Sequence alignment for CL0362

PF01881

W6RS12_9CLOT/95-244GLLKL----STYKYKD..-.-----------------KYEFIKEKVIL...E----------------------------
Q6L357_PICTO/91-231SFSSY----PEIRIG...-.-----------------NSVFSIVEIKD...T----------------------------
Q5JHS4_THEKO/94-238GFLDD----PLLKIK...-.-----------------DATFIADDVKV...L----------------------------
D5WUC6_KYRT2/99-252RLLGD----AMLRLG...-.-----------------NVELELAEVES...S----------------------------
R5LEA9_9SPIR/108-254.....----...KYYYPL-K-----------------NNKMELKNITM...V----------------------------
Q8R6W9_THETN/98-246GFLRQ----GKVRIG...-.-----------------EAVLEVQNMSV...G----------------------------
I0GHZ9_CALEA/103-252.....----..IVLN...-.-----------------DFNLFLSAVEV...I----------------------------
I3VSC9_THESW/97-245NIFKK----DFCVFN...-.-----------------NQTFKLNSINI...E----------------------------
K0NH01_DESTT/117-279.IFSN----QKMMLNLSG-Q-----------------RHFFDIVNVDI...Q----------------------------
C8W340_DESAS/104-254ALMAR----RNKWFPLAD-C-----------------DNKLRTLSINN...V----------------------------
B3QWN9_CHLT3/102-265GLFQD----GLFRIA...-.-----------------QSYFEKELIET...L----------------------------
Q5JGA0_THEKO/96-240GLLQN----PEVELW...-.-----------------REKFTVEEVKA...L----------------------------
U6EA28_9EURY/92-240GHLEN----SEVDFK...-.-----------------GDKLLVEQIEL...L----------------------------
D9RZH3_THEOJ/95-246GLLKN----DDLSLA...-.-----------------GRRVVLENVTVHAAV----------------------------
A1BI29_CHLPD/104-261GLLHE----PYVFVG...-.-----------------RERFRVECVRR...L----------------------------
L0AM89_NATGS/80-250DLLED----PELNIG...-.-----------------EMPFHVEDVTS...L----------------------------
A9BGZ0_PETMO/96-247SLLFK----DDFELL...-.-----------------GQKIHVEKLEY...D----------------------------
D1CID5_THET1/96-249HLLKR----PQVRLG...-.-----------------NEVCRVDEVAV...E----------------------------
F6DTP0_DESRL/96-242GFLTR----GQIRLG...-.-----------------SHFAEVKAVTV...R----------------------------
R7ML22_9FIRM/93-237AFMSQ----KNKSYPFPN-.-----------------VNKIKITKIEM...R----------------------------
S0AQH2_FERAC/95-242NLLAD----ENIFLN...-.-----------------STKINVIDIKSHSFD----------------------------
A6LNL8_THEM4/96-241KLLTF----ENIRMG...-.-----------------KNILKVEKIETINFM----------------------------
F2NN51_MARHT/98-239GLLTQ----PRVRLH...-.-----------------KARFTLEELTL...S----------------------------
C5D4N1_GEOSW/99-245.LLLH----PDVQIG...-.-----------------GQPVEVQRIDV...E----------------------------
F8E5C0_FLESM/100-243LLQEK----NEAKIFG..-.-----------------DAVQKIEHINL...E----------------------------
B8DZI0_DICTD/99-246..FKE----REFELC...-.-----------------GKKIYISQLQI...I----------------------------
Q3AA62_CARHZ/99-248GLWAL----RNFKII...-.-----------------TLPVSIIEIAA...I----------------------------
CAS6_PYRFU/97-237GLLMN----PEVRLW...-.-----------------DERFYLHEIKV...L----------------------------
O30164_ARCFU/96-240GLLSK----PEIRIC...-.-----------------GVDFIVSEVSV...L----------------------------
F4LS54_TEPAE/98-244GLLLK----STVRLG...-.-----------------NTNMQVTNVSF...A----------------------------
R6G9C8_9FIRM/96-238QLMRN----IEYSMG...-.-----------------GNSMKLREVKA...K----------------------------
B4SEV7_PELPB/104-261GLLQE----PYVWVG...-.-----------------NERFRVETVRK...L----------------------------
Q8TJV5_METAC/91-240GLLLE----PEFFLGNNE-N-----------------KVSFIIERIEV...L----------------------------
Q184H4_PEPD6/93-241GLMTS----KKCLYK...-.-----------------DYELTRIRIDL...S----------------------------
D3T9Q1_ACIB4/83-232RLRDL----EHIYLS...-.-----------------DGPMKVAELKK...F----------------------------
R6MWP8_9FIRM/94-238..IKQ----KDKPIPAPL-.-----------------GNEMKLVSVNL...V----------------------------
B4S5I3_PROA2/104-260GLLHQ----PLVQIG...-.-----------------AQRFRVETVKK...L----------------------------
Q2NH84_METST/83-232QLSNL----EIFRLN...-.-----------------KYYMEKYKVKL...I----------------------------
Q11SY3_CYTH3/88-249QLFNE----TEVNLG...-.-----------------KLILNPINVDQ...E----------------------------
F7PNQ2_9EURY/83-252DLKDD----PELNIG...-.-----------------EMPFTVEELTP...L----------------------------
Q8R6W6_THETN/100-249NILKR----EYCHFN...-.-----------------GQKFTLNSLNI...E----------------------------
A6LJX4_THEM4/95-242NLLNG----DKYFLG...-.-----------------ENDIYLSSVEV...V----------------------------
A6TQ80_ALKMQ/113-256...KG----KAFSIR...-.-----------------DNTYTIGKINL...K----------------------------
F0SWC2_SYNGF/93-241ALLSR----RNHWAPLAD-T-----------------GNQLKITAVTK...V----------------------------
R5F1G6_9BACE/103-255QLFSG----ETFVLGDRR-S-----------------RVELEVEDIVE...C----------------------------
D7DSW4_METV3/93-244GLFKV----GYMQIN...-.-----------------NTKLDVVGV.....L----------------------------
A3DHS6_CLOTH/100-239....R----RDVEIA...-.-----------------GHKAYVSKMDII..M----------------------------
A3I0J5_9BACT/87-249QVFAT----PKVELG...-.-----------------NLILVPEYTEI...E----------------------------
Q8REC5_FUSNN/93-241VFLSQ----RNKKFPLPK-.-----------------DTHMILKDVRI...I----------------------------
H1XXZ4_9BACT/97-255EFRTQ----KKVKIY...-.-----------------NTFFEVEAVRF...V----------------------------
Q24TS7_DESHY/112-258VLLTK----GVMRLG...-.-----------------AQELEIDRISA...G----------------------------
C5CE93_KOSOT/105-255.FLAE----DYVKLG...-.-----------------DHTLKVDSARA...L----------------------------
F6BD56_METIK/93-234GLLED----GMLKVG...-.-----------------DIEFFVKKAKI...L----------------------------
I7CU20_NATSJ/82-250.FKDD----RELNIG...-.-----------------EMPFHVNSVNG...L----------------------------
C7N977_LEPBD/102-257EIEIS----E........-.-----------------ETKVVVTNISI...L----------------------------
I4AF01_FLELS/86-246SLFSR----EHIQIG...-.-----------------ELDLAPEAVEQ...E----------------------------
D4LL18_9FIRM/20-161.LMKY----KTYSMN...-.-----------------QNSMRLMAVKI...R----------------------------
I4BY45_ANAMD/101-249..LSL----GEIKLG...-.-----------------NNLLTCKEVKI...E----------------------------
M1MKV7_9CLOT/95-244GLLRL----RKHEYK...-.-----------------KYKINIEKVLL...E----------------------------
C5CFB4_KOSOT/93-238QFLKS----EELDII...-.-----------------GQKLKLVQLDV...S----------------------------
D1AI68_SEBTE/102-241IRFSN----.........-.-----------------LNSIKITRIVV...Q----------------------------
D3PEQ4_DEFDS/104-252NFLLS----DNLKLG...-.-----------------DNTVYIESIEV...L----------------------------
Q2NFS1_METST/94-243GCLEN----PELRIG...-.-----------------KNIYKITQIKE...I----------------------------
H3ZLX7_THELN/94-238GFISN----PILKVG...-.-----------------EATFSMADIKI...L----------------------------
E4TSF2_MARTH/87-240VLFSL----PEIKLN...-.-----------------GLTIIPHSVEL...E----------------------------
A5D0Y7_PELTS/97-243NLLTR----GQIQVG...-.-----------------QSLLLIDEIRF....----------------------------
F8C1X9_THEGP/88-239GVLKL----KNERFKII.-.-----------------GENFEIKDINL...L----------------------------
L0EHC1_THECK/97-248SMLLS----ENLRIG...-.-----------------NYPIRLLSFETMPEM----------------------------
C9RCX9_AMMDK/97-244SLLRQ----GRFYLG...-.-----------------KNRLTVGSIKT...R----------------------------
H3ZK27_THELN/95-239GLLQE----PEVTLW...-.-----------------NERFYVEEVKA...L----------------------------
A5D0Y8_PELTS/98-246GFLQQ----GQVRLG...-.-----------------DARLEVKEMAA...A----------------------------
F4KYC0_HALH1/106-260.....----GSFFLGDKT-S-----------------GARFALRSIQM...D----------------------------
I2F7N5_9THEM/94-240GLMKN----GGIKLL...-.-----------------GATLDLRSIEV...E----------------------------
E8T539_THEA1/123-268KEMLV----GGKRV....-.-----------------..IWELLKITP...Y----------------------------
F7YVR8_9THEM/97-247SLLQK----PYLEIC...-.-----------------GENFEIVEIEV...P----------------------------
R5NPA5_9PORP/99-253GVFRN----RRMEIGDRK-S-----------------RVAFEVMTVER...L----------------------------
Q1AZD0_RUBXD/95-247HLLRR----PETRLG...-.-----------------KTRCLVEEVGV...E----------------------------
F6D794_METSW/92-236SYLED----PQVVFR...-.-----------------GDRLLVEQVEL...L----------------------------
R5Q6M6_9FIRM/94-236TILLN----NSLLIN...-.-----------------KQQVKIKNISI...L----------------------------
G2TLN2_BACCO/98-246SLLTS----GHLELN...-.-----------------GQEMKVEEVTY...R----------------------------
D9RZG4_THEOJ/95-241GLLKR----GEIILG...-.-----------------KSSFPVSKVEI...A----------------------------
D3E282_METRM/92-241GFLND----LTINFI...-.-----------------GEDLLIEKVEL...L----------------------------
F9ZC95_ODOSD/99-253GLFKN----RQLEVGDRK-S-----------------RVRFEVFNLER...Q----------------------------
W0DCW4_9AQUI/104-247SLLKK----ERLLMH...-.-----------------KQYVFLSEVEV...L----------------------------
R6N4L4_9BACE/105-257GLFMN----QVFEIGDRK-S-----------------TVQFIVRNVEV...V----------------------------
D4M9Y0_9BACT/110-256..LAA----RELRIG...-.-----------------NNVVLCSRVLA...E----------------------------
B7GIV2_ANOFW/71-220GLQSK----KRFEYK...-.-----------------GYELIRRKTVM...G----------------------------
A8F3P6_THELT/94-244SIIEN----PFIELE...-.-----------------GVLFNILQVRV...L----------------------------
R9SJL2_9EURY/92-241GFLDD----LTVNFI...-.-----------------GEDLFVQKVEL...L----------------------------
L7VPR9_CLOSH/98-240....K----KEAKLG...-.-----------------KNLLEIESIEI...S----------------------------
CAS6L_PYRFU/93-237GIEKS----PEFKIG...-.-----------------DVGFLVADIKA...L----------------------------
G7V6P2_THELD/96-246EVLQK----EYLRLA...-.-----------------GNEVFCSSVNV...Y----------------------------
Q9X2D4_THEMA/95-245SLSED----PVIRVG...-.-----------------KTEFIVKSIDI...E----------------------------
CAS6B_METJA/83-239RLDNL----EEVNLN...-.-----------------NFKFEVSELKK...F----------------------------
A9BIX0_PETMO/97-241SLNEQ----KVVRIE...-.-----------------KNYFTLRKYEV...I----------------------------
Q5V7W8_HALMA/83-252DLTHD----RELNIG...-.-----------------EMPFHVDKVSP...L----------------------------
K0AY46_CLOA9/100-241.....----RSYPIK...-.-----------------DNAIKVSNISM...R----------------------------
I3VSW8_THESW/106-256GLYKN----EKIKIG...-.-----------------EAEFNFEEVKI...L----------------------------
E6SGU1_THEM7/160-301.....----GALRLG...-.-----------------TQVVEVEAVRF...E----------------------------
G7V6F2_THELD/105-253GLMSL----GEVRIG...-.-----------------SLNAEVGQIID...E----------------------------
G8TRE8_NIAKG/100-264.IFIN----QQFEIADKI-S-----------------RTQFSVTHVQL...L----------------------------
Q3AA81_CARHZ/97-247GLFKD----HKFIIG...-.-----------------REEFTVKGAFI...R----------------------------
A7HMV7_FERNB/99-241...TF----DSLRIG...-.-----------------RNIVRPEKIEI...F----------------------------
A5UJJ7_METS3/91-240GFLED----LEISFQ...-.-----------------NQKLTIQKIEA...L----------------------------
C5D2U6_GEOSW/88-237GLQKN----QAFSYK...-.-----------------DYHFVKKKIAV...V----------------------------
I3RB26_HALMT/83-252GLQRN----RDFNVG...-.-----------------EMSFEVDDLSQ...L----------------------------
A4J1X6_DESRM/97-248SLLAR----GFIQIG...-.-----------------KNQLQVKEIKLA..V----------------------------
A4XIJ2_CALS8/99-248GLLKK----DQIYLK...-.-----------------DNILYVTSANM...L----------------------------
A4XM43_CALS8/100-259SLISS----KLYPHKLTN-.-----------------NCEIKLRRAYL...I----------------------------
H1YB50_9SPHI/101-259GVFTD----QLISIGGSG-A-----------------VGRFRVEQIVS...L----------------------------
F8A9G0_THEID/98-270HLVRE----GQFRLG...-.-----------------ENLCEIEAVEV...E----------------------------
M1E4R5_9FIRM/102-250.....----.DFKLG...-.-----------------GNSLRINAVSVLKSF----------------------------
F2KRM8_ARCVS/96-239GLLEK----PEVKIG...-.-----------------GTEFVVSEINV...M----------------------------
E3CYI3_9BACT/99-270GLLAG----RSLRLG...-.-----------------NNDLVCSGVEV...A----------------------------
I6ZYF6_MELRP/91-233GFLKV----KEHTWQNSG-S-----------------SINFKPLRAYL...Q----------------------------
H2J3Z6_MARPK/100-251NLFEK----DRFSLG...-.-----------------ENILYLSSVIS...L----------------------------
B5YIV6_THEYD/110-261GLLEN----KSFQFSD..-.-----------------ELTFMLKRIFM...L----------------------------
O27163_METTH/3-152GFIDR----PEIDFL...-.-----------------RRSVNVEYVEF...L----------------------------
O66704_AQUAE/88-235.ILQL----KKNQYIHPI-G-----------------TGKFKIIDFRP...E----------------------------
H1XYR5_9BACT/101-261.LFLH----QQMDIVDAR-H-----------------QCRFFITQVES...L----------------------------
R6AKE9_9CLOT/101-242.....----.QINLF...-.-----------------ENTLEILDSRI....----------------------------
Q182E2_PEPD6/98-243GILKV----KELEYK...-.-----------------GYRFKIKNIKI...H----------------------------
F4A3C4_MAHA5/97-245AFMKS----DRLNLA...-.-----------------GQPLSLSSIKV...I----------------------------
Q6L312_PICTO/84-234VLNKN----KYFYLS...-.-----------------GYKFNIAEIKK...F----------------------------
F7YTK7_9THEM/97-245GLLKK----KYIRLG...-.-----------------ENLLQISEIAT...M----------------------------
Q12WX9_METBU/91-239GLLLE----PEFFLG.RD-K-----------------KANFIIERIEI...M----------------------------
D5XAY0_THEPJ/96-242GILTK----GRLRLG...-.-----------------TAEAEVEKLVV...R----------------------------
I0GI07_CALEA/110-270GLLSL----KEFKFSS..-.-----------------DLTLKLSKVYM...L----------------------------
G8UK03_TANFA/105-257GLFAN----QAFEIGDRQ-S-----------------TVRFMVKNIEV...I----------------------------
F8I2S5_SULAT/94-242ALLSR----HQWRIG...-.-----------------PTPCRLGSITV...Q----------------------------
E4TH18_CALNY/109-261GLIKM----KRFEYSS..-.-----------------DIKFEYLKSML...L----------------------------
I2F5U2_9THEM/105-254.LLLN----REIRIL...-.-----------------NHNLVIQNAFA...S----------------------------
O66560_AQUAE/89-243GLKKL----REYNGRYT.-.-----------------NGNIKVKKVLM...C----------------------------
B5YKZ6_THEYD/94-242NLIKW----HELKLG...-.-----------------NNTLYIESISI...H----------------------------
G7M8P5_9CLOT/95-244GLLRL----RVYDYK...-.-----------------EYKINIQKVLL...E----------------------------
D3PBR5_DEFDS/101-244TFLKK----ENIFLG...-.-----------------KNPLYLESIEV...L----------------------------
N0BC99_9EURY/89-232GLLEK----PEVKIG...-.-----------------DAKFVVSEIKV...L----------------------------
E8T547_THEA1/126-270EMVVG----GK.......-.-----------------SLSWEVVKVAP...L----------------------------
D3DIQ3_HYDTT/95-238VFLKR----ENLFLG...-.-----------------ENRLRLESVEL...I----------------------------
B1I5K4_DESAP/98-246GFLRQ----GRVRLG...-.-----------------DAHLEVKKMAT...A----------------------------
R5UPH1_9PORP/99-253GLFRN----RRIEIGDRK-S-----------------RVMLEVSTLER...M----------------------------
C8VZL4_DESAS/97-243QFIIQ----GKVRIG...-.-----------------KNQLQVMEVRS...K----------------------------
D7CN19_SYNLT/100-243..LKE----GTALIG...-.-----------------GVELRIKKIEA...E----------------------------
W0JFB3_DESAE/95-241..FTT----KKISFW...-.-----------------QNELYLSEVSV...L----------------------------
CAS6A_METJA/97-238GLLED----GKLRVG...-.-----------------NVEFFVRKAKI...L----------------------------

PF10040

L0K6N4_HALHC/192-313--------------------------------------------------------------------------------
F3ZXK6_MAHA5/109-225--------------------------------------------------------------------------------
G2MK90_9ARCH/153-282--------------------------------------------------------------------------------
K9Y918_HALP7/157-268--------------------------------------------------------------------------------
H1XX22_9BACT/179-297--------------------------------------------------------------------------------
B1L433_KORCO/181-296--------------------------------------------------------------------------------
A0ZJZ0_NODSP/168-288--------------------------------------------------------------------------------
Q2JNR9_SYNJB/173-291--------------------------------------------------------------------------------
B7KDF7_CYAP7/219-329--------------------------------------------------------------------------------
A4J507_DESRM/141-258--------------------------------------------------------------------------------
F4EVS7_SELS3/145-262--------------------------------------------------------------------------------
K9QB89_9NOSO/174-286--------------------------------------------------------------------------------
A8ZV96_DESOH/179-300--------------------------------------------------------------------------------
C9R989_AMMDK/199-320--------------------------------------------------------------------------------
R5PNI3_9BURK/195-316--------------------------------------------------------------------------------
I0I1W5_CALAS/150-266--------------------------------------------------------------------------------
K9WP49_9CYAN/161-281--------------------------------------------------------------------------------
E1QU68_VULDI/131-260--------------------------------------------------------------------------------
H9ZZ94_FERFK/153-293--------------------------------------------------------------------------------
E8T6Q0_THEA1/128-244--------------------------------------------------------------------------------
I0I2Y7_CALAS/165-288--------------------------------------------------------------------------------
G4RMW7_THETK/109-233--------------------------------------------------------------------------------
B7KB41_CYAP7/154-264--------------------------------------------------------------------------------
E6W3H3_DESIS/152-268--------------------------------------------------------------------------------
A9WEP3_CHLAA/149-264--------------------------------------------------------------------------------
A3CNA0_STRSV/121-237--------------------------------------------------------------------------------
K9VUC0_9CYAN/184-304--------------------------------------------------------------------------------
G0VQ62_MEGEL/131-244--------------------------------------------------------------------------------
Q8ZZK8_PYRAE/121-245--------------------------------------------------------------------------------
B9M7F5_GEODF/178-295--------------------------------------------------------------------------------
K9Z6D5_CYAAP/156-268--------------------------------------------------------------------------------
B7JVM6_CYAP8/153-263--------------------------------------------------------------------------------
I7GZK7_9HELI/102-216--------------------------------------------------------------------------------
B3EIY9_CHLPB/190-322--------------------------------------------------------------------------------
B5YHA0_THEYD/183-305--------------------------------------------------------------------------------
Q2RV92_RHORT/175-295--------------------------------------------------------------------------------
K4LGU6_THEPS/201-322--------------------------------------------------------------------------------
B2ITK0_NOSP7/163-275--------------------------------------------------------------------------------
D7BB61_MEISD/120-235--------------------------------------------------------------------------------
D1BQ19_VEIPT/134-250--------------------------------------------------------------------------------
K9WFD7_9CYAN/163-275--------------------------------------------------------------------------------
B8D4R7_DESK1/164-296--------------------------------------------------------------------------------
B0VHA6_CLOAI/114-232--------------------------------------------------------------------------------
K9PEZ2_9CYAN/154-264--------------------------------------------------------------------------------
U5QKR7_9CYAN/153-269--------------------------------------------------------------------------------
Q39T05_GEOMG/185-302--------------------------------------------------------------------------------
A9B3B3_HERA2/187-307--------------------------------------------------------------------------------
D9PZC3_ACIS3/155-292--------------------------------------------------------------------------------
E0STW9_IGNAA/133-249--------------------------------------------------------------------------------
E1QHL8_DESB2/181-300--------------------------------------------------------------------------------
F5YHB2_TREPZ/187-308--------------------------------------------------------------------------------
F6B8N9_DESCC/193-314--------------------------------------------------------------------------------
F8A9J4_THEID/178-299--------------------------------------------------------------------------------
C7RP07_ACCPU/214-336--------------------------------------------------------------------------------
I5B4K9_9DELT/185-305--------------------------------------------------------------------------------
E6N6Z0_9ARCH/137-279--------------------------------------------------------------------------------
V4J6E9_9GAMM/199-322--------------------------------------------------------------------------------
A5G6J6_GEOUR/186-302--------------------------------------------------------------------------------
Q97YE5_SULSO/103-227--------------------------------------------------------------------------------
Q2LQW0_SYNAS/206-327--------------------------------------------------------------------------------
I3TFC5_THEC1/166-297--------------------------------------------------------------------------------
D7CS37_TRURR/124-238--------------------------------------------------------------------------------
F2NN98_MARHT/122-236--------------------------------------------------------------------------------
I3WBS4_THESW/113-229--------------------------------------------------------------------------------
Q74DY6_GEOSL/182-300--------------------------------------------------------------------------------
K9U2M1_9CYAN/157-268--------------------------------------------------------------------------------
A0LHY9_SYNFM/189-311--------------------------------------------------------------------------------
F8AWH3_FRADG/56-175--------------------------------------------------------------------------------
R5D9G4_9FIRM/121-237--------------------------------------------------------------------------------
K9Z2G9_CYAAP/132-249--------------------------------------------------------------------------------
Q0AW55_SYNWW/127-243--------------------------------------------------------------------------------
E8N1C5_ANATU/199-324--------------------------------------------------------------------------------
K9QGU5_9NOSO/132-249--------------------------------------------------------------------------------
A5UUF5_ROSS1/193-311--------------------------------------------------------------------------------
A0B9F8_METTP/179-309--------------------------------------------------------------------------------
Q3IQ75_NATPD/155-284--------------------------------------------------------------------------------
B8HXC7_CYAP4/154-266--------------------------------------------------------------------------------
Q2FM73_METHJ/142-274--------------------------------------------------------------------------------
B1XQV2_SYNP2/146-256--------------------------------------------------------------------------------
H2J4R7_MARPK/152-265--------------------------------------------------------------------------------
A8ABE5_IGNH4/136-253--------------------------------------------------------------------------------
Q0AU02_SYNWW/189-308--------------------------------------------------------------------------------
K9ZE49_ANACC/159-269--------------------------------------------------------------------------------
A1WUQ5_HALHL/173-290--------------------------------------------------------------------------------
H1XUD1_9BACT/171-291--------------------------------------------------------------------------------
K0I7U3_NITGG/134-256--------------------------------------------------------------------------------
A8M9A8_CALMQ/140-275--------------------------------------------------------------------------------
D7BJF9_MEISD/140-264--------------------------------------------------------------------------------
K9Z986_CYAAP/157-276--------------------------------------------------------------------------------
C8W2P2_DESAS/150-266--------------------------------------------------------------------------------
Q5M4I8_STRT2/122-236--------------------------------------------------------------------------------
A9WJU8_CHLAA/202-322--------------------------------------------------------------------------------
L0DVU2_THIND/189-312--------------------------------------------------------------------------------
K9UYS9_9CYAN/166-276--------------------------------------------------------------------------------
A9G7I6_SORC5/239-364--------------------------------------------------------------------------------
K9VAI7_9CYAN/164-284--------------------------------------------------------------------------------
B4S549_PROA2/190-322--------------------------------------------------------------------------------
A3DLD1_STAMF/165-290--------------------------------------------------------------------------------
D4ZUE3_ARTPN/132-249--------------------------------------------------------------------------------
Q8ZZM1_PYRAE/124-248--------------------------------------------------------------------------------
Q53VU8_THET8/136-259--------------------------------------------------------------------------------
R5SKY0_9FIRM/124-242--------------------------------------------------------------------------------
I6XRG2_PROPF/138-250--------------------------------------------------------------------------------
A4YFW1_METS5/128-261--------------------------------------------------------------------------------
K9VP83_9CYAN/158-269--------------------------------------------------------------------------------
CAS6A_SULSO/138-276--------------------------------------------------------------------------------
Q1J2Q0_DEIGD/229-349--------------------------------------------------------------------------------
U5N9J4_9BURK/187-313--------------------------------------------------------------------------------
D5BXY1_NITHN/195-319--------------------------------------------------------------------------------
K9VUL1_9CYAN/157-268--------------------------------------------------------------------------------
B8HZK9_CYAP4/163-283--------------------------------------------------------------------------------
F2NCY6_DESAR/192-310--------------------------------------------------------------------------------
G4RK11_THETK/123-247--------------------------------------------------------------------------------
R6P553_9FIRM/125-241--------------------------------------------------------------------------------
A1RZS7_THEPD/144-262--------------------------------------------------------------------------------
E3IY75_FRASU/114-233--------------------------------------------------------------------------------
G0EG84_PYRF1/160-282--------------------------------------------------------------------------------
B9LX88_HALLT/152-281--------------------------------------------------------------------------------
R5EQX2_9GAMM/149-273--------------------------------------------------------------------------------
R6GYJ4_9FIRM/123-239--------------------------------------------------------------------------------
K9Q0F8_9CYAN/153-272--------------------------------------------------------------------------------
F2NCL0_DESAR/192-312--------------------------------------------------------------------------------
F4B5Q5_ACIHW/132-254--------------------------------------------------------------------------------
K9SF16_9CYAN/154-274--------------------------------------------------------------------------------
F4HFU9_GALAU/181-302--------------------------------------------------------------------------------
K9VE89_9CYAN/176-287--------------------------------------------------------------------------------
K9TTK8_9CYAN/158-269--------------------------------------------------------------------------------
A8AA66_IGNH4/120-231--------------------------------------------------------------------------------
F4BVN4_METCG/195-321--------------------------------------------------------------------------------
A9AX64_HERA2/145-263--------------------------------------------------------------------------------
G4RJS6_THETK/34-142--------------------------------------------------------------------------------
G4SY21_META2/183-306--------------------------------------------------------------------------------
F4B6S4_ACIHW/137-278--------------------------------------------------------------------------------
Q8TVD3_METKA/146-269--------------------------------------------------------------------------------
D4ZX77_ARTPN/162-287--------------------------------------------------------------------------------
Q4J7P9_SULAC/157-282--------------------------------------------------------------------------------
G7ZCD4_AZOL4/213-331--------------------------------------------------------------------------------
K9Y1X1_STAC7/155-269--------------------------------------------------------------------------------
A1RZX7_THEPD/116-251--------------------------------------------------------------------------------
Q4J7R1_SULAC/134-278--------------------------------------------------------------------------------
R6PQ35_9CLOT/170-290--------------------------------------------------------------------------------
F8AW66_FRADG/144-268--------------------------------------------------------------------------------
K9XLZ1_9CHRO/153-265--------------------------------------------------------------------------------
J7LAT0_NOCAA/122-261--------------------------------------------------------------------------------
Q7MC52_VIBVY/165-292--------------------------------------------------------------------------------
E0SSI4_IGNAA/163-304--------------------------------------------------------------------------------
Q5HK95_STAEQ/125-241--------------------------------------------------------------------------------
E0UKL6_CYAP2/154-264--------------------------------------------------------------------------------
K9TQ72_9CYAN/193-313--------------------------------------------------------------------------------
Q01QC2_SOLUE/166-287--------------------------------------------------------------------------------
B1L7L1_KORCO/136-264--------------------------------------------------------------------------------
D3PLA6_MEIRD/120-235--------------------------------------------------------------------------------
D5X8I6_THEPJ/130-246--------------------------------------------------------------------------------
R5DX83_9FIRM/123-238--------------------------------------------------------------------------------
V4IUZ5_9GAMM/183-318--------------------------------------------------------------------------------
Q4J7D4_SULAC/139-263--------------------------------------------------------------------------------
A9AZH6_HERA2/149-264--------------------------------------------------------------------------------
Q8ZZU6_PYRAE/127-237--------------------------------------------------------------------------------
Q65S11_MANSM/165-285--------------------------------------------------------------------------------
Q6ZEI4_SYNY3/146-256--------------------------------------------------------------------------------
E8MZD5_ANATU/156-270--------------------------------------------------------------------------------
B1I4N7_DESAP/204-325--------------------------------------------------------------------------------
D4KCT1_9FIRM/124-240--------------------------------------------------------------------------------
C8XDH3_NAKMY/112-225--------------------------------------------------------------------------------
Q1AT68_RUBXD/185-307--------------------------------------------------------------------------------
D4L090_9FIRM/123-239--------------------------------------------------------------------------------
CAS6_MYCTU/184-299--------------------------------------------------------------------------------
K9REI7_9CYAN/159-279--------------------------------------------------------------------------------
K8GNP3_9CYAN/167-279--------------------------------------------------------------------------------
B5EGG7_GEOBB/173-285--------------------------------------------------------------------------------
F8E951_FLESM/180-296--------------------------------------------------------------------------------
A5UQ98_ROSS1/201-322--------------------------------------------------------------------------------
F9VPJ5_SULTO/122-263--------------------------------------------------------------------------------
G0GAL5_SPITZ/216-341--------------------------------------------------------------------------------
K9TQH4_9CYAN/147-257--------------------------------------------------------------------------------
D3RZU7_FERPA/182-298--------------------------------------------------------------------------------
R7BKP7_9FIRM/123-239--------------------------------------------------------------------------------
F8C651_THEGP/144-257--------------------------------------------------------------------------------
D9QVV0_ACEAZ/146-259--------------------------------------------------------------------------------
D1BQ29_VEIPT/148-260--------------------------------------------------------------------------------
G2SNW3_LACRR/125-241--------------------------------------------------------------------------------
D3RWD2_ALLVD/219-343--------------------------------------------------------------------------------
E4TFF0_CALNY/178-296--------------------------------------------------------------------------------
B8GIG7_METPE/143-274--------------------------------------------------------------------------------
F2NWE0_TRES6/180-299--------------------------------------------------------------------------------
Q9YCN0_AERPE/130-237--------------------------------------------------------------------------------
A4YFU6_METS5/153-293--------------------------------------------------------------------------------
A9B8P4_HERA2/194-316--------------------------------------------------------------------------------
B5YJR6_THEYD/170-291--------------------------------------------------------------------------------
Q6ZED0_SYNY3/150-271--------------------------------------------------------------------------------
A1BI47_CHLPD/189-321--------------------------------------------------------------------------------
H8GGS4_METAL/183-307--------------------------------------------------------------------------------
K9PIY0_9CYAN/160-280--------------------------------------------------------------------------------
B0TFX1_HELMI/206-328--------------------------------------------------------------------------------
F5XNN8_MICPN/117-229--------------------------------------------------------------------------------
E1QQW2_VULDI/142-269--------------------------------------------------------------------------------
Q2FR84_METHJ/137-256--------------------------------------------------------------------------------
B0JKW7_MICAN/158-269--------------------------------------------------------------------------------
Q5SM65_THET8/120-234--------------------------------------------------------------------------------
D0MKP1_RHOM4/203-324--------------------------------------------------------------------------------
Q82XX5_NITEU/191-313--------------------------------------------------------------------------------
M1E8T8_9FIRM/184-306--------------------------------------------------------------------------------
F5YD05_TREAZ/184-300--------------------------------------------------------------------------------
R7K0L3_9CLOT/123-239--------------------------------------------------------------------------------
K9R5X4_9CYAN/163-274--------------------------------------------------------------------------------
K9ZQ95_ANACC/226-336--------------------------------------------------------------------------------
F6CKB2_DESK7/215-335--------------------------------------------------------------------------------

PF08798

E4N250_KITSK/3-213LWLTR....IIPDQRHRD-V..........HCDG...DDAVNLHHRIMSLFP.....DDVPST..E....PRRHL.....
Q1GAI3_LACDA/1-205MYLSR....VEIDTDNRQ-K..........IKDL...SHLGAYHNWVERSFP.....AEIAEG..ERQ............
B1VIX9_CORU7/5-232...TK....IQLNPHRRE-G..........RKLL...SDPQRMHAAVRAAFP.....PELDES..DA.............
Q32CH4_SHIDS/1-198MYLSK....VIIARAWSR-...................DLYQLHQGLWHLFP.....NRPDAA..RD.............
I3Y7Y7_THIV6/4-234.YLLH....CSPDPEALA-IWATRHRLLSPDG.....DDGYALHALLTAAFG.....EQSPKP.................
B6IWM2_RHOCS/29-260.WESR....VVLAPRSPA-A...LQSILGPDMRR...QDGQFAHRMLWTLFP.....DRP.TA..RR.............
B1VNZ6_STRGG/1-237MYLTR....FRVNTGRSE-G..........RRLL...GSPHRVHGAVNASFP.....TPPSRD..GSG.......P....
E4N5A8_KITSK/2-247TYLSR....VRINPLRAA-S..........RTLL...ANPRALHGAVQAGVP.....DQAPGD.................
K4INP2_BIFAP/1-227MYISR....MPLNTARYA-A..........KQLI...ASPYRLHAAVEKSFP.....PGAVRS..GDGG...........
G2IXW9_PSEUL/3-219.WFSR....IRVDLAGLP-H.....DEIQ.RLIA...GDAYLHHALVWRAFA.....K.E.DA..RR.............
G0FR05_AMYMS/1-212MFLSK....LTINVHSRT-F..........RRDY...ANVHDMHRTLMSVYP.....DVPADT..PK...RQAH......
D3VAX8_XENNA/1-223MYLSK....VTLRPSVYP-I.....QAPSLKKTK...NDVYTAHQLLWQLFT.....E...QE..ER.............
I2BC80_SHIBC/1-231MYLSR....IRLRLEQLQ-P.....VMLQ.KWDA...AAPYASHQWLWQLFP.....D...QD..RR.............
Q0W583_UNCMA/1-248MYLSR....LILNPRTRA-V..........RRDL...ADCHELHRTILGGFP.....DLNGKG..GE..ARETF......
E3D0F9_9BACT/1-235MYLSR....LILDPRSRQ-V..........RRDT...GDCQQMHRTLCRAFP.....GTEGKD..PRFRSRAG.......
D1CAI9_SPHTD/1-253MYLSR....LILNPRSRE-V..........RRDL...ADCQQLHRSVMSGFP.....NL.AAP..GD..ARARL......
J7L987_NOCAA/16-239....V....LTLDARHPF-V..........AKSL...VDAQEMHRTVMSGFRGWVEDGSPDAR..SQM............
B5GY64_STRC2/3-305.YLSR....IRINPLRAE-S..........RKLL...ASPRAMHGAVLGGVPGGAGAPGMPGVPGVPGVPGVSEGTEGEQ
Q60AD3_METCA/5-237LYMIE....LRPDPAALI-RFAQDQGLNTHQDQ....DLGYATHAWLKALCG.....ELAPKP.................
A1ARH5_PELPD/1-222MFLSR....LRLNLRCRE-A..........RRDL...SNPYQLHSTLCRAFS.PPETKCPKGE.................
Q0BSC8_GRABC/21-226.........VLLRPSESG-G..........RASG...ERVSAQHHLLWSVFA.....DSE.ER..KR.............
C4ZJY2_THASP/8-234.........CHPDPHRLA-AWATRFGLTAGGD.....DLGYALHTLLAAAFG.....DLAPKP.................
Q2JH26_FRASC/2-267TYLSR....IWLNPLRTG-A..........QALL...KNPQRMHAAVLGGLS.....RQPVTE.................
X4RBI6_9ACTO/5-219...TR....VQLNPARRQ-G..........QKYL...NNPQALHAAVQASFP.....SDVVVK..NE.............
C7LYW5_ACIFD/1-220MFLTR....LYIDPQKQA-A..........LSVL...RNPQRMHAIIAQATS.....ASVPQEANSIG............
F8E3A0_CORRG/2-224..........ILNPNRRQ-G..........RKLL...ANPQAMHAAVRSAFP.....PDIDES..QS.............
Q03C59_LACC3/1-212MYLSR....VQVNTNDHQ-I..........FKHL...THLGAYHDWVKRSFP.....REIAAG..TRL............
K7SNJ1_PROA4/34-264.YLSS....IPINPLRRG-A..........QRLI...TNRQRMHAAILGGVA.....VQPMKE.................
A9GV72_SORC5/1-243MYLSR....ALLNPISRA-V..........RADI...ADIEGLHRTIMRAFP.....DGAGPH..PR...RAH.......
Q4JWK1_CORJK/5-216...TR....LHLNPSSRQ-A..........RKLL...GNPQAMHAAVLSCFP.....KEVSEK..E..............
E3D9L3_GARV3/3-212.YLSR....VEIDYKKPS-S..........LRDL...KSVGAFHNWVEQSFP.....DEWENH..ERS............
A7MFK9_CROS8/1-212MYLSK....ITLPTARLT-P.....ERLM.EMMA...RGEYVMHQWLWELFP.....G...VA..QR.............
Q47PJ5_THEFY/2-224TWLTK....IVPDLRYRQ-T..........RADF...RTAGNLHRKLIRLSS......D.LGE..ERIANPRQQS.....
C8XAY3_NAKMY/1-211MYLTR....FPINRARRG-A..........QKLL...GSPQAMHAAVLSGFP...PANGPSEG.................
R5IV38_9CLOT/1-210MYLTR....MELNTKNMD-T..........IRLL...GSQEKIHGLVESGFS.....GE.....................
C6WMQ8_ACTMD/1-218MFLTK....LTVDVRSRE-F..........RRDL...ANLHEMHRTVMSGYP.....RVEDGS..PA...RQTH......
D7CSJ6_TRURR/1-209MYLSK....LQLNPRAKQ-A..........RRDL...ANPYEMHATLSWAFA.....GREGGR.................
F3ZMY9_9ACTO/3-245.YLSR....IRINPLRTA-S..........RTLL...ASPRALHAQVQGGVP.....TLPNES.................
L0J770_MYCSM/1-219MFLTK....MPIHTRKRG-A..........VKLL...SSPQAMHAAVQSAFP.....PRALED..AGG............
Q0BRF7_GRABC/2-239LHLIH....LPIEARSFA-RWARDRGFGPKGTQ....DNDAVLHHLLTQLFG.....RQMLQP.................
Q7N8H4_PHOLL/1-222MYLSK....IVLRQSSQT-A.....NILA.KLSA...NGVYTSHQLLWKLFS.....T...DE..KR.............
Q6NEQ5_CORDI/6-226.HLVKLPVHIALSVPAKN-K..........PRKGWELTDPSFRHRAVMALFP......DTDSPLPRK.............
C7MTM6_SACVD/3-234.FLSR....IRINPFRQK-S..........RELL...ANPHKTHGAVLAGLP......DPEAE.................
C1DSI0_AZOVD/1-204MYLTR....LTLDPRSAQ-A..........RRDL...ADAYDMHRTLVRAFV.....RDERDA..PG.............
Q314I5_DESAG/1-218MWMSK....LVLDPRRA.-.............VG...KNLYDTHRLLWNLFA.....DAP.DR..TR.............
D6YAN0_THEBD/1-227MYLTR....FRFNTARVG-A..........RRLL...SSPQRLHAAVMSAFA.....EPPPAP..SGG.......P....
J9VY84_LACBU/1-220MYLSR....VEIDLNNRQ-K..........IKEL...THLGAYHNWVEQSFP.....DEIAEH..TRL............
Q825C0_STRAW/3-217VWLTR....IVPDPRSRD-A..........RRDLGGNDSAMGLHRRLMSLYP.....CD.AGP..D....PRARF.....
B0S4B5_FINM2/1-205MYLSR....VMLKDNQNY-R..........NYVY...TNLQYFHKWVEESFP.....NEFKEN..IRT............
V6KHH8_STRNV/6-213..LTR....IQLNPRHPS-V..........IKDL...ADAVGLHRTIMRLAP.....HD.LGD..R....AREQA.....
A9HLC4_GLUDA/5-226.FLSR....IALRRDA.P-VRALARLLVP.DGEG...RQHAAAHHLLWALFG.....DDP.DR..TR.............
A6W167_MARMS/1-222MYLSK....VSFQASQQA-R.....QLLL.GFGG...KGVYSTHQMLWQLFT.....E...ED..ER.............
D1A6Q6_THECD/5-212LWITQ....IIPDLRDRA-A..........RDDL...GDVVRLHRRIMSLFP......DGLGP..E....ARRRA.....
D6ZIM7_MOBCV/5-218...TK....ILLNPARRQ-G..........RKLL...TNPQAVHAAVCACFP.....PDMNQN..QG.............
G2KWT8_LACSM/1-220MYLSR....VQIDVNNRQ-K..........TKSL...THLGAFHNWIEHCFP.....DEIRAH..KRY............
H8GLK4_METAL/1-204MYLSK....IHIPWHQAK-...................NPYQFHQALWRLFP.....GQDEST..RD.............
B8IZA5_DESDA/2-205TWMTR....FMVELPALH-...........RNRL...SDCYAWHKAIWQCFP.....NRPDAS..RD.............
B8IMR1_METNO/3-240LHLSR....LRLRRDP.D-VAALAHLLLP.KTEG...ARVAAGHRLLWSLFA.....DSP.DR..AR.............
R6Q6M2_9FIRM/1-206MYLSR....VELDPIRRS-T..........MTAL...AAPQKFHGAVESAFS.....GE.....................
A5GBK0_GEOUR/3-226.WLAR....LEVDAETVR-A..........AGIS...EDVYAWHKLLWECYP.....DQPEAE..RD.............
F0RQX4_DEIPM/1-214MYLSR....LFLNDHSKQ-A..........AADL...RSAYGLHQTLRWAFP.....NAGEEN..GP..LPEGE......
D1CGD5_THET1/2-229LYLSR....LRLQPRHRD-V..........QKDL...SNCHALHSRILSAFPLLPTPSSPRAE..MG.............
A4XYT8_PSEMY/1-202MYLTR....LTLDPRSAQ-A..........RRDL...ADAYEMHRTLARAFV.....TDEHSA..PA.............
B8HWH7_CYAP4/1-204MYLSK....LVLNERDRT-V..........QRDL...SNVHALHQRIMQAFP.....DEQREN..PRA............
Q67RN9_SYMTH/1-223MYLSL....LRLNPASAA-V..........QRDL...RDVQALHQRVMSAFP.....DV..LD..PEVEARAYF......
Q1J366_DEIGD/4-210LYLSR....LRFEDRDRR-T..........ARDL...ASPYALHQTLRWAFA.....GAGVEG..AP..LPDGE......
K7SEU6_GLUOY/4-237LYLSR....ARLRRDSQA-LSALSSLLLP.HDTS...AQIKSGHHLIWALFG.....DTP.ER..NR.............
W5TGY3_9NOCA/19-245...SI....LTLDARHPF-V..........LKSL...HDAQDMHRTVMSGFLGWVEDGQPEAR..KLM............
Q2RXJ4_RHORT/4-241LYLIS....LPLDMVSFH-RWAGQRGIGT........DEGRALHHLLGESFG.....KGVLQP.................
A5FTJ9_ACICJ/1-224MWLSK....ARLNHDQKA-VAALASVLVP.EDGS...ARVAATHHLVWSLFA.....GDA.DR..KR.............
G4SY61_META2/1-204MYLSK....VFIDFKKPK-...................NIYQIHQDLWKLFP.....GQDDKV..RS.............
J7L4F7_NOCAA/1-247MYLTR....FRLNTHRAG-A..........RKLL...SSPQTMHAAVLGGLP.....EKLPTT..SGS.......SGAED
CAS6_THET8/1-211MWLTK....LVLNPASRA-A..........RRDL...ANPYEMHRTLSKAVS.....RALEEG.................
B7KJ27_CYAP7/1-214MYLSK....IELNIRSSA-V..........STDL...SDCHKLHQRVMQGFPNENNPEYRSEA.................
W5WPN4_9CORY/1-214MYLSR....MELHPRRRG-A..........RELL...SSPGKMHGAVMDAFP.....RDLINE..K..............
W8KR76_HALHR/1-229MYLSR....VVVDLNGLS-R.....GTLF.EIMG...AGAYAAHQLLWRLFP.....D.H.QG..PR.............
R6BMI8_9CLOT/1-206MYLTQ....MRLDMNNHR-T..........LSAI...SAPNKLHGALESSFP.....GE.....................
A0LM55_SYNFM/1-201MYLSL....LSLDRLHRG-T..........MRLL...SDIYLLHKGIMSGFT.....RCGDGL.................
F2GBG6_ALTMD/1-221MFLSK....VTMVSSPQT-A.....QELA.KLQR...NGVYASHQLIWQLFS.....N...VT..ER.............
A8LMM7_DINSH/4-255.YLAR....LPVDLPALA-RAAGERGWTRGRRAAF..DEGRALHHLLAETFG.....PGALQP.................
I4CC95_DESTA/1-227MYFSR....IRLDGERAS-A.....AELT.KMIG...QDGYGDHQIIWQLFK.....CAD.KS..ER.............
D7BDY1_MEISD/1-207MYLSR....LLLDPRHKQ-A..........RTDL...ANPYQMHATLCHAFA.....EPEQTP..PR.............
F4H8A3_CELFA/1-228MYLSR....IQLNPQRRD-A..........RRLL...GSPQRLHAAVLASYP.....DAPTGA..LDG......AP....
G2PH26_STRVO/4-213LWLTR....IIPDLRSRQ-A..........RRDL...ASAVGMHHRVMQLFP......DTAAE..Q....ARAAL.....
B8GIV2_METPE/3-224..ISK....IQLNADASD-H.....PAFW.EHVG....GAYQAHSLIWDLFS.....DGP.ER..ER.............
A5UR13_ROSS1/1-236MYLSR....LILDVRQPR-V..........RRDL...SDVYRLHRTILSAFP.....QA.PDN..VP..ARAHF......
K4QSD2_9ACTO/21-242....V....LTMDARHPY-T..........AKSL...VDAQDMHRTVMSGFRGWVADGAPDAR..AQM............
D3V5E3_XENBS/1-222MYLSK....VTLRPSAYR-E.....QFLS.KMAK...NSVYSSHQLLWQLFT.....E...QV..ER.............
K0JYJ1_SACES/1-217MHLTR....FEINPARRA-A..........RDLL...ASPQKIHAAVMAAFP.....STANAA..EAG............
F2NLA6_MARHT/1-206MWISK....LVLNPRSKA-V..........RRDL...ANPYEMHRTLSRAVA.....EALGTQ.................
F2NAL6_CORGP/1-225MYISK....VPLNMARPD-T..........IRFI...SSPYKVHAAVEQSFS.....PLAKRA..GDDC...........
B2GBK0_LACF3/13-222VYLSR....VEIDTKNRR-K..........IKDL...TNLGAYHNWIEQSFP.....DEIQKG..IRK............
C3PF96_CORA7/4-227..LTK....ILINPQLRQ-G..........RKLL...TNPHAMHAAVSAAFP.....PDIDTD..EA.............
Q5YRB7_NOCFA/1-222MFLSR....VPLNPARQG-T..........RKLL...SSPQAAHAAVLAAFP.....PQPSTP..GTG............
R7C5Y6_9CLOT/4-210MYLSR....VELDISKKQ-T..........QVAL...SARNKFHGAIENTFF.....GEDDE..................
D1A5U1_THECD/1-227MYLTR....FRFNTARVT-A..........RRIL...SSPQMLHAAVMSSFA.....TPPVQE..DDG.......P....
F7XPH1_METZD/1-225MYMTK....AEILPDKVF-D.....KDVW.NKLQ....NTYSIHQLVWSLFS.....KKP.DD..KR.............
C7QEM3_CATAD/1-234MYLTR....FRFNTARTG-A..........RRLL...TSPQILHAAVMQSFA.....N.VPAL..PDG.....NSP....
X2HBF6_9GAMM/1-222MYFSR....VTLKLNQLP-Y.....IMQQ.KMQN...SGPYAIHQWLWQLFP.....N...QG..KR.............
Q8ZMF1_SALTY/1-212MYLSR....ITLHTSELS-P.....AQLL.HLVE...RGEYVMHQWLWDLFP.....G...SK..ER.............
F7V5D4_CLOSS/1-209MYLSR....VEIDVRNRR-K..........IKDL...THLGAYHNWVECSFP.....NEWKES..IRS............
C7JIG8_ACEP3/5-227.FLSR....VALRRDA.S-VQALAGLLVP.QGEG...RQHGAAHHLLWVLFG.....DDS.SR..IR.............
F4F6M1_VERMA/1-220MFLTR....FQINAARRN-A..........RKLL...SSPHAMHAAVRAAFA.....DAADYE..RPGV...........
H2KA43_STRHJ/1-258MYLTR....ARINVARPG-A..........RRLL...GSPQALHAAVMSSFP.....SLLPAA..PSATPAQQQGP....
D5QGJ9_KOMHA/5-227.FLSR....VALRRDA.A-VQAIAALLVP.QGEG...RQHGAAHHLLWTLFG.....DTP.DR..RR.............
W5XRF5_9CORY/5-230...SK....LMLNPLRRQ-G..........AKLL...TQPQALHAAVAGAFP.....PDVSTD..ES.............
D7B2M5_NOCDD/1-237MYLTR....FRFNTHRPG-A..........RKLL...SSPQALHAAVMGSYA.....DLLPSD..TGG.......P....
Q74DC7_GEOSL/1-201MYLSK....VLINGTACR-...................NPYEIHRVLWKLFP.....EDADAE..RD.............
G2I4Z3_GLUMN/5-233.FLSR....VALRHEA.S-VQAIIRLLVP.GSAG...QQHGAAHHLLWALFG.....DTP.ER..RR.............
D8PDH7_9BACT/7-231.WLSR....ISLRGDVGC-KQLVGMGEL..DL........YGQHRALWKLFT.....VAPEDRTERA.............
Q0RTG6_FRAAA/28-266TYLSR....VWLNPLRTG-A..........QSLL...RNPERMHAAVLGGLT.....RQPVTE.................
Q1R113_CHRSD/1-229MYLSS....VRVDLNALT-R.....EQLF.DVLE...GGAYTAHQLLWTLFA.....DTS.EG..ER.............
W5YA73_9CORY/5-211...TR....ILLNPERRQ-A..........RKLL...TNPQAMHAAVRGAFP.....PDLS.D..ES.............
Q2FNT6_METHJ/1-225MFFSK....MTLDREAAI-S.....GRFR.DLVT....GPYQVHEVIWDLFA.....DHP.DR..KR.............

PF09559

I3Y6I2_THIV6/19-221VDVLFAIDCKRLPV-----------------------DHAHLLSTALQAALP----------------------------
K9XG27_9CHRO/19-215INLSFSVTGESFPA-----------------------DHGYGLYSALTHWNH----------------------------
K8GDJ5_9CYAN/5-213.EIQFALQGKTLPA-----------------------DHGYALYSAVKKRLQ----------------------------
A1WYF2_HALHL/43-242VDVAFPLRGRVLPE-----------------------AYAVPLADALAPRLA----------------------------
L0GUP4_9GAMM/19-220VDVQFAIDAKRIPV-----------------------DHGCALGEAVLAALP----------------------------
B1WUU2_CYAA5/5-214.EIQCSVRGKTLPA-----------------------DHGYALYSAIKHICK----------------------------
A9GDE4_SORC5/9-194VDIAFHLAANLVPL-----------------------DHGYALFGAICRIAG----------------------------
S6AB47_9PROT/13-201.EVHFELQGTLLPR-----------------------DHGYPLFLELSRLLP----------------------------
K9UJP2_9CHRO/24-218.DYLFPVEGQSIGV-----------------------DHAHPLYGGISQIIP----------------------------
L0D6C1_SINAD/4-204IDLSFNIIGTTIPL-----------------------DHGYSLFSALCRVVP----------------------------
B7KMS1_CYAP7/17-211VDLNFQVLGNILPA-----------------------DHGYGLYAALTHWNP----------------------------
U5QID9_9CYAN/4-208VELDFGISGSSLPA-----------------------DHGYPLFSALSESVP----------------------------
A1AWQ7_RUTMC/20-216.DAVFNIFAKILPI-----------------------NHSFLLAQTLLKHLP----------------------------
G2LKY9_CHLTF/7-196VEMRFYLSGERLPV-----------------------DHGYLLYAALSHLLP----------------------------
Q8F1E7_LEPIN/7-203IELNFPVLGSLLPA-----------------------DHGYGLYSAICHLCP----------------------------
D5ECJ4_AMICL/2-214VDLEFQLHGKTIDA-----------------------DHGYQLYSAITDILP----------------------------
H5WQR3_9BURK/14-206VDLVFPLAGRTLPR-----------------------DHRLALAQALEAAAP----------------------------
Q0A841_ALKEH/18-217VDVTFRLEGHSLPA-----------------------DYAPALAEALADPLA----------------------------
D3RSM8_ALLVD/19-226VDLLFAIDCKRLPV-----------------------DHAYALSSAVRALVP----------------------------
K9YQR8_CYASC/5-205INLVFPVQGNLLWA-----------------------DNNYRLYATLCRICP----------------------------
K9XVY7_STAC7/5-218.EIQFALKGKTLPA-----------------------DHGYSLYSALKNIVL----------------------------
B8GUE2_THISH/18-218IDVSYRIDCRCLPL-----------------------DHAHALSSAVLAALP----------------------------
D5CSI5_SIDLE/9-195IDLVFEISGGTLPI-----------------------AYHYELWDELTRLVP----------------------------
B7JW14_CYAP8/13-212.DMIFKLRGAPIPL-----------------------DNGYVIYSALCRICP----------------------------
B7KHP0_CYAP7/13-209IDLKFPVSGHTIPL-----------------------NHGYPLYSAISHQFP----------------------------
CAS6_MYXXD/31-219VDLLFPVQGGPVPL-----------------------DHAYLLFSALSRHLP----------------------------
L0DSG3_THIND/18-218VDVAYRIDCPRLPL-----------------------DHAHALSSALLELLP----------------------------
S6BKH6_9GAMM/19-222IDLAFSIQCRELPV-----------------------DHLYALGSALCEAAP----------------------------
K9RC65_9CYAN/23-224VDLTFKLRGAPIPL-----------------------DNGYVIYSALSRICP----------------------------
Q1CW34_MYXXD/5-192.DLLYPVRGGPVPL-----------------------DHGYALFSALCTRVP----------------------------
V4IWF5_9GAMM/19-219VDVLFALDCRSIPV-----------------------DHAFALSQALLDPAP----------------------------
K9RR28_SYNP3/19-213VELCFAVVGQTLPA-----------------------DHGYGLYSAIVHRCP----------------------------
W0E0S8_MARPU/19-220VELVFAIDCRALPV-----------------------DHADALHRALIVAQP----------------------------
B1XPP5_SYNP2/5-214.EVQFELRGKTLPA-----------------------DHGYSLYSGIKQIW.----------------------------
Q3SG16_THIDA/19-210IDLQFELAGSTIPA-----------------------DNAQMLCDALLGVLP----------------------------

PF03787

Q1Q3H4_9BACT/4-335--------------------------------------------------------------------------------
Q8TPH7_METAC/4-317--------------------------------------------------------------------------------
O57906_PYRHO/18-333--------------------------------------------------------------------------------
B3EIY8_CHLPB/11-320--------------------------------------------------------------------------------
A6LNL6_THEM4/4-297--------------------------------------------------------------------------------
A4XFP8_CALS8/12-334--------------------------------------------------------------------------------
Q3AA80_CARHZ/5-311--------------------------------------------------------------------------------
A7HMV5_FERNB/4-324--------------------------------------------------------------------------------
A2VLF2_MYCTX/11-314--------------------------------------------------------------------------------
Q0AW54_SYNWW/12-313--------------------------------------------------------------------------------
H3UYT7_STAEP/9-268--------------------------------------------------------------------------------
Q03KS9_STRTD/11-288--------------------------------------------------------------------------------
A2BKQ7_HYPBU/87-311--------------------------------------------------------------------------------
Q2LQX1_SYNAS/103-281--------------------------------------------------------------------------------
I8UHN2_PORGN/59-251--------------------------------------------------------------------------------
A5I3U2_CLOBH/73-293--------------------------------------------------------------------------------
Q8TVU2_METKA/491-691--------------------------------------------------------------------------------
A1WUQ4_HALHL/82-287--------------------------------------------------------------------------------
A9AWU2_HERA2/90-292--------------------------------------------------------------------------------
Q1CW33_MYXXD/74-261--------------------------------------------------------------------------------
Q977D5_SULTO/23-210--------------------------------------------------------------------------------
A8A9P3_IGNH4/77-241--------------------------------------------------------------------------------
A1RZR1_THEPD/18-247--------------------------------------------------------------------------------
G2TF03_RHORU/11-210--------------------------------------------------------------------------------
M1IFS5_9CREN/8-222--------------------------------------------------------------------------------
A4YFX5_METS5/9-241--------------------------------------------------------------------------------
M1IF98_9CREN/8-291--------------------------------------------------------------------------------
A8F3D7_THELT/30-277--------------------------------------------------------------------------------
A4FJY4_SACEN/194-372--------------------------------------------------------------------------------
A4YFW9_METS5/24-229--------------------------------------------------------------------------------
G2T688_RHORU/19-223--------------------------------------------------------------------------------
G2TF03_RHORU/253-439--------------------------------------------------------------------------------
Q5LZX3_STRT1/11-194--------------------------------------------------------------------------------
A5UWG2_ROSS1/10-302--------------------------------------------------------------------------------
Q2JNS6_SYNJB/14-218--------------------------------------------------------------------------------
A9WGF2_CHLAA/265-444--------------------------------------------------------------------------------
A7NFU0_ROSCS/21-222--------------------------------------------------------------------------------
O66706_AQUAE/7-289--------------------------------------------------------------------------------
A6LNK3_THEM4/7-272--------------------------------------------------------------------------------
A6UNE9_METVS/9-264--------------------------------------------------------------------------------
Q2FL77_METHJ/279-403--------------------------------------------------------------------------------
A1WUQ2_HALHL/9-296--------------------------------------------------------------------------------
Q8TVT9_METKA/8-335--------------------------------------------------------------------------------
Q47PK3_THEFY/7-290--------------------------------------------------------------------------------
Q2JRT2_SYNJA/7-252--------------------------------------------------------------------------------
A0YUX6_LYNSP/8-262--------------------------------------------------------------------------------
A0YQJ5_LYNSP/5-273--------------------------------------------------------------------------------
A8A9P1_IGNH4/9-272--------------------------------------------------------------------------------
CMR4_SULSO/14-302--------------------------------------------------------------------------------
Q97XK7_SULSO/7-290--------------------------------------------------------------------------------
A3MVP2_PYRCJ/10-303--------------------------------------------------------------------------------
Q2JNS1_SYNJB/20-216--------------------------------------------------------------------------------
A5UT82_ROSS1/9-185--------------------------------------------------------------------------------
Q2FL76_METHJ/14-206--------------------------------------------------------------------------------
B8G728_CHLAD/8-184--------------------------------------------------------------------------------
M1LLF0_9SYNC/7-200--------------------------------------------------------------------------------
B0K2G5_THEPX/4-192--------------------------------------------------------------------------------
A9AUN2_HERA2/7-194--------------------------------------------------------------------------------
Q7MC47_VIBVY/7-190--------------------------------------------------------------------------------
A3DH28_CLOTH/14-216--------------------------------------------------------------------------------
A4YFX0_METS5/20-218--------------------------------------------------------------------------------
Q2JRT5_SYNJA/129-478--------------------------------------------------------------------------------
Q2FL77_METHJ/16-208--------------------------------------------------------------------------------
A4TG45_MYCGI/12-250--------------------------------------------------------------------------------
A4XGU1_CALS8/51-316--------------------------------------------------------------------------------
Q0ATZ2_SYNWW/170-634--------------------------------------------------------------------------------
B0K8W5_THEP3/133-594--------------------------------------------------------------------------------
A3DH27_CLOTH/31-251--------------------------------------------------------------------------------
A3DKC8_CLOTH/235-405--------------------------------------------------------------------------------
M1MPL7_9SYNC/156-674--------------------------------------------------------------------------------
Q82XX3_NITEU/10-223--------------------------------------------------------------------------------
A3DH32_CLOTH/9-175--------------------------------------------------------------------------------
A6NTP4_9FIRM/14-168--------------------------------------------------------------------------------
Q7MC49_VIBVY/10-189--------------------------------------------------------------------------------
A0RRG9_CAMFF/11-179--------------------------------------------------------------------------------
A3DKC8_CLOTH/16-186--------------------------------------------------------------------------------
A0YPM8_LYNSP/30-210--------------------------------------------------------------------------------
D2C6C1_THENR/8-159--------------------------------------------------------------------------------
Q8PRT5_METMA/8-181--------------------------------------------------------------------------------
O26428_METTH/15-144--------------------------------------------------------------------------------
A7NRR3_ROSCS/6-141--------------------------------------------------------------------------------
C9RCS1_AMMDK/9-145--------------------------------------------------------------------------------
C9RCG8_AMMDK/9-178--------------------------------------------------------------------------------
A5UWG6_ROSS1/4-173--------------------------------------------------------------------------------
A7NRS6_ROSCS/4-175--------------------------------------------------------------------------------
A5D4F7_PELTS/4-177--------------------------------------------------------------------------------
B3EIR8_CHLL2/6-173--------------------------------------------------------------------------------
B4S552_PROA2/12-192--------------------------------------------------------------------------------
A6DAG1_9PROT/9-198--------------------------------------------------------------------------------
C7P6D1_METFA/9-230--------------------------------------------------------------------------------
B7IGV5_THEAB/8-173--------------------------------------------------------------------------------
D3T315_THEIA/9-219--------------------------------------------------------------------------------
O28411_ARCFU/9-154--------------------------------------------------------------------------------
CMR1B_PYRFU/7-178--------------------------------------------------------------------------------
D3T7Q1_THEIA/22-173--------------------------------------------------------------------------------
B0M908_9FIRM/9-142--------------------------------------------------------------------------------
C5D4N4_GEOSW/18-161--------------------------------------------------------------------------------
Q53W07_THET8/34-193--------------------------------------------------------------------------------
A9AWU5_HERA2/41-244--------------------------------------------------------------------------------
D2ZTS9_NEIMU/25-187--------------------------------------------------------------------------------
D0W1J3_NEICI/30-211--------------------------------------------------------------------------------
E6XI85_SHEP2/30-186--------------------------------------------------------------------------------
D1Y2F0_9BACT/26-187--------------------------------------------------------------------------------
Q1IZR9_DEIGD/24-191--------------------------------------------------------------------------------
D3PS14_MEIRD/23-188--------------------------------------------------------------------------------
D2Z4K2_9BACT/26-193--------------------------------------------------------------------------------
C5BIW8_TERTT/31-214--------------------------------------------------------------------------------
Q9KFY9_BACHD/34-207--------------------------------------------------------------------------------
C8WRP6_ALIAD/23-238--------------------------------------------------------------------------------
Q1CW28_MYXXD/33-206--------------------------------------------------------------------------------
D3SNA7_THEAH/10-153--------------------------------------------------------------------------------
Q2LQW6_SYNAS/16-162--------------------------------------------------------------------------------
B6IX20_RHOCS/283-454--------------------------------------------------------------------------------
A8DJU4_9BACT/304-514--------------------------------------------------------------------------------
C8W3E8_DESAS/7-167--------------------------------------------------------------------------------
B8GSG8_THISH/11-176--------------------------------------------------------------------------------
B7R675_9THEO/7-162--------------------------------------------------------------------------------
O66703_AQUAE/10-154--------------------------------------------------------------------------------
Q47PK0_THEFY/7-173--------------------------------------------------------------------------------
A6LNK0_THEM4/7-158--------------------------------------------------------------------------------
B7IFF0_THEAB/10-183--------------------------------------------------------------------------------
A8UTQ9_9AQUI/7-200--------------------------------------------------------------------------------
B2V8M0_SULSY/7-150--------------------------------------------------------------------------------
A8V361_9AQUI/9-167--------------------------------------------------------------------------------
A8M9C0_CALMQ/7-192--------------------------------------------------------------------------------
Q96Z54_SULTO/9-305--------------------------------------------------------------------------------
CMR1_SULSO/9-255--------------------------------------------------------------------------------
D2PID8_SULID/27-180--------------------------------------------------------------------------------
D0KVA4_SULS9/24-174--------------------------------------------------------------------------------
C4KFX7_SULIK/27-177--------------------------------------------------------------------------------
Q8TPH8_METAC/9-242--------------------------------------------------------------------------------
A6UVY5_META3/7-263--------------------------------------------------------------------------------
A0A038KP63_MYCTX/9-193--------------------------------------------------------------------------------
Q5HK92_STAEQ/9-199--------------------------------------------------------------------------------
Q9X2C8_THEMA/9-196--------------------------------------------------------------------------------
A3DLB2_STAMF/6-246--------------------------------------------------------------------------------
B8GB50_CHLAD/99-293--------------------------------------------------------------------------------
A1ZVA0_9BACT/4-254--------------------------------------------------------------------------------
A5ILN4_THEP1/4-318--------------------------------------------------------------------------------
Q46CS3_METBF/9-174--------------------------------------------------------------------------------
A6DAF6_9PROT/10-162--------------------------------------------------------------------------------
Q2FL73_METHJ/7-220--------------------------------------------------------------------------------
A0ZJ98_NODSP/7-256--------------------------------------------------------------------------------
A4XGT8_CALS8/240-441--------------------------------------------------------------------------------
A9AUN3_HERA2/7-220--------------------------------------------------------------------------------
A3DKC7_CLOTH/8-205--------------------------------------------------------------------------------
Q8TVR9_METKA/10-323--------------------------------------------------------------------------------
Q8TVU2_METKA/6-335--------------------------------------------------------------------------------
Q6L316_PICTO/4-317--------------------------------------------------------------------------------
Q97CJ4_THEVO/4-334--------------------------------------------------------------------------------
CSM5_METJA/49-345--------------------------------------------------------------------------------
A6DE72_9PROT/4-332--------------------------------------------------------------------------------
O27150_METTH/4-274--------------------------------------------------------------------------------

PF09700

A0B6W4_METTP/4-358LRITPVDSWFFRDGRPFH.LGEATS.DVGGLFPPSAFTVVGAIRAHLARSMGWRE...GKWSEEICRVL...........
O28413_ARCFU/3-341LVMKPYDSLLFREPRPFD.VNNH....VARTILPLPQTLAGAVRSAIYVKYGSKV...KDLIGFGKE.............
A6VYS5_MARMS/4-381FVLNPLDPLIIRSSRPFE.AISD....AEAAKFPPPSTIAGALRNIHGRTIGIDF...NDRNNQEQL.............
Q47PK4_THEFY/13-381IAFEPHDTVHVRDGRQFS.SRDSNT.ALAETVIPRPSTIAGAAASAYGGDLT............................
Q9KFY7_BACHD/8-408IRIRPLDPLMVRDGRPFK.DSPGAR..AYSMMDVVPGVIAGTVRTMLAEQAAKSS............RV...........
Q1CW30_MYXXD/6-386FALLPRDGLSAKDGRGWY.TSEVGR..GYSLPWPLPTTVRGALRAAWGHDAMAVS...GAVLAPDEWERC.........S
Q2JN53_SYNJB/4-377FTLSPLDVWMFRDAKPFA.PGERAW..ANSSFPPSGHTLAGAVQAYLGQPLT............................
A9AWU6_HERA2/68-470WLIEPRDPLIVRDGRPFN.NTPGAR..AYTQSFPPPSVLAGVIRSQTAYASKLQF...TRNSDDNRH.............
A1WUQ1_HALHL/5-362RYIEPQDVLFFRGNRLFG.EPGNA...GAALMPPWPSVFAGALRSAMLSAAGADP...AQLRSGELPAPLD......TVL
A5D0Z3_PELTS/4-387WVIEPRDPLIARDGRPFG.PVPGAR..AFTLAFPFPSTIAGAVRTRDGLDASGRF............QP...........
Q8TVU0_METKA/10-439FLVLPQDRAFFRRPEPFR.AAAES...VAESEGPKPWTVAGCVRNALLEVTDGDL...GEVLEYPRKLVRSA.....PPG
Q6ZEA9_SYNY3/4-365YSLTPLDILLLRDAKPFT.PGDRAW..AGSIFPPNGHTLAGAVRSLLPQNQT............................
Q1IZS1_DEIGD/6-393LELQPLAPLLLRDGRPFAGGGEESR..AQSLPLPLPHTLAGFIRTQLGEGRGLKW...RNLSDDALRR............
Q7MTH3_PORGI/6-391IKLTPLDKFFFGQKKTFG.DDNANY.FVYSSLFPQQTTLLGLLRYQLLQIAGEEIFKDNKIQDEHKAGELIGKQSFSPFV
A9AVY8_HERA2/6-387WLIQPFNSLVIADGRPFE.NQPGAR..AKSLSFPPPSVTVGGFRARAGVKANYNF...SAKLSDPEY.............
Q8R6Z6_THETN/4-372FKITPYDVFFFGSGRPFN.VGD.....VVYSIFPHPHTLAGAICTKIHAHTKIDT...SRILK.................
Q1AZD9_RUBXD/4-359YGIEALDTLFFGDGSPFD.AGETGQIEVTGVFPPSPTTVVGALRAAFARELGWRC...GDWPENVKAKL...........
G2LF94_CHLTF/11-373.CLEALDVLFFRDGRPFM.DGTE....QMLSGLPLPQTLAGAICTALMQAAGCDF...GRLRHALEEGKPFAEAVREACS
Q53W08_THET8/2-351.LIEPRDPLIVRDGRPFT.NSPGAR..AKSLPFPLPQTLAGAYRTRRALLEGLPL...PERAEEVLR.............

PF09704

Q2MF31_STRSD/16-248--------------------------------------------------------------------------------
Q7NYP8_CHRVO/13-224--------------------------------------------------------------------------------
A1ARH6_PELPD/3-217--------------------------------------------------------------------------------
Q12YA8_METBU/4-236--------------------------------------------------------------------------------
Q0BSC7_GRABC/6-215--------------------------------------------------------------------------------
A8ABL4_IGNH4/3-275--------------------------------------------------------------------------------
A6W168_MARMS/4-241--------------------------------------------------------------------------------
O66696_AQUAE/3-211--------------------------------------------------------------------------------
A8ZZ17_DESOH/3-251--------------------------------------------------------------------------------
Q1EQJ4_STRKN/3-213--------------------------------------------------------------------------------
A5UR14_ROSS1/3-244--------------------------------------------------------------------------------
H6NZD8_SALTI/4-233--------------------------------------------------------------------------------
Q3A5Z4_PELCD/3-236--------------------------------------------------------------------------------
C1DSH9_AZOVD/3-205--------------------------------------------------------------------------------
Q5YRB6_NOCFA/3-211--------------------------------------------------------------------------------
Q1CWU1_MYXXD/10-210--------------------------------------------------------------------------------
A3DLC5_STAMF/3-270--------------------------------------------------------------------------------
A4J385_DESRM/4-212--------------------------------------------------------------------------------
CAS5_MANSM/4-216--------------------------------------------------------------------------------
Q8KDC0_CHLTE/7-228--------------------------------------------------------------------------------
Q2P7C5_XANOM/4-215--------------------------------------------------------------------------------
Q9X2C0_THEMA/3-212--------------------------------------------------------------------------------
Q03C60_LACC3/3-210--------------------------------------------------------------------------------
I6UXT4_9EURY/3-239--------------------------------------------------------------------------------
Q47PI7_THEFY/3-209--------------------------------------------------------------------------------
O28407_ARCFU/3-252--------------------------------------------------------------------------------
Q2SID2_HAHCH/4-215--------------------------------------------------------------------------------
CAS5_METJA/5-228--------------------------------------------------------------------------------
G7QLA9_LEPII/11-225--------------------------------------------------------------------------------
O27159_METTH/3-241--------------------------------------------------------------------------------
B3E5U9_GEOLS/3-263--------------------------------------------------------------------------------
Q04QB7_LEPBJ/4-240--------------------------------------------------------------------------------
Q60AD2_METCA/3-241--------------------------------------------------------------------------------
Q2RL62_MOOTA/18-224--------------------------------------------------------------------------------
A5GBK2_GEOUR/12-223--------------------------------------------------------------------------------
E3ITF8_DESVR/10-218--------------------------------------------------------------------------------
Q0W584_UNCMA/6-214--------------------------------------------------------------------------------
Q1NKD4_9DELT/4-199--------------------------------------------------------------------------------
A4YFV1_METS5/10-233--------------------------------------------------------------------------------
A8LYZ7_SALAI/3-226--------------------------------------------------------------------------------
B1XDH0_ECODH/4-214--------------------------------------------------------------------------------
Q0AZP3_SYNWW/4-212--------------------------------------------------------------------------------
Q1R114_CHRSD/4-250--------------------------------------------------------------------------------
C3MMV7_SULIL/5-232--------------------------------------------------------------------------------
G2TC86_RHORU/4-212--------------------------------------------------------------------------------
Q5P3Y6_AROAE/8-203--------------------------------------------------------------------------------
Q314I4_DESAG/4-228--------------------------------------------------------------------------------
A1SV73_PSYIN/3-198--------------------------------------------------------------------------------
Q1EQS9_STRKN/13-242--------------------------------------------------------------------------------
A0A025A1M5_ECOLX/4-233--------------------------------------------------------------------------------
A6TNS2_ALKMQ/6-209--------------------------------------------------------------------------------
B4SAU9_PELPB/4-206--------------------------------------------------------------------------------
Q1H3R5_METFK/4-216--------------------------------------------------------------------------------
Q67RP0_SYMTH/3-220--------------------------------------------------------------------------------
Q2JWC5_SYNJA/3-192--------------------------------------------------------------------------------
B1YHA3_EXIS2/4-198--------------------------------------------------------------------------------
C8RRP0_CORJE/4-209--------------------------------------------------------------------------------
Q7N8H5_PHOLL/4-236--------------------------------------------------------------------------------
Q60B28_METCA/3-213--------------------------------------------------------------------------------
Q2LX12_SYNAS/8-216--------------------------------------------------------------------------------
B8I205_CLOCE/4-212--------------------------------------------------------------------------------
G2T7M5_RHORU/6-238--------------------------------------------------------------------------------
C1DNX2_AZOVD/4-215--------------------------------------------------------------------------------
Q0AA33_ALKEH/3-231--------------------------------------------------------------------------------
D3SKA4_DEHMG/6-199--------------------------------------------------------------------------------
Q47PJ4_THEFY/3-220--------------------------------------------------------------------------------
H2G9N4_CORD2/4-220--------------------------------------------------------------------------------
Q1JX11_DESAC/4-219--------------------------------------------------------------------------------
Q746C2_THET2/3-211--------------------------------------------------------------------------------
Q0RTG7_FRAAA/8-241--------------------------------------------------------------------------------
H1L764_GEOME/10-218--------------------------------------------------------------------------------
Q977B3_SULTO/4-249--------------------------------------------------------------------------------
Q0BRF8_GRABC/3-224--------------------------------------------------------------------------------
D0KV44_SULS9/4-251--------------------------------------------------------------------------------
Q8ZZL1_PYRAE/3-217--------------------------------------------------------------------------------
Q3ARV4_CHLCH/4-200--------------------------------------------------------------------------------
Q1J367_DEIGD/3-208--------------------------------------------------------------------------------
Q9KFY3_BACHD/4-199--------------------------------------------------------------------------------
A5V1B9_ROSS1/6-202--------------------------------------------------------------------------------
G6EUG2_LACDE/3-211--------------------------------------------------------------------------------
O57910_PYRHO/4-218--------------------------------------------------------------------------------
A0A031WDW5_PEPDI/3-221--------------------------------------------------------------------------------
A2BKI9_HYPBU/5-261--------------------------------------------------------------------------------
A1A2N3_BIFAA/7-207--------------------------------------------------------------------------------
Q9YCM4_AERPE/7-241--------------------------------------------------------------------------------
Q6LWA3_PHOPR/12-207--------------------------------------------------------------------------------
A0AE91_STRAM/6-214--------------------------------------------------------------------------------
D7AIG1_GEOSK/4-217--------------------------------------------------------------------------------
Q8KB22_CHLTE/5-230--------------------------------------------------------------------------------
A0A029S7I4_STRPY/6-202--------------------------------------------------------------------------------
A0A022MV28_9ACTO/14-209--------------------------------------------------------------------------------
Q5JGB2_THEKO/7-237--------------------------------------------------------------------------------
B3ENH9_CHLPB/5-225--------------------------------------------------------------------------------
Q96X68_SULTO/5-233--------------------------------------------------------------------------------
Q53WH0_THET8/3-225--------------------------------------------------------------------------------
A5D0R8_PELTS/6-219--------------------------------------------------------------------------------
G2T675_RHORU/6-247--------------------------------------------------------------------------------
A0LDG2_MAGSM/7-202--------------------------------------------------------------------------------
Q3SR91_NITWN/4-221--------------------------------------------------------------------------------
Q1ZM77_PHOAS/4-242--------------------------------------------------------------------------------
Q9UZX1_PYRAB/18-248--------------------------------------------------------------------------------
A4SFQ4_PROVI/7-227--------------------------------------------------------------------------------

PF01881

W6RS12_9CLOT/95-244-------------KEKI....ISDE..HVV.LKTL..---SP-IV------MK---------------------------
Q6L357_PICTO/91-231-------------KRVDFSSDIY........FKSL..---SP-IL------IR---------------------------
Q5JHS4_THEKO/94-238-------------KEPE....LKGP..VL..FSTL..---SP-IL------VR---------------------------
D5WUC6_KYRT2/99-252-------------NPKVQSSR.......IL.VQTL..---SP-IT------AY---------------------------
R5LEA9_9SPIR/108-254-------------NEKN....MMSN..RVR.IKFL..---SP-LV------LR---------------------------
Q8R6W9_THETN/98-246-------------AQQVLSTS.......IR.VRML..---SP-LV------VY---------------------------
I0GHZ9_CALEA/103-252-------------KPPRLTDD.......IL.IRTL..---SP-IT------AY---------------------------
I3VSC9_THESW/97-245-------------NPPIFRDK.......AR.IKFL..---SP-VV------TY---------------------------
K0NH01_DESTT/117-279-------------EDCQ....FTNT..EK..FICL..---SP-IT------VS---------------------------
C8W340_DESAS/104-254-------------QERP....ITAN..TAL.FRIL..---SP-IV------IR---------------------------
B3QWN9_CHLT3/102-265-------------PEPI....FENK..MS..FSMM..---SP-LT------LS---------------------------
Q5JGA0_THEKO/96-240-------------AEPE....RLSG..KK..FVTL..---SP-IA------VT---------------------------
U6EA28_9EURY/92-240-------------KKPD....FSEV..EIIKMRTL..---SP-VM------TR---------------------------
D9RZH3_THEOJ/95-246-------------EDHDLGDR.......IK.INML..---SP-VV------AY---------------------------
A1BI29_CHLPD/104-261-------------DCPE....ISGD..MR..FIAL..---SP-VV------CA---------------------------
L0AM89_NATGS/80-250-------------APDVGEPGSRGT......IETG..---TG-LL------VR---------------------------
A9BGZ0_PETMO/96-247-------------DLEIKSDK.......IK.VKTL..---SP-IT------IY---------------------------
D1CID5_THET1/96-249-------------PKPEVGQEDRLV......VRAA..---SP-IT------VY---------------------------
F6DTP0_DESRL/96-242-------------QFTVRGEK.......VL.LRTL..---SP-VV------AY---------------------------
R7ML22_9FIRM/93-237-------------NHKT....VTSN..TIL.IKMN..---SP-LL------VR---------------------------
S0AQH2_FERAC/95-242-------------DEKYKNIKYYM.......IEMI..---SP-LT------VY---------------------------
A6LNL8_THEM4/96-241-------------PTDT..............LKVVTR---SP-VT------VY---------------------------
F2NN51_MARHT/98-239-------------EVPLPQTP.......AL.LEAR..---AP-IT------VY---------------------------
C5D4N1_GEOSW/99-245-------------KRDIEGEE.......IE.IEML..---SP-LT------VY---------------------------
F8E5C0_FLESM/100-243-------------KDKK....IDDS..TTV.FKTL..---SP-IL------VR---------------------------
B8DZI0_DICTD/99-246-------------TTPKIEEK.......VK.IKAI..---SP-IT------IY---------------------------
Q3AA62_CARHZ/99-248-------------PLRN....FTDE..EL..FTLK..---SP-LV------LA---------------------------
CAS6_PYRFU/97-237-------------REPK....KFNG..ST..FVTL..---SP-IA------VT---------------------------
O30164_ARCFU/96-240-------------PERE....VKGR..EK..FVTL..---SP-IY------AS---------------------------
F4LS54_TEPAE/98-244-------------KDMIYQDK.......IQ.ISTL..---SP-IV------VY---------------------------
R6G9C8_9FIRM/96-238-------------KIPE....IKES..ELI.IKMQ..---SS-LL------AR---------------------------
B4SEV7_PELPB/104-261-------------DQPE....LSDD..ME..FVML..---SP-LV------CT---------------------------
Q8TJV5_METAC/91-240-------------PAVH....FSDM..CT..FRTL..---SP-IY------LK---------------------------
Q184H4_PEPD6/93-241-------------REKK....VTEE..RVL.FNAL..---SP-IC------VK---------------------------
D3T9Q1_ACIB4/83-232-------------KVKT.TGKFRSG............---SP-VV------IQ---------------------------
R6MWP8_9FIRM/94-238-------------PEKN....VTSS..SAV.VKML..---SP-LC------IR---------------------------
B4S5I3_PROA2/104-260-------------DPPQ....LSDD..MA..CIMM..---SP-LV------CS---------------------------
Q2NH84_METST/83-232-------------KNNKCSNSIITG............---TP-IV------LF---------------------------
Q11SY3_CYTH3/88-249-------------KLAD....FTNE......MKYICL---SP-LA------II---------------------------
F7PNQ2_9EURY/83-252-------------APDVGEPGTSGT......ISTG..---TG-VL------VR---------------------------
Q8R6W6_THETN/100-249-------------NPPIFKEK.......AR.IKFI..---SP-VV------MY---------------------------
A6LJX4_THEM4/95-242-------------YKEIAKDI.......LK.VNAL..---TP-IE------VH---------------------------
A6TQ80_ALKMQ/113-256-------------REKL....ITEH..QVI.FKTM..---SP-IV------AR---------------------------
F0SWC2_SYNGF/93-241-------------REHE....MTDT..AA..FRIL..---SP-VV------VR---------------------------
R5F1G6_9BACE/103-255-------------PAPG....FGEE..AE..YLAL..---SP-IV------FM---------------------------
D7DSW4_METV3/93-244-------------NEKGYNSNIKK.......MKTI..---SP-VL------LR---------------------------
A3DHS6_CLOTH/100-239-------------EEPKSIQK..........IRML..---SP-VT------AY---------------------------
A3I0J5_9BACT/87-249-------------IEPV....LETS......NKFVCI---SP-LV------LI---------------------------
Q8REC5_FUSNN/93-241-------------EEKI....IKEE..EAV.FQTTIG---GG-VV------VR---------------------------
H1XXZ4_9BACT/97-255-------------PVPE....FSDS..EVQ.FTCL..---SP-MT------VL---------------------------
Q24TS7_DESHY/112-258-------------QYEVREHK.......VM.VRTL..---SP-VV------LY---------------------------
C5CE93_KOSOT/105-255-------------TTPD....FGDK..TV..FKAI..---TP-IV------LS---------------------------
F6BD56_METIK/93-234-------------PTPE..........KFEVLKTL..---SP-IY------LK---------------------------
I7CU20_NATSJ/82-250-------------ATDVGEPGTSGT......IETG..---TG-VL------VR---------------------------
C7N977_LEPBD/102-257-------------PRKI....IKDN..VLI.VKTM..---SP-IV------CR---------------------------
I4AF01_FLELS/86-246-------------LMPEQREM..........TKYICI---SP-LV------VS---------------------------
D4LL18_9FIRM/20-161-------------NIPE....IQDT..ELI.IKMR..---SA-LI------VR---------------------------
I4BY45_ANAMD/101-249-------------SPCVDSEE.......IE.CHTL..---SP-IV------CY---------------------------
M1MKV7_9CLOT/95-244-------------KEKL....ISEG..EIL.CKTL..---SP-IN------IK---------------------------
C5CFB4_KOSOT/93-238-------------DQKVKESP.......IK.VITL..---SP-IT------VR---------------------------
D1AI68_SEBTE/102-241-------------KERK....IVSN..KVV.FRTQ..---SP-LI------VR---------------------------
D3PEQ4_DEFDS/104-252-------------PQPEITNK.......CL.INTL..---SP-IT------VY---------------------------
Q2NFS1_METST/94-243-------------KDPK....IHKK..EE..INTL..---SP-II------TR---------------------------
H3ZLX7_THELN/94-238-------------REPK....IRDG..TL..FSTL..---SP-IV------VR---------------------------
E4TSF2_MARTH/87-240-------------NDIE....FAEE......VKYICL---SP-VV------LL---------------------------
A5D0Y7_PELTS/97-243-------------DEQVADGE.......VLTVRTL..---SP-VV------AY---------------------------
F8C1X9_THEGP/88-239-------------PYKK....IKTN..KAI.FKTI..---GV-CV------LN---------------------------
L0EHC1_THECK/97-248-------------NELPDTMR..........VRML..---SP-LV------IY---------------------------
C9RCX9_AMMDK/97-244-------------DTVVRQSP.......IT.VRML..---SP-LT------VY---------------------------
H3ZK27_THELN/95-239-------------AEPF....SYSG..RT..YSTL..---SP-IA------VT---------------------------
A5D0Y8_PELTS/98-246-------------SPRVSSSS.......IR.VRML..---SP-VV------MY---------------------------
F4KYC0_HALH1/106-260-------------MLPP....LGES..ID..LFTV..---SP-VV------VS---------------------------
I2F7N5_9THEM/94-240-------------PTLPETKY.......IA.AKTI..---SP-IT------VY---------------------------
E8T539_THEA1/123-268-------------RSRP....VKKG..EAV.VKTL..---SP-IV------VE---------------------------
F7YVR8_9THEM/97-247-------------TNIE....FSSR..MK..FKML..---SP-MV------LS---------------------------
R5NPA5_9PORP/99-253-------------PEPE....FTPK..MT..FKAI..---SP-VF------VE---------------------------
Q1AZD0_RUBXD/95-247-------------PEPEVEDGRPLL......VRAL..---SP-IT------AY---------------------------
F6D794_METSW/92-236-------------KKPE....FKRS..AI..MKTM..---SP-VM------AR---------------------------
R5Q6M6_9FIRM/94-236-------------NLQPFIGT......KKICIETL..---SP-ML------IY---------------------------
G2TLN2_BACCO/98-246-------------QDTPESEK.......CR.IRML..---SP-IT------VY---------------------------
D9RZG4_THEOJ/95-241-------------DPKVSGSS.......IL.VRTL..---SP-IT------VY---------------------------
D3E282_METRM/92-241-------------PVPD....FEEE..IN..VKTL..---SP-II------SR---------------------------
F9ZC95_ODOSD/99-253-------------AEPE....FTSR..MF..FKTL..---SP-MF------IE---------------------------
W0DCW4_9AQUI/104-247-------------EEEIESEE..........ITVVCL---SP-IV------VY---------------------------
R6N4L4_9BACE/105-257-------------SSPE....FTEE..MT..FRTL..---SP-MC------LK---------------------------
D4M9Y0_9BACT/110-256-------------QQWAKGES.......LT.VRTL..---SP-IS------CY---------------------------
B7GIV2_ANOFW/71-220-------------DEKK....ITSS..TVV.FRTL..---SP-LL------VE---------------------------
A8F3P6_THELT/94-244-------------DEPK....ITDQ..MK..FILI..---SP-LV------VS---------------------------
R9SJL2_9EURY/92-241-------------PIPE....FKDK..IT..VRTL..---SP-II------VR---------------------------
L7VPR9_CLOSH/98-240-------------RQDVLDNK.......IV.LKTL..---SP-IT------AY---------------------------
CAS6L_PYRFU/93-237-------------KSKE....IKNV..NI..FSTL..---SP-IV------VR---------------------------
G7V6P2_THELD/96-246-------------TELVVEEE.......IS.IRTL..---SP-IC------CY---------------------------
Q9X2D4_THEMA/95-245-------------NSLP....DQSE..YH..FVML..---SP-LV------VS---------------------------
CAS6B_METJA/83-239-------------DLKV.KNKFITG............---SP-IV------LY---------------------------
A9BIX0_PETMO/97-241-------------QNEVDEEML.........VKTL..---SP-IT------AY---------------------------
Q5V7W8_HALMA/83-252-------------APDVGEPGTSGT......IETG..---TG-LL------VR---------------------------
K0AY46_CLOA9/100-241-------------KEKT....IYGN..EVI.FKTM..---SP-LV------AR---------------------------
I3VSW8_THESW/106-256-------------PELR....FKTE..EM..FYLD..---TP-LV------LS---------------------------
E6SGU1_THEM7/160-301-------------ELPPVTPP.......VT.LRAR..---TP-IT------VY---------------------------
G7V6F2_THELD/105-253-------------PMPD....FSDG..FAT.FSCI..---SP-LV------SS---------------------------
G8TRE8_NIAKG/100-264-------------PNSFASIHHTEP..EMV.LQPL..---SP-LV------VG---------------------------
Q3AA81_CARHZ/97-247-------------ENPE....IKPG..QT..FVCL..---SP-IV------VS---------------------------
A7HMV7_FERNB/99-241-------------EFPQTQK........IV.VSTK..---SP-IT------VY---------------------------
A5UJJ7_METS3/91-240-------------KTPE....FSSK..SE..FKTL..---AP-II------VR---------------------------
C5D2U6_GEOSW/88-237-------------KEKQ....VTSP..SVV.FRTL..---SP-IL------IE---------------------------
I3RB26_HALMT/83-252-------------TVDVGEPGTRGV......IETA..---TG-VV------VR---------------------------
A4J1X6_DESRM/97-248-------------TPPFNQDQ.......SYPVKML..---SP-VT------MY---------------------------
A4XIJ2_CALS8/99-248-------------RKPKFSSFHK........IKML..---SP-MC------AY---------------------------
A4XM43_CALS8/100-259-------------KEPE....QFSS..TMT.FKTF..---SP-VV------IE---------------------------
H1YB50_9SPHI/101-259-------------PAAF....KDDDEIHTMQFKPL..---SP-LV------VG---------------------------
F8A9G0_THEID/98-270-------------MPVSAKGP.......LI.VRAL..---SP-IT------IH---------------------------
M1E4R5_9FIRM/102-250-------------EEFIAKGS.......VV.VKAL..---TP-IE------VH---------------------------
F2KRM8_ARCVS/96-239-------------KEKE....VGKR..EK..FVTL..---SP-IN------VT---------------------------
E3CYI3_9BACT/99-270-------------APKTTGTR.......LR.LHTC..---SP-IT------CY---------------------------
I6ZYF6_MELRP/91-233-------------PNKY....SYKE..EII.VKTL..---SP-LL------VN---------------------------
H2J3Z6_MARPK/100-251-------------GSFYTEKN.......IINIKML..---TP-LE------VH---------------------------
B5YIV6_THEYD/110-261-------------NEKK....IEND..SVT.FKTL..---CP-AL------IE---------------------------
O27163_METTH/3-152-------------EPPE....FRRN..MK..FRTL..---SP-II------IK---------------------------
O66704_AQUAE/88-235-------------KERE..........IIGFFKTL..---SP-IV------IE---------------------------
H1XYR5_9BACT/101-261-------------SAPE....FKAR..MH..FRSK..---SP-IC------LS---------------------------
R6AKE9_9CLOT/101-242-------------......EDYSPNTCCAK.ISML..---SP-IT------VF---------------------------
Q182E2_PEPD6/98-243-------------KEHE....IKEN..GVI.FKTM..---SP-II------VK---------------------------
F4A3C4_MAHA5/97-245-------------PPPHIDGR.......VK.VKML..---SP-VV------AY---------------------------
Q6L312_PICTO/84-234-------------DVNI.SKSFITG............---SP-IV------LY---------------------------
F7YTK7_9THEM/97-245-------------NNDVNESR.......IR.VKML..---SP-IV------VY---------------------------
Q12WX9_METBU/91-239-------------PNLE....ISES..CK..FTTL..---SP-IY------VK---------------------------
D5XAY0_THEPJ/96-242-------------QYRVEDGR.......AV.LRIL..---SP-VV------LY---------------------------
I0GI07_CALEA/110-270-------------NERK....INSK..EVV.LKTM..---SP-IL------IE---------------------------
G8UK03_TANFA/105-257-------------PPPA....YTHE..MD..FITM..---SP-IC------LR---------------------------
F8I2S5_SULAT/94-242-------------EPRVTDNK.......IL.VRTL..---SP-IT------IH---------------------------
E4TH18_CALNY/109-261-------------NEKD....ITEN..EIT.FKTL..---SP-IL------VE---------------------------
I2F5U2_9THEM/105-254-------------TESF....ESEE..EL..FKCI..---TP-IV------LS---------------------------
O66560_AQUAE/89-243-------------EEEQ....ITKP..RQT.FRTL..---SP-IV------VI---------------------------
B5YKZ6_THEYD/94-242-------------YTPEIKET.......AF.IRML..---SP-IT------IY---------------------------
G7M8P5_9CLOT/95-244-------------KEKT....INED..EIL.CRTL..---SP-IY------IR---------------------------
D3PBR5_DEFDS/101-244-------------QNPYFEED.......FI.IKTL..---SP-IT------AY---------------------------
N0BC99_9EURY/89-232-------------KEKE....IGRK..ER..FITL..---SP-IN------VT---------------------------
E8T547_THEA1/126-270-------------PERR....VQEL..PVT.VRTL..---SP-IL------VE---------------------------
D3DIQ3_HYDTT/95-238-------------KPTVRED........VN.VRCL..---SP-IT------VY---------------------------
B1I5K4_DESAP/98-246-------------APWVTRET.......LQ.VRML..---SP-LV------VY---------------------------
R5UPH1_9PORP/99-253-------------PEPE....FVSR..MS..FKTL..---SP-LF------LE---------------------------
C8VZL4_DESAS/97-243-------------KVIVKENE.......VS.FRTL..---SP-VV------AY---------------------------
D7CN19_SYNLT/100-243-------------PVPE....FTGR..VL..CEMI..---SP-LI------AS---------------------------
W0JFB3_DESAE/95-241-------------KPPQITQN......EIK.IRAI..---TP-IE------VH---------------------------
CAS6A_METJA/97-238-------------PIPK..........KFNILKTI..---SP-IY------LK---------------------------

PF10040

L0K6N4_HALHC/192-313-------------------------------LKLV-----TP-TL------LK..-------------------------
F3ZXK6_MAHA5/109-225-------------------------------IQFR-----TP-TA------FK..-------------------------
G2MK90_9ARCH/153-282-------------------------------LSFE-----TA-TC------IE..-------------------------
K9Y918_HALP7/157-268-------------------------------.TLA-----TP-VS------FR..-------------------------
H1XX22_9BACT/179-297-------------------------------LEFL-----TP-VR------FK..-------------------------
B1L433_KORCO/181-296-------------------------------LRFI-----TP-FR------LV..-------------------------
A0ZJZ0_NODSP/168-288-------------------------------LSFI-----SP-TS------FR..-------------------------
Q2JNR9_SYNJB/173-291-------------------------------LSFV-----SP-TS------FR..-------------------------
B7KDF7_CYAP7/219-329-------------------------------LQFL-----SP-TS------FK..-------------------------
A4J507_DESRM/141-258-------------------------------.DFL-----SP-TN------FR..-------------------------
F4EVS7_SELS3/145-262-------------------------------LRFL-----SP-VA------FR..-------------------------
K9QB89_9NOSO/174-286-------------------------------LSFA-----TP-TA------FR..-------------------------
A8ZV96_DESOH/179-300-------------------------------LTME-----TP-LR------TK..-------------------------
C9R989_AMMDK/199-320-------------------------------LDFI-----TP-TR------LT..-------------------------
R5PNI3_9BURK/195-316-------------------------------.KVT-----TP-LR------LQ..-------------------------
I0I1W5_CALAS/150-266-------------------------------LEFV-----SP-TA------FK..-------------------------
K9WP49_9CYAN/161-281-------------------------------LSFL-----TP-TS------FR..-------------------------
E1QU68_VULDI/131-260-------------------------------..RF-----WP-TS------FI..-------------------------
H9ZZ94_FERFK/153-293-------------------------------VRFL-----TP-TI------LS..-------------------------
E8T6Q0_THEA1/128-244-------------------------------LQFK-----SP-TS------FK..-------------------------
I0I2Y7_CALAS/165-288-------------------------------IEFA-----TP-MR------LI..-------------------------
G4RMW7_THETK/109-233-------------------------------.ETI-----TP-VQ------FA..-------------------------
B7KB41_CYAP7/154-264-------------------------------LSFL-----SP-TS------FK..-------------------------
E6W3H3_DESIS/152-268-------------------------------LRLQ-----SP-LR------SK..-------------------------
A9WEP3_CHLAA/149-264-------------------------------.QLA-----SP-TT------FR..-------------------------
A3CNA0_STRSV/121-237-------------------------------LNFY-----TP-TT------FK..-------------------------
K9VUC0_9CYAN/184-304-------------------------------LSFL-----TP-TS------FR..-------------------------
G0VQ62_MEGEL/131-244-------------------------------...L-----SI-MS------FK..-------------------------
Q8ZZK8_PYRAE/121-245-------------------------------LEFL-----TP-LR------FA..-------------------------
B9M7F5_GEODF/178-295-------------------------------VTFV-----TP-VI------LF..-------------------------
K9Z6D5_CYAAP/156-268-------------------------------LKIY-----TP-TA------FR..-------------------------
B7JVM6_CYAP8/153-263-------------------------------LKFL-----SP-TS------FK..-------------------------
I7GZK7_9HELI/102-216-------------------------------LHFR-----TP-LR------MK..-------------------------
B3EIY9_CHLPB/190-322-------------------------------LSFK-----TP-LR------MK..-------------------------
B5YHA0_THEYD/183-305-------------------------------LKII-----TP-LR------IR..-------------------------
Q2RV92_RHORT/175-295-------------------------------LTFH-----VP-LR------LM..-------------------------
K4LGU6_THEPS/201-322-------------------------------INFC-----TP-TR------IT..-------------------------
B2ITK0_NOSP7/163-275-------------------------------LTFS-----TP-TA------FR..-------------------------
D7BB61_MEISD/120-235-------------------------------LQFA-----SP-TF------FR..-------------------------
D1BQ19_VEIPT/134-250-------------------------------LRCV-----TT-TS------FK..-------------------------
K9WFD7_9CYAN/163-275-------------------------------LAFC-----TP-TA------FR..-------------------------
B8D4R7_DESK1/164-296-------------------------------..FS-----SP-VM------LRDP-------------------------
B0VHA6_CLOAI/114-232-------------------------------ITFT-----TP-LR------QK..-------------------------
K9PEZ2_9CYAN/154-264-------------------------------LHFL-----SP-TS------FK..-------------------------
U5QKR7_9CYAN/153-269-------------------------------LRFC-----TP-TC------FR..-------------------------
Q39T05_GEOMG/185-302-------------------------------LRLL-----TP-LK------IM..-------------------------
A9B3B3_HERA2/187-307-------------------------------LQFV-----TP-TR------LK..-------------------------
D9PZC3_ACIS3/155-292-------------------------------..FL-----TP-TA------IP..-------------------------
E0STW9_IGNAA/133-249-------------------------------...F-----AP-TV------FK..-------------------------
E1QHL8_DESB2/181-300-------------------------------LRFL-----AP-LN------QR..-------------------------
F5YHB2_TREPZ/187-308-------------------------------VQML-----SP-LR------FK..-------------------------
F6B8N9_DESCC/193-314-------------------------------LNFL-----TM-TR------LK..-------------------------
F8A9J4_THEID/178-299-------------------------------..FE-----TP-VT------LR..-------------------------
C7RP07_ACCPU/214-336-------------------------------LRFE-----TP-LR------LQ..-------------------------
I5B4K9_9DELT/185-305-------------------------------.KLQ-----TP-FR------IS..-------------------------
E6N6Z0_9ARCH/137-279-------------------------------VRFR-----SP-TF------FRST-------------------------
V4J6E9_9GAMM/199-322-------------------------------.SLT-----TP-TR------LK..-------------------------
A5G6J6_GEOUR/186-302-------------------------------.SIE-----TP-LR------LL..-------------------------
Q97YE5_SULSO/103-227-------------------------------IHFK-----TP-TL------LQ..-------------------------
Q2LQW0_SYNAS/206-327-------------------------------LTLL-----TP-LR------LK..-------------------------
I3TFC5_THEC1/166-297-------------------------------V.FS-----SP-TQ------LRDP-------------------------
D7CS37_TRURR/124-238-------------------------------LHFA-----TP-TV------FR..-------------------------
F2NN98_MARHT/122-236-------------------------------LEFA-----SP-TF------FR..-------------------------
I3WBS4_THESW/113-229-------------------------------.YFT-----SP-TS------FK..-------------------------
Q74DY6_GEOSL/182-300-------------------------------LSFN-----TP-LR------II..-------------------------
K9U2M1_9CYAN/157-268-------------------------------.TLT-----TP-VS------FR..-------------------------
A0LHY9_SYNFM/189-311-------------------------------LRFV-----TP-LR------LV..-------------------------
F8AWH3_FRADG/56-175-------------------------------LRMI-----TP-LF------FS..-------------------------
R5D9G4_9FIRM/121-237-------------------------------LAFQ-----TP-TA------FK..-------------------------
K9Z2G9_CYAAP/132-249-------------------------------INFL-----TP-TA------FA..-------------------------
Q0AW55_SYNWW/127-243-------------------------------IEFL-----TP-CT------HK..-------------------------
E8N1C5_ANATU/199-324-------------------------------MRFL-----TP-MR------LV..-------------------------
K9QGU5_9NOSO/132-249-------------------------------LQFI-----TP-TA------FA..-------------------------
A5UUF5_ROSS1/193-311-------------------------------LRFL-----TP-MR------LI..-------------------------
A0B9F8_METTP/179-309-------------------------------IRFI-----SP-TC------IQ..-------------------------
Q3IQ75_NATPD/155-284-------------------------------MTFQ-----TA-TC------IE..-------------------------
B8HXC7_CYAP4/154-266-------------------------------LKLL-----SP-TS------FK..-------------------------
Q2FM73_METHJ/142-274-------------------------------MDFI-----TP-TC------IQ..-------------------------
B1XQV2_SYNP2/146-256-------------------------------LDFK-----SS-TS------FK..-------------------------
H2J4R7_MARPK/152-265-------------------------------.IFI-----TP-TL------FK..-------------------------
A8ABE5_IGNH4/136-253-------------------------------VKFR-----GP-AV------LRDP-------------------------
Q0AU02_SYNWW/189-308-------------------------------.ELI-----TP-LR------LK..-------------------------
K9ZE49_ANACC/159-269-------------------------------..FS-----TP-VA------FR..-------------------------
A1WUQ5_HALHL/173-290-------------------------------...D-----SP-LR------LQ..-------------------------
H1XUD1_9BACT/171-291-------------------------------IRFL-----TP-TA------LK..-------------------------
K0I7U3_NITGG/134-256-------------------------------.YFE-----TP-TH------LA..-------------------------
A8M9A8_CALMQ/140-275-------------------------------...Y-----GP-TV------FR..-------------------------
D7BJF9_MEISD/140-264-------------------------------LRFR-----TP-TV------FA..-------------------------
K9Z986_CYAAP/157-276-------------------------------.TFL-----SP-TS------FR..-------------------------
C8W2P2_DESAS/150-266-------------------------------IEFY-----SP-TT------FR..-------------------------
Q5M4I8_STRT2/122-236-------------------------------..FE-----TP-TG------FK..-------------------------
A9WJU8_CHLAA/202-322-------------------------------...R-----TP-LR------IK..-------------------------
L0DVU2_THIND/189-312-------------------------------VEFR-----TP-LR------LR..-------------------------
K9UYS9_9CYAN/166-276-------------------------------..FS-----TP-VC------FR..-------------------------
A9G7I6_SORC5/239-364-------------------------------LTFD-----TP-AW------LT..-------------------------
K9VAI7_9CYAN/164-284-------------------------------LSFV-----TP-TS------FR..-------------------------
B4S549_PROA2/190-322-------------------------------LRFE-----TP-LR------MK..-------------------------
A3DLD1_STAMF/165-290-------------------------------VEFR-----TP-AL------LLDP-------------------------
D4ZUE3_ARTPN/132-249-------------------------------LKFT-----TP-TA------FA..-------------------------
Q8ZZM1_PYRAE/124-248-------------------------------VEFL-----SP-TR------FA..-------------------------
Q53VU8_THET8/136-259-------------------------------FRFL-----TP-TV------FA..-------------------------
R5SKY0_9FIRM/124-242-------------------------------LRFC-----TP-TC------FK..-------------------------
I6XRG2_PROPF/138-250-------------------------------....-----..-..------FK..-------------------------
A4YFW1_METS5/128-261-------------------------------VNFV-----SP-VL------LS..-------------------------
K9VP83_9CYAN/158-269-------------------------------.SFA-----TP-TT------FR..-------------------------
CAS6A_SULSO/138-276-------------------------------VRFI-----SP-TL------LS..-------------------------
Q1J2Q0_DEIGD/229-349-------------------------------.QLH-----SP-LH------IK..-------------------------
U5N9J4_9BURK/187-313-------------------------------LTLH-----TP-LR------LQ..-------------------------
D5BXY1_NITHN/195-319-------------------------------IHFQ-----TP-LR------LK..-------------------------
K9VUL1_9CYAN/157-268-------------------------------.AFC-----TP-TA------FR..-------------------------
B8HZK9_CYAP4/163-283-------------------------------LTFI-----ST-TS------FR..-------------------------
F2NCY6_DESAR/192-310-------------------------------...Q-----TP-MR------LK..-------------------------
G4RK11_THETK/123-247-------------------------------LEFL-----TP-LR------FA..-------------------------
R6P553_9FIRM/125-241-------------------------------MEFI-----TP-TA------FK..-------------------------
A1RZS7_THEPD/144-262-------------------------------VRFH-----TP-TY------FN..-------------------------
E3IY75_FRASU/114-233-------------------------------LTMT-----TP-TF------FA..-------------------------
G0EG84_PYRF1/160-282-------------------------------..FR-----SP-TL------PVNP-------------------------
B9LX88_HALLT/152-281-------------------------------IEFR-----TS-TC------IE..-------------------------
R5EQX2_9GAMM/149-273-------------------------------.NFF-----TP-LR------LPLP-------------------------
R6GYJ4_9FIRM/123-239-------------------------------IRFL-----TP-TA------FK..-------------------------
K9Q0F8_9CYAN/153-272-------------------------------LSFL-----SP-TV------FR..-------------------------
F2NCL0_DESAR/192-312-------------------------------LELL-----TP-LR------LK..-------------------------
F4B5Q5_ACIHW/132-254-------------------------------..FN-----TP-TL------LQ..-------------------------
K9SF16_9CYAN/154-274-------------------------------LSFT-----SP-TG------FR..-------------------------
F4HFU9_GALAU/181-302-------------------------------.KIL-----TP-MR------IQ..-------------------------
K9VE89_9CYAN/176-287-------------------------------.SFC-----TP-TN------FR..-------------------------
K9TTK8_9CYAN/158-269-------------------------------.IFC-----TP-TA------FR..-------------------------
A8AA66_IGNH4/120-231-------------------------------...H-----GP-TL------YR..-------------------------
F4BVN4_METCG/195-321-------------------------------VRFL-----TP-AQ------IKED-------------------------
A9AX64_HERA2/145-263-------------------------------LWFA-----TP-TC------FK..-------------------------
G4RJS6_THETK/34-142-------------------------------...F-----YP-TA------FM..-------------------------
G4SY21_META2/183-306-------------------------------.SLE-----TP-LR------IK..-------------------------
F4B6S4_ACIHW/137-278-------------------------------VKFL-----TP-TL------LS..-------------------------
Q8TVD3_METKA/146-269-------------------------------VTFT-----TP-TY------IV..-------------------------
D4ZX77_ARTPN/162-287-------------------------------LSFL-----SP-TS------FR..-------------------------
Q4J7P9_SULAC/157-282-------------------------------VKLI-----TP-SM------FKDP-------------------------
G7ZCD4_AZOL4/213-331-------------------------------LEFT-----TP-VC------LR..-------------------------
K9Y1X1_STAC7/155-269-------------------------------.SFA-----TP-TT------FG..-------------------------
A1RZX7_THEPD/116-251-------------------------------LRFL-----TP-TL------VPVP-------------------------
Q4J7R1_SULAC/134-278-------------------------------LRFE-----SP-TL------LS..-------------------------
R6PQ35_9CLOT/170-290-------------------------------.KLQ-----TP-LR------IR..-------------------------
F8AW66_FRADG/144-268-------------------------------...V-----TP-VS------FA..-------------------------
K9XLZ1_9CHRO/153-265-------------------------------FRFY-----TP-TC------FR..-------------------------
J7LAT0_NOCAA/122-261-------------------------------.HAL-----TP-VV------TTTR-------------------------
Q7MC52_VIBVY/165-292-------------------------------MQFI-----TP-TR------IK..-------------------------
E0SSI4_IGNAA/163-304-------------------------------V.FH-----TP-TL------LS..-------------------------
Q5HK95_STAEQ/125-241-------------------------------LNIQ-----TP-MS------FK..-------------------------
E0UKL6_CYAP2/154-264-------------------------------LKFL-----SP-TS------FK..-------------------------
K9TQ72_9CYAN/193-313-------------------------------LSFM-----TP-TS------FR..-------------------------
Q01QC2_SOLUE/166-287-------------------------------VRFL-----TP-TE------LK..-------------------------
B1L7L1_KORCO/136-264-------------------------------LRFL-----TP-TC------FK..-------------------------
D3PLA6_MEIRD/120-235-------------------------------LQFA-----SP-TF------FR..-------------------------
D5X8I6_THEPJ/130-246-------------------------------ITFL-----TP-CS------FK..-------------------------
R5DX83_9FIRM/123-238-------------------------------VEFI-----TP-TS------FK..-------------------------
V4IUZ5_9GAMM/183-318-------------------------------.KLL-----TP-LR------IK..-------------------------
Q4J7D4_SULAC/139-263-------------------------------MEFL-----TP-TL------LQ..-------------------------
A9AZH6_HERA2/149-264-------------------------------.QFH-----SP-VT------FR..-------------------------
Q8ZZU6_PYRAE/127-237-------------------------------LRFY-----.P-TA------FM..-------------------------
Q65S11_MANSM/165-285-------------------------------.QIE-----TP-LR------IQ..-------------------------
Q6ZEI4_SYNY3/146-256-------------------------------LKFH-----SA-TS------FK..-------------------------
E8MZD5_ANATU/156-270-------------------------------..FA-----SP-TT------FR..-------------------------
B1I4N7_DESAP/204-325-------------------------------IRLL-----TM-TR------LK..-------------------------
D4KCT1_9FIRM/124-240-------------------------------LWFR-----TP-CA------FK..-------------------------
C8XDH3_NAKMY/112-225-------------------------------VEFL-----TP-AT------FR..-------------------------
Q1AT68_RUBXD/185-307-------------------------------VEFL-----TP-TQ------VR..-------------------------
D4L090_9FIRM/123-239-------------------------------IHFL-----SP-TA------FK..-------------------------
CAS6_MYCTU/184-299-------------------------------VEFL-----TP-TA------FK..-------------------------
K9REI7_9CYAN/159-279-------------------------------LSYI-----SP-TS------FR..-------------------------
K8GNP3_9CYAN/167-279-------------------------------LSFC-----TP-TT------FR..-------------------------
B5EGG7_GEOBB/173-285-------------------------------LQLL-----TP-LK------LV..-------------------------
F8E951_FLESM/180-296-------------------------------..MD-----SP-LR------LK..-------------------------
A5UQ98_ROSS1/201-322-------------------------------LRLQ-----TP-LR------IR..-------------------------
F9VPJ5_SULTO/122-263-------------------------------VKFV-----TP-AL------LS..-------------------------
G0GAL5_SPITZ/216-341-------------------------------LHFL-----TP-LR------LV..-------------------------
K9TQH4_9CYAN/147-257-------------------------------LTFL-----SP-TS------FK..-------------------------
D3RZU7_FERPA/182-298-------------------------------LKFL-----TP-FR------II..-------------------------
R7BKP7_9FIRM/123-239-------------------------------LQFL-----SP-TA------FK..-------------------------
F8C651_THEGP/144-257-------------------------------...I-----TP-IS------FK..-------------------------
D9QVV0_ACEAZ/146-259-------------------------------.KFH-----ST-TT------FS..-------------------------
D1BQ29_VEIPT/148-260-------------------------------....-----.P-TS------FN..-------------------------
G2SNW3_LACRR/125-241-------------------------------LKIM-----TP-TA------FK..-------------------------
D3RWD2_ALLVD/219-343-------------------------------LHLL-----TP-WR------LK..-------------------------
E4TFF0_CALNY/178-296-------------------------------ITFL-----SP-VR------MK..-------------------------
B8GIG7_METPE/143-274-------------------------------.NFE-----TV-TC------IQ..-------------------------
F2NWE0_TRES6/180-299-------------------------------.ELN-----SP-LR------FK..-------------------------
Q9YCN0_AERPE/130-237-------------------------------....-----.P-TI------YM..-------------------------
A4YFU6_METS5/153-293-------------------------------VSFL-----TP-AL------LC..-------------------------
A9B8P4_HERA2/194-316-------------------------------LHFM-----TP-LR------II..-------------------------
B5YJR6_THEYD/170-291-------------------------------.RAI-----TP-LR------IK..-------------------------
Q6ZED0_SYNY3/150-271-------------------------------.TFT-----SP-TS------FR..-------------------------
A1BI47_CHLPD/189-321-------------------------------LRFE-----TP-LR------MK..-------------------------
H8GGS4_METAL/183-307-------------------------------MTFH-----SP-LR------IK..-------------------------
K9PIY0_9CYAN/160-280-------------------------------LRFL-----SP-TS------FR..-------------------------
B0TFX1_HELMI/206-328-------------------------------MEYV-----TP-LR------LK..-------------------------
F5XNN8_MICPN/117-229-------------------------------LEFV-----TP-VT------FR..-------------------------
E1QQW2_VULDI/142-269-------------------------------IEFL-----SP-VR------FA..-------------------------
Q2FR84_METHJ/137-256-------------------------------..SL-----SP-LY------LE..-------------------------
B0JKW7_MICAN/158-269-------------------------------..FA-----TP-VT------FR..-------------------------
Q5SM65_THET8/120-234-------------------------------LRFA-----SP-TF------FR..-------------------------
D0MKP1_RHOM4/203-324-------------------------------.RAI-----AP-LR------LK..-------------------------
Q82XX5_NITEU/191-313-------------------------------LHIT-----TP-LR------LQ..-------------------------
M1E8T8_9FIRM/184-306-------------------------------ISFL-----SP-VS------LR..-------------------------
F5YD05_TREAZ/184-300-------------------------------...D-----SP-LR------LK..-------------------------
R7K0L3_9CLOT/123-239-------------------------------IHFV-----AP-TA------FK..-------------------------
K9R5X4_9CYAN/163-274-------------------------------VNFA-----TP-TA------WR..-------------------------
K9ZQ95_ANACC/226-336-------------------------------LQFI-----SP-TS------FK..-------------------------
F6CKB2_DESK7/215-335-------------------------------.DFL-----TM-TR------LK..-------------------------

PF08798

E4N250_KITSK/3-213.....G..IL..-FRTETG.........RDGDQILLQ---SN-RE------PDLA-------------------------
Q1GAI3_LACDA/1-205.....R..HL..-WRLDTL.........NGRNYLLLL---SP-EK------PDLH-------------------------
B1VIX9_CORU7/5-232.....R..VL..-WRVD.........PGEHEHVLYVV---GP-EK------PTGA-------------------------
Q32CH4_SHIDS/1-198........FL..-FHVEKR.....NTPEGC..HVLLQ---SA-QM------P..V-------------------------
I3Y7Y7_THIV6/4-234............-FRYLGA...........RQGLLAY---SD-QP------PALL-------------------------
B6IWM2_RHOCS/29-260.....EGLFL..-FHVE..........GTRPFSAIVR---SR-VP------PEDG-------------------------
B1VNZ6_STRGG/1-237.....R..VL..-WRVDRN......TTS..ETLLYVV---SP-NR------PDLT-------------------------
E4N5A8_KITSK/2-247.....R..IL..-WRLDTD........QPRRPQLLVL---TP-GK------PDWT-------------------------
K4INP2_BIFAP/1-227.....R..IL..-WRLDFS.......REGDSTWLYVV---SP-ER------PDFT-------------------------
G2IXW9_PSEUL/3-219.....D..FV..-FRIDQGE.......QGLP.QYYVV---SQ-RP------PQAL-------------------------
G0FR05_AMYMS/1-212.....G..VL..-WRLDSN....RGSY.....VQYVQ---SH-TR------PDWD-------------------------
D3VAX8_XENNA/1-223.....N..FL..-FREEISL.......SGRP.EFFVL---SR-TA------PIIN-------------------------
I2BC80_SHIBC/1-231.....Q..FL..-FRQE.DN.......G....QFFML---SA-MP------PLTG-------------------------
Q0W583_UNCMA/1-248.....G..VL..-HRIDIH....PRSGAI...VLLVQ---SQ-EK------PDWS-------------------------
E3D0F9_9BACT/1-235........LL..-WRLDRR........EDGTLCVIAQ---SE-AE------PNWG-------------------------
D1CAI9_SPHTD/1-253.....G..IL..-YRLETH....PRTGMP...TLLVQ---SA-IE------PTWS-------------------------
J7L987_NOCAA/16-239.....G..VLST-WSVDLK.........AAALVLVVQ---SR-VA------GDWS-------------------------
B5GY64_STRC2/3-305AKGAPR..VL..-WRLDAD........DPHRPQLYVL---TP-GR------PDWS-------------------------
Q60AD3_METCA/5-237............-FRLLQD......GRNLRPPRLLGF---SA-HD------GTRL-------------------------
A1ARH5_PELPD/1-222........FL..-WRLEPE......TDSSGYPRIIVQ---SR-NI------PDWG-------------------------
Q0BSC8_GRABC/21-226.....D..FL..-WREERDG............SFLTL---SA-RP------PLQS-------------------------
C4ZJY2_THASP/8-234............-FRHFGD...........VRGLLAY---SG-QG------ADRI-------------------------
Q2JH26_FRASC/2-267.....R..VL..-WRLETG.EGLRGADRPHRAEVLVL---TE-ST------PSWE-------------------------
X4RBI6_9ACTO/5-219.....R..IL..-WRLD.........QRGHQHTLYIV---GP-EM------PTAA-------------------------
C7LYW5_ACIFD/1-220.....R..TL..-WRVDGD........DPRVPILYVV---SA-VQ------PQFA-------------------------
F8E3A0_CORRG/2-224.....R..VL..-WRVD.........GAEHQRTLYIV---GP-EK------PDGK-------------------------
Q03C59_LACC3/1-212.....R..HL..-WRLDSL.........NGRDYLLVL---SP-DA------PELA-------------------------
K7SNJ1_PROA4/34-264.....R..VL..-WRLDTA.........QHSSHVLVL---TQ-SR------PNWD-------------------------
A9GV72_SORC5/1-243.....G..VL..-FRVDEA....VLRGRF...VLLVQ---SA-TR------PDFT-------------------------
Q4JWK1_CORJK/5-216.....R..IL..-WRHDGK......VRGADEHFVYIV---GP-DS------CDPT-------------------------
E3D9L3_GARV3/3-212.....R..KL..-WRVDVL.........HGKHYLLIV---SD-SE------PDLQ-------------------------
A7MFK9_CROS8/1-212.....Q..YL..-YRRE.TL.......QNGF.CFYLL---SA-SA------PERT-------------------------
Q47PJ5_THEFY/2-224.....G..LL..-FRIEET.........RNELYLLVQ---SH-SP------LRVD-------------------------
C8XAY3_NAKMY/1-211.....R..VL..-WRVDRD.........GPATLLYIL---SP-DR------PDLT-------------------------
R5IV38_9CLOT/1-210.....RKRNL..-WRLEYL.........GDRLYLLIL---SP-DR------PDLS-------------------------
C6WMQ8_ACTMD/1-218.....G..VL..-WRLDAT....PAGY.....TQYVQ---SL-TR------PDWT-------------------------
D7CSJ6_TRURR/1-209........PL..-WRLEQS.........RREAVLLVQ---SL-TP------PDWP-------------------------
F3ZMY9_9ACTO/3-245.....R..TL..-WRLDAD........NPHRPELFVL---TA-GK------PDWT-------------------------
L0J770_MYCSM/1-219.....R..TL..-WRIDRA........TNAETTLYLV---SP-VA------PDLT-------------------------
Q0BRF7_GRABC/2-239............-FRVFTP........EQANWSLYAY---AN-QD------ATTL-------------------------
Q7N8H4_PHOLL/1-222.....Q..FL..-FREEIGI.......MGLP.VFYVL---SK-TS------PQTE-------------------------
Q6NEQ5_CORDI/6-226.....SVDIL..-FRFEQL........AGQPPFFLIQ---ST-VA------PKQV-------------------------
C7MTM6_SACVD/3-234.....R..PL..-WRWDTG........RERRPYLLVL---TH-TV------ADWT-------------------------
C1DSI0_AZOVD/1-204.....R..FL..-WRLEPG......ADAWASPTLLVQ---SC-ES------GDWD-------------------------
Q314I5_DESAG/1-218.....D..FL..-FR...E........QDEPYTFLTV---SR-RQ------PEDT-------------------------
D6YAN0_THEBD/1-227.....R..VL..-WRVDRN......SRA..ETYLFIV---SP-AK------PDLT-------------------------
J9VY84_LACBU/1-220.....R..HL..-WRIDRL.........AGKSYLLVL---SQ-EA------PDLE-------------------------
Q825C0_STRAW/3-217.....G..VL..-FRIEDT.........PAGAHILLQ---SA-HE------PDLT-------------------------
B0S4B5_FINM2/1-205.....R..KL..-WRLDSF.........NNKNYLVML---SE-QK------PDIE-------------------------
V6KHH8_STRNV/6-213.....G..VL..-FRLDEN.........DDGATLLVQ---TR-TP------PQLG-------------------------
A9HLC4_GLUDA/5-226.....D..FL..-WRQMEAG............RFMVL---SA-RE------PVDS-------------------------
A6W167_MARMS/1-222.....S..FL..-FREEQSA.......DGSK.AFFVL---SS-VK------PESD-------------------------
D1A6Q6_THECD/5-212.....A..VL..-FRLEER.........PTGTSILMQ---SS-IE------PALE-------------------------
D6ZIM7_MOBCV/5-218.....R..VL..-WRLD.........QRSHENILYIV---GP-EK------PTAV-------------------------
G2KWT8_LACSM/1-220.....R..HL..-WRIDQL.........AGKKYLLLL---SE-ER------PDLT-------------------------
H8GLK4_METAL/1-204........FL..-FRVEQM.....QKGIGA..NVLLQ---ST-LQ------PQ.S-------------------------
B8IZA5_DESDA/2-205........FL..-FRLDEV.........PAGTLVHVL---SP-HE------PQRP-------------------------
B8IMR1_METNO/3-240.....D..FL..-WCEDAGG.......TWQRATFLIL---SR-RR------PQDT-------------------------
R6Q6M2_9FIRM/1-206.....RRRRL..-WRLDRL.........GEKLYLLLL---SE-EM------PDLS-------------------------
A5GBK0_GEOUR/3-226........FL..-TRIDQL.........EGAYRFWVL---AK-RK------PVMP-------------------------
F0RQX4_DEIPM/1-214.....R..LL..-WRDDGP....H........GILVQ---SV-TR------PSWD-------------------------
D1CGD5_THET1/2-229........VL..-YRLEEA.........GRFPTVIVQ---SR-LE------PDWS-------------------------
A4XYT8_PSEMY/1-202.....R..FL..-WRLEAG......SNAWATPVVLVQ---ST-LA------GDWS-------------------------
B8HWH7_CYAP4/1-204.....DWNVL..-FRQEPD...........ISIVLVQ---SE-IE------PNWT-------------------------
Q67RN9_SYMTH/1-223.....G..VL..-YRLELN....RYSGQV...LLYVQ---SR-VE------PDWG-------------------------
Q1J366_DEIGD/4-210.....R..AL..-WRQEDR....A........TLLVQ---SL-TA------PDWE-------------------------
K7SEU6_GLUOY/4-237.....D..FL..-WRQEEPG............SFYIL---SE-RP------PADP-------------------------
W5TGY3_9NOCA/19-245.....G..VLST-WSLNLR.........ESTLIIVVQ---AN-VP------ADWS-------------------------
Q2RXJ4_RHORT/4-241............-FRLMVA.......PNGATGTLYAY---TR-AD------RTAL-------------------------
A5FTJ9_ACICJ/1-224.....D..FL..-WREERPG............HFLIL---SP-DR------PGDG-------------------------
G4SY61_META2/1-204........FL..-FRVEQQ.....QVGVGA..SILMQ---SE-IA------PS.V-------------------------
J7L4F7_NOCAA/1-247GRGEGR..VL..-WRVDRN......AKA..EVLLYIV---SP-SR------PEPT-------------------------
CAS6_THET8/1-211.....RERLL..-WRLEPA.......RGLEPPVVLVQ---TL-TE------PDWS-------------------------
B7KJ27_CYAP7/1-214.....K..IL..-YRLEGS.............ILFVQ---SK-NK------PDWT-------------------------
W5WPN4_9CORY/1-214.....R..VL..-WRVDTL......SD...RSLLYIV---SP-DK------PSFE-------------------------
W8KR76_HALHR/1-229.....P..FL..-FRQEMEEPEGGGAPRGLP.LFYVL---SD-RE------PVPV-------------------------
R6BMI8_9CLOT/1-206.....RQRNL..-WRIDSR.........GGQNYLLIL---SS-EK------PDLS-------------------------
A0LM55_SYNFM/1-201.....R..VL..-FRVEPE.......NDDRIVRIMVQ---SD-GS------PSWE-------------------------
F2GBG6_ALTMD/1-221.....S..FL..-YREEMGI.......TGMP.EFYVL---SK-TE------PQAS-------------------------
A8LMM7_DINSH/4-255............-FRLVVA.......PRAKSGTLWAY---TD-VD------ATAL-------------------------
I4CC95_DESTA/1-227.....D..FL..-FRKESQ........QSLP.VFFTV---SR-TP------PARD-------------------------
D7BDY1_MEISD/1-207........FL..-WRAEEG..........KTPTVLVQ---SI-ET------PNWE-------------------------
F4H8A3_CELFA/1-228.....R..VL..-WRLDVE......PDA..RTFLYVV---SP-DR------PDFA-------------------------
G2PH26_STRVO/4-213.....G..VL..-FRIEDG.........PQGPHLLIQ---SQ-AQ------PDTT-------------------------
B8GIV2_METPE/3-224.....D..FL..-FRQEVH........QGMP.VFWTV---SE-RV------PSDR-------------------------
A5UR13_ROSS1/1-236.....G..IL..-YRIE......PISDMPWLVRLLVQ---SR-EQ------PDWS-------------------------
K4QSD2_9ACTO/21-242.....G..VLST-WSVDLK.........AGALVLVVQ---SR-VP------GDWA-------------------------
D3V5E3_XENBS/1-222.....N..FL..-FREDIGI.......NGTP.EFFVL---SH-TA------PIPN-------------------------
K0JYJ1_SACES/1-217.....R..VL..-WRIDR.........HQHQILLYLV---SP-AR------PDLT-------------------------
F2NLA6_MARHT/1-206.....KERLL..-WRLEPT.......RATEPPVVLVQ---TL-TE------PNWG-------------------------
F2NAL6_CORGP/1-225.....R..IL..-WRLDSM......PKAIKTLWLYVV---SP-DK------PDFT-------------------------
B2GBK0_LACF3/13-222.....R..HL..-WRIDTL.........ANRKYLLVV---SE-DK------PDLT-------------------------
C3PF96_CORA7/4-227.....R..LL..-WRID.........RNGHENALYIV---GP-EK------PTAS-------------------------
Q5YRB7_NOCFA/1-222.....R..VL..-WRVDRR.........DHAVDLYVV---SP-SE------PDFT-------------------------
R7C5Y6_9CLOT/4-210.....RLRNL..-WRIDKV.........NGKMYLLLL---SR-LK------PDLS-------------------------
D1A5U1_THECD/1-227.....R..VL..-WRIDRN......GKS..ETYLYIV---SP-LK------PDLT-------------------------
F7XPH1_METZD/1-225.....D..FL..-YRYEFN........RNVP.TFYVV---SK-SI------PANN-------------------------
C7QEM3_CATAD/1-234.....R..VL..-WRLDRN......ANN..QVLLYIV---SP-DR------PDLT-------------------------
X2HBF6_9GAMM/1-222.....I..FL..-FREE.RI.......GKGY.QYYLL---SE-VA------PLSN-------------------------
Q8ZMF1_SALTY/1-212.....Q..FL..-YRRE.EL.......QGAF.RFFVL---SQ-EQ------PAAS-------------------------
F7V5D4_CLOSS/1-209.....R..KL..-WRIDTL.........QGRRYLLLV---SE-EK------PDLE-------------------------
C7JIG8_ACEP3/5-227.....D..FL..-WRQTEPG............HFMIL---SA-RK------PVDS-------------------------
F4F6M1_VERMA/1-220.....R..TL..-WRLDTP........ATATVHLYIA---SP-GR------PDLT-------------------------
H2KA43_STRHJ/1-258.....R..VL..-WRLDRN......KPA..EVFLYIV---SP-DR------PDLT-------------------------
D5QGJ9_KOMHA/5-227.....D..FL..-WRQTEPA............HFMVL---SA-RE------PVDT-------------------------
W5XRF5_9CORY/5-230.....R..IL..-WRVD.........SSKNSTVLYIV---GP-EK------PSLE-------------------------
D7B2M5_NOCDD/1-237.....R..VL..-WRVDRN......ARA..EVFLYVV---GP-NR------PDLT-------------------------
Q74DC7_GEOSL/1-201........FL..-FRVERS....GQQSV....EVLLQ---SR-RE------PTMA-------------------------
G2I4Z3_GLUMN/5-233.....D..FL..-WRQTAPG............QFMVL---SA-RA------PVDR-------------------------
D8PDH7_9BACT/7-231.....E..FL..-FRAERK........GSVP.VFYVL---SR-QQ------PIDR-------------------------
Q0RTG6_FRAAA/28-266.....R..VL..-WRLETG........RPHRAEVLIL---TE-SR------PSWE-------------------------
Q1R113_CHRSD/1-229.....P..FL..-FRQEMEEAANGKS.QGLP.RFYVY---ST-RR------PEAV-------------------------
W5YA73_9CORY/5-211.....R..VL..-WRLD.........KRGHEYVLYVV---GP-EA------SDAS-------------------------
Q2FNT6_METHJ/1-225.....D..FL..-YRAELT........GRDP.VVYLL---SA-RK------PVYE-------------------------

PF09559

I3Y6I2_THIV6/19-221-------------WIAEEP............GMALHT---IH-VA------GS---------------------------
K9XG27_9CHRO/19-215-------------NLHHLE............GLSIQT---IA-GI------PD---------------------------
K8GDJ5_9CYAN/5-213-------------KQENESL.....PNDLPTEVHLCT---IS-GV------PD---------------------------
A1WYF2_HALHL/43-242-------------PLLDPG............EVGIRV---TH-LP------TS---------------------------
L0GUP4_9GAMM/19-220-------------WEEGQA............ALGVHT---IH-VA------GS---------------------------
B1WUU2_CYAA5/5-214-------------EQQPLLL....DNNNLSSEILLSS---IP-GV------PD---------------------------
A9GDE4_SORC5/9-194-------------DLHGAG............WLAVHP---LP-GV------LR---------------------------
S6AB47_9PROT/13-201-------------WLPDEA............LAAVHH---IH-AA------ET---------------------------
K9UJP2_9CHRO/24-218-------------EFHESN............SIGIFG---IN-GK------LS---------------------------
L0D6C1_SINAD/4-204-------------QLHGDT............RIGVHP---IR-GR------QT---------------------------
B7KMS1_CYAP7/17-211-------------IIHDLE............GLSIQT---IA-GI------PD---------------------------
U5QID9_9CYAN/4-208-------------EIHEAD............WLGIHT---LP-GV------RD---------------------------
A1AWQ7_RUTMC/20-216-------------WLDEV.............DAGIFN---IS-.V------AD---------------------------
G2LKY9_CHLTF/7-196-------------WLHDDT............AVRLAP---IR-GL------YA---------------------------
Q8F1E7_LEPIN/7-203-------------TLHEHD............SLSIQT---IS-GL------PD---------------------------
D5ECJ4_AMICL/2-214-------------SIHHAEH.........RRNISIHP---IN-GA------PC---------------------------
H5WQR3_9BURK/14-206-------------WLNSEP............AIGLHP---VN-LV------QG---------------------------
Q0A841_ALKEH/18-217-------------DFSRLP............GFGVKV---LH-LP------VS---------------------------
D3RSM8_ALLVD/19-226-------------WFDEEP............RLGVHT---IH-VA------GS---------------------------
K9YQR8_CYASC/5-205-------------ELHSLP............GLAINS---IS-GI------PD---------------------------
K9XVY7_STAC7/5-218-------------ENSSQIILEEERTRDFPPEVILST---IP-GV------PD---------------------------
B8GUE2_THISH/18-218-------------WMSEEP............AAGVHL---IH-GA------ES---------------------------
D5CSI5_SIDLE/9-195-------------QLGECE............EVGVIP---LR-MA------SS---------------------------
B7JW14_CYAP8/13-212-------------TLHELK............DVGIHP---IA-GI------PT---------------------------
B7KHP0_CYAP7/13-209-------------VIHDLT............TLSIHP---IT-GK------PE---------------------------
CAS6_MYXXD/31-219-------------ALHERS............DMGVFS---LR-GV------SN---------------------------
L0DSG3_THIND/18-218-------------WLGTED............HAGVHL---IH-GA------ES---------------------------
S6BKH6_9GAMM/19-222-------------VLTEDP............RVAIHE---IH-LA------GS---------------------------
K9RC65_9CYAN/23-224-------------SLHELK............SIGIHP---IA-GI------PT---------------------------
Q1CW34_MYXXD/5-192-------------ALHERL............DLGVFT---LR-GE------RA---------------------------
V4IWF5_9GAMM/19-219-------------WLSEP.............GCAIHL---IH-GA------GS---------------------------
K9RR28_SYNP3/19-213-------------EIHERK............GLSILT---IA-GI------PD---------------------------
W0E0S8_MARPU/19-220-------------WLAETA............GLGIHS---IH-GA------GS---------------------------
B1XPP5_SYNP2/5-214-------------.QQSALI..PELNEDISPEVLISS---IS-GV------GN---------------------------
Q3SG16_THIDA/19-210-------------WLGEDP............GSGIQH---LK-GA------AT---------------------------

PF03787

Q1Q3H4_9BACT/4-335--------------------------------KLKTL---SS.IH......IGGK.........................
Q8TPH7_METAC/4-317--------------------------------KIELL---SP.LH......IGNG........NELKMVDFYLNEKKDEI
O57906_PYRHO/18-333--------------------------------MFEVL---TP.LH......IGNG..........NELTPVDFYPLGDRI
B3EIY8_CHLPB/11-320--------------------------------SLTTL---SP.VF......IGAG.........................
A6LNL6_THEM4/4-297--------------------------------EVEVL---TP.LA......INNG..........NEIKSFEIIREGGKS
A4XFP8_CALS8/12-334--------------------------------EVEIL---TP.TV......IGGQ..........DKIQSFEFVRDGAYL
Q3AA80_CARHZ/5-311--------------------------------EIEVL---SP.LF......VGSG.........................
A7HMV5_FERNB/4-324--------------------------------RIEPV---SP.VY......IGSG.........................
A2VLF2_MYCTX/11-314--------------------------------TLRCL---GP.VF......IGSG...............EKRTSKEYHV
Q0AW54_SYNWW/12-313--------------------------------TLRAL---AP.VF......IGSG...................EQLGKK
H3UYT7_STAEP/9-268--------------------------------VIKTL---GP.IH......IGSG........QVMKKQDYIYDFYNSKV
Q03KS9_STRTD/11-288--------------------------------SLLTL---AP.IH......IGNG..........EKYTSREFIYENKKF
A2BKQ7_HYPBU/87-311--------------------------------TAKTK---SK.LI......VGAS.........................
Q2LQX1_SYNAS/103-281--------------------------------TLD..---SP.LI......TGIG.........................
I8UHN2_PORGN/59-251--------------------------------ELKTC---YPGLL......CGVG.........................
A5I3U2_CLOBH/73-293--------------------------------YFKTT---YPGLI......VGTG.........................
Q8TVU2_METKA/491-691--------------------------------RFP.H---SR.LV......VGMG.........................
A1WUQ4_HALHL/82-287--------------------------------PATST---SP.FT......TGLG.........................
A9AWU2_HERA2/90-292--------------------------------KAEVK---GR.MV......VGLG.........................
Q1CW33_MYXXD/74-261--------------------------------TARAE---SR.LL......VGHG.........................
Q977D5_SULTO/23-210--------------------------------EMEVV---SDYLH......VGSG.........................
A8A9P3_IGNH4/77-241--------------------------------ALKTE---GL.VG......IGFG.........................
A1RZR1_THEPD/18-247--------------------------------AFEAR---GP.LH......VGGR.........................
G2TF03_RHORU/11-210--------------------------------KVTAL---SP.LH......VGTG.........................
M1IFS5_9CREN/8-222--------------------------------VFKTP---NG.LR......VGGE.........................
A4YFX5_METS5/9-241--------------------------------RLEE.---...VR......IGTT.........................
M1IF98_9CREN/8-291--------------------------------LIKTM---SI.TR......IGST.........................
A8F3D7_THELT/30-277--------------------------------EVAGG---SF.LH......IGAA.........................
A4FJY4_SACEN/194-372--------------------------------DLSIV---DA.IH......CGTE.........................
A4YFW9_METS5/24-229--------------------------------YLTNL---TP.LR......IGSG.........................
G2T688_RHORU/19-223--------------------------------ELTTR---TP.LH......MGSG.........................
G2TF03_RHORU/253-439--------------------------------GLTCE---GPFAV......LDGS.........................
Q5LZX3_STRT1/11-194--------------------------------QIRLE---TG.LH......IGGS.........................
A5UWG2_ROSS1/10-302--------------------------------LLMTL---DP.VH......IGAG.........................
Q2JNS6_SYNJB/14-218--------------------------------TLKPD---GP.VL......IKAG.........................
A9WGF2_CHLAA/265-444--------------------------------QFVVD---GS.IL......IRAG.........................
A7NFU0_ROSCS/21-222--------------------------------DLLAL---TA.LR......IGAG.........................
O66706_AQUAE/7-289--------------------------------FIKAI---TP.LH......IGTG.........................
A6LNK3_THEM4/7-272--------------------------------FLYAV---TQ.IH......AGKG.........................
A6UNE9_METVS/9-264--------------------------------IIEAI---TN.MH......VGSG.........................
Q2FL77_METHJ/279-403--------------------------------IVTCI---TDFSM......KGLD.........................
A1WUQ2_HALHL/9-296--------------------------------FLYSV---SP.VH......MGAG.........................
Q8TVT9_METKA/8-335--------------------------------FLVCR---TP.TR......AGAG.........................
Q47PK3_THEFY/7-290--------------------------------YLYAE---SP.LH......AGAA.........................
Q2JRT2_SYNJA/7-252--------------------------------YLTLL---TP.LH......TGGT.........................
A0YUX6_LYNSP/8-262--------------------------------IIETL---AP.LH......VGAT.........................
A0YQJ5_LYNSP/5-273--------------------------------WLICC---EP.VH......IGGA.........................
A8A9P1_IGNH4/9-272--------------------------------LMSAL---TH.VH......VGAG.........................
CMR4_SULSO/14-302--------------------------------FIKAV---TH.LH......VSSG.........................
Q97XK7_SULSO/7-290--------------------------------LAYAI---TN.LH......PGAG.........................
A3MVP2_PYRCJ/10-303--------------------------------SLTSL---HP..........GVG.........................
Q2JNS1_SYNJB/20-216--------------------------------RATLA---SA.LA......VGAG.........................
A5UT82_ROSS1/9-185--------------------------------RFPLA---TS.FH......TTGN.........................
Q2FL76_METHJ/14-206--------------------------------DIVTK---SD.LH......IGGH.........................
B8G728_CHLAD/8-184--------------------------------EIEFK---SD.YH......IGAG.........................
M1LLF0_9SYNC/7-200--------------------------------TITMQ---SD.WH......VGTG.........................
B0K2G5_THEPX/4-192--------------------------------KIDLL---SY.TL......IGSG.........................
A9AUN2_HERA2/7-194--------------------------------KITLL---SD.TT......FGTG.........................
Q7MC47_VIBVY/7-190--------------------------------TIDIH---SE.WH......VGSG.........................
A3DH28_CLOTH/14-216--------------------------------DMHTE---SP.LF......IKSS.........................
A4YFX0_METS5/20-218--------------------------------VLRAD---SP.VL......VSTG.........................
Q2JRT5_SYNJA/129-478--------------------------------TFQVT---CP.WR......IRVG.........................
Q2FL77_METHJ/16-208--------------------------------TIELK---TP.MR......IGGG.........................
A4TG45_MYCGI/12-250--------------------------------DIVAL---SSIVHREDYSSVGTD.........................
A4XGU1_CALS8/51-316--------------------------------DIETK---TP.IF......IRGE.........................
Q0ATZ2_SYNWW/170-634--------------------------------NIEAL---TP.LY......IRDA.........................
B0K8W5_THEP3/133-594--------------------------------FLTTK---TP.IY......IRRD.........................
A3DH27_CLOTH/31-251--------------------------------RVKTL---TP.VH......IPSG.........................
A3DKC8_CLOTH/235-405--------------------------------KGKTV---TP.LL......VKDE.........................
M1MPL7_9SYNC/156-674--------------------------------KLTTV---TP.LL......IPDA.........................
Q82XX3_NITEU/10-223--------------------------------VVSTL---SP.VH......IGCG.......EDYEPTEYVVDTSGVLHR
A3DH32_CLOTH/9-175--------------------------------KINLM---TP.FN......ISSG.........................
A6NTP4_9FIRM/14-168--------------------------------CAACQ---SP.IR......TGGT.........................
Q7MC49_VIBVY/10-189--------------------------------VIETV---SP.LA......ITSG.........................
A0RRG9_CAMFF/11-179--------------------------------TLEAL---TP.LK......VGSQ.........................
A3DKC8_CLOTH/16-186--------------------------------KATTI---SP.LA......IRDD.........................
A0YPM8_LYNSP/30-210--------------------------------TLILN---TP.TC......LGSG.........................
D2C6C1_THENR/8-159--------------------------------KILAK---TP.IW......TGNI.........................
Q8PRT5_METMA/8-181--------------------------------VIETL---TP.IW......TGGV.........................
O26428_METTH/15-144--------------------------------ELQIL---NE.IF......TGGP.........................
A7NRR3_ROSCS/6-141--------------------------------KLEAH---TD.IW......TGDA.........................
C9RCS1_AMMDK/9-145--------------------------------HLKAL---TD.IW......TGDV.........................
C9RCG8_AMMDK/9-178--------------------------------ELKTL---TP.VW......TGNV.........................
A5UWG6_ROSS1/4-173--------------------------------QITTL---TP.LW......TGGV.........................
A7NRS6_ROSCS/4-175--------------------------------TISTL---TP.LW......TGGV.........................
A5D4F7_PELTS/4-177--------------------------------EVKTL---TP.LW......TGGA.........................
B3EIR8_CHLL2/6-173--------------------------------ELRTL---TP.IW......TGGV.........................
B4S552_PROA2/12-192--------------------------------TLSTL---TP.LW......TGGP.........................
A6DAG1_9PROT/9-198--------------------------------TFETV---TP.LW......TGDI.........................
C7P6D1_METFA/9-230--------------------------------KFETL---TP.LW......NGNA.........................
B7IGV5_THEAB/8-173--------------------------------KFKTL---SP.LW......TGNY.........................
D3T315_THEIA/9-219--------------------------------HLETI---TP.LW......TGDA.........................
O28411_ARCFU/9-154--------------------------------TLEAI---TP.VF......MRGA.........................
CMR1B_PYRFU/7-178--------------------------------DLEAI---TP.LF......MRGA.........................
D3T7Q1_THEIA/22-173--------------------------------KCEVI---TP.VF......MAGA.........................
B0M908_9FIRM/9-142--------------------------------KLELI---TA.MG......THGA.........................
C5D4N4_GEOSW/18-161--------------------------------KLKLI---TP.MA......MHGA.........................
Q53W07_THET8/34-193--------------------------------TYTLL---TP.LF......GGGV.........................
A9AWU5_HERA2/41-244--------------------------------SYRLI---TP.LF......GGGV.........................
D2ZTS9_NEIMU/25-187--------------------------------YCELV---TP.LH......GGGV.........................
D0W1J3_NEICI/30-211--------------------------------HCELI---TP.IY......GGGI.........................
E6XI85_SHEP2/30-186--------------------------------HCTLV---TP.MY......GGGV.........................
D1Y2F0_9BACT/26-187--------------------------------ACSVI---TP.MF......GGGA.........................
Q1IZR9_DEIGD/24-191--------------------------------QLRTI---TP.MF......GGSA.........................
D3PS14_MEIRD/23-188--------------------------------RLRTI---TP.LF......GSSA.........................
D2Z4K2_9BACT/26-193--------------------------------RISVV---TP.MF......GGGV.........................
C5BIW8_TERTT/31-214--------------------------------NIQVV---TP.MF......GGGV.........................
Q9KFY9_BACHD/34-207--------------------------------NISII---TH.MF......GGGT.........................
C8WRP6_ALIAD/23-238--------------------------------RVTTL---TP.VI......GAGV.........................
Q1CW28_MYXXD/33-206--------------------------------ALKTF---TP.IL......GGGP.........................
D3SNA7_THEAH/10-153--------------------------------TLEFV---TP.AF......IGGA.........................
Q2LQW6_SYNAS/16-162--------------------------------KFEVV---TP.LF......LGGA.........................
B6IX20_RHOCS/283-454--------------------------------TLDLV---SP.AF......FAGA.........................
A8DJU4_9BACT/304-514--------------------------------ELKLT---SP.AF......LAGA.........................
C8W3E8_DESAS/7-167--------------------------------VYQVV---TP.LF......MGGA.........................
B8GSG8_THISH/11-176--------------------------------SYQIV---TP.MF......LGDG.........................
B7R675_9THEO/7-162--------------------------------KLQIV---TP.II......MGGA.........................
O66703_AQUAE/10-154--------------------------------TFEII---TP.VV......MAGT.........................
Q47PK0_THEFY/7-173--------------------------------RLRVT---TP.LF......NGHD.........................
A6LNK0_THEM4/7-158--------------------------------TINFT---TP.SF......ASNN.........................
B7IFF0_THEAB/10-183--------------------------------NIEFI---SP.LI......NRRG.........................
A8UTQ9_9AQUI/7-200--------------------------------EIEFI---TP.AF......IGGA.........................
B2V8M0_SULSY/7-150--------------------------------KVEII---TP.TI......MGGA.........................
A8V361_9AQUI/9-167--------------------------------LIKVI---TP.TI......MGGG.........................
A8M9C0_CALMQ/7-192--------------------------------TLRLV---TP.LF......TGSA.........................
Q96Z54_SULTO/9-305--------------------------------EAKAL---YP.IV......GGYN.........................
CMR1_SULSO/9-255--------------------------------KLKAI---YP.LT......GGYN.........................
D2PID8_SULID/27-180--------------------------------KFKGV---TP.WW......GGDY.........................
D0KVA4_SULS9/24-174--------------------------------NFVGV---TP.WW......GRDH.........................
C4KFX7_SULIK/27-177--------------------------------KFKGV---TP.WW......GGDY.........................
Q8TPH8_METAC/9-242--------------------------------KLDFT---SP.LH......IGEV.........................
A6UVY5_META3/7-263--------------------------------LIPKE---NSKYH......FGEG.........................
A0A038KP63_MYCTX/9-193--------------------------------DFDR.---...TH......FGDH.........................
Q5HK92_STAEQ/9-199--------------------------------KLSFK---TP.VH......FGKK.........................
Q9X2C8_THEMA/9-196--------------------------------KMSFR---SG.FR......VGRG.........................
A3DLB2_STAMF/6-246--------------------------------KLHFT---TP.VH......VGER.........................
B8GB50_CHLAD/99-293--------------------------------NFELL---TP.WY......SKDD.........................
A1ZVA0_9BACT/4-254--------------------------------TLKTL---TP.LH......IGNGEELSALDYVLHQRTYYRVSQYQFLE
A5ILN4_THEP1/4-318--------------------------------TLKTL---TP.LH......IGSG.....EKYPPCNLVVLKEEDNKKTA
Q46CS3_METBF/9-174--------------------------------SLRLL---SP.VH......IGWK.........................
A6DAF6_9PROT/10-162--------------------------------TFKQI---EP.IN......IGQG.........................
Q2FL73_METHJ/7-220--------------------------------TITSV---SP.LH......FGNG.........................
A0ZJ98_NODSP/7-256--------------------------------TITAL---SP.LA......IATR.........................
A4XGT8_CALS8/240-441--------------------------------TVKTL---SP.VV......IAQP.........................
A9AUN3_HERA2/7-220--------------------------------TITTE---QP.LL......ITSL.........................
A3DKC7_CLOTH/8-205--------------------------------DIQAL---EP.LK......LGKF.........................
Q8TVR9_METKA/10-323--------------------------------RLEVL---TP.LH......VGVP.........................
Q8TVU2_METKA/6-335--------------------------------WALTV---TP.TR......VGTG.........................
Q6L316_PICTO/4-317--------------------------------EINVK---SP.LL......ISSS...DYLNLSEVLRNGNEIYMLDINK
Q97CJ4_THEVO/4-334--------------------------------QLKVS---SP.VL......IGND....YVNVTNMIINKDSLYMLDMDK
CSM5_METJA/49-345--------------------------------KCELI---TP.IF......IGCGEEYSQLDYFIEDGLAHIIDLEKAVS
A6DE72_9PROT/4-332--------------------------------KFEVI---TP.IF......SGSG.........................
O27150_METTH/4-274--------------------------------TLEVI---TP.VH......IGNG.........................

PF09700

A0B6W4_METTP/4-358GDGYDLAGLRFR.GPLLCRE......GD.RGPEMLYP...AP-LN------LL..-------------------------
O28413_ARCFU/3-341.....EPEFEIL.GHFFYR.......YD.GKFELLVE...SP-HD------....-------------------------
A6VYS5_MARMS/4-381...NSLLEVPVT.GPLAVKIPLDQSVSKLEQRHILVP...KP-AD------AQYF-------------------------
Q47PK4_THEFY/13-381.........AVR.GPILGKQ.....NPD.GRWCPYFP...VP-SD------IVVV-------------------------
Q9KFY7_BACHD/8-408VDYHTFSKVPVY.GPLYVW...........KGKPFFP...LP-SD------IGF.-------------------------
Q1CW30_MYXXD/6-386EEVRLRHLVALR.RPLGES........F.SLAHRMWP...FP-AD------AVC.-------------------------
Q2JN53_SYNJB/4-377........LRLR.GPFLCH...........DERLYFP...AP-LH------LEDG-------------------------
A9AWU6_HERA2/68-470.QGNKLQPIQIY.GPVLVELLE.PNEAN.AEAEFLCP...AP-AD------ALLF-------------------------
A1WUQ1_HALHL/5-362GTPEEPGTFTLT.GVTLARR.....QSS.GTAEPLHP...LP-AD------LSVE-------------------------
A5D0Z3_PELTS/4-387AEIPRLKKIEVL.GPLLVELD...AGTG.DIDRWLVP...AP-AD------ALFF-------------------------
Q8TVU0_METKA/10-439SIGEALGETALFLGTWVVEVRP..GAPD.RLERVWWP...CP-AH------LARY-------------------------
Q6ZEA9_SYNY3/4-365........ISLI.GPLLYH...........KETLYFP...RP-LG------FVGK-------------------------
Q1IZS1_DEIGD/6-393.ELQALHNTPIR..ALLRR...........DETFMFP...AP-LN------AV..-------------------------
Q7MTH3_PORGI/6-391KDKLQFGIIQSL.SPVFIIDKK..KNDE.GKEEYFLP...VG-RR------FQ..-------------------------
A9AVY8_HERA2/6-387...TNLLAMQVR.GPILLK..........ETVDLLIPFVAIP-AD------ALIR-------------------------
Q8R6Z6_THETN/4-372.........NVY.GPFIER...........NGKLYFP...KP-SN------ILG.-------------------------
Q1AZD9_RUBXD/4-359GDGQRLGPLRFA.GPYVTR...........GGEPLFP...AP-LY------LM..-------------------------
G2LF94_CHLTF/11-373AEAHWIGALAVR.GPWLARWD...KNPA.TPCEVLVP...AP-AT------LHR.-------------------------
Q53W08_THET8/2-351........WGLR.GPLLAEE......GE.GGWRLLAP...RP-LD------AL..-------------------------

PF09704

Q2MF31_STRSD/16-248--------------------------------VLLLRLAG.P-LQ------SW.G-------------------------
Q7NYP8_CHRVO/13-224--------------------------------GIRIHVWG.A-RA------CF.T-------------------------
A1ARH6_PELPD/3-217--------------------------------TLLLRLVG.P-MQ------SW.G-------------------------
Q12YA8_METBU/4-236--------------------------------YLIFRLYG.P-MA------SW.G-------------------------
Q0BSC7_GRABC/6-215--------------------------------FLVFGLAA.S-LG------SM.G-------------------------
A8ABL4_IGNH4/3-275--------------------------------GLFFELEL..-..------AW.G-------------------------
A6W168_MARMS/4-241--------------------------------YLVFRLYG.P-MA------SW.G-------------------------
O66696_AQUAE/3-211--------------------------------CLKAEFFS.P-IA------LF.K-------------------------
A8ZZ17_DESOH/3-251--------------------------------YLLFRLYG.P-MA------SW.G-------------------------
Q1EQJ4_STRKN/3-213--------------------------------VLALQLAG.P-LQ------AW.G-------------------------
A5UR14_ROSS1/3-244--------------------------------TLFLRLEG.P-LQ------SW.G-------------------------
H6NZD8_SALTI/4-233--------------------------------YLVFQLYA.P-LA------SW.G-------------------------
Q3A5Z4_PELCD/3-236--------------------------------HLVFRLYG.P-LA------AW.G-------------------------
C1DSH9_AZOVD/3-205--------------------------------TLLLCLQG.P-MQ------SW.G-------------------------
Q5YRB6_NOCFA/3-211--------------------------------VLLLRLAA.P-LQ------SW.G-------------------------
Q1CWU1_MYXXD/10-210--------------------------------SFRVRARG.P-VA------CF.T-------------------------
A3DLC5_STAMF/3-270--------------------------------AYKLRIEF..-..------LW.G-------------------------
A4J385_DESRM/4-212--------------------------------GIRLLVWG.E-FA------CF.T-------------------------
CAS5_MANSM/4-216--------------------------------RIRLHIWG.D-YA------CF.T-------------------------
Q8KDC0_CHLTE/7-228--------------------------------TFCLEVKG.D-YA------CF.T-------------------------
Q2P7C5_XANOM/4-215--------------------------------GVRLHVWG.E-RA------LF.T-------------------------
Q9X2C0_THEMA/3-212--------------------------------VLVFDVSA.P-YA------LF.R-------------------------
Q03C60_LACC3/3-210--------------------------------TISIRLTS.P-LQ------SY.G-------------------------
I6UXT4_9EURY/3-239--------------------------------ILLVCLRF.P-FF------SV.A-------------------------
Q47PI7_THEFY/3-209--------------------------------VLTLLLAG.P-LQ------AW.G-------------------------
O28407_ARCFU/3-252--------------------------------GYLVDVEF..-..------VW.G-------------------------
Q2SID2_HAHCH/4-215--------------------------------GIRLLVWG.E-RA------CF.T-------------------------
CAS5_METJA/5-228--------------------------------ALVALLRF.P-FY------SF.G-------------------------
G7QLA9_LEPII/11-225--------------------------------IFQLKVSG.E-NA------CF.T-------------------------
O27159_METTH/3-241--------------------------------TLAVEIFQ.P-FA------QF.R-------------------------
B3E5U9_GEOLS/3-263--------------------------------YLLFRLYG.P-LA------SW.G-------------------------
Q04QB7_LEPBJ/4-240--------------------------------YLVFRLYG.P-LV------SW.G-------------------------
Q60AD2_METCA/3-241--------------------------------ILLLRFDA.P-LM------SF.G-------------------------
Q2RL62_MOOTA/18-224--------------------------------WLAVKVWG.D-LA------CF.T-------------------------
A5GBK2_GEOUR/12-223--------------------------------FLALRLEG.P-LQ------SW.G-------------------------
E3ITF8_DESVR/10-218--------------------------------GIRLRVWG.D-YA------CF.T-------------------------
Q0W584_UNCMA/6-214--------------------------------LLLLRLEG.P-MQ------SW.G-------------------------
Q1NKD4_9DELT/4-199--------------------------------RIDFKVTG.R-FA------LF.T-------------------------
A4YFV1_METS5/10-233--------------------------------KVWVRLHW..-..------...G-------------------------
A8LYZ7_SALAI/3-226--------------------------------GLLLRLAG.P-MQ------SW.G-------------------------
B1XDH0_ECODH/4-214--------------------------------YLILRLAG.P-MQ------AW.G-------------------------
Q0AZP3_SYNWW/4-212--------------------------------GVKLKVWG.D-FA------CF.T-------------------------
Q1R114_CHRSD/4-250--------------------------------HLVFRLYA.P-MA------SW.G-------------------------
C3MMV7_SULIL/5-232--------------------------------KVFLKLHW..-..------...G-------------------------
G2TC86_RHORU/4-212--------------------------------GIKLLVSG.D-HA------CF.T-------------------------
Q5P3Y6_AROAE/8-203--------------------------------SIEFKVWG.R-HA------LF.T-------------------------
Q314I4_DESAG/4-228--------------------------------YLTFQIYG.P-LQ------AY.G-------------------------
A1SV73_PSYIN/3-198--------------------------------TLILKTEG..-MS------AY.G-------------------------
Q1EQS9_STRKN/13-242--------------------------------GLLLRLSG.P-LQ------SW.G-------------------------
A0A025A1M5_ECOLX/4-233--------------------------------YLIFQLHG.P-MA------SW.G-------------------------
A6TNS2_ALKMQ/6-209--------------------------------SVEFKVSG.R-YA------LF.S-------------------------
B4SAU9_PELPB/4-206--------------------------------GIKLRVWG.D-YA------LF.T-------------------------
Q1H3R5_METFK/4-216--------------------------------GVRLHVWG.D-YA------CF.T-------------------------
Q67RP0_SYMTH/3-220--------------------------------TLLLRLAG.P-MQ------SW.G-------------------------
Q2JWC5_SYNJA/3-192--------------------------------TLLMRLRA.P-MM------SW.G-------------------------
B1YHA3_EXIS2/4-198--------------------------------TIEFKVYG.E-YA------LF.T-------------------------
C8RRP0_CORJE/4-209--------------------------------TLLLRLSG.P-MQ------SW.G-------------------------
Q7N8H5_PHOLL/4-236--------------------------------YLVFRLYG.P-MA------SW.G-------------------------
Q60B28_METCA/3-213--------------------------------DICLKVFG.D-YA------CF.T-------------------------
Q2LX12_SYNAS/8-216--------------------------------TIEFKLWG.R-FA------LF.T-------------------------
B8I205_CLOCE/4-212--------------------------------GIKLEVWG.E-YA------LF.T-------------------------
G2T7M5_RHORU/6-238--------------------------------WLIVHLEA.P-LL------AF.G-------------------------
C1DNX2_AZOVD/4-215--------------------------------GIRLLVWG.E-RA------CF.T-------------------------
Q0AA33_ALKEH/3-231--------------------------------CLILRLDA.P-LM------SF.G-------------------------
D3SKA4_DEHMG/6-199--------------------------------TLLMRLEG.P-MQ------SW.G-------------------------
Q47PJ4_THEFY/3-220--------------------------------GFLLRLAG.P-MQ------SW.G-------------------------
H2G9N4_CORD2/4-220--------------------------------SAYIRLSG.P-LQ------SWAG-------------------------
Q1JX11_DESAC/4-219--------------------------------FLILKLQG.P-MQ------AW.G-------------------------
Q746C2_THET2/3-211--------------------------------RLKVKVWG.E-YA------CF.S-------------------------
Q0RTG7_FRAAA/8-241--------------------------------CLVLRLAG.P-VQ------SW.G-------------------------
H1L764_GEOME/10-218--------------------------------MLRLKVWG.D-NA------CF.T-------------------------
Q977B3_SULTO/4-249--------------------------------VLIY.....G-LH------HW.G-------------------------
Q0BRF8_GRABC/3-224--------------------------------WLVLQWRA.P-LA------SF.G-------------------------
D0KV44_SULS9/4-251--------------------------------VVIF.....G-IH------HW.G-------------------------
Q8ZZL1_PYRAE/3-217--------------------------------ILLVKLRL.P-LF------SI.K-------------------------
Q3ARV4_CHLCH/4-200--------------------------------SIEFKVYG.R-EA------MF.T-------------------------
Q1J367_DEIGD/3-208--------------------------------TLLLRLVA.P-MQ------AW.G-------------------------
Q9KFY3_BACHD/4-199--------------------------------EVQFELFG.D-YA------LF.T-------------------------
A5V1B9_ROSS1/6-202--------------------------------SVTFKVWG.R-YA------LF.T-------------------------
G6EUG2_LACDE/3-211--------------------------------TLTIKLTA.P-LQ------AY.G-------------------------
O57910_PYRHO/4-218--------------------------------LLGLIVDARP-LQ------AHFR-------------------------
A0A031WDW5_PEPDI/3-221--------------------------------VLKLDLFQ.E-TA------CY.K-------------------------
A2BKI9_HYPBU/5-261--------------------------------MLVSKVEL..-..------AW.G-------------------------
A1A2N3_BIFAA/7-207--------------------------------SIEYEVWG.R-YA------LF.S-------------------------
Q9YCM4_AERPE/7-241--------------------------------VVVAELAT.P-AF------SV.K-------------------------
Q6LWA3_PHOPR/12-207--------------------------------TLILKTEG..-LS------AY.G-------------------------
A0AE91_STRAM/6-214--------------------------------VLVLRLAG.P-LQ------SW.G-------------------------
D7AIG1_GEOSK/4-217--------------------------------YLILKLQG.P-MQ------SW.G-------------------------
Q8KB22_CHLTE/5-230--------------------------------FILLWLEA.P-LQ------SW.G-------------------------
A0A029S7I4_STRPY/6-202--------------------------------DFYVRVSG.Q-RA------LF.T-------------------------
A0A022MV28_9ACTO/14-209--------------------------------PVAVQVWA.E-GA------LF.T-------------------------
Q5JGB2_THEKO/7-237--------------------------------FLKVQLRPTG-II------ALRA-------------------------
B3ENH9_CHLPB/5-225--------------------------------FLLLWLEA.P-LQ------SW.G-------------------------
Q96X68_SULTO/5-233--------------------------------KVFLKLHW..-..------...G-------------------------
Q53WH0_THET8/3-225--------------------------------TLLIRLQG.P-LQ------SW.G-------------------------
A5D0R8_PELTS/6-219--------------------------------DVKVKVWG.E-YA------CF.T-------------------------
G2T675_RHORU/6-247--------------------------------FLVFRLVG.P-MA------AW.G-------------------------
A0LDG2_MAGSM/7-202--------------------------------DLEFLLTA.R-YA------LF.T-------------------------
Q3SR91_NITWN/4-221--------------------------------GIRLKVWG.D-YA------CF.T-------------------------
Q1ZM77_PHOAS/4-242--------------------------------YLVFRLYG.A-MA------SW.G-------------------------
Q9UZX1_PYRAB/18-248--------------------------------FLKVEASPSG-II------ALRS-------------------------
A4SFQ4_PROVI/7-227--------------------------------TFCLEVEG.D-YA------CF.T-------------------------

PF01881

W6RS12_9CLOT/95-244--------------------------------------------------------------------------------
Q6L357_PICTO/91-231--------------------------------------------------------------------------------
Q5JHS4_THEKO/94-238--------------------------------------------------------------------------------
D5WUC6_KYRT2/99-252--------------------------------------------------------------------------------
R5LEA9_9SPIR/108-254--------------------------------------------------------------------------------
Q8R6W9_THETN/98-246--------------------------------------------------------------------------------
I0GHZ9_CALEA/103-252--------------------------------------------------------------------------------
I3VSC9_THESW/97-245--------------------------------------------------------------------------------
K0NH01_DESTT/117-279--------------------------------------------------------------------------------
C8W340_DESAS/104-254--------------------------------------------------------------------------------
B3QWN9_CHLT3/102-265--------------------------------------------------------------------------------
Q5JGA0_THEKO/96-240--------------------------------------------------------------------------------
U6EA28_9EURY/92-240--------------------------------------------------------------------------------
D9RZH3_THEOJ/95-246--------------------------------------------------------------------------------
A1BI29_CHLPD/104-261--------------------------------------------------------------------------------
L0AM89_NATGS/80-250--------------------------------------------------------------------------------
A9BGZ0_PETMO/96-247--------------------------------------------------------------------------------
D1CID5_THET1/96-249--------------------------------------------------------------------------------
F6DTP0_DESRL/96-242--------------------------------------------------------------------------------
R7ML22_9FIRM/93-237--------------------------------------------------------------------------------
S0AQH2_FERAC/95-242--------------------------------------------------------------------------------
A6LNL8_THEM4/96-241--------------------------------------------------------------------------------
F2NN51_MARHT/98-239--------------------------------------------------------------------------------
C5D4N1_GEOSW/99-245--------------------------------------------------------------------------------
F8E5C0_FLESM/100-243--------------------------------------------------------------------------------
B8DZI0_DICTD/99-246--------------------------------------------------------------------------------
Q3AA62_CARHZ/99-248--------------------------------------------------------------------------------
CAS6_PYRFU/97-237--------------------------------------------------------------------------------
O30164_ARCFU/96-240--------------------------------------------------------------------------------
F4LS54_TEPAE/98-244--------------------------------------------------------------------------------
R6G9C8_9FIRM/96-238--------------------------------------------------------------------------------
B4SEV7_PELPB/104-261--------------------------------------------------------------------------------
Q8TJV5_METAC/91-240--------------------------------------------------------------------------------
Q184H4_PEPD6/93-241--------------------------------------------------------------------------------
D3T9Q1_ACIB4/83-232--------------------------------------------------------------------------------
R6MWP8_9FIRM/94-238--------------------------------------------------------------------------------
B4S5I3_PROA2/104-260--------------------------------------------------------------------------------
Q2NH84_METST/83-232--------------------------------------------------------------------------------
Q11SY3_CYTH3/88-249--------------------------------------------------------------------------------
F7PNQ2_9EURY/83-252--------------------------------------------------------------------------------
Q8R6W6_THETN/100-249--------------------------------------------------------------------------------
A6LJX4_THEM4/95-242--------------------------------------------------------------------------------
A6TQ80_ALKMQ/113-256--------------------------------------------------------------------------------
F0SWC2_SYNGF/93-241--------------------------------------------------------------------------------
R5F1G6_9BACE/103-255--------------------------------------------------------------------------------
D7DSW4_METV3/93-244--------------------------------------------------------------------------------
A3DHS6_CLOTH/100-239--------------------------------------------------------------------------------
A3I0J5_9BACT/87-249--------------------------------------------------------------------------------
Q8REC5_FUSNN/93-241--------------------------------------------------------------------------------
H1XXZ4_9BACT/97-255--------------------------------------------------------------------------------
Q24TS7_DESHY/112-258--------------------------------------------------------------------------------
C5CE93_KOSOT/105-255--------------------------------------------------------------------------------
F6BD56_METIK/93-234--------------------------------------------------------------------------------
I7CU20_NATSJ/82-250--------------------------------------------------------------------------------
C7N977_LEPBD/102-257--------------------------------------------------------------------------------
I4AF01_FLELS/86-246--------------------------------------------------------------------------------
D4LL18_9FIRM/20-161--------------------------------------------------------------------------------
I4BY45_ANAMD/101-249--------------------------------------------------------------------------------
M1MKV7_9CLOT/95-244--------------------------------------------------------------------------------
C5CFB4_KOSOT/93-238--------------------------------------------------------------------------------
D1AI68_SEBTE/102-241--------------------------------------------------------------------------------
D3PEQ4_DEFDS/104-252--------------------------------------------------------------------------------
Q2NFS1_METST/94-243--------------------------------------------------------------------------------
H3ZLX7_THELN/94-238--------------------------------------------------------------------------------
E4TSF2_MARTH/87-240--------------------------------------------------------------------------------
A5D0Y7_PELTS/97-243--------------------------------------------------------------------------------
F8C1X9_THEGP/88-239--------------------------------------------------------------------------------
L0EHC1_THECK/97-248--------------------------------------------------------------------------------
C9RCX9_AMMDK/97-244--------------------------------------------------------------------------------
H3ZK27_THELN/95-239--------------------------------------------------------------------------------
A5D0Y8_PELTS/98-246--------------------------------------------------------------------------------
F4KYC0_HALH1/106-260--------------------------------------------------------------------------------
I2F7N5_9THEM/94-240--------------------------------------------------------------------------------
E8T539_THEA1/123-268--------------------------------------------------------------------------------
F7YVR8_9THEM/97-247--------------------------------------------------------------------------------
R5NPA5_9PORP/99-253--------------------------------------------------------------------------------
Q1AZD0_RUBXD/95-247--------------------------------------------------------------------------------
F6D794_METSW/92-236--------------------------------------------------------------------------------
R5Q6M6_9FIRM/94-236--------------------------------------------------------------------------------
G2TLN2_BACCO/98-246--------------------------------------------------------------------------------
D9RZG4_THEOJ/95-241--------------------------------------------------------------------------------
D3E282_METRM/92-241--------------------------------------------------------------------------------
F9ZC95_ODOSD/99-253--------------------------------------------------------------------------------
W0DCW4_9AQUI/104-247--------------------------------------------------------------------------------
R6N4L4_9BACE/105-257--------------------------------------------------------------------------------
D4M9Y0_9BACT/110-256--------------------------------------------------------------------------------
B7GIV2_ANOFW/71-220--------------------------------------------------------------------------------
A8F3P6_THELT/94-244--------------------------------------------------------------------------------
R9SJL2_9EURY/92-241--------------------------------------------------------------------------------
L7VPR9_CLOSH/98-240--------------------------------------------------------------------------------
CAS6L_PYRFU/93-237--------------------------------------------------------------------------------
G7V6P2_THELD/96-246--------------------------------------------------------------------------------
Q9X2D4_THEMA/95-245--------------------------------------------------------------------------------
CAS6B_METJA/83-239--------------------------------------------------------------------------------
A9BIX0_PETMO/97-241--------------------------------------------------------------------------------
Q5V7W8_HALMA/83-252--------------------------------------------------------------------------------
K0AY46_CLOA9/100-241--------------------------------------------------------------------------------
I3VSW8_THESW/106-256--------------------------------------------------------------------------------
E6SGU1_THEM7/160-301--------------------------------------------------------------------------------
G7V6F2_THELD/105-253--------------------------------------------------------------------------------
G8TRE8_NIAKG/100-264--------------------------------------------------------------------------------
Q3AA81_CARHZ/97-247--------------------------------------------------------------------------------
A7HMV7_FERNB/99-241--------------------------------------------------------------------------------
A5UJJ7_METS3/91-240--------------------------------------------------------------------------------
C5D2U6_GEOSW/88-237--------------------------------------------------------------------------------
I3RB26_HALMT/83-252--------------------------------------------------------------------------------
A4J1X6_DESRM/97-248--------------------------------------------------------------------------------
A4XIJ2_CALS8/99-248--------------------------------------------------------------------------------
A4XM43_CALS8/100-259--------------------------------------------------------------------------------
H1YB50_9SPHI/101-259--------------------------------------------------------------------------------
F8A9G0_THEID/98-270--------------------------------------------------------------------------------
M1E4R5_9FIRM/102-250--------------------------------------------------------------------------------
F2KRM8_ARCVS/96-239--------------------------------------------------------------------------------
E3CYI3_9BACT/99-270--------------------------------------------------------------------------------
I6ZYF6_MELRP/91-233--------------------------------------------------------------------------------
H2J3Z6_MARPK/100-251--------------------------------------------------------------------------------
B5YIV6_THEYD/110-261--------------------------------------------------------------------------------
O27163_METTH/3-152--------------------------------------------------------------------------------
O66704_AQUAE/88-235--------------------------------------------------------------------------------
H1XYR5_9BACT/101-261--------------------------------------------------------------------------------
R6AKE9_9CLOT/101-242--------------------------------------------------------------------------------
Q182E2_PEPD6/98-243--------------------------------------------------------------------------------
F4A3C4_MAHA5/97-245--------------------------------------------------------------------------------
Q6L312_PICTO/84-234--------------------------------------------------------------------------------
F7YTK7_9THEM/97-245--------------------------------------------------------------------------------
Q12WX9_METBU/91-239--------------------------------------------------------------------------------
D5XAY0_THEPJ/96-242--------------------------------------------------------------------------------
I0GI07_CALEA/110-270--------------------------------------------------------------------------------
G8UK03_TANFA/105-257--------------------------------------------------------------------------------
F8I2S5_SULAT/94-242--------------------------------------------------------------------------------
E4TH18_CALNY/109-261--------------------------------------------------------------------------------
I2F5U2_9THEM/105-254--------------------------------------------------------------------------------
O66560_AQUAE/89-243--------------------------------------------------------------------------------
B5YKZ6_THEYD/94-242--------------------------------------------------------------------------------
G7M8P5_9CLOT/95-244--------------------------------------------------------------------------------
D3PBR5_DEFDS/101-244--------------------------------------------------------------------------------
N0BC99_9EURY/89-232--------------------------------------------------------------------------------
E8T547_THEA1/126-270--------------------------------------------------------------------------------
D3DIQ3_HYDTT/95-238--------------------------------------------------------------------------------
B1I5K4_DESAP/98-246--------------------------------------------------------------------------------
R5UPH1_9PORP/99-253--------------------------------------------------------------------------------
C8VZL4_DESAS/97-243--------------------------------------------------------------------------------
D7CN19_SYNLT/100-243--------------------------------------------------------------------------------
W0JFB3_DESAE/95-241--------------------------------------------------------------------------------
CAS6A_METJA/97-238--------------------------------------------------------------------------------

PF10040

L0K6N4_HALHC/192-313---------------------------------------------------------------------...........
F3ZXK6_MAHA5/109-225---------------------------------------------------------------------...........
G2MK90_9ARCH/153-282---------------------------------------------------------------------...........
K9Y918_HALP7/157-268---------------------------------------------------------------------...........
H1XX22_9BACT/179-297---------------------------------------------------------------------...........
B1L433_KORCO/181-296---------------------------------------------------------------------...........
A0ZJZ0_NODSP/168-288---------------------------------------------------------------------...........
Q2JNR9_SYNJB/173-291---------------------------------------------------------------------...........
B7KDF7_CYAP7/219-329---------------------------------------------------------------------...........
A4J507_DESRM/141-258---------------------------------------------------------------------...........
F4EVS7_SELS3/145-262---------------------------------------------------------------------...........
K9QB89_9NOSO/174-286---------------------------------------------------------------------...........
A8ZV96_DESOH/179-300---------------------------------------------------------------------...........
C9R989_AMMDK/199-320---------------------------------------------------------------------...........
R5PNI3_9BURK/195-316---------------------------------------------------------------------...........
I0I1W5_CALAS/150-266---------------------------------------------------------------------...........
K9WP49_9CYAN/161-281---------------------------------------------------------------------...........
E1QU68_VULDI/131-260---------------------------------------------------------------------...........
H9ZZ94_FERFK/153-293---------------------------------------------------------------------.....KKIATP
E8T6Q0_THEA1/128-244---------------------------------------------------------------------...........
I0I2Y7_CALAS/165-288---------------------------------------------------------------------...........
G4RMW7_THETK/109-233---------------------------------------------------------------------...........
B7KB41_CYAP7/154-264---------------------------------------------------------------------...........
E6W3H3_DESIS/152-268---------------------------------------------------------------------...........
A9WEP3_CHLAA/149-264---------------------------------------------------------------------...........
A3CNA0_STRSV/121-237---------------------------------------------------------------------...........
K9VUC0_9CYAN/184-304---------------------------------------------------------------------...........
G0VQ62_MEGEL/131-244---------------------------------------------------------------------...........
Q8ZZK8_PYRAE/121-245---------------------------------------------------------------------...........
B9M7F5_GEODF/178-295---------------------------------------------------------------------...........
K9Z6D5_CYAAP/156-268---------------------------------------------------------------------...........
B7JVM6_CYAP8/153-263---------------------------------------------------------------------...........
I7GZK7_9HELI/102-216---------------------------------------------------------------------...........
B3EIY9_CHLPB/190-322---------------------------------------------------------------------...........
B5YHA0_THEYD/183-305---------------------------------------------------------------------...........
Q2RV92_RHORT/175-295---------------------------------------------------------------------...........
K4LGU6_THEPS/201-322---------------------------------------------------------------------...........
B2ITK0_NOSP7/163-275---------------------------------------------------------------------...........
D7BB61_MEISD/120-235---------------------------------------------------------------------...........
D1BQ19_VEIPT/134-250---------------------------------------------------------------------...........
K9WFD7_9CYAN/163-275---------------------------------------------------------------------...........
B8D4R7_DESK1/164-296---------------------------------------------------------------------FKLASK.....
B0VHA6_CLOAI/114-232---------------------------------------------------------------------...........
K9PEZ2_9CYAN/154-264---------------------------------------------------------------------...........
U5QKR7_9CYAN/153-269---------------------------------------------------------------------...........
Q39T05_GEOMG/185-302---------------------------------------------------------------------...........
A9B3B3_HERA2/187-307---------------------------------------------------------------------...........
D9PZC3_ACIS3/155-292---------------------------------------------------------------------.....LKVMTP
E0STW9_IGNAA/133-249---------------------------------------------------------------------...........
E1QHL8_DESB2/181-300---------------------------------------------------------------------...........
F5YHB2_TREPZ/187-308---------------------------------------------------------------------...........
F6B8N9_DESCC/193-314---------------------------------------------------------------------...........
F8A9J4_THEID/178-299---------------------------------------------------------------------...........
C7RP07_ACCPU/214-336---------------------------------------------------------------------...........
I5B4K9_9DELT/185-305---------------------------------------------------------------------...........
E6N6Z0_9ARCH/137-279---------------------------------------------------------------------QKGPTFFMRLL
V4J6E9_9GAMM/199-322---------------------------------------------------------------------...........
A5G6J6_GEOUR/186-302---------------------------------------------------------------------...........
Q97YE5_SULSO/103-227---------------------------------------------------------------------...........
Q2LQW0_SYNAS/206-327---------------------------------------------------------------------...........
I3TFC5_THEC1/166-297---------------------------------------------------------------------FRRGR......
D7CS37_TRURR/124-238---------------------------------------------------------------------...........
F2NN98_MARHT/122-236---------------------------------------------------------------------...........
I3WBS4_THESW/113-229---------------------------------------------------------------------...........
Q74DY6_GEOSL/182-300---------------------------------------------------------------------...........
K9U2M1_9CYAN/157-268---------------------------------------------------------------------...........
A0LHY9_SYNFM/189-311---------------------------------------------------------------------...........
F8AWH3_FRADG/56-175---------------------------------------------------------------------...........
R5D9G4_9FIRM/121-237---------------------------------------------------------------------...........
K9Z2G9_CYAAP/132-249---------------------------------------------------------------------...........
Q0AW55_SYNWW/127-243---------------------------------------------------------------------...........
E8N1C5_ANATU/199-324---------------------------------------------------------------------...........
K9QGU5_9NOSO/132-249---------------------------------------------------------------------...........
A5UUF5_ROSS1/193-311---------------------------------------------------------------------...........
A0B9F8_METTP/179-309---------------------------------------------------------------------...........
Q3IQ75_NATPD/155-284---------------------------------------------------------------------...........
B8HXC7_CYAP4/154-266---------------------------------------------------------------------...........
Q2FM73_METHJ/142-274---------------------------------------------------------------------...........
B1XQV2_SYNP2/146-256---------------------------------------------------------------------...........
H2J4R7_MARPK/152-265---------------------------------------------------------------------...........
A8ABE5_IGNH4/136-253---------------------------------------------------------------------WRGPGEEL...
Q0AU02_SYNWW/189-308---------------------------------------------------------------------...........
K9ZE49_ANACC/159-269---------------------------------------------------------------------...........
A1WUQ5_HALHL/173-290---------------------------------------------------------------------...........
H1XUD1_9BACT/171-291---------------------------------------------------------------------...........
K0I7U3_NITGG/134-256---------------------------------------------------------------------...........
A8M9A8_CALMQ/140-275---------------------------------------------------------------------...........
D7BJF9_MEISD/140-264---------------------------------------------------------------------...........
K9Z986_CYAAP/157-276---------------------------------------------------------------------...........
C8W2P2_DESAS/150-266---------------------------------------------------------------------...........
Q5M4I8_STRT2/122-236---------------------------------------------------------------------...........
A9WJU8_CHLAA/202-322---------------------------------------------------------------------...........
L0DVU2_THIND/189-312---------------------------------------------------------------------...........
K9UYS9_9CYAN/166-276---------------------------------------------------------------------...........
A9G7I6_SORC5/239-364---------------------------------------------------------------------...........
K9VAI7_9CYAN/164-284---------------------------------------------------------------------...........
B4S549_PROA2/190-322---------------------------------------------------------------------...........
A3DLD1_STAMF/165-290---------------------------------------------------------------------YKKTR......
D4ZUE3_ARTPN/132-249---------------------------------------------------------------------...........
Q8ZZM1_PYRAE/124-248---------------------------------------------------------------------...........
Q53VU8_THET8/136-259---------------------------------------------------------------------...........
R5SKY0_9FIRM/124-242---------------------------------------------------------------------...........
I6XRG2_PROPF/138-250---------------------------------------------------------------------...........
A4YFW1_METS5/128-261---------------------------------------------------------------------.....SMIGLP
K9VP83_9CYAN/158-269---------------------------------------------------------------------...........
CAS6A_SULSO/138-276---------------------------------------------------------------------.....SKVLLP
Q1J2Q0_DEIGD/229-349---------------------------------------------------------------------...........
U5N9J4_9BURK/187-313---------------------------------------------------------------------...........
D5BXY1_NITHN/195-319---------------------------------------------------------------------...........
K9VUL1_9CYAN/157-268---------------------------------------------------------------------...........
B8HZK9_CYAP4/163-283---------------------------------------------------------------------...........
F2NCY6_DESAR/192-310---------------------------------------------------------------------...........
G4RK11_THETK/123-247---------------------------------------------------------------------...........
R6P553_9FIRM/125-241---------------------------------------------------------------------...........
A1RZS7_THEPD/144-262---------------------------------------------------------------------...........
E3IY75_FRASU/114-233---------------------------------------------------------------------...........
G0EG84_PYRF1/160-282---------------------------------------------------------------------WRPGSR.....
B9LX88_HALLT/152-281---------------------------------------------------------------------...........
R5EQX2_9GAMM/149-273---------------------------------------------------------------------...........
R6GYJ4_9FIRM/123-239---------------------------------------------------------------------...........
K9Q0F8_9CYAN/153-272---------------------------------------------------------------------...........
F2NCL0_DESAR/192-312---------------------------------------------------------------------...........
F4B5Q5_ACIHW/132-254---------------------------------------------------------------------...........
K9SF16_9CYAN/154-274---------------------------------------------------------------------...........
F4HFU9_GALAU/181-302---------------------------------------------------------------------...........
K9VE89_9CYAN/176-287---------------------------------------------------------------------...........
K9TTK8_9CYAN/158-269---------------------------------------------------------------------...........
A8AA66_IGNH4/120-231---------------------------------------------------------------------...........
F4BVN4_METCG/195-321---------------------------------------------------------------------D..........
A9AX64_HERA2/145-263---------------------------------------------------------------------...........
G4RJS6_THETK/34-142---------------------------------------------------------------------...........
G4SY21_META2/183-306---------------------------------------------------------------------...........
F4B6S4_ACIHW/137-278---------------------------------------------------------------------.....SKILLP
Q8TVD3_METKA/146-269---------------------------------------------------------------------...........
D4ZX77_ARTPN/162-287---------------------------------------------------------------------...........
Q4J7P9_SULAC/157-282---------------------------------------------------------------------FEKLADLDRVK
G7ZCD4_AZOL4/213-331---------------------------------------------------------------------...........
K9Y1X1_STAC7/155-269---------------------------------------------------------------------...........
A1RZX7_THEPD/116-251---------------------------------------------------------------------GRGSLLKAGGP
Q4J7R1_SULAC/134-278---------------------------------------------------------------------.....NKYMVP
R6PQ35_9CLOT/170-290---------------------------------------------------------------------...........
F8AW66_FRADG/144-268---------------------------------------------------------------------...........
K9XLZ1_9CHRO/153-265---------------------------------------------------------------------...........
J7LAT0_NOCAA/122-261---------------------------------------------------------------------DNAGERIPHIW
Q7MC52_VIBVY/165-292---------------------------------------------------------------------...........
E0SSI4_IGNAA/163-304---------------------------------------------------------------------.....SKLMAP
Q5HK95_STAEQ/125-241---------------------------------------------------------------------...........
E0UKL6_CYAP2/154-264---------------------------------------------------------------------...........
K9TQ72_9CYAN/193-313---------------------------------------------------------------------...........
Q01QC2_SOLUE/166-287---------------------------------------------------------------------...........
B1L7L1_KORCO/136-264---------------------------------------------------------------------...........
D3PLA6_MEIRD/120-235---------------------------------------------------------------------...........
D5X8I6_THEPJ/130-246---------------------------------------------------------------------...........
R5DX83_9FIRM/123-238---------------------------------------------------------------------...........
V4IUZ5_9GAMM/183-318---------------------------------------------------------------------...........
Q4J7D4_SULAC/139-263---------------------------------------------------------------------...........
A9AZH6_HERA2/149-264---------------------------------------------------------------------...........
Q8ZZU6_PYRAE/127-237---------------------------------------------------------------------...........
Q65S11_MANSM/165-285---------------------------------------------------------------------...........
Q6ZEI4_SYNY3/146-256---------------------------------------------------------------------...........
E8MZD5_ANATU/156-270---------------------------------------------------------------------...........
B1I4N7_DESAP/204-325---------------------------------------------------------------------...........
D4KCT1_9FIRM/124-240---------------------------------------------------------------------...........
C8XDH3_NAKMY/112-225---------------------------------------------------------------------...........
Q1AT68_RUBXD/185-307---------------------------------------------------------------------...........
D4L090_9FIRM/123-239---------------------------------------------------------------------...........
CAS6_MYCTU/184-299---------------------------------------------------------------------...........
K9REI7_9CYAN/159-279---------------------------------------------------------------------...........
K8GNP3_9CYAN/167-279---------------------------------------------------------------------...........
B5EGG7_GEOBB/173-285---------------------------------------------------------------------...........
F8E951_FLESM/180-296---------------------------------------------------------------------...........
A5UQ98_ROSS1/201-322---------------------------------------------------------------------...........
F9VPJ5_SULTO/122-263---------------------------------------------------------------------.....SKVLLP
G0GAL5_SPITZ/216-341---------------------------------------------------------------------...........
K9TQH4_9CYAN/147-257---------------------------------------------------------------------...........
D3RZU7_FERPA/182-298---------------------------------------------------------------------...........
R7BKP7_9FIRM/123-239---------------------------------------------------------------------...........
F8C651_THEGP/144-257---------------------------------------------------------------------...........
D9QVV0_ACEAZ/146-259---------------------------------------------------------------------...........
D1BQ29_VEIPT/148-260---------------------------------------------------------------------...........
G2SNW3_LACRR/125-241---------------------------------------------------------------------...........
D3RWD2_ALLVD/219-343---------------------------------------------------------------------...........
E4TFF0_CALNY/178-296---------------------------------------------------------------------...........
B8GIG7_METPE/143-274---------------------------------------------------------------------...........
F2NWE0_TRES6/180-299---------------------------------------------------------------------...........
Q9YCN0_AERPE/130-237---------------------------------------------------------------------...........
A4YFU6_METS5/153-293---------------------------------------------------------------------.....SKIYLP
A9B8P4_HERA2/194-316---------------------------------------------------------------------...........
B5YJR6_THEYD/170-291---------------------------------------------------------------------...........
Q6ZED0_SYNY3/150-271---------------------------------------------------------------------...........
A1BI47_CHLPD/189-321---------------------------------------------------------------------...........
H8GGS4_METAL/183-307---------------------------------------------------------------------...........
K9PIY0_9CYAN/160-280---------------------------------------------------------------------...........
B0TFX1_HELMI/206-328---------------------------------------------------------------------...........
F5XNN8_MICPN/117-229---------------------------------------------------------------------...........
E1QQW2_VULDI/142-269---------------------------------------------------------------------...........
Q2FR84_METHJ/137-256---------------------------------------------------------------------...........
B0JKW7_MICAN/158-269---------------------------------------------------------------------...........
Q5SM65_THET8/120-234---------------------------------------------------------------------...........
D0MKP1_RHOM4/203-324---------------------------------------------------------------------...........
Q82XX5_NITEU/191-313---------------------------------------------------------------------...........
M1E8T8_9FIRM/184-306---------------------------------------------------------------------...........
F5YD05_TREAZ/184-300---------------------------------------------------------------------...........
R7K0L3_9CLOT/123-239---------------------------------------------------------------------...........
K9R5X4_9CYAN/163-274---------------------------------------------------------------------...........
K9ZQ95_ANACC/226-336---------------------------------------------------------------------...........
F6CKB2_DESK7/215-335---------------------------------------------------------------------...........

PF08798

E4N250_KITSK/3-213---------------------------------------------------------------------...QLP..AGY
Q1GAI3_LACDA/1-205---------------------------------------------------------------------...EF.ERYGK
B1VIX9_CORU7/5-232---------------------------------------------------------------------...VLVEQAGW
Q32CH4_SHIDS/1-198---------------------------------------------------------------------...........
I3Y7Y7_THIV6/4-234---------------------------------------------------------------------...........
B6IWM2_RHOCS/29-260---------------------------------------------------------------------...........
B1VNZ6_STRGG/1-237---------------------------------------------------------------------...HLVEQAGW
E4N5A8_KITSK/2-247---------------------------------------------------------------------...HLVEQAGW
K4INP2_BIFAP/1-227---------------------------------------------------------------------...HIVEQAGW
G2IXW9_PSEUL/3-219---------------------------------------------------------------------...........
G0FR05_AMYMS/1-212---------------------------------------------------------------------...KLP..DGH
D3VAX8_XENNA/1-223---------------------------------------------------------------------...........
I2BC80_SHIBC/1-231---------------------------------------------------------------------...........
Q0W583_UNCMA/1-248---------------------------------------------------------------------...KLP..EGY
E3D0F9_9BACT/1-235---------------------------------------------------------------------...FLQECPGY
D1CAI9_SPHTD/1-253---------------------------------------------------------------------...QLP..ADY
J7L987_NOCAA/16-239---------------------------------------------------------------------...AIPR....
B5GY64_STRC2/3-305---------------------------------------------------------------------...HVVERAGW
Q60AD3_METCA/5-237---------------------------------------------------------------------...........
A1ARH5_PELPD/1-222---------------------------------------------------------------------...........
Q0BSC8_GRABC/21-226---------------------------------------------------------------------...........
C4ZJY2_THASP/8-234---------------------------------------------------------------------...........
Q2JH26_FRASC/2-267---------------------------------------------------------------------...HLIEQAGW
X4RBI6_9ACTO/5-219---------------------------------------------------------------------...HIVEEAGW
C7LYW5_ACIFD/1-220---------------------------------------------------------------------...HFAASVGQ
F8E3A0_CORRG/2-224---------------------------------------------------------------------...HIAEQAGW
Q03C59_LACC3/1-212---------------------------------------------------------------------...QL.ARYGV
K7SNJ1_PROA4/34-264---------------------------------------------------------------------...HLVEQAGW
A9GV72_SORC5/1-243---------------------------------------------------------------------...RLP..EDY
Q4JWK1_CORJK/5-216---------------------------------------------------------------------...KIAEQTGS
E3D9L3_GARV3/3-212---------------------------------------------------------------------...RL.EMYGV
A7MFK9_CROS8/1-212---------------------------------------------------------------------...........
Q47PJ5_THEFY/2-224---------------------------------------------------------------------...RLG..PGY
C8XAY3_NAKMY/1-211---------------------------------------------------------------------...HLVEQAGW
R5IV38_9CLOT/1-210---------------------------------------------------------------------...IGVRRYGF
C6WMQ8_ACTMD/1-218---------------------------------------------------------------------...GLP..ETL
D7CSJ6_TRURR/1-209---------------------------------------------------------------------...ALF.....
F3ZMY9_9ACTO/3-245---------------------------------------------------------------------...HLVEQAGW
L0J770_MYCSM/1-219---------------------------------------------------------------------...HLVEQAGW
Q0BRF7_GRABC/2-239---------------------------------------------------------------------...........
Q7N8H4_PHOLL/1-222---------------------------------------------------------------------...........
Q6NEQ5_CORDI/6-226---------------------------------------------------------------------...........
C7MTM6_SACVD/3-234---------------------------------------------------------------------...HLVEQCGW
C1DSI0_AZOVD/1-204---------------------------------------------------------------------VLQGLP...GY
Q314I5_DESAG/1-218---------------------------------------------------------------------...........
D6YAN0_THEBD/1-227---------------------------------------------------------------------...HLVEQAGW
J9VY84_LACBU/1-220---------------------------------------------------------------------...LL.GAYGV
Q825C0_STRAW/3-217---------------------------------------------------------------------...RLP..DGY
B0S4B5_FINM2/1-205---------------------------------------------------------------------...MF.ERNGI
V6KHH8_STRNV/6-213---------------------------------------------------------------------...ELP..NGY
A9HLC4_GLUDA/5-226---------------------------------------------------------------------...........
A6W167_MARMS/1-222---------------------------------------------------------------------...........
D1A6Q6_THECD/5-212---------------------------------------------------------------------...KLP..ASY
D6ZIM7_MOBCV/5-218---------------------------------------------------------------------...HIVEQAGW
G2KWT8_LACSM/1-220---------------------------------------------------------------------...EL.VKYGI
H8GLK4_METAL/1-204---------------------------------------------------------------------...........
B8IZA5_DESDA/2-205---------------------------------------------------------------------...........
B8IMR1_METNO/3-240---------------------------------------------------------------------...........
R6Q6M2_9FIRM/1-206---------------------------------------------------------------------...GVVEQFGT
A5GBK0_GEOUR/3-226---------------------------------------------------------------------...........
F0RQX4_DEIPM/1-214---------------------------------------------------------------------...AVS.....
D1CGD5_THET1/2-229---------------------------------------------------------------------...RLP..EGY
A4XYT8_PSEMY/1-202---------------------------------------------------------------------ALQVLP...NY
B8HWH7_CYAP4/1-204---------------------------------------------------------------------...HLS..YNY
Q67RN9_SYMTH/1-223---------------------------------------------------------------------...RLP..AGY
Q1J366_DEIGD/4-210---------------------------------------------------------------------...ALN.....
K7SEU6_GLUOY/4-237---------------------------------------------------------------------...........
W5TGY3_9NOCA/19-245---------------------------------------------------------------------...RIPS....
Q2RXJ4_RHORT/4-241---------------------------------------------------------------------...........
A5FTJ9_ACICJ/1-224---------------------------------------------------------------------...........
G4SY61_META2/1-204---------------------------------------------------------------------...........
J7L4F7_NOCAA/1-247---------------------------------------------------------------------...HMVEQAGR
CAS6_THET8/1-211---------------------------------------------------------------------...........
B7KJ27_CYAP7/1-214---------------------------------------------------------------------...QLP.....
W5WPN4_9CORY/1-214---------------------------------------------------------------------...HIQEQAGW
W8KR76_HALHR/1-229---------------------------------------------------------------------...........
R6BMI8_9CLOT/1-206---------------------------------------------------------------------...RMAVQFAP
A0LM55_SYNFM/1-201---------------------------------------------------------------------...........
F2GBG6_ALTMD/1-221---------------------------------------------------------------------...........
A8LMM7_DINSH/4-255---------------------------------------------------------------------...........
I4CC95_DESTA/1-227---------------------------------------------------------------------...........
D7BDY1_MEISD/1-207---------------------------------------------------------------------...KLTQRFPG
F4H8A3_CELFA/1-228---------------------------------------------------------------------...HLAEQAGW
G2PH26_STRVO/4-213---------------------------------------------------------------------...ALP..VGY
B8GIV2_METPE/3-224---------------------------------------------------------------------...........
A5UR13_ROSS1/1-236---------------------------------------------------------------------...HIP..DRM
K4QSD2_9ACTO/21-242---------------------------------------------------------------------...GMPR....
D3V5E3_XENBS/1-222---------------------------------------------------------------------...........
K0JYJ1_SACES/1-217---------------------------------------------------------------------...HLVEQVGW
F2NLA6_MARHT/1-206---------------------------------------------------------------------...........
F2NAL6_CORGP/1-225---------------------------------------------------------------------...HVVEQAGW
B2GBK0_LACF3/13-222---------------------------------------------------------------------...IL.SRYGI
C3PF96_CORA7/4-227---------------------------------------------------------------------...GIVEQAGY
Q5YRB7_NOCFA/1-222---------------------------------------------------------------------...HIVEQAGW
R7C5Y6_9CLOT/4-210---------------------------------------------------------------------...NLVKQFGV
D1A5U1_THECD/1-227---------------------------------------------------------------------...HLVEQAGW
F7XPH1_METZD/1-225---------------------------------------------------------------------...........
C7QEM3_CATAD/1-234---------------------------------------------------------------------...HIVEQAGW
X2HBF6_9GAMM/1-222---------------------------------------------------------------------...........
Q8ZMF1_SALTY/1-212---------------------------------------------------------------------...........
F7V5D4_CLOSS/1-209---------------------------------------------------------------------...KL.EKYGI
C7JIG8_ACEP3/5-227---------------------------------------------------------------------...........
F4F6M1_VERMA/1-220---------------------------------------------------------------------...HLVEQAGW
H2KA43_STRHJ/1-258---------------------------------------------------------------------...HFVEQAGW
D5QGJ9_KOMHA/5-227---------------------------------------------------------------------...........
W5XRF5_9CORY/5-230---------------------------------------------------------------------...HIVEQAGW
D7B2M5_NOCDD/1-237---------------------------------------------------------------------...HVVEQAGW
Q74DC7_GEOSL/1-201---------------------------------------------------------------------...........
G2I4Z3_GLUMN/5-233---------------------------------------------------------------------...........
D8PDH7_9BACT/7-231---------------------------------------------------------------------...........
Q0RTG6_FRAAA/28-266---------------------------------------------------------------------...HLIEQAGW
Q1R113_CHRSD/1-229---------------------------------------------------------------------...........
W5YA73_9CORY/5-211---------------------------------------------------------------------...HIVEQAGW
Q2FNT6_METHJ/1-225---------------------------------------------------------------------...........

PF09559

I3Y6I2_THIV6/19-221--------------------------------------------------------------------------------
K9XG27_9CHRO/19-215--------------------------------------------------------------------------------
K8GDJ5_9CYAN/5-213--------------------------------------------------------------------------------
A1WYF2_HALHL/43-242--------------------------------------------------------------------------------
L0GUP4_9GAMM/19-220--------------------------------------------------------------------------------
B1WUU2_CYAA5/5-214--------------------------------------------------------------------------------
A9GDE4_SORC5/9-194--------------------------------------------------------------------------------
S6AB47_9PROT/13-201--------------------------------------------------------------------------------
K9UJP2_9CHRO/24-218--------------------------------------------------------------------------------
L0D6C1_SINAD/4-204--------------------------------------------------------------------------------
B7KMS1_CYAP7/17-211--------------------------------------------------------------------------------
U5QID9_9CYAN/4-208--------------------------------------------------------------------------------
A1AWQ7_RUTMC/20-216--------------------------------------------------------------------------------
G2LKY9_CHLTF/7-196--------------------------------------------------------------------------------
Q8F1E7_LEPIN/7-203--------------------------------------------------------------------------------
D5ECJ4_AMICL/2-214--------------------------------------------------------------------------------
H5WQR3_9BURK/14-206--------------------------------------------------------------------------------
Q0A841_ALKEH/18-217--------------------------------------------------------------------------------
D3RSM8_ALLVD/19-226--------------------------------------------------------------------------------
K9YQR8_CYASC/5-205--------------------------------------------------------------------------------
K9XVY7_STAC7/5-218--------------------------------------------------------------------------------
B8GUE2_THISH/18-218--------------------------------------------------------------------------------
D5CSI5_SIDLE/9-195--------------------------------------------------------------------------------
B7JW14_CYAP8/13-212--------------------------------------------------------------------------------
B7KHP0_CYAP7/13-209--------------------------------------------------------------------------------
CAS6_MYXXD/31-219--------------------------------------------------------------------------------
L0DSG3_THIND/18-218--------------------------------------------------------------------------------
S6BKH6_9GAMM/19-222--------------------------------------------------------------------------------
K9RC65_9CYAN/23-224--------------------------------------------------------------------------------
Q1CW34_MYXXD/5-192--------------------------------------------------------------------------------
V4IWF5_9GAMM/19-219--------------------------------------------------------------------------------
K9RR28_SYNP3/19-213--------------------------------------------------------------------------------
W0E0S8_MARPU/19-220--------------------------------------------------------------------------------
B1XPP5_SYNP2/5-214--------------------------------------------------------------------------------
Q3SG16_THIDA/19-210--------------------------------------------------------------------------------

PF03787

Q1Q3H4_9BACT/4-335.......EGNFLPMEYLIFRNKCYFINEDKLSKELYDRQLLDNFLTGIKQKGKDFSVDAFLKEKKLLTQEFLDKTSSYSS
Q8TPH7_METAC/4-317RFIDFEKFIDYCIEKRINLNQEMKNPRYYTGSDFSISKFMDAKQIDPNTFTSYAV......................SAI
O57906_PYRHO/18-333IVLDTEKLINDLLRLGVEVEELLDFLRNPPGSLYLWRGYLEKLHLDPRNYARYS.......................LRI
B3EIY8_CHLPB/11-320....AEHVLSPYSDFVQRGDSLIYIDTDRLQDAMQGDKALIEAFVKGMRHIENNRLTFVLEKFITGTLGREVDDFAARVV
A6LNL6_THEM4/4-297YILDFNKLFENENFVELVVNSPQILSDEDSLKKAFKFLKLDYKKYT...............................KMV
A4XFP8_CALS8/12-334YFINFDRLLEENLFKESFVDELTRGLSGNLKDFNIHDVMTKYNMDFRQFSKY.........................KLK
Q3AA80_CARHZ/5-311..QKYPPLEYLISLEEEKFVVADMERVFTSPRFVLNDFLDKVKRPGFFLGESYPWAREFPRFKFSSS..........RKT
A7HMV5_FERNB/4-324........EKIGKFEMLIRGDKTYVLDFDKLMSKNNFVEYFVANIDIILEPSKKDIALEKIFKALKMNVEDYTKFVFQTI
A2VLF2_MYCTX/11-314EGDRVYFPDMELLYADIPAHKRKSFEAFVMNTDGAQATAPLKEWVEPNAVKLDPAKHRGYEVKIGSIEPRRASRGRGGRM
Q0AW54_SYNWW/12-313EYIFDSPNALIYFPDFPRLVAFLKERSLLAEYEKFLSTPRLKDIRVFLEENGISAADYPSFVRYSIA..........AGE
H3UYT7_STAEP/9-268YMINGNKLVKFLKRKNLLYTYQNFLRYPPKNPRENGLKDYLDAQNVKQSEWEAFVSYSEKVNQGK............KYG
Q03KS9_STRTD/11-288YFPDMGKFYNKMVEKRLAEKFEAFLIQTRPNARNNRLISFLNDNRIAERSFGGYSISETGLES..............DRN
A2BKQ7_HYPBU/87-311................................................................................
Q2LQX1_SYNAS/103-281................................................................................
I8UHN2_PORGN/59-251............................................................YHHEINKPADEKGKKVEGDK
A5I3U2_CLOBH/73-293.............................................................................YSH
Q8TVU2_METKA/491-691................................................................................
A1WUQ4_HALHL/82-287................................................................................
A9AWU2_HERA2/90-292................................................................................
Q1CW33_MYXXD/74-261................................................................................
Q977D5_SULTO/23-210.......................................................VYDVEIIKPLENIDQLVETALKGTI
A8A9P3_IGNH4/77-241................................................................................
A1RZR1_THEPD/18-247................................................................................
G2TF03_RHORU/11-210............................................................DFTTIEG..........LSG
M1IFS5_9CREN/8-222................................................................................
A4YFX5_METS5/9-241................................................................................
M1IF98_9CREN/8-291.........................................................................GVYFDYA
A8F3D7_THELT/30-277................................................................................
A4FJY4_SACEN/194-372................................................................................
A4YFW9_METS5/24-229................................................................................
G2T688_RHORU/19-223......................................................................SFEARQELRR
G2TF03_RHORU/253-439..........................................................................YQSNKG
Q5LZX3_STRT1/11-194...............................................................................D
A5UWG2_ROSS1/10-302................................................................................
Q2JNS6_SYNJB/14-218.............................................................................KEG
A9WGF2_CHLAA/265-444.............................................................................FDE
A7NFU0_ROSCS/21-222................................................................................
O66706_AQUAE/7-289................................................................................
A6LNK3_THEM4/7-272................................................................................
A6UNE9_METVS/9-264................................................................................
Q2FL77_METHJ/279-403................................................................................
A1WUQ2_HALHL/9-296................................................................................
Q8TVT9_METKA/8-335................................................................................
Q47PK3_THEFY/7-290................................................................................
Q2JRT2_SYNJA/7-252................................................................................
A0YUX6_LYNSP/8-262................................................................................
A0YQJ5_LYNSP/5-273................................................................................
A8A9P1_IGNH4/9-272................................................................................
CMR4_SULSO/14-302................................................................................
Q97XK7_SULSO/7-290................................................................................
A3MVP2_PYRCJ/10-303................................................................................
Q2JNS1_SYNJB/20-216................................................................................
A5UT82_ROSS1/9-185................................................................................
Q2FL76_METHJ/14-206................................................................................
B8G728_CHLAD/8-184................................................................................
M1LLF0_9SYNC/7-200................................................................................
B0K2G5_THEPX/4-192................................................................................
A9AUN2_HERA2/7-194................................................................................
Q7MC47_VIBVY/7-190................................................................................
A3DH28_CLOTH/14-216............................................................................DENQ
A4YFX0_METS5/20-218................................................................................
Q2JRT5_SYNJA/129-478................................................................................
Q2FL77_METHJ/16-208...........................................................................QNAAM
A4TG45_MYCGI/12-250................................................................................
A4XGU1_CALS8/51-316................................................................................
Q0ATZ2_SYNWW/170-634......................................................................YKQDEEKRTY
B0K8W5_THEP3/133-594................................................................................
A3DH27_CLOTH/31-251...............................................................................E
A3DKC8_CLOTH/235-405................................................................................
M1MPL7_9SYNC/156-674...............................................................................S
Q82XX3_NITEU/10-223FNAGILPDLSDAGISSDILTILSNDEAHTEQLRAVHKVLSKYRDKIIPLASVHVSMCTGVHAHYKST..........QDK
A3DH32_CLOTH/9-175................................................................................
A6NTP4_9FIRM/14-168................................................................................
Q7MC49_VIBVY/10-189................................................................................
A0RRG9_CAMFF/11-179................................................................................
A3DKC8_CLOTH/16-186................................................................................
A0YPM8_LYNSP/30-210................................................................................
D2C6C1_THENR/8-159................................................................................
Q8PRT5_METMA/8-181................................................................................
O26428_METTH/15-144................................................................................
A7NRR3_ROSCS/6-141................................................................................
C9RCS1_AMMDK/9-145................................................................................
C9RCG8_AMMDK/9-178................................................................................
A5UWG6_ROSS1/4-173................................................................................
A7NRS6_ROSCS/4-175................................................................................
A5D4F7_PELTS/4-177................................................................................
B3EIR8_CHLL2/6-173................................................................................
B4S552_PROA2/12-192................................................................................
A6DAG1_9PROT/9-198................................................................................
C7P6D1_METFA/9-230................................................................................
B7IGV5_THEAB/8-173................................................................................
D3T315_THEIA/9-219................................................................................
O28411_ARCFU/9-154................................................................................
CMR1B_PYRFU/7-178................................................................................
D3T7Q1_THEIA/22-173................................................................................
B0M908_9FIRM/9-142................................................................................
C5D4N4_GEOSW/18-161................................................................................
Q53W07_THET8/34-193................................................................................
A9AWU5_HERA2/41-244................................................................................
D2ZTS9_NEIMU/25-187................................................................................
D0W1J3_NEICI/30-211................................................................................
E6XI85_SHEP2/30-186................................................................................
D1Y2F0_9BACT/26-187................................................................................
Q1IZR9_DEIGD/24-191................................................................................
D3PS14_MEIRD/23-188................................................................................
D2Z4K2_9BACT/26-193................................................................................
C5BIW8_TERTT/31-214................................................................................
Q9KFY9_BACHD/34-207................................................................................
C8WRP6_ALIAD/23-238................................................................................
Q1CW28_MYXXD/33-206................................................................................
D3SNA7_THEAH/10-153................................................................................
Q2LQW6_SYNAS/16-162................................................................................
B6IX20_RHOCS/283-454................................................................................
A8DJU4_9BACT/304-514................................................................................
C8W3E8_DESAS/7-167................................................................................
B8GSG8_THISH/11-176................................................................................
B7R675_9THEO/7-162................................................................................
O66703_AQUAE/10-154................................................................................
Q47PK0_THEFY/7-173................................................................................
A6LNK0_THEM4/7-158................................................................................
B7IFF0_THEAB/10-183................................................................................
A8UTQ9_9AQUI/7-200................................................................................
B2V8M0_SULSY/7-150................................................................................
A8V361_9AQUI/9-167................................................................................
A8M9C0_CALMQ/7-192................................................................................
Q96Z54_SULTO/9-305................................................................................
CMR1_SULSO/9-255................................................................................
D2PID8_SULID/27-180................................................................................
D0KVA4_SULS9/24-174................................................................................
C4KFX7_SULIK/27-177................................................................................
Q8TPH8_METAC/9-242................................................................................
A6UVY5_META3/7-263................................................................................
A0A038KP63_MYCTX/9-193................................................................................
Q5HK92_STAEQ/9-199................................................................................
Q9X2C8_THEMA/9-196................................................................................
A3DLB2_STAMF/6-246................................................................................
B8GB50_CHLAD/99-293................................................................................
A1ZVA0_9BACT/4-254FIKNDEALVEAYAKWIDQTTRELDDLQDRKNREHDKNRKRDYNQQLSHLRKQFSLLSFMQIQGKEQELLEFLKRPEVLKT
A5ILN4_THEP1/4-318VRLNTRKFLEVLRKRPQITKELSKTLTLKEVENVEDGVFYEVSL.................................YSD
Q46CS3_METBF/9-174................................................................................
A6DAF6_9PROT/10-162................................................................................
Q2FL73_METHJ/7-220................................................................................
A0ZJ98_NODSP/7-256................................................................................
A4XGT8_CALS8/240-441................................................................................
A9AUN3_HERA2/7-220................................................................................
A3DKC7_CLOTH/8-205................................................................................
Q8TVR9_METKA/10-323...................REEELVRGLDYRVDGNRILVVDFTTLPPERAERVLGALEGGDHAEAEGYLEGAEVLREVEL
Q8TVU2_METKA/6-335................................................................................
Q6L316_PICTO/4-317LIYENKNMINKLKKIFMNYYNRDINESFNELQNQYRSINNIDRYKIYPAIKYNRL...........D..........IKK
Q97CJ4_THEVO/4-334LIDNEPKIDQLAEYFLSYKSSDKDEYSKYNEIKRFYNNINAENYKIEPEIKGDKEFYEVINSNDNKF..........LKA
CSM5_METJA/49-345DLDDLEKVDYISGLIVSNIDNNRLNLTAKDILESVGLNPYDYVIR................................KIE
A6DE72_9PROT/4-332........EDYYPNEFFIMNDEIYFLDKNKFLDKIVKEDKLDEFIKVSSNIDDLLDFIDENADESVASDKLYADSEVIDD
O27150_METTH/4-274.......TTYGPQEFYTGKAKSGDKLVPIFGRVDVSKLYSELDDDARDELVDHISTQDFQLDSMKKFKKAARRAVRYRGF

PF09700

A0B6W4_METTP/4-358--------------------------------------------------------------------------......
O28413_ARCFU/3-341--------------------------------------------------------------------------......
A6VYS5_MARMS/4-381--------------------------------------------------------------------------......
Q47PK4_THEFY/13-381--------------------------------------------------------------------------E.....
Q9KFY7_BACHD/8-408--------------------------------------------------------------------------......
Q1CW30_MYXXD/6-386--------------------------------------------------------------------------......
Q2JN53_SYNJB/4-377--------------------------------------------------------------------------FPLVPV
A9AWU6_HERA2/68-470--------------------------------------------------------------------------EPE.SK
A1WUQ1_HALHL/5-362--------------------------------------------------------------------------......
A5D0Z3_PELTS/4-387--------------------------------------------------------------------------EL...V
Q8TVU0_METKA/10-439--------------------------------------------------------------------------......
Q6ZEA9_SYNY3/4-365--------------------------------------------------------------------------TPLLPL
Q1IZS1_DEIGD/6-393--------------------------------------------------------------------------......
Q7MTH3_PORGI/6-391--------------------------------------------------------------------------......
A9AVY8_HERA2/6-387--------------------------------------------------------------------------......
Q8R6Z6_THETN/4-372--------------------------------------------------------------------------......
Q1AZD9_RUBXD/4-359--------------------------------------------------------------------------......
G2LF94_CHLTF/11-373--------------------------------------------------------------------------......
Q53W08_THET8/2-351--------------------------------------------------------------------------......

PF09704

Q2MF31_STRSD/16-248--------------------------------------------------------------------------------
Q7NYP8_CHRVO/13-224--------------------------------------------------------------------------------
A1ARH6_PELPD/3-217--------------------------------------------------------------------------------
Q12YA8_METBU/4-236--------------------------------------------------------------------------------
Q0BSC7_GRABC/6-215--------------------------------------------------------------------------------
A8ABL4_IGNH4/3-275--------------------------------------------------------------------------------
A6W168_MARMS/4-241--------------------------------------------------------------------------------
O66696_AQUAE/3-211--------------------------------------------------------------------------------
A8ZZ17_DESOH/3-251--------------------------------------------------------------------------------
Q1EQJ4_STRKN/3-213--------------------------------------------------------------------------------
A5UR14_ROSS1/3-244--------------------------------------------------------------------------------
H6NZD8_SALTI/4-233--------------------------------------------------------------------------------
Q3A5Z4_PELCD/3-236--------------------------------------------------------------------------------
C1DSH9_AZOVD/3-205--------------------------------------------------------------------------------
Q5YRB6_NOCFA/3-211--------------------------------------------------------------------------------
Q1CWU1_MYXXD/10-210--------------------------------------------------------------------------------
A3DLC5_STAMF/3-270--------------------------------------------------------------------------------
A4J385_DESRM/4-212--------------------------------------------------------------------------------
CAS5_MANSM/4-216--------------------------------------------------------------------------------
Q8KDC0_CHLTE/7-228--------------------------------------------------------------------------------
Q2P7C5_XANOM/4-215--------------------------------------------------------------------------------
Q9X2C0_THEMA/3-212--------------------------------------------------------------------------------
Q03C60_LACC3/3-210--------------------------------------------------------------------------------
I6UXT4_9EURY/3-239--------------------------------------------------------------------------------
Q47PI7_THEFY/3-209--------------------------------------------------------------------------------
O28407_ARCFU/3-252--------------------------------------------------------------------------------
Q2SID2_HAHCH/4-215--------------------------------------------------------------------------------
CAS5_METJA/5-228--------------------------------------------------------------------------------
G7QLA9_LEPII/11-225--------------------------------------------------------------------------------
O27159_METTH/3-241--------------------------------------------------------------------------------
B3E5U9_GEOLS/3-263--------------------------------------------------------------------------------
Q04QB7_LEPBJ/4-240--------------------------------------------------------------------------------
Q60AD2_METCA/3-241--------------------------------------------------------------------------------
Q2RL62_MOOTA/18-224--------------------------------------------------------------------------------
A5GBK2_GEOUR/12-223--------------------------------------------------------------------------------
E3ITF8_DESVR/10-218--------------------------------------------------------------------------------
Q0W584_UNCMA/6-214--------------------------------------------------------------------------------
Q1NKD4_9DELT/4-199--------------------------------------------------------------------------------
A4YFV1_METS5/10-233--------------------------------------------------------------------------------
A8LYZ7_SALAI/3-226--------------------------------------------------------------------------------
B1XDH0_ECODH/4-214--------------------------------------------------------------------------------
Q0AZP3_SYNWW/4-212--------------------------------------------------------------------------------
Q1R114_CHRSD/4-250--------------------------------------------------------------------------------
C3MMV7_SULIL/5-232--------------------------------------------------------------------------------
G2TC86_RHORU/4-212--------------------------------------------------------------------------------
Q5P3Y6_AROAE/8-203--------------------------------------------------------------------------------
Q314I4_DESAG/4-228--------------------------------------------------------------------------------
A1SV73_PSYIN/3-198--------------------------------------------------------------------------------
Q1EQS9_STRKN/13-242--------------------------------------------------------------------------------
A0A025A1M5_ECOLX/4-233--------------------------------------------------------------------------------
A6TNS2_ALKMQ/6-209--------------------------------------------------------------------------------
B4SAU9_PELPB/4-206--------------------------------------------------------------------------------
Q1H3R5_METFK/4-216--------------------------------------------------------------------------------
Q67RP0_SYMTH/3-220--------------------------------------------------------------------------------
Q2JWC5_SYNJA/3-192--------------------------------------------------------------------------------
B1YHA3_EXIS2/4-198--------------------------------------------------------------------------------
C8RRP0_CORJE/4-209--------------------------------------------------------------------------------
Q7N8H5_PHOLL/4-236--------------------------------------------------------------------------------
Q60B28_METCA/3-213--------------------------------------------------------------------------------
Q2LX12_SYNAS/8-216--------------------------------------------------------------------------------
B8I205_CLOCE/4-212--------------------------------------------------------------------------------
G2T7M5_RHORU/6-238--------------------------------------------------------------------------------
C1DNX2_AZOVD/4-215--------------------------------------------------------------------------------
Q0AA33_ALKEH/3-231--------------------------------------------------------------------------------
D3SKA4_DEHMG/6-199--------------------------------------------------------------------------------
Q47PJ4_THEFY/3-220--------------------------------------------------------------------------------
H2G9N4_CORD2/4-220--------------------------------------------------------------------------------
Q1JX11_DESAC/4-219--------------------------------------------------------------------------------
Q746C2_THET2/3-211--------------------------------------------------------------------------------
Q0RTG7_FRAAA/8-241--------------------------------------------------------------------------------
H1L764_GEOME/10-218--------------------------------------------------------------------------------
Q977B3_SULTO/4-249--------------------------------------------------------------------------------
Q0BRF8_GRABC/3-224--------------------------------------------------------------------------------
D0KV44_SULS9/4-251--------------------------------------------------------------------------------
Q8ZZL1_PYRAE/3-217--------------------------------------------------------------------------------
Q3ARV4_CHLCH/4-200--------------------------------------------------------------------------------
Q1J367_DEIGD/3-208--------------------------------------------------------------------------------
Q9KFY3_BACHD/4-199--------------------------------------------------------------------------------
A5V1B9_ROSS1/6-202--------------------------------------------------------------------------------
G6EUG2_LACDE/3-211--------------------------------------------------------------------------------
O57910_PYRHO/4-218--------------------------------------------------------------------------------
A0A031WDW5_PEPDI/3-221--------------------------------------------------------------------------------
A2BKI9_HYPBU/5-261--------------------------------------------------------------------------------
A1A2N3_BIFAA/7-207--------------------------------------------------------------------------------
Q9YCM4_AERPE/7-241--------------------------------------------------------------------------------
Q6LWA3_PHOPR/12-207--------------------------------------------------------------------------------
A0AE91_STRAM/6-214--------------------------------------------------------------------------------
D7AIG1_GEOSK/4-217--------------------------------------------------------------------------------
Q8KB22_CHLTE/5-230--------------------------------------------------------------------------------
A0A029S7I4_STRPY/6-202--------------------------------------------------------------------------------
A0A022MV28_9ACTO/14-209--------------------------------------------------------------------------------
Q5JGB2_THEKO/7-237--------------------------------------------------------------------------------
B3ENH9_CHLPB/5-225--------------------------------------------------------------------------------
Q96X68_SULTO/5-233--------------------------------------------------------------------------------
Q53WH0_THET8/3-225--------------------------------------------------------------------------------
A5D0R8_PELTS/6-219--------------------------------------------------------------------------------
G2T675_RHORU/6-247--------------------------------------------------------------------------------
A0LDG2_MAGSM/7-202--------------------------------------------------------------------------------
Q3SR91_NITWN/4-221--------------------------------------------------------------------------------
Q1ZM77_PHOAS/4-242--------------------------------------------------------------------------------
Q9UZX1_PYRAB/18-248--------------------------------------------------------------------------------
A4SFQ4_PROVI/7-227--------------------------------------------------------------------------------

PF01881

W6RS12_9CLOT/95-244..............DSE--------------------GKKVDI..................DSENYEKEL..........
Q6L357_PICTO/91-231.................--------------------............................YSKKL..........
Q5JHS4_THEKO/94-238.....TV......KFVN--------------------GRMKVW.........DL...YP..DDEMFFDKL..........
D5WUC6_KYRT2/99-252.....ST.....LFKPD--------------------GRKYTV.........YF...HP..RESSFSEVV..........
R5LEA9_9SPIR/108-254.....NHKEKIINKKRK--------------------GEDIYL.........DF.......NDSDFNEQI..........
Q8R6W9_THETN/98-246.....ST.....LEKEG--------------------GDRYVY.........YY...TP..FEERFSQLV..........
I0GHZ9_CALEA/103-252.....ST......FNNN--------------------GKRTTH.........YY...RP..TESEFKRLI..........
I3VSC9_THESW/97-245.....ST......IEDK--------------------GVRYTY.........YY...SP..WHDNFSELL..........
K0NH01_DESTT/117-279.....SI.....MIKEK--------------------GKRVQH.........FLNYMVPA.ERDHFVENL..........
C8W340_DESAS/104-254.....DH.....DNKEM--------------------KKDWYY.........TY.......EDSEFEIIW..........
B3QWN9_CHLT3/102-265.....IS.....ENVEN--------------------GVRRKH.........YL...RA..HDERFPILI..........
Q5JGA0_THEKO/96-240.....TK......RIQF--------------------GKPRSY.........DL...SP..REPEFYELV..........
U6EA28_9EURY/92-240.....IK......REID--------------------GKLKIW.........DL...EP..GDERFYEGI..........
D9RZH3_THEOJ/95-246.....KT......LVEG--------------------GKKRTL.........YL...TP..LQEEFGELL..........
A1BI29_CHLPD/104-261.....TK........HA--------------------GDLYAQ.........YL...FP..GDDDFERVL..........
L0AM89_NATGS/80-250.............IPPW--------------------RCEEYDI..DHPGGDTAVFWQPEHTTEPLVEQL..........
A9BGZ0_PETMO/96-247.....ST......IVQN--------------------SSKKTI.........YF...SP..SEDQFSKLI..........
D1CID5_THET1/96-249.....ST.....LTTIR--------------------GSRKTY.........YY...SP..YEDEWSQGI..........
F6DTP0_DESRL/96-242.....ST.....MRRLD--------------------GRKYTC.........YF...QP..GDPDYSGLI..........
R7ML22_9FIRM/93-237.............CHEN--------------------GKDMYL.........SY.......KDENFQKYF..........
S0AQH2_FERAC/95-242.............ITQN--------------------NHRKT..........FF...SP..WSPEFENAI..........
A6LNL8_THEM4/96-241.....ST.....YIDET--------------------GKKKTL.........FY...HP..DDFKFKEIV..........
F2NN51_MARHT/98-239.............RKEN--------------------GQRR...........YY...TP..FEPEFAALV..........
C5D4N1_GEOSW/99-245.....ST.....YETVD--------------------GSKKTQ.........FF...SP..YDEVFSHLV..........
F8E5C0_FLESM/100-243.............DLHN--------------------GKGKGFIDS...............NHKNFSGNL..........
B8DZI0_DICTD/99-246.....ST.....LKKAD--------------------GSKIVH.........FY...KP..IDKEFSKLI..........
Q3AA62_CARHZ/99-248.............IKSQ--------------------EKATPT.........YL...SYVEDKALYKEKL..........
CAS6_PYRFU/97-237.....VV..........--------------------RKGKSY.........DV...PP..MEKEFYSII..........
O30164_ARCFU/96-240.....TS......VGEN--------------------GRRRIF.........DL...YP..KDSKFYEVI..........
F4LS54_TEPAE/98-244.....ST.....LMRPD--------------------GRKYTC.........YF...EP..GEKDFDEIM..........
R6G9C8_9FIRM/96-238.....KH......DPEN--------------------NTDIYY.........TC.......EDPEFSDTL..........
B4SEV7_PELPB/104-261.....TK........GE--------------------ADHYPQ.........YL...YP..GDPEFERVL..........
Q8TJV5_METAC/91-240.....TL......RKQN--------------------DKLVEF.........DL...YP..KDSKFHENL..........
Q184H4_PEPD6/93-241..............SKE--------------------GKFLEI..................TDDRYIEEL..........
D3T9Q1_ACIB4/83-232KDNKKSK..........--------------------...............YFSFRDGG.SMRFFMDRL..........
R6MWP8_9FIRM/94-238...........LHKAEN--------------------NSDRYI.........SV.......ANPDFTEIV..........
B4S5I3_PROA2/104-260.....AK........RD--------------------GDKYPR.........FL...LQ..DDEEFERVL..........
Q2NH84_METST/83-232ENNYENR..........--------------------...............YYSFNQKL.DFNFFFNRL..........
Q11SY3_CYTH3/88-249.....TP.....QDNPV--------------------DAKRFI..............NP..SFDVFSDAL..........
F7PNQ2_9EURY/83-252.............IPPW--------------------RFEEYGIETEH...EEAEFWRPEHTMEPFRNQI..........
Q8R6W6_THETN/100-249.....TT......LRNG--------------------EKKYTY.........YY...SP..WDEKFSPLL..........
A6LJX4_THEM4/95-242.....QT......YKEN--------------------GRNKTK.........YF...AP..FEREFSKLI..........
A6TQ80_ALKMQ/113-256.....EH......QGDN--------------------KKTWYH.........SL.......NTEEGQAVF..........
F0SWC2_SYNGF/93-241.....DH......DQKE--------------------GRDWYL.........TF.......EDKLFEAVW..........
R5F1G6_9BACE/103-255.............V.AR--------------------PNRSME.........YV...GP..DYPGYADCF..........
D7DSW4_METV3/93-244.....TKKERNGIDNTE--------------------G.LKIY.........DI...LPQENSEKFHENL..........
A3DHS6_CLOTH/100-239.....ST.........L--------------------DDKRTV.........YF...SP..YNHDFKRII..........
A3I0J5_9BACT/87-249.....TP.....AFNEE--------------------AGKRFI..............SP..DSDEFSDLL..........
Q8REC5_FUSNN/93-241.....EH......NKEE--------------------NKDIYY.........SV.......GNERFEEVL..........
H1XXZ4_9BACT/97-255.....KK......EGNN--------------------GQTRKK.........YI...LP..DQDDFYQAL..........
Q24TS7_DESHY/112-258.....ST.....LLRPD--------------------GRKYTV.........YF...QP..GETDYSRLF..........
C5CE93_KOSOT/105-255.............KRVE--------------------GYNTPF.........YI...RAYQSPDEFDEYL..........
F6BD56_METIK/93-234.....TL......VDTE--------------------EGKKTY.........DL...LP..NNSKFYENL..........
I7CU20_NATSJ/82-250.............IPPW--------------------RFEEYDIETDH...DEAEFWRPEHTMEPFRNQI..........
C7N977_LEPBD/102-257.....DH......NQET--------------------KKDAYYIG................TDDKFTEII..........
I4AF01_FLELS/86-246.....SP......RFHR--------------------DTKEFI..............VP..SMDKFSDLL..........
D4LL18_9FIRM/20-161.....KH......DSIN--------------------NSDKYY.........TC.......KDLEFGEMV..........
I4BY45_ANAMD/101-249.....ST.....LKKYD--------------------RSNFTY.........YY...SP..KEREFSEQI..........
M1MKV7_9CLOT/95-244..............SKD--------------------NRAVAIE.................DLEQFNAEL..........
C5CFB4_KOSOT/93-238.....ST.....LVTPE--------------------GKKKSY.........YY...NP..FEKDFGIQI..........
D1AI68_SEBTE/102-241.....DH......HPES--------------------GKDWYY.........SC.......NDMNFEKFL..........
D3PEQ4_DEFDS/104-252.....RT........LE--------------------NKKYH..........YY...NP..NDIDFNVLV..........
Q2NFS1_METST/94-243.....TK......EEIE--------------------GKLKIR.........DL...AP...SPHFFRNL..........
H3ZLX7_THELN/94-238.....TA......KFED--------------------NKVKIW.........DL...YP..NNEGFQDKL..........
E4TSF2_MARTH/87-240.....TP.....EFSSD--------------------SGKKFI..............HP..SSIEFADFL..........
A5D0Y7_PELTS/97-243.....ST.....LLRPE--------------------GGKYTC.........YY...QP..GEGEFDKLI..........
F8C1X9_THEGP/88-239.........NPQVQKKD--------------------FKSWYI..............TPYDDLDKFNEIL..........
L0EHC1_THECK/97-248.....ST.....LTHPN--------------------GVKYTY.........YY...QP..YHEQFSVMV..........
C9RCX9_AMMDK/97-244.....ST......FNDN--------------------GKPFTY.........YY...SP..FEPRFPELI..........
H3ZK27_THELN/95-239.....TL......KPEL--------------------GRLKHY.........DL...SP..MEGEFYNNL..........
A5D0Y8_PELTS/98-246.....ST.....AGAEN--------------------GRSYTY.........YY...SP..FEPRFAELI..........
F4KYC0_HALH1/106-260.....TI.....VDTPE--------------------GKLSRE.........YL...RP..FDEAYSPQI..........
I2F7N5_9THEM/94-240.....ST.....LMTAD--------------------GRKKTY.........FY...NP..AEKDFTIQI..........
E8T539_THEA1/123-268..............DKR--------------------GKPVLW..................NSPDFQKAL..........
F7YVR8_9THEM/97-247.....IP......VEFK--------------------GKLSHK.........YL...VP..SDPEYQNAF..........
R5NPA5_9PORP/99-253.............EQFP--------------------DTSRTV.........HL...TP..GDPRFAELL..........
Q1AZD0_RUBXD/95-247.....TT.....LATPE--------------------GRKKTY.........YY...SP..QEEEWGVAI..........
F6D794_METSW/92-236.....TK..........--------------------REDKIW.........DL...NP..GDRQFYTAL..........
R5Q6M6_9FIRM/94-236.....ST..........--------------------KDNYST.........YY...RP..SDKESLNFI..........
G2TLN2_BACCO/98-246.....ST.....YQNQN--------------------GKKITQ.........YF...DP..KDPAFTYLV..........
D9RZG4_THEOJ/95-241.....ST.....MLKFD--------------------GSKYTC.........YF...SP..KDSEFVSLC..........
D3E282_METRM/92-241.....TK......KEVD--------------------GELKIW.........DL...AP...GDHFFKNL..........
F9ZC95_ODOSD/99-253.............EQLP--------------------ETRKAI.........HL...SP..GNPKFAELL..........
W0DCW4_9AQUI/104-247.....RT........PE--------------------GSRRHI.........YL...SP..FEEQFYAML..........
R6N4L4_9BACE/105-257..............LRH--------------------EGRKVD.........YL...SP..TDSAASYIL..........
D4M9Y0_9BACT/110-256.....SQ......TERE--------------------GRPYTV.........YL...AP..EDPAFAVSV..........
B7GIV2_ANOFW/71-220..............DEN--------------------KSPIAP..................DDKNYEKHI..........
A8F3P6_THELT/94-244.....IP......VENQ--------------------GKLSHK.........YL...TP..EDDFFQNAI..........
R9SJL2_9EURY/92-241.....TK......KEVN--------------------GELKIW.........DL...AP...GDKFFENL..........
L7VPR9_CLOSH/98-240.....ST.....LLRPD--------------------QRKYTC.........FF...QP..GEEDFNRIV..........
CAS6L_PYRFU/93-237.....TV......KFEG--------------------DKLKHW.........DL...YP..HDELFLDRL..........
G7V6P2_THELD/96-246.....ST.....MYKTD--------------------GRPYTV.........YH...AP..SEQDFQRQI..........
Q9X2D4_THEMA/95-245.....VP......EENN--------------------GKLYHR.........YL...HP..GEEEFYEVF..........
CAS6B_METJA/83-239KDKDRGE..........--------------------...............YIKFYDDDFDLMFFVQRL..........
A9BIX0_PETMO/97-241.....ST.....IVLPN--------------------GNRYTH.........YF...SP..YSSDFKKLI..........
Q5V7W8_HALMA/83-252.............IPPW--------------------RFDDYGMDVNH...DQAEFWRPEHTLEPFRTQL..........
K0AY46_CLOA9/100-241.....EH......RGDN--------------------KKTWYH.........SL.......RAEEGQVIL..........
I3VSW8_THESW/106-256.....VK......DHST--------------------GKAK...........YL...RYLDDREKFKEAL..........
E6SGU1_THEM7/160-301.....ST.....VNRPD--------------------GSRFTY.........FF...EP..RSGEFERLV..........
G7V6F2_THELD/105-253.....VP.........D--------------------AKLGHK.........YL...DP..KDNQFWEVL..........
G8TRE8_NIAKG/100-264..............RKN--------------------NKGNYD.........FL...SP..ADPDFNEWF..........
Q3AA81_CARHZ/97-247.....TL........KE--------------------GYTKPY.........YI...RYTEEPELFSEKI..........
A7HMV7_FERNB/99-241.....ST.....IEKDD--------------------GKKFTK.........FH...SP..NEDDFIRIL..........
A5UJJ7_METS3/91-240.....TK......KEIN--------------------GELKIW.........DL...AP...SDKFFKSL..........
C5D2U6_GEOSW/88-237..............DEK--------------------GNPIAP..................DDASYEGHV..........
I3RB26_HALMT/83-252.............LTPE--------------------HREQYGIEAEH...DAPTYWRPEHTIKPFKDAI..........
A4J1X6_DESRM/97-248.....ST.....LETRE--------------------GSKKTY.........YY...SP..TEREFTRLI..........
A4XIJ2_CALS8/99-248.....KT......IRNE--------------------NSEYKH.........FF...TP..FEDEFYNLI..........
A4XM43_CALS8/100-259.KKEGDDKIPILPY...--------------------.........................DEGFEEVLNDVIDFEIRN
H1YB50_9SPHI/101-259..............RTN--------------------AKGNDD.........YL...SP..EDEDFIPLL..........
F8A9G0_THEID/98-270.....ST.....LYTPE--------------------GKKKTY.........FY...TP..FESEFSAKI..........
M1E4R5_9FIRM/102-250.....ST.....FITAN--------------------GARKTY.........FY...TP..FENEFSELI..........
F2KRM8_ARCVS/96-239.....TV.......EEN--------------------GRKKTV.........DL...YP..NNPKFYENL..........
E3CYI3_9BACT/99-270.....ST.....LKKQD--------------------GQPYAV.........YY...EP..QETTFAEQI..........
I6ZYF6_MELRP/91-233............NIGDS--------------------NKFLLP..................GEEGFLEGL..........
H2J3Z6_MARPK/100-251.....KT......EIIN--------------------NKKKTI.........YY...SP..FSAEFEELI..........
B5YIV6_THEYD/110-261..............TKD--------------------GKPILP.........SD.......NVEDFNIEF..........
O27163_METTH/3-152.....TV......REED--------------------GVLKQW.........DV...NP..NDLKFYENL..........
O66704_AQUAE/88-235RIGSKPK......DSPE--------------------ERYITP..................DEESFEESL..........
H1XYR5_9BACT/101-261.....KP......VEIN--------------------GKSGKE.........FL...HP..SHPEYGQRL..........
R6AKE9_9CLOT/101-242.....ET.........E--------------------RSGYRR.........FI...AP..DESLFYTAV..........
Q182E2_PEPD6/98-243..............NKE--------------------GKYLDV..................EDSNYIECL..........
F4A3C4_MAHA5/97-245.....ST......AKNM--------------------ERTITY.........YY...SP..MEDNFSRII..........
Q6L312_PICTO/84-234LDNRKNR..........--------------------...............YFSIRNGD.SIAFFIKRL..........
F7YTK7_9THEM/97-245.....ST.....FEKPD--------------------QNKQTH.........YY...SP..FEERFNELV..........
Q12WX9_METBU/91-239.....TM......RKKN--------------------DKLVEI.........DL...YP..KDSKFYENI..........
D5XAY0_THEPJ/96-242.....ST.....LLKPD--------------------GRKYTC.........YF...QP..GEPDYDTLL..........
I0GI07_CALEA/110-270..............TAN--------------------DKPIIPFDESGDLLKEE.......SLSVFNEEF..........
G8UK03_TANFA/105-257............MKCEN--------------------GGSD...........YL...SP..VSPHASSAI..........
F8I2S5_SULAT/94-242.....ST.....FEKPD--------------------GGVYTQ.........YY...HP..REVEFGRLI..........
E4TH18_CALNY/109-261..............NKN--------------------EKPVLPI........QE.......SLQNFNDEL..........
I2F5U2_9THEM/105-254.............TRND--------------------EHKTPF.........YL...RAYQDPAQFGEFL..........
O66560_AQUAE/89-243.NRDKKPVLPSKLGNRN--------------------DDFILY..................DDGAFTQEL..........
B5YKZ6_THEYD/94-242.....ST.....LNTPD--------------------GRKKTY.........YY...NP..KEKEFSELI..........
G7M8P5_9CLOT/95-244..............TND--------------------NKTVTID.................EINKFNAEL..........
D3PBR5_DEFDS/101-244.....KT.......FEN--------------------GKKYYR.........YY...SP..SEPEFQYLI..........
N0BC99_9EURY/89-232.....TV.......VDN--------------------GRRRIV.........DL...YP..DSLKFYENL..........
E8T547_THEA1/126-270..............ERG--------------------GNPILP..................DNPRFNEAV..........
D3DIQ3_HYDTT/95-238.....RT........PE--------------------GETKKQ.........FF...SP..WQEEFYELI..........
B1I5K4_DESAP/98-246.....ST.....LSGVD--------------------GRNYTY.........YY...SP..FEPRFTELV..........
R5UPH1_9PORP/99-253.............EQFS--------------------DSRRTV.........HL...QP..EDPKFAALL..........
C8VZL4_DESAS/97-243.....ST.....LLRSD--------------------GRKYTC.........YF...QP..GESDFERLL..........
D7CN19_SYNLT/100-243.....TG.....I.VRN--------------------RKLHKR.........FL...LP..SEPDFWRVV..........
W0JFB3_DESAE/95-241.....ST......FQIY--------------------KQKKTY.........YY...NP..YEKEFSLLI..........
CAS6A_METJA/97-238.....TM......IETE--------------------DGLKTY.........DL...LP..NNSKFYENL..........

PF10040

L0K6N4_HALHC/192-313.................--------------------YKGEFV---------DK.........IEFHTLM----------
F3ZXK6_MAHA5/109-225.........YN..T...--------------------GYVPE.---------...........FYGPVFI----------
G2MK90_9ARCH/153-282..........EAGE...--------------------ITTMF.---------...........PHRGAVF----------
K9Y918_HALP7/157-268.........QG..K...--------------------QDTAL.---------...........PTAELVF----------
H1XX22_9BACT/179-297.................--------------------KDGRYL---------KE.........MSVEDVL----------
B1L433_KORCO/181-296.................--------------------RDGNLV---------RD.........LDFRNLF----------
A0ZJZ0_NODSP/168-288.........RK..G...--------------------HHFPL.---------...........PVPVNLF----------
Q2JNR9_SYNJB/173-291.........HR..G...--------------------HHLPL.---------...........PIPRNLF----------
B7KDF7_CYAP7/219-329.........QQ..K...--------------------QIQLF.---------...........PSLKLVF----------
A4J507_DESRM/141-258.........VN..G...--------------------IQHIF.---------...........PDSHTVF----------
F4EVS7_SELS3/145-262.........RD..D...--------------------KDYPT.---------...........PDPVFIF----------
K9QB89_9NOSO/174-286.........QG..H...--------------------FDTTL.---------...........PTRECVF----------
A8ZV96_DESOH/179-300.................--------------------MQNRLT---------AD.........LPFHALV----------
C9R989_AMMDK/199-320.................--------------------FEGKPA---------AV.........PEFHVLV----------
R5PNI3_9BURK/195-316.................--------------------KNGRPL---------RS.......EEITARGLL----------
I0I1W5_CALAS/150-266.........SK..E...--------------------MTVPV.---------...........PLPGLVF----------
K9WP49_9CYAN/161-281.........RK..G...--------------------HHLPL.---------...........PWPVNVF----------
E1QU68_VULDI/131-260...........FRS...--------------------HYVTW.---------...........PSPARFL----------
H9ZZ94_FERFK/153-293P..WLSKRASALKD...--------------------SYSLL.---------...........PTPGLLA----------
E8T6Q0_THEA1/128-244.........RG..N...--------------------YDYPL.---------...........PDPTLIV----------
I0I2Y7_CALAS/165-288.................--------------------QTGHIA---------KE.........AAFFPLI----------
G4RMW7_THETK/109-233.....VKTKERRRA...--------------------KLAFL.---------...........PEPLRVF----------
B7KB41_CYAP7/154-264.........QQ..K...--------------------HIQLL.---------...........LTPDLVF----------
E6W3H3_DESIS/152-268.................--------------------TGSRLT---------TD.........LGLQKIL----------
A9WEP3_CHLAA/149-264.........QR..G...--------------------LNVPL.---------...........PLPDLVF----------
A3CNA0_STRSV/121-237.........RQ..G...--------------------QFVLF.---------...........PDTRLIF----------
K9VUC0_9CYAN/184-304.........RK..K...--------------------HHFPL.---------...........PTPVNVF----------
G0VQ62_MEGEL/131-244.........QE..G...--------------------RYVIL.---------...........PDIRLIY----------
Q8ZZK8_PYRAE/121-245....VKPLYKRKRA...--------------------IFDFL.---------...........PRPLSVF----------
B9M7F5_GEODF/178-295.................--------------------RQGHAM---------RE.........MSFSTFI----------
K9Z6D5_CYAAP/156-268.........QG..K...--------------------YDVSL.---------...........PTAELVF----------
B7JVM6_CYAP8/153-263.........QI..Q...--------------------GVQPF.---------...........PLPELVF----------
I7GZK7_9HELI/102-216.................--------------------QNNVFV---------KS.......QNLTLHDIG----------
B3EIY9_CHLPB/190-322.................--------------------TSLGRE---------RKELLTRMDDHASVRVLL----------
B5YHA0_THEYD/183-305.................--------------------YQRKFV---------TE.........LDFHILV----------
Q2RV92_RHORT/175-295.................--------------------RKGRLI---------LC.........PTLGDIV----------
K4LGU6_THEPS/201-322.................--------------------HQGAAI---------HT.........PEFHTII----------
B2ITK0_NOSP7/163-275.........QG..Q...--------------------YDTTL.---------...........PTRESVF----------
D7BB61_MEISD/120-235.........RK..G...--------------------NSYPL.---------...........PEPKLVF----------
D1BQ19_VEIPT/134-250.........VD..Q...--------------------QYTIF.---------...........PEAFRIY----------
K9WFD7_9CYAN/163-275.........QS..N...--------------------YDCAL.---------...........PTRDLVF----------
B8D4R7_DESK1/164-296.................--------------------FKSFV.---------...........PTPMNVF----------
B0VHA6_CLOAI/114-232.................--------------------HQGKLM---------SE.........FMWEPFA----------
K9PEZ2_9CYAN/154-264.........QN..K...--------------------NVQTF.---------...........PLPELVF----------
U5QKR7_9CYAN/153-269.........QN..D...--------------------YDTAL.---------...........PTAELVF----------
Q39T05_GEOMG/185-302.................--------------------QDGRPS---------RT.........FSFPLLM----------
A9B3B3_HERA2/187-307.................--------------------QQGQLA---------RQ.........FDLPLIV----------
D9PZC3_ACIS3/155-292P..WASRLSRRVPN...--------------------AYRLL.---------...........PEPAYIA----------
E0STW9_IGNAA/133-249...........YRG...--------------------LEILY.---------...........PSPTRFF----------
E1QHL8_DESB2/181-300.................--------------------SGRESL---------...........LSPQSML----------
F5YHB2_TREPZ/187-308.................--------------------VQGHYD---------DS.........FSAADFA----------
F6B8N9_DESCC/193-314.................--------------------FADEFV---------ER.........IEFHILI----------
F8A9J4_THEID/178-299.................--------------------FEGKLV---------KP.......EQFEFHVFI----------
C7RP07_ACCPU/214-336.................--------------------QNGHAL---------PP.......EKLQARTLL----------
I5B4K9_9DELT/185-305.................--------------------TDTGQA---------PN.........LPFDLLM----------
E6N6Z0_9ARCH/137-279PRRLRKPVRPVY.....--------------------RYMIL.---------...........PDPYLFF----------
V4J6E9_9GAMM/199-322.................--------------------RHGHLL---------GP.......EDLDAETLL----------
A5G6J6_GEOUR/186-302.................--------------------QEGRPL---------RE.........LSFSPFI----------
Q97YE5_SULSO/103-227...PPRPSIKRKGN...--------------------RYVLF.---------...........PYVPLLF----------
Q2LQW0_SYNAS/206-327.................--------------------YENKFE---------AT.........LPFHVLI----------
I3TFC5_THEC1/166-297.................--------------------HKSFL.---------...........PSPLNVF----------
D7CS37_TRURR/124-238.........RH..G...--------------------ANYPL.---------...........PEPRLVL----------
F2NN98_MARHT/122-236.........RQ..G...--------------------ANYPL.---------...........PEPRLVL----------
I3WBS4_THESW/113-229.........TT..N...--------------------SHIPY.---------...........FEPLMFW----------
Q74DY6_GEOSL/182-300.................--------------------QDGAPL---------RS.........FSFSVFA----------
K9U2M1_9CYAN/157-268.........QG..E...--------------------YDTIL.---------...........PVKECVF----------
A0LHY9_SYNFM/189-311.................--------------------YEGELC---------TD........PPRFHVLA----------
F8AWH3_FRADG/56-175.........RS..G...--------------------RDLPL.---------...........PEPVLIV----------
R5D9G4_9FIRM/121-237.........QN..G...--------------------RYVFY.---------...........PDLRLIY----------
K9Z2G9_CYAAP/132-249.........QG..K...--------------------INLPL.---------...........PIPSLMF----------
Q0AW55_SYNWW/127-243.........QD..G...--------------------SYVLF.---------...........PTPELIV----------
E8N1C5_ANATU/199-324.................--------------------WNERLV---------KT.........PDFAILF----------
K9QGU5_9NOSO/132-249.........QG..G...--------------------ANLPL.---------...........PLPTLMF----------
A5UUF5_ROSS1/193-311.................--------------------DKGGLV---------KR.........PALRPLI----------
A0B9F8_METTP/179-309.........YRNSG...--------------------VCEMF.---------...........PHREAVF----------
Q3IQ75_NATPD/155-284..........EADG...--------------------VTTMF.---------...........PTRGAVF----------
B8HXC7_CYAP4/154-266.........SNAGQ...--------------------GIQPF.---------...........PLPESVF----------
Q2FM73_METHJ/142-274.........YRNSR...--------------------VTEMF.---------...........PNRIAVF----------
B1XQV2_SYNP2/146-256.........VDR.K...--------------------IIQVF.---------...........PLGEHVF----------
H2J4R7_MARPK/152-265.........TG..D...--------------------KHLRY.---------...........PDPEKIF----------
A8ABE5_IGNH4/136-253.................--------------------RTRFL.---------...........PSPSHLF----------
Q0AU02_SYNWW/189-308.................--------------------KEGHLQ---------SK.........LDFSTIV----------
K9ZE49_ANACC/159-269.........QG..G...--------------------FDNLL.---------...........PTRESVF----------
A1WUQ5_HALHL/173-290.................--------------------RNGRPL---------TA.......EAFSPEPLI----------
H1XUD1_9BACT/171-291.................--------------------VKGKIT---------NT.........IDFITLL----------
K0I7U3_NITGG/134-256.........KIGSK...--------------------FDQVF.---------...........PEPLSVF----------
A8M9A8_CALMQ/140-275...........FRA...--------------------SNVLY.---------...........PSPRMLI----------
D7BJF9_MEISD/140-264.....TSK.PGRRT...--------------------RHTPL.---------...........PDPFLIA----------
K9Z986_CYAAP/157-276.........RN..N...--------------------HHYPL.---------...........PHPPNLF----------
C8W2P2_DESAS/150-266.........AR..G...--------------------SNYPL.---------...........PDPQKVF----------
Q5M4I8_STRT2/122-236.........SQ..G...--------------------SYVIF.---------...........PSMRLIF----------
A9WJU8_CHLAA/202-322.................--------------------TRGSLM---------ER.........FEMPALV----------
L0DVU2_THIND/189-312.................--------------------REGRPV---------RP.......DTFRFSDLF----------
K9UYS9_9CYAN/166-276.........QG..S...--------------------YDSCL.---------...........PTRESVF----------
A9G7I6_SORC5/239-364.................--------------------HKGRLH---------TA.......GDLDFRALF----------
K9VAI7_9CYAN/164-284.........SK..G...--------------------HHFPL.---------...........PVPENIF----------
B4S549_PROA2/190-322.................--------------------TAFGRD---------RKALVTGMHEPADFRVLL----------
A3DLD1_STAMF/165-290.................--------------------YKRFL.---------...........PTPGNVF----------
D4ZUE3_ARTPN/132-249.........QK..S...--------------------IKLPL.---------...........PVPGLMF----------
Q8ZZM1_PYRAE/124-248....VKPLYKRRRA...--------------------LFDFT.---------...........PRPLNLF----------
Q53VU8_THET8/136-259.....TSK.PGGRT...--------------------RYTPL.---------...........PDPRLIA----------
R5SKY0_9FIRM/124-242.........SV..G...--------------------QYLPL.---------...........PTTRLIV----------
I6XRG2_PROPF/138-250.........RG..D...--------------------VFMPW.---------...........PDPYLLL----------
A4YFW1_METS5/128-261P..SLNPRFRGRGS...--------------------NFT.I.---------...........PSPGLII----------
K9VP83_9CYAN/158-269.........QG..K...--------------------FDSVI.---------...........PTRDCVF----------
CAS6A_SULSO/138-276P..SLSERYKRVNA...--------------------GYSTL.---------...........PSVGLIV----------
Q1J2Q0_DEIGD/229-349.................--------------------AGGGLA---------RE.........LHFPVLL----------
U5N9J4_9BURK/187-313.................--------------------HQGRPL---------GV.......GELTARALI----------
D5BXY1_NITHN/195-319.................--------------------REGRNV---------RP.......QDFFFADLF----------
K9VUL1_9CYAN/157-268.........QT..Q...--------------------FDTAL.---------...........PTKDLVF----------
B8HZK9_CYAP4/163-283.........RK..G...--------------------YHLPL.---------...........PWPRNVF----------
F2NCY6_DESAR/192-310.................--------------------FQNSLK---------AE.........LPFHVLI----------
G4RK11_THETK/123-247....VPPIYRRRRA...--------------------LFDFL.---------...........PRPLSLF----------
R6P553_9FIRM/125-241.........SN..E...--------------------KYVFM.---------...........PDIALIM----------
A1RZS7_THEPD/144-262..........PLSGDKE--------------------YKVLY.---------...........PDPVHML----------
E3IY75_FRASU/114-233.........LD..G...--------------------RDLPL.---------...........PDPALMI----------
G0EG84_PYRF1/160-282.................--------------------WKRLL.---------...........PTPSYLL----------
B9LX88_HALLT/152-281..........EAGS...--------------------VTTMF.---------...........PTRTAVF----------
R5EQX2_9GAMM/149-273.................--------------------......---------...........PGVRVVN----------
R6GYJ4_9FIRM/123-239.........QA..G...--------------------RYAIF.---------...........PQERLLL----------
K9Q0F8_9CYAN/153-272.........VR..G...--------------------AYLPL.---------...........PMPRNVF----------
F2NCL0_DESAR/192-312.................--------------------VRGDLA---------TD.........LSFGLWW----------
F4B5Q5_ACIHW/132-254...PPRPKFKRKEN...--------------------RFILF.---------...........PYVPSFF----------
K9SF16_9CYAN/154-274.........SK..G...--------------------HHLPL.---------...........PIPRNVF----------
F4HFU9_GALAU/181-302.................--------------------RDGHAL---------SP.......TEITLDRII----------
K9VE89_9CYAN/176-287.........QG..V...--------------------YDSAM.---------...........PTRESIF----------
K9TTK8_9CYAN/158-269.........QG..Q...--------------------YDSCL.---------...........PTRECLF----------
A8AA66_IGNH4/120-231...........FHG...--------------------AWVPL.---------...........PSAPRAV----------
F4BVN4_METCG/195-321.................--------------------RFTAA.---------...........PSFRGLI----------
A9AX64_HERA2/145-263.....LGRDRQGKQ...--------------------RVGLI.---------...........PDGQSVF----------
G4RJS6_THETK/34-142...........FHG...--------------------RDVLY.---------...........PSPQRLA----------
G4SY21_META2/183-306.................--------------------QEGKNL---------TP.......DYFNFGKFF----------
F4B6S4_ACIHW/137-278P..SLASKYKQVNS...--------------------GFSLL.---------...........PSIGLII----------
Q8TVD3_METKA/146-269.................--------------------HDGKPR---------V..........PKFHMIV----------
D4ZX77_ARTPN/162-287.........HK..G...--------------------HHLPL.---------...........PIPVNLF----------
Q4J7P9_SULAC/157-282.................--------------------YRRYL.---------...........PFPAFIF----------
G7ZCD4_AZOL4/213-331.................--------------------GSTDLR---------HG...........LAGFV----------
K9Y1X1_STAC7/155-269.........KG..K...--------------------QNDSL.---------...........PTPENIF----------
A1RZX7_THEPD/116-251RR...............--------------------RYRLV.---------...........PDLPLAL----------
Q4J7R1_SULAC/134-278PVFKKKKVRS.......--------------------MNRLI.---------...........PQPSLIF----------
R6PQ35_9CLOT/170-290.................--------------------RGGKLL---------MH.........ISFETLI----------
F8AW66_FRADG/144-268.........TGRGDGAR--------------------RQRIL.---------...........PEPERVF----------
K9XLZ1_9CHRO/153-265.........QG..E...--------------------FDAAL.---------...........PTRECVF----------
J7LAT0_NOCAA/122-261.................--------------------......---------...........PTPRRLF----------
Q7MC52_VIBVY/165-292.................--------------------HHGQLV---------RY.......EVPNVGFWI----------
E0SSI4_IGNAA/163-304PLDSFKKRIESMPN...--------------------LYILY.---------...........PSTGHIC----------
Q5HK95_STAEQ/125-241.........YQ..N...--------------------SYMIF.---------...........PDVKRFF----------
E0UKL6_CYAP2/154-264.........QQ..K...--------------------SIQLF.---------...........PLSDLVF----------
K9TQ72_9CYAN/193-313.........RK..K...--------------------HHFPL.---------...........PVPANVF----------
Q01QC2_SOLUE/166-287.................--------------------SDGALA---------GR.........PEFPILF----------
B1L7L1_KORCO/136-264.........RTTSQ...--------------------YCYLY.---------...........PNPRLIV----------
D3PLA6_MEIRD/120-235.........RK..G...--------------------HSYPL.---------...........PEPRLVF----------
D5X8I6_THEPJ/130-246.........SA..G...--------------------RYAIL.---------...........PDLALIY----------
R5DX83_9FIRM/123-238.........SN..G...--------------------KYMIY.---------...........PDLGMIY----------
V4IUZ5_9GAMM/183-318.................--------------------QRGRYI---------RA.......TGLSARALL----------
Q4J7D4_SULAC/139-263...PIRPNLKRKDN...--------------------RFVLF.---------...........PYVPILL----------
A9AZH6_HERA2/149-264.........QR..G...--------------------LNQPM.---------...........PTPDLVF----------
Q8ZZU6_PYRAE/127-237...........FHG...--------------------RDVLY.---------...........PSPQRMA----------
Q65S11_MANSM/165-285.................--------------------ENGKPL---------RE.......NQINADRFF----------
Q6ZEI4_SYNY3/146-256.........IDR.N...--------------------TIQPF.---------...........PLGDSVF----------
E8MZD5_ANATU/156-270.........VD..G...--------------------RLIPL.---------...........PLPDLVF----------
B1I4N7_DESAP/204-325.................--------------------HHDRFV---------TA.........LPFHVLL----------
D4KCT1_9FIRM/124-240.........QA..G...--------------------RYAIY.---------...........PQEFLLL----------
C8XDH3_NAKMY/112-225.........RG..G...--------------------RTSPW.---------...........PAPESVA----------
Q1AT68_RUBXD/185-307.................--------------------FRGEVA---------AG........APPFAALA----------
D4L090_9FIRM/123-239.........QN..G...--------------------RYLFY.---------...........PDLRCVF----------
CAS6_MYCTU/184-299.........QS..G...--------------------EYVFW.---------...........PDPRLVF----------
K9REI7_9CYAN/159-279.........RK..K...--------------------HHFPL.---------...........PLPFNIF----------
K8GNP3_9CYAN/167-279.........IS..D...--------------------YDCAL.---------...........PTRELVF----------
B5EGG7_GEOBB/173-285.................--------------------NEGRLL---------KT.........FTFAQFA----------
F8E951_FLESM/180-296.................--------------------INGKYT---------DK.........ITYRDFL----------
A5UQ98_ROSS1/201-322.................--------------------ERGDIL---------RT.........FDLPALI----------
F9VPJ5_SULTO/122-263P..SLKEKYKNVNP...--------------------GYSLI.---------...........PSVGLVV----------
G0GAL5_SPITZ/216-341.................--------------------HENHLV---------KT.........PEFLPFF----------
K9TQH4_9CYAN/147-257.........QK..Q...--------------------GIQTF.---------...........PLPELVF----------
D3RZU7_FERPA/182-298.................--------------------RENSLV---------AE.........PSFEDVV----------
R7BKP7_9FIRM/123-239.........KD..G...--------------------RYVFY.---------...........PDIRCIF----------
F8C651_THEGP/144-257.........KG..Q...--------------------IDYPL.---------...........PDPKIFF----------
D9QVV0_ACEAZ/146-259.........IE..D...--------------------RHIIF.---------...........PRADYLF----------
D1BQ29_VEIPT/148-260.........GT..Y...--------------------GDITF.---------...........PTSSLIF----------
G2SNW3_LACRR/125-241.........TN..G...--------------------KYVFL.---------...........PDVRLVF----------
D3RWD2_ALLVD/219-343.................--------------------REGRRI---------GA.......RELTALDIA----------
E4TFF0_CALNY/178-296.................--------------------INNRYT---------HR.........ITYLDML----------
B8GIG7_METPE/143-274.........YRNST...--------------------VTEMY.---------...........PNRIAVF----------
F2NWE0_TRES6/180-299.................--------------------FGGRYG---------TD.........FSAQDFM----------
Q9YCN0_AERPE/130-237.........FR..S...--------------------RPILY.---------...........PSPQRLV----------
A4YFU6_METS5/153-293P..FLREKYRRKKI...--------------------GFSLI.---------...........PTPGLVV----------
A9B8P4_HERA2/194-316.................--------------------EQKILL---------KV.........PQLRPII----------
B5YJR6_THEYD/170-291.................--------------------YNRDLV---------RD.........IEFHILI----------
Q6ZED0_SYNY3/150-271.........RQ..G...--------------------NHYPL.---------...........PEPRNVL----------
A1BI47_CHLPD/189-321.................--------------------TAWQRK---------EQELLTGIGHEDDFRLLL----------
H8GGS4_METAL/183-307.................--------------------QDGKNL---------SP.......DGFNFGALF----------
K9PIY0_9CYAN/160-280.........RK..G...--------------------HHFPL.---------...........PVPANVF----------
B0TFX1_HELMI/206-328.................--------------------SDSRLQ---------HS.........VDPVLFV----------
F5XNN8_MICPN/117-229.........RG..N...--------------------RSSPL.---------...........PMAGSVL----------
E1QQW2_VULDI/142-269...KRSTMGRRRKV...--------------------RFDFC.---------...........PSIVNIL----------
Q2FR84_METHJ/137-256.................--------------------KNERME---------IL.........PELAHIL----------
B0JKW7_MICAN/158-269.........QG..K...--------------------FDSAL.---------...........PTRELVF----------
Q5SM65_THET8/120-234.........RK..G...--------------------VHYPV.---------...........PEPRLVL----------
D0MKP1_RHOM4/203-324.................--------------------AQGRLV---------RQ.........LTFRVLL----------
Q82XX5_NITEU/191-313.................--------------------NNGVPL---------KA.......QTVTERALL----------
M1E8T8_9FIRM/184-306.................--------------------FEGKTV---------YN.........PEFHILA----------
F5YD05_TREAZ/184-300.................--------------------IDGRYV---------KS.........LEAGDFA----------
R7K0L3_9CLOT/123-239.........SQ..G...--------------------KYVFY.---------...........PDIRCIF----------
K9R5X4_9CYAN/163-274.........QG..K...--------------------YDSTL.---------...........PTRESVF----------
K9ZQ95_ANACC/226-336.........QN..Q...--------------------NIQPF.---------...........PLPELVF----------
F6CKB2_DESK7/215-335.................--------------------YAEAYA---------GK.........IEFHVLI----------

PF08798

E4N250_KITSK/3-213.................--------------------.GSAAT--------------------KPLTPLL----------
Q1GAI3_LACDA/1-205............P....--------------------.GTAIS--------------------KDYEPFL----------
B1VIX9_CORU7/5-232............DT...--------------------.LPAQT--------------------ADYSRFL----------
Q32CH4_SHIDS/1-198................S--------------------TAVATV--------------------IKTKQVE----------
I3Y7Y7_THIV6/4-234....HDNAALATPDVAR--------------------ALGLNS--------------------LAVRAFP----------
B6IWM2_RHOCS/29-260................L--------------------GGIWTI--------------------TT.RPFD----------
B1VNZ6_STRGG/1-237............PASDE--------------------.PGWTT--------------------FAYADFL----------
E4N5A8_KITSK/2-247............PDAEG--------------------.EHYAV--------------------RDYSPLL----------
K4INP2_BIFAP/1-227............PTH..--------------------.AEWEV--------------------KDYEPLI----------
G2IXW9_PSEUL/3-219.................--------------------PG.LLI--------------------DT.KPFA----------
G0FR05_AMYMS/1-212LN...............--------------------.APAEI--------------------RPLQPVL----------
D3VAX8_XENNA/1-223.................--------------------SPQFQV--------------------QT.KPFA----------
I2BC80_SHIBC/1-231.................--------------------HALLAV--------------------ET.RPFR----------
Q0W583_UNCMA/1-248LL.........ENT..G--------------------TENPAC--------------------KAIDEQY----------
E3D0F9_9BACT/1-235LL.............PS--------------------FPCPAV--------------------RSLDPLW----------
D1CAI9_SPHTD/1-253LL.........NTA..G--------------------VPNPDC--------------------KPVGPIY----------
J7L987_NOCAA/16-239.................--------------------.DAFVR--------------------GPRVITV----------
B5GY64_STRC2/3-305............PDADG--------------------.EHAVI--------------------RDCAPLI----------
Q60AD3_METCA/5-237..TEHARAFASPLAAQV--------------------CSLADG--------------------IAFKPMP----------
A1ARH5_PELPD/1-222........GVGVNGWIQ--------------------QADPAI--------------------DLKERLK----------
Q0BSC8_GRABC/21-226.................--------------------.DLFQP--------------------HRIKSYA----------
C4ZJY2_THASP/8-234....HTAAQMAAPDVHA--------------------VLGLER--------------------FAARSFP----------
Q2JH26_FRASC/2-267............IHTDE--------------------.PQVLV--------------------RDYQPLL----------
X4RBI6_9ACTO/5-219............EI...--------------------.RPQET--------------------ADYDRLL----------
C7LYW5_ACIFD/1-220VVRG.............--------------------.TDYDT--------------------KPYGPLL----------
F8E3A0_CORRG/2-224............DT...--------------------.RPAQS--------------------LDYERFL----------
Q03C59_LACC3/1-212............A....--------------------.GTAQT--------------------KDYDPFV----------
K7SNJ1_PROA4/34-264............PGADG--------------------.GSPRI--------------------ADYSPVL----------
A9GV72_SORC5/1-243FLDIQEDLGLTEPS.P.--------------------IENPAI--------------------REVGSER----------
Q4JWK1_CORJK/5-216............ES...--------------------.DP.QK--------------------ASYNRLL----------
E3D9L3_GARV3/3-212............A....--------------------.GTASS--------------------KNYDKFL----------
A7MFK9_CROS8/1-212.................--------------------HPLFEI--------------------QT.RPFA----------
Q47PJ5_THEFY/2-224.................--------------------.HGVQM--------------------RNLDPFL----------
C8XAY3_NAKMY/1-211............PISDL--------------------.EPWET--------------------RSYDGLL----------
R5IV38_9CLOT/1-210..............PDD--------------------ENAYQT--------------------KDYTPLL----------
C6WMQ8_ACTMD/1-218LT...............--------------------.SPAEV--------------------RSLDPLL----------
D7CSJ6_TRURR/1-209............SRHPD--------------------YATLDA--------------------QSPKPFE----------
F3ZMY9_9ACTO/3-245............PGADG--------------------.EHYAV--------------------RDYAPLL----------
L0J770_MYCSM/1-219............QTG..--------------------.DSWRT--------------------RDYRNLL----------
Q0BRF7_GRABC/2-239...VEQARFSITPDMTE--------------------VISLER--------------------LRSKAMP----------
Q7N8H4_PHOLL/1-222.................--------------------SPLFEV--------------------ET.KAFY----------
Q6NEQ5_CORDI/6-226................D--------------------NLDSEV--------------------QHRTVSL----------
C7MTM6_SACVD/3-234............PAADG--------------------.DHVIT--------------------RDYTPLI----------
C1DSI0_AZOVD/1-204LQ...............--------------------.RPAEC--------------------KALD..L----------
Q314I5_DESAG/1-218.................--------------------TGWWSI--------------------QI.KPYA----------
D6YAN0_THEBD/1-227............PET..--------------------.GRWET--------------------YDYAPFL----------
J9VY84_LACBU/1-220............E....--------------------.NTAMT--------------------KPYDPFL----------
Q825C0_STRAW/3-217.................--------------------.GQAIT--------------------RPLDPLL----------
B0S4B5_FINM2/1-205............K....--------------------.GTAKI--------------------TNYDQFL----------
V6KHH8_STRNV/6-213.................--------------------.GRADS--------------------RDLAPMF----------
A9HLC4_GLUDA/5-226.................--------------------HGLFDV--------------------ET.RPFD----------
A6W167_MARMS/1-222.................--------------------ESTFNV--------------------KT.KTFM----------
D1A6Q6_THECD/5-212.................--------------------.GKARC--------------------KSLAPLL----------
D6ZIM7_MOBCV/5-218............DT...--------------------.RPAQS--------------------AEYDRLL----------
G2KWT8_LACSM/1-220............P....--------------------.QTAMS--------------------RDYDPFL----------
H8GLK4_METAL/1-204................S--------------------VQSPSL--------------------LAQREYD----------
B8IZA5_DESDA/2-205.............DFCT--------------------EDHWQI--------------------KAVPPC.----------
B8IMR1_METNO/3-240.................--------------------RGLFEI--------------------ET.KPFA----------
R6Q6M2_9FIRM/1-206.................--------------------GAAPES--------------------RNYDPLL----------
A5GBK0_GEOUR/3-226.............RWCP--------------------VDGFGL--------------------NEISPS.----------
F0RQX4_DEIPM/1-214...........ARHPDY--------------------FHDVQV--------------------KPFD.LT----------
D1CGD5_THET1/2-229LA...............--------------------.FPAEC--------------------KRVDDKY----------
A4XYT8_PSEMY/1-202LQ...............--------------------.REIES--------------------KPLE..F----------
B8HWH7_CYAP4/1-204LL...............--------------------.QPPQL--------------------TSVNFVT----------
Q67RN9_SYMTH/1-223LT..........PA.DG--------------------LPNPAV--------------------KRVDEAY----------
Q1J366_DEIGD/4-210...........ARHPGS--------------------LRGWEV--------------------KTVD.LA----------
K7SEU6_GLUOY/4-237.................--------------------HGLFEI--------------------DAPRPFE----------
W5TGY3_9NOCA/19-245.................--------------------.NAMKD--------------------KPHTITV----------
Q2RXJ4_RHORT/4-241...VQTTRDFGLPDALA--------------------VCDPAR--------------------LAAKAMP----------
A5FTJ9_ACICJ/1-224.................--------------------GGLCTV--------------------ES.KEFT----------
G4SY61_META2/1-204................G--------------------NKQVNL--------------------LATRELP----------
J7L4F7_NOCAA/1-247............PRSEP--------------------ETWWRT--------------------HDYTGFL----------
CAS6_THET8/1-211..............VLD--------------------EGYAQV--------------------FPPKPFH----------
B7KJ27_CYAP7/1-214.................--------------------.KGYTA--------------------EEITEMD----------
W5WPN4_9CORY/1-214............ANE..--------------------.QSWAI--------------------RDYTPLL----------
W8KR76_HALHR/1-229.................--------------------SGLLQA--------------------QC.KRFS----------
R6BMI8_9CLOT/1-206................P--------------------GETWQT--------------------KDYTPLL----------
A0LM55_SYNFM/1-201.........LFTERHPC--------------------VIDMRT--------------------KVFSPA.----------
F2GBG6_ALTMD/1-221.................--------------------LPIFSC--------------------VT.KVFE----------
A8LMM7_DINSH/4-255..REIAAPVPLSEAMVT--------------------ALSPDR--------------------IETKPMP----------
I4CC95_DESTA/1-227.................--------------------HGIFRL--------------------KT.KSYD----------
D7BDY1_MEISD/1-207YF...............--------------------...SQR--------------------PESKPIP----------
F4H8A3_CELFA/1-228............PST..--------------------.ERGTS--------------------KEYGPFL----------
G2PH26_STRVO/4-213.................--------------------.GTIAT--------------------KPLTPLL----------
B8GIV2_METPE/3-224.................--------------------NETWNI--------------------KS.KPYA----------
A5UR13_ROSS1/1-236FG..........PALDE--------------------RGNPAL--------------------RRIDDEY----------
K4QSD2_9ACTO/21-242.................--------------------.GALTV--------------------KPHVITV----------
D3V5E3_XENBS/1-222.................--------------------SAMFQI--------------------QS.KAFT----------
K0JYJ1_SACES/1-217............PTT..--------------------.HTWDT--------------------RDYRPLL----------
F2NLA6_MARHT/1-206.............ALET--------------------DYYAEV--------------------FPPKPFN----------
F2NAL6_CORGP/1-225............TDS..--------------------.KRWQT--------------------KSYLPLL----------
B2GBK0_LACF3/13-222............A....--------------------.NTTAT--------------------KEYSPFI----------
C3PF96_CORA7/4-227............DT...--------------------.RPAQS--------------------LDYTRLL----------
Q5YRB7_NOCFA/1-222............PTT..--------------------.TAWTT--------------------RKYGPLL----------
R7C5Y6_9CLOT/4-210................A--------------------SSTFET--------------------KEYDVLL----------
D1A5U1_THECD/1-227............PTT..--------------------.GTWQT--------------------YDYGPFL----------
F7XPH1_METZD/1-225.................--------------------LSYFNI--------------------DV.KTYD----------
C7QEM3_CATAD/1-234............PTT..--------------------.GSWDS--------------------FAYAPFL----------
X2HBF6_9GAMM/1-222.................--------------------HQLFLI--------------------ET.KPYQ----------
Q8ZMF1_SALTY/1-212.................--------------------.AIFDV--------------------QT.RPFA----------
F7V5D4_CLOSS/1-209.................--------------------HGSAQT--------------------KSYDKFL----------
C7JIG8_ACEP3/5-227.................--------------------HRLFEI--------------------ES.REFT----------
F4F6M1_VERMA/1-220............PTSE.--------------------.EAWTT--------------------REYDGLL----------
H2KA43_STRHJ/1-258PA.....AAAADPAT..--------------------.PGWET--------------------RPYGPFL----------
D5QGJ9_KOMHA/5-227.................--------------------HGLFDI--------------------ES.RTFA----------
W5XRF5_9CORY/5-230............AT...--------------------.RPGLS--------------------ADYARLL----------
D7B2M5_NOCDD/1-237............P.TDP--------------------ANTWQT--------------------HEYSGFL----------
Q74DC7_GEOSL/1-201................A--------------------SREVLL--------------------MGSKPYL----------
G2I4Z3_GLUMN/5-233.................--------------------HAIFDI--------------------ES.RPFA----------
D8PDH7_9BACT/7-231.................--------------------AGLWHI--------------------ES.KPYR----------
Q0RTG6_FRAAA/28-266............PNAED--------------------.PQALV--------------------RDYQPLL----------
Q1R113_CHRSD/1-229.................--------------------AG.LDV--------------------QC.KPFA----------
W5YA73_9CORY/5-211............AT...--------------------.RPPEI--------------------ADYMPLL----------
Q2FNT6_METHJ/1-225.................--------------------GNVWNI--------------------LS.KPFH----------

PF09559

I3Y6I2_THIV6/19-221-----QNGWERPAHGTD--------------------SELMLS--------------------RRTKLTI----------
K9XG27_9CHRO/19-215-----KQG.........--------------------.KIYLT--------------------ERSRLVI----------
K8GDJ5_9CYAN/5-213-----RAG.........--------------------.MIYLN--------------------RGSRFRL----------
A1WYF2_HALHL/43-242-----GHGWWRTPDQ..--------------------.PILLP--------------------RRSRLVL----------
L0GUP4_9GAMM/19-220-----QNGWQRPDHGQD--------------------QFLILS--------------------RRTKLTI----------
B1WUU2_CYAA5/5-214-----KNG.........--------------------.LVYLN--------------------NKSRFRF----------
A9GDE4_SORC5/9-194-----PDG.........--------------------.LLAVD--------------------ARRGLRL----------
S6AB47_9PROT/13-201-----GKD.........--------------------DLLILN--------------------RRAKLVI----------
K9UJP2_9CHRO/24-218-----GAY........S--------------------KRLNID--------------------VDSVLKI----------
L0D6C1_SINAD/4-204-----APG.........--------------------.VLSLI--------------------DSSRIRL----------
B7KMS1_CYAP7/17-211-----KQG.........--------------------.KIYLT--------------------ERSRFRI----------
U5QID9_9CYAN/4-208-----GHG.........--------------------.SITLP--------------------SSSKLRL----------
A1AWQ7_RUTMC/20-216-----GNGWTQNHKDG.--------------------.FYYPS--------------------KRSKLTI----------
G2LKY9_CHLTF/7-196-----SGN.........--------------------.NLLLQ--------------------NWSRLVI----------
Q8F1E7_LEPIN/7-203-----RPG.........--------------------.ILRLT--------------------ANSQLRI----------
D5ECJ4_AMICL/2-214-----GER.........--------------------.KIALN--------------------NKSRLTL----------
H5WQR3_9BURK/14-206-----GSE.........--------------------.PALLS--------------------ARARLLV----------
Q0A841_ALKEH/18-217-----GNGWHRGEGQ..--------------------.PIYLS--------------------RRVQLLL----------
D3RSM8_ALLVD/19-226-----QNGWERPEHSPE--------------------ALIMVS--------------------RRTKLTI----------
K9YQR8_CYASC/5-205-----YQG.........--------------------.KITLT--------------------PYSRLYL----------
K9XVY7_STAC7/5-218-----RQG.........--------------------.LIYLN--------------------RSSRLRL----------
B8GUE2_THISH/18-218-----GNGWYRPQDPEH--------------------DLLHLS--------------------RRARFRL----------
D5CSI5_SIDLE/9-195-----NEG.........--------------------..MLIP--------------------KRAKLAL----------
B7JW14_CYAP8/13-212-----QNK.........--------------------.FLELT--------------------PNSCLKI----------
B7KHP0_CYAP7/13-209-----FPQ.........--------------------.LLHLT--------------------EDSYLCL----------
CAS6_MYXXD/31-219-----TRE.........--------------------.LLYLG--------------------.RGTMRL----------
L0DSG3_THIND/18-218-----GNGWMRPQDPER--------------------DLLHLS--------------------RRARLRL----------
S6BKH6_9GAMM/19-222-----QNGWERPDPQMG--------------------QKLVLS--------------------RRTKLHI----------
K9RC65_9CYAN/23-224-----RNN.........--------------------.LLEIA--------------------AQSRLKI----------
Q1CW34_MYXXD/5-192-----VGD.........--------------------.LLHLG--------------------.RGTLRL----------
V4IWF5_9GAMM/19-219-----QNGWERPEHGIG--------------------RQLHLS--------------------RRTKLCI----------
K9RR28_SYNP3/19-213-----RQG.........--------------------.KIFLT--------------------ARSHLRI----------
W0E0S8_MARPU/19-220-----QNGWERPPHGTD--------------------TCLQLS--------------------RRTKLRL----------
B1XPP5_SYNP2/5-214-----KQG.........--------------------.MIYLN--------------------RRSRFRL----------
Q3SG16_THIDA/19-210-----NSG........D--------------------TVLNIN--------------------RRTRLFM----------

PF03787

Q1Q3H4_9BACT/4-335HCNINIQGNIRSCIRNA--------------------FSQPYL------------------PGSAIKGVI----------
Q8TPH7_METAC/4-317IGKRNRESEFAIKEFVK--------------------CGGPYL------------------PGSSIKGSI----------
O57906_PYRHO/18-333RGELGRESSRIKEFIKI--------------------KGKPYI------------------PGTSLKGAI----------
B3EIY8_CHLPB/11-320RIDGDIQKNHIRRFIAT--------------------GGKPFI------------------PGSSLKGAI----------
A6LNL6_THEM4/4-297LNYPLDKRYNIKEFIKT--------------------IGKPFL------------------PGSSLKGAI----------
A4XFP8_CALS8/12-334LEGVQKFPREIVAFVKS--------------------AGRFYI------------------PGSSLKGGI----------
Q3AA80_CARHZ/5-311LMDLKIRKAEVLAPVAE--------------------GQGFYL------------------PGSSLKGSL----------
A7HMV5_FERNB/4-324MDEESAKTLQISKFIHS--------------------ANRRYI------------------PGTSIKGAL----------
A2VLF2_MYCTX/11-314TRKKLTLNEIHAFIKDP--------------------LGRPYV------------------PGSTVKGML----------
Q0AW54_SYNWW/12-313AAHIENFREVLTFIKDS--------------------KGYPYI------------------PGSSLKGAI----------
H3UYT7_STAEP/9-268NTRPKPLNDLHLMVRDG--------------------QNKVYL------------------PGSSIKGAI----------
Q03KS9_STRTD/11-288PNSAGAINEVNKFIRDA--------------------FGNPYI------------------PGSSLKGAI----------
A2BKQ7_HYPBU/87-311SGLLGTVLEVGLSWDYL--------------------LDLPYI------------------PASSIKGLI----------
Q2LQX1_SYNAS/103-281...ESHPHEVSMVFDHN--------------------MGIPYI------------------PASGVKGIV----------
I8UHN2_PORGN/59-251EDDAPEVYNLGMYFDYT--------------------SGLPVI------------------PGSSIKGML----------
A5I3U2_CLOBH/73-293ILKEKEEFKLSLEFDYT--------------------TGLPVI------------------NGSSIKGML----------
Q8TVU2_METKA/491-691...GPHPAENDLTLDPV--------------------TGLPVI------------------PGTTLKGVA----------
A1WUQ4_HALHL/82-287...MAHPLENGFAFLTP--------------------YGLPYL------------------AGSGVKGVL----------
A9AWU2_HERA2/90-292...AESVLENSIALQRT--------------------YGMPYI------------------PGSALKGLA----------
Q1CW33_MYXXD/74-261...NASPTGVGLTLHHT--------------------WGVPVV------------------PGSSLKGVL----------
Q977D5_SULTO/23-210PDVNKYFSPVTHEMNRY--------------------LGKVII------------------PGSTIKGLV----------
A8A9P3_IGNH4/77-241..ALKAVFEVGLNVDPI--------------------LGLPYY------------------PGSGIKGAV----------
A1RZR1_THEPD/18-247.....REGNVLYALRLP--------------------DGRLLV------------------PGSTWKGAF----------
G2TF03_RHORU/11-210KAGANAAPQVARIARDA--------------------MARPMI------------------PSTALKGVL----------
M1IFS5_9CREN/8-222.........DTLKPLKY--------------------DNDYVI------------------PSTSLKGIF----------
A4YFX5_METS5/9-241......SLGNELEALKY--------------------GDTYVI------------------PFSTWKGAF----------
M1IF98_9CREN/8-291SADIVTYKLPLQDSNEV--------------------YYIPAI------------------PATSFKGLL----------
A8F3D7_THELT/30-277...PSPLTEKKGAIFKV--------------------DRTPVI------------------PATSFKGAL----------
A4FJY4_SACEN/194-372LNSVNGPKHNTLTAFRH--------------------GEEFVV------------------PGSTLKGVL----------
A4YFW9_METS5/24-229KGSASFRDTTDNPILTR--------------------GDMPYI------------------PGSSLKGAL----------
G2T688_RHORU/19-223APQTDDIAKAKAVLLDS--------------------DQRPCL------------------TGSGLKGAM----------
G2TF03_RHORU/253-439KRDKSDKEPNARAQSAG--------------------KNLPLI------------------LGSSLSGAL----------
Q5LZX3_STRT1/11-194AFAAIGAIDSPVIKDPI--------------------TNLPII------------------PGSSLKGKM----------
A5UWG2_ROSS1/10-302.SYRLGRVDNSIVREPG--------------------TRVPKI------------------PGTSLHGAA----------
Q2JNS6_SYNJB/14-218ADPTKPDMEFVETYHGG--------------------GRTVYF------------------PGSSLKGAI----------
A9WGF2_CHLAA/265-444QDRGPDTVHLHSARPGG--------------------TRKPVL------------------SGTSLAGAL----------
A7NFU0_ROSCS/21-222.RATEIIANDLPVLRDA--------------------FDRPFI------------------PGASLKGAL----------
O66706_AQUAE/7-289..QGLTHIDLPIAREVH--------------------TGFPFI------------------PGSAIKGCL----------
A6LNK3_THEM4/7-272..MDLGVIDQPIQREIH--------------------TGFPII------------------..SGIKGAL----------
A6UNE9_METVS/9-264.DANFGIIDKTVQRDVL--------------------TGFPAI------------------YSSSLKGSL----------
Q2FL77_METHJ/279-403...........EPTVTN--------------------GLGPVI------------------PGSTIKGFL----------
A1WUQ2_HALHL/9-296..TATGVIDNPIQREVH--------------------TQHPSF------------------AGSGLKGAI----------
Q8TVT9_METKA/8-335.QRATDVIDLPLQREAH--------------------TKLPVI------------------YGSTLKGAL----------
Q47PK3_THEFY/7-290..ASDGVLDLPIQRESS--------------------TNYPLI------------------WGQSLKGAL----------
Q2JRT2_SYNJA/7-252...TQEGNLLGIAREAH--------------------TNLPYI------------------PSSTIRGKL----------
A0YUX6_LYNSP/8-262.AGEESGNLNLIFRDQF--------------------TQTGIV------------------PGSSIRGRF----------
A0YQJ5_LYNSP/5-273..DSSIRGNNNPIYRLS--------------------DRTPAI------------------PGSSVRGAL----------
A8A9P1_IGNH4/9-272...RSPGTVDQPIIKDP--------------------MGIPFI------------------PGSSVKGAL----------
CMR4_SULSO/14-302..TSVEEEVDLPFQRDE--------------------LNYPTI------------------FASSLKGAI----------
Q97XK7_SULSO/7-290...RGYGIVDMPVQRDQ--------------------MGYPII------------------YSSAFKGPL----------
A3MVP2_PYRCJ/10-303..RSEEAQVDLPVQRDE--------------------FGLPTI------------------WASSLKGAI----------
Q2JNS1_SYNJB/20-216..GSSGSLADKPLLKDA--------------------FGRLII------------------PGSQLKGRL----------
A5UT82_ROSS1/9-185...RRRLGVDKTLALST--------------------EGVPVL------------------PATTIKGFL----------
Q2FL76_METHJ/14-206.GSSGPADVDLPVLRNS--------------------EDFPII------------------PGSSIKGVL----------
B8G728_CHLAD/8-184..YGLGLQVDSALLRDA--------------------DGVPVI------------------RGTVLAGLL----------
M1LLF0_9SYNC/7-200...MGRGELDSVVQRDG--------------------DNLPYI------------------PGKTLTGIL----------
B0K2G5_THEPX/4-192...EGAGIIDSDVVLDD--------------------LGFPYI------------------PSRRVKGVL----------
A9AUN2_HERA2/7-194..DGIVGLIDQEVEYDQ--------------------YGFPFL------------------RGRTLKGLL----------
Q7MC47_VIBVY/7-190..EEGGTYADALVLKNP--------------------HNLPFL------------------PGKALKGLF----------
A3DH28_CLOTH/14-216LNPASVEHTFFVTYKNG--------------------ELVPAI------------------PGSSLKGVF----------
A4YFX0_METS5/20-218.....ERGPIKEVIRDA--------------------DGNPYI------------------PGSSWKGVF----------
Q2JRT5_SYNJA/129-478..GAKGPESMLLPAFDP--------------------LGIPYI------------------PSSTLCGVA----------
Q2FL77_METHJ/16-208YSLSPAPVIECFDAGSG--------------------VFEPYI------------------PGSSLKGIL----------
A4TG45_MYCGI/12-250NFALFRREKILSADGTM--------------------TEVPIV------------------SGSSFRGVL----------
A4XGU1_CALS8/51-316..........GSQFFKI--------------------NNKPFI------------------PGSSLRGMI----------
Q0ATZ2_SYNWW/170-634EAKIRDEKWENPEFFSP--------------------GGTPKI------------------PGSSLRGMV----------
B0K8W5_THEP3/133-594.......KEESDFFSIK--------------------NGLPII------------------PGSSLRGMV----------
A3DH27_CLOTH/31-251YTVSGDNSMIYKEFVKV--------------------NGVPVI------------------PGTSFKGCI----------
A3DKC8_CLOTH/235-405.TVRLSNESDGINIKDS--------------------RGNYII------------------PGSSIKGVI----------
M1MPL7_9SYNC/156-674KEEINNNHKTYPVRIGK--------------------DGKPYL------------------PPTSIKGML----------
Q82XX3_NITEU/10-223KNDFNRNGVERTSYQPF--------------------NQLPYL------------------PGSSIKGAI----------
A3DH32_CLOTH/9-175...QERRGSVQRRTVLC--------------------KNRPYI------------------PGSTIKGKI----------
A6NTP4_9FIRM/14-168......GLTTEQLLTDT--------------------QGRPYF------------------QGTSLAGAL----------
Q7MC49_VIBVY/10-189...LREAAFDTALVRDC--------------------NGLPMI------------------PATSIAGVW----------
A0RRG9_CAMFF/11-179...SVDFLQDSPVQKDW--------------------NNLPMI------------------LGSSIAGVL----------
A3DKC8_CLOTH/16-186........EDNLKIDQL--------------------TGKVYI------------------PGSSVAGAF----------
A0YPM8_LYNSP/30-210..DADSPTDLPLLRDSI--------------------SDHALL------------------TGSSIAGAL----------
D2C6C1_THENR/8-159................D--------------------SKSDTI------------------QPTGIMGSL----------
Q8PRT5_METMA/8-181................N--------------------GNSDTV------------------RETGVIGSM----------
O26428_METTH/15-144................E--------------------RRSEVI------------------RDTGLIGSL----------
A7NRR3_ROSCS/6-141................A--------------------GKPDRL------------------IPTGIMGSL----------
C9RCS1_AMMDK/9-145................D--------------------RESKRL------------------ILTGLLGSI----------
C9RCG8_AMMDK/9-178................K--------------------GKCDRL------------------RETGLLGSL----------
A5UWG6_ROSS1/4-173................D--------------------GTTDRL------------------HESGLLGSL----------
A7NRS6_ROSCS/4-175...............EP--------------------GKVDRI------------------HETGILGSL----------
A5D4F7_PELTS/4-177...............KS--------------------GAVDRV------------------HETGIIGSL----------
B3EIR8_CHLL2/6-173...............ET--------------------GKMERI------------------HETGIIGNL----------
B4S552_PROA2/12-192...............QA--------------------GVVDRI------------------HETGMIGSL----------
A6DAG1_9PROT/9-198................N--------------------GECTEL------------------KPASIFGSL----------
C7P6D1_METFA/9-230................W--------------------GQCMEI------------------RPSSILGSL----------
B7IGV5_THEAB/8-173................R--------------------GITNEI------------------RPSSLIGSL----------
D3T315_THEIA/9-219................W--------------------QENSKV------------------RPSSLMGSL----------
O28411_ARCFU/9-154................N--------------------QSKAEI------------------RAASIKGLM----------
CMR1B_PYRFU/7-178................D--------------------ARSPEF------------------SSASVKGVM----------
D3T7Q1_THEIA/22-173................D--------------------GRTPEL------------------RPSEFKGMM----------
B0M908_9FIRM/9-142................N--------------------NKELEF------------------RITELKSAM----------
C5D4N4_GEOSW/18-161...............NA--------------------KEKAEF------------------RISSLRGVW----------
Q53W07_THET8/34-193............EPREA--------------------DPVSVV------------------RATAVRGHL----------
A9AWU5_HERA2/41-244............KAGVN--------------------DPITPI------------------RASGIRGQL----------
D2ZTS9_NEIMU/25-187............VARES--------------------DEKLPV------------------RVTAIRGQL----------
D0W1J3_NEICI/30-211............QAAVP--------------------DVLMPI------------------RVTAIRGQL----------
E6XI85_SHEP2/30-186............EAGKV--------------------DTAMPI------------------RASAIRGQL----------
D1Y2F0_9BACT/26-187............KAGEV--------------------SREFPV------------------RAPSIRGQL----------
Q1IZR9_DEIGD/24-191............ETREV--------------------DERHPV------------------RAASVRGHL----------
D3PS14_MEIRD/23-188............TPRQV--------------------DPEHPV------------------RAASVRGHL----------
D2Z4K2_9BACT/26-193............KAGEV--------------------DGKHPV------------------RGTAIRGHL----------
C5BIW8_TERTT/31-214............EARVL--------------------DPSQLI------------------RGTSIRGHL----------
Q9KFY9_BACHD/34-207............KAGQV--------------------DKEIPV------------------RSTSIRGNL----------
C8WRP6_ALIAD/23-238............HSQRV--------------------DRSHPV------------------RGETVRGHL----------
Q1CW28_MYXXD/33-206..........VARSPDL--------------------PSVDII------------------RVPTLRGHL----------
D3SNA7_THEAH/10-153................D--------------------PEKAEL------------------RPASIVGML----------
Q2LQW6_SYNAS/16-162................D--------------------PQNAEI------------------RSAPIKGAL----------
B6IX20_RHOCS/283-454..............TQD--------------------GNDCDL------------------RPATLRGLL----------
A8DJU4_9BACT/304-514..............NQQ--------------------REDCDL------------------RPATLRGLL----------
C8W3E8_DESAS/7-167...............NP--------------------VNSAEL------------------RPPSFKGVM----------
B8GSG8_THISH/11-176..............DAK--------------------RVADAI------------------RPPSVKGAL----------
B7R675_9THEO/7-162................R--------------------KNSLEL------------------REQSINGIL----------
O66703_AQUAE/10-154................Y--------------------KDEPEL------------------RIPSIKGML----------
Q47PK0_THEFY/7-173.................--------------------..DEPL------------------RVSSLRGAM----------
A6LNK0_THEM4/7-158.................--------------------RKDFKL------------------TSQTIRGIL----------
B7IFF0_THEAB/10-183................K--------------------YKDSIL------------------LPQTVRGVM----------
A8UTQ9_9AQUI/7-200...............EP--------------------NKYAEL------------------RPASFVGLL----------
B2V8M0_SULSY/7-150.............NSGK--------------------LDSIFI------------------RPTEIKSTM----------
A8V361_9AQUI/9-167................F--------------------GQSDDI------------------RPSEIKGLM----------
A8M9C0_CALMQ/7-192............DPNSV--------------------DYDWPL------------------RPSEVKGVW----------
Q96Z54_SULTO/9-305.........QYPVSLKV--------------------GYEEPI------------------RSTEIKGLW----------
CMR1_SULSO/9-255...........RHSINE--------------------FYEENV------------------RPTEIKGLW----------
D2PID8_SULID/27-180...............KG--------------------ETSNRI------------------DEDEIVGRL----------
D0KVA4_SULS9/24-174...............RG--------------------YTSDHV------------------DEDGIVGKL----------
C4KFX7_SULIK/27-177...............EG--------------------KTSNHV------------------DEDEIVGRL----------
Q8TPH8_METAC/9-242............GIGLE--------------------ENSLVL------------------HSDTIFNAI----------
A6UVY5_META3/7-263..............DLT--------------------ESSTIL------------------HSHSLFSAL----------
A0A038KP63_MYCTX/9-193..............GLE--------------------SSTISC------------------PADTLYSAL----------
Q5HK92_STAEQ/9-199..............RLS--------------------DGEMTI------------------TADTLFSAL----------
Q9X2C8_THEMA/9-196.............NETD--------------------STLPTI------------------HSDTIYGAV----------
A3DLB2_STAMF/6-246..............GVE--------------------SVNKFI------------------PSTTIWSAL----------
B8GB50_CHLAD/99-293..RVFHLLDNPVRKDRV--------------------FGVPFM------------------AASSWKGML----------
A1ZVA0_9BACT/4-254KLGESPKQQIRGHIKTA--------------------NREFYV------------------PGTSLKGAI----------
A5ILN4_THEP1/4-318FSSGKRNPEIPEVVHHP--------------------DGSVYI------------------PGSSLKGAV----------
Q46CS3_METBF/9-174...........KTDNLQ--------------------QTRPYV------------------PAKTMWGAL----------
A6DAF6_9PROT/10-162...........GWGVVN--------------------ETRIFI------------------PGITMWGAL----------
Q2FL73_METHJ/7-220..........RARGTFS--------------------QTLSYV------------------PGRTIRGMI----------
A0ZJ98_NODSP/7-256...........KPGSVS--------------------EAEDYI------------------PGSVIRGAL----------
A4XGT8_CALS8/240-441..........RGEQNTV--------------------YTKKYI------------------PASVIRGLL----------
A9AUN3_HERA2/7-220..........QGDPNSS--------------------VSFDYI------------------PGSAIRGAL----------
A3DKC7_CLOTH/8-205..........ERDSNNE--------------------YSYSYI------------------PGSVVKGAV----------
Q8TVR9_METKA/10-323RTGGVPDRFLPTYRPTR--------------------VDDPWI------------------PGTSVKGAL----------
Q8TVU2_METKA/6-335..GRPGAIDLPLIRRRH--------------------TRVPYV------------------PGSSVKGAL----------
Q6L316_PICTO/4-317SDIKMPIGNYVNEDNKI--------------------FFRPFI------------------PGSSIKGAI----------
Q97CJ4_THEVO/4-334KDVKLTMGTYEVINNKK--------------------TFVPFI------------------PGSTIKGAI----------
CSM5_METJA/49-345SEIFSNKKTRVKKFINQ--------------------NNTYYI------------------PGSSIKGAI----------
A6DE72_9PROT/4-332LLETTSRPISAFIKEKF--------------------EFKPII------------------PGSTLKGVI----------
O27150_METTH/4-274LKTESSNIKDVHEHIKT--------------------SDEIYI------------------PGSSIKGSI----------

PF09700

A0B6W4_METTP/4-358..GKRNDSGYEMRLLRPG.............EEVEC.DLGRVRLPTAE.............KIDGMKQLS----------
O28413_ARCFU/3-341..VTQNLGLVKPHRIDK.....................LGITILMDS..............EGIKFRPFN----------
A6VYS5_MARMS/4-381.AVDNKPTLVGLQPLQPNED.........EGCDLPN.GLLPLFLSQD..............IEGKPVSGP----------
Q47PK4_THEFY/13-381.GKETTAQERAYYRLVKG..............SAVD.GTDLAHVPGAPESLLE....LPPQVTAKAEPLQ----------
Q9KFY7_BACHD/8-408..YEDENGALQMNYRQPQ..............PLVN.GQGYLGIGDKGDHESLWPAKVIPQMGKVSSIVP----------
Q1CW30_MYXXD/6-386..VRDADGSEHLERLEP................RPD.GAATLGPDDDDAREAL....WHPRRNSSGKPMA----------
Q2JN53_SYNJB/4-377PWLDERDPYFHC.HWDP.....................TRPAPLVSLRPVEEE....PERSQSSKKKKTG----------
A9AWU6_HERA2/68-470IEDKPSESVPWLRRLIPIQAP.......AKLVSDFN.ELGLVGLVEPD.............PRKPAKEQP----------
A1WUQ1_HALHL/5-362..RDEATGECAVHRLTP....................QPLPAGVASSQPLERL....PVLRRSDRGKPAA----------
A5D0Z3_PELTS/4-387PSDFTKAAIRQLTPLQLPPG.........SHTNLPEDSLAPVGMPDRD.............PRKPFSKTP----------
Q8TVU0_METKA/10-439.EPESGGEAVDLLRVEEVG...........DAAIAF.SGHDEALRRRYGFMTP....KPPRPGSDVETPG----------
Q6ZEA9_SYNY3/4-365PWHDATSPLRSQMLWDK.....................TQPAPLAPLETVSQ.......TDIKRDEKQAR----------
Q1IZS1_DEIGD/6-393..VDKNGQIFRALPAELREG.........EGTDAPE.GLRPLLLTDRDGNA..........PGDAFKPQG----------
Q7MTH3_PORGI/6-391..KENEKAPYNLLHLSC............................................QAGCPPIFG----------
A9AVY8_HERA2/6-387.QDGANVTCYRLQPLDPRYF.........PTEQTDL.VLGQQPDQPRFSLVGS....QQHTKGKAPANLP----------
Q8R6Z6_THETN/4-372..ERKKEEIENIFHARHYELNTKLFKKENTNADSNI.KTFPLYM.................GKEDIGTFP----------
Q1AZD9_RUBXD/4-359.....KSGERFTTRLRPRD............TPLET.DMGEVRLPEVVPVEDD....SGKEAKGFKPLAD----------
G2LF94_CHLTF/11-373..AKGKTGGQQLFALAP.................LQ.EELPGWHPVPEEQRRP....LWLKEAVVTEPVE----------
Q53W08_THET8/2-351...KLGEALYPLRPLELPQG.........AGTNLPE.GLSPVGLPSPA.............LKEKPAPLP----------

PF09704

Q2MF31_STRSD/16-248-----DRSAFNRRD...--------------------.TRPEP------------------TKSGIIGLLAAAE......
Q7NYP8_CHRVO/13-224-----RPEMKVERV...--------------------.SYDVI------------------TPSAARGILEAVH......
A1ARH6_PELPD/3-217-----TTSRFDQRD...--------------------.TGKEP------------------SKSGVVGLLAAAL......
Q12YA8_METBU/4-236-----DIAVGQHRP...--------------------.TYDHP------------------SKSAIFGLIAAAL......
Q0BSC7_GRABC/6-215-----ELAGHERRG...--------------------.SLIWP------------------TRSAIIGLMGAAL......
A8ABL4_IGNH4/3-275-----FSVRYPMSSAAQ--------------------LAPPLP------------------PPSTAIGALAEALAITLGL
A6W168_MARMS/4-241-----QPAVGGDRA...--------------------.TAIAP------------------TRSAILGLLGAAL......
O66696_AQUAE/3-211-----TPFSIKGIE...--------------------.TYPLP------------------PYSTVIGLLYTAS......
A8ZZ17_DESOH/3-251-----EIAVGETRH...--------------------.TANYP------------------GRSAIIGLMAAAL......
Q1EQJ4_STRKN/3-213-----ASARFARRT...--------------------.TENAP------------------TKSGVIGLLAAAQ......
A5UR14_ROSS1/3-244-----LRARWGERD...--------------------.TTDAP------------------TKSGVIGLLGCAL......
H6NZD8_SALTI/4-233-----EEASGEIRH...--------------------.SATVP------------------TRSALLGLLAAAL......
Q3A5Z4_PELCD/3-236-----EIAVGESRH...--------------------.SAVYP------------------SKSALLGLLAAAL......
C1DSH9_AZOVD/3-205-----TTSRFDERD...--------------------.TQLEP------------------SKSGVLGLVCAAL......
Q5YRB6_NOCFA/3-211-----VASRFARRE...--------------------.TQQYP------------------SKSGILGLIAAAR......
Q1CWU1_MYXXD/10-210-----RPEMKAERV...--------------------.SYEVM------------------TPSAARGVLEAIL......
A3DLC5_STAMF/3-270-----HQSRIVGLSKTN--------------------PSYYYP------------------PPTTILGAIAEPI......
A4J385_DESRM/4-212-----RPEMKVERV...--------------------.SYDVM------------------TPSAARGILESIH......
CAS5_MANSM/4-216-----RPEMKVERV...--------------------.SYDVI------------------TPSAARGILSAIH......
Q8KDC0_CHLTE/7-228-----RPEMKVERV...--------------------.SYDVI------------------TPSAARGIFEAIF......
Q2P7C5_XANOM/4-215-----RPEMKVERV...--------------------.SYDII------------------TPSAARGILEAIH......
Q9X2C0_THEMA/3-212-----RPYTTTSSY...--------------------.TLPFP------------------PRTTLLGLVGCVL......
Q03C60_LACC3/3-210-----NEAQFARRT...--------------------.TGDYP------------------SKSAIIGMLAAAL......
I6UXT4_9EURY/3-239-----KRSYQVRT....--------------------.SFLLP------------------PPSALKGALAKGLIL....
Q47PI7_THEFY/3-209-----AASRFTRRT...--------------------.TEHAP------------------TKSGVLGLLAAAQ......
O28407_ARCFU/3-252-----FQARIAGLSKTS--------------------PSFYYP------------------PPTTFLGAVAEAI......
Q2SID2_HAHCH/4-215-----RPEMKVERV...--------------------.SYDVI------------------TPSAARGIIEAIH......
CAS5_METJA/5-228-----KQSYQVRQ....--------------------.SLLLP------------------SPSALKGALAKGII.....
G7QLA9_LEPII/11-225-----RPEMKAERV...--------------------.SYDVI------------------TPSAARAIFDAIL......
O27159_METTH/3-241-----NPFTFDYAQ...--------------------.TYPLS------------------PKSTVTGMLQNAT......
B3E5U9_GEOLS/3-263-----EIAVGESRH...--------------------.SAVYP------------------GKSALLGLIAAAL......
Q04QB7_LEPBJ/4-240-----NIAVGEYRP...--------------------.SDSFP------------------TKSAIIGLISASF......
Q60AD2_METCA/3-241-----GVMVDQHGP...--------------------.TEQFP------------------GLSMLAGLLGNAM......
Q2RL62_MOOTA/18-224-----RPEMKVERV...--------------------.SYPVM------------------TPSAARGILEAIF......
A5GBK2_GEOUR/12-223-----FDSQYNRRN...--------------------.TGLMP------------------TKSAIAGMCCAAL......
E3ITF8_DESVR/10-218-----RPEMKVERV...--------------------.SYDVM------------------PPSAARGILEAIH......
Q0W584_UNCMA/6-214-----LKARWDIRD...--------------------.TGDEP------------------TKSGIIGLLGCAL......
Q1NKD4_9DELT/4-199-----DPLTKIGGEK..--------------------CSYHIP------------------TYEALKGVAKSVY......
A4YFV1_METS5/10-233-----FSISYPTASKEK--------------------RATLLP------------------PPTTLVGALSY........
A8LYZ7_SALAI/3-226-----DHSTFSVRD...--------------------.TGTVP------------------TRSAMIGIIAAAQ......
B1XDH0_ECODH/4-214-----QPTFEGTRP...--------------------.TGRFP------------------TRSGLLGLLGACL......
Q0AZP3_SYNWW/4-212-----RPEMKVERV...--------------------.SYDVI------------------TPSAARGILEAIH......
Q1R114_CHRSD/4-250-----EAAVGEARP...--------------------.TATYP------------------GRGAILGLIGAAL......
C3MMV7_SULIL/5-232-----FSVVKPSAAKAK--------------------SGFYLP------------------PPTTLIGALSY....