------------------
B5DY39_DROPS/216-240--------------------------------------------------------------------------------
B3NYH6_DROER/222-246--------------------------------------------------------------------------------
B4LXR7_DROVI/219-243--------------------------------------------------------------------------------
B7YZI7_DROME/250-274--------------------------------------------------------------------------------
B3MD64_DROAN/241-265--------------------------------------------------------------------------------
Q17HT4_AEDAE/209-233--------------------------------------------------------------------------------
B0WL51_CULQU/30-54--------------------------------------------------------------------------------
B4NFE6_DROWI/297-321--------------------------------------------------------------------------------
A7SCJ1_NEMVE/2-26--------------------------------------------------------------------------------
A0BPA2_PARTE/18-42--------------------------------------------------------------------------------
ZN474_BOVIN/162-186--------------------------------------------------------------------------------
ZN474_BOVIN/281-305--------------------------------------------------------------------------------
Q22W47_TETTS/1074-1098--------------------------------------------------------------------------------
Q22W47_TETTS/1316-1340--------------------------------------------------------------------------------
Q22W47_TETTS/1368-1392--------------------------------------------------------------------------------
ZC21C_RAT/378-402--------------------------------------------------------------------------------
D0NJC1_PHYIT/328-352--------------------------------------------------------------------------------
C3XR94_BRAFL/2-26--------------------------------------------------------------------------------
B7PKC9_IXOSC/144-168--------------------------------------------------------------------------------
A9VC46_MONBE/24-48--------------------------------------------------------------------------------
ZC21C_MACFA/385-409--------------------------------------------------------------------------------
Q4DZW2_TRYCC/500-524--------------------------------------------------------------------------------
C9ZU86_TRYB9/474-498--------------------------------------------------------------------------------
B4J546_DROGR/189-213--------------------------------------------------------------------------------
B4KUA9_DROMO/257-281--------------------------------------------------------------------------------
Q4QJB7_LEIMA/494-518--------------------------------------------------------------------------------
A2DFG0_TRIVA/216-240--------------------------------------------------------------------------------
A9UUD0_MONBE/507-531--------------------------------------------------------------------------------
B0WFX3_CULQU/56-80--------------------------------------------------------------------------------
A2DDQ6_TRIVA/317-341--------------------------------------------------------------------------------
A4H4C7_LEIBR/498-522--------------------------------------------------------------------------------
A2DCT4_TRIVA/353-377--------------------------------------------------------------------------------
A2G025_TRIVA/191-215--------------------------------------------------------------------------------
C3Y249_BRAFL/296-320--------------------------------------------------------------------------------
C3Y249_BRAFL/360-384--------------------------------------------------------------------------------
C1N5S1_MICPC/567-591--------------------------------------------------------------------------------
A4HNQ7_LEIBR/99-123--------------------------------------------------------------------------------
A0E7F3_PARTE/259-284--------------------------------------------------------------------------------
Q22FZ1_TETTS/1345-1370--------------------------------------------------------------------------------
B4L4C9_DROMO/16-40--------------------------------------------------------------------------------
B4MCV5_DROVI/16-40--------------------------------------------------------------------------------
A0CCZ1_PARTE/398-423--------------------------------------------------------------------------------
Q23G89_TETTS/565-590--------------------------------------------------------------------------------
C5KY37_PERM5/133-157--------------------------------------------------------------------------------
Q4CZP9_TRYCC/394-419--------------------------------------------------------------------------------
A7SW12_NEMVE/136-160--------------------------------------------------------------------------------
A7SW12_NEMVE/403-427--------------------------------------------------------------------------------
A7SW12_NEMVE/632-656--------------------------------------------------------------------------------
C6LWB9_GIAIB/210-234--------------------------------------------------------------------------------
C6LWB9_GIAIB/330-354--------------------------------------------------------------------------------
D2V1Q0_NAEGR/80-104--------------------------------------------------------------------------------
D2V1Q0_NAEGR/313-337--------------------------------------------------------------------------------
D2V1Q0_NAEGR/382-406--------------------------------------------------------------------------------
D2V1Q0_NAEGR/449-473--------------------------------------------------------------------------------
Q38BB2_TRYB2/94-118--------------------------------------------------------------------------------
B6DTK8_9EUGL/177-201--------------------------------------------------------------------------------
ZN474_HUMAN/220-244--------------------------------------------------------------------------------
ZN474_HUMAN/283-307--------------------------------------------------------------------------------
A4I482_LEIIN/241-265--------------------------------------------------------------------------------
Q1RL46_CIOIN/441-465--------------------------------------------------------------------------------
A4HH62_LEIBR/245-269--------------------------------------------------------------------------------
Q22MG0_TETTS/91-115--------------------------------------------------------------------------------
A4I8G9_LEIIN/131-155--------------------------------------------------------------------------------
A4I8G9_LEIIN/464-488--------------------------------------------------------------------------------
D0AAP9_TRYB9/450-474--------------------------------------------------------------------------------
A0BQ29_PARTE/191-216--------------------------------------------------------------------------------
A0D235_PARTE/9-34--------------------------------------------------------------------------------
A4HKY8_LEIBR/181-205--------------------------------------------------------------------------------
A4HKY8_LEIBR/514-538--------------------------------------------------------------------------------
D0A5S6_TRYB9/389-414--------------------------------------------------------------------------------
B3S813_TRIAD/83-107--------------------------------------------------------------------------------
Q4DWN4_TRYCC/191-215--------------------------------------------------------------------------------
D2V0X3_NAEGR/490-514--------------------------------------------------------------------------------
A0BJ34_PARTE/111-135--------------------------------------------------------------------------------
A8BKJ5_GIAIC/107-131--------------------------------------------------------------------------------
A8XNV4_CAEBR/16-40--------------------------------------------------------------------------------
A8XNV4_CAEBR/88-112--------------------------------------------------------------------------------
D2HAR5_AILME/6-30--------------------------------------------------------------------------------
D2GZX7_AILME/382-406--------------------------------------------------------------------------------
D0NEA9_PHYIT/340-364--------------------------------------------------------------------------------
D0NEA9_PHYIT/424-448--------------------------------------------------------------------------------
C6LPS8_GIAIB/136-160--------------------------------------------------------------------------------
C1N8C4_MICPC/6-30--------------------------------------------------------------------------------
C1N8C4_MICPC/111-135--------------------------------------------------------------------------------
A0EFR9_PARTE/7-31--------------------------------------------------------------------------------
A9SXU7_PHYPA/74-98--------------------------------------------------------------------------------
D2VLG1_NAEGR/218-242--------------------------------------------------------------------------------
D0N855_PHYIT/585-609--------------------------------------------------------------------------------
B9Q6J7_TOXGO/439-463--------------------------------------------------------------------------------
B9Q6J7_TOXGO/1000-1024--------------------------------------------------------------------------------
A0C1Z5_PARTE/50-74--------------------------------------------------------------------------------
Q568L6_DANRE/321-345--------------------------------------------------------------------------------
Q568L6_DANRE/368-392--------------------------------------------------------------------------------
Q01B39_OSTTA/34-58--------------------------------------------------------------------------------
Q247Z8_TETTS/496-521--------------------------------------------------------------------------------
B5YP21_THAPS/32-60--------------------------------------------------------------------------------
D0NT76_PHYIT/53-77--------------------------------------------------------------------------------
B3NTK5_DROER/605-629--------------------------------------------------------------------------------

PF13465

ZN486_HUMAN/168-193----------------------------------------------------------------....EK.K.....P..
C3Y5N9_BRAFL/492-517----------------------------------------------------------------....GQ.K.....P..
C3Y5N9_BRAFL/642-667----------------------------------------------------------------....SD.M.....T..
C3Y5N9_BRAFL/701-726----------------------------------------------------------------....AN.L.....P..
C3Y5N9_BRAFL/908-933----------------------------------------------------------------....AD.L.....P..
C3Y5N9_BRAFL/1509-1534----------------------------------------------------------------....GR.K.....S..
C3Y5N9_BRAFL/1565-1590----------------------------------------------------------------....AK.H.....S..
C3Y5N9_BRAFL/1710-1735----------------------------------------------------------------....VK.G.....A..
C3Y5N9_BRAFL/1822-1845----------------------------------------------------------------.......R.....K..
C3Y5N9_BRAFL/2160-2186----------------------------------------------------------------....TS.K.....V..
C3Y5N6_BRAFL/2472-2497----------------------------------------------------------------....GE.K.....P..
C3Y5N6_BRAFL/2500-2525----------------------------------------------------------------....VR.S.....K..
B4LSE1_DROVI/978-1006----------------------------------------------------------------....GK.F.....I..
Q17I36_AEDAE/547-572----------------------------------------------------------------....IP.R.....M..
Q17I36_AEDAE/709-735----------------------------------------------------------------....MN.N.....K..
C9JV94_HUMAN/189-214----------------------------------------------------------------....GD.G.....P..
B4JE27_DROGR/815-840----------------------------------------------------------------....VQ.K.....E..
B4P6G0_DROYA/936-964----------------------------------------------------------------....GM.F.....I..
B4NB09_DROWI/246-271----------------------------------------------------------------....GE.R.....P..
B4IIG8_DROSE/638-663----------------------------------------------------------------....SS.D.....N..
B4IIG8_DROSE/709-740----------------------------------------------------------------.GTIGK.N.....E..
D2HPL2_AILME/1017-1043----------------------------------------------------------------....KE.F.....A..
C3Y3Q4_BRAFL/924-949----------------------------------------------------------------....PD.G.....S..
Q5T0T3_HUMAN/464-490----------------------------------------------------------------....GHHK.....P..
D2HT61_AILME/925-953----------------------------------------------------------------....EN.Q.....KV.
B4M0K3_DROVI/332-358----------------------------------------------------------------....RS.W.....S..
Q8CCP9_MOUSE/216-241----------------------------------------------------------------....GE.K.....P..
Q8CCP9_MOUSE/244-269----------------------------------------------------------------....RE.K.....T..
B5DPM3_DROPS/803-828----------------------------------------------------------------....GA.K.....P..
B7QDL7_IXOSC/281-306----------------------------------------------------------------....GV.R.....K..
Q7PWB5_ANOGA/939-967----------------------------------------------------------------....GK.F.....L..
Q27GU0_CAEEL/587-612----------------------------------------------------------------....NH.Y.....Q..
B4NKU8_DROWI/172-197----------------------------------------------------------------....GK.K.....D..
B4NKU8_DROWI/228-253----------------------------------------------------------------....NE.R.....P..
Q16FS5_AEDAE/123-151----------------------------------------------------------------....GK.F.....L..
Q4RMA1_TETNG/725-751----------------------------------------------------------------....EF.K.....A..
Q2A130_HUMAN/419-444----------------------------------------------------------------....RE.K.....P..
C3ZL56_BRAFL/166-191----------------------------------------------------------------....GD.K.....P..
Q9VGR9_DROME/285-309----------------------------------------------------------------.....E.G.....P..
C4WXH9_ACYPI/38-64----------------------------------------------------------------....KL.K.....P..
D2A615_TRICA/169-196----------------------------------------------------------------....PP.S.....V..
D2A615_TRICA/362-390----------------------------------------------------------------...SGE.A.....E..
A8WZ67_CAEBR/128-153----------------------------------------------------------------....FQ.S.....F..
B0X845_CULQU/202-227----------------------------------------------------------------....SD.D.....Q..
B0X845_CULQU/257-282----------------------------------------------------------------....QQ.R.....D..
C3XUG1_BRAFL/351-375----------------------------------------------------------------....DS.......A..
C3XUG1_BRAFL/478-504----------------------------------------------------------------....RV.R.....K..
Q95UR8_SCHAM/391-416----------------------------------------------------------------....GW.K.....P..
B0X0R8_CULQU/239-264----------------------------------------------------------------....RS.K.....P..
B0X0R8_CULQU/267-292----------------------------------------------------------------....NV.F.....Q..
O18327_BOMMO/31-56----------------------------------------------------------------....GE.R.....P..
B6DCI8_SELML/257-285----------------------------------------------------------------....KF.R.....P..
C3ZCI8_BRAFL/46-74----------------------------------------------------------------..APPK.K.....T..
B6ILE7_CAEBR/111-136----------------------------------------------------------------....KL.K.....P..
B4GTY9_DROPE/163-188----------------------------------------------------------------....GD.R.....P..
A8X4P7_CAEBR/267-292----------------------------------------------------------------....GE.K.....P..
B7PIW0_IXOSC/428-454----------------------------------------------------------------....RA.K.....R..
B4H5Z4_DROPE/372-397----------------------------------------------------------------....KP.K.....P..
Q65XX7_CAEEL/75-103----------------------------------------------------------------..IRGS.S.....P..
Q0KG18_PLADU/548-574----------------------------------------------------------------....KE.E.....X..
Q45TD4_NASVI/353-378----------------------------------------------------------------....TV.Y.....Q..
Q45TD4_NASVI/693-718----------------------------------------------------------------....CQ.N.....P..
B4DM04_HUMAN/36-61----------------------------------------------------------------....GE.K.....P..
B4KJP4_DROMO/725-751----------------------------------------------------------------....QM.K.....P..
C3Z3Y6_BRAFL/29-54----------------------------------------------------------------....SE.K.....P..
D2BGQ7_DEHSV/54-80----------------------------------------------------------------....VE.R.....V..
B6JXI3_SCHJY/130-155----------------------------------------------------------------....GE.K.....N..
B0X7A1_CULQU/220-245----------------------------------------------------------------....GE.K.....P..
D2A5C7_TRICA/167-196----------------------------------------------------------------..VGKE.T.....I..
A8QCF0_BRUMA/224-250----------------------------------------------------------------....EE.V.....L..
A8PSF9_BRUMA/132-156----------------------------------------------------------------....DL.K.....G..
D2HCL5_AILME/531-560----------------------------------------------------------------....GE.S.....RLR
C3ZY15_BRAFL/99-125----------------------------------------------------------------....VV.D.....K..
A8X4P5_CAEBR/36-61----------------------------------------------------------------....KT.K.....P..
Q4RZB6_TETNG/590-615----------------------------------------------------------------....GE.K.....P..
D3J922_9DIPT/94-119----------------------------------------------------------------....QS.K.....P..
B4PAD9_DROYA/635-660----------------------------------------------------------------....TE.R.....Q..
C1M0Z0_SCHMA/245-268----------------------------------------------------------------....NT..........
A2CF18_MOUSE/89-114----------------------------------------------------------------....GE.K.....H..
Q4R869_MACFA/163-190----------------------------------------------------------------....AQ.E.....P..
Q4R869_MACFA/223-249----------------------------------------------------------------....NT.K.....N..
Q19807_CAEEL/281-308----------------------------------------------------------------....GE.DL...FP..
Q19807_CAEEL/311-337----------------------------------------------------------------....MD.G.....G..
B3LZJ1_DROAN/264-290----------------------------------------------------------------....PP.K.....R..
Q3V2G0_MOUSE/57-82----------------------------------------------------------------....GE.K.....P..
B4KY04_DROMO/729-753----------------------------------------------------------------....VQ.L........
D2HQG8_AILME/621-647----------------------------------------------------------------....VF.R.....A..
B0XEJ1_CULQU/238-263----------------------------------------------------------------....EQ.S.....R..
O44720_CAEEL/224-249----------------------------------------------------------------....GT.K.....S..
O44720_CAEEL/252-280----------------------------------------------------------------....KE.R.....S..
B0XUY9_ASPFC/38-63----------------------------------------------------------------....KE.R.....P..
A8WRV0_CAEBR/303-329----------------------------------------------------------------....VF.T.....T..
Q29EW8_DROPS/622-646----------------------------------------------------------------....GQ.S.....L..
C8Z2G2_PARTP/312-337----------------------------------------------------------------....KI.Y.....P..
C4Y0F7_CLAL4/93-120----------------------------------------------------------------....GE.K.....P..
Q1HQJ4_AEDAE/218-244----------------------------------------------------------------....QT.E.....Q..
B8XJD6_EPIBA/286-311----------------------------------------------------------------....SV.Y.....Q..
B4JJM0_DROGR/170-195----------------------------------------------------------------....GL.K.....P..
B0WHQ5_CULQU/350-376----------------------------------------------------------------....KE.G.....K..
B0WHQ5_CULQU/435-460----------------------------------------------------------------....IK.T.....K..
B0WIF5_CULQU/318-345----------------------------------------------------------------....EN.A.....R..
Q16SQ7_AEDAE/717-746----------------------------------------------------------------..NPKE.N.....Y..
B7QI19_IXOSC/542-567----------------------------------------------------------------....GY.F.....P..
B4IEF4_DROSE/345-370----------------------------------------------------------------....AN.G.....H..
C3XTT5_BRAFL/572-600----------------------------------------------------------------....GV.K.....L..
A7S9P2_NEMVE/562-587----------------------------------------------------------------....KE.M.....P..
A8XN82_CAEBR/442-467----------------------------------------------------------------....GI.I.....K..
B7XCJ2_GASAC/35-67----------------------------------------------------------------SGGAKE.K.....K..
A5DLM3_PICGU/158-185----------------------------------------------------------------....GE.R.....K..
C6JW60_ACYPI/179-204----------------------------------------------------------------....NV.F.....Q..
C6JW60_ACYPI/545-570----------------------------------------------------------------....FR.D.....P..
B7WNA2_CAEEL/413-438----------------------------------------------------------------....GI.L.....K..
A8XPR2_CAEBR/339-365----------------------------------------------------------------....PE.E.....G..
A8WS90_CAEBR/300-326----------------------------------------------------------------...AGE.S.....P..
B4NLT6_DROWI/36-64----------------------------------------------------------------...ESE.R.....K..
B0WAV3_CULQU/214-240----------------------------------------------------------------....QT.E.....I..
Q20709_CAEEL/484-506----------------------------------------------------------------....G...........
D4ACS2_RAT/534-563----------------------------------------------------------------....GDNR.....PK.
A8PJF0_BRUMA/38-64----------------------------------------------------------------....IN.R.....P..
SPR3_CAEEL/275-302----------------------------------------------------------------....QKSK.....Q..
A2WLN2_ORYSI/165-188----------------------------------------------------------------....GT.R.....E..
D2SM16_DROCP/38-63----------------------------------------------------------------....NQ.K.....P..
D3DWS4_HUMAN/121-146----------------------------------------------------------------....ED.Q.....R..
B0CWQ2_LACBS/44-69----------------------------------------------------------------....NE.R.....S..
B4UT12_OTOGA/218-244----------------------------------------------------------------....DT.R.....H..
B4UT12_OTOGA/247-272----------------------------------------------------------------....KR.N.....V..
B4ME14_DROVI/489-514----------------------------------------------------------------....NE.R.....P..
Q7Q5B0_ANOGA/452-477----------------------------------------------------------------....KL.K.....P..
Q170B3_AEDAE/215-240----------------------------------------------------------------....GV.K........
B0X2S1_CULQU/37-63----------------------------------------------------------------....QG.D.....R..
B4JVC8_DROGR/257-281----------------------------------------------------------------....Q..S.....V..
Q2T9Q4_BOVIN/417-443----------------------------------------------------------------....NT.K.....N..
ATBP_DROGR/368-393----------------------------------------------------------------....KE.R.....R..
Z518B_HUMAN/176-201----------------------------------------------------------------....GI.F.....P..
C7ZP87_NECH7/43-67----------------------------------------------------------------....GE.R.....N..
B6GZI2_PENCW/31-56----------------------------------------------------------------....TV.K.....S..
Q7Q704_ANOGA/486-511----------------------------------------------------------------....GE.R.....N..
A6ZY10_YEAS7/188-215----------------------------------------------------------------....GE.K.....N..
A8Q9Q4_BRUMA/314-337----------------------------------------------------------------....PH.......P..
Q3Z7R8_DEHE1/43-70----------------------------------------------------------------....VE.K.....A..
C5GLY3_AJEDR/134-158----------------------------------------------------------------.....E.R.....D..
B4GP26_DROPE/271-303----------------------------------------------------------------....PP.T.....P..
B0D6U7_LACBS/443-468----------------------------------------------------------------....GI.K.....D..
B3KU17_HUMAN/197-222----------------------------------------------------------------....LE.K.....Q..
D3SJ61_DEHSG/41-70----------------------------------------------------------------..QSVE.K.....A..
B4KPH3_DROMO/470-496----------------------------------------------------------------....MH.D.....S..
Z518A_HUMAN/248-273----------------------------------------------------------------....GT.F.....P..
B9WB05_CANDC/230-257----------------------------------------------------------------...PNN.R.....P..
C3XQK7_BRAFL/378-402----------------------------------------------------------------....PD.G.....P..
A0NE47_ANOGA/173-198----------------------------------------------------------------....SG.Q.....M..
Q9LIV0_ORYSJ/349-377----------------------------------------------------------------....QK.R.....P..
B3NN72_DROER/565-591----------------------------------------------------------------....NQPK.....K..
B0WBK7_CULQU/334-360----------------------------------------------------------------....VR.A.....S..
B4J604_DROGR/860-888----------------------------------------------------------------....NQ.N.....F..
A5JYT9_CAEEL/287-313----------------------------------------------------------------...SGE.A.....P..
B6HWU0_PENCW/300-326----------------------------------------------------------------....KE.K.....P..
A2QMC6_ASPNC/73-100----------------------------------------------------------------....PK.Q.....I..
B4M184_DROVI/277-309----------------------------------------------------------------....SP.T.....P..
A1YGC0_PANPA/667-694----------------------------------------------------------------....VK.E.....M..
Q16WW2_AEDAE/220-248----------------------------------------------------------------..IHGP.K.....K..
C4V7P9_NOSCE/296-329----------------------------------------------------------------....VE.KSKVIKP..
B4FJN4_MAIZE/67-95----------------------------------------------------------------....QL.K.....P..
Q7Q1J4_ANOGA/124-149----------------------------------------------------------------....GE.A........

PF09237

Q7QGK8_ANOGA/312-365--------------------------------------------------------------------------FCLLEI
GAGA_DROME/319-372--------------------------------------------------------------------------PGTEKP
Q17MR3_AEDAE/275-328--------------------------------------------------------------------------DGIIKI

PF02892

ZBED4_HUMAN/561-609----------------------------------------------------------------------------CS..
ZBED4_HUMAN/459-506----------------------------------------------------------------------------AP..
ZBED4_HUMAN/118-166----------------------------------------------------------------------------SP..
ZBED4_HUMAN/288-336----------------------------------------------------------------------------SP..
O24423_SOLLC/299-349----------------------------------------------------------------------------VD..
O24423_SOLLC/200-250----------------------------------------------------------------------------VD..
Q7XH06_ORYSJ/402-447----------------------------------------------------------------------------IG..
Q9LRP0_ARATH/133-180----------------------------------------------------------------------------QD..
Q9LRP0_ARATH/11-58----------------------------------------------------------------------------QD..
Q94LV8_ORYSJ/29-78----------------------------------------------------------------------------PD..
Q852A8_ORYSJ/25-74----------------------------------------------------------------------------VR..
O81190_ARATH/24-74----------------------------------------------------------------------------SKD.
Q9M305_ARATH/27-76----------------------------------------------------------------------------AID.
O23355_ARATH/16-63----------------------------------------------------------------------------YK..
Q8L717_ARATH/16-65----------------------------------------------------------------------------YK..
Q9SKV9_ARATH/37-84----------------------------------------------------------------------------VP..
Q19902_CAEEL/4-44----------------------------------------------------------------------------HK..
Q9VAF2_DROME/120-161----------------------------------------------------------------------------IS..
Q9VAF2_DROME/6-47----------------------------------------------------------------------------LT..
ENV11_YEAST/87-132----------------------------------------------------------------------------IE..
O82332_ARATH/62-107----------------------------------------------------------------------------KK..
O65237_ARATH/49-94----------------------------------------------------------------------------LS..
O48647_ORYSA/143-191----------------------------------------------------------------------------VEFT
Q9VM61_DROME/6-48----------------------------------------------------------------------------TS..
Q94513_DROME/7-58----------------------------------------------------------------------------NE..
Q9XWZ9_CAEEL/186-230----------------------------------------------------------------------------MKD.
O96084_DROVI/33-82----------------------------------------------------------------------------PSND
ZBED1_HUMAN/23-72----------------------------------------------------------------------------DTNA
Q21374_CAEEL/4-47----------------------------------------------------------------------------LQ..
Q9VEP0_DROME/6-47----------------------------------------------------------------------------VD..
Q9XIM5_ARATH/34-81----------------------------------------------------------------------------VGI.
O23600_ARATH/421-469----------------------------------------------------------------------------ILEL
Q9S9W0_ARATH/38-83----------------------------------------------------------------------------ED..
Q9SI73_ARATH/54-102----------------------------------------------------------------------------GQK.
Q9ZPF6_ARATH/108-159----------------------------------------------------------------------------IWKK
Q9S7T4_ARATH/45-96----------------------------------------------------------------------------ETV.
O24134_TOBAC/145-191----------------------------------------------------------------------------VR..
Q38743_ANTMA/129-173----------------------------------------------------------------------------VT..
Q19787_CAEEL/126-170----------------------------------------------------------------------------LP..
O96691_BACRY/27-74----------------------------------------------------------------------------ILKP
Q9XWZ9_CAEEL/353-396----------------------------------------------------------------------------LN..

PF05605

B9I3F4_POPTR/43-96--------------------------------------------------------------------------------
DI197_ARATH/41-94--------------------------------------------------------------------------------
C0PIR5_MAIZE/63-116--------------------------------------------------------------------------------
F1SP03_PIG/76-137--------------------------------------------------------------------------------
Q4TZT2_GOSHI/42-95--------------------------------------------------------------------------------
B9MZZ9_POPTR/35-88--------------------------------------------------------------------------------
C6T0D8_SOYBN/37-90--------------------------------------------------------------------------------
E9FW83_DAPPU/76-137--------------------------------------------------------------------------------
B4NA68_DROWI/76-137--------------------------------------------------------------------------------
Q6J0N0_ORYLA/131-192--------------------------------------------------------------------------------
DI192_ARATH/45-98--------------------------------------------------------------------------------
B9NH25_POPTR/12-65--------------------------------------------------------------------------------
C5XJD3_SORBI/54-107--------------------------------------------------------------------------------
A7SGR5_NEMVE/76-137--------------------------------------------------------------------------------
Q7KT86_DROME/76-139--------------------------------------------------------------------------------
F0ZDS1_DICPU/325-378--------------------------------------------------------------------------------
B4MCR4_DROVI/76-136--------------------------------------------------------------------------------
C6TJ79_SOYBN/33-84--------------------------------------------------------------------------------
D8QZV5_SELML/43-95--------------------------------------------------------------------------------
DI192_ORYSJ/52-105--------------------------------------------------------------------------------
B9SAX0_RICCO/49-102--------------------------------------------------------------------------------
C0P4E3_MAIZE/52-105--------------------------------------------------------------------------------
B3TLS9_ELAGV/43-96--------------------------------------------------------------------------------
Q9W4V2_DROME/99-152--------------------------------------------------------------------------------
B7E5F9_ORYSJ/60-113--------------------------------------------------------------------------------
D8SWT1_SELML/39-92--------------------------------------------------------------------------------
B7P2G0_IXOSC/26-81--------------------------------------------------------------------------------
E2BIQ4_HARSA/91-152--------------------------------------------------------------------------------
B9I9N5_POPTR/37-90--------------------------------------------------------------------------------
B4FRH9_MAIZE/49-102--------------------------------------------------------------------------------
D7KAY8_ARALL/33-86--------------------------------------------------------------------------------
E0VYN0_PEDHC/76-137--------------------------------------------------------------------------------
D7M5F4_ARALL/56-109--------------------------------------------------------------------------------
A9NRR0_PICSI/43-96--------------------------------------------------------------------------------
E2B3G1_HARSA/95-148--------------------------------------------------------------------------------
Q0IMP6_ORYSJ/39-92--------------------------------------------------------------------------------
D3B6G1_POLPA/495-556--------------------------------------------------------------------------------
D8SWM4_SELML/55-106--------------------------------------------------------------------------------
B8AWQ7_ORYSI/40-93--------------------------------------------------------------------------------
B4JJE5_DROGR/60-120--------------------------------------------------------------------------------
A9NNC1_PICSI/39-92--------------------------------------------------------------------------------
A9RX96_PHYPA/18-71--------------------------------------------------------------------------------
Q84ZW5_ORYSI/35-88--------------------------------------------------------------------------------
A9RX94_PHYPA/15-69--------------------------------------------------------------------------------
A9NZE0_PICSI/37-89--------------------------------------------------------------------------------
D5AD63_PICSI/42-95--------------------------------------------------------------------------------
D7U2E3_VITVI/42-95--------------------------------------------------------------------------------
D4P881_LINUS/39-92--------------------------------------------------------------------------------
D6W7D8_TRICA/77-138--------------------------------------------------------------------------------
A9SS49_PHYPA/43-96--------------------------------------------------------------------------------
B0WIV3_CULQU/74-135--------------------------------------------------------------------------------
C6T3G5_SOYBN/42-95--------------------------------------------------------------------------------
F2D7R3_HORVD/39-92--------------------------------------------------------------------------------
B7QDE6_IXOSC/75-136--------------------------------------------------------------------------------
Q6J0N1_DANRE/132-193--------------------------------------------------------------------------------
B7FME8_MEDTR/44-97--------------------------------------------------------------------------------

PF15269

E7FF07_DANRE/14-67--------------------------------------------------------------------------------
ZN750_DANRE/5-58--------------------------------------------------------------------------------

PF12907

A6MZL5_ORYSI/1-40--------------------------------------------------------------------------------
B8CDP1_THAPS/41-82--------------------------------------------------------------------------------
B0YEW9_ASPFC/36-74--------------------------------------------------------------------------------
B6K9E6_TOXGO/37-75--------------------------------------------------------------------------------
C5L3K4_PERM5/40-78--------------------------------------------------------------------------------
A5JZJ9_PLAVS/36-74--------------------------------------------------------------------------------
C5LL36_PERM5/36-69--------------------------------------------------------------------------------
C1N1U6_MICPC/37-76--------------------------------------------------------------------------------
B9HMX2_POPTR/26-65--------------------------------------------------------------------------------
B6K6M8_SCHJY/34-72--------------------------------------------------------------------------------
C1FFR1_MICSR/37-76--------------------------------------------------------------------------------
A8HPM7_CHLRE/37-76--------------------------------------------------------------------------------
B7FQP9_PHATC/41-72--------------------------------------------------------------------------------

PF11931

Q757U7_ASHGO/318-527RDAYDAPAYSSGEPEDVIE............................TPQQQ.QNAHPDDVNP.LNLPLGPDGYPIPYWL
Q6BPR8_DEBHA/322-517ISIVGDESDYTTINSTSGG............................ESDSN.ESSDNDEYNM.KDLPIGVDGKPIPYWL
A5DJE8_PICGU/306-499IGLADDDSEDTVVQSSSGS............................DDNSD.SDREESAF...ANMPLGADGTPIPPWL
Q0UAS9_PHANO/330-517....ELEQLYSETPTGGEN............................EEQHD.SDGEDKIYNP.LKLPLAWDGKPIPFWL
Q5KJJ3_CRYNJ/329-512..EIEEQEEGPAEAVELGG............................QESDE.ESDDGKIYNP.LKLPLGWDGKPIPYWL
SF3A3_MOUSE/321-500............EEEEQIS............................ESESE.DEENEIIYNP.KNLPLGWDGKPIPYWL
A7EM87_SCLS1/308-497..ELDSLFAESSSAAPRDG............................DSDSE.SDGDDKIYNP.LKLPLAWDGKPIPFWL
Q4DZ62_TRYCC/344-537.....QAAQYDVMATLNSK............................DVEND.PKENTAVADDTSGQLLDRDGKPVARWL
Q5AUL5_EMENI/312-501...ELEAMLAETEDAKGDR............................GNESD.EEGEDRIYNP.LKLPLAWDGKPIPYWL
Q9P736_NEUCS/307-496..ELENLYNTTFRRQAKEA............................EEDED.DGGDDKIYNP.LKLPLAWDGKPIPFWL
Q7R8D2_PLAYO/329-569FNPNSVVSSSSYDTSDLGSEIDE...................NEEQDNEETD.KDENKTIYNP.LNLPLGHDNKPIPYWL
Q59YK2_CANAL/310-512ENEFVAINNEFDDDDLSQN............................EHGDD.DDNDDYLDDSFKNLPLGPDGTPIPFWL
Q6C2A2_YARLI/346-547NLRYGQQSDGSPWSKKQKT............................GDEDD.EDEDEVISNP.LKLPLGWDGKPIPFWL
A5K6W2_PLAVS/371-630FGPSSGDDDSSTDESDGGSVSGEGDGKGKKKGKGVSGAGGADGADGADGTDE.DEEEKPIYNP.LNLPLGHDNKPIPYWL
Q6FNA1_CANGA/320-515HRPVYDPTEKEGDVEEDNS............................KSKTK.DELKEMLGLG.EDMPLGPDGLPIPYWL
Q10DW3_ORYSJ/326-506...........EREEEEVQ............................ADSES.DDEDQQIYNP.LKLPMGWDGKPIPYWL
Q4P183_USTMA/361-564RMSALHPTSGLDSNDANDA............................IDQGGDDDGASRVYNP.LKLPLGWDGRPIPFWL
A5E2D1_LODEL/396-573............NGDDDND............................NSGSD.SDLDLELF...KNLPMGPDGTPIPLWL
A3LZB0_PICST/335-529IVGDESDYTTVYDSSSDSG............................NDSSD.EEENENL....KHLPLGADGKPIPFWL
A7TQD9_VANPO/315-516ERPAYSVGEPEEGKPNENS.............................SKTS.SNKNDIINGS.FDMPLGPDGLPMPYWL
A8WYD7_CAEBR/321-500............EEEEEVV............................IEEEE.EVDESAPYNP.KNLPLGWDGKPIPYWL
Q00TY4_OSTTA/336-514............EAEEDDD............................FSDAE.TDEEEEIYNP.LKLPLGWDGKPIPYWL
Q4Q7B2_LEIMA/416-622EDSKGSRRGRHGKASAPAP............................VAAAP.AAPELPLEEE.EEQLIGENGEPIPRWL
A6ZXU1_YEAS7/315-529EAPAYDSTEKEGAEQVDGE............................QRDGQ.LQEEHLSGKS.FDMPLGPDGLPMPYWL
Q7QBN1_ANOGA/307-483..........LDESDEDSM............................DEEES.DDDDGIPYNP.KNLPLGYDGKPIPYWL
Q6CIR1_KLULA/319-529ESPIYAKDESEDKPSYIDN............................AEDTA.QKESMDPTNP.YNLPLGPDGFPIPRWL
A0BHR1_PARTE/51-236......DEAVPVQDQQLDQ............................PEEAS.SEDESPIYNP.KNLPLGWDGRPIPYWL
Q5DFZ0_SCHJA/331-515.......DDTDADKDATNA............................ENGQN.EDDDDIPYNP.KNLPLGWDGKPIPYWL
Q8I2R0_PLAF7/343-588ENNNLSISMSDDDSSDMSNISNNED...............QQKDLDEENEDD.NDDNKPIYNP.LNLPLGFDNKPIPYWL
Q295L4_DROPS/322-502...........SDVEASES............................DNDDD.PDADDVPYNP.KNLPLGWDGKPIPYWL
A7AWA7_BABBO/340-533GLALKILESVGEENNIDIG............................DISSE.EEEEQPVYNP.LNLPLGWDGKPIPFWL
Q7YZ45_CRYPV/279-492NKNKSKGDRDSNKMEFDTD............................SDDDF.DELQEKVYNP.LKLPLGPDGRPMPYWL
Q8SUY4_ENCCU/234-369..........................................................................SVPRWL
Q3LWI3_BIGNA/267-418........EIVESFVSLNR............................QKKSL.NEEKTSISNP.LRLPLGWDNKPIPFWL
Q4UCY7_THEAN/343-533..SQTLAQEILDALETNVV............................ESDSEVEEDEKPVYNP.LNLPLGWDGKPIPFWL
Q55CK7_DICDI/343-533.GVMVGGVGDDEEEDEEVN............................IDDLE.VDVEVSKLKI.ANYPVDWSGKPIPYWV
SAP61_SCHPO/296-491AEREAFEQSTPSVSVEGNQ............................DEESD.QDDEEKIYNP.LKLPLGWDGKPIPFWL

PF06220

WBP4_MOUSE/8-44--------------------------------------------------------------------------------
RU1C_ARATH/1-38--------------------------------------------------------------------------------
RU1C_CAEEL/1-38--------------------------------------------------------------------------------
RU1C_YEAST/1-38--------------------------------------------------------------------------------
RU1C_SCHPO/1-38--------------------------------------------------------------------------------
RU1C_PLAF7/1-38--------------------------------------------------------------------------------
YNS7_SCHPO/8-44--------------------------------------------------------------------------------
RU1C_HUMAN/1-38--------------------------------------------------------------------------------
Q8IPW7_DROME/3-39--------------------------------------------------------------------------------
Q9HEK5_NEUCS/1-38--------------------------------------------------------------------------------
Q8SR72_ENCCU/1-38--------------------------------------------------------------------------------

PF08209

C8ZIY2_YEAS8/67-99--------------------------------------------------------------------------------
SGF11_CANAL/95-124--------------------------------------------------------------------------------
A9RK45_PHYPA/893-922--------------------------------------------------------------------------------
SGF11_DROSI/102-134--------------------------------------------------------------------------------
AT7L3_DANRE/80-112--------------------------------------------------------------------------------
SG111_DROWI/116-148--------------------------------------------------------------------------------
B9HNC7_POPTR/82-114--------------------------------------------------------------------------------
SGF11_PICST/71-100--------------------------------------------------------------------------------
SGF11_AEDAE/94-126--------------------------------------------------------------------------------
Q4PD44_USTMA/95-127--------------------------------------------------------------------------------
B6Q2K2_PENMQ/191-223--------------------------------------------------------------------------------
SGF11_ASHGO/72-104--------------------------------------------------------------------------------
D3BEH2_POLPA/162-193--------------------------------------------------------------------------------
B3S8N8_TRIAD/115-147--------------------------------------------------------------------------------
C5DIC9_LACTC/66-98--------------------------------------------------------------------------------
B2W5Z8_PYRTR/1052-1084--------------------------------------------------------------------------------
C4R2D9_PICPG/91-121--------------------------------------------------------------------------------
C3YL49_BRAFL/83-115--------------------------------------------------------------------------------
SGF11_SCHPO/68-100--------------------------------------------------------------------------------
SGF11_DEBHA/69-98--------------------------------------------------------------------------------
B6K4N7_SCHJY/67-99--------------------------------------------------------------------------------
B0CPA4_LACBS/109-141--------------------------------------------------------------------------------
Q5KH30_CRYNJ/121-151--------------------------------------------------------------------------------
SGF11_CANGA/67-99--------------------------------------------------------------------------------
D0N3C8_PHYIT/53-84--------------------------------------------------------------------------------
B5Y4P9_PHATC/145-177--------------------------------------------------------------------------------
C1FHG8_MICSR/173-205--------------------------------------------------------------------------------
SGF11_VANPO/64-96--------------------------------------------------------------------------------
A8PBW2_BRUMA/63-95--------------------------------------------------------------------------------
A8JIK2_CHLRE/145-177--------------------------------------------------------------------------------
Q6CGL5_YARLI/100-132--------------------------------------------------------------------------------
A2Y3K0_ORYSI/106-138--------------------------------------------------------------------------------
D2VLX0_NAEGR/90-123--------------------------------------------------------------------------------

PF07776

A7UV01_ANOGA/9-76--------------------------------------------------------------------------------
Q9VGL1_DROME/5-76--------------------------------------------------------------------------------
Q9VYG4_DROME/5-80--------------------------------------------------------------------------------
ZN276_HUMAN/78-164--------------------------------------------------------------------------------
Q29ND0_DROPS/6-81--------------------------------------------------------------------------------
Q29IN3_DROPS/2-81--------------------------------------------------------------------------------
Q28WY1_DROPS/10-81--------------------------------------------------------------------------------
Q296L3_DROPS/6-84--------------------------------------------------------------------------------
Q28ZV2_DROPS/21-102--------------------------------------------------------------------------------
Q293S4_DROPS/4-78--------------------------------------------------------------------------------
Q29J43_DROPS/21-101--------------------------------------------------------------------------------
Q295I6_DROPS/3-85--------------------------------------------------------------------------------
Q172A9_AEDAE/36-109--------------------------------------------------------------------------------
Q17J41_AEDAE/18-90--------------------------------------------------------------------------------
Q5TSD0_ANOGA/15-94--------------------------------------------------------------------------------
Q9VEW6_DROME/16-90--------------------------------------------------------------------------------
Q17BB2_AEDAE/4-80--------------------------------------------------------------------------------
Q17Q26_AEDAE/11-84--------------------------------------------------------------------------------
Q16LJ9_AEDAE/12-89--------------------------------------------------------------------------------
Q8T3Y6_DROME/4-81--------------------------------------------------------------------------------
Q17H01_AEDAE/9-82--------------------------------------------------------------------------------
Q5TPX0_ANOGA/12-86--------------------------------------------------------------------------------
Q7PSS4_ANOGA/5-78--------------------------------------------------------------------------------
Q0IFU7_AEDAE/4-77--------------------------------------------------------------------------------
Q7Q764_ANOGA/4-76--------------------------------------------------------------------------------
Q16XL6_AEDAE/6-82--------------------------------------------------------------------------------
Q16UU9_AEDAE/69-144--------------------------------------------------------------------------------
Q16IT5_AEDAE/11-81--------------------------------------------------------------------------------
Q17FQ3_AEDAE/16-94--------------------------------------------------------------------------------
Q7PE48_ANOGA/10-85--------------------------------------------------------------------------------
Q9W3T3_DROME/13-95--------------------------------------------------------------------------------
A0APC7_DROSI/1-89--------------------------------------------------------------------------------
Q17ES4_AEDAE/9-86--------------------------------------------------------------------------------
Q9VDQ6_DROME/10-92--------------------------------------------------------------------------------
Q9U1J8_DROME/16-94--------------------------------------------------------------------------------
Q29GX8_DROPS/7-88--------------------------------------------------------------------------------
Q16U61_AEDAE/101-172--------------------------------------------------------------------------------
Q29BJ8_DROPS/19-99--------------------------------------------------------------------------------
Q17L68_AEDAE/12-105--------------------------------------------------------------------------------
Q7QGF1_ANOGA/29-103--------------------------------------------------------------------------------
Q17BA3_AEDAE/91-169--------------------------------------------------------------------------------
Q4RZ79_TETNG/4-78--------------------------------------------------------------------------------
Q7PZF0_ANOGA/11-96--------------------------------------------------------------------------------
Q8T092_DROME/6-82--------------------------------------------------------------------------------
Q293X8_DROPS/4-78--------------------------------------------------------------------------------
Q16L11_AEDAE/6-87--------------------------------------------------------------------------------
A0NGY9_ANOGA/14-91--------------------------------------------------------------------------------
Q95RA7_DROME/41-116--------------------------------------------------------------------------------
Q16TP6_AEDAE/7-79--------------------------------------------------------------------------------
Q16V18_AEDAE/51-126--------------------------------------------------------------------------------
Q9VBN9_DROME/46-125--------------------------------------------------------------------------------
Q16TP8_AEDAE/49-124--------------------------------------------------------------------------------
Q7Q2A4_ANOGA/17-101--------------------------------------------------------------------------------
A0NBW7_ANOGA/15-87--------------------------------------------------------------------------------
Q17JD7_AEDAE/2-72--------------------------------------------------------------------------------
O96395_DROME/20-95--------------------------------------------------------------------------------
Q17FQ4_AEDAE/25-91--------------------------------------------------------------------------------
Q17GH4_AEDAE/30-111--------------------------------------------------------------------------------
Q17H35_AEDAE/96-172--------------------------------------------------------------------------------
Q16MQ6_AEDAE/5-79--------------------------------------------------------------------------------
PHYL_DROME/28-97--------------------------------------------------------------------------------
A2VEG0_DROME/80-155--------------------------------------------------------------------------------
Q17I37_AEDAE/16-86--------------------------------------------------------------------------------
Q17MD3_AEDAE/10-83--------------------------------------------------------------------------------
Q16K79_AEDAE/10-91--------------------------------------------------------------------------------
Q16G18_AEDAE/7-79--------------------------------------------------------------------------------
Q17PD2_AEDAE/5-79--------------------------------------------------------------------------------
Q16YV7_AEDAE/147-222--------------------------------------------------------------------------------
Q17EK1_AEDAE/5-79--------------------------------------------------------------------------------
A0NBZ7_ANOGA/18-102--------------------------------------------------------------------------------
Q17H96_AEDAE/12-89--------------------------------------------------------------------------------
Q16SB8_AEDAE/44-121--------------------------------------------------------------------------------
Q16ES4_AEDAE/19-91--------------------------------------------------------------------------------
Q173P4_AEDAE/173-244--------------------------------------------------------------------------------
Q174L0_AEDAE/17-95--------------------------------------------------------------------------------
Q16MP6_AEDAE/212-285--------------------------------------------------------------------------------
Q9W137_DROME/3-77--------------------------------------------------------------------------------
Q17JM9_AEDAE/19-93--------------------------------------------------------------------------------
Q16IP3_AEDAE/12-92--------------------------------------------------------------------------------
Q8SZ92_DROME/17-102--------------------------------------------------------------------------------
Q17G83_AEDAE/137-213--------------------------------------------------------------------------------
Q16YH3_AEDAE/5-78--------------------------------------------------------------------------------
Q9VGQ6_DROME/7-83--------------------------------------------------------------------------------
Q9VIS9_DROME/28-108--------------------------------------------------------------------------------
Q170M9_AEDAE/12-99--------------------------------------------------------------------------------
Q16GR5_AEDAE/13-97--------------------------------------------------------------------------------
Q296H7_DROPS/6-79--------------------------------------------------------------------------------
Q16LN4_AEDAE/36-103--------------------------------------------------------------------------------
Q171F5_AEDAE/7-112--------------------------------------------------------------------------------
Q17FB1_AEDAE/20-106--------------------------------------------------------------------------------
Q29BM8_DROPS/14-88--------------------------------------------------------------------------------
Q17MM2_AEDAE/4-82--------------------------------------------------------------------------------
Q4V5B7_DROME/13-89--------------------------------------------------------------------------------
A0NE47_ANOGA/7-75--------------------------------------------------------------------------------
Q16GR6_AEDAE/13-97--------------------------------------------------------------------------------
Q7JW60_DROME/21-102--------------------------------------------------------------------------------
Q295U2_DROPS/12-90--------------------------------------------------------------------------------
Q17JX0_AEDAE/4-85--------------------------------------------------------------------------------

PF04419

Q4WNN0_ASPFU/1-37--------------------------------------------------------------------------------
C5P8K7_COCP7/1-37--------------------------------------------------------------------------------
A1CCH0_ASPCL/1-34--------------------------------------------------------------------------------
A2I456_MACHI/1-41--------------------------------------------------------------------------------
A2YHJ0_ORYSI/3-36--------------------------------------------------------------------------------
A4HUF3_LEIIN/3-41--------------------------------------------------------------------------------
A4RZ85_OSTLU/3-37--------------------------------------------------------------------------------
A4S433_OSTLU/1-37--------------------------------------------------------------------------------
A5AXN0_VITVI/245-281--------------------------------------------------------------------------------
A5JZQ1_PLAVS/1-35--------------------------------------------------------------------------------
A5WW23_DANRE/1-38--------------------------------------------------------------------------------
A6RTA6_BOTFB/1-38--------------------------------------------------------------------------------
A7RLR9_NEMVE/1-39--------------------------------------------------------------------------------
A7RQF4_NEMVE/1-38--------------------------------------------------------------------------------
A7TH18_VANPO/1-36--------------------------------------------------------------------------------
A8BVJ6_GIAIC/1-39--------------------------------------------------------------------------------
A8XJE4_CAEBR/1-38--------------------------------------------------------------------------------
A8Y1E8_CAEBR/1-43--------------------------------------------------------------------------------
B9FID9_ORYSJ/19-53--------------------------------------------------------------------------------
Y2309_ARATH/3-37--------------------------------------------------------------------------------
SERF1_MOUSE/1-38--------------------------------------------------------------------------------
Q013U6_OSTTA/23-66--------------------------------------------------------------------------------
Q0IT26_ORYSJ/1-35--------------------------------------------------------------------------------
Q1RL63_CIOIN/1-36--------------------------------------------------------------------------------
Q4DJ29_TRYCC/1-37--------------------------------------------------------------------------------
Q4PAY1_USTMA/1-34--------------------------------------------------------------------------------
Q4XL55_PLACH/4-36--------------------------------------------------------------------------------
Q553T6_DICDI/3-38--------------------------------------------------------------------------------
Q5B540_EMENI/1-37--------------------------------------------------------------------------------
Q5BT45_SCHJA/1-37--------------------------------------------------------------------------------
Q5CHK6_CRYHO/4-37--------------------------------------------------------------------------------
Q5CQG7_CRYPI/6-43--------------------------------------------------------------------------------
Q5KLR0_CRYNJ/1-35--------------------------------------------------------------------------------
Q66M64_BRUMA/1-38--------------------------------------------------------------------------------
Q7PNM0_ANOGA/1-41--------------------------------------------------------------------------------
Q7SG18_NEUCR/3-36--------------------------------------------------------------------------------
Q8GXU7_ARATH/1-36--------------------------------------------------------------------------------
Q9C2J3_NEUCS/1-37--------------------------------------------------------------------------------
YIN2_SCHPO/1-34--------------------------------------------------------------------------------
ZN706_HUMAN/1-38--------------------------------------------------------------------------------

PF00096

LOLA1_DROME/791-814-----------C-------R...H------C------G----------...K-----K----------------------
ZNF91_HUMAN/238-260-----------C-------E...E------C------G----------...K-----A----------------------
ZNF17_HUMAN/442-464-----------C-------N...K------C------G----------...K-----F----------------------
SDC1_CAEEL/268-290-----------C-------H...I------C------G----------...T-----V----------------------
ZN592_HUMAN/1043-1069-----------C-------G...Y------C------T----------EDSP-----S----------------------
SDC1_CAEEL/652-674-----------C-------F...H------C------G----------...T-----R----------------------
SDC1_CAEEL/145-168-----------C-------Q...V------C------L----------...T-----L----------------------
SDC1_CAEEL/117-139-----------C-------A...H------C------D----------...W-----S----------------------
ZEP1_HUMAN/959-982-----------C-------E...T------C------R----------...N-----R----------------------
SDC1_CAEEL/233-254-----------C-------H...L------C------H----------...L-----P----------------------
MZF1_HUMAN/412-434-----------C-------G...D------C------G----------...Q-----G----------------------
ZSC22_HUMAN/352-374-----------C-------G...E------C------G----------...K-----T----------------------
EVI1_HUMAN/217-239-----------C-------K...D------C------G----------...Q-----M----------------------
EVI1_HUMAN/21-44-----------C-------E...D------C------D----------...Q-----L----------------------
EVI1_HUMAN/131-154-----------C-------E...N------C------A----------...K-----V----------------------
EVI1_HUMAN/790-812-----------C-------H...L------C------D----------...R-----C----------------------
EVI1_HUMAN/761-784-----------C-------K...Y------C------D----------...R-----S----------------------
ZN239_MOUSE/6-28-----------C-------D...K------C------G----------...K-----G----------------------
EVI1_HUMAN/75-97-----------C-------K...E------C------D----------...Q-----V----------------------
INSM1_HUMAN/441-464-----------C-------P...V------C------G----------...E-----S----------------------
ZNF76_HUMAN/285-309-----------C-------PE.PH------C------G----------...R-----G----------------------
ADR1_YEAST/104-126-----------C-------E...V------C------T----------...R-----A----------------------
KRUH_DROME/299-321-----------C-------E...F------C------H----------...K-----L----------------------
P43_XENBO/45-69-----------C-------GK.KD------C------G----------...K-----M----------------------
ZFA_MOUSE/513-536-----------C-------Q...Y------C------E----------...Y-----R----------------------
P43_XENBO/220-245-----------C-------PR.QD------C------D----------...K-----I----------------------
SUHW_DROME/319-341-----------C-------S...I------C------N----------...A-----N----------------------
SUHW_DROAN/221-243-----------C-------G...K------C------Y----------...K-----T----------------------
ZG29_XENLA/62-84-----------C-------T...V------C------G----------...K-----T----------------------
TYY1_HUMAN/296-320-----------C-------PH.KG------C------T----------...K-----M----------------------
RGM1_YEAST/19-44-----------C-------VGYPD------C------N----------...M-----S----------------------
ZO2_XENLA/34-59-----------C-------A...D------C------G----------...K-----H----------------------
TF3A_ANAAE/12-36-----------C-------SF.PD------C------N----------...A-----T----------------------
ZFA_MOUSE/570-593-----------C-------L...H------C------D----------...H-----K----------------------
ESCA_DROME/344-366-----------C-------K...D------C------D----------...K-----T----------------------
GP_DUGBA/768-790-----------C-------P...F------C------E----------...K-----Q----------------------
SUHW_DROME/523-545-----------C-------E...Q------C------D----------...E-----K----------------------
ZG8_XENLA/146-168-----------C-------T...E------C------G----------...E-----H----------------------
ZG28_XENLA/174-196-----------C-------T...E------C------G----------...K-----C----------------------
CTCF_CHICK/555-577-----------C-------S...K------C------G----------...K-----T----------------------
CI_DROME/451-476-----------C-------HW.RS------C------R----------...I-----E----------------------
TERM_DROME/323-346-----------C-------R...R------C------R----------...T-----Q----------------------
IKZF1_MOUSE/488-512-----------C-------N...M------C------G----------...Y-----H----------------------
TRA1_CAEEL/337-362-----------C-------QI.PQ------C------T----------...K-----S----------------------
INSM1_HUMAN/367-390-----------C-------H...H------C------A----------...K-----K----------------------
ZNF76_HUMAN/225-249-----------C-------PE.EL------C------S----------...K-----A----------------------
GP_PHV/549-571-----------C-------E...V------C------Q----------...Q-----E----------------------
HUNB_DROME/269-291-----------C-------P...K------C------P----------...F-----V----------------------
XFIN_XENLA/1276-1298-----------C-------N...C------C------D----------...R-----S----------------------
XFIN_XENLA/1044-1066-----------C-------G...L------C------E----------...R-----S----------------------
CF2_DROME/429-451-----------C-------G...Y------C------G----------...R-----A----------------------
ZEB1_CHICK/268-292-----------C-------P...N------C------K----------...K-----R----------------------
P43_XENBO/106-130-----------C-------SV.PG------C------K----------...R-----S----------------------
TF3A_ANAAE/72-97-----------C-------ET.EN------C------N----------...L-----A----------------------
ZG5_XENLA/185-207-----------C-------C...K------C------G----------...D-----S----------------------
SUHW_DROME/290-313-----------C-------P...D------C------P----------...K-----S----------------------
ZG44_XENLA/5-27-----------C-------T...K------C------K----------...R-----R----------------------
BNC1_HUMAN/720-743-----------C-------D...I------C------K----------...K-----T----------------------
ZFA_MOUSE/542-564-----------C-------D...I------C------L----------...L-----T----------------------
IKZF1_MOUSE/200-223-----------C-------G...Y------C------G----------...R-----S----------------------
SRYC_DROME/358-380-----------C-------D...I