Sequence alignment for CL0362

PF01881

A3I0J5_9BACT/85-250LEQVF....ATPKVELG...N....LI-LV------PEYT----------------------------------------
B4SEV7_PELPB/102-262VIGLL....QEPYVWVG...N....ER-FR------VETV----------------------------------------
A9BGZ0_PETMO/94-248ADSLL....FKDDFELL...G....QK-IH------VEKL----------------------------------------
B4S5I3_PROA2/102-261VVGLL....HQPLVQIG...A....QR-FR------VETV----------------------------------------
A9BIX0_PETMO/95-244LHSLN....EQKVVRIE...K....NY-FT------LRKY----------------------------------------
B8FSG8_DESHD/95-244VNVLL....TKGVMRLG...A....QE-LE------IDRI----------------------------------------
A5D0Y7_PELTS/95-244INNLL....TRGQIQVG...Q....SL-LL------IDEI----------------------------------------
O30164_ARCFU/94-241VEGLL....SKPEIRIC...G....VD-FI------VSEV----------------------------------------
CAS6_PYRHO/96-239ITGLF....REPEITLW...G....EK-FY------LEEV----------------------------------------
A7HMV7_FERNB/94-242IEKVG....TFDSLRIG...R....NI-VR------PEKI----------------------------------------
Q5JGA0_PYRKO/94-241IGGLL....QNPEVELW...R....EK-FT------VEEV----------------------------------------
A1BI29_CHLPD/102-262VVGLL....HEPYVFVG...R....ER-FR------VECV----------------------------------------
A5ILP0_THEP1/93-246FSSLS....EDPVIRVE...K....TE-FI------VKSI----------------------------------------
A4XIJ2_CALS8/97-249STGLL....KKDQIYLK...D....NI-LY------VTSA----------------------------------------
CAS6L_PYRFU/91-238VEGIE....KSPEFKIG...D....VG-FL------VADI----------------------------------------
CAS6_PYRFU/95-238VNGLL....MNPEVRLW...D....ER-FY------LHEI----------------------------------------
O66704_AQUAE/85-236YNGILQLKKNQYIHPIG...T....GK-FK------IIDF----------------------------------------
Q97CI9_THEVO/80-232YNILD....KNKIFYLS...G....YK-FH------IAEI----------------------------------------
Q6L312_PICTO/82-235YDVLN....KNKYFYLS...G....YK-FN------IAEI----------------------------------------
Y1234_METJA/81-240YERLD....NLEEVNLN...N....FK-FE------VSEL----------------------------------------
Q6L114_PICTO/79-219YKIIDDIMDAIKSGNVK...H....RL-MR------INSV----------------------------------------
A5TU40_FUSNP/91-242VNVFL....SQRNKKFPLPKD....TC-MI------LKDV----------------------------------------
Q3AA81_CARHZ/95-248LNGLF....KDHKFIIG...R....EE-FT------VKGA----------------------------------------
Q1AZD0_RUBXD/93-249AEHLL....RRPETRLG...K....TR-CL------VEEV----------------------------------------
Q6L357_PICTO/89-232KVSFS....SYPEIRIG...N....SV-FS------IVEI----------------------------------------
Y375_METJA/95-240VAGLL....EDGKLRVG...N....VE-FF------VRKA----------------------------------------
Q4EVR3_LISMN/89-240YNALM....SLRGSKVLFGAG....NH-IT------VKNI----------------------------------------
Q2NFS1_METST/92-244LSGCL....ENPELRIG...K....NI-YK------ITQI----------------------------------------
O27163_METTH/1-154MEGFI....DRPEIDFL...R....RS-VN------VEYV----------------------------------------
A7GQ92_BACCN/87-233YNGLM....KMNDFRYK...G....FS-LK------RMKV----------------------------------------
O57900_PYRHO/78-237YLSLK....DRDHVYIG...K....DE-IK------LVEV----------------------------------------
A4J1X6_DESRM/95-249ANSLL....ARGFIQIG...K....NQ-LQ------VKEI----------------------------------------
Q46FQ7_METBF/89-241AEGLL....IEPEFFLG...NNGNKSN-FV------IERI----------------------------------------
A5UJJ7_METS3/89-241VDGFL....EDLEISFQ...N....QK-LT------IQKI----------------------------------------
Q5JHS4_PYRKO/92-239AEGFL....DDPLLKIK...D....AT-FI------ADDV----------------------------------------
Q332K8_CBCP/101-247LQGLC....INNEINLN...N....II-FK------VVDI----------------------------------------
O66560_AQUAE/87-244YNGLK....KLREYNGRYTNG.....N-IK------VKKV----------------------------------------
A1ZVQ2_9BACT/100-263VAGVF....QDQHLYIN...DAFAHND-FL------IEQI----------------------------------------
CAS6L_PYRHO/91-238AEAVE....KSPEFKIG...E....LS-FL------VGDI----------------------------------------
Q184H4_CLOD6/91-242YNGLM....TSKKCLYK...D....YE-LT------RIRI----------------------------------------
A4XM43_CALS8/98-260YNSLI....SSKLYPHKLTNN....CE-IK------LRRA----------------------------------------
A1ZPF3_9BACT/98-260IKDLF....LDRQMYLG...DKFSQAR-FI------VENV----------------------------------------
A8F3P6_THELT/92-245FSSII....ENPFIELE...G....VL-FN------ILQV----------------------------------------
Q8TJV5_METAC/89-241AEGLL....LEPEFFLG...NNENKVS-FI------IERI----------------------------------------
Q12WX9_METBU/89-240TEGLL....LEPEFFLG...RD.KKAN-FI------IERI----------------------------------------
A6DAF5_9PROT/81-224VSSIM...WEDKFLRVE...G....IK-FR------EVKF----------------------------------------

PF10040

A1RZS7_THEPD/144-263-------------------------VR-FH--------------------------------------------------
A4J507_DESRM/140-259-------------------------ID-FL--------------------------------------------------
Q3M5G3_ANAVT/172-285-------------------------FT-FT--------------------------------------------------
A0ZJZ0_NODSP/168-289-------------------------LS-FI--------------------------------------------------
CAS6A_SULSO/138-277-------------------------VR-FI--------------------------------------------------
Q2JNR9_SYNJB/173-292-------------------------LS-FV--------------------------------------------------
A8ABE5_IGNH4/136-254-------------------------VK-FR--------------------------------------------------
Q7TXS3_MYCBO/184-300-------------------------VE-FL--------------------------------------------------
Q6ZED0_SYNY3/149-272-------------------------FT-FT--------------------------------------------------
A0ZJ83_NODSP/132-250-------------------------LQ-FI--------------------------------------------------
A1HND4_9FIRM/191-314-------------------------IN-FV--------------------------------------------------
Q03KT3_STRTD/120-237-------------------------II-FE--------------------------------------------------
B8G917_CHLAD/148-265-------------------------LE-FA--------------------------------------------------
Q977A9_SULTO/131-247-------------------------VN-FI--------------------------------------------------
Q72GC1_THET2/120-235-------------------------LR-FA--------------------------------------------------
A3MST1_PYRCJ/120-246-------------------------LR-FL--------------------------------------------------
Q2FR84_METHJ/135-257-------------------------IQ-SL--------------------------------------------------
A3CNA0_STRSV/121-238-------------------------LN-FY--------------------------------------------------
A7NKQ1_ROSCS/148-265-------------------------FE-FA--------------------------------------------------
A1HM59_9FIRM/128-245-------------------------MK-FA--------------------------------------------------
Q9YCN0_AERPE/126-238-------------------------VE-YW--------------------------------------------------
Q745V3_THET2/136-262-------------------------FR-FL--------------------------------------------------
B3EIY9_CHLPB/190-323-------------------------LS-FK--------------------------------------------------
Q8ZZK8_PYRAE/121-246-------------------------LE-FL--------------------------------------------------
A0YW92_LYNSP/157-270-------------------------LI-FC--------------------------------------------------
A3DLD1_STAMF/165-291-------------------------VE-FR--------------------------------------------------
Q74DY6_GEOSL/182-301-------------------------LS-FN--------------------------------------------------
A1RZX7_THEPD/116-252-------------------------LR-FL--------------------------------------------------
B4S549_PROA2/190-323-------------------------LR-FE--------------------------------------------------
Q4J7R1_SULAC/134-279-------------------------LR-FE--------------------------------------------------
Q1Q3G5_9BACT/191-313-------------------------IS-LK--------------------------------------------------
A8M9A8_CALMQ/139-276-------------------------D.-.Y--------------------------------------------------
A1RQV9_PYRIL/103-214-------------------------LV-FY--------------------------------------------------
Q5HK95_STAEQ/125-242-------------------------LN-IQ--------------------------------------------------
A6NTQ0_9FIRM/121-240-------------------------LR-FV--------------------------------------------------
A8AA66_IGNH4/119-232-------------------------TH-..--------------------------------------------------
Q01QC2_SOLUE/166-288-------------------------VR-FL--------------------------------------------------
Q4J7D4_SULAC/139-264-------------------------ME-FL--------------------------------------------------
Q8ZZU6_PYRAE/127-238-------------------------LR-FY--------------------------------------------------
A2BMX9_HYPBU/151-264-------------------------LH-EA--------------------------------------------------
Q6ZEI4_SYNY3/146-257-------------------------LK-FH--------------------------------------------------
A6DE70_9PROT/157-271-------------------------LN-FI--------------------------------------------------
A9AZH6_HERA2/148-265-------------------------FQ-FH--------------------------------------------------
A0LHY9_SYNFM/189-312-------------------------LR-FV--------------------------------------------------
Q4J7P9_SULAC/157-283-------------------------VK-LI--------------------------------------------------
Q0AW55_SYNWW/127-244-------------------------IE-FL--------------------------------------------------
Q3IQ75_NATPD/155-285-------------------------MT-FQ--------------------------------------------------
A0B9F8_METTP/179-310-------------------------IR-FI--------------------------------------------------
Q39T05_GEOMG/185-303-------------------------LR-LL--------------------------------------------------
A4YFW1_METS5/128-262-------------------------VN-FV--------------------------------------------------
B9LJK3_CHLSY/148-265-------------------------FQ-LA--------------------------------------------------
A4YFU6_METS5/153-294-------------------------VS-FL--------------------------------------------------
Y1859_ARCFU/176-286-------------------------VD-YL--------------------------------------------------
A0YIK9_LYNSP/157-279-------------------------LS-FM--------------------------------------------------
A1BI47_CHLPD/189-322-------------------------LR-FE--------------------------------------------------
Q8TVD3_METKA/146-270-------------------------VT-FT--------------------------------------------------
A0YUQ2_LYNSP/96-214-------------------------LK-FS--------------------------------------------------
A3MVN5_PYRCJ/123-252-------------------------LE-FL--------------------------------------------------
Q97YE5_SULSO/103-228-------------------------IH-FK--------------------------------------------------
Q2FM73_METHJ/142-275-------------------------MD-FI--------------------------------------------------
Q8ZZM1_PYRAE/124-249-------------------------VE-FL--------------------------------------------------
A9AX64_HERA2/145-264-------------------------LW-FA--------------------------------------------------
A8ZV96_DESOH/179-301-------------------------LT-ME--------------------------------------------------

PF03787

Q1Q3H4_9BACT/4-335KLKTL--------------------SS.IH......IGGK................................EGNFLPME
Q8TPH7_METAC/4-317KIELL--------------------SP.LH......IGNG........NELKMVDFYLNEKKDEIRFIDFEKFIDYCIEK
O57906_PYRHO/18-333MFEVL--------------------TP.LH......IGNG..........NELTPVDFYPLGDRIIVLDTEKLINDLLRL
B3EIY8_CHLPB/11-320SLTTL--------------------SP.VF......IGAG.............................AEHVLSPYSDF
A6LNL6_THEM4/4-297EVEVL--------------------TP.LA......INNG..........NEIKSFEIIREGGKSYILDFNKLFENENFV
A4XFP8_CALS8/12-334EVEIL--------------------TP.TV......IGGQ..........DKIQSFEFVRDGAYLYFINFDRLLEENLFK
Q3AA80_CARHZ/5-311EIEVL--------------------SP.LF......VGSG...........................QKYPPLEYLISLE
A7HMV5_FERNB/4-324RIEPV--------------------SP.VY......IGSG.................................EKIGKFE
A2VLF2_MYCTU/11-314TLRCL--------------------GP.VF......IGSG...............EKRTSKEYHVEGDRVYFPDMELLYA
Q0AW54_SYNWW/12-313TLRAL--------------------AP.VF......IGSG...................EQLGKKEYIFDSPNALIYFPD
Q5HK93_STAEQ/9-268VIKTL--------------------GP.IH......IGSG........QVMKKQDYIYDFYNSKVYMINGNKLVKFLKRK
Q03KS9_STRTD/11-288SLLTL--------------------AP.IH......IGNG..........EKYTSREFIYENKKFYFPDMGKFYNKMVEK
A2BKQ7_HYPBU/87-311TAKTK--------------------SK.LI......VGAS........................................
Q2LQX1_SYNAS/103-281TLD..--------------------SP.LI......TGIG........................................
Q7MTH6_PORGI/59-251ELKTC--------------------YPGLL......CGVG........................................
A7FVL1_CLOB1/73-293YFKTT--------------------YPGLI......VGTG........................................
Q8TVU2_METKA/491-691RFP.H--------------------SR.LV......VGMG........................................
A1WUQ4_HALHL/82-287PATST--------------------SP.FT......TGLG........................................
A9AWU2_HERA2/90-292KAEVK--------------------GR.MV......VGLG........................................
Q1CW33_MYXXD/74-261TARAE--------------------SR.LL......VGHG........................................
Q977D5_SULTO/23-210EMEVV--------------------SDYLH......VGSG........................................
A8A9P3_IGNH4/77-241ALKTE--------------------GL.VG......IGFG........................................
A1RZR1_THEPD/18-247AFEAR--------------------GP.LH......VGGR........................................
Q2RV95_RHORT/11-210KVTAL--------------------SP.LH......VGTG........................................
Q4J793_SULAC/8-222VFKTP--------------------NG.LR......VGGE........................................
A4YFX5_METS5/9-241RLEE.--------------------...VR......IGTT........................................
Q4J7N6_SULAC/8-291LIKTM--------------------SI.TR......IGST........................................
A8F3D7_THELT/30-277EVAGG--------------------SF.LH......IGAA........................................
A4FJY4_SACEN/194-372DLSIV--------------------DA.IH......CGTE........................................
A4YFW9_METS5/24-229YLTNL--------------------TP.LR......IGSG........................................
Q2RY06_RHORT/19-223ELTTR--------------------TP.LH......MGSG........................................
Q2RV95_RHORT/253-439GLTCE--------------------GPFAV......LDGS........................................
Q5LZX3_STRT1/11-194QIRLE--------------------TG.LH......IGGS........................................
A5UWG2_ROSS1/10-302LLMTL--------------------DP.VH......IGAG........................................
Q2JNS6_SYNJB/14-218TLKPD--------------------GP.VL......IKAG........................................
B9LIP8_CHLSY/265-444QFVVD--------------------GS.IL......IRAG........................................
A7NFU0_ROSCS/21-222DLLAL--------------------TA.LR......IGAG........................................
O66706_AQUAE/7-289FIKAI--------------------TP.LH......IGTG........................................
A6LNK3_THEM4/7-272FLYAV--------------------TQ.IH......AGKG........................................
A6UNE9_METVS/9-264IIEAI--------------------TN.MH......VGSG........................................
Q2FL77_METHJ/279-403IVTCI--------------------TDFSM......KGLD........................................
A1WUQ2_HALHL/9-296FLYSV--------------------SP.VH......MGAG........................................
Q8TVT9_METKA/8-335FLVCR--------------------TP.TR......AGAG........................................
Q47PK3_THEFY/7-290YLYAE--------------------SP.LH......AGAA........................................
Q2JRT2_SYNJA/7-252YLTLL--------------------TP.LH......TGGT........................................
A0YUX6_LYNSP/8-262IIETL--------------------AP.LH......VGAT........................................
A0YQJ5_LYNSP/5-273WLICC--------------------EP.VH......IGGA........................................
A8A9P1_IGNH4/9-272LMSAL--------------------TH.VH......VGAG........................................
Q97WX4_SULSO/14-302FIKAV--------------------TH.LH......VSSG........................................
Q97XK7_SULSO/7-290LAYAI--------------------TN.LH......PGAG........................................
A3MVP2_PYRCJ/10-303SLTSL--------------------HP..........GVG........................................
Q2JNS1_SYNJB/20-216RATLA--------------------SA.LA......VGAG........................................
A5UT82_ROSS1/9-185RFPLA--------------------TS.FH......TTGN........................................
Q2FL76_METHJ/14-206DIVTK--------------------SD.LH......IGGH........................................
B8G728_CHLAD/8-184EIEFK--------------------SD.YH......IGAG........................................
Q6ZED2_SYNY3/7-200TITMQ--------------------SD.WH......VGTG........................................
B0K2G5_THEPX/4-192KIDLL--------------------SY.TL......IGSG........................................
A9AUN2_HERA2/7-194KITLL--------------------SD.TT......FGTG........................................
Q7MC47_VIBVY/7-190TIDIH--------------------SE.WH......VGSG........................................
A3DH28_CLOTH/14-216DMHTE--------------------SP.LF......IKSS........................................
A4YFX0_METS5/20-218VLRAD--------------------SP.VL......VSTG........................................
Q2JRT5_SYNJA/129-478TFQVT--------------------CP.WR......IRVG........................................
Q2FL77_METHJ/16-208TIELK--------------------TP.MR......IGGG........................................
A4TG45_MYCGI/12-250DIVAL--------------------SSIVHREDYSSVGTD........................................
A4XGU1_CALS8/51-316DIETK--------------------TP.IF......IRGE........................................
Q0ATZ2_SYNWW/170-634NIEAL--------------------TP.LY......IRDA........................................
B0K8W5_THEP3/133-594FLTTK--------------------TP.IY......IRRD........................................
A3DH27_CLOTH/31-251RVKTL--------------------TP.VH......IPSG........................................
A3DKC8_CLOTH/235-405KGKTV--------------------TP.LL......VKDE........................................
Q6ZED5_SYNY3/156-674KLTTV--------------------TP.LL......IPDA........................................
Q82XX3_NITEU/10-223VVSTL--------------------SP.VH......IGCG.......EDYEPTEYVVDTSGVLHRFNAGILPDLSDAGIS
A3DH32_CLOTH/9-175KINLM--------------------TP.FN......ISSG........................................
A6NTP4_9FIRM/14-168CAACQ--------------------SP.IR......TGGT........................................
Q7MC49_VIBVY/10-189VIETV--------------------SP.LA......ITSG........................................
A0RRG9_CAMFF/11-179TLEAL--------------------TP.LK......VGSQ........................................
A3DKC8_CLOTH/16-186KATTI--------------------SP.LA......IRDD........................................
A0YPM8_LYNSP/30-210TLILN--------------------TP.TC......LGSG........................................
D2C6C1_THENR/8-159KILAK--------------------TP.IW......TGNI........................................
Q8PRT5_METMA/8-181VIETL--------------------TP.IW......TGGV........................................
O26428_METTH/15-144ELQIL--------------------NE.IF......TGGP........................................
A7NRR3_ROSCS/6-141KLEAH--------------------TD.IW......TGDA........................................
C9RCS1_AMMDK/9-145HLKAL--------------------TD.IW......TGDV........................................
C9RCG8_AMMDK/9-178ELKTL--------------------TP.VW......TGNV........................................
A5UWG6_ROSS1/4-173QITTL--------------------TP.LW......TGGV........................................
A7NRS6_ROSCS/4-175TISTL--------------------TP.LW......TGGV........................................
A5D4F7_PELTS/4-177EVKTL--------------------TP.LW......TGGA........................................
B3EIR8_CHLL2/6-173ELRTL--------------------TP.IW......TGGV........................................
B4S552_PROA2/12-192TLSTL--------------------TP.LW......TGGP........................................
A6DAG1_9PROT/9-198TFETV--------------------TP.LW......TGDI........................................
C7P6D1_METFA/9-230KFETL--------------------TP.LW......NGNA........................................
B7IGV5_THEAB/8-173KFKTL--------------------SP.LW......TGNY........................................
D3T315_THEIA/9-219HLETI--------------------TP.LW......TGDA........................................
O28411_ARCFU/9-154TLEAI--------------------TP.VF......MRGA........................................
Q8U3V3_PYRFU/7-178DLEAI--------------------TP.LF......MRGA........................................
D3T7Q1_THEIA/22-173KCEVI--------------------TP.VF......MAGA........................................
B0M908_9FIRM/9-142KLELI--------------------TA.MG......THGA........................................
C5D4N4_GEOSW/18-161KLKLI--------------------TP.MA......MHGA........................................
Q53W07_THET8/34-193TYTLL--------------------TP.LF......GGGV........................................
A9AWU5_HERA2/41-244SYRLI--------------------TP.LF......GGGV........................................
D2ZTS9_NEIMU/25-187YCELV--------------------TP.LH......GGGV........................................
D0W1J3_NEICI/30-211HCELI--------------------TP.IY......GGGI........................................
E6XI85_SHEP2/30-186HCTLV--------------------TP.MY......GGGV........................................
D1Y2F0_9BACT/26-187ACSVI--------------------TP.MF......GGGA........................................
Q1IZR9_DEIGD/24-191QLRTI--------------------TP.MF......GGSA........................................
D3PS14_MEIRD/23-188RLRTI--------------------TP.LF......GSSA........................................
D2Z4K2_9BACT/26-193RISVV--------------------TP.MF......GGGV........................................
C5BIW8_TERTT/31-214NIQVV--------------------TP.MF......GGGV........................................
Q9KFY9_BACHD/34-207NISII--------------------TH.MF......GGGT........................................
C8WRP6_ALIAD/23-238RVTTL--------------------TP.VI......GAGV........................................
Q1CW28_MYXXD/33-206ALKTF--------------------TP.IL......GGGP........................................
D3SNA7_THEAH/10-153TLEFV--------------------TP.AF......IGGA........................................
Q2LQW6_SYNAS/16-162KFEVV--------------------TP.LF......LGGA........................................
B6IX20_RHOCS/283-454TLDLV--------------------SP.AF......FAGA........................................
A8DJU4_9BACT/304-514ELKLT--------------------SP.AF......LAGA........................................
C8W3E8_DESAS/7-167VYQVV--------------------TP.LF......MGGA........................................
C0A713_9BACT/8-185TFRVT--------------------TP.MF......LGGA........................................
B8GSG8_THISH/11-176SYQIV--------------------TP.MF......LGDG........................................
B7R675_9THEO/7-162KLQIV--------------------TP.II......MGGA........................................
O66703_AQUAE/10-154TFEII--------------------TP.VV......MAGT........................................
Q47PK0_THEFY/7-173RLRVT--------------------TP.LF......NGHD........................................
A6LNK0_THEM4/7-158TINFT--------------------TP.SF......ASNN........................................
B7IFF0_THEAB/10-183NIEFI--------------------SP.LI......NRRG........................................
A8UTQ9_9AQUI/7-200EIEFI--------------------TP.AF......IGGA........................................
B2V8M0_SULSY/7-150KVEII--------------------TP.TI......MGGA........................................
A8V361_9AQUI/9-167LIKVI--------------------TP.TI......MGGG........................................
A8M9C0_CALMQ/7-192TLRLV--------------------TP.LF......TGSA........................................
Q96Z54_SULTO/9-305EAKAL--------------------YP.IV......GGYN........................................
Q97WX2_SULSO/9-255KLKAI--------------------YP.LT......GGYN........................................
D2PID8_SULID/27-180KFKGV--------------------TP.WW......GGDY........................................
Q97Y38_SULSO/24-174NFVGV--------------------TP.WW......GRDH........................................
C4KFX7_SULIK/27-177KFKGV--------------------TP.WW......GGDY........................................
Q8TPH8_METAC/9-242KLDFT--------------------SP.LH......IGEV........................................
A6UVY5_META3/7-263LIPKE--------------------NSKYH......FGEG........................................
A1KMG2_MYCBP/9-193DFDR.--------------------...TH......FGDH........................................
Q5HK92_STAEQ/9-199KLSFK--------------------TP.VH......FGKK........................................
Q9X2C8_THEMA/9-196KMSFR--------------------SG.FR......VGRG........................................
A3DLB2_STAMF/6-246KLHFT--------------------TP.VH......VGER........................................
B8GB50_CHLAD/99-293NFELL--------------------TP.WY......SKDD........................................
A1ZVA0_9BACT/4-254TLKTL--------------------TP.LH......IGNGEELSALDYVLHQRTYYRVSQYQFLEFIKNDEALVEAYAKW
A5ILN4_THEP1/4-318TLKTL--------------------TP.LH......IGSG.....EKYPPCNLVVLKEEDNKKTAVRLNTRKFLEVLRKR
Q46CS3_METBF/9-174SLRLL--------------------SP.VH......IGWK........................................
A6DAF6_9PROT/10-162TFKQI--------------------EP.IN......IGQG........................................
Q2FL73_METHJ/7-220TITSV--------------------SP.LH......FGNG........................................
A0ZJ98_NODSP/7-256TITAL--------------------SP.LA......IATR........................................
A4XGT8_CALS8/240-441TVKTL--------------------SP.VV......IAQP........................................
A9AUN3_HERA2/7-220TITTE--------------------QP.LL......ITSL........................................
A3DKC7_CLOTH/8-205DIQAL--------------------EP.LK......LGKF........................................
Q8TVR9_METKA/10-323RLEVL--------------------TP.LH......VGVP........................................
Q8TVU2_METKA/6-335WALTV--------------------TP.TR......VGTG........................................
Q6L316_PICTO/4-317EINVK--------------------SP.LL......ISSS...DYLNLSEVLRNGNEIYMLDINKLIYENKNMINKLKKI
Q97CJ4_THEVO/4-334QLKVS--------------------SP.VL......IGND....YVNVTNMIINKDSLYMLDMDKLIDNEPKIDQLAEYF
Y1667_METJA/49-345KCELI--------------------TP.IF......IGCGEEYSQLDYFIEDGLAHIIDLEKAVSDLDDLEKVDYISGLI
A6DE72_9PROT/4-332KFEVI--------------------TP.IF......SGSG.................................EDYYPNE
O27150_METTH/4-274TLEVI--------------------TP.VH......IGNG................................TTYGPQEF

PF08798

C1NCW0_9ESCH/1-198MYLSK--------------------VIIAR------AW..----------------------------------------
Q1GAI3_LACDA/1-205MYLSR--------------------VEIDT------DNRQ----------------------------------------
Q1EQT0_STRKN/3-219IWLTR--------------------IVPDL------RSRD----------------------------------------
Q8X7W1_ECO57/1-212MYLSR--------------------ITLHT------GQLS----------------------------------------
A4XYT8_PSEMY/1-203MYLTR--------------------LTLDP------RSAQ----------------------------------------
Q67RN9_SYMTH/1-223MYLSL--------------------LRLNP------ASAA----------------------------------------
Q8KB24_CHLTE/1-202MIATM--------------------LTLSR------KDVK----------------------------------------
A5UR13_ROSS1/1-237MYLSR--------------------LILDV------RQPR----------------------------------------
Q1J366_DEIGD/4-210LYLSR--------------------LRFED------RDRR----------------------------------------
Q5PEG8_SALPA/1-232MYLSR--------------------IQLRF------NNLR----------------------------------------
A5FTJ9_ACICJ/1-224MWLSK--------------------ARLNH------DQKA----------------------------------------
A1SV70_PSYIN/1-178MYLSQ--------------------VMLN.------....----------------------------------------
Q2RXJ4_RHORT/4-241LYLIS--------------------LPLDM------VSFH----------------------------------------
B3ENH7_CHLPB/1-201MIASI--------------------LRLGP------KEIK----------------------------------------
Q2JWC6_SYNJA/1-204MYLSR--------------------LILNE------RQLL----------------------------------------
CSE3_THET8/1-211MWLTK--------------------LVLNP------ASRA----------------------------------------
A3LCN7_PSEAI/1-202MYLTR--------------------LTLDP------RSAQ----------------------------------------
Q57KI5_SALCH/1-212MYLSR--------------------ITLHT------SELS----------------------------------------
Q0W583_UNCMA/1-248MYLSR--------------------LILNP------RTRA----------------------------------------
A0LM55_SYNFM/1-201MYLSL--------------------LSLDR------LHRG----------------------------------------
Q60AD3_METCA/5-237LYMIE--------------------LRPDP------AALI----------------------------------------
Q1JX12_DESAC/1-200MYLSK--------------------IMIKG------AA..----------------------------------------
A1ARH5_PELPD/1-222MFLSR--------------------LRLNL------RCRE----------------------------------------
Q6LWA0_PHOPR/2-180MYISM--------------------VALS.------....----------------------------------------
C1DSI0_AZOVD/1-204MYLTR--------------------LTLDP------RSAQ----------------------------------------
Q1EQJ3_STRKN/1-237MFLTR--------------------FRVNT------ARPA----------------------------------------
Q2JH26_FRASC/2-267TYLSR--------------------IWLNP------LRTG----------------------------------------
Q03C59_LACC3/1-212MYLSR--------------------VQVNT------NDHQ----------------------------------------
Q3ZZ80_DEHSC/1-206MYLSL--------------------LRLNP------RSKR----------------------------------------
A7MFK9_CROS8/1-212MYLSK--------------------ITLPT------ARLT----------------------------------------
Q5YRB7_NOCFA/1-222MFLSR--------------------VPLNP------ARQG----------------------------------------
Q7N8H4_PHOLL/1-223MYLSK--------------------IVLRQ------SSQT----------------------------------------
Q0BRF7_GRABC/2-239LHLIH--------------------LPIEA------RSFA----------------------------------------
A6W167_MARMS/1-223MYLSK--------------------VSFQA------SQQA----------------------------------------
A8M405_SALAI/1-222MYLTR--------------------FLVNP------ARRG----------------------------------------
A3EQA3_9BACT/1-214MFLHR--------------------LHLDP------RSRE----------------------------------------
Q1ZM76_PHOAS/1-219MYLSK--------------------ITLAP------SATL----------------------------------------
Q314I5_DESDG/1-218MWMSK--------------------LVLDP------RRAV----------------------------------------
A0AE92_STRAM/1-253MFLSR--------------------FRVNT------ARPG----------------------------------------
A8LYZ8_SALAI/3-204AWLTR--------------------IALDL------RHSA----------------------------------------
Q825C0_STRAW/3-217VWLTR--------------------IVPDP------RSRD----------------------------------------
Q47PJ5_THEFY/2-225TWLTK--------------------IVPDL------RYRQ----------------------------------------
F2GBG6_ALTMD/1-221MFLSK--------------------VTMVS------SPQT----------------------------------------
Q74DC7_GEOSL/1-201MYLSK--------------------VLING------TA..----------------------------------------
Q0RTG6_FRAAA/28-266TYLSR--------------------VWLNP------LRTG----------------------------------------
A7BA62_9ACTO/1-248MYLTR--------------------IYLNP------HRRG----------------------------------------
Q1R113_CHRSD/1-229MYLSS--------------------VRVDL------NALT----------------------------------------
Q6NEQ5_CORDI/5-227IHLVK--------------------LPVHI------ALSV----------------------------------------
Q2FNT6_METHJ/1-225MFFSK--------------------MTLDR------EAAI----------------------------------------
A5F3T0_VIBC3/4-208LFASA--------------------LHLDR------RAVK----------------------------------------

PF09559

Q1CW34_MYXXD/4-194---LD--------------------LLYPV------RGGP----------------------------------------
Q1CW45_MYXXD/31-221---VD--------------------LLFPV------QGGP----------------------------------------
Q3M7D9_ANAVT/30-227---MD--------------------LTFSL------TGET----------------------------------------
Q8F1E7_LEPIN/7-205---IE--------------------LNFPV------LGSL----------------------------------------
A0YQL0_LYNSP/20-218---VN--------------------ARFDV------FGKV----------------------------------------
Q0A841_ALHEH/18-219---VD--------------------VTFRL------EGHS----------------------------------------
A1WYF2_HALHL/43-244---VD--------------------VAFPL------RGRV----------------------------------------
A1AWQ7_RUTMC/19-218---QD--------------------AVFNI------FAKI----------------------------------------
Q4JN26_9BACT/18-217---AE--------------------LSFSV------NCRE----------------------------------------
Q3SG16_THIDA/19-212---ID--------------------LQFEL------AGST----------------------------------------

PF09700

Q746D9_THET2/1-351MLIEP--------------------RDP-L------IVRD----------------------------------------
A0B6W4_METTP/4-358LRITP--------------------VDS-W------FFRD----------------------------------------
O28413_ARCFU/3-341LVMKP--------------------YDS-L------LFRE----------------------------------------
A6LNK2_THEM4/6-323LYIKP--------------------IDV-I------GFRK----------------------------------------
A6VYS5_MARMS/4-381FVLNP--------------------LDP-L------IIRS----------------------------------------
Q47PK4_THEFY/13-381IAFEP--------------------HDT-V------HVRD----------------------------------------
A4BL65_9GAMM/5-384RFIEP--------------------LDV-L------YLRG----------------------------------------
Q9KFY7_BACHD/8-408IRIRP--------------------LDP-L------MVRD----------------------------------------
A6UNE8_METVS/6-362VKLTP--------------------IDR-Y------FFGG----------------------------------------
O66707_AQUAE/4-323YLFKP--------------------YDV-I------GFGG----------------------------------------
Q97WW9_SULSO/5-306VLIKP--------------------LEP-L------MFRS----------------------------------------
Q1CW30_MYXXD/6-386FALLP--------------------RDG-L------SAKD----------------------------------------
Q9X2B3_THEMA/6-327IYFEP--------------------EDW-V------GFRE----------------------------------------
A7C3N9_9GAMM/9-401WCFAP--------------------IDT-W------FFRE----------------------------------------
Q2JN53_SYNJB/4-377FTLSP--------------------LDV-W------MFRD----------------------------------------
A3IZR5_9CHRO/4-391YTLTP--------------------TDV-L------LLRD----------------------------------------
Q8U1S7_PYRFU/4-321VTFTP--------------------YDV-L------LFRE----------------------------------------
A9AWU6_HERA2/68-470WLIEP--------------------RDP-L------IVRD----------------------------------------
A1WUQ1_HALHL/5-362RYIEP--------------------QDV-L------FFRG----------------------------------------
C0A715_9BACT/6-379YTLTP--------------------QDA-W------FFRD----------------------------------------
A5D0Z3_PELTS/4-387WVIEP--------------------RDP-L------IARD----------------------------------------
A1ZP54_9BACT/3-366IKIDA--------------------LDT-L------FFRD----------------------------------------
Q8TVU0_METKA/10-439FLVLP--------------------QDR-A------FFRR----------------------------------------
Q2JRT1_SYNJA/4-372FTLSP--------------------LDV-W------MFRD----------------------------------------
Q6ZEA9_SYNY3/4-365YSLTP--------------------LDI-L------LLRD----------------------------------------
Q1IZS1_DEIGD/6-393LELQP--------------------LAP-L------LLRD----------------------------------------
A7GFA9_CLOBL/4-366LKIKP--------------------YDN-T------FFRL----------------------------------------
A8DJU1_9BACT/6-369LCLEA--------------------LDV-L------FFRD----------------------------------------
Q7MTH3_PORGI/6-391IKLTP--------------------LDK-F------FFGQ----------------------------------------
A9AVY8_HERA2/6-387WLIQP--------------------FNS-L------VIAD----------------------------------------
Q8R6Z6_THETN/4-372FKITP--------------------YDV-F------FFGS----------------------------------------
E6XI87_SHEP2/4-375YLIEP--------------------KDP-L------IIRS----------------------------------------
Q1AZD9_RUBXD/4-359YGIEA--------------------LDT-L------FFGD----------------------------------------

PF09704

Q2MF31_STRSD/16-248VLLLR--------------------LAG.P------LQSW----------------------------------------
Q7NYP8_CHRVO/13-224GIRIH--------------------VWG.A------RACF----------------------------------------
A1ARH6_PELPD/3-217TLLLR--------------------LVG.P------MQSW----------------------------------------
Q12YA8_METBU/4-236YLIFR--------------------LYG.P------MASW----------------------------------------
Q0BSC7_GRABC/6-215FLVFG--------------------LAA.S------LGSM----------------------------------------
A8ABL4_IGNH4/3-275GLFFE--------------------LEL..------..AW----------------------------------------
A6W168_MARMS/4-241YLVFR--------------------LYG.P------MASW----------------------------------------
O66696_AQUAE/3-211CLKAE--------------------FFS.P------IALF----------------------------------------
A8ZZ17_DESOH/3-251YLLFR--------------------LYG.P------MASW----------------------------------------
Q1EQJ4_STRKN/3-213VLALQ--------------------LAG.P------LQAW----------------------------------------
A5UR14_ROSS1/3-244TLFLR--------------------LEG.P------LQSW----------------------------------------
Q8Z465_SALTI/4-233YLVFQ--------------------LYA.P------LASW----------------------------------------
Q3A5Z4_PELCD/3-236HLVFR--------------------LYG.P------LAAW----------------------------------------
C1DSH9_AZOVD/3-205TLLLC--------------------LQG.P------MQSW----------------------------------------
Q5YRB6_NOCFA/3-211VLLLR--------------------LAA.P------LQSW----------------------------------------
Q1CWU1_MYXXD/10-210SFRVR--------------------ARG.P------VACF----------------------------------------
A3DLC5_STAMF/3-270AYKLR--------------------IEF..------..LW----------------------------------------
A4J385_DESRM/4-212GIRLL--------------------VWG.E------FACF----------------------------------------
Q65TW5_MANSM/4-216RIRLH--------------------IWG.D------YACF----------------------------------------
Q8KDC0_CHLTE/7-228TFCLE--------------------VKG.D------YACF----------------------------------------
Q5H4J6_XANOR/4-215GVRLH--------------------VWG.E------RALF----------------------------------------
Q9X2C0_THEMA/3-212VLVFD--------------------VSA.P------YALF----------------------------------------
Q03C60_LACC3/3-210TISIR--------------------LTS.P------LQSY----------------------------------------
Q8U334_PYRFU/3-239ILLVC--------------------LRF.P------FFSV----------------------------------------
Q47PI7_THEFY/3-209VLTLL--------------------LAG.P------LQAW----------------------------------------
O28407_ARCFU/3-252GYLVD--------------------VEF..------..VW----------------------------------------
Q2SID2_HAHCH/4-215GIRLL--------------------VWG.E------RACF----------------------------------------
CAS5_METJA/5-228ALVAL--------------------LRF.P------FYSF----------------------------------------
Q72NC2_LEPIC/11-225IFQLK--------------------VSG.E------NACF----------------------------------------
O27159_METTH/3-241TLAVE--------------------IFQ.P------FAQF----------------------------------------
B3E5U9_GEOLS/3-263YLLFR--------------------LYG.P------LASW----------------------------------------
Q04QB7_LEPBJ/4-240YLVFR--------------------LYG.P------LVSW----------------------------------------
Q60AD2_METCA/3-241ILLLR--------------------FDA.P------LMSF----------------------------------------
Q2RL62_MOOTA/18-224WLAVK--------------------VWG.D------LACF----------------------------------------
A5GBK2_GEOUR/12-223FLALR--------------------LEG.P------LQSW----------------------------------------
Q72WF9_DESVH/10-218GIRLR--------------------VWG.D------YACF----------------------------------------
Q0W584_UNCMA/6-214LLLLR--------------------LEG.P------MQSW----------------------------------------
Q1NKD4_9DELT/4-199RIDFK--------------------VTG.R------FALF----------------------------------------
A4YFV1_METS5/10-233KVWVR--------------------LHW..------....----------------------------------------
A8LYZ7_SALAI/3-226GLLLR--------------------LAG.P------MQSW----------------------------------------
CASD_ECOLI/4-214YLILR--------------------LAG.P------MQAW----------------------------------------
Q0AZP3_SYNWW/4-212GVKLK--------------------VWG.D------FACF----------------------------------------
Q1R114_CHRSD/4-250HLVFR--------------------LYA.P------MASW----------------------------------------
CAS5C_SULSO/5-232KVFLK--------------------LHW..------....----------------------------------------
Q2RW65_RHORT/4-212GIKLL--------------------VSG.D------HACF----------------------------------------
Q5P3Y6_AROAE/8-203SIEFK--------------------VWG.R------HALF----------------------------------------
Q314I4_DESDG/4-228YLTFQ--------------------IYG.P------LQAY----------------------------------------
A1SV73_PSYIN/3-198TLILK--------------------TEG..------MSAY----------------------------------------
Q1EQS9_STRKN/13-242GLLLR--------------------LSG.P------LQSW----------------------------------------
Q3YYA5_SHISS/4-233YLIFQ--------------------LHG.P------MASW----------------------------------------
A6TNS2_ALKMQ/6-209SVEFK--------------------VSG.R------YALF----------------------------------------
B4SAU9_PELPB/4-206GIKLR--------------------VWG.D------YALF----------------------------------------
Q1H3R5_METFK/4-216GVRLH--------------------VWG.D------YACF----------------------------------------
Q67RP0_SYMTH/3-220TLLLR--------------------LAG.P------MQSW----------------------------------------
Q2JWC5_SYNJA/3-192TLLMR--------------------LRA.P------MMSW----------------------------------------
B1YHA3_EXIS2/4-198TIEFK--------------------VYG.E------YALF----------------------------------------
Q4JWK0_CORJK/4-209TLLLR--------------------LSG.P------MQSW----------------------------------------
Q7N8H5_PHOLL/4-236YLVFR--------------------LYG.P------MASW----------------------------------------
Q60B28_METCA/3-213DICLK--------------------VFG.D------YACF----------------------------------------
Q2LX12_SYNAS/8-216TIEFK--------------------LWG.R------FALF----------------------------------------
B8I205_CLOCE/4-212GIKLE--------------------VWG.E------YALF----------------------------------------
Q2RXJ5_RHORT/6-238WLIVH--------------------LEA.P------LLAF----------------------------------------
C1DNX2_AZOVD/4-215GIRLL--------------------VWG.E------RACF----------------------------------------
Q0AA33_ALHEH/3-231CLILR--------------------LDA.P------LMSF----------------------------------------
Q3ZZ79_DEHSC/6-199TLLMR--------------------LEG.P------MQSW----------------------------------------
Q47PJ4_THEFY/3-220GFLLR--------------------LAG.P------MQSW----------------------------------------
Q6NEQ9_CORDI/4-220SAYIR--------------------LSG.P------LQSW----------------------------------------
Q1JX11_DESAC/4-219FLILK--------------------LQG.P------MQAW----------------------------------------
Q746C2_THET2/3-211RLKVK--------------------VWG.E------YACF----------------------------------------
Q0RTG7_FRAAA/8-241CLVLR--------------------LAG.P------VQSW----------------------------------------
Q39WR9_GEOMG/10-218MLRLK--------------------VWG.D------NACF----------------------------------------
Q977B3_SULTO/4-249VLIY.--------------------....G------LHHW----------------------------------------
Q0BRF8_GRABC/3-224WLVLQ--------------------WRA.P------LASF----------------------------------------
CAS5B_SULSO/4-251VVIF.--------------------....G------IHHW----------------------------------------
Q8ZZL1_PYRAE/3-217ILLVK--------------------LRL.P------LFSI----------------------------------------
Q3ARV4_CHLCH/4-200SIEFK--------------------VYG.R------EAMF----------------------------------------
Q1J367_DEIGD/3-208TLLLR--------------------LVA.P------MQAW----------------------------------------
Q9KFY3_BACHD/4-199EVQFE--------------------LFG.D------YALF----------------------------------------
A5V1B9_ROSS1/6-202SVTFK--------------------VWG.R------YALF----------------------------------------
Q04AW9_LACDB/3-211TLTIK--------------------LTA.P------LQAY----------------------------------------
O57910_PYRHO/4-218LLGLI--------------------VDARP------LQAH----------------------------------------
Q184H2_CLOD6/3-221VLKLD--------------------LFQ.E------TACY----------------------------------------
A2BKI9_HYPBU/5-261MLVSK--------------------VEL..------..AW----------------------------------------
A1A2N3_BIFAA/7-207SIEYE--------------------VWG.R------YALF----------------------------------------
Q9YCM4_AERPE/7-241VVVAE--------------------LAT.P------AFSV----------------------------------------
Q6LWA3_PHOPR/12-207TLILK--------------------TEG..------LSAY----------------------------------------
A0AE91_STRAM/6-214VLVLR--------------------LAG.P------LQSW----------------------------------------
Q74DC8_GEOSL/4-217YLILK--------------------LQG.P------MQSW----------------------------------------
Q8KB22_CHLTE/5-230FILLW--------------------LEA.P------LQSW----------------------------------------
Q1JAP7_STRPB/6-202DFYVR--------------------VSG.Q------RALF----------------------------------------
Q2J7P3_FRASC/14-209PVAVQ--------------------VWA.E------GALF----------------------------------------
Q5JGB2_PYRKO/7-237FLKVQ--------------------LRPTG------IIAL----------------------------------------
B3ENH9_CHLPB/5-225FLLLW--------------------LEA.P------LQSW----------------------------------------
Q96X68_SULTO/5-233KVFLK--------------------LHW..------....----------------------------------------
Q53WH0_THET8/3-225TLLIR--------------------LQG.P------LQSW----------------------------------------
A5D0R8_PELTS/6-219DVKVK--------------------VWG.E------YACF----------------------------------------
Q2RY19_RHORT/6-247FLVFR--------------------LVG.P------MAAW----------------------------------------
A0LDG2_MAGSM/7-202DLEFL--------------------LTA.R------YALF----------------------------------------
Q3SR91_NITWN/4-221GIRLK--------------------VWG.D------YACF----------------------------------------
Q1ZM77_PHOAS/4-242YLVFR--------------------LYG.A------MASW----------------------------------------
Q9UZX1_PYRAB/18-248FLKVE--------------------ASPSG------IIAL----------------------------------------
A4SFQ4_PROVI/7-227TFCLE--------------------VEG.D------YACF----------------------------------------

PF01881

A3I0J5_9BACT/85-250--------------------------------------------------------------..EIEIEPVL.ETSNKFV
B4SEV7_PELPB/102-262--------------------------------------------------------------..RKLDQPEL.SDDMEFV
A9BGZ0_PETMO/94-248--------------------------------------------------------------..EYDDLEIK.SDKIKVK
B4S5I3_PROA2/102-261--------------------------------------------------------------..KKLDPPQL.SDDMACI
A9BIX0_PETMO/95-244--------------------------------------------------------------..EVIQNEV..DEEMLVK
B8FSG8_DESHD/95-244--------------------------------------------------------------..SAGQYKVR.ENKVMVR
A5D0Y7_PELTS/95-244--------------------------------------------------------------..RFDEQVAD.GEVLTVR
O30164_ARCFU/94-241--------------------------------------------------------------..SVLPEREV.KGREKFV
CAS6_PYRHO/96-239--------------------------------------------------------------..KTLKEPKK.FSGSTFI
A7HMV7_FERNB/94-242--------------------------------------------------------------..EIFEFPQ..TQKIVVS
Q5JGA0_PYRKO/94-241--------------------------------------------------------------..KALAEPER.LSGKKFV
A1BI29_CHLPD/102-262--------------------------------------------------------------..RRLDCPEI.SGDMRFI
A5ILP0_THEP1/93-246--------------------------------------------------------------..DIENSLPD.QSEYHFV
A4XIJ2_CALS8/97-249--------------------------------------------------------------..NMLRKPKF.SSFHKIK
CAS6L_PYRFU/91-238--------------------------------------------------------------..KALKSKEI.KNVNIFS
CAS6_PYRFU/95-238--------------------------------------------------------------..KVLREPKK.FNGSTFV
O66704_AQUAE/85-236--------------------------------------------------------------..RPEKEREI...IGFFK
Q97CI9_THEVO/80-232--------------------------------------------------------------.....KEFDI.NISKDFI
Q6L312_PICTO/82-235--------------------------------------------------------------.....KKFDV.NISKSFI
Y1234_METJA/81-240--------------------------------------------------------------.....KKFDL.KVKNKFI
Q6L114_PICTO/79-219--------------------------------------------------------------..KMENNNCF.FDTVNMI
A5TU40_FUSNP/91-242--------------------------------------------------------------..RIIEEKIIRGEEAVFQ
Q3AA81_CARHZ/95-248--------------------------------------------------------------..FIRENPEI.KPGQTFV
Q1AZD0_RUBXD/93-249--------------------------------------------------------------GVEPEPEVED.GRPLLVR
Q6L357_PICTO/89-232--------------------------------------------------------------..KDTKRVDF.SSDIYFK
Y375_METJA/95-240--------------------------------------------------------------..KILPIP...KKFNILK
Q4EVR3_LISMN/89-240--------------------------------------------------------------..QIVPEKKIIGKRTILR
Q2NFS1_METST/92-244--------------------------------------------------------------..KEIKDPKI.HKKEEIN
O27163_METTH/1-154--------------------------------------------------------------..EFLEPPEF.RRNMKFR
A7GQ92_BACCN/87-233--------------------------------------------------------------..QMVNSADINQNHVYFK
O57900_PYRHO/78-237--------------------------------------------------------------.....KKFKL.KLKRAFQ
A4J1X6_DESRM/95-249--------------------------------------------------------------KLAVTPPFNQ.DQSYPVK
Q46FQ7_METBF/89-241--------------------------------------------------------------..EVLPLIHF.SDTCTFR
A5UJJ7_METS3/89-241--------------------------------------------------------------..EALKTPEF.SSKSEFK
Q5JHS4_PYRKO/92-239--------------------------------------------------------------..KVLKEPEL.KGPVLFS
Q332K8_CBCP/101-247--------------------------------------------------------------..KNDRRVKF.NKINIYK
O66560_AQUAE/87-244--------------------------------------------------------------..LMCEEEQITKPRQTFR
A1ZVQ2_9BACT/100-263--------------------------------------------------------------..EMLPTVAF.GEMMRFS
CAS6L_PYRHO/91-238--------------------------------------------------------------..KAIKVKEL.GKENVFS
Q184H4_CLOD6/91-242--------------------------------------------------------------..DLSREKKVTEERVLFN
A4XM43_CALS8/98-260--------------------------------------------------------------..YLIKEPEQFSSTMTFK
A1ZPF3_9BACT/98-260--------------------------------------------------------------..EPLPLRMP.STTVSFK
A8F3P6_THELT/92-245--------------------------------------------------------------..RVLDEPKI.TDQMKFI
Q8TJV5_METAC/89-241--------------------------------------------------------------..EVLPAVHF.SDMCTFR
Q12WX9_METBU/89-240--------------------------------------------------------------..EIMPNLEI.SESCKFT
A6DAF5_9PROT/81-224--------------------------------------------------------------...........REYKNFI

PF10040

A1RZS7_THEPD/144-263--------------------------------------------------------------------------------
A4J507_DESRM/140-259--------------------------------------------------------------------------------
Q3M5G3_ANAVT/172-285--------------------------------------------------------------------------------
A0ZJZ0_NODSP/168-289--------------------------------------------------------------------------------
CAS6A_SULSO/138-277--------------------------------------------------------------------------------
Q2JNR9_SYNJB/173-292--------------------------------------------------------------------------------
A8ABE5_IGNH4/136-254--------------------------------------------------------------------------------
Q7TXS3_MYCBO/184-300--------------------------------------------------------------------------------
Q6ZED0_SYNY3/149-272--------------------------------------------------------------------------------
A0ZJ83_NODSP/132-250--------------------------------------------------------------------------------
A1HND4_9FIRM/191-314--------------------------------------------------------------------------------
Q03KT3_STRTD/120-237--------------------------------------------------------------------------------
B8G917_CHLAD/148-265--------------------------------------------------------------------------------
Q977A9_SULTO/131-247--------------------------------------------------------------------------------
Q72GC1_THET2/120-235--------------------------------------------------------------------------------
A3MST1_PYRCJ/120-246--------------------------------------------------------------------------------
Q2FR84_METHJ/135-257--------------------------------------------------------------------------------
A3CNA0_STRSV/121-238--------------------------------------------------------------------------------
A7NKQ1_ROSCS/148-265--------------------------------------------------------------------------------
A1HM59_9FIRM/128-245--------------------------------------------------------------------------------
Q9YCN0_AERPE/126-238--------------------------------------------------------------------------------
Q745V3_THET2/136-262--------------------------------------------------------------------------------
B3EIY9_CHLPB/190-323--------------------------------------------------------------------------------
Q8ZZK8_PYRAE/121-246--------------------------------------------------------------------------------
A0YW92_LYNSP/157-270--------------------------------------------------------------------------------
A3DLD1_STAMF/165-291--------------------------------------------------------------------------------
Q74DY6_GEOSL/182-301--------------------------------------------------------------------------------
A1RZX7_THEPD/116-252--------------------------------------------------------------------------------
B4S549_PROA2/190-323--------------------------------------------------------------------------------
Q4J7R1_SULAC/134-279--------------------------------------------------------------------------------
Q1Q3G5_9BACT/191-313--------------------------------------------------------------------------------
A8M9A8_CALMQ/139-276--------------------------------------------------------------------------------
A1RQV9_PYRIL/103-214--------------------------------------------------------------------------------
Q5HK95_STAEQ/125-242--------------------------------------------------------------------------------
A6NTQ0_9FIRM/121-240--------------------------------------------------------------------------------
A8AA66_IGNH4/119-232--------------------------------------------------------------------------------
Q01QC2_SOLUE/166-288--------------------------------------------------------------------------------
Q4J7D4_SULAC/139-264--------------------------------------------------------------------------------
Q8ZZU6_PYRAE/127-238--------------------------------------------------------------------------------
A2BMX9_HYPBU/151-264--------------------------------------------------------------------------------
Q6ZEI4_SYNY3/146-257--------------------------------------------------------------------------------
A6DE70_9PROT/157-271--------------------------------------------------------------------------------
A9AZH6_HERA2/148-265--------------------------------------------------------------------------------
A0LHY9_SYNFM/189-312--------------------------------------------------------------------------------
Q4J7P9_SULAC/157-283--------------------------------------------------------------------------------
Q0AW55_SYNWW/127-244--------------------------------------------------------------------------------
Q3IQ75_NATPD/155-285--------------------------------------------------------------------------------
A0B9F8_METTP/179-310--------------------------------------------------------------------------------
Q39T05_GEOMG/185-303--------------------------------------------------------------------------------
A4YFW1_METS5/128-262--------------------------------------------------------------------------------
B9LJK3_CHLSY/148-265--------------------------------------------------------------------------------
A4YFU6_METS5/153-294--------------------------------------------------------------------------------
Y1859_ARCFU/176-286--------------------------------------------------------------------------------
A0YIK9_LYNSP/157-279--------------------------------------------------------------------------------
A1BI47_CHLPD/189-322--------------------------------------------------------------------------------
Q8TVD3_METKA/146-270--------------------------------------------------------------------------------
A0YUQ2_LYNSP/96-214--------------------------------------------------------------------------------
A3MVN5_PYRCJ/123-252--------------------------------------------------------------------------------
Q97YE5_SULSO/103-228--------------------------------------------------------------------------------
Q2FM73_METHJ/142-275--------------------------------------------------------------------------------
Q8ZZM1_PYRAE/124-249--------------------------------------------------------------------------------
A9AX64_HERA2/145-264--------------------------------------------------------------------------------
A8ZV96_DESOH/179-301--------------------------------------------------------------------------------

PF03787

Q1Q3H4_9BACT/4-335YLIFRNKCYFINEDKLSKELYDRQLLDNFLTGIKQKGKDFSVDAFLKEKKLLTQEFLDKTSSYSSHCNINIQGNIRSCIR
Q8TPH7_METAC/4-317RINLNQEMKNPRYYTGSDFSISKFMDAKQIDPNTFTSYAV......................SAIIGKRNRESEFAIKEF
O57906_PYRHO/18-333GVEVEELLDFLRNPPGSLYLWRGYLEKLHLDPRNYARYS.......................LRIRGELGRESSRIKEFI
B3EIY8_CHLPB/11-320VQRGDSLIYIDTDRLQDAMQGDKALIEAFVKGMRHIENNRLTFVLEKFITGTLGREVDDFAARVVRIDGDIQKNHIRRFI
A6LNL6_THEM4/4-297ELVVNSPQILSDEDSLKKAFKFLKLDYKKYT...............................KMVLNYPLDKRYNIKEFI
A4XFP8_CALS8/12-334ESFVDELTRGLSGNLKDFNIHDVMTKYNMDFRQFSKY.........................KLKLEGVQKFPREIVAFV
Q3AA80_CARHZ/5-311EEKFVVADMERVFTSPRFVLNDFLDKVKRPGFFLGESYPWAREFPRFKFSSS..........RKTLMDLKIRKAEVLAPV
A7HMV5_FERNB/4-324MLIRGDKTYVLDFDKLMSKNNFVEYFVANIDIILEPSKKDIALEKIFKALKMNVEDYTKFVFQTIMDEESAKTLQISKFI
A2VLF2_MYCTU/11-314DIPAHKRKSFEAFVMNTDGAQATAPLKEWVEPNAVKLDPAKHRGYEVKIGSIEPRRASRGRGGRMTRKKLTLNEIHAFIK
Q0AW54_SYNWW/12-313FPRLVAFLKERSLLAEYEKFLSTPRLKDIRVFLEENGISAADYPSFVRYSIA..........AGEAAHIENFREVLTFIK
Q5HK93_STAEQ/9-268NLLYTYQNFLRYPPKNPRENGLKDYLDAQNVKQSEWEAFVSYSEKVNQGK............KYGNTRPKPLNDLHLMVR
Q03KS9_STRTD/11-288RLAEKFEAFLIQTRPNARNNRLISFLNDNRIAERSFGGYSISETGLES..............DRNPNSAGAINEVNKFIR
A2BKQ7_HYPBU/87-311.................................................................SGLLGTVLEVGLSWD
Q2LQX1_SYNAS/103-281....................................................................ESHPHEVSMVFD
Q7MTH6_PORGI/59-251.............................................YHHEINKPADEKGKKVEGDKEDDAPEVYNLGMYFD
A7FVL1_CLOB1/73-293..............................................................YSHILKEKEEFKLSLEFD
Q8TVU2_METKA/491-691....................................................................GPHPAENDLTLD
A1WUQ4_HALHL/82-287....................................................................MAHPLENGFAFL
A9AWU2_HERA2/90-292....................................................................AESVLENSIALQ
Q1CW33_MYXXD/74-261....................................................................NASPTGVGLTLH
Q977D5_SULTO/23-210........................................VYDVEIIKPLENIDQLVETALKGTIPDVNKYFSPVTHEMN
A8A9P3_IGNH4/77-241...................................................................ALKAVFEVGLNVD
A1RZR1_THEPD/18-247......................................................................REGNVLYALR
Q2RV95_RHORT/11-210.............................................DFTTIEG..........LSGKAGANAAPQVARIAR
Q4J793_SULAC/8-222..........................................................................DTLKPL
A4YFX5_METS5/9-241.......................................................................SLGNELEAL
Q4J7N6_SULAC/8-291..........................................................GVYFDYASADIVTYKLPLQDSN
A8F3D7_THELT/30-277....................................................................PSPLTEKKGAIF
A4FJY4_SACEN/194-372.................................................................LNSVNGPKHNTLTAF
A4YFW9_METS5/24-229.................................................................KGSASFRDTTDNPIL
Q2RY06_RHORT/19-223.......................................................SFEARQELRRAPQTDDIAKAKAVLL
Q2RV95_RHORT/253-439...........................................................YQSNKGKRDKSDKEPNARAQS
Q5LZX3_STRT1/11-194................................................................DAFAAIGAIDSPVIKD
A5UWG2_ROSS1/10-302..................................................................SYRLGRVDNSIVRE
Q2JNS6_SYNJB/14-218..............................................................KEGADPTKPDMEFVETYH
B9LIP8_CHLSY/265-444..............................................................FDEQDRGPDTVHLHSARP
A7NFU0_ROSCS/21-222..................................................................RATEIIANDLPVLR
O66706_AQUAE/7-289...................................................................QGLTHIDLPIARE
A6LNK3_THEM4/7-272...................................................................MDLGVIDQPIQRE
A6UNE9_METVS/9-264..................................................................DANFGIIDKTVQRD
Q2FL77_METHJ/279-403............................................................................EPTV
A1WUQ2_HALHL/9-296...................................................................TATGVIDNPIQRE
Q8TVT9_METKA/8-335..................................................................QRATDVIDLPLQRE
Q47PK3_THEFY/7-290...................................................................ASDGVLDLPIQRE
Q2JRT2_SYNJA/7-252....................................................................TQEGNLLGIARE
A0YUX6_LYNSP/8-262..................................................................AGEESGNLNLIFRD
A0YQJ5_LYNSP/5-273...................................................................DSSIRGNNNPIYR
A8A9P1_IGNH4/9-272....................................................................RSPGTVDQPIIK
Q97WX4_SULSO/14-302...................................................................TSVEEEVDLPFQR
Q97XK7_SULSO/7-290....................................................................RGYGIVDMPVQR
A3MVP2_PYRCJ/10-303...................................................................RSEEAQVDLPVQR
Q2JNS1_SYNJB/20-216...................................................................GSSGSLADKPLLK
A5UT82_ROSS1/9-185....................................................................RRRLGVDKTLAL
Q2FL76_METHJ/14-206..................................................................GSSGPADVDLPVLR
B8G728_CHLAD/8-184...................................................................YGLGLQVDSALLR
Q6ZED2_SYNY3/7-200....................................................................MGRGELDSVVQR
B0K2G5_THEPX/4-192....................................................................EGAGIIDSDVVL
A9AUN2_HERA2/7-194...................................................................DGIVGLIDQEVEY
Q7MC47_VIBVY/7-190...................................................................EEGGTYADALVLK
A3DH28_CLOTH/14-216.............................................................DENQLNPASVEHTFFVTYK
A4YFX0_METS5/20-218......................................................................ERGPIKEVIR
Q2JRT5_SYNJA/129-478...................................................................GAKGPESMLLPAF
Q2FL77_METHJ/16-208............................................................QNAAMYSLSPAPVIECFDAG
A4TG45_MYCGI/12-250.................................................................NFALFRREKILSADG
A4XGU1_CALS8/51-316...........................................................................GSQFF
Q0ATZ2_SYNWW/170-634.......................................................YKQDEEKRTYEAKIRDEKWENPEFF
B0K8W5_THEP3/133-594........................................................................KEESDFFS
A3DH27_CLOTH/31-251................................................................EYTVSGDNSMIYKEFV
A3DKC8_CLOTH/235-405..................................................................TVRLSNESDGINIK
Q6ZED5_SYNY3/156-674................................................................SKEEINNNHKTYPVRI
Q82XX3_NITEU/10-223SDILTILSNDEAHTEQLRAVHKVLSKYRDKIIPLASVHVSMCTGVHAHYKST..........QDKKNDFNRNGVERTSYQ
A3DH32_CLOTH/9-175....................................................................QERRGSVQRRTV
A6NTP4_9FIRM/14-168.......................................................................GLTTEQLLT
Q7MC49_VIBVY/10-189....................................................................LREAAFDTALVR
A0RRG9_CAMFF/11-179....................................................................SVDFLQDSPVQK
A3DKC8_CLOTH/16-186.........................................................................EDNLKID
A0YPM8_LYNSP/30-210...................................................................DADSPTDLPLLRD
D2C6C1_THENR/8-159................................................................................
Q8PRT5_METMA/8-181................................................................................
O26428_METTH/15-144................................................................................
A7NRR3_ROSCS/6-141................................................................................
C9RCS1_AMMDK/9-145................................................................................
C9RCG8_AMMDK/9-178................................................................................
A5UWG6_ROSS1/4-173................................................................................
A7NRS6_ROSCS/4-175................................................................................
A5D4F7_PELTS/4-177................................................................................
B3EIR8_CHLL2/6-173................................................................................
B4S552_PROA2/12-192................................................................................
A6DAG1_9PROT/9-198................................................................................
C7P6D1_METFA/9-230................................................................................
B7IGV5_THEAB/8-173................................................................................
D3T315_THEIA/9-219................................................................................
O28411_ARCFU/9-154................................................................................
Q8U3V3_PYRFU/7-178................................................................................
D3T7Q1_THEIA/22-173................................................................................
B0M908_9FIRM/9-142................................................................................
C5D4N4_GEOSW/18-161................................................................................
Q53W07_THET8/34-193.............................................................................EPR
A9AWU5_HERA2/41-244.............................................................................KAG
D2ZTS9_NEIMU/25-187.............................................................................VAR
D0W1J3_NEICI/30-211.............................................................................QAA
E6XI85_SHEP2/30-186.............................................................................EAG
D1Y2F0_9BACT/26-187.............................................................................KAG
Q1IZR9_DEIGD/24-191.............................................................................ETR
D3PS14_MEIRD/23-188.............................................................................TPR
D2Z4K2_9BACT/26-193.............................................................................KAG
C5BIW8_TERTT/31-214.............................................................................EAR
Q9KFY9_BACHD/34-207.............................................................................KAG
C8WRP6_ALIAD/23-238.............................................................................HSQ
Q1CW28_MYXXD/33-206...........................................................................VARSP
D3SNA7_THEAH/10-153................................................................................
Q2LQW6_SYNAS/16-162................................................................................
B6IX20_RHOCS/283-454...............................................................................T
A8DJU4_9BACT/304-514...............................................................................N
C8W3E8_DESAS/7-167................................................................................
C0A713_9BACT/8-185................................................................................
B8GSG8_THISH/11-176...............................................................................D
B7R675_9THEO/7-162................................................................................
O66703_AQUAE/10-154................................................................................
Q47PK0_THEFY/7-173................................................................................
A6LNK0_THEM4/7-158................................................................................
B7IFF0_THEAB/10-183................................................................................
A8UTQ9_9AQUI/7-200................................................................................
B2V8M0_SULSY/7-150..............................................................................NS
A8V361_9AQUI/9-167................................................................................
A8M9C0_CALMQ/7-192.............................................................................DPN
Q96Z54_SULTO/9-305..........................................................................QYPVSL
Q97WX2_SULSO/9-255............................................................................RHSI
D2PID8_SULID/27-180................................................................................
Q97Y38_SULSO/24-174................................................................................
C4KFX7_SULIK/27-177................................................................................
Q8TPH8_METAC/9-242.............................................................................GIG
A6UVY5_META3/7-263...............................................................................D
A1KMG2_MYCBP/9-193...............................................................................G
Q5HK92_STAEQ/9-199...............................................................................R
Q9X2C8_THEMA/9-196..............................................................................NE
A3DLB2_STAMF/6-246...............................................................................G
B8GB50_CHLAD/99-293...................................................................RVFHLLDNPVRKD
A1ZVA0_9BACT/4-254IDQTTRELDDLQDRKNREHDKNRKRDYNQQLSHLRKQFSLLSFMQIQGKEQELLEFLKRPEVLKTKLGESPKQQIRGHIK
A5ILN4_THEP1/4-318PQITKELSKTLTLKEVENVEDGVFYEVSL.................................YSDFSSGKRNPEIPEVVH
Q46CS3_METBF/9-174............................................................................KTDN
A6DAF6_9PROT/10-162............................................................................GWGV
Q2FL73_METHJ/7-220...........................................................................RARGT
A0ZJ98_NODSP/7-256............................................................................KPGS
A4XGT8_CALS8/240-441...........................................................................RGEQN
A9AUN3_HERA2/7-220...........................................................................QGDPN
A3DKC7_CLOTH/8-205...........................................................................ERDSN
Q8TVR9_METKA/10-323....REEELVRGLDYRVDGNRILVVDFTTLPPERAERVLGALEGGDHAEAEGYLEGAEVLREVELRTGGVPDRFLPTYRP
Q8TVU2_METKA/6-335...................................................................GRPGAIDLPLIRR
Q6L316_PICTO/4-317FMNYYNRDINESFNELQNQYRSINNIDRYKIYPAIKYNRL...........D..........IKKSDIKMPIGNYVNEDN
Q97CJ4_THEVO/4-334LSYKSSDKDEYSKYNEIKRFYNNINAENYKIEPEIKGDKEFYEVINSNDNKF..........LKAKDVKLTMGTYEVINN
Y1667_METJA/49-345VSNIDNNRLNLTAKDILESVGLNPYDYVIR................................KIESEIFSNKKTRVKKFI
A6DE72_9PROT/4-332FFIMNDEIYFLDKNKFLDKIVKEDKLDEFIKVSSNIDDLLDFIDENADESVASDKLYADSEVIDDLLETTSRPISAFIKE
O27150_METTH/4-274YTGKAKSGDKLVPIFGRVDVSKLYSELDDDARDELVDHISTQDFQLDSMKKFKKAARRAVRYRGFLKTESSNIKDVHEHI

PF08798

C1NCW0_9ESCH/1-198----------------------------------------------------------------.....----.......
Q1GAI3_LACDA/1-205----------------------------------------------------------------KIKD.----.......
Q1EQT0_STRKN/3-219----------------------------------------------------------------ARRDL----TG.....
Q8X7W1_ECO57/1-212----------------------------------------------------------------PAQLL----HLV....
A4XYT8_PSEMY/1-203----------------------------------------------------------------ARRD.----.......
Q67RN9_SYMTH/1-223----------------------------------------------------------------VQRD.----.......
Q8KB24_CHLTE/1-202----------------------------------------------------------------ALR..----.......
A5UR13_ROSS1/1-237----------------------------------------------------------------VRRD.----.......
Q1J366_DEIGD/4-210----------------------------------------------------------------TARD.----.......
Q5PEG8_SALPA/1-232----------------------------------------------------------------PEMLA----KWN....
A5FTJ9_ACICJ/1-224----------------------------------------------------------------VAALA----SVL.VPE
A1SV70_PSYIN/1-178----------------------------------------------------------------.....----.......
Q2RXJ4_RHORT/4-241----------------------------------------------------------------RWAGQ----RGIG...
B3ENH7_CHLPB/1-201----------------------------------------------------------------ALR..----.......
Q2JWC6_SYNJA/1-204----------------------------------------------------------------VQRE.----.......
CSE3_THET8/1-211----------------------------------------------------------------ARRD.----.......
A3LCN7_PSEAI/1-202----------------------------------------------------------------ARRD.----.......
Q57KI5_SALCH/1-212----------------------------------------------------------------PAQLL----HLV....
Q0W583_UNCMA/1-248----------------------------------------------------------------VRRD.----.......
A0LM55_SYNFM/1-201----------------------------------------------------------------TMRL.----.......
Q60AD3_METCA/5-237----------------------------------------------------------------RFAQD----QGL.NTH
Q1JX12_DESAC/1-200----------------------------------------------------------------.....----.......
A1ARH5_PELPD/1-222----------------------------------------------------------------ARRD.----.......
Q6LWA0_PHOPR/2-180----------------------------------------------------------------.....----.......
C1DSI0_AZOVD/1-204----------------------------------------------------------------ARRD.----.......
Q1EQJ3_STRKN/1-237----------------------------------------------------------------SRQL.----.......
Q2JH26_FRASC/2-267----------------------------------------------------------------AQAL.----.......
Q03C59_LACC3/1-212----------------------------------------------------------------IFKH.----.......
Q3ZZ80_DEHSC/1-206----------------------------------------------------------------ALTE.----.......
A7MFK9_CROS8/1-212----------------------------------------------------------------PERLM----EMM....
Q5YRB7_NOCFA/1-222----------------------------------------------------------------TRKL.----.......
Q7N8H4_PHOLL/1-223----------------------------------------------------------------ANILA----KLS....
Q0BRF7_GRABC/2-239----------------------------------------------------------------RWARD----RGF.GPK
A6W167_MARMS/1-223----------------------------------------------------------------RQLLL----GFG....
A8M405_SALAI/1-222----------------------------------------------------------------ARKL.----.......
A3EQA3_9BACT/1-214----------------------------------------------------------------ARRD.----.......
Q1ZM76_PHOAS/1-219----------------------------------------------------------------AETLL----MLQ....
Q314I5_DESDG/1-218----------------------------------------------------------------.....----.......
A0AE92_STRAM/1-253----------------------------------------------------------------ARRL.----.......
A8LYZ8_SALAI/3-204----------------------------------------------------------------ARRD.----.......
Q825C0_STRAW/3-217----------------------------------------------------------------ARRDL----GG.....
Q47PJ5_THEFY/2-225----------------------------------------------------------------TRAD.----.......
F2GBG6_ALTMD/1-221----------------------------------------------------------------AQELA----KLQ....
Q74DC7_GEOSL/1-201----------------------------------------------------------------.....----.......
Q0RTG6_FRAAA/28-266----------------------------------------------------------------AQSL.----.......
A7BA62_9ACTO/1-248----------------------------------------------------------------AKQL.----.......
Q1R113_CHRSD/1-229----------------------------------------------------------------REQLF----DVL....
Q6NEQ5_CORDI/5-227----------------------------------------------------------------PAKNK----PRK.GWE
Q2FNT6_METHJ/1-225----------------------------------------------------------------SGRFR----DL.....
A5F3T0_VIBC3/4-208----------------------------------------------------------------ALK..----.......

PF09559

Q1CW34_MYXXD/4-194----------------------------------------------------------------VP--------------
Q1CW45_MYXXD/31-221----------------------------------------------------------------VP--------------
Q3M7D9_ANAVT/30-227----------------------------------------------------------------LP--------------
Q8F1E7_LEPIN/7-205----------------------------------------------------------------LP--------------
A0YQL0_LYNSP/20-218----------------------------------------------------------------ID--------------
Q0A841_ALHEH/18-219----------------------------------------------------------------LP--------------
A1WYF2_HALHL/43-244----------------------------------------------------------------LP--------------
A1AWQ7_RUTMC/19-218----------------------------------------------------------------LP--------------
Q4JN26_9BACT/18-217----------------------------------------------------------------LP--------------
Q3SG16_THIDA/19-212----------------------------------------------------------------IP--------------

PF09700

Q746D9_THET2/1-351-----------------------------------------------------------------GRPFT...NSPGAR.
A0B6W4_METTP/4-358-----------------------------------------------------------------GRPFH...LGEATS.
O28413_ARCFU/3-341-----------------------------------------------------------------PRPFD...VNNH...
A6LNK2_THEM4/6-323-----------------------------------------------------------------SKTFS...T......
A6VYS5_MARMS/4-381-----------------------------------------------------------------SRPFE...AISD...
Q47PK4_THEFY/13-381-----------------------------------------------------------------GRQFS...SRDSNT.
A4BL65_9GAMM/5-384-----------------------------------------------------------------NRLFG...GAGAD..
Q9KFY7_BACHD/8-408-----------------------------------------------------------------GRPFK...DSPGAR.
A6UNE8_METVS/6-362-----------------------------------------------------------------NETFG...DGKNTNY
O66707_AQUAE/4-323-----------------------------------------------------------------LKNFS...AGET...
Q97WW9_SULSO/5-306-----------------------------------------------------------------QGEFEPLITGSHTA.
Q1CW30_MYXXD/6-386-----------------------------------------------------------------GRGWY...TSEVGR.
Q9X2B3_THEMA/6-327-----------------------------------------------------------------TRRFS...FSD....
A7C3N9_9GAMM/9-401-----------------------------------------------------------------ARPYD...SIGGTQ.
Q2JN53_SYNJB/4-377-----------------------------------------------------------------AKPFA...PGERAW.
A3IZR5_9CHRO/4-391-----------------------------------------------------------------AKPFT...PGERAW.
Q8U1S7_PYRFU/4-321-----------------------------------------------------------------SRPFD...AGSES..
A9AWU6_HERA2/68-470-----------------------------------------------------------------GRPFN...NTPGAR.
A1WUQ1_HALHL/5-362-----------------------------------------------------------------NRLFG...EPGNA..
C0A715_9BACT/6-379-----------------------------------------------------------------GRPYN...HGESNQA
A5D0Z3_PELTS/4-387-----------------------------------------------------------------GRPFG...PVPGAR.
A1ZP54_9BACT/3-366-----------------------------------------------------------------GKPFS...LGEETW.
Q8TVU0_METKA/10-439-----------------------------------------------------------------PEPFR...AAAES..
Q2JRT1_SYNJA/4-372-----------------------------------------------------------------AKPFA...PGERAW.
Q6ZEA9_SYNY3/4-365-----------------------------------------------------------------AKPFT...PGDRAW.
Q1IZS1_DEIGD/6-393-----------------------------------------------------------------GRPFAG..GGEESR.
A7GFA9_CLOBL/4-366-----------------------------------------------------------------GNNFE...FKISNV.
A8DJU1_9BACT/6-369-----------------------------------------------------------------GRPFM...DGTE...
Q7MTH3_PORGI/6-391-----------------------------------------------------------------KKTFG...DDNANY.
A9AVY8_HERA2/6-387-----------------------------------------------------------------GRPFE...NQPGAR.
Q8R6Z6_THETN/4-372-----------------------------------------------------------------GRPFN...VGD....
E6XI87_SHEP2/4-375-----------------------------------------------------------------GRPFE...EISD...
Q1AZD9_RUBXD/4-359-----------------------------------------------------------------GSPFD...AGETGQI

PF09704

Q2MF31_STRSD/16-248----------------------------------------------------------------.GDRS----AFNRRD.
Q7NYP8_CHRVO/13-224----------------------------------------------------------------.TRPE----MKVERV.
A1ARH6_PELPD/3-217----------------------------------------------------------------.GTTS----RFDQRD.
Q12YA8_METBU/4-236----------------------------------------------------------------.GDIA----VGQHRP.
Q0BSC7_GRABC/6-215----------------------------------------------------------------.GELA----GHERRG.
A8ABL4_IGNH4/3-275----------------------------------------------------------------.GFSV----RYPMSSA
A6W168_MARMS/4-241----------------------------------------------------------------.GQPA----VGGDRA.
O66696_AQUAE/3-211----------------------------------------------------------------.KTPF----SIKGIE.
A8ZZ17_DESOH/3-251----------------------------------------------------------------.GEIA----VGETRH.
Q1EQJ4_STRKN/3-213----------------------------------------------------------------.GASA----RFARRT.
A5UR14_ROSS1/3-244----------------------------------------------------------------.GLRA----RWGERD.
Q8Z465_SALTI/4-233----------------------------------------------------------------.GEEA----SGEIRH.
Q3A5Z4_PELCD/3-236----------------------------------------------------------------.GEIA----VGESRH.
C1DSH9_AZOVD/3-205----------------------------------------------------------------.GTTS----RFDERD.
Q5YRB6_NOCFA/3-211----------------------------------------------------------------.GVAS----RFARRE.
Q1CWU1_MYXXD/10-210----------------------------------------------------------------.TRPE----MKAERV.
A3DLC5_STAMF/3-270----------------------------------------------------------------.GHQS----RIVGLSK
A4J385_DESRM/4-212----------------------------------------------------------------.TRPE----MKVERV.
Q65TW5_MANSM/4-216----------------------------------------------------------------.TRPE----MKVERV.
Q8KDC0_CHLTE/7-228----------------------------------------------------------------.TRPE----MKVERV.
Q5H4J6_XANOR/4-215----------------------------------------------------------------.TRPE----MKVERV.
Q9X2C0_THEMA/3-212----------------------------------------------------------------.RRPY----TTTSSY.
Q03C60_LACC3/3-210----------------------------------------------------------------.GNEA----QFARRT.
Q8U334_PYRFU/3-239----------------------------------------------------------------.AKRS----YQVRT..
Q47PI7_THEFY/3-209----------------------------------------------------------------.GAAS----RFTRRT.
O28407_ARCFU/3-252----------------------------------------------------------------.GFQA----RIAGLSK
Q2SID2_HAHCH/4-215----------------------------------------------------------------.TRPE----MKVERV.
CAS5_METJA/5-228----------------------------------------------------------------.GKQS----YQVRQ..
Q72NC2_LEPIC/11-225----------------------------------------------------------------.TRPE----MKAERV.
O27159_METTH/3-241----------------------------------------------------------------.RNPF----TFDYAQ.
B3E5U9_GEOLS/3-263----------------------------------------------------------------.GEIA----VGESRH.
Q04QB7_LEPBJ/4-240----------------------------------------------------------------.GNIA----VGEYRP.
Q60AD2_METCA/3-241----------------------------------------------------------------.GGVM----VDQHGP.
Q2RL62_MOOTA/18-224----------------------------------------------------------------.TRPE----MKVERV.
A5GBK2_GEOUR/12-223----------------------------------------------------------------.GFDS----QYNRRN.
Q72WF9_DESVH/10-218----------------------------------------------------------------.TRPE----MKVERV.
Q0W584_UNCMA/6-214----------------------------------------------------------------.GLKA----RWDIRD.
Q1NKD4_9DELT/4-199----------------------------------------------------------------.TDPL----TKIGGEK
A4YFV1_METS5/10-233----------------------------------------------------------------.GFSI----SYPTASK
A8LYZ7_SALAI/3-226----------------------------------------------------------------.GDHS----TFSVRD.
CASD_ECOLI/4-214----------------------------------------------------------------.GQPT----FEGTRP.
Q0AZP3_SYNWW/4-212----------------------------------------------------------------.TRPE----MKVERV.
Q1R114_CHRSD/4-250----------------------------------------------------------------.GEAA----VGEARP.
CAS5C_SULSO/5-232----------------------------------------------------------------.GFSV----VKPSAAK
Q2RW65_RHORT/4-212----------------------------------------------------------------.TRPE----MKAERV.
Q5P3Y6_AROAE/8-203----------------------------------------------------------------.TDPL----TKVGGEK
Q314I4_DESDG/4-228----------------------------------------------------------------.GTVA----VGEIRP.
A1SV73_PSYIN/3-198----------------------------------------------------------------.GLQT----FDVHRR.
Q1EQS9_STRKN/13-242----------------------------------------------------------------.GERS----HFNERD.
Q3YYA5_SHISS/4-233----------------------------------------------------------------.GVDA----PGEVRH.
A6TNS2_ALKMQ/6-209----------------------------------------------------------------.SDPI----NRIGGEK
B4SAU9_PELPB/4-206----------------------------------------------------------------.TRPE----MKVERV.
Q1H3R5_METFK/4-216----------------------------------------------------------------.TRPE----MKVERV.
Q67RP0_SYMTH/3-220----------------------------------------------------------------.GTAS----RFTERD.
Q2JWC5_SYNJA/3-192----------------------------------------------------------------.GDHS----QFDYRD.
B1YHA3_EXIS2/4-198----------------------------------------------------------------.TDPL----TKLGGEK
Q4JWK0_CORJK/4-209----------------------------------------------------------------.GVSS----RFKQRA.
Q7N8H5_PHOLL/4-236----------------------------------------------------------------.GQPA----VGGERP.
Q60B28_METCA/3-213----------------------------------------------------------------.TRPE----MKVERV.
Q2LX12_SYNAS/8-216----------------------------------------------------------------.TDPL----TKIGGEK
B8I205_CLOCE/4-212----------------------------------------------------------------.TRPE----MKVERV.
Q2RXJ5_RHORT/6-238----------------------------------------------------------------.GGVA----IDNVGV.
C1DNX2_AZOVD/4-215----------------------------------------------------------------.TRPE----MKVERV.
Q0AA33_ALHEH/3-231----------------------------------------------------------------.GGVL----VDQHNP.
Q3ZZ79_DEHSC/6-199----------------------------------------------------------------.GYRS----RFDCRD.
Q47PJ4_THEFY/3-220----------------------------------------------------------------.GEHS----MFGERD.
Q6NEQ9_CORDI/4-220----------------------------------------------------------------AGSVV----TGNIVR.
Q1JX11_DESAC/4-219----------------------------------------------------------------.GEHS----FEGTRS.
Q746C2_THET2/3-211----------------------------------------------------------------.SRPE----FKVERV.
Q0RTG7_FRAAA/8-241----------------------------------------------------------------.GGGS----MFNRRE.
Q39WR9_GEOMG/10-218----------------------------------------------------------------.TRPE----MKVERV.
Q977B3_SULTO/4-249----------------------------------------------------------------.GFSI----RVPKASA
Q0BRF8_GRABC/3-224----------------------------------------------------------------.GGTT----IDSRGV.
CAS5B_SULSO/4-251----------------------------------------------------------------.GFSV----RVPRTSA
Q8ZZL1_PYRAE/3-217----------------------------------------------------------------.KHYE----TYQVAA.
Q3ARV4_CHLCH/4-200----------------------------------------------------------------.TDPV----SRIGGEK
Q1J367_DEIGD/3-208----------------------------------------------------------------.GTRS----RFDDRD.
Q9KFY3_BACHD/4-199----------------------------------------------------------------.TDPL----TKIGGEK
A5V1B9_ROSS1/6-202----------------------------------------------------------------.TDPL----TRIGGEK
Q04AW9_LACDB/3-211----------------------------------------------------------------.GNEA----SFERRT.
O57910_PYRHO/4-218----------------------------------------------------------------FRIPH----TSLLLD.
Q184H2_CLOD6/3-221----------------------------------------------------------------.KKPF----AMKITE.
A2BKI9_HYPBU/5-261----------------------------------------------------------------.GFSV----RYAGASA
A1A2N3_BIFAA/7-207----------------------------------------------------------------.SEVA----TRVGGEK
Q9YCM4_AERPE/7-241----------------------------------------------------------------.KNPE----SYQVAS.
Q6LWA3_PHOPR/12-207----------------------------------------------------------------.GLQT----FDVHRR.
A0AE91_STRAM/6-214----------------------------------------------------------------.GASS----RFTRRT.
Q74DC8_GEOSL/4-217----------------------------------------------------------------.GEHT----FEGKRP.
Q8KB22_CHLTE/5-230----------------------------------------------------------------.GADS----RFGRRD.
Q1JAP7_STRPB/6-202----------------------------------------------------------------.TNPA----TKGGSER
Q2J7P3_FRASC/14-209----------------------------------------------------------------.TRPE----FRVERV.
Q5JGB2_PYRKO/7-237----------------------------------------------------------------RALPQ----SKMRT..
B3ENH9_CHLPB/5-225----------------------------------------------------------------.GADS----RFGRRG.
Q96X68_SULTO/5-233----------------------------------------------------------------.GFYV----SYPEASK
Q53WH0_THET8/3-225----------------------------------------------------------------.GTRS----RFDHRD.
A5D0R8_PELTS/6-219----------------------------------------------------------------.TRPE----FKVERV.
Q2RY19_RHORT/6-247----------------------------------------------------------------.GDIA----VGERRG.
A0LDG2_MAGSM/7-202----------------------------------------------------------------.TDPL----TRGGGEK
Q3SR91_NITWN/4-221----------------------------------------------------------------.TRPE----MKVERV.
Q1ZM77_PHOAS/4-242----------------------------------------------------------------.GQPT----VGGDRH.
Q9UZX1_PYRAB/18-248----------------------------------------------------------------RSLPQ----SKMRN..
A4SFQ4_PROVI/7-227----------------------------------------------------------------.TRPE----MKVERV.

PF01881

A3I0J5_9BACT/85-250CI..SPLVLITPAFN......-----------------------------------------------------------
B4SEV7_PELPB/102-262ML..SPLVCTTKGE.......-----------------------------------------------------------
A9BGZ0_PETMO/94-248TL..SPITIYSTIVQ......-----------------------------------------------------------
B4S5I3_PROA2/102-261MM..SPLVCSAKRD.......-----------------------------------------------------------
A9BIX0_PETMO/95-244TL..SPITAYSTIVLP.....-----------------------------------------------------------
B8FSG8_DESHD/95-244TL..SPVVLYSTLLRP.....-----------------------------------------------------------
A5D0Y7_PELTS/95-244TL..SPVVAYSTLLRP.....-----------------------------------------------------------
O30164_ARCFU/94-241TL..SPIYASTSVGE......-----------------------------------------------------------
CAS6_PYRHO/96-239TL..SPIAVTMEK........-----------------------------------------------------------
A7HMV7_FERNB/94-242TK..SPITVYSTIEKD.....-----------------------------------------------------------
Q5JGA0_PYRKO/94-241TL..SPIAVTTKRIQ......-----------------------------------------------------------
A1BI29_CHLPD/102-262AL..SPVVCATKHA.......-----------------------------------------------------------
A5ILP0_THEP1/93-246ML..SPLVVSVPEEN......-----------------------------------------------------------
A4XIJ2_CALS8/97-249ML..SPMCAYKTI.RN.....-----------------------------------------------------------
CAS6L_PYRFU/91-238TL..SPIVVRTVKFE......-----------------------------------------------------------
CAS6_PYRFU/95-238TL..SPIAVTVVR........-----------------------------------------------------------
O66704_AQUAE/85-236TL..SPIVIERIGSKP.....-----------------------------------------------------------
Q97CI9_THEVO/80-232TG..SPVVLYL..........-----------------------------------------------------------
Q6L312_PICTO/82-235TG..SPIVLYL..........-----------------------------------------------------------
Y1234_METJA/81-240TG..SPIVLYK..........-----------------------------------------------------------
Q6L114_PICTO/79-219SR..SPVII............-----------------------------------------------------------
A5TU40_FUSNP/91-242TTIGGGVVVREHNKE......-----------------------------------------------------------
Q3AA81_CARHZ/95-248CL..SPIVVSTLKEG......-----------------------------------------------------------
Q1AZD0_RUBXD/93-249AL..SPITAYTTLATP.....-----------------------------------------------------------
Q6L357_PICTO/89-232SL..SPILIRY..........-----------------------------------------------------------
Y375_METJA/95-240TI..SPIYLKTMIET......-----------------------------------------------------------
Q4EVR3_LISMN/89-240TL..SPVVSRDHNRE......-----------------------------------------------------------
Q2NFS1_METST/92-244TL..SPIITRTKEEI......-----------------------------------------------------------
O27163_METTH/1-154TL..SPIIIKTVREE......-----------------------------------------------------------
A7GQ92_BACCN/87-233TL..SPLLIRDKHAK......-----------------------------------------------------------
O57900_PYRHO/78-237TG..SPVVIYK..........-----------------------------------------------------------
A4J1X6_DESRM/95-249ML..SPVTMYSTLETR.....-----------------------------------------------------------
Q46FQ7_METBF/89-241TL..SPIYLKTQRKQ......-----------------------------------------------------------
A5UJJ7_METS3/89-241TL..APIIVRTKKEI......-----------------------------------------------------------
Q5JHS4_PYRKO/92-239TL..SPILVRTVKFV......-----------------------------------------------------------
Q332K8_CBCP/101-247VM..TPIVESIW.........-----------------------------------------------------------
O66560_AQUAE/87-244TL..SPIVVINRDKKPVLPSK-----------------------------------------------------------
A1ZVQ2_9BACT/100-263CQ..SPLIITRKNK.......-----------------------------------------------------------
CAS6L_PYRHO/91-238TL..SPIVVRTVKFE......-----------------------------------------------------------
Q184H4_CLOD6/91-242AL..SPICVKSKEGK......-----------------------------------------------------------
A4XM43_CALS8/98-260TF..SPVVIEKKEGD......-----------------------------------------------------------
A1ZPF3_9BACT/98-260TL..SPLLISKLN........-----------------------------------------------------------
A8F3P6_THELT/92-245LI..SPLVVSIPVEN......-----------------------------------------------------------
Q8TJV5_METAC/89-241TL..SPIYLKTLRKQ......-----------------------------------------------------------
Q12WX9_METBU/89-240TL..SPIYVKTMRKK......-----------------------------------------------------------
A6DAF5_9PROT/81-224TL..NPVFV............-----------------------------------------------------------

PF10040

A1RZS7_THEPD/144-263----TPTYFNPLS........-----------------------------------------------------------
A4J507_DESRM/140-259----SPTNFRV..........-----------------------------------------------------------
Q3M5G3_ANAVT/172-285----TPTAFRQ..........-----------------------------------------------------------
A0ZJZ0_NODSP/168-289----SPTSFRR..........-----------------------------------------------------------
CAS6A_SULSO/138-277----SPTLLSSKVLLPPSLSE-----------------------------------------------------------
Q2JNR9_SYNJB/173-292----SPTSFRH..........-----------------------------------------------------------
A8ABE5_IGNH4/136-254----GPAVLRDPWRGP.....-----------------------------------------------------------
Q7TXS3_MYCBO/184-300----TPTAFKQ..........-----------------------------------------------------------
Q6ZED0_SYNY3/149-272----SPTSFRR..........-----------------------------------------------------------
A0ZJ83_NODSP/132-250----TPTAFAQ..........-----------------------------------------------------------
A1HND4_9FIRM/191-314----TMTRLKY..........-----------------------------------------------------------
Q03KT3_STRTD/120-237----TPTGFKS..........-----------------------------------------------------------
B8G917_CHLAD/148-265----APVTFRQ..........-----------------------------------------------------------
Q977A9_SULTO/131-247----TPTLLQPPKF.......-----------------------------------------------------------
Q72GC1_THET2/120-235----SPTFFRR..........-----------------------------------------------------------
A3MST1_PYRCJ/120-246----TPVRF............-----------------------------------------------------------
Q2FR84_METHJ/135-257----SPLYL............-----------------------------------------------------------
A3CNA0_STRSV/121-238----TPTTFKR..........-----------------------------------------------------------
A7NKQ1_ROSCS/148-265----TPVTFRQ..........-----------------------------------------------------------
A1HM59_9FIRM/128-245----TPASFKI..........-----------------------------------------------------------
Q9YCN0_AERPE/126-238----.PTIYMF..........-----------------------------------------------------------
Q745V3_THET2/136-262----TPTVFATSKP.......-----------------------------------------------------------
B3EIY9_CHLPB/190-323----TPLRMKTSLGRE.....-----------------------------------------------------------
Q8ZZK8_PYRAE/121-246----TPLRFAVKPLYK.....-----------------------------------------------------------
A0YW92_LYNSP/157-270----TPTAFRQ..........-----------------------------------------------------------
A3DLD1_STAMF/165-291----TPALLLDPY........-----------------------------------------------------------
Q74DY6_GEOSL/182-301----TPLRIIQ..........-----------------------------------------------------------
A1RZX7_THEPD/116-252----TPTLVPVPGRGSLLKAG-----------------------------------------------------------
B4S549_PROA2/190-323----TPLRMKTAFGRD.....-----------------------------------------------------------
Q4J7R1_SULAC/134-279----SPTLLSNKYMVPPVFKK-----------------------------------------------------------
Q1Q3G5_9BACT/191-313----TPVRLRF..........-----------------------------------------------------------
A8M9A8_CALMQ/139-276----GPTVFRF..........-----------------------------------------------------------
A1RQV9_PYRIL/103-214----.PTVFMF..........-----------------------------------------------------------
Q5HK95_STAEQ/125-242----TPMSFKY..........-----------------------------------------------------------
A6NTQ0_9FIRM/121-240----TPTAFKS..........-----------------------------------------------------------
A8AA66_IGNH4/119-232----GPTLYRF..........-----------------------------------------------------------
Q01QC2_SOLUE/166-288----TPTELKS..........-----------------------------------------------------------
Q4J7D4_SULAC/139-264----TPTLLQPIRPNLK....-----------------------------------------------------------
Q8ZZU6_PYRAE/127-238----.PTAFMF..........-----------------------------------------------------------
A2BMX9_HYPBU/151-264----TFYRF............-----------------------------------------------------------
Q6ZEI4_SYNY3/146-257----SATSFK...........-----------------------------------------------------------
A6DE70_9PROT/157-271----TPLRIKQ..........-----------------------------------------------------------
A9AZH6_HERA2/148-265----SPVTFRQ..........-----------------------------------------------------------
A0LHY9_SYNFM/189-312----TPLRLVY..........-----------------------------------------------------------
Q4J7P9_SULAC/157-283----TPSMFKDPFEKLADL..-----------------------------------------------------------
Q0AW55_SYNWW/127-244----TPCTHKQ..........-----------------------------------------------------------
Q3IQ75_NATPD/155-285----TATCIE...........-----------------------------------------------------------
A0B9F8_METTP/179-310----SPTCIQY..........-----------------------------------------------------------
Q39T05_GEOMG/185-303----TPLKIMQ..........-----------------------------------------------------------
A4YFW1_METS5/128-262----SPVLLSSMIGLPPSLNP-----------------------------------------------------------
B9LJK3_CHLSY/148-265----SPTTFRQ..........-----------------------------------------------------------
A4YFU6_METS5/153-294----TPALLCSKIYLPPFLRE-----------------------------------------------------------
Y1859_ARCFU/176-286----TP...............-----------------------------------------------------------
A0YIK9_LYNSP/157-279----SPTSFRR..........-----------------------------------------------------------
A1BI47_CHLPD/189-322----TPLRMKTAWQRK.....-----------------------------------------------------------
Q8TVD3_METKA/146-270----TPTYIVH..........-----------------------------------------------------------
A0YUQ2_LYNSP/96-214----TPTAFAQ..........-----------------------------------------------------------
A3MVN5_PYRCJ/123-252----TPTRFAVPPLYK.....-----------------------------------------------------------
Q97YE5_SULSO/103-228----TPTLLQPPRPSIK....-----------------------------------------------------------
Q2FM73_METHJ/142-275----TPTCIQY..........-----------------------------------------------------------
Q8ZZM1_PYRAE/124-249----SPTRFAVKPLYK.....-----------------------------------------------------------
A9AX64_HERA2/145-264----TPTCFKLGRDR......-----------------------------------------------------------
A8ZV96_DESOH/179-301----TPLRTKM..........-----------------------------------------------------------

PF03787

Q1Q3H4_9BACT/4-335NAFSQPYLPGSAIKGVIR...-----------------------------------------------------------
Q8TPH7_METAC/4-317VKCGGPYLPGSSIKGSIR...-----------------------------------------------------------
O57906_PYRHO/18-333KIKGKPYIPGTSLKGAIR...-----------------------------------------------------------
B3EIY8_CHLPB/11-320ATGGKPFIPGSSLKGAIR...-----------------------------------------------------------
A6LNL6_THEM4/4-297KTIGKPFLPGSSLKGAIR...-----------------------------------------------------------
A4XFP8_CALS8/12-334KSAGRFYIPGSSLKGGIR...-----------------------------------------------------------
Q3AA80_CARHZ/5-311AEGQGFYLPGSSLKGSLR...-----------------------------------------------------------
A7HMV5_FERNB/4-324HSANRRYIPGTSIKGALR...-----------------------------------------------------------
A2VLF2_MYCTU/11-314DPLGRPYVPGSTVKGMLR...-----------------------------------------------------------
Q0AW54_SYNWW/12-313DSKGYPYIPGSSLKGAIR...-----------------------------------------------------------
Q5HK93_STAEQ/9-268DGQNKVYLPGSSIKGAIK...-----------------------------------------------------------
Q03KS9_STRTD/11-288DAFGNPYIPGSSLKGAIR...-----------------------------------------------------------
A2BKQ7_HYPBU/87-311YLLDLPYIPASSIKGLIR...-----------------------------------------------------------
Q2LQX1_SYNAS/103-281HNMGIPYIPASGVKGIVRFAH-----------------------------------------------------------
Q7MTH6_PORGI/59-251YTSGLPVIPGSSIKGMLR...-----------------------------------------------------------
A7FVL1_CLOB1/73-293YTTGLPVINGSSIKGMLR...-----------------------------------------------------------
Q8TVU2_METKA/491-691PVTGLPVIPGTTLKGVAR...-----------------------------------------------------------
A1WUQ4_HALHL/82-287TPYGLPYLAGSGVKGVLR...-----------------------------------------------------------
A9AWU2_HERA2/90-292RTYGMPYIPGSALKGLAS...-----------------------------------------------------------
Q1CW33_MYXXD/74-261HTWGVPVVPGSSLKGVLA...-----------------------------------------------------------
Q977D5_SULTO/23-210RYLGKVIIPGSTIKGLVR...-----------------------------------------------------------
A8A9P3_IGNH4/77-241PILGLPYYPGSGIKGAVR...-----------------------------------------------------------
A1RZR1_THEPD/18-247LPDGRLLVPGSTWKGAFR...-----------------------------------------------------------
Q2RV95_RHORT/11-210DAMARPMIPSTALKGVLL...-----------------------------------------------------------
Q4J793_SULAC/8-222KYDNDYVIPSTSLKGIFR...-----------------------------------------------------------
A4YFX5_METS5/9-241KYGDTYVIPFSTWKGAFR...-----------------------------------------------------------
Q4J7N6_SULAC/8-291EVYYIPAIPATSFKGLLR...-----------------------------------------------------------
A8F3D7_THELT/30-277KVDRTPVIPATSFKGALR...-----------------------------------------------------------
A4FJY4_SACEN/194-372RHGEEFVVPGSTLKGVLR...-----------------------------------------------------------
A4YFW9_METS5/24-229TRGDMPYIPGSSLKGALR...-----------------------------------------------------------
Q2RY06_RHORT/19-223DSDQRPCLTGSGLKGAML...-----------------------------------------------------------
Q2RV95_RHORT/253-439AGKNLPLILGSSLSGALR..S-----------------------------------------------------------
Q5LZX3_STRT1/11-194PITNLPIIPGSSLKGKMR...-----------------------------------------------------------
A5UWG2_ROSS1/10-302PGTRVPKIPGTSLHGAAR...-----------------------------------------------------------
Q2JNS6_SYNJB/14-218GGGRTVYFPGSSLKGAIR...-----------------------------------------------------------
B9LIP8_CHLSY/265-444GGTRKPVLSGTSLAGALR...-----------------------------------------------------------
A7NFU0_ROSCS/21-222DAFDRPFIPGASLKGALR...-----------------------------------------------------------
O66706_AQUAE/7-289VHTGFPFIPGSAIKGCLR...-----------------------------------------------------------
A6LNK3_THEM4/7-272IHTGFPII..SGIKGALR...-----------------------------------------------------------
A6UNE9_METVS/9-264VLTGFPAIYSSSLKGSLR...-----------------------------------------------------------
Q2FL77_METHJ/279-403TNGLGPVIPGSTIKGFLR...-----------------------------------------------------------
A1WUQ2_HALHL/9-296VHTQHPSFAGSGLKGAIR...-----------------------------------------------------------
Q8TVT9_METKA/8-335AHTKLPVIYGSTLKGALR...-----------------------------------------------------------
Q47PK3_THEFY/7-290SSTNYPLIWGQSLKGALR...-----------------------------------------------------------
Q2JRT2_SYNJA/7-252AHTNLPYIPSSTIRGKLR...-----------------------------------------------------------
A0YUX6_LYNSP/8-262QFTQTGIVPGSSIRGRFR...-----------------------------------------------------------
A0YQJ5_LYNSP/5-273LSDRTPAIPGSSVRGALR...-----------------------------------------------------------
A8A9P1_IGNH4/9-272DPMGIPFIPGSSVKGALK...-----------------------------------------------------------
Q97WX4_SULSO/14-302DELNYPTIFASSLKGAIK...-----------------------------------------------------------
Q97XK7_SULSO/7-290DQMGYPIIYSSAFKGPLK...-----------------------------------------------------------
A3MVP2_PYRCJ/10-303DEFGLPTIWASSLKGAIR...-----------------------------------------------------------
Q2JNS1_SYNJB/20-216DAFGRLIIPGSQLKGRLR...-----------------------------------------------------------
A5UT82_ROSS1/9-185STEGVPVLPATTIKGFLR...-----------------------------------------------------------
Q2FL76_METHJ/14-206NSEDFPIIPGSSIKGVLR...-----------------------------------------------------------
B8G728_CHLAD/8-184DADGVPVIRGTVLAGLLR...-----------------------------------------------------------
Q6ZED2_SYNY3/7-200DGDNLPYIPGKTLTGILR...-----------------------------------------------------------
B0K2G5_THEPX/4-192DDLGFPYIPSRRVKGVLK...-----------------------------------------------------------
A9AUN2_HERA2/7-194DQYGFPFLRGRTLKGLLC...-----------------------------------------------------------
Q7MC47_VIBVY/7-190NPHNLPFLPGKALKGLFR...-----------------------------------------------------------
A3DH28_CLOTH/14-216NGELVPAIPGSSLKGVFR...-----------------------------------------------------------
A4YFX0_METS5/20-218DADGNPYIPGSSWKGVFR...-----------------------------------------------------------
Q2JRT5_SYNJA/129-478DPLGIPYIPSSTLCGVAR...-----------------------------------------------------------
Q2FL77_METHJ/16-208SGVFEPYIPGSSLKGILR...-----------------------------------------------------------
A4TG45_MYCGI/12-250TMTEVPIVSGSSFRGVLR...-----------------------------------------------------------
A4XGU1_CALS8/51-316KINNKPFIPGSSLRGMIR...-----------------------------------------------------------
Q0ATZ2_SYNWW/170-634SPGGTPKIPGSSLRGMVR...-----------------------------------------------------------
B0K8W5_THEP3/133-594IKNGLPIIPGSSLRGMVR...-----------------------------------------------------------
A3DH27_CLOTH/31-251KVNGVPVIPGTSFKGCIR...-----------------------------------------------------------
A3DKC8_CLOTH/235-405DSRGNYIIPGSSIKGVIR...-----------------------------------------------------------
Q6ZED5_SYNY3/156-674GKDGKPYLPPTSIKGMLR...-----------------------------------------------------------
Q82XX3_NITEU/10-223PFNQLPYLPGSSIKGAIR...-----------------------------------------------------------
A3DH32_CLOTH/9-175LCKNRPYIPGSTIKGKIR...-----------------------------------------------------------
A6NTP4_9FIRM/14-168DTQGRPYFQGTSLAGALR...-----------------------------------------------------------
Q7MC49_VIBVY/10-189DCNGLPMIPATSIAGVWS...-----------------------------------------------------------
A0RRG9_CAMFF/11-179DWNNLPMILGSSIAGVLR...-----------------------------------------------------------
A3DKC8_CLOTH/16-186QLTGKVYIPGSSVAGAFR...-----------------------------------------------------------
A0YPM8_LYNSP/30-210SISDHALLTGSSIAGALR...-----------------------------------------------------------
D2C6C1_THENR/8-159.DSKSDTIQPTGIMGSLR...-----------------------------------------------------------
Q8PRT5_METMA/8-181.NGNSDTVRETGVIGSMR...-----------------------------------------------------------
O26428_METTH/15-144.ERRSEVIRDTGLIGSLR...-----------------------------------------------------------
A7NRR3_ROSCS/6-141.AGKPDRLIPTGIMGSLR...-----------------------------------------------------------
C9RCS1_AMMDK/9-145.DRESKRLILTGLLGSIR...-----------------------------------------------------------
C9RCG8_AMMDK/9-178.KGKCDRLRETGLLGSLR...-----------------------------------------------------------
A5UWG6_ROSS1/4-173.DGTTDRLHESGLLGSLR...-----------------------------------------------------------
A7NRS6_ROSCS/4-175EPGKVDRIHETGILGSLR...-----------------------------------------------------------
A5D4F7_PELTS/4-177KSGAVDRVHETGIIGSLR...-----------------------------------------------------------
B3EIR8_CHLL2/6-173ETGKMERIHETGIIGNLR...-----------------------------------------------------------
B4S552_PROA2/12-192QAGVVDRIHETGMIGSLR...-----------------------------------------------------------
A6DAG1_9PROT/9-198.NGECTELKPASIFGSLR...-----------------------------------------------------------
C7P6D1_METFA/9-230.WGQCMEIRPSSILGSLR...-----------------------------------------------------------
B7IGV5_THEAB/8-173.RGITNEIRPSSLIGSLR...-----------------------------------------------------------
D3T315_THEIA/9-219.WQENSKVRPSSLMGSLR...-----------------------------------------------------------
O28411_ARCFU/9-154.NQSKAEIRAASIKGLMR...-----------------------------------------------------------
Q8U3V3_PYRFU/7-178.DARSPEFSSASVKGVMR...-----------------------------------------------------------
D3T7Q1_THEIA/22-173.DGRTPELRPSEFKGMMR...-----------------------------------------------------------
B0M908_9FIRM/9-142.NNKELEFRITELKSAMR...-----------------------------------------------------------
C5D4N4_GEOSW/18-161NAKEKAEFRISSLRGVWR...-----------------------------------------------------------
Q53W07_THET8/34-193EADPVSVVRATAVRGHLR...-----------------------------------------------------------
A9AWU5_HERA2/41-244VNDPITPIRASGIRGQLR...-----------------------------------------------------------
D2ZTS9_NEIMU/25-187ESDEKLPVRVTAIRGQLR...-----------------------------------------------------------
D0W1J3_NEICI/30-211VPDVLMPIRVTAIRGQLR...-----------------------------------------------------------
E6XI85_SHEP2/30-186KVDTAMPIRASAIRGQLR...-----------------------------------------------------------
D1Y2F0_9BACT/26-187EVSREFPVRAPSIRGQLR...-----------------------------------------------------------
Q1IZR9_DEIGD/24-191EVDERHPVRAASVRGHLR...-----------------------------------------------------------
D3PS14_MEIRD/23-188QVDPEHPVRAASVRGHLR...-----------------------------------------------------------
D2Z4K2_9BACT/26-193EVDGKHPVRGTAIRGHLR...-----------------------------------------------------------
C5BIW8_TERTT/31-214VLDPSQLIRGTSIRGHLR...-----------------------------------------------------------
Q9KFY9_BACHD/34-207QVDKEIPVRSTSIRGNLR...-----------------------------------------------------------
C8WRP6_ALIAD/23-238RVDRSHPVRGETVRGHLR...-----------------------------------------------------------
Q1CW28_MYXXD/33-206DLPSVDIIRVPTLRGHLR...-----------------------------------------------------------
D3SNA7_THEAH/10-153.DPEKAELRPASIVGMLR...-----------------------------------------------------------
Q2LQW6_SYNAS/16-162.DPQNAEIRSAPIKGALR...-----------------------------------------------------------
B6IX20_RHOCS/283-454QDGNDCDLRPATLRGLLR...-----------------------------------------------------------
A8DJU4_9BACT/304-514QQREDCDLRPATLRGLLR...-----------------------------------------------------------
C8W3E8_DESAS/7-167NPVNSAELRPPSFKGVMR...-----------------------------------------------------------
C0A713_9BACT/8-185NPNGEAELRPASIKGALR...-----------------------------------------------------------
B8GSG8_THISH/11-176AKRVADAIRPPSVKGALR...-----------------------------------------------------------
B7R675_9THEO/7-162.RKNSLELREQSINGILR...-----------------------------------------------------------
O66703_AQUAE/10-154.YKDEPELRIPSIKGMLR...-----------------------------------------------------------
Q47PK0_THEFY/7-173....DEPLRVSSLRGAMR...-----------------------------------------------------------
A6LNK0_THEM4/7-158..RKDFKLTSQTIRGILR...-----------------------------------------------------------
B7IFF0_THEAB/10-183.KYKDSILLPQTVRGVMR...-----------------------------------------------------------
A8UTQ9_9AQUI/7-200EPNKYAELRPASFVGLLR...-----------------------------------------------------------
B2V8M0_SULSY/7-150GKLDSIFIRPTEIKSTMR...-----------------------------------------------------------
A8V361_9AQUI/9-167.FGQSDDIRPSEIKGLMR...-----------------------------------------------------------
A8M9C0_CALMQ/7-192SVDYDWPLRPSEVKGVWR...-----------------------------------------------------------
Q96Z54_SULTO/9-305KVGYEEPIRSTEIKGLWK...-----------------------------------------------------------
Q97WX2_SULSO/9-255NEFYEENVRPTEIKGLWR...-----------------------------------------------------------
D2PID8_SULID/27-180KGETSNRIDEDEIVGRLR...-----------------------------------------------------------
Q97Y38_SULSO/24-174RGYTSDHVDEDGIVGKLR...-----------------------------------------------------------
C4KFX7_SULIK/27-177EGKTSNHVDEDEIVGRLR...-----------------------------------------------------------
Q8TPH8_METAC/9-242LEENSLVLHSDTIFNAIC...-----------------------------------------------------------
A6UVY5_META3/7-263LTESSTILHSHSLFSALV...-----------------------------------------------------------
A1KMG2_MYCBP/9-193LESSTISCPADTLYSALC...-----------------------------------------------------------
Q5HK92_STAEQ/9-199LSDGEMTITADTLFSALF...-----------------------------------------------------------
Q9X2C8_THEMA/9-196TDSTLPTIHSDTIYGAVV...-----------------------------------------------------------
A3DLB2_STAMF/6-246VESVNKFIPSTTIWSALL...-----------------------------------------------------------
B8GB50_CHLAD/99-293RVFGVPFMAASSWKGMLR...-----------------------------------------------------------
A1ZVA0_9BACT/4-254TANREFYVPGTSLKGAIR...-----------------------------------------------------------
A5ILN4_THEP1/4-318HPDGSVYIPGSSLKGAVK...-----------------------------------------------------------
Q46CS3_METBF/9-174LQQTRPYVPAKTMWGALT...-----------------------------------------------------------
A6DAF6_9PROT/10-162VNETRIFIPGITMWGALT...-----------------------------------------------------------
Q2FL73_METHJ/7-220FSQTLSYVPGRTIRGMIG...-----------------------------------------------------------
A0ZJ98_NODSP/7-256VSEAEDYIPGSVIRGALA...-----------------------------------------------------------
A4XGT8_CALS8/240-441TVYTKKYIPASVIRGLLA...-----------------------------------------------------------
A9AUN3_HERA2/7-220SSVSFDYIPGSAIRGALI...-----------------------------------------------------------
A3DKC7_CLOTH/8-205NEYSYSYIPGSVVKGAVA...-----------------------------------------------------------
Q8TVR9_METKA/10-323TRVDDPWIPGTSVKGALR...-----------------------------------------------------------
Q8TVU2_METKA/6-335RHTRVPYVPGSSVKGALR...-----------------------------------------------------------
Q6L316_PICTO/4-317KIFFRPFIPGSSIKGAIR...-----------------------------------------------------------
Q97CJ4_THEVO/4-334KKTFVPFIPGSTIKGAIR...-----------------------------------------------------------
Y1667_METJA/49-345NQNNTYYIPGSSIKGAIR...-----------------------------------------------------------
A6DE72_9PROT/4-332KFEFKPIIPGSTLKGVIR...-----------------------------------------------------------
O27150_METTH/4-274KTSDEIYIPGSSIKGSIR...-----------------------------------------------------------

PF08798

C1NCW0_9ESCH/1-198..SRDLYQLHQGLWHLFPN..-------------.....RPD--------------------------------------
Q1GAI3_LACDA/1-205..LSHLGAYHNWVERSFPA..-------------...EIAEG--------------------------------------
Q1EQT0_STRKN/3-219..TATAVGLHRRLMALFPQ..-------------.DAGPDPR--------------------------------------
Q8X7W1_ECO57/1-212..DRGEYVMHQWLWDLFPG..-------------.......G--------------------------------------
A4XYT8_PSEMY/1-203..LADAYEMHRTLARAFVT..-------------....DEHS--------------------------------------
Q67RN9_SYMTH/1-223..LRDVQALHQRVMSAFPD.V-------------LDPEVEAR--------------------------------------
Q8KB24_CHLTE/1-202..ITDSYSLHRVIYSLFEDVR-------------SEAEKRSS--------------------------------------
A5UR13_ROSS1/1-237..LSDVYRLHRTILSAFPQ..-------------APDNVPAR--------------------------------------
Q1J366_DEIGD/4-210..LASPYALHQTLRWAFAG.A-------------GVEGAPLP--------------------------------------
Q5PEG8_SALPA/1-232..SARPYASHQWLWQLFPE..-------------.......Q--------------------------------------
A5FTJ9_ACICJ/1-224DGSARVAATHHLVWSLFAG..-------------.....DAD--------------------------------------
A1SV70_PSYIN/1-178..THDIYEQHQAIWSLFEN..-------------.....VAD--------------------------------------
Q2RXJ4_RHORT/4-241..TDEGRALHHLLGESFGK..-------------........--------------------------------------
B3ENH7_CHLPB/1-201..ITDDYSLHRVVYSLFEDRR-------------SEAEKNAS--------------------------------------
Q2JWC6_SYNJA/1-204..LSNAHALHQRIMHGFPD..-------------.QPTKTPR--------------------------------------
CSE3_THET8/1-211..LANPYEMHRTLSKAVSR..-------------....ALEE--------------------------------------
A3LCN7_PSEAI/1-202..LGDAYEMHRTLSRVFAD..-------------.....EQA--------------------------------------
Q57KI5_SALCH/1-212..ECGEYVMHQWLWDLFPG..-------------.......G--------------------------------------
Q0W583_UNCMA/1-248..LADCHELHRTILGGFPD.L-------------NGKGGEAR--------------------------------------
A0LM55_SYNFM/1-201..LSDIYLLHKGIMSGFTR..-------------......CG--------------------------------------
Q60AD3_METCA/5-237QDQDLGYATHAWLKALCGE..-------------........--------------------------------------
Q1JX12_DESAC/1-200..CRNPYEIHRILWNLFPS..-------------.....DAD--------------------------------------
A1ARH5_PELPD/1-222..LSNPYQLHSTLCRAFSP..-------------...PETKC--------------------------------------
Q6LWA0_PHOPR/2-180..VIDTYEQHQAIWELFPN..-------------.....SSE--------------------------------------
C1DSI0_AZOVD/1-204..LADAYDMHRTLVRAFVR..-------------....DERD--------------------------------------
Q1EQJ3_STRKN/1-237..LSSPQALHAGVMSSFPQ..-------------..ILPSAP--------------------------------------
Q2JH26_FRASC/2-267..LKNPQRMHAAVLGGLSR..-------------......QP--------------------------------------
Q03C59_LACC3/1-212..LTHLGAYHDWVKRSFPR..-------------...EIAAG--------------------------------------
Q3ZZ80_DEHSC/1-206..SSRPYELHRSLLKAFPD..-------------....KADG--------------------------------------
A7MFK9_CROS8/1-212..ARGEYVMHQWLWELFPG..-------------.......V--------------------------------------
Q5YRB7_NOCFA/1-222..LSSPQAAHAAVLAAFPP..-------------...QPSTP--------------------------------------
Q7N8H4_PHOLL/1-223..ANGVYTSHQLLWKLFST..-------------.......D--------------------------------------
Q0BRF7_GRABC/2-239GTQDNDAVLHHLLTQLFGR..-------------........--------------------------------------
A6W167_MARMS/1-223..GKGVYSTHQMLWQLFTE..-------------.......E--------------------------------------
A8M405_SALAI/1-222..LASPQAMHAAVLSGFPR..-------------..PEDHTR--------------------------------------
A3EQA3_9BACT/1-214..LSDPYQLHSTLCRAFSP..-------------...PSQKC--------------------------------------
Q1ZM76_PHOAS/1-219..RNDAYAAHQLLWQLFHQ..-------------.......Q--------------------------------------
Q314I5_DESDG/1-218..GKNLYDTHRLLWNLFAD..-------------.....APD--------------------------------------
A0AE92_STRAM/1-253..LSSPQAMHAAVMSSFPH.I-------------LPSDSPQP--------------------------------------
A8LYZ8_SALAI/3-204..LRDTTALHRRVMSLVPD..-------------.GLGEQPR--------------------------------------
Q825C0_STRAW/3-217..NDSAMGLHRRLMSLYPC..-------------.DAGPDPR--------------------------------------
Q47PJ5_THEFY/2-225..FRTAGNLHRKLIRLSSDLG-------------EERIANPR--------------------------------------
F2GBG6_ALTMD/1-221..RNGVYASHQLIWQLFSN..-------------.......V--------------------------------------
Q74DC7_GEOSL/1-201..CRNPYEIHRVLWKLFPE..-------------.....DAD--------------------------------------
Q0RTG6_FRAAA/28-266..LRNPERMHAAVLGGLTR..-------------......QP--------------------------------------
A7BA62_9ACTO/1-248..MRSRQTLHAAVLNCFPP..-------------..SVLDDP--------------------------------------
Q1R113_CHRSD/1-229..EGGAYTAHQLLWTLFAD..-------------.....TSE--------------------------------------
Q6NEQ5_CORDI/5-227..LTDPSFRHRAVMALFPD..-------------.TDSPLPR--------------------------------------
Q2FNT6_METHJ/1-225..VTGPYQVHEVIWDLFAD..-------------.....HPD--------------------------------------
A5F3T0_VIBC3/4-208..ITDAYSLHRVVYSLFPDVR-------------SPEEKGGH--------------------------------------

PF09559

Q1CW34_MYXXD/4-194--LDHGYALFSALCTRVPA--------------------LHE--------------------------------------
Q1CW45_MYXXD/31-221--LDHAYLLFSALSRHLPA--------------------LHE--------------------------------------
Q3M7D9_ANAVT/30-227--FDHGYELFSAIAHFEPK--------------------LHT--------------------------------------
Q8F1E7_LEPIN/7-205--ADHGYGLYSAICHLCPT--------------------LHE--------------------------------------
A0YQL0_LYNSP/20-218--IDHVYPLYSAFCRQEPL--------------------LHQ--------------------------------------
Q0A841_ALHEH/18-219--ADYAPALAEALADPLAD--------------------FSR--------------------------------------
A1WYF2_HALHL/43-244--EAYAVPLADALAPRLAP--------------------LLD--------------------------------------
A1AWQ7_RUTMC/19-218--INHSFLLAQTLLKHLPW--------------------LDE--------------------------------------
Q4JN26_9BACT/18-217--YDHAYELSSEILNLVPQ--------------------IKN--------------------------------------
Q3SG16_THIDA/19-212--ADNAQMLCDALLGVLPW--------------------LGE--------------------------------------

PF09700

Q746D9_THET2/1-351.AKSLPFPLPQTLAGAYRTRR-------------ALLEGLPL...PERAEEVLR.....................WGLR.
A0B6W4_METTP/4-358DVGGLFPPSAFTVVGAIRAHL-------------ARSMGWRE...GKWSEEICR...........VLGDGYDLAGLRFR.
O28413_ARCFU/3-341.VARTILPLPQTLAGAVRSAI-------------YVKYGSKV...KDLIGFGKE..................EPEFEIL.
A6LNK2_THEM4/6-323.TEASIFPNPKTFYGAIFAAY-------------LRKNKLSV...DDIEKIIEN...................KKLSII.
A6VYS5_MARMS/4-381.AEAAKFPPPSTIAGALRNIH-------------GRTIGIDF...NDRNNQEQL................NSLLEVPVT.
Q47PK4_THEFY/13-381ALAETVIPRPSTIAGAAASAY-------------GGDLT.....................................AVR.
A4BL65_9GAMM/5-384.SEALMPPWPSVFAGALRTRM-------------LIDAGVDP...NAFAAGRAR....LPAGYAEALGTPAQPGGFTL..
Q9KFY7_BACHD/8-408.AYSMMDVVPGVIAGTVRTML-------------AEQAAKSS.......................RVVDYHTFSKVPVY.
A6UNE8_METVS/6-362FVRSKEFPQQTSLLGMIKKEI-------------LIITGVYK...EDFKEYREKELENTIGKTFKLSDSNQNHGIINSI.
O66707_AQUAE/4-323HIQKSIFPPPIMRFFHIFN..-------------..........................................SVY.
Q97WW9_SULSO/5-306.AQSLIIPRPSTIAGMLGYIL-------------FNKSSGTGDWLSDLTNLLDT.......................IY.
Q1CW30_MYXXD/6-386.GYSLPWPLPTTVRGALRAAW-------------GHDAMAVS...GAVLAPDEW.........ERCSEEVRLRHLVALR.
Q9X2B3_THEMA/6-327.RVESVFPSSFPFYGAVRTAL-------------LMKNQ........................KFDPGDVERAGDVRMF.
A7C3N9_9GAMM/9-401.LSSIFPPSARTVAGAVRTLI-------------GENTEVDW...NDFHQNENH.......HLRKEIGDSKQLGQLKLV.
Q2JN53_SYNJB/4-377.ANSSFPPSGHTLAGAVQAYL-------------GQPLT....................................LRLR.
A3IZR5_9CHRO/4-391.AGSMFPPNGHTIAGALRGLL-------------GKKDD....................................FQIK.
Q8U1S7_PYRFU/4-321.VARSIIPLPQTVAGAIRTLL-------------FYKGLKNC...VGVGEEEPE.....................FTLV.
A9AWU6_HERA2/68-470.AYTQSFPPPSVLAGVIRSQT-------------AYASKLQF...TRNSDDNRH..............QGNKLQPIQIY.
A1WUQ1_HALHL/5-362.GAALMPPWPSVFAGALRSAM-------------LSAAGADP...AQLRSGELP......APLDTVLGTPEEPGTFTLT.
C0A715_9BACT/6-379DALSQFPPSPRTITGALRAAL-------------ARANGWNG..TGRWIPELNT..........AFGKDADNLAKLQFC.
A5D0Z3_PELTS/4-387.AFTLAFPFPSTIAGAVRTRD-------------GLDASGRF.......................QPAEIPRLKKIEVL.
A1ZP54_9BACT/3-366.AEGLFPPGPGVFYGALRSLY-------------FSLHPHEM...GKAGQTNDP..................TAHLRIK.
Q8TVU0_METKA/10-439.VAESEGPKPWTVAGCVRNAL-------------LEVTDGDL...GEVLEYPRK.....LVRSAPPGSIGEALGETALFL
Q2JRT1_SYNJA/4-372.ANSGFPPSGHTLAGAILAHL-------------GQPAT....................................LRLC.
Q6ZEA9_SYNY3/4-365.AGSIFPPNGHTLAGAVRSLL-------------PQNQT....................................ISLI.
Q1IZS1_DEIGD/6-393.AQSLPLPLPHTLAGFIRTQL-------------GEGRGLKW...RNLSDDALR.............RELQALHNTPIR.
A7GFA9_CLOBL/4-366.IQTKNVAYPSTFFGAIFTAI-------------LANNDEFR...ESFLNIPGN...............TDHLEILNIK.
A8DJU1_9BACT/6-369.QMLSGLPLPQTLAGAICTAL-------------MQAAGCDF...GRLRHALEEGKPFAKAVCEACSAEAHWIGALAVR.
Q7MTH3_PORGI/6-391FVYSSLFPQQTTLLGLLRYQL-------------LQIAGEEIFKDNKIQDEHKAGELIGKQSFSPFVKDKLQFGIIQSL.
A9AVY8_HERA2/6-387.AKSLSFPPPSVTVGGFRARA-------------GVKANYNF...SAKLSDPEY................TNLLAMQVR.
Q8R6Z6_THETN/4-372.VVYSIFPHPHTLAGAICTKI-------------HAHTKIDT...SRILK..........................NVY.
E6XI87_SHEP2/4-375.AQAARFPPPSTVAGALRNIH-------------ARSNGKPL...N........................NELLKLAVT.
Q1AZD9_RUBXD/4-359EVTGVFPPSPTTVVGALRAAF-------------ARELGWRC...GDWPENVKA...........KLGDGQRLGPLRFA.

PF09704

Q2MF31_STRSD/16-248...TRPEPTKSGIIGLLAAAE.............GRPRGES............V--------------------------
Q7NYP8_CHRVO/13-224...SYDVITPSAARGILEAVH.................................--------------------------
A1ARH6_PELPD/3-217...TGKEPSKSGVVGLLAAAL.............GIDRENW............V--------------------------
Q12YA8_METBU/4-236...TYDHPSKSAIFGLIAAAL.............GIRRDEE..........ERH--------------------------
Q0BSC7_GRABC/6-215...SLIWPTRSAIIGLMGAAL.............GIERDGDF.........SAL--------------------------
A8ABL4_IGNH4/3-275AQLAPPLPPPSTAIGALAEALAITLGLGETIKVAGKAAKRGRKRSKEGLCSTAY--------------------------
A6W168_MARMS/4-241...TAIAPTRSAILGLLGAAL.............GIKRDDA..........QQL--------------------------
O66696_AQUAE/3-211...TYPLPPYSTVIGLLYTAS.............GKKWKGE.............--------------------------
A8ZZ17_DESOH/3-251...TANYPGRSAIIGLMAAAL.............GIKRSET..........ENQ--------------------------
Q1EQJ4_STRKN/3-213...TENAPTKSGVIGLLAAAQ.............GLERTAD............L--------------------------
A5UR14_ROSS1/3-244...TTDAPTKSGVIGLLGCAL.............GLRRDDA...........RL--------------------------
Q8Z465_SALTI/4-233...SATVPTRSALLGLLAAAL.............GIRRDEE..........ARL--------------------------
Q3A5Z4_PELCD/3-236...SAVYPSKSALLGLLAAAL.............GIRRDEE..........EQQ--------------------------
C1DSH9_AZOVD/3-205...TQLEPSKSGVLGLVCAAL.............GRDRREP............L--------------------------
Q5YRB6_NOCFA/3-211...TQQYPSKSGILGLIAAAR.............GHRRTDP............I--------------------------
Q1CWU1_MYXXD/10-210...SYEVMTPSAARGVLEAIL.................................--------------------------
A3DLC5_STAMF/3-270TNPSYYYPPPTTILGAIAEPI.............AKEYKLGENSASVRKLLASL--------------------------
A4J385_DESRM/4-212...SYDVMTPSAARGILESIH.................................--------------------------
Q65TW5_MANSM/4-216...SYDVITPSAARGILSAIH.................................--------------------------
Q8KDC0_CHLTE/7-228...SYDVITPSAARGIFEAIF.................................--------------------------
Q5H4J6_XANOR/4-215...SYDIITPSAARGILEAIH.................................--------------------------
Q9X2C0_THEMA/3-212...TLPFPPRTTLLGLVGCVL.............GYSTPER.............--------------------------
Q03C60_LACC3/3-210...TGDYPSKSAIIGMLAAAL.............GYQRDDP...........AI--------------------------
Q8U334_PYRFU/3-239...SFLLPPPSALKGALAKGLIL........LKPEKYASSSLDEAALKAIKEIE--------------------------
Q47PI7_THEFY/3-209...TEHAPTKSGVLGLLAAAQ.............GRERTDD............L--------------------------
O28407_ARCFU/3-252TSPSFYYPPPTTFLGAVAEAI...............AKDKGIGEQRGKEIISEL--------------------------
Q2SID2_HAHCH/4-215...SYDVITPSAARGIIEAIH.................................--------------------------
CAS5_METJA/5-228...SLLLPSPSALKGALAKGII..........LLGGKKGKSLDEIAKKTVEELE--------------------------
Q72NC2_LEPIC/11-225...SYDVITPSAARAIFDAIL.................................--------------------------
O27159_METTH/3-241...TYPLSPKSTVTGMLQNAT.............GRYYDQD.............--------------------------
B3E5U9_GEOLS/3-263...SAVYPGKSALLGLIAAAL.............GIRRDEE..........QRQ--------------------------
Q04QB7_LEPBJ/4-240...SDSFPTKSAIIGLISASF.............GFDRSED..........GKI--------------------------
Q60AD2_METCA/3-241...TEQFPGLSMLAGLLGNAM.............GYRHG.DA.........DAL--------------------------
Q2RL62_MOOTA/18-224...SYPVMTPSAARGILEAIF.................................--------------------------
A5GBK2_GEOUR/12-223...TGLMPTKSAIAGMCCAAL.............GFLRGCD..........KEQ--------------------------
Q72WF9_DESVH/10-218...SYDVMPPSAARGILEAIH.................................--------------------------
Q0W584_UNCMA/6-214...TGDEPTKSGIIGLLGCAL.............GYARKDP..........RLT--------------------------
Q1NKD4_9DELT/4-199..CSYHIPTYEALKGVAKSVY.................................--------------------------
A4YFV1_METS5/10-233EKRATLLPPPTTLVGALSY...............GKFRGFDVSGDMKGSPAISI--------------------------
A8LYZ7_SALAI/3-226...TGTVPTRSAMIGIIAAAQ.............GRHRGEP............L--------------------------
CASD_ECOLI/4-214...TGRFPTRSGLLGLLGACL.............GIQRDDT..........SSL--------------------------
Q0AZP3_SYNWW/4-212...SYDVITPSAARGILEAIH.................................--------------------------
Q1R114_CHRSD/4-250...TATYPGRGAILGLIGAAL.............GIRRDDD..........EGQ--------------------------
CAS5C_SULSO/5-232AKSGFYLPPPTTLIGALSY...............GKFRGIDNTNLGKIYGSPAY--------------------------
Q2RW65_RHORT/4-212...SYDVMTPSAARGILEAIH.................................--------------------------
Q5P3Y6_AROAE/8-203..CSYHVPTYEALKGIAKSIY.................................--------------------------
Q314I4_DESDG/4-228...TSTMPTRSAVLGILAAAI.............GIRRDEE..........TRL--------------------------
A1SV73_PSYIN/3-198...ANHFPTRSAIMGILGAAM.............GITRENF..........NEL--------------------------
Q1EQS9_STRKN/13-242...TARFPTRSGIIGMLAAAL.............GRRRGEP............V--------------------------
Q3YYA5_SHISS/4-233...THELPSRSALLGLLAAGV.............GIRRDDT..........ERL--------------------------
A6TNS2_ALKMQ/6-209..FSYQVPTYQALKGILESVY.................................--------------------------
B4SAU9_PELPB/4-206...SYDVMTPSAARGILEAIY.................................--------------------------
Q1H3R5_METFK/4-216...SYDVMTPSAARGILTAIH.................................--------------------------
Q67RP0_SYMTH/3-220...TGMEPSKSGVIGILCAAL.............GKPREERPEDG...GRWPSL--------------------------
Q2JWC5_SYNJA/3-192...SRREPTKSAVIGILCAAL.............GRPRWEP............V--------------------------
B1YHA3_EXIS2/4-198..MSYQVPTYQAIKGIVESIY.................................--------------------------
Q4JWK0_CORJK/4-209...TEQVPTKSGVLGLLAAAQ.............GRRRTDD............L--------------------------
Q7N8H5_PHOLL/4-236...TELYPGRSAILGLLGAAL.............GIQRDNE..........SEL--------------------------
Q60B28_METCA/3-213...SYDIITPSAARAIFEAIL.................................--------------------------
Q2LX12_SYNAS/8-216..CSYHVPTYEALKGVCKSIY.................................--------------------------
B8I205_CLOCE/4-212...SYDVITPSAARGIIEAIY.................................--------------------------
Q2RXJ5_RHORT/6-238...TRDFPAASMLTGLFANAL.............GWRRT.EW.........ERH--------------------------
C1DNX2_AZOVD/4-215...SYDVITPSAARGILEAIH.................................--------------------------
Q0AA33_ALHEH/3-231...TDRFPGRSMLTGMLANAL.............GWHHQ.DT.........EAL--------------------------
Q3ZZ79_DEHSC/6-199...TALEPTRSGVIGLICAAM.............GIARDED............I--------------------------
Q47PJ4_THEFY/3-220...TLPYPSRSGLIGMFAAAQ.............GVRRGDP............L--------------------------
Q6NEQ9_CORDI/4-220...TEPRPTFSSLRGLLAGAL.............GARRGEWP.........N..--------------------------
Q1JX11_DESAC/4-219...SGNFPTLSALLGLLGACL.............GIRRNEH..........GRL--------------------------
Q746C2_THET2/3-211...SYPVPTPSAARGLLEAIF.................................--------------------------
Q0RTG7_FRAAA/8-241...TLTEPTKSGLIGLLAAAE.............GRRRADP............I--------------------------
Q39WR9_GEOMG/10-218...SYDVMTPSAARGVLEAIL.................................--------------------------
Q977B3_SULTO/4-249GGKSFPYVPISTILGALSKSY.............CENYAVKNGTS...CTKEFI--------------------------
Q0BRF8_GRABC/3-224...TRDFPALSAVTGLLANAL.............GLDRT.DT.........TQL--------------------------
CAS5B_SULSO/4-251GGSSYIVPPITTILGALSRGY.............CSDYAVKNNVS...CTKEFI--------------------------
Q8ZZL1_PYRAE/3-217...TLPFIPPSTVVGALVQAAA...........RGGLCEGDCLAEVRGWIYKAR--------------------------
Q3ARV4_CHLCH/4-200..CSYHIPTYEALKGIVKSIY.................................--------------------------
Q1J367_DEIGD/3-208...TEAEPSKSGVLGLCAAAL.............GIDRADS............V--------------------------
Q9KFY3_BACHD/4-199..LSYSVPTYQALKGIAESIY.................................--------------------------
A5V1B9_ROSS1/6-202..YSYQVPTYEALKGILSSVY.................................--------------------------
Q04AW9_LACDB/3-211...SWPAPSKSAVVGMIAAAL.............GMRREDE...........RI--------------------------
O57910_PYRHO/4-218...TYPFPPKTTAVGMLAGCM.............GLGEEGFK.........K..--------------------------
Q184H2_CLOD6/3-221...TYPLPPYSTINGLIHKIL.................................--------------------------
A2BKI9_HYPBU/5-261AQPALPIPPPTTIVGFYAEPLAR.........LLGLAEYRGFPAKRPCSPAALL--------------------------
A1A2N3_BIFAA/7-207..YSYQVPTYQALKGITESIY.................................--------------------------
Q9YCM4_AERPE/7-241...PLPLPLPSTLLGGLMRGASLL......GSCTGGIASQSCIKKTGRIVKAAA--------------------------
Q6LWA3_PHOPR/12-207...VNHFPTRSAIVGILCAAL.............GISRDEH..........AKI--------------------------
A0AE91_STRAM/6-214...TESAPTKSGIVGLLAAAA.............GIERGDD..........TRL--------------------------
Q74DC8_GEOSL/4-217...SGNFPTRSALLGLLGACL.............GIRRNEA..........GRL--------------------------
Q8KB22_CHLTE/5-230...TLDFPTKSGLLGLLCCAL.............GAGGEQR...........EL--------------------------
Q1JAP7_STRPB/6-202..SSYSVPTRQALNGIVDAIY.................................--------------------------
Q2J7P3_FRASC/14-209...SYPVMTPTAAVGVLESIF.................................--------------------------
Q5JGB2_PYRKO/7-237...ALRYVPPTTLIGAISYPLLH.........ISDDRGETIYEKKTFKSKAESV--------------------------
B3ENH9_CHLPB/5-225...TIDFPTKSGILGMLCCAL.............GAGGEQK...........EL--------------------------
Q96X68_SULTO/5-233AKPSFYLPPPTTLIGALSY...............GKYRGVDTKAFKGKAGSPAL--------------------------
Q53WH0_THET8/3-225...TWPYPTKSGVVGLLAAAL.............GRDRRED............V--------------------------
A5D0R8_PELTS/6-219...SYPVITPSAARGVLEAIF.................................--------------------------
Q2RY19_RHORT/6-247...TWDVPAKSAILGLLAAGL.............GIDRADR..........TAH--------------------------
A0LDG2_MAGSM/7-202..LSYHIPTYEALKGICKSIY.................................--------------------------
Q3SR91_NITWN/4-221...SYDVITPSAARGILEAIH.................................--------------------------
Q1ZM77_PHOAS/4-242...TGVIPSRSALLGLLGAAL.............GIKRDEQ..........STL--------------------------
Q9UZX1_PYRAB/18-248...ALRYIPPSTLIGAIAYPLFH.........IAGYRGETLIDRRNPRSAADKI--------------------------
A4SFQ4_PROVI/7-227...SYDVITPSAARAIFEAIF.................................--------------------------

PF01881

A3I0J5_9BACT/85-250---------------------------.EEAGK------------------RFI------S-------------------
B4SEV7_PELPB/102-262---------------------------.ADHYP------------------QYL------Y-------------------
A9BGZ0_PETMO/94-248---------------------------NSSKKT------------------IYF------S-------------------
B4S5I3_PROA2/102-261---------------------------.GDKYP------------------RFL------L-------------------
A9BIX0_PETMO/95-244---------------------------NGNRYT------------------HYF------S-------------------
B8FSG8_DESHD/95-244---------------------------DGRKYT------------------VYF------Q-------------------
A5D0Y7_PELTS/95-244---------------------------EGGKYT------------------CYY------Q-------------------
O30164_ARCFU/94-241---------------------------NGRRRI------------------FDL------Y-------------------
CAS6_PYRHO/96-239---------------------------..GGKR------------------YDV------S-------------------
A7HMV7_FERNB/94-242---------------------------DGKKFT------------------KFH------S-------------------
Q5JGA0_PYRKO/94-241---------------------------FGKPRS------------------YDL------S-------------------
A1BI29_CHLPD/102-262---------------------------.GDLYA------------------QYL------F-------------------
A5ILP0_THEP1/93-246---------------------------NGKLYH------------------RYL------H-------------------
A4XIJ2_CALS8/97-249---------------------------ENSEYK------------------HFF------T-------------------
CAS6L_PYRFU/91-238---------------------------GDKLKH------------------WDL------Y-------------------
CAS6_PYRFU/95-238---------------------------..KGKS------------------YDV------P-------------------
O66704_AQUAE/85-236---------------------------KDSPEE------------------RYI------T-------------------
Q97CI9_THEVO/80-232---------------------------.DNKKN------------------KYF------S-------------------
Q6L312_PICTO/82-235---------------------------.DNRKN------------------RYF------S-------------------
Y1234_METJA/81-240---------------------------.DKDRG------------------EYI------K-------------------
Q6L114_PICTO/79-219---------------------------..KYNG------------------EYI------D-------------------
A5TU40_FUSNP/91-242---------------------------..ENKD------------------IYY------S-------------------
Q3AA81_CARHZ/95-248---------------------------YTKPYY------------------IRY------T-------------------
Q1AZD0_RUBXD/93-249---------------------------EGRKKT------------------YYY------S-------------------
Q6L357_PICTO/89-232---------------------------.SKKLD------------------NFV------T-------------------
Y375_METJA/95-240---------------------------EDGLKT------------------YDL------L-------------------
Q4EVR3_LISMN/89-240---------------------------..TFKN------------------WFY------S-------------------
Q2NFS1_METST/92-244---------------------------EGKLKI------------------RDL------A-------------------
O27163_METTH/1-154---------------------------DGVLKQ------------------WDV------N-------------------
A7GQ92_BACCN/87-233---------------------------......------------------.PI------F-------------------
O57900_PYRHO/78-237---------------------------.DSRKN------------------EYF------K-------------------
A4J1X6_DESRM/95-249---------------------------EGSKKT------------------YYY------S-------------------
Q46FQ7_METBF/89-241---------------------------DDRLVE------------------FDL------Y-------------------
A5UJJ7_METS3/89-241---------------------------NGELKI------------------WDL------A-------------------
Q5JHS4_PYRKO/92-239---------------------------NGRMKV------------------WDL------Y-------------------
Q332K8_CBCP/101-247---------------------------.ENGLV------------------KFL------N-------------------
O66560_AQUAE/87-244---------------------------LGNRND------------------DFI------L-------------------
A1ZVQ2_9BACT/100-263---------------------------.HNKHC------------------TYL------A-------------------
CAS6L_PYRHO/91-238---------------------------GNKLRH------------------WDL------Y-------------------
Q184H4_CLOD6/91-242---------------------------......------------------.FL------E-------------------
A4XM43_CALS8/98-260---------------------------....DK------------------IPI------L-------------------
A1ZPF3_9BACT/98-260---------------------------.NRGNV------------------DYL------P-------------------
A8F3P6_THELT/92-245---------------------------QGKLSH------------------KYL------T-------------------
Q8TJV5_METAC/89-241---------------------------NDKLVE------------------FDL------Y-------------------
Q12WX9_METBU/89-240---------------------------NDKLVE------------------IDL------Y-------------------
A6DAF5_9PROT/81-224---------------------------.TLKNN------------------RFW------T-------------------

PF10040

A1RZS7_THEPD/144-263---------------------------...GDK------------------EYK------V-------------------
A4J507_DESRM/140-259---------------------------...NGI------------------QHI------.-------------------
Q3M5G3_ANAVT/172-285---------------------------...GKF------------------DTT------.-------------------
A0ZJZ0_NODSP/168-289---------------------------...KGH------------------HFP------.-------------------
CAS6A_SULSO/138-277---------------------------RYKRVN------------------AGY------S-------------------
Q2JNR9_SYNJB/173-292---------------------------...RGH------------------HLP------.-------------------
A8ABE5_IGNH4/136-254---------------------------...GEE------------------LRT------R-------------------
Q7TXS3_MYCBO/184-300---------------------------...SGE------------------YVF------.-------------------
Q6ZED0_SYNY3/149-272---------------------------...QGN------------------HYP------.-------------------
A0ZJ83_NODSP/132-250---------------------------...GGV------------------NLP------.-------------------
A1HND4_9FIRM/191-314---------------------------...EHN------------------LVT------T-------------------
Q03KT3_STRTD/120-237---------------------------...QGS------------------YVI------.-------------------
B8G917_CHLAD/148-265---------------------------...RGM------------------TMP------.-------------------
Q977A9_SULTO/131-247---------------------------...GKM------------------NRF------L-------------------
Q72GC1_THET2/120-235---------------------------...KGV------------------HYP------.-------------------
A3MST1_PYRCJ/120-246---------------------------...KRG------------------RVF------D-------------------
Q2FR84_METHJ/135-257---------------------------...EKN------------------ERM------E-------------------
A3CNA0_STRSV/121-238---------------------------...QGQ------------------FVL------.-------------------
A7NKQ1_ROSCS/148-265---------------------------...RGL------------------NQP------.-------------------
A1HM59_9FIRM/128-245---------------------------...DNA------------------YQI------.-------------------
Q9YCN0_AERPE/126-238---------------------------...RSR------------------PIL------.-------------------
Q745V3_THET2/136-262---------------------------...GGR------------------TRY------T-------------------
B3EIY9_CHLPB/190-323---------------------------...RKE------------------LLT------R-------------------
Q8ZZK8_PYRAE/121-246---------------------------...RKR------------------AIF------D-------------------
A0YW92_LYNSP/157-270---------------------------...GKF------------------DTS------.-------------------
A3DLD1_STAMF/165-291---------------------------...KKT------------------RYK------R-------------------
Q74DY6_GEOSL/182-301---------------------------...DGA------------------PLR------S-------------------
A1RZX7_THEPD/116-252---------------------------GPRRRY------------------RLV------P-------------------
B4S549_PROA2/190-323---------------------------...RKA------------------LVT------G-------------------
Q4J7R1_SULAC/134-279---------------------------K..KVR------------------SMN------R-------------------
Q1Q3G5_9BACT/191-313---------------------------...NGH------------------ITD------I-------------------
A8M9A8_CALMQ/139-276---------------------------...RAS------------------NVL------.-------------------
A1RQV9_PYRIL/103-214---------------------------...HGR------------------DVL------.-------------------
Q5HK95_STAEQ/125-242---------------------------...QNS------------------YMI------.-------------------
A6NTQ0_9FIRM/121-240---------------------------...RKA------------------YDV------.-------------------
A8AA66_IGNH4/119-232---------------------------...HGA------------------WVP------.-------------------
Q01QC2_SOLUE/166-288---------------------------...DGA------------------LAG------R-------------------
Q4J7D4_SULAC/139-264---------------------------...RKD------------------NRF------V-------------------
Q8ZZU6_PYRAE/127-238---------------------------...HGR------------------DVL------.-------------------
A2BMX9_HYPBU/151-264---------------------------...HGA------------------LVS------.-------------------
Q6ZEI4_SYNY3/146-257---------------------------...IDR------------------NTI------Q-------------------
A6DE70_9PROT/157-271---------------------------...DGK------------------YVR------G-------------------
A9AZH6_HERA2/148-265---------------------------...RGL------------------NQP------.-------------------
A0LHY9_SYNFM/189-312---------------------------...EGE------------------LCT------D-------------------
Q4J7P9_SULAC/157-283---------------------------...DRV------------------KYR------R-------------------
Q0AW55_SYNWW/127-244---------------------------...DGS------------------YVL------.-------------------
Q3IQ75_NATPD/155-285---------------------------...EAD------------------GVT------T-------------------
A0B9F8_METTP/179-310---------------------------...RNS------------------GVC------E-------------------
Q39T05_GEOMG/185-303---------------------------...DGR------------------PSR------T-------------------
A4YFW1_METS5/128-262---------------------------RF.RGR------------------GSN------F-------------------
B9LJK3_CHLSY/148-265---------------------------...RGL------------------NVP------.-------------------
A4YFU6_METS5/153-294---------------------------KYRRKK------------------IGF------S-------------------
Y1859_ARCFU/176-286---------------------------...MEA------------------KTP------I-------------------
A0YIK9_LYNSP/157-279---------------------------...KGH------------------HFP------.-------------------
A1BI47_CHLPD/189-322---------------------------...EQE------------------LLT------G-------------------
Q8TVD3_METKA/146-270---------------------------...DGK------------------PR.------.-------------------
A0YUQ2_LYNSP/96-214---------------------------...GKL------------------QLP------.-------------------
A3MVN5_PYRCJ/123-252---------------------------...RRR------------------ALF------D-------------------
Q97YE5_SULSO/103-228---------------------------...RKG------------------NRY------V-------------------
Q2FM73_METHJ/142-275---------------------------...RNS------------------RVT------E-------------------
Q8ZZM1_PYRAE/124-249---------------------------...RRR------------------ALF------D-------------------
A9AX64_HERA2/145-264---------------------------...QGK------------------QRV------G-------------------
A8ZV96_DESOH/179-301---------------------------...QNR------------------LTA------D-------------------

PF03787

Q1Q3H4_9BACT/4-335---------------------------..TSIM..................YVI------L...................
Q8TPH7_METAC/4-317---------------------------..TALMWNCLNERPDGMEIVQNGLQKW------L...................
O57906_PYRHO/18-333---------------------------..TAVLYKVLKDCGDVPTVVEALGKYG------K...................
B3EIY8_CHLPB/11-320---------------------------..TAVLVD................WLL------N...................
A6LNL6_THEM4/4-297---------------------------..TALI..................RGN------N...................
A4XFP8_CALS8/12-334---------------------------..SFVT..................KAL------K...................
Q3AA80_CARHZ/5-311---------------------------..TLIY..................KIN------L...................
A7HMV5_FERNB/4-324---------------------------..TMLI..................KAT------S...................
A2VLF2_MYCTU/11-314---------------------------..SIYL..................QSL------V...................
Q0AW54_SYNWW/12-313---------------------------..TALA..................TYL------L...................
Q5HK93_STAEQ/9-268---------------------------..TTLV..................SKY------N...................
Q03KS9_STRTD/11-288---------------------------..TILM..................NTT------P...................
A2BKQ7_HYPBU/87-311---------------------------..SWLV..................HTV------L...................
Q2LQX1_SYNAS/103-281---------------------------TISLIP..................EAM------N...................
Q7MTH6_PORGI/59-251---------------------------..SAIE..................EWD------F...................
A7FVL1_CLOB1/73-293---------------------------..SVFY..................NKK------D...................
Q8TVU2_METKA/491-691---------------------------..AAGE..................LIL------E...................
A1WUQ4_HALHL/82-287---------------------------..QAAR..................ELA------E...................
A9AWU2_HERA2/90-292---------------------------..SFAH..................QRL------G...................
Q1CW33_MYXXD/74-261---------------------------..GYLR..................AVY------G...................
Q977D5_SULTO/23-210---------------------------..TRLE..................LSI------R...................
A8A9P3_IGNH4/77-241---------------------------..AFLE..................GCA------P...................
A1RZR1_THEPD/18-247---------------------------..SIAE..................KLA------P...................
Q2RV95_RHORT/11-210---------------------------..TLAR..................SLV------D...................
Q4J793_SULAC/8-222---------------------------..RVSE..................MIV------N...................
A4YFX5_METS5/9-241---------------------------..STTE..................AIV------E...................
Q4J7N6_SULAC/8-291---------------------------..STYE..................KYL------R...................
A8F3D7_THELT/30-277---------------------------..HQLE..................LLF------A...................
A4FJY4_SACEN/194-372---------------------------..SRAE..................YIC------R...................
A4YFW9_METS5/24-229---------------------------..SWLE..................ANV------E...................
Q2RY06_RHORT/19-223---------------------------..AWAN..................AYL------P...................
Q2RV95_RHORT/253-439---------------------------RAVWLE..................NLR------R...................
Q5LZX3_STRT1/11-194---------------------------..TLLA..................KVY------N...................
A5UWG2_ROSS1/10-302---------------------------..SYAA..................QLY------E...................
Q2JNS6_SYNJB/14-218---------------------------..AHAERIVRTVGSDRRPEGGGFKLWA------S...................
B9LIP8_CHLSY/265-444---------------------------..HRAG..................RIL------R...................
A7NFU0_ROSCS/21-222---------------------------..AQVE..................SLV------R...................
O66706_AQUAE/7-289---------------------------..EYHI..................KKV------A...................
A6LNK3_THEM4/7-272---------------------------..HEIN....................F------E...................
A6UNE9_METVS/9-264---------------------------..DYFV..................GLK------S...................
Q2FL77_METHJ/279-403---------------------------..HKLE.....................------....................
A1WUQ2_HALHL/9-296---------------------------..HGFK..................ALG------G...................
Q8TVT9_METKA/8-335---------------------------..HATL..................RKL------S...................
Q47PK3_THEFY/7-290---------------------------..QTAR..................DAG------W...................
Q2JRT2_SYNJA/7-252---------------------------........................ASV------A...................
A0YUX6_LYNSP/8-262---------------------------..SEIR..................QER------G...................
A0YQJ5_LYNSP/5-273---------------------------..EHAE.....................------....................
A8A9P1_IGNH4/9-272---------------------------..SEAL..................LSR------G...................
Q97WX4_SULSO/14-302---------------------------..SFLL..................KEY------S...................
Q97XK7_SULSO/7-290---------------------------........................ALC------A...................
A3MVP2_PYRCJ/10-303---------------------------..SRIE..................KTL------F...................
Q2JNS1_SYNJB/20-216---------------------------..HECE..................KLA------R...................
A5UT82_ROSS1/9-185---------------------------..DCAE..................TLL------R...................
Q2FL76_METHJ/14-206---------------------------..TELE..................RLL------R...................
B8G728_CHLAD/8-184---------------------------..ESLT..................NLL------T...................
Q6ZED2_SYNY3/7-200---------------------------..DSCE..................QVA------L...................
B0K2G5_THEPX/4-192---------------------------..ESAK..................EVC------D...................
A9AUN2_HERA2/7-194---------------------------..DECD..................TFI------A...................
Q7MC47_VIBVY/7-190---------------------------..DSFL...................VA------H...................
A3DH28_CLOTH/14-216---------------------------..STAE..................QIL------K.................EH
A4YFX0_METS5/20-218---------------------------..SAGE..................RIA------R...................
Q2JRT5_SYNJA/129-478---------------------------..SQAI..................REL------M...................
Q2FL77_METHJ/16-208---------------------------..STLE..................RLV------R...................
A4TG45_MYCGI/12-250---------------------------..RIGEQHTAAILDYESTLPVPAAHLL------T...................
A4XGU1_CALS8/51-316---------------------------..TLLEIVSFGKFSFCDIGRKLFYRAV------G...................
Q0ATZ2_SYNWW/170-634---------------------------..NLLEIVSCSQLKYVEDKRFYYRKVA------VPGRYQTLMIKGSKNRDGLR
B0K8W5_THEP3/133-594---------------------------..NLVEIVSFGKFEFFDKDKRLYYRDV------A...................
A3DH27_CLOTH/31-251---------------------------..SIAESISYSCLYIFDKQKKELIPEF------K...................
A3DKC8_CLOTH/235-405---------------------------..SRAE..................RLH------R...................
Q6ZED5_SYNY3/156-674---------------------------..SAYE..................AVT------N...................
Q82XX3_NITEU/10-223---------------------------..TAI......................------....................
A3DH32_CLOTH/9-175---------------------------..DNFY..................KIT------D...................
A6NTP4_9FIRM/14-168---------------------------..EYHR..................TAF------G...................
Q7MC49_VIBVY/10-189---------------------------..HLAE..................KYF------G...................
A0RRG9_CAMFF/11-179---------------------------..VKFQ..................DKF------K...................
A3DKC8_CLOTH/16-186---------------------------..NYYE..................NYI------D...................
A0YPM8_LYNSP/30-210---------------------------..NYLK..................ERE------H...................
D2C6C1_THENR/8-159---------------------------..WWTE..................ALL------R...................
Q8PRT5_METMA/8-181---------------------------..WWYE..................AII------R...................
O26428_METTH/15-144---------------------------..WWYE..................ALI------R...................
A7NRR3_ROSCS/6-141---------------------------..WWFE..................VLV------R...................
C9RCS1_AMMDK/9-145---------------------------..WWFE..................VLV------R...................
C9RCG8_AMMDK/9-178---------------------------..WWFE..................VVV------R...................
A5UWG6_ROSS1/4-173---------------------------..WWYE..................AIV------R...................
A7NRS6_ROSCS/4-175---------------------------..WWYE..................AIV------R...................
A5D4F7_PELTS/4-177---------------------------..WWFE..................AMV------R...................
B3EIR8_CHLL2/6-173---------------------------..WWYE..................AIV------R...................
B4S552_PROA2/12-192---------------------------..WWFE..................VLV------R...................
A6DAG1_9PROT/9-198---------------------------..FWFE..................VY.------..............CYFAGI
C7P6D1_METFA/9-230---------------------------..FWFE..................VL.------..............CYFNGI
B7IGV5_THEAB/8-173---------------------------..FWLD..................II.------..............CYFSGL
D3T315_THEIA/9-219---------------------------..FWFS..................VYW------KAVKNGNNEKLNNN....NV
O28411_ARCFU/9-154---------------------------..WWFR..................ALS------G...................
Q8U3V3_PYRFU/7-178---------------------------..WWFR..................ALA------G...................
D3T7Q1_THEIA/22-173---------------------------..FWWR..................AVK------A...................
B0M908_9FIRM/9-142---------------------------..FWWR..................AVQ------C...................
C5D4N4_GEOSW/18-161---------------------------..YWWR..................TLQ------E...................
Q53W07_THET8/34-193---------------------------..FWWR..................AVR------G...................
A9AWU5_HERA2/41-244---------------------------..FWWR..................AIR------G...................
D2ZTS9_NEIMU/25-187---------------------------..FWWR..................LLA------Q...................
D0W1J3_NEICI/30-211---------------------------..FWWR..................LLA------Q...................
E6XI85_SHEP2/30-186---------------------------..FWWR..................IAC------G...................
D1Y2F0_9BACT/26-187---------------------------..FWWR..................LLH------G...................
Q1IZR9_DEIGD/24-191---------------------------..FWWR..................ATA------G...................
D3PS14_MEIRD/23-188---------------------------..FWWR..................ATA------G...................
D2Z4K2_9BACT/26-193---------------------------..FWWR..................ATC------G...................
C5BIW8_TERTT/31-214---------------------------..FWWR..................ATR------G...................
Q9KFY9_BACHD/34-207---------------------------..FWWR..................ATR------G...................
C8WRP6_ALIAD/23-238---------------------------..FWWR..................TVS------QPGPLEQWIDKLREEEARKR
Q1CW28_MYXXD/33-206---------------------------..FWWR..................ALY------G...................
D3SNA7_THEAH/10-153---------------------------..WWFR..................VLV------G...................
Q2LQW6_SYNAS/16-162---------------------------..FWWR..................ALY------G...................
B6IX20_RHOCS/283-454---------------------------..WWWR..................TLH------V...................
A8DJU4_9BACT/304-514---------------------------..WWWR..................TLH------A...................
C8W3E8_DESAS/7-167---------------------------..FWYR..................AVT------L...................
C0A713_9BACT/8-185---------------------------..FWWR..................ALM------W...................
B8GSG8_THISH/11-176---------------------------..FWWR..................AMA------W...................
B7R675_9THEO/7-162---------------------------..WWFR..................FYG------G...................
O66703_AQUAE/10-154---------------------------..WWFR..................FFY------A...................
Q47PK0_THEFY/7-173---------------------------..YWFR..................ALA------G...................
A6LNK0_THEM4/7-158---------------------------..FWFR..................AII------P...................
B7IFF0_THEAB/10-183---------------------------..YYFR..................ATA------A...................
A8UTQ9_9AQUI/7-200---------------------------..YWFR..................VIV------G...................
B2V8M0_SULSY/7-150---------------------------..QAFR..................LVA------G...................
A8V361_9AQUI/9-167---------------------------..YWFR..................AVA------G...................
A8M9C0_CALMQ/7-192---------------------------..WWAR..................TFV------S...................
Q96Z54_SULTO/9-305---------------------------..WWTR..................ILI------E...................
Q97WX2_SULSO/9-255---------------------------..WWNR..................VLF------N...................
D2PID8_SULID/27-180---------------------------..WFLR..................TVY------D...................
Q97Y38_SULSO/24-174---------------------------..WFLR..................TVY------N...................
C4KFX7_SULIK/27-177---------------------------..WFLR..................TVY------N...................
Q8TPH8_METAC/9-242---------------------------..NSLA..................KLY------G...................
A6UVY5_META3/7-263---------------------------..NNFV..................RLY------G...................
A1KMG2_MYCBP/9-193---------------------------..VEAL..................RMG------G...................
Q5HK92_STAEQ/9-199---------------------------...........................------....................
Q9X2C8_THEMA/9-196---------------------------..YHAF..................KWS------E...................
A3DLB2_STAMF/6-246---------------------------..NSML..................QLG------I...................
B8GB50_CHLAD/99-293---------------------------..WVCR..................MQA------G...................
A1ZVA0_9BACT/4-254---------------------------..TALLY.................KYL------E...................
A5ILN4_THEP1/4-318---------------------------..LALTW.................HVL------R...................
Q46CS3_METBF/9-174---------------------------..ARLA.....................------....................
A6DAF6_9PROT/10-162---------------------------..NEYF..................KIT------G...................
Q2FL73_METHJ/7-220---------------------------........................WYL------Y...................
A0ZJ98_NODSP/7-256---------------------------..SQIL..................QLS------G...................
A4XGT8_CALS8/240-441---------------------------..KRLV..................EIL------K...................
A9AUN3_HERA2/7-220---------------------------........................GLY------Q...................
A3DKC7_CLOTH/8-205---------------------------..WGLV..................EEK------G...................
Q8TVR9_METKA/10-323---------------------------..TGLL..................LAA------L...................
Q8TVU2_METKA/6-335---------------------------..THVE..................AEL------E...................
Q6L316_PICTO/4-317---------------------------..NAVR..................NTY------I...................
Q97CJ4_THEVO/4-334---------------------------..NAIR..................NEY------I...................
Y1667_METJA/49-345---------------------------..TAYIF.................NYY------D...................
A6DE72_9PROT/4-332---------------------------..TALL..................DYA------V...................
O27150_METTH/4-274---------------------------..TALLY.................KNL------R...................

PF08798

C1NCW0_9ESCH/1-198---------------------------AARDFLFHVE.........KRNTPEGC------H-------------------
Q1GAI3_LACDA/1-205---------------------------ERQRHLWRLD...........TLNGRN------Y-------------------
Q1EQT0_STRKN/3-219---------------------------AQFGVLFRIE...........DTTTGP------H-------------------
Q8X7W1_ECO57/1-212---------------------------KERQFLYRRE...........ELQGAF------R-------------------
A4XYT8_PSEMY/1-203---------------------------APARFLWRLE........AGSNAWATP------V-------------------
Q67RN9_SYMTH/1-223---------------------------AYFGVLYRLE.........LNRYSGQV------L-------------------
Q8KB24_CHLTE/1-202---------------------------VPSGFLFADK..........GGDAKGR------K-------------------
A5UR13_ROSS1/1-237---------------------------AHFGILYRIE........PISDMPWLV------R-------------------
Q1J366_DEIGD/4-210---------------------------DGERALWRQE..............DRA------T-------------------
Q5PEG8_SALPA/1-232---------------------------ELRQFLFREE..............AHG------G-------------------
A5FTJ9_ACICJ/1-224---------------------------RKRDFLWREE..............RPG------H-------------------
A1SV70_PSYIN/1-178---------------------------RKRDHLFRVE..........VADRQSC------K-------------------
Q2RXJ4_RHORT/4-241---------------------------.GVLQPFRLM.........VAPNGATG------T-------------------
B3ENH7_CHLPB/1-201---------------------------IPSGFLYADK..........GGDSNGR------L-------------------
Q2JWC6_SYNJA/1-204---------------------------SDWHILYRQE.............PDGC------T-------------------
CSE3_THET8/1-211---------------------------GRERLLWRLE.........PARGLEPP------V-------------------
A3LCN7_PSEAI/1-202---------------------------PASRFLWRLE........ASGNAWSTP------T-------------------
Q57KI5_SALCH/1-212---------------------------KERQFLYRRE...........ELQGAF------R-------------------
Q0W583_UNCMA/1-248---------------------------ETFGVLHRID.........IHPRSGAI------V-------------------
A0LM55_SYNFM/1-201---------------------------DGLRVLFRVE.........PENDDRIV------R-------------------
Q60AD3_METCA/5-237---------------------------.LAPKPFRLL........QDGRNLRPP------R-------------------
Q1JX12_DESAC/1-200---------------------------AQRDYLFRVE..........RMGQQQA------E-------------------
A1ARH5_PELPD/1-222---------------------------PKGEFLWRLE........PETDSSGYP------R-------------------
Q6LWA0_PHOPR/2-180---------------------------RKRDHLFRVE.........NINTSGQV------M-------------------
C1DSI0_AZOVD/1-204---------------------------APGRFLWRLE........PGADAWASP------T-------------------
Q1EQJ3_STRKN/1-237---------------------------DAPRILWRID..........RNAAAEV------M-------------------
Q2JH26_FRASC/2-267---------------------------VTERVLWRLE...TGEGLRGADRPHRA------E-------------------
Q03C59_LACC3/1-212---------------------------TRLRHLWRLD...........SLNGRD------Y-------------------
Q3ZZ80_DEHSC/1-206---------------------------GPGRVLFRLD.........MNEQTGGI------S-------------------
A7MFK9_CROS8/1-212---------------------------AQRQYLYRRE...........TLQNGF------C-------------------
Q5YRB7_NOCFA/1-222---------------------------GTGRVLWRVD...........RRDHAV------D-------------------
Q7N8H4_PHOLL/1-223---------------------------EKRQFLFREE..........IGIMGLP------V-------------------
Q0BRF7_GRABC/2-239---------------------------.QMLQPFRVF..........TPEQANW------S-------------------
A6W167_MARMS/1-223---------------------------DERSFLFREE..........QSADGSK------A-------------------
A8M405_SALAI/1-222---------------------------DGARTLWRLD..........HRQDRQV------V-------------------
A3EQA3_9BACT/1-214---------------------------SEGEFLWRLE........PETDSLGFP------L-------------------
Q1ZM76_PHOAS/1-219---------------------------SERQFIYRQE..........LMPNGLP------V-------------------
Q314I5_DESDG/1-218---------------------------RTRDFLFREQ.............DEPY------T-------------------
A0AE92_STRAM/1-253---------------------------EAPRVLWRLD..........QRARAEV------L-------------------
A8LYZ8_SALAI/3-204---------------------------HHAGVLFRLD...........HTTTGP------M-------------------
Q825C0_STRAW/3-217---------------------------ARFGVLFRIE...........DTPAGA------H-------------------
Q47PJ5_THEFY/2-225---------------------------QQSGLLFRIE...........ETRNEL------Y-------------------
F2GBG6_ALTMD/1-221---------------------------TERSFLYREE..........MGITGMP------E-------------------
Q74DC7_GEOSL/1-201---------------------------AERDFLFRVE..........RSGQQSV------E-------------------
Q0RTG6_FRAAA/28-266---------------------------VTERVLWRLE..........TGRPHRA------E-------------------
A7BA62_9ACTO/1-248---------------------------GAPRVLWRLDRPPAVRGAAPRQGSPSC------S-------------------
Q1R113_CHRSD/1-229---------------------------GERPFLFRQE....MEEAANGKSQGLP------R-------------------
Q6NEQ5_CORDI/5-227---------------------------KSVDILFRFE..........QLAGQPP------F-------------------
Q2FNT6_METHJ/1-225---------------------------RKRDFLYRAE...........LTGRDP------V-------------------
A5F3T0_VIBC3/4-208---------------------------TQSGIVYADQ..........GGDFHGR------K-------------------

PF09559

Q1CW34_MYXXD/4-194---------------------------RLDLGVFTLR----------GERAVGD.......-------------------
Q1CW45_MYXXD/31-221---------------------------RSDMGVFSLR----------GVSNTRE.......-------------------
Q3M7D9_ANAVT/30-227---------------------------LDTLGIQTIA----------GIPKDG........-------------------
Q8F1E7_LEPIN/7-205---------------------------HDSLSIQTIS----------GLPDRPG.......-------------------
A0YQL0_LYNSP/20-218---------------------------IQGIGMTAIT----------GSPTPQG.......-------------------
Q0A841_ALHEH/18-219---------------------------LPGFGVKVLH----------LPVSGNGWHRGEGQ-------------------
A1WYF2_HALHL/43-244---------------------------PGEVGIRVTH----------LPTSGHGWWRTPDQ-------------------
A1AWQ7_RUTMC/19-218---------------------------VDA.GIFNIS----------VADGNGWTQNHKDG-------------------
Q4JN26_9BACT/18-217---------------------------DNRNSIQTLH----------GPMSGNGWVRPDSE-------------------
Q3SG16_THIDA/19-212---------------------------DPGSGIQHLK----------GAATNSG.....DT-------------------

PF09700

Q746D9_THET2/1-351GPLLAE......EGE.GGWRLLAP...RPLDA.....---......LKLGEALY------P-------------------
A0B6W4_METTP/4-358GPLLCR......EGD.RGPEMLYP...APLNLL....---......GKRNDSGY------E-------------------
O28413_ARCFU/3-341GHFFYR.......YD.GKFELLVE...SPHD......---......VTQNLGLV------K-------------------
A6LNK2_THEM4/6-323GPFLSN..........AYGEIFFK...IPTIV.....---......KQNEKTGK------F-------------------
A6VYS5_MARMS/4-381GPLAVKIPLDQSVSKLEQRHILVP...KPADAQYFA.---......VDNKPTLV------G-------------------
Q47PK4_THEFY/13-381GPILGK.....QNPD.GRWCPYFP...VPSDIVVVEG---......KETTAQER------A-------------------
A4BL65_9GAMM/5-384GPVRLA.....RASA.AGIEPVYP...LPADLQVT..---......LAEDLDKT------T-------------------
Q9KFY7_BACHD/8-408GPLYVW...........KGKPFFP...LPSDIGF...---......YEDENGAL------Q-------------------
A6UNE8_METVS/6-362SPLFLL........D.NENNIYYK...APLDYGLT..---......FVKSDGKC------N-------------------
O66707_AQUAE/4-323GVFLYK...........DGNLFLP...VPSDCLVK..---......RKEESGKA------K-------------------
Q97WW9_SULSO/5-306GTFIET...........NGEYLFP...LRMGNHLAL.---......VDQQHLIN------L-------------------
Q1CW30_MYXXD/6-386RPLGES........F.SLAHRMWP...FPADAVC...---......VRDADGSE------H-------------------
Q9X2B3_THEMA/6-327GPFVFE......NTP.EGRKHYFP...LPRNIYK...---......TDSGYRVT------P-------------------
A7C3N9_9GAMM/9-401GPYLLN...........DNQRLYP...VPLILLEADV---K.....RKSEVKKN------T-------------------
Q2JN53_SYNJB/4-377GPFLCH...........DERLYFP...APLHLEDGFP---LVPVPWLDERDPYF------H-------------------
A3IZR5_9CHRO/4-391GVFFARESKTEGTNQ.PEMTLYLP...RPLGFVGDQS---LIPLNW..NPTLPL------N-------------------
Q8U1S7_PYRFU/4-321GIAIGT...........EKGRIYP...LPFNIIK...---......SEKFYKVV------N-------------------
A9AWU6_HERA2/68-470GPVLVE.LLEPNEAN.AEAEFLCP...APADALLFEP---ESKIE.DKPSESVP------W-------------------
A1WUQ1_HALHL/5-362GVTLAR.....RQSS.GTAEPLHP...LPADLSVE..---......RDEATGEC------A-------------------
C0A715_9BACT/6-379APFLIR...........ENNPLWS...APLHFLGKR.---......EKKSDKWT------P-------------------
A5D0Z3_PELTS/4-387GPLLVE...LDAGTG.DIDRWLVP...APADALFFEL---VPS...DFTKAAIR------Q-------------------
A1ZP54_9BACT/3-366GIYFLV...........NNKLHIE...CPLDYV....---......QEKQDEAP------C-------------------
Q8TVU0_METKA/10-439GTWVVE..VRPGAPD.RLERVWWP...CPAHLARYE.---......PESGGEAV------D-------------------
Q2JRT1_SYNJA/4-372GPFLCW...........DEQLYFP...GPLHLYQGSP---LVPIPWLEEGHSYD------G-------------------
Q6ZEA9_SYNY3/4-365GPLLYH...........KETLYFP...RPLGFVGKTP---LLPLPWHDATSPLR------S-------------------
Q1IZS1_DEIGD/6-393.ALLRR...........DETFMFP...APLNAV....---......VDKNGQIF------R-------------------
A7GFA9_CLOBL/4-366QIYLYA........E.KQGMIYIK...APKDIFV...---......NNNEVKFG------N-------------------
A8DJU1_9BACT/6-369GPWLAR...WDKNPA.TPCEVLVP...APATLHR...---......AKGKAGGQ------Q-------------------
Q7MTH3_PORGI/6-391SPVFII..DKKKNDE.GKEEYFLP...VGRRFQ....---......KENEKAPY------N-------------------
A9AVY8_HERA2/6-387GPILLK..........ETVDLLIPFVAIPADALIRQ.---......DGANVTCY------R-------------------
Q8R6Z6_THETN/4-372GPFIER...........NGKLYFP...KPSNILG...---......ERKKEEIE------N-------------------
E6XI87_SHEP2/4-375GPLAVK.RPINGDAP.SEKHILVP...KPADVQYC..---......YDQQTQLT------H-------------------
Q1AZD9_RUBXD/4-359GPYVTR...........GGEPLFP...APLYLM....---.........KSGER------F-------------------

PF09704

Q2MF31_STRSD/16-248AD..LT---------------------.ALRLGVRV.---..........DQAG------R-------------------
Q7NYP8_CHRVO/13-224....WK---------------------PAIRWVVDRI---GVLKPIRFESIRRN------E-------------------
A1ARH6_PELPD/3-217DLEPLT---------------------.CLAMGVRH.---..........DRPG------V-------------------
Q12YA8_METBU/4-236LE..LS---------------------NAYSYGTLI.---..........NSAG------K-------------------
Q0BSC7_GRABC/6-215DV....---------------------..LSIDVAI.---..........FDAG------A-------------------
A8ABL4_IGNH4/3-275AVFKAT---------------------KGAAFALSP.---..........ESPV------G-------------------
A6W168_MARMS/4-241DA..LH---------------------SSVQMATKQ.---..........VTPT------S-------------------
O66696_AQUAE/3-211......---------------------.RFNISVQG.---..........DYEA------I-------------------
A8ZZ17_DESOH/3-251QA..LD---------------------QGCLIAVEA.---..........RSHG------S-------------------
Q1EQJ4_STRKN/3-213TA..LT---------------------.ALRFGVRI.---..........DQPG------T-------------------
A5UR14_ROSS1/3-244RD..LS---------------------DNLRMGVRV.---..........DLPG------I-------------------
Q8Z465_SALTI/4-233NN..FN---------------------RHYHLAVHA.---.........LASQD------R-------------------
Q3A5Z4_PELCD/3-236AA..LA---------------------AGYLFAVKV.---..........LRTG------S-------------------
C1DSH9_AZOVD/3-205ED..LA---------------------.ALRMGVRV.---..........DREG------V-------------------
Q5YRB6_NOCFA/3-211EE..AL---------------------QNLAFGVRV.---..........DQPG------R-------------------
Q1CWU1_MYXXD/10-210....WK---------------------PAIRWHVHEI---AVLAPVRWTSFRRN------E-------------------
A3DLC5_STAMF/3-270SANLLA---------------------LGLK......---..........PVNV------L-------------------
A4J385_DESRM/4-212....WK---------------------PSIVWKIDKI---HVLNEIRFDNVRRN------E-------------------
Q65TW5_MANSM/4-216....WK---------------------PAINWVIDKI---YVLKPIRFESVRRN------E-------------------
Q8KDC0_CHLTE/7-228....WK---------------------PAIRWRIRKI---EVLNPIKWISVRRN------E-------------------
Q5H4J6_XANOR/4-215....WK---------------------PAIRWVVDSI---QVLKPICFESIRRN------E-------------------
Q9X2C0_THEMA/3-212.....L---------------------DSAKVAVQI.---..........KNPL------K-------------------
Q03C60_LACC3/3-210NA..LN---------------------.DLLFAVRV.---..........DQPG------Q-------------------
Q8U334_PYRFU/3-239SKLVDI---------------------KAVSVAPLSP---........LIRNAF------L-------------------
Q47PI7_THEFY/3-209SD..LA---------------------.ALRFGVRV.---..........DQRG------T-------------------
O28407_ARCFU/3-252GENLLA---------------------IGWK......---..........ALNC------T-------------------
Q2SID2_HAHCH/4-215....WK---------------------PAIRWVIDRI---HVLNPIRFESIRRN------E-------------------
CAS5_METJA/5-228NKLIYV---------------------GAKPYKSSI.---.........IKTPI------L-------------------
Q72NC2_LEPIC/11-225....WK---------------------PAILWIIHKI---DILKPILWESIRRN------E-------------------
O27159_METTH/3-241.....I---------------------SEISVSIHG.---..........LFES------T-------------------
B3E5U9_GEOLS/3-263AA..LA---------------------SGYRFAVKV.---..........ISTG------H-------------------
Q04QB7_LEPBJ/4-240SE..LV---------------------KSVFFATKT.---..........LNPG------N-------------------
Q60AD2_METCA/3-241EA..LQ---------------------ARIEYAARW.---..........DVEP------E-------------------
Q2RL62_MOOTA/18-224....WK---------------------PEFRWRVRQI---EVLKPIRYFSILRN------E-------------------
A5GBK2_GEOUR/12-223EFLVAF---------------------GAVRMTAIAI---PR.....NGAKKEL------P-------------------
Q72WF9_DESVH/10-218....WK---------------------PAIRWIVDRI---HVLRPIVFDNVRRN------E-------------------
Q0W584_UNCMA/6-214DE..LD---------------------SQLRIGIRV.---..........ECPG------E-------------------
Q1NKD4_9DELT/4-199....WK---------------------PTFVWIIDKV---RVMRRIRTQSKSMK------P-------------------
A4YFV1_METS5/10-233LDRVKV---------------------ASARL.....---..........EGQA------T-------------------
A8LYZ7_SALAI/3-226GD..LA---------------------.PVQFTVRV.---..........DRPG------T-------------------
CASD_ECOLI/4-214QA..LS---------------------ESVQFAVRCD---EL.....ILDDRRV------S-------------------
Q0AZP3_SYNWW/4-212....WK---------------------PAIRWVIERI---TILNEIKFDSFRRN------E-------------------
Q1R114_CHRSD/4-250LR..LR---------------------QSLGIAVKQ.---..........RSPG------W-------------------
CAS5C_SULSO/5-232NFRNVM---------------------ATARL.....---..........ESEG------A-------------------
Q2RW65_RHORT/4-212....WK---------------------PAITWVIDAI---HVLKPIRFQTLRRN------E-------------------
Q5P3Y6_AROAE/8-203....WK---------------------PTLIWVIDEV---RVMKRVRTQTKGTK------P-------------------
Q314I4_DESDG/4-228AE..LR---------------------DGYRVAVRE.---..........DAPG------K-------------------
A1SV73_PSYIN/3-198YA..LS---------------------EQLKIAVQV.---..........NLSG------E-------------------
Q1EQS9_STRKN/13-242DD..LA---------------------.RLSLTVRT.---..........DRPG------I-------------------
Q3YYA5_SHISS/4-233NA..FN---------------------RHYSLVVCA.---..........SRNP------R-------------------
A6TNS2_ALKMQ/6-209....WK---------------------PTLIWIIDEV---RVMNLIKTQSQNIR------P-------------------
B4SAU9_PELPB/4-206....WK---------------------PSIRWIIDRI---HVLKPIRFENIRRN------E-------------------
Q1H3R5_METFK/4-216....WK---------------------PAIRWVVDSI---HVLKPIRFESIRRN------E-------------------
Q67RP0_SYMTH/3-220AE..LA---------------------.RLRMGVRI.---..........DAPG------R-------------------
Q2JWC5_SYNJA/3-192DD..LA---------------------.ALKMGVRV.---..........NKEG------I-------------------
B1YHA3_EXIS2/4-198....WK---------------------PTILIVVDAI---RIMHPIKMEAKGMR------P-------------------
Q4JWK0_CORJK/4-209QD..LA---------------------.ALTFAVRV.---..........DQPG------S-------------------
Q7N8H5_PHOLL/4-236AK..LQ---------------------KSVLIAIKQ.---..........TVPG------S-------------------
Q60B28_METCA/3-213....WK---------------------PAIRWRVTKI---EVLKPIRWISVRRN------E-------------------
Q2LX12_SYNAS/8-216....WK---------------------PTIIWVIDAV---RVIRRIRTQTKGTK------P-------------------
B8I205_CLOCE/4-212....WK---------------------RAIKWVIDKI---HVCNKIQFTNIRRN------E-------------------
Q2RXJ5_RHORT/6-238QR..LQ---------------------DRLIFAARR.---..........EREN------P-------------------
C1DNX2_AZOVD/4-215....WK---------------------PAICWVVDRI---HVLKPIRFESIRRN------E-------------------
Q0AA33_ALHEH/3-231NS..LQ---------------------ARISYAARW.---..........DVPP------E-------------------
Q3ZZ79_DEHSC/6-199AR..FD---------------------.GIRMGVRV.---..........DRDG------K-------------------
Q47PJ4_THEFY/3-220DR..YK---------------------.ELKFTVRV.---..........DRPG------V-------------------
Q6NEQ9_CORDI/4-220....WL---------------------DDVEFWVRE.---..........DRKP------I-------------------
Q1JX11_DESAC/4-219QQ..LA---------------------DSVHFAVRKE---VRHV.KTAGSTCPL------T-------------------
Q746C2_THET2/3-211....WK---------------------PEFRYEVRRI---GVLRLGTPFALLRN------E-------------------
Q0RTG7_FRAAA/8-241ED..LL---------------------.ALTFGVRT.---..........DQPG------T-------------------
Q39WR9_GEOMG/10-218....WK---------------------PAIRWQVDRI---DVLKPIRWESVRRN------E-------------------
Q977B3_SULTO/4-249DK..YK---------------------GSLFWVAYG.---..........ADES------R-------------------
Q0BRF8_GRABC/3-224DR..LQ---------------------ERIVFGARR.---..........EQEP------L-------------------
CAS5B_SULSO/4-251DK..FS---------------------SDLFWVTYG.---..........TEEH------M-------------------
Q8ZZL1_PYRAE/3-217DV..AA---------------------PTVKFPVVL.---..........KRAR------G-------------------
Q3ARV4_CHLCH/4-200....WK---------------------PTIIWVVDKV---RVMKPIRTKTKCLK------P-------------------
Q1J367_DEIGD/3-208EH..LA---------------------.RLAFGVRV.---..........DREG------V-------------------
Q9KFY3_BACHD/4-199....WK---------------------PTIVFVIDEL---RVMKPIQMESKGVR------P-------------------
A5V1B9_ROSS1/6-202....WK---------------------PTIVWIIDKV---RVMKPIRTQPRSVK------P-------------------
Q04AW9_LACDB/3-211KS..LN---------------------.DLAYAVRV.---..........DQIG------K-------------------
O57910_PYRHO/4-218....LL---------------------EKIKYGVII.---..........EDPG------E-------------------
Q184H2_CLOD6/3-221.NATEY---------------------IPFNISVQG.---..........TYES------I-------------------
A2BKI9_HYPBU/5-261AEHTLA---------------------ASAGLNS...---..........DSRS------G-------------------
A1A2N3_BIFAA/7-207....WK---------------------PTFKWVIDAV---RVMNKIQTESRGVR------T-------------------
Q9YCM4_AERPE/7-241PLSKPG---------------------QILGVEWEVV---LRRLRKVLEPDSEE------G-------------------
Q6LWA3_PHOPR/12-207HE..LS---------------------TKLTIAVQV.---..........HHTG------E-------------------
A0AE91_STRAM/6-214AP..LA---------------------.ALRFGVRI.---..........DQPG------T-------------------
Q74DC8_GEOSL/4-217QQ..LA---------------------DSVAFAVRKE---ERFRIRHDGRKTSL------P-------------------
Q8KB22_CHLTE/5-230LD..EM---------------------AELRQTVLAF---Q......RERGERP------P-------------------
Q1JAP7_STRPB/6-202....YK---------------------PTFTNIVTEV---KVINQIQTELQGVR------A-------------------
Q2J7P3_FRASC/14-209....WK---------------------PEFRWAPVAI---EVLRPLHQFTLRRN------E-------------------
Q5JGB2_PYRKO/7-237IGLFKW---------------------VTIKTEGRP.---..........KLYG------S-------------------
B3ENH9_CHLPB/5-225LA..EM---------------------GKLRQTVLSF---R.......RSKERE------A-------------------
Q96X68_SULTO/5-233EI.KVK---------------------AAASFSN...---..........EFVG------G-------------------
Q53WH0_THET8/3-225SD..LA---------------------.ALRMGVRV.---..........DRKG------V-------------------
A5D0R8_PELTS/6-219....WK---------------------PEFRWEVREI---WVLNEVREEVIVRN------E-------------------
Q2RY19_RHORT/6-247EA..LD---------------------RGLGFAVRQ.---..........DRPG------R-------------------
A0LDG2_MAGSM/7-202....WK---------------------PTLIWVIDEV---RVLNRIQTQTKGVK------P-------------------
Q3SR91_NITWN/4-221....WK---------------------PAIRWVIDAI---HVLERPRFQSIRRN------E-------------------
Q1ZM77_PHOAS/4-242TM..LQ---------------------KSVQFAIKQ.---..........LAPS------S-------------------
Q9UZX1_PYRAB/18-248KDLFLW---------------------VTVKGSIKP.---..........IIYG------S-------------------
A4SFQ4_PROVI/7-227....WK---------------------PAIHWKITKI---EVLKPIKWISFRRN------E-------------------

PF01881

A3I0J5_9BACT/85-250------PDSDE.-----------------------....FSDL-------------------------------------
B4SEV7_PELPB/102-262------PGDPE.-----------------------....FERV-------------------------------------
A9BGZ0_PETMO/94-248------PSEDQ.-----------------------....FSKL-------------------------------------
B4S5I3_PROA2/102-261------QDDEE.-----------------------....FERV-------------------------------------
A9BIX0_PETMO/95-244------PYSSD.-----------------------....FKKL-------------------------------------
B8FSG8_DESHD/95-244------PGETD.-----------------------....YSRL-------------------------------------
A5D0Y7_PELTS/95-244------PGEGE.-----------------------....FDKL-------------------------------------
O30164_ARCFU/94-241------PKDSK.-----------------------....FYEV-------------------------------------
CAS6_PYRHO/96-239------PLEEE.-----------------------....FYAL-------------------------------------
A7HMV7_FERNB/94-242------PNEDD.-----------------------....FIRI-------------------------------------
Q5JGA0_PYRKO/94-241------PREPE.-----------------------....FYEL-------------------------------------
A1BI29_CHLPD/102-262------PGDDD.-----------------------....FERV-------------------------------------
A5ILP0_THEP1/93-246------PEEEE.-----------------------....FYEV-------------------------------------
A4XIJ2_CALS8/97-249------PFEDE.-----------------------....FYNL-------------------------------------
CAS6L_PYRFU/91-238------PHDEL.-----------------------....FLDR-------------------------------------
CAS6_PYRFU/95-238------PMEKE.-----------------------....FYSI-------------------------------------
O66704_AQUAE/85-236------PDEES.-----------------------....FEES-------------------------------------
Q97CI9_THEVO/80-232------IKDDSI-----------------------..AFFLRR-------------------------------------
Q6L312_PICTO/82-235------IRNGDS-----------------------I.AFFIKR-------------------------------------
Y1234_METJA/81-240------FYDDDF-----------------------DLMFFVQR-------------------------------------
Q6L114_PICTO/79-219------ANNRN.-----------------------....FVDA-------------------------------------
A5TU40_FUSNP/91-242------VGNER.-----------------------....FEEV-------------------------------------
Q3AA81_CARHZ/95-248------EEPEL.-----------------------....FSEK-------------------------------------
Q1AZD0_RUBXD/93-249------PQEEE.-----------------------....WGVA-------------------------------------
Q6L357_PICTO/89-232------QKNE..-----------------------....IEPN-------------------------------------
Y375_METJA/95-240------PNNSK.-----------------------....FYEN-------------------------------------
Q4EVR3_LISMN/89-240------FEDEE.-----------------------....FEPT-------------------------------------
Q2NFS1_METST/92-244------PSP.H.-----------------------....FFRN-------------------------------------
O27163_METTH/1-154------PNDLK.-----------------------....FYEN-------------------------------------
A7GQ92_BACCN/87-233------IDDDK.-----------------------....FEKE-------------------------------------
O57900_PYRHO/78-237------LHEHRD-----------------------L.LFFLQR-------------------------------------
A4J1X6_DESRM/95-249------PTERE.-----------------------....FTRL-------------------------------------
Q46FQ7_METBF/89-241------PKDSK.-----------------------....FHEN-------------------------------------
A5UJJ7_METS3/89-241------PSD.K.-----------------------....FFKS-------------------------------------
Q5JHS4_PYRKO/92-239------PDDEM.-----------------------....FFDK-------------------------------------
Q332K8_CBCP/101-247------PYEPE.-----------------------....YYDA-------------------------------------
O66560_AQUAE/87-244------YDDGA.-----------------------....FTQE-------------------------------------
A1ZVQ2_9BACT/100-263------PGDAL.-----------------------....YHEI-------------------------------------
CAS6L_PYRHO/91-238------PHDEL.-----------------------....FMDR-------------------------------------
Q184H4_CLOD6/91-242------ITDDR.-----------------------....YIEE-------------------------------------
A4XM43_CALS8/98-260------PYDEG.-----------------------....FEEV-------------------------------------
A1ZPF3_9BACT/98-260------PEHPE.-----------------------....YENL-------------------------------------
A8F3P6_THELT/92-245------PEDDF.-----------------------....FQNA-------------------------------------
Q8TJV5_METAC/89-241------PKDSK.-----------------------....FHEN-------------------------------------
Q12WX9_METBU/89-240------PKDSK.-----------------------....FYEN-------------------------------------
A6DAF5_9PROT/81-224------YKESGD-----------------------I.LLFIDR-------------------------------------

PF10040

A1RZS7_THEPD/144-263------LYPDP----------------------------.VHM-------------------------------------
A4J507_DESRM/140-259------.FPDS----------------------------.HTV-------------------------------------
Q3M5G3_ANAVT/172-285------.LPTR----------------------------.ECV-------------------------------------
A0ZJZ0_NODSP/168-289------.LPVP----------------------------.VNL-------------------------------------
CAS6A_SULSO/138-277------TLPSV----------------------------.GLI-------------------------------------
Q2JNR9_SYNJB/173-292------.LPIP----------------------------.RNL-------------------------------------
A8ABE5_IGNH4/136-254------FLPSP----------------------------.SHL-------------------------------------
Q7TXS3_MYCBO/184-300------.WPDP----------------------------.RLV-------------------------------------
Q6ZED0_SYNY3/149-272------.LPEP----------------------------.RNV-------------------------------------
A0ZJ83_NODSP/132-250------.LPLP----------------------------.TLM-------------------------------------
A1HND4_9FIRM/191-314------VP...----------------------------.FHV-------------------------------------
Q03KT3_STRTD/120-237------.FPSM----------------------------.RLI-------------------------------------
B8G917_CHLAD/148-265------.LPLP----------------------------.DLV-------------------------------------
Q977A9_SULTO/131-247------LFPYA----------------------------.HFF-------------------------------------
Q72GC1_THET2/120-235------.VPEP----------------------------.RLV-------------------------------------
A3MST1_PYRCJ/120-246------VMPAP----------------------------.HNL-------------------------------------
Q2FR84_METHJ/135-257------ILPEL----------------------------.AHI-------------------------------------
A3CNA0_STRSV/121-238------.FPDT----------------------------.RLI-------------------------------------
A7NKQ1_ROSCS/148-265------.LPLP----------------------------.ALT-------------------------------------
A1HM59_9FIRM/128-245------.FPSV----------------------------.FHI-------------------------------------
Q9YCN0_AERPE/126-238------.YPSP----------------------------.QRL-------------------------------------
Q745V3_THET2/136-262------PLPDP----------------------------.RLI-------------------------------------
B3EIY9_CHLPB/190-323------MDDHA----------------------------SVRV-------------------------------------
Q8ZZK8_PYRAE/121-246------FLPRP----------------------------.LSV-------------------------------------
A0YW92_LYNSP/157-270------.LPTA----------------------------.EII-------------------------------------
A3DLD1_STAMF/165-291------FLPTP----------------------------.GNV-------------------------------------
Q74DY6_GEOSL/182-301------FS...----------------------------.FSV-------------------------------------
A1RZX7_THEPD/116-252------DLPLA----------------------------LAHL-------------------------------------
B4S549_PROA2/190-323------MHEPA----------------------------DFRV-------------------------------------
Q4J7R1_SULAC/134-279------LIPQP----------------------------.SLI-------------------------------------
Q1Q3G5_9BACT/191-313------LE...----------------------------.FHV-------------------------------------
A8M9A8_CALMQ/139-276------.YPSP----------------------------.RML-------------------------------------
A1RQV9_PYRIL/103-214------.YPSP----------------------------.QRL-------------------------------------
Q5HK95_STAEQ/125-242------.FPDV----------------------------.KRF-------------------------------------
A6NTQ0_9FIRM/121-240------.LPTP----------------------------.ERI-------------------------------------
A8AA66_IGNH4/119-232------.LPSA----------------------------.PRA-------------------------------------
Q01QC2_SOLUE/166-288------PE...----------------------------.FPI-------------------------------------
Q4J7D4_SULAC/139-264------LFPYV----------------------------.PIL-------------------------------------
Q8ZZU6_PYRAE/127-238------.YPSP----------------------------.QRM-------------------------------------
A2BMX9_HYPBU/151-264------.YPSP----------------------------.WRL-------------------------------------
Q6ZEI4_SYNY3/146-257------PFPLG----------------------------.DSV-------------------------------------
A6DE70_9PROT/157-271------DELYP----------------------------.ISI-------------------------------------
A9AZH6_HERA2/148-265------.MPTP----------------------------.DLV-------------------------------------
A0LHY9_SYNFM/189-312------PPR..----------------------------.FHV-------------------------------------
Q4J7P9_SULAC/157-283------YLPFP----------------------------.AFI-------------------------------------
Q0AW55_SYNWW/127-244------.FPTP----------------------------.ELI-------------------------------------
Q3IQ75_NATPD/155-285------MFPTR----------------------------.GAV-------------------------------------
A0B9F8_METTP/179-310------MFPHR----------------------------.EAV-------------------------------------
Q39T05_GEOMG/185-303------FS...----------------------------.FPL-------------------------------------
A4YFW1_METS5/128-262------TIPSP----------------------------.GLI-------------------------------------
B9LJK3_CHLSY/148-265------.LPLP----------------------------.DLV-------------------------------------
A4YFU6_METS5/153-294------LIPTP----------------------------.GLV-------------------------------------
Y1859_ARCFU/176-286------NLPFL----------------------------.IHI-------------------------------------
A0YIK9_LYNSP/157-279------.LPLP----------------------------.TNL-------------------------------------
A1BI47_CHLPD/189-322------IGHED----------------------------DFRL-------------------------------------
Q8TVD3_METKA/146-270------.VPKF----------------------------.HMI-------------------------------------
A0YUQ2_LYNSP/96-214------.LPVP----------------------------.GLM-------------------------------------
A3MVN5_PYRCJ/123-252------FLPRP----------------------------.LTL-------------------------------------
Q97YE5_SULSO/103-228------LFPYV----------------------------.PLL-------------------------------------
Q2FM73_METHJ/142-275------MFPNR----------------------------.IAV-------------------------------------
Q8ZZM1_PYRAE/124-249------FTPRP----------------------------.LNL-------------------------------------
A9AX64_HERA2/145-264------LIPDG----------------------------.QSV-------------------------------------
A8ZV96_DESOH/179-301------LP...----------------------------.FHA-------------------------------------

PF03787

Q1Q3H4_9BACT/4-335......KRLNDT-----------------------LRKKILTDFVQKKLLEYKKDPRGEQGYSWFKERFKQWFAQR....
Q8TPH7_METAC/4-317......DKSRIA-----------------------ARDLKMLDEN...................................
O57906_PYRHO/18-333......TTGNII-----------------------RAITHPGNQDLLDYYLFYLGRGNVRGKQADDI.............
B3EIY8_CHLPB/11-320......RKAGEP-----------------------IFNQIRENINKRDRRSLKDMN........................
A6LNL6_THEM4/4-297......FEEHYK-----------------------KSLNFLNKSKGRNINKKHFDDF.......................
A4XFP8_CALS8/12-334......KDLIKH-----------------------YEDALNPKGRVNPQHLSSD..........................
Q3AA80_CARHZ/5-311......PEIKET-----------------------FNQKIKERLQNPRIKKEKLSEA.......................
A7HMV5_FERNB/4-324......LREKMT-----------------------RKFGDNNSVNDIRKNA.............................
A2VLF2_MYCTU/11-314......HKRTAQ-----------------------PVRVPGHQTREHRQYGER...........................
Q0AW54_SYNWW/12-313......KRGDWE-----------------------RDRRNIEGSDSSVPARKYLARESST....................
Q5HK93_STAEQ/9-268......NEKN..-----------------------.............................................
Q03KS9_STRTD/11-288......KWNNEN-----------------------AVNDFGRFPKE..................................
A2BKQ7_HYPBU/87-311......SNYKLS-----------------------EQDKRR.......................................
Q2LQX1_SYNAS/103-281......KAEVID-----------------------NVRFDDEADWT..................................
Q7MTH6_PORGI/59-251......LADYEL-----------------------NNGVTREE.....................................
A7FVL1_CLOB1/73-293......DEKLIE-----------------------EKEKYIRDILKELIKKENPKFNGEFDFEE................
Q8TVU2_METKA/491-691......RGDPDE-----------------------LRKYFGADDTRQARK..............................
A1WUQ4_HALHL/82-287......GGEFED-----------------------PGRDWDWP.....................................
A9AWU2_HERA2/90-292......QSPANA-----------------------APINDWAKGGK..................................
Q1CW33_MYXXD/74-261......DAAME.-----------------------.............................................
Q977D5_SULTO/23-210......DACFIV-----------------------SRNSNTSSAAYKRIFRNPRPRPTDRFPQRVC..............
A8A9P3_IGNH4/77-241......SE....-----------------------.............................................
A1RZR1_THEPD/18-247......SIPATG-----------------------PEKLALELAAAGERGRDA...........................
Q2RV95_RHORT/11-210......VSDE..-----------------------.............................................
Q4J793_SULAC/8-222......DKDHME-----------------------EHPVEDLSRYQNELKQIESCLNSNCFDM.................
A4YFX5_METS5/9-241......QPDSQN-----------------------VINLLMDKVNAAIDKAEEWNPV.......................
Q4J7N6_SULAC/8-291......WNNVGY-----------------------QRREVKKERIKNIINEYSVNHGD......................
A8F3D7_THELT/30-277......EKADEF-----------------------AQLFNIPDDKKDLLKPCIPSPRPTK....................
A4FJY4_SACEN/194-372......VLGLLA-----------------------CKDQQCGEC....................................
A4YFW9_METS5/24-229......GLYGRL-----------------------GQKYTKVYPITARDNEVKSCVKSSDTQGNQVEEYC..........
Q2RY06_RHORT/19-223......DPE...-----------------------.............................................
Q2RV95_RHORT/253-439......HRAGAP-----------------------LLDLAD.NETPH.................................
Q5LZX3_STRT1/11-194......EKVAEK-----------------------PSDDSD.......................................
A5UWG2_ROSS1/10-302......TPEAAG-----------------------QTHDTVTNPEQN.................................
Q2JNS6_SYNJB/14-218......DPLDQK-----------------------ANQWLEKIEEPHQVYALSS..........................
B9LIP8_CHLSY/265-444......TIADDK-----------------------QAQT.........................................
A7NFU0_ROSCS/21-222......AVQPDQ-----------------------AFDLEQIEAHMRREISRLKEQHDDDMELSKAIWRAST........
O66706_AQUAE/7-289......RNTELT-----------------------ASMIDEILQEGEIRGNLNDKEKKYLK...................
A6LNK3_THEM4/7-272............-----------------------.............................................
A6UNE9_METVS/9-264......EKTGIN-----------------------DL...........................................
Q2FL77_METHJ/279-403......QRETDK-----------------------K............................................
A1WUQ2_HALHL/9-296......NPD...-----------------------.............................................
Q8TVT9_METKA/8-335......EELDGE-----------------------TSEG.........................................
Q47PK3_THEFY/7-290......SED...-----------------------.............................................
Q2JRT2_SYNJA/7-252......EKE...-----------------------.............................................
A0YUX6_LYNSP/8-262......EE....-----------------------.............................................
A0YQJ5_LYNSP/5-273......NQEDYK-----------------------D............................................
A8A9P1_IGNH4/9-272......CAECPK-----------------------PGEDDEECE....................................
Q97WX4_SULSO/14-302......NARE..-----------------------.............................................
Q97XK7_SULSO/7-290......GDAIND-----------------------HGRIDCKKKG...................................
A3MVP2_PYRCJ/10-303......NNGVCV-----------------------GDKGECA......................................
Q2JNS1_SYNJB/20-216......GLGWAI-----------------------CRSPDPERMCPQREGSAGNFHRPEYQVEGYAGSHC..........
A5UT82_ROSS1/9-185......TWAQRV-----------------------CLPPTPMTMCSEKNLC.............................
Q2FL76_METHJ/14-206......GCSIEV-----------------------CTIPDV.CYSSRWLKEHPEKRDKAVDPC.................
B8G728_CHLAD/8-184......LQVFAS-----------------------NHH..........................................
Q6ZED2_SYNY3/7-200......GLDNGQ-----------------------TRGLWHG......................................
B0K2G5_THEPX/4-192......ILGVKD-----------------------YS...........................................
A9AUN2_HERA2/7-194......GIESNS-----------------------NPEFDEIRR....................................
Q7MC47_VIBVY/7-190......DNRWFG-----------------------GELTTE.......................................
A3DH28_CLOTH/14-216GVCDILSKNNSC-----------------------STRITNEEKQNKNDGLKKPLGKSRYEKSC................
A4YFX0_METS5/20-218......ERGLTV-----------------------CSGLTNDSCLRKYQKERDFMNALRQGQQQLPTAMEIAWNYTC...
Q2JRT5_SYNJA/129-478......QERNLS-----------------------WEQADK.......................................
Q2FL77_METHJ/16-208......TFDDSK-----------------------CCVSVGNKKEGMVLCGNDTC.........................
A4TG45_MYCGI/12-250......NGGRLA-----------------------KSARPLTDESERQLKTLL...........................
A4XGU1_CALS8/51-316......DLSSLG-----------------------KE.YRSLFTNQQDCYSYK...........................
Q0ATZ2_SYNWW/170-634PATEAGWLKKEK-----------------------GKYYIYPLEKQQVYRIDAKVSGDSWKVVMKDDEDKEYSQELAKFD
B0K8W5_THEP3/133-594......GKKSNL-----------------------KDIYSSKISKDRIKAGYLIYDQRKYKIIPSEYDRFQDTSKEFMIE
A3DH27_CLOTH/31-251......LEAQEK-----------------------DHEKNKEQRNENGKKC.............................
A3DKC8_CLOTH/235-405......TFPCIG-----------------------EE...........................................
Q6ZED5_SYNY3/156-674......SRLAVF-----------------------EDHDSRLAYRMPATMGLQMVPARIEGDNIVLYPGTS......RIG
Q82XX3_NITEU/10-223............-----------------------.............................................
A3DH32_CLOTH/9-175......LNHTEN-----------------------DCNC.........................................
A6NTP4_9FIRM/14-168......EE....-----------------------.............................................
Q7MC49_VIBVY/10-189......RE....-----------------------.............................................
A0RRG9_CAMFF/11-179......D.....-----------------------.............................................
A3DKC8_CLOTH/16-186......KNSNE.-----------------------.............................................
A0YPM8_LYNSP/30-210......GYMASE-----------------------QAND.........................................
D2C6C1_THENR/8-159......GMEEFA-----------------------CDPTSN.SRCPDDGNYC............................
Q8PRT5_METMA/8-181......GIGEYA-----------------------CDPLSD.SKCMLDGKEKADERNKKLC...................
O26428_METTH/15-144......GVGGTA-----------------------CDPSQG.PPCEERLHC.............................
A7NRR3_ROSCS/6-141......GLGGQA-----------------------CDPTSD.VRCPDKDGRHC...........................
C9RCS1_AMMDK/9-145......GLGGKA-----------------------CDPTVDGVRCPDEKGHRC...........................
C9RCG8_AMMDK/9-178......GLGGHA-----------------------CDPTGE.KKCEYEEREGVEKLC.......................
A5UWG6_ROSS1/4-173......GLGGEA-----------------------CDPSQS.KCTFDAEKYKQSLASTPSQRLRDAGLC...........
A7NRS6_ROSCS/4-175......GLGGTA-----------------------CDPSKG.ECRFDAEKYQKSTATDERQRLRDAGLC...........
A5D4F7_PELTS/4-177......GMGGNA-----------------------CSPEQAEQKCIYDPEKPNKGIC.......................
B3EIR8_CHLL2/6-173......GLGGEA-----------------------CDPTTH..SCAYDREKPNNGLC.......................
B4S552_PROA2/12-192......GVGGKV-----------------------LSPNGE.KCAILDLEKYKKLTTQQKNDPEKLKECGLC........
A6DAG1_9PROT/9-198EVKENESLDYKT-----------------------FEKIRN.KTFEKYKYKDKEISDIEEYIIKNLPLT...........
C7P6D1_METFA/9-230IDNEYFDENGKP-----------------------SETLDY.KKFKELKDKIKSKMDLEKAIDKILKDMEIS........
B7IGV5_THEAB/8-173QINDLGSFDPEK-----------------------FQNFIL.KEGTDFESLNKIFSEFRLS...................
D3T315_THEIA/9-219VVDNLGELENPK-----------------------EVRTLK.QIFLKRLLREGDNKSFDNILDESLEDLGLS........
O28411_ARCFU/9-154.......SYFGN-----------------------DVEGLR.R.....................................
Q8U3V3_PYRFU/7-178.......GYFGN-----------------------NIEALK.E.....................................
D3T7Q1_THEIA/22-173..........ED-----------------------DIAKLK.K.....................................
B0M908_9FIRM/9-142..........FD-----------------------SAEELY.R.....................................
C5D4N4_GEOSW/18-161..........EK-----------------------NHAALL.E.....................................
Q53W07_THET8/34-193.......WRAGG-----------------------SLERLW.E.....................................
A9AWU5_HERA2/41-244........GGYR-----------------------SIDDLR.A.....................................
D2ZTS9_NEIMU/25-187.......QKWNL-----------------------SGKSLR.E.....................................
D0W1J3_NEICI/30-211.......QKWNL-----------------------KEKSLR.E.....................................
E6XI85_SHEP2/30-186..........PK-----------------------DPKVMR.E.....................................
D1Y2F0_9BACT/26-187........IRGL-----------------------RGNALK.E.....................................
Q1IZR9_DEIGD/24-191........AGYA-----------------------TAKELH.K.....................................
D3PS14_MEIRD/23-188........AQYA-----------------------TPGELF.K.....................................
D2Z4K2_9BACT/26-193........RKFS-----------------------SSQELY.H.....................................
C5BIW8_TERTT/31-214........AKFD-----------------------NLASLR.E.....................................
Q9KFY9_BACHD/34-207........AMYP-----------------------NVKSLK.E.....................................
C8WRP6_ALIAD/23-238SLSNLPSMEELD-----------------------PTERLR.I.....................................
Q1CW28_MYXXD/33-206......HAYVGR-----------------------GAEALA.R.....................................
D3SNA7_THEAH/10-153........AFVE-----------------------SIEELF.Q.....................................
Q2LQW6_SYNAS/16-162..........SD-----------------------DIEEMK.T.....................................
B6IX20_RHOCS/283-454.........AHV-----------------------SLKDLK.N.....................................
A8DJU4_9BACT/304-514.........GAV-----------------------DVTTLR.A.....................................
C8W3E8_DESAS/7-167........PKYK-----------------------DWSEVK.K.....................................
C0A713_9BACT/8-185.......GRGIQ-----------------------NVEELH.K.....................................
B8GSG8_THISH/11-176..SRLYDGNEAS-----------------------TLKKVH.R.....................................
B7R675_9THEO/7-162........LKYQ-----------------------DLQDLQ.K.....................................
O66703_AQUAE/10-154........SHNQ-----------------------SIDKLR.E.....................................
Q47PK0_THEFY/7-173.......TKVGP-----------------------SIRTLR.R.....................................
A6LNK0_THEM4/7-158......RIINIH-----------------------KYNECDKKFIGLKK...............................
B7IFF0_THEAB/10-183..........RV-----------------------FGNNYKKIKE...................................
A8UTQ9_9AQUI/7-200........AYVQ-----------------------KPEELF.K.....................................
B2V8M0_SULSY/7-150....KYVRHDNE-----------------------RVEDLY.K.....................................
A8V361_9AQUI/9-167......SFIVHF-----------------------PEDKLKQDLKILKQ...............................
A8M9C0_CALMQ/7-192......GALYEA-----------------------GQLHGHPDKDIIKVPKKDEAK........................
Q96Z54_SULTO/9-305......SAIERK-----------------------RHGVTKYNDLNK.................................
Q97WX2_SULSO/9-255......TVSYVK-----------------------EGKLYTYDSIDR.................................
D2PID8_SULID/27-180......RFCNVN-----------------------LNNYKDSEN....................................
Q97Y38_SULSO/24-174......RFCVKN-----------------------LNSYDEADS....................................
C4KFX7_SULIK/27-177......RFCAKN-----------------------LNSYAEAEQ....................................
Q8TPH8_METAC/9-242......REWVTK-----------------------FLQNFSENVPFRISSGFPF..........................
A6UVY5_META3/7-263......DEEFKK-----------------------YAEKIKELRISSLYPAIYQFNLDNLNKIKQEILF...........
A1KMG2_MYCBP/9-193......QQLLGE-----------------------LVACSTLRLTDLLPYVGPDYL........................
Q5HK92_STAEQ/9-199............-----------------------.............................................
Q9X2C8_THEMA/9-196......KAEDFA-----------------------KKLK.........................................
A3DLB2_STAMF/6-246......IDPKTD-----------------------PKNLFRVNTPSPIINGEAMFWVYGLDIVLYD..............
B8GB50_CHLAD/99-293......LREHLE-----------------------KQGGKMDDWRDPD................................
A1ZVA0_9BACT/4-254......NHQPNT-----------------------.............................................
A5ILN4_THEP1/4-318......NNRNLL-----------------------EEFRKRVQEDIKNHKKNHKRTFYGTNE..................
Q46CS3_METBF/9-174............-----------------------.............................................
A6DAF6_9PROT/10-162......KHSEHI-----------------------FEEISC.......................................
Q2FL73_METHJ/7-220......Q.....-----------------------.............................................
A0ZJ98_NODSP/7-256......IEEQDL-----------------------TTDGGDFQALFLG................................
A4XGT8_CALS8/240-441......LGRDAQ-----------------------RNEHFYTLFLSDKTKIGNAYPKKEGYVF.................
A9AUN3_HERA2/7-220......QKKQST-----------------------ADLLDDP......................................
A3DKC7_CLOTH/8-205......FVPKEI-----------------------LNGSSIFYNAYPLLDGNPAIP........................
Q8TVR9_METKA/10-323......KRLDGL-----------------------GTDLSTLTDRLPRNPKKAAVALDNR....................
Q8TVU2_METKA/6-335......KPDDLV-----------------------DEILRDLGEDTEERRER............................
Q6L316_PICTO/4-317......KNKGAS-----------------------LKIYIDNNFALYKFKGSNSKN........................
Q97CJ4_THEVO/4-334......KKNKIN-----------------------ITYDDHKKVKSYNFNGNSYGD........................
Y1667_METJA/49-345......KNLPEL-----------------------LKILDDRNIKLHDKGKE............................
A6DE72_9PROT/4-332......SKQKKE-----------------------IEEIANKDISNLDAKT.............................
O27150_METTH/4-274......DSDLER-----------------------ISEEVSRGHRGDPNK..............................

PF08798

C1NCW0_9ESCH/1-198------VLLQSA-----------------------QMPVSTA................V---------------------
Q1GAI3_LACDA/1-205------LLLLSP-----------------------EKPDLHEFERYGKPG........T---------------------
Q1EQT0_STRKN/3-219------VLLQST-----------------------HEPDLTRLPDGYG..........T---------------------
Q8X7W1_ECO57/1-212------FFVLSQ-----------------------ERPAES.................E---------------------
A4XYT8_PSEMY/1-203------VLVQST-----------------------LAGDWSALQVLPNYLQ.......R---------------------
Q67RN9_SYMTH/1-223------LYVQSR-----------------------VEPDWGRLPAGYLTPADGLP...N---------------------
Q8KB24_CHLTE/1-202------ILILSD-----------------------RPPLQP.................A---------------------
A5UR13_ROSS1/1-237------LLVQSR-----------------------EQPDWSHIPDRMFGPALDERG..N---------------------
Q1J366_DEIGD/4-210------LLVQSL-----------------------TAPDWEALNARHPGSL.......R---------------------
Q5PEG8_SALPA/1-232------FFMLSA-----------------------IPPLLQH................S---------------------
A5FTJ9_ACICJ/1-224------FLILSP-----------------------DRPGDGG................G---------------------
A1SV70_PSYIN/1-178------VLLQSS-----------------------TEPKSSE................Q---------------------
Q2RXJ4_RHORT/4-241------LYAYTR-----------------------ADRTALVQTTRDFGLPDALAVC.D---------------------
B3ENH7_CHLPB/1-201------ILMLSD-----------------------REPRKP.................E---------------------
Q2JWC6_SYNJA/1-204------ILVQSV-----------------------IQPDWSRLPQGYVQR........D---------------------
CSE3_THET8/1-211------VLVQTL-----------------------TEPDWSVLDEG............Y---------------------
A3LCN7_PSEAI/1-202------LLVQAA-----------------------SEGNWSVLQALPGYLL.......G---------------------
Q57KI5_SALCH/1-212------FFVLSQ-----------------------EQPAAS.................A---------------------
Q0W583_UNCMA/1-248------LLVQSQ-----------------------EKPDWSKLPEGYLLENTGTE...N---------------------
A0LM55_SYNFM/1-201------IMVQSD-----------------------GSPSWELFTERHP..........C---------------------
Q60AD3_METCA/5-237------LLGFSA-----------------------HDGTRLTEHARAFASPLAAQVCSL---------------------
Q1JX12_DESAC/1-200------ILLQSQ-----------------------RKPECATR...............D---------------------
A1ARH5_PELPD/1-222------IIVQSR-----------------------NIPDWGGVGVNGWIQQAD.....P---------------------
Q6LWA0_PHOPR/2-180------VLLQSA-----------------------SEPQSNV................K---------------------
C1DSI0_AZOVD/1-204------LLVQSC-----------------------ESGDWDVLQGLPGYLQ.......R---------------------
Q1EQJ3_STRKN/1-237------LYVVGP-----------------------QRPDLTHLVEQAGWPAAAAAGTPG---------------------
Q2JH26_FRASC/2-267------VLVLTE-----------------------STPSWEHLIEQAGWIHTDEP...Q---------------------
Q03C59_LACC3/1-212------LLVLSP-----------------------DAPELAQLARYGVAG........T---------------------
Q3ZZ80_DEHSC/1-206------VLIQSE-----------------------KKPFWTNLNGYTE..........F---------------------
A7MFK9_CROS8/1-212------FYLLSA-----------------------SAPERTH................P---------------------
Q5YRB7_NOCFA/1-222------LYVVSP-----------------------SEPDFTHIVEQAGWPTTT.....A---------------------
Q7N8H4_PHOLL/1-223------FYVLSK-----------------------TSPQTES................P---------------------
Q0BRF7_GRABC/2-239------LYAYAN-----------------------QDATTLVEQARFSITPDMTEVI.S---------------------
A6W167_MARMS/1-223------FFVLSS-----------------------VKPESDE................S---------------------
A8M405_SALAI/1-222------LYVVSP-----------------------TAPDLTHMVEQAGWPSNAE....T---------------------
A3EQA3_9BACT/1-214------ILVQSQ-----------------------TLPDWTRINLKGWLAKAD.....P---------------------
Q1ZM76_PHOAS/1-219------FWVLSR-----------------------FAPDETN................A---------------------
Q314I5_DESDG/1-218------FLTVSR-----------------------RQPEDTT................G---------------------
A0AE92_STRAM/1-253------LYVVSP-----------------------DRPDLTHLVEQAGWPAVADRENPG---------------------
A8LYZ8_SALAI/3-204------LLVQTT-----------------------LPPDPNRLPDGYA..........A---------------------
Q825C0_STRAW/3-217------ILLQSA-----------------------HEPDLTRLPDGYG..........Q---------------------
Q47PJ5_THEFY/2-225------LLVQSH-----------------------SPLRVDRLGPGYH..........G---------------------
F2GBG6_ALTMD/1-221------FYVLSK-----------------------TEPQASL................P---------------------
Q74DC7_GEOSL/1-201------VLLQSR-----------------------REPTMAASR..............E---------------------
Q0RTG6_FRAAA/28-266------VLILTE-----------------------SRPSWEHLIEQAGWPNAEDP...Q---------------------
A7BA62_9ACTO/1-248------LYISSP-----------------------VAPDPSHIVEEAGYATEG.....G---------------------
Q1R113_CHRSD/1-229------FYVYST-----------------------RRPEAV.................A---------------------
Q6NEQ5_CORDI/5-227------FLIQST-----------------------VAPKQVDNL..............D---------------------
Q2FNT6_METHJ/1-225------VYLLSA-----------------------RKPVYEG................N---------------------
A5F3T0_VIBC3/4-208------VLVVSD-----------------------RMPNASVDG..............V---------------------

PF09559

Q1CW34_MYXXD/4-194------LLHLGR-----------------------GT.LRLRCS--------------P---------------------
Q1CW45_MYXXD/31-221------LLYLGR-----------------------GT.MRLRCP--------------I---------------------
Q3M7D9_ANAVT/30-227------VINLTQ-----------------------NSRLRIRIP--------------V---------------------
Q8F1E7_LEPIN/7-205------ILRLTA-----------------------NSQLRIRIP--------------V---------------------
A0YQL0_LYNSP/20-218------LLKLTP-----------------------DSHVIFRVL--------------A---------------------
Q0A841_ALHEH/18-219------PIYLSR-----------------------RVQLLLRVP--------------R---------------------
A1WYF2_HALHL/43-244------PILLPR-----------------------RSRLVLRVA--------------R---------------------
A1AWQ7_RUTMC/19-218------FYYPSK-----------------------RSKLTIRVP--------------K---------------------
Q4JN26_9BACT/18-217------NIPLSK-----------------------RAKLIMRIN--------------K---------------------
Q3SG16_THIDA/19-212------VLNINR-----------------------RTRLFMRVP--------------K---------------------

PF09700

Q746D9_THET2/1-351------LRPLEL.............PQGAGTNLPE.GLSPVGLPSPA............---------------------
A0B6W4_METTP/4-358------MRLLRP.................GEEVEC.DLGRVRLPTAE............---------------------
O28413_ARCFU/3-341------PHRIDK.........................LGITILMDS.............---------------------
A6LNK2_THEM4/6-323------LKAFVD.........................WNFSFYVNNKKLQGIRY....E---------------------
A6VYS5_MARMS/4-381------LQPLQP.............NEDEGCDLPN.GLLPLFLSQD.............---------------------
Q47PK4_THEFY/13-381------YYRLVK..................GSAVD.GTDLAHVPGAPESLLELP....P---------------------
A4BL65_9GAMM/5-384------VHRLEP........................RLLPEGIACSRATRELAL....L---------------------
Q9KFY7_BACHD/8-408------MNYRQP..................QPLVN.GQGYLGIGDKGDHESLWPAKVIP---------------------
A6UNE8_METVS/6-362------FGNTEK...............................................---------------------
O66707_AQUAE/4-323------ISPLEF......................................PPLI....R---------------------
Q97WW9_SULSO/5-306------PILLEK..............................................E---------------------
Q1CW30_MYXXD/6-386------LERLEP....................RPD.GAATLGPDDDDAREALWH....P---------------------
Q9X2B3_THEMA/6-327------IVEIDG............................VYLPWKPEY..........---------------------
A7C3N9_9GAMM/9-401------NTRIKFKSKNTSTQKQFVRLHPGYKPVNC.DLGHVYLPEITALKNKV......---------------------
Q2JN53_SYNJB/4-377------C.HWDP.........................TRPAPLVSLRPVEEEPE....R---------------------
A3IZR5_9CHRO/4-391------HIFWDH.........................TKPCPLTTSKQAEN........---------------------
Q8U1S7_PYRFU/4-321------PGRF...........................LGKLILPPK.............---------------------
A9AWU6_HERA2/68-470------LRRLIP...........IQAPAKLVSDFN.ELGLVGLVEPD............---------------------
A1WUQ1_HALHL/5-362------VHRLTP........................QPLPAGVASSQPLERLPV....L---------------------
C0A715_9BACT/6-379------AAFLRP................AATRTLT.DQGPIFLPEKTHTD.........---------------------
A5D0Z3_PELTS/4-387------LTPLQL.............PPGSHTNLPEDSLAPVGMPDRD............---------------------
A1ZP54_9BACT/3-366------LLQLQA.........................LPDSIAATSFQLSHWLA....P---------------------
Q8TVU0_METKA/10-439------LLRVEE...............VGDAAIAF.SGHDEALRRRYGFMTPKP....P---------------------
Q2JRT1_SYNJA/4-372------Y.RWDP.........................TRPAPLVAAAPEEE........---------------------
Q6ZEA9_SYNY3/4-365------QMLWDK.........................TQPAPLAPLETVSQ.......T---------------------
Q1IZS1_DEIGD/6-393------ALPAEL.............REGEGTDAPE.GLRPLLLTDRDGNA.........---------------------
A7GFA9_CLOBL/4-366------FKEIKD..............................GESSIKYDYYLE....E---------------------
A8DJU1_9BACT/6-369------LFALAP.....................LQ.EELPGWHPVPEEQRRPLW....L---------------------
Q7MTH3_PORGI/6-391------LLHLSC...............................................---------------------
A9AVY8_HERA2/6-387------LQPLDP.............RYFPTEQTDL.VLGQQPDQPRFSLVGSQQ....H---------------------
Q8R6Z6_THETN/4-372------IFHARH....YELNTKLFKKENTNADSNI.KTFPLYM................---------------------
E6XI87_SHEP2/4-375------LVRSKP..........MAFAEGEGCDLPS.GLLPLFAENV.............---------------------
Q1AZD9_RUBXD/4-359------TTRLRP................RDTPLET.DMGEVRLPEVVPVEDDSG....K---------------------

PF09704

Q2MF31_STRSD/16-248------LLR..D---------------Y.......HTVSDYRG................---------------------
Q7NYP8_CHRVO/13-224------VGSKLS---------------A.......AGVAKAMK................---------------------
A1ARH6_PELPD/3-217------PKR..D---------------Y.......QTAG....................---------------------
Q12YA8_METBU/4-236------LLR..D---------------Y.......HTSQVPSAG...............---------------------
Q0BSC7_GRABC/6-215------PLR..D---------------Y.......HTIETIP.................---------------------
A8ABL4_IGNH4/3-275------VALKSE---------------I.......NRLLQA..................---------------------
A6W168_MARMS/4-241------LLR..D---------------Y.......HTSQVPSR................---------------------
O66696_AQUAE/3-211------FRDYVR---------------F.......RKYN....................---------------------
A8ZZ17_DESOH/3-251------LLR..D---------------Y.......HTTQVPDS................---------------------
Q1EQJ4_STRKN/3-213------RIR..D---------------F.......QTAH....................---------------------
A5UR14_ROSS1/3-244------LMR..D---------------Y.......HTTGGGRYSTIASTGGPRYHDEPY---------------------
Q8Z465_SALTI/4-233------WLR..D---------------Y.......HTVSAPRE................---------------------
Q3A5Z4_PELCD/3-236------LLR..D---------------Y.......HTTQVPDS................---------------------
C1DSH9_AZOVD/3-205------PLR..D---------------Y.......QTAT....................---------------------
Q5YRB6_NOCFA/3-211------LIR..D---------------F.......QVAL....................---------------------
Q1CWU1_MYXXD/10-210------VNSRAT---------------V.......GKFD....................---------------------
A3DLC5_STAMF/3-270------PIKYMD---------------I.......NRILAVKLTGKT...........L---------------------
A4J385_DESRM/4-212------VGSKIP---------------T.......GNVRKAM.................---------------------
Q65TW5_MANSM/4-216------LGAKIS---------------E.......SKVSGAMK................---------------------
Q8KDC0_CHLTE/7-228------VGQTAS---------------E.......RSDG....................---------------------
Q5H4J6_XANOR/4-215------VGSKLS---------------A.......ASISKAIK................---------------------
Q9X2C0_THEMA/3-212------FLRTGT---------------........NFVE....................---------------------
Q03C60_LACC3/3-210------VMT..E---------------F.......QTAE....................---------------------
Q8U334_PYRFU/3-239------LKRLRN---------------L.......ESGS....................---------------------
Q47PI7_THEFY/3-209------RIR..D---------------F.......QTAI....................---------------------
O28407_ARCFU/3-252------PLRYSD---------------I.......NRILAVKI................---------------------
Q2SID2_HAHCH/4-215------VGGKLS---------------A.......RNVAKAMK................---------------------
CAS5_METJA/5-228------LKRLRN---------------L.......EDQK....................---------------------
Q72NC2_LEPIC/11-225------LGSKIA---------------P.......QNIMQTM.................---------------------
O27159_METTH/3-241------FWNYQS---------------FIVGDIALKYHHN...................---------------------
B3E5U9_GEOLS/3-263------PLR..D---------------Y.......HTAQAPDS................---------------------
Q04QB7_LEPBJ/4-240------LLR..D---------------Y.......HTIQSPG.................---------------------
Q60AD2_METCA/3-241------ALL..D---------------Y.......HTVDLGQEKMR.............---------------------
Q2RL62_MOOTA/18-224------VNDKMV---------------V.......STARGW..................---------------------
A5GBK2_GEOUR/12-223------VRRLQD---------------Y.......HTVQ....................---------------------
Q72WF9_DESVH/10-218------VSSKIP---------------K.......PNPATAM.................---------------------
Q0W584_UNCMA/6-214------IAR..D---------------Y.......HTVS....................---------------------
Q1NKD4_9DELT/4-199------LVF.SG---------------G.......NSLA....................---------------------
A4YFV1_METS5/10-233------YVEDIV---------------R.......NVVS....................---------------------
A8LYZ7_SALAI/3-226------VMS..D---------------F.......HTVGGG..................---------------------
CASD_ECOLI/4-214------VTGLRD---------------Y.......HTVL....................---------------------
Q0AZP3_SYNWW/4-212------LSGRIS---------------A.......VTMKSAM.................---------------------
Q1R114_CHRSD/4-250------LLR..D---------------Y.......HTVQVPPS................---------------------
CAS5C_SULSO/5-232------YTEDIV---------------R.......NVIS....................---------------------
Q2RW65_RHORT/4-212------VGGKVP---------------A.......GKVKSAMT................---------------------
Q5P3Y6_AROAE/8-203------LEF.GG---------------G.......NSLA....................---------------------
Q314I4_DESDG/4-228------VML..D---------------Y.......HTIQTPGA................---------------------
A1SV73_PSYIN/3-198------KMV..D---------------Y.......HTVQ....................---------------------
Q1EQS9_STRKN/13-242------LLR..D---------------L.......HTVGGG..................---------------------
Q3YYA5_SHISS/4-233------WAR..D---------------Y.......HTVQMPKE................---------------------
A6TNS2_ALKMQ/6-209------VNFSGT---------------SKGTGTPLNTLS....................---------------------
B4SAU9_PELPB/4-206------VAKKTS---------------L.......NRVDMV..................---------------------
Q1H3R5_METFK/4-216------VGSKAS---------------A.......SKASGGMA................---------------------
Q67RP0_SYMTH/3-220------VGV..D---------------F.......QTAGG...................---------------------
Q2JWC5_SYNJA/3-192------LCK..D---------------F.......HTVQ....................---------------------
B1YHA3_EXIS2/4-198------IEY.GG---------------G.......NSLA....................---------------------
Q4JWK0_CORJK/4-209------LLR..D---------------Y.......QTAQ....................---------------------
Q7N8H5_PHOLL/4-236------LMR..D---------------Y.......HTTQVPTH................---------------------
Q60B28_METCA/3-213------VGAVAS---------------V.......RTAQTAM.................---------------------
Q2LX12_SYNAS/8-216------LEY.NG---------------R.......NTLA....................---------------------
B8I205_CLOCE/4-212------VSIKIA---------------K.......SNAKALM.................---------------------
Q2RXJ5_RHORT/6-238------TGVLTD---------------T.......QNAKLSKTE...............---------------------
C1DNX2_AZOVD/4-215------VGGKLS---------------A.......ASVGKAMK................---------------------
Q0AA33_ALHEH/3-231------PLR..D---------------Y.......QTVDLGQTHLA.............---------------------
Q3ZZ79_DEHSC/6-199------VEQ..D---------------Y.......HTAL....................---------------------
Q47PJ4_THEFY/3-220------RLV..D---------------F.......HTIGGG..................---------------------
Q6NEQ9_CORDI/4-220------VVN..E---------------F.......QTINPLPEVETF...........R---------------------
Q1JX11_DESAC/4-219------VIKMTD---------------Y.......HTVQ....................---------------------
Q746C2_THET2/3-211------VGNRMG---------------A...............................---------------------
Q0RTG7_FRAAA/8-241------LLR..D---------------Y.......HTVSDYRG................---------------------
Q39WR9_GEOMG/10-218------VGSVMS---------------P.......RTNG....................---------------------
Q977B3_SULTO/4-249------LLPYSD---------------I.......MREQRV..................---------------------
Q0BRF8_GRABC/3-224------LGRMTD---------------F.......QTALLGSND...............---------------------
CAS5B_SULSO/4-251------LMPYSD---------------L.......LREERV..................---------------------
Q8ZZL1_PYRAE/3-217------VLEEGK---------------L...............................---------------------
Q3ARV4_CHLCH/4-200------LKYHEK---------------G.......NSLA....................---------------------
Q1J367_DEIGD/3-208------AGT..D---------------Y.......HTAQ....................---------------------
Q9KFY3_BACHD/4-199------IEY.GG---------------G.......NTLA....................---------------------
A5V1B9_ROSS1/6-202------LKYHAS---------------G.......NDLA....................---------------------
Q04AW9_LACDB/3-211------TMT..E---------------F.......QTVE....................---------------------
O57910_PYRHO/4-218------KIEEVS---------------V.......IYKN....................---------------------
Q184H2_CLOD6/3-221------FNNYQT---------------T.......YFYK....................---------------------
A2BKI9_HYPBU/5-261------LVVHSD---------------L.......SHVA....................---------------------
A1A2N3_BIFAA/7-207------IVYQPK---------------KKN...VKNDLS....................---------------------
Q9YCM4_AERPE/7-241------STRENR---------------G.......NRVL....................---------------------
Q6LWA3_PHOPR/12-207------KMM..D---------------Y.......HTVE....................---------------------
A0AE91_STRAM/6-214------RIR..D---------------F.......HTAR....................---------------------
Q74DC8_GEOSL/4-217------IIKATD---------------Y.......HTVR....................---------------------
Q8KB22_CHLTE/5-230------LLR..D---------------F.......QMVGSGYNEK..............---------------------
Q1JAP7_STRPB/6-202------LLHDYS---------------A........DLS....................---------------------
Q2J7P3_FRASC/14-209------TYDLPL---------------L.......SDAA....................---------------------
Q5JGB2_PYRKO/7-237------LLKINT---------------I.......YRGK....................---------------------
B3ENH9_CHLPB/5-225------LLR..D---------------F.......HMVGSGYDDK..............---------------------
Q96X68_SULTO/5-233------YTEDII---------------R.......SVIM....................---------------------
Q53WH0_THET8/3-225------LKV..D---------------Y.......QTAQFVYRTEGY...........V---------------------
A5D0R8_PELTS/6-219------IESRQS---------------P.......RAKC....................---------------------
Q2RY19_RHORT/6-247------LLR..D---------------Y.......HTAQAPKA................---------------------
A0LDG2_MAGSM/7-202------LKF.SG---------------G.......NDLS....................---------------------
Q3SR91_NITWN/4-221------VGSKAP---------------A.......GKIKSAMK................---------------------
Q1ZM77_PHOAS/4-242------LLR..D---------------Y.......HTTQVAAN................---------------------
Q9UZX1_PYRAB/18-248------ILKINR---------------L.......HRGS....................---------------------
A4SFQ4_PROVI/7-227------VGAVAS---------------P.......QSNG....................---------------------

PF01881

A3I0J5_9BACT/85-250--------------------------------------------------------------------------------
B4SEV7_PELPB/102-262--------------------------------------------------------------------------------
A9BGZ0_PETMO/94-248--------------------------------------------------------------------------------
B4S5I3_PROA2/102-261--------------------------------------------------------------------------------
A9BIX0_PETMO/95-244--------------------------------------------------------------------------------
B8FSG8_DESHD/95-244--------------------------------------------------------------------------------
A5D0Y7_PELTS/95-244--------------------------------------------------------------------------------
O30164_ARCFU/94-241--------------------------------------------------------------------------------
CAS6_PYRHO/96-239--------------------------------------------------------------------------------
A7HMV7_FERNB/94-242--------------------------------------------------------------------------------
Q5JGA0_PYRKO/94-241--------------------------------------------------------------------------------
A1BI29_CHLPD/102-262--------------------------------------------------------------------------------
A5ILP0_THEP1/93-246--------------------------------------------------------------------------------
A4XIJ2_CALS8/97-249--------------------------------------------------------------------------------
CAS6L_PYRFU/91-238--------------------------------------------------------------------------------
CAS6_PYRFU/95-238--------------------------------------------------------------------------------
O66704_AQUAE/85-236--------------------------------------------------------------------------------
Q97CI9_THEVO/80-232--------------------------------------------------------------------------------
Q6L312_PICTO/82-235--------------------------------------------------------------------------------
Y1234_METJA/81-240--------------------------------------------------------------------------------
Q6L114_PICTO/79-219--------------------------------------------------------------------------------
A5TU40_FUSNP/91-242--------------------------------------------------------------------------------
Q3AA81_CARHZ/95-248--------------------------------------------------------------------------------
Q1AZD0_RUBXD/93-249--------------------------------------------------------------------------------
Q6L357_PICTO/89-232--------------------------------------------------------------------------------
Y375_METJA/95-240--------------------------------------------------------------------------------
Q4EVR3_LISMN/89-240--------------------------------------------------------------------------------
Q2NFS1_METST/92-244--------------------------------------------------------------------------------
O27163_METTH/1-154--------------------------------------------------------------------------------
A7GQ92_BACCN/87-233--------------------------------------------------------------------------------
O57900_PYRHO/78-237--------------------------------------------------------------------------------
A4J1X6_DESRM/95-249--------------------------------------------------------------------------------
Q46FQ7_METBF/89-241--------------------------------------------------------------------------------
A5UJJ7_METS3/89-241--------------------------------------------------------------------------------
Q5JHS4_PYRKO/92-239--------------------------------------------------------------------------------
Q332K8_CBCP/101-247--------------------------------------------------------------------------------
O66560_AQUAE/87-244--------------------------------------------------------------------------------
A1ZVQ2_9BACT/100-263--------------------------------------------------------------------------------
CAS6L_PYRHO/91-238--------------------------------------------------------------------------------
Q184H4_CLOD6/91-242--------------------------------------------------------------------------------
A4XM43_CALS8/98-260--------------------------------------------------------------------------------
A1ZPF3_9BACT/98-260--------------------------------------------------------------------------------
A8F3P6_THELT/92-245--------------------------------------------------------------------------------
Q8TJV5_METAC/89-241--------------------------------------------------------------------------------
Q12WX9_METBU/89-240--------------------------------------------------------------------------------
A6DAF5_9PROT/81-224--------------------------------------------------------------------------------

PF10040

A1RZS7_THEPD/144-263--------------------------------------------------------------------------------
A4J507_DESRM/140-259--------------------------------------------------------------------------------
Q3M5G3_ANAVT/172-285--------------------------------------------------------------------------------
A0ZJZ0_NODSP/168-289--------------------------------------------------------------------------------
CAS6A_SULSO/138-277--------------------------------------------------------------------------------
Q2JNR9_SYNJB/173-292--------------------------------------------------------------------------------
A8ABE5_IGNH4/136-254--------------------------------------------------------------------------------
Q7TXS3_MYCBO/184-300--------------------------------------------------------------------------------
Q6ZED0_SYNY3/149-272--------------------------------------------------------------------------------
A0ZJ83_NODSP/132-250--------------------------------------------------------------------------------
A1HND4_9FIRM/191-314--------------------------------------------------------------------------------
Q03KT3_STRTD/120-237--------------------------------------------------------------------------------
B8G917_CHLAD/148-265--------------------------------------------------------------------------------
Q977A9_SULTO/131-247--------------------------------------------------------------------------------
Q72GC1_THET2/120-235--------------------------------------------------------------------------------
A3MST1_PYRCJ/120-246--------------------------------------------------------------------------------
Q2FR84_METHJ/135-257--------------------------------------------------------------------------------
A3CNA0_STRSV/121-238--------------------------------------------------------------------------------
A7NKQ1_ROSCS/148-265--------------------------------------------------------------------------------
A1HM59_9FIRM/128-245--------------------------------------------------------------------------------
Q9YCN0_AERPE/126-238--------------------------------------------------------------------------------
Q745V3_THET2/136-262--------------------------------------------------------------------------------
B3EIY9_CHLPB/190-323--------------------------------------------------------------------------------
Q8ZZK8_PYRAE/121-246--------------------------------------------------------------------------------
A0YW92_LYNSP/157-270--------------------------------------------------------------------------------
A3DLD1_STAMF/165-291--------------------------------------------------------------------------------
Q74DY6_GEOSL/182-301--------------------------------------------------------------------------------
A1RZX7_THEPD/116-252--------------------------------------------------------------------------------
B4S549_PROA2/190-323--------------------------------------------------------------------------------
Q4J7R1_SULAC/134-279--------------------------------------------------------------------------------
Q1Q3G5_9BACT/191-313--------------------------------------------------------------------------------
A8M9A8_CALMQ/139-276--------------------------------------------------------------------------------
A1RQV9_PYRIL/103-214--------------------------------------------------------------------------------
Q5HK95_STAEQ/125-242--------------------------------------------------------------------------------
A6NTQ0_9FIRM/121-240--------------------------------------------------------------------------------
A8AA66_IGNH4/119-232--------------------------------------------------------------------------------
Q01QC2_SOLUE/166-288--------------------------------------------------------------------------------
Q4J7D4_SULAC/139-264--------------------------------------------------------------------------------
Q8ZZU6_PYRAE/127-238--------------------------------------------------------------------------------
A2BMX9_HYPBU/151-264--------------------------------------------------------------------------------
Q6ZEI4_SYNY3/146-257--------------------------------------------------------------------------------
A6DE70_9PROT/157-271--------------------------------------------------------------------------------
A9AZH6_HERA2/148-265--------------------------------------------------------------------------------
A0LHY9_SYNFM/189-312--------------------------------------------------------------------------------
Q4J7P9_SULAC/157-283--------------------------------------------------------------------------------
Q0AW55_SYNWW/127-244--------------------------------------------------------------------------------
Q3IQ75_NATPD/155-285--------------------------------------------------------------------------------
A0B9F8_METTP/179-310--------------------------------------------------------------------------------
Q39T05_GEOMG/185-303--------------------------------------------------------------------------------
A4YFW1_METS5/128-262--------------------------------------------------------------------------------
B9LJK3_CHLSY/148-265--------------------------------------------------------------------------------
A4YFU6_METS5/153-294--------------------------------------------------------------------------------
Y1859_ARCFU/176-286--------------------------------------------------------------------------------
A0YIK9_LYNSP/157-279--------------------------------------------------------------------------------
A1BI47_CHLPD/189-322--------------------------------------------------------------------------------
Q8TVD3_METKA/146-270--------------------------------------------------------------------------------
A0YUQ2_LYNSP/96-214--------------------------------------------------------------------------------
A3MVN5_PYRCJ/123-252--------------------------------------------------------------------------------
Q97YE5_SULSO/103-228--------------------------------------------------------------------------------
Q2FM73_METHJ/142-275--------------------------------------------------------------------------------
Q8ZZM1_PYRAE/124-249--------------------------------------------------------------------------------
A9AX64_HERA2/145-264--------------------------------------------------------------------------------
A8ZV96_DESOH/179-301--------------------------------------------------------------------------------

PF03787

Q1Q3H4_9BACT/4-335................................................................................
Q8TPH7_METAC/4-317................................................................................
O57906_PYRHO/18-333................................................................................
B3EIY8_CHLPB/11-320................................................................................
A6LNL6_THEM4/4-297................................................................................
A4XFP8_CALS8/12-334................................................................................
Q3AA80_CARHZ/5-311................................................................................
A7HMV5_FERNB/4-324................................................................................
A2VLF2_MYCTU/11-314................................................................................
Q0AW54_SYNWW/12-313................................................................................
Q5HK93_STAEQ/9-268................................................................................
Q03KS9_STRTD/11-288................................................................................
A2BKQ7_HYPBU/87-311................................................................................
Q2LQX1_SYNAS/103-281................................................................................
Q7MTH6_PORGI/59-251................................................................................
A7FVL1_CLOB1/73-293................................................................................
Q8TVU2_METKA/491-691................................................................................
A1WUQ4_HALHL/82-287................................................................................
A9AWU2_HERA2/90-292................................................................................
Q1CW33_MYXXD/74-261................................................................................
Q977D5_SULTO/23-210................................................................................
A8A9P3_IGNH4/77-241................................................................................
A1RZR1_THEPD/18-247................................................................................
Q2RV95_RHORT/11-210................................................................................
Q4J793_SULAC/8-222................................................................................
A4YFX5_METS5/9-241................................................................................
Q4J7N6_SULAC/8-291................................................................................
A8F3D7_THELT/30-277................................................................................
A4FJY4_SACEN/194-372................................................................................
A4YFW9_METS5/24-229................................................................................
Q2RY06_RHORT/19-223................................................................................
Q2RV95_RHORT/253-439................................................................................
Q5LZX3_STRT1/11-194................................................................................
A5UWG2_ROSS1/10-302................................................................................
Q2JNS6_SYNJB/14-218................................................................................
B9LIP8_CHLSY/265-444................................................................................
A7NFU0_ROSCS/21-222................................................................................
O66706_AQUAE/7-289................................................................................
A6LNK3_THEM4/7-272................................................................................
A6UNE9_METVS/9-264................................................................................
Q2FL77_METHJ/279-403................................................................................
A1WUQ2_HALHL/9-296................................................................................
Q8TVT9_METKA/8-335................................................................................
Q47PK3_THEFY/7-290................................................................................
Q2JRT2_SYNJA/7-252................................................................................
A0YUX6_LYNSP/8-262................................................................................
A0YQJ5_LYNSP/5-273................................................................................
A8A9P1_IGNH4/9-272................................................................................
Q97WX4_SULSO/14-302................................................................................
Q97XK7_SULSO/7-290................................................................................
A3MVP2_PYRCJ/10-303................................................................................
Q2JNS1_SYNJB/20-216................................................................................
A5UT82_ROSS1/9-185................................................................................
Q2FL76_METHJ/14-206................................................................................
B8G728_CHLAD/8-184................................................................................
Q6ZED2_SYNY3/7-200................................................................................
B0K2G5_THEPX/4-192................................................................................
A9AUN2_HERA2/7-194................................................................................
Q7MC47_VIBVY/7-190................................................................................
A3DH28_CLOTH/14-216................................................................................
A4YFX0_METS5/20-218................................................................................
Q2JRT5_SYNJA/129-478................................................................................
Q2FL77_METHJ/16-208................................................................................
A4TG45_MYCGI/12-250................................................................................
A4XGU1_CALS8/51-316................................................................................
Q0ATZ2_SYNWW/170-634FYPVSFIPAKEKAHPHRGGKIRLSYALIINNSLEIGHEKAELDSNYKKGYLVLSGSMGRNKHMHPVIHGPKDEGRVEIDQ
B0K8W5_THEP3/133-594KYNNDYKVWSGRMQKKRKNWIMKS............................ISNSGDFIELTENDIKDYKSDINRNIPE
A3DH27_CLOTH/31-251................................................................................
A3DKC8_CLOTH/235-405................................................................................
Q6ZED5_SYNY3/156-674NNGRPANNDPMYAAWLPYYQNRIA............................YDGSRDYQMAEHGD..............
Q82XX3_NITEU/10-223................................................................................
A3DH32_CLOTH/9-175................................................................................
A6NTP4_9FIRM/14-168................................................................................
Q7MC49_VIBVY/10-189................................................................................
A0RRG9_CAMFF/11-179................................................................................
A3DKC8_CLOTH/16-186................................................................................
A0YPM8_LYNSP/30-210................................................................................
D2C6C1_THENR/8-159................................................................................
Q8PRT5_METMA/8-181................................................................................
O26428_METTH/15-144................................................................................
A7NRR3_ROSCS/6-141................................................................................
C9RCS1_AMMDK/9-145................................................................................
C9RCG8_AMMDK/9-178................................................................................
A5UWG6_ROSS1/4-173................................................................................
A7NRS6_ROSCS/4-175................................................................................
A5D4F7_PELTS/4-177................................................................................
B3EIR8_CHLL2/6-173................................................................................
B4S552_PROA2/12-192................................................................................
A6DAG1_9PROT/9-198................................................................................
C7P6D1_METFA/9-230................................................................................
B7IGV5_THEAB/8-173................................................................................
D3T315_THEIA/9-219................................................................................
O28411_ARCFU/9-154................................................................................
Q8U3V3_PYRFU/7-178................................................................................
D3T7Q1_THEIA/22-173................................................................................
B0M908_9FIRM/9-142................................................................................
C5D4N4_GEOSW/18-161................................................................................
Q53W07_THET8/34-193................................................................................
A9AWU5_HERA2/41-244................................................................................
D2ZTS9_NEIMU/25-187................................................................................
D0W1J3_NEICI/30-211................................................................................
E6XI85_SHEP2/30-186................................................................................
D1Y2F0_9BACT/26-187................................................................................
Q1IZR9_DEIGD/24-191................................................................................
D3PS14_MEIRD/23-188................................................................................
D2Z4K2_9BACT/26-193................................................................................
C5BIW8_TERTT/31-214................................................................................
Q9KFY9_BACHD/34-207................................................................................
C8WRP6_ALIAD/23-238................................................................................
Q1CW28_MYXXD/33-206................................................................................
D3SNA7_THEAH/10-153................................................................................
Q2LQW6_SYNAS/16-162................................................................................
B6IX20_RHOCS/283-454................................................................................
A8DJU4_9BACT/304-514................................................................................
C8W3E8_DESAS/7-167................................................................................
C0A713_9BACT/8-185................................................................................
B8GSG8_THISH/11-176................................................................................
B7R675_9THEO/7-162................................................................................
O66703_AQUAE/10-154................................................................................
Q47PK0_THEFY/7-173................................................................................
A6LNK0_THEM4/7-158................................................................................
B7IFF0_THEAB/10-183................................................................................
A8UTQ9_9AQUI/7-200................................................................................
B2V8M0_SULSY/7-150................................................................................
A8V361_9AQUI/9-167................................................................................
A8M9C0_CALMQ/7-192................................................................................
Q96Z54_SULTO/9-305................................................................................
Q97WX2_SULSO/9-255................................................................................
D2PID8_SULID/27-180................................................................................
Q97Y38_SULSO/24-174................................................................................
C4KFX7_SULIK/27-177................................................................................
Q8TPH8_METAC/9-242................................................................................
A6UVY5_META3/7-263................................................................................
A1KMG2_MYCBP/9-193................................................................................
Q5HK92_STAEQ/9-199................................................................................
Q9X2C8_THEMA/9-196................................................................................
A3DLB2_STAMF/6-246................................................................................
B8GB50_CHLAD/99-293................................................................................
A1ZVA0_9BACT/4-254................................................................................
A5ILN4_THEP1/4-318................................................................................
Q46CS3_METBF/9-174................................................................................
A6DAF6_9PROT/10-162................................................................................
Q2FL73_METHJ/7-220................................................................................
A0ZJ98_NODSP/7-256................................................................................
A4XGT8_CALS8/240-441................................................................................
A9AUN3_HERA2/7-220................................................................................
A3DKC7_CLOTH/8-205................................................................................
Q8TVR9_METKA/10-323................................................................................
Q8TVU2_METKA/6-335................................................................................
Q6L316_PICTO/4-317................................................................................
Q97CJ4_THEVO/4-334................................................................................
Y1667_METJA/49-345................................................................................
A6DE72_9PROT/4-332................................................................................
O27150_METTH/4-274................................................................................

PF08798

C1NCW0_9ESCH/1-198--------------------------------------------------------------------------------
Q1GAI3_LACDA/1-205--------------------------------------------------------------------------------
Q1EQT0_STRKN/3-219--------------------------------------------------------------------------------
Q8X7W1_ECO57/1-212--------------------------------------------------------------------------------
A4XYT8_PSEMY/1-203--------------------------------------------------------------------------------
Q67RN9_SYMTH/1-223--------------------------------------------------------------------------------
Q8KB24_CHLTE/1-202--------------------------------------------------------------------------------
A5UR13_ROSS1/1-237--------------------------------------------------------------------------------
Q1J366_DEIGD/4-210--------------------------------------------------------------------------------
Q5PEG8_SALPA/1-232--------------------------------------------------------------------------------
A5FTJ9_ACICJ/1-224--------------------------------------------------------------------------------
A1SV70_PSYIN/1-178--------------------------------------------------------------------------------
Q2RXJ4_RHORT/4-241--------------------------------------------------------------------------------
B3ENH7_CHLPB/1-201--------------------------------------------------------------------------------
Q2JWC6_SYNJA/1-204--------------------------------------------------------------------------------
CSE3_THET8/1-211--------------------------------------------------------------------------------
A3LCN7_PSEAI/1-202--------------------------------------------------------------------------------
Q57KI5_SALCH/1-212--------------------------------------------------------------------------------
Q0W583_UNCMA/1-248--------------------------------------------------------------------------------
A0LM55_SYNFM/1-201--------------------------------------------------------------------------------
Q60AD3_METCA/5-237--------------------------------------------------------------------------------
Q1JX12_DESAC/1-200--------------------------------------------------------------------------------
A1ARH5_PELPD/1-222--------------------------------------------------------------------------------
Q6LWA0_PHOPR/2-180--------------------------------------------------------------------------------
C1DSI0_AZOVD/1-204--------------------------------------------------------------------------------
Q1EQJ3_STRKN/1-237--------------------------------------------------------------------------------
Q2JH26_FRASC/2-267--------------------------------------------------------------------------------
Q03C59_LACC3/1-212--------------------------------------------------------------------------------
Q3ZZ80_DEHSC/1-206--------------------------------------------------------------------------------
A7MFK9_CROS8/1-212--------------------------------------------------------------------------------
Q5YRB7_NOCFA/1-222--------------------------------------------------------------------------------
Q7N8H4_PHOLL/1-223--------------------------------------------------------------------------------
Q0BRF7_GRABC/2-239--------------------------------------------------------------------------------
A6W167_MARMS/1-223--------------------------------------------------------------------------------
A8M405_SALAI/1-222--------------------------------------------------------------------------------
A3EQA3_9BACT/1-214--------------------------------------------------------------------------------
Q1ZM76_PHOAS/1-219--------------------------------------------------------------------------------
Q314I5_DESDG/1-218--------------------------------------------------------------------------------
A0AE92_STRAM/1-253--------------------------------------------------------------------------------
A8LYZ8_SALAI/3-204--------------------------------------------------------------------------------
Q825C0_STRAW/3-217--------------------------------------------------------------------------------
Q47PJ5_THEFY/2-225--------------------------------------------------------------------------------
F2GBG6_ALTMD/1-221--------------------------------------------------------------------------------
Q74DC7_GEOSL/1-201--------------------------------------------------------------------------------
Q0RTG6_FRAAA/28-266--------------------------------------------------------------------------------
A7BA62_9ACTO/1-248--------------------------------------------------------------------------------
Q1R113_CHRSD/1-229--------------------------------------------------------------------------------
Q6NEQ5_CORDI/5-227--------------------------------------------------------------------------------
Q2FNT6_METHJ/1-225--------------------------------------------------------------------------------
A5F3T0_VIBC3/4-208--------------------------------------------------------------------------------

PF09559

Q1CW34_MYXXD/4-194--------------------------------------------------------------------------------
Q1CW45_MYXXD/31-221--------------------------------------------------------------------------------
Q3M7D9_ANAVT/30-227--------------------------------------------------------------------------------
Q8F1E7_LEPIN/7-205--------------------------------------------------------------------------------
A0YQL0_LYNSP/20-218--------------------------------------------------------------------------------
Q0A841_ALHEH/18-219--------------------------------------------------------------------------------
A1WYF2_HALHL/43-244--------------------------------------------------------------------------------
A1AWQ7_RUTMC/19-218--------------------------------------------------------------------------------
Q4JN26_9BACT/18-217--------------------------------------------------------------------------------
Q3SG16_THIDA/19-212--------------------------------------------------------------------------------

PF09700

Q746D9_THET2/1-351--------------------------------------------------------------------------------
A0B6W4_METTP/4-358--------------------------------------------------------------------------------
O28413_ARCFU/3-341--------------------------------------------------------------------------------
A6LNK2_THEM4/6-323--------------------------------------------------------------------------------
A6VYS5_MARMS/4-381--------------------------------------------------------------------------------
Q47PK4_THEFY/13-381--------------------------------------------------------------------------------
A4BL65_9GAMM/5-384--------------------------------------------------------------------------------
Q9KFY7_BACHD/8-408--------------------------------------------------------------------------------
A6UNE8_METVS/6-362--------------------------------------------------------------------------------
O66707_AQUAE/4-323--------------------------------------------------------------------------------
Q97WW9_SULSO/5-306--------------------------------------------------------------------------------
Q1CW30_MYXXD/6-386--------------------------------------------------------------------------------
Q9X2B3_THEMA/6-327--------------------------------------------------------------------------------
A7C3N9_9GAMM/9-401--------------------------------------------------------------------------------
Q2JN53_SYNJB/4-377--------------------------------------------------------------------------------
A3IZR5_9CHRO/4-391--------------------------------------------------------------------------------
Q8U1S7_PYRFU/4-321--------------------------------------------------------------------------------
A9AWU6_HERA2/68-470--------------------------------------------------------------------------------
A1WUQ1_HALHL/5-362--------------------------------------------------------------------------------
C0A715_9BACT/6-379--------------------------------------------------------------------------------
A5D0Z3_PELTS/4-387--------------------------------------------------------------------------------
A1ZP54_9BACT/3-366--------------------------------------------------------------------------------
Q8TVU0_METKA/10-439--------------------------------------------------------------------------------
Q2JRT1_SYNJA/4-372--------------------------------------------------------------------------------
Q6ZEA9_SYNY3/4-365--------------------------------------------------------------------------------
Q1IZS1_DEIGD/6-393--------------------------------------------------------------------------------
A7GFA9_CLOBL/4-366--------------------------------------------------------------------------------
A8DJU1_9BACT/6-369--------------------------------------------------------------------------------
Q7MTH3_PORGI/6-391--------------------------------------------------------------------------------
A9AVY8_HERA2/6-387--------------------------------------------------------------------------------
Q8R6Z6_THETN/4-372--------------------------------------------------------------------------------
E6XI87_SHEP2/4-375--------------------------------------------------------------------------------
Q1AZD9_RUBXD/4-359--------------------------------------------------------------------------------

PF09704

Q2MF31_STRSD/16-248--------------------------------------------------------------------------------
Q7NYP8_CHRVO/13-224--------------------------------------------------------------------------------
A1ARH6_PELPD/3-217--------------------------------------------------------------------------------
Q12YA8_METBU/4-236--------------------------------------------------------------------------------
Q0BSC7_GRABC/6-215--------------------------------------------------------------------------------
A8ABL4_IGNH4/3-275--------------------------------------------------------------------------------
A6W168_MARMS/4-241--------------------------------------------------------------------------------
O66696_AQUAE/3-211--------------------------------------------------------------------------------
A8ZZ17_DESOH/3-251--------------------------------------------------------------------------------
Q1EQJ4_STRKN/3-213--------------------------------------------------------------------------------
A5UR14_ROSS1/3-244--------------------------------------------------------------------------------
Q8Z465_SALTI/4-233--------------------------------------------------------------------------------
Q3A5Z4_PELCD/3-236--------------------------------------------------------------------------------
C1DSH9_AZOVD/3-205--------------------------------------------------------------------------------
Q5YRB6_NOCFA/3-211--------------------------------------------------------------------------------
Q1CWU1_MYXXD/10-210--------------------------------------------------------------------------------
A3DLC5_STAMF/3-270--------------------------------------------------------------------------------
A4J385_DESRM/4-212--------------------------------------------------------------------------------
Q65TW5_MANSM/4-216--------------------------------------------------------------------------------
Q8KDC0_CHLTE/7-228--------------------------------------------------------------------------------
Q5H4J6_XANOR/4-215--------------------------------------------------------------------------------
Q9X2C0_THEMA/3-212--------------------------------------------------------------------------------
Q03C60_LACC3/3-210--------------------------------------------------------------------------------
Q8U334_PYRFU/3-239--------------------------------------------------------------------------------
Q47PI7_THEFY/3-209--------------------------------------------------------------------------------
O28407_ARCFU/3-252--------------------------------------------------------------------------------
Q2SID2_HAHCH/4-215--------------------------------------------------------------------------------
CAS5_METJA/5-228--------------------------------------------------------------------------------
Q72NC2_LEPIC/11-225--------------------------------------------------------------------------------
O27159_METTH/3-241--------------------------------------------------------------------------------
B3E5U9_GEOLS/3-263--------------------------------------------------------------------------------
Q04QB7_LEPBJ/4-240--------------------------------------------------------------------------------
Q60AD2_METCA/3-241--------------------------------------------------------------------------------
Q2RL62_MOOTA/18-224--------------------------------------------------------------------------------
A5GBK2_GEOUR/12-223--------------------------------------------------------------------------------
Q72WF9_DESVH/10-218--------------------------------------------------------------------------------
Q0W584_UNCMA/6-214--------------------------------------------------------------------------------
Q1NKD4_9DELT/4-199--------------------------------------------------------------------------------
A4YFV1_METS5/10-233--------------------------------------------------------------------------------
A8LYZ7_SALAI/3-226--------------------------------------------------------------------------------
CASD_ECOLI/4-214--------------------------------------------------------------------------------
Q0AZP3_SYNWW/4-212--------------------------------------------------------------------------------
Q1R114_CHRSD/4-250--------------------------------------------------------------------------------
CAS5C_SULSO/5-232--------------------------------------------------------------------------------
Q2RW65_RHORT/4-212--------------------------------------------------------------------------------
Q5P3Y6_AROAE/8-203--------------------------------------------------------------------------------
Q314I4_DESDG/4-228--------------------------------------------------------------------------------
A1SV73_PSYIN/3-198--------------------------------------------------------------------------------
Q1EQS9_STRKN/13-242--------------------------------------------------------------------------------
Q3YYA5_SHISS/4-233--------------------------------------------------------------------------------
A6TNS2_ALKMQ/6-209--------------------------------------------------------------------------------
B4SAU9_PELPB/4-206--------------------------------------------------------------------------------
Q1H3R5_METFK/4-216--------------------------------------------------------------------------------
Q67RP0_SYMTH/3-220--------------------------------------------------------------------------------
Q2JWC5_SYNJA/3-192--------------------------------------------------------------------------------
B1YHA3_EXIS2/4-198--------------------------------------------------------------------------------
Q4JWK0_CORJK/4-209--------------------------------------------------------------------------------
Q7N8H5_PHOLL/4-236--------------------------------------------------------------------------------
Q60B28_METCA/3-213--------------------------------------------------------------------------------
Q2LX12_SYNAS/8-216--------------------------------------------------------------------------------
B8I205_CLOCE/4-212--------------------------------------------------------------------------------
Q2RXJ5_RHORT/6-238--------------------------------------------------------------------------------
C1DNX2_AZOVD/4-215--------------------------------------------------------------------------------
Q0AA33_ALHEH/3-231--------------------------------------------------------------------------------
Q3ZZ79_DEHSC/6-199--------------------------------------------------------------------------------
Q47PJ4_THEFY/3-220--------------------------------------------------------------------------------
Q6NEQ9_CORDI/4-220--------------------------------------------------------------------------------
Q1JX11_DESAC/4-219--------------------------------------------------------------------------------
Q746C2_THET2/3-211--------------------------------------------------------------------------------
Q0RTG7_FRAAA/8-241--------------------------------------------------------------------------------
Q39WR9_GEOMG/10-218--------------------------------------------------------------------------------
Q977B3_SULTO/4-249--------------------------------------------------------------------------------
Q0BRF8_GRABC/3-224--------------------------------------------------------------------------------
CAS5B_SULSO/4-251--------------------------------------------------------------------------------
Q8ZZL1_PYRAE/3-217--------------------------------------------------------------------------------
Q3ARV4_CHLCH/4-200--------------------------------------------------------------------------------
Q1J367_DEIGD/3-208--------------------------------------------------------------------------------
Q9KFY3_BACHD/4-199--------------------------------------------------------------------------------
A5V1B9_ROSS1/6-202--------------------------------------------------------------------------------
Q04AW9_LACDB/3-211--------------------------------------------------------------------------------
O57910_PYRHO/4-218--------------------------------------------------------------------------------
Q184H2_CLOD6/3-221--------------------------------------------------------------------------------
A2BKI9_HYPBU/5-261--------------------------------------------------------------------------------
A1A2N3_BIFAA/7-207--------------------------------------------------------------------------------
Q9YCM4_AERPE/7-241--------------------------------------------------------------------------------
Q6LWA3_PHOPR/12-207--------------------------------------------------------------------------------
A0AE91_STRAM/6-214--------------------------------------------------------------------------------
Q74DC8_GEOSL/4-217--------------------------------------------------------------------------------
Q8KB22_CHLTE/5-230--------------------------------------------------------------------------------
Q1JAP7_STRPB/6-202--------------------------------------------------------------------------------
Q2J7P3_FRASC/14-209--------------------------------------------------------------------------------
Q5JGB2_PYRKO/7-237--------------------------------------------------------------------------------
B3ENH9_CHLPB/5-225--------------------------------------------------------------------------------
Q96X68_SULTO/5-233--------------------------------------------------------------------------------
Q53WH0_THET8/3-225--------------------------------------------------------------------------------
A5D0R8_PELTS/6-219--------------------------------------------------------------------------------
Q2RY19_RHORT/6-247--------------------------------------------------------------------------------
A0LDG2_MAGSM/7-202--------------------------------------------------------------------------------
Q3SR91_NITWN/4-221--------------------------------------------------------------------------------
Q1ZM77_PHOAS/4-242--------------------------------------------------------------------------------
Q9UZX1_PYRAB/18-248--------------------------------------------------------------------------------
A4SFQ4_PROVI/7-227--------------------------------------------------------------------------------

PF01881

A3I0J5_9BACT/85-250-------------------------------------------------------------------------LYESTL-
B4SEV7_PELPB/102-262-------------------------------------------------------------------------LLENLC-
A9BGZ0_PETMO/94-248-------------------------------------------------------------------------IKENLI-
B4S5I3_PROA2/102-261-------------------------------------------------------------------------LLENLL-
A9BIX0_PETMO/95-244-------------------------------------------------------------------------IEENLK-
B8FSG8_DESHD/95-244-------------------------------------------------------------------------FNENLR-
A5D0Y7_PELTS/95-244-------------------------------------------------------------------------ITANLA-
O30164_ARCFU/94-241-------------------------------------------------------------------------ILQNLV-
CAS6_PYRHO/96-239-------------------------------------------------------------------------IRENLK-
A7HMV7_FERNB/94-242-------------------------------------------------------------------------LKENLL-
Q5JGA0_PYRKO/94-241-------------------------------------------------------------------------VRENLR-
A1BI29_CHLPD/102-262-------------------------------------------------------------------------LFDNLC-
A5ILP0_THEP1/93-246-------------------------------------------------------------------------FRKNLV-
A4XIJ2_CALS8/97-249-------------------------------------------------------------------------ISQNLM-
CAS6L_PYRFU/91-238-------------------------------------------------------------------------LRKVML-
CAS6_PYRFU/95-238-------------------------------------------------------------------------IKDDLQ-
O66704_AQUAE/85-236-------------------------------------------------------------------------LVENIY-
Q97CI9_THEVO/80-232-------------------------------------------------------------------------LKENAI-
Q6L312_PICTO/82-235-------------------------------------------------------------------------LKENAI-
Y1234_METJA/81-240-------------------------------------------------------------------------LQDNAV-
Q6L114_PICTO/79-219-------------------------------------------------------------------------IKNDII-
A5TU40_FUSNP/91-242-------------------------------------------------------------------------LNWLMK-
Q3AA81_CARHZ/95-248-------------------------------------------------------------------------IRQNLL-
Q1AZD0_RUBXD/93-249-------------------------------------------------------------------------ILENIK-
Q6L357_PICTO/89-232-------------------------------------------------------------------------LKAWMI-
Y375_METJA/95-240-------------------------------------------------------------------------LKNNLK-
Q4EVR3_LISMN/89-240-------------------------------------------------------------------------LKRNML-
Q2NFS1_METST/92-244-------------------------------------------------------------------------LEKNLI-
O27163_METTH/1-154-------------------------------------------------------------------------LQNNLV-
A7GQ92_BACCN/87-233-------------------------------------------------------------------------LNYISD-
O57900_PYRHO/78-237-------------------------------------------------------------------------LKENAE-
A4J1X6_DESRM/95-249-------------------------------------------------------------------------IAQNLV-
Q46FQ7_METBF/89-241-------------------------------------------------------------------------LHKNLV-
A5UJJ7_METS3/89-241-------------------------------------------------------------------------LENNLI-
Q5JHS4_PYRKO/92-239-------------------------------------------------------------------------LRKIML-
Q332K8_CBCP/101-247-------------------------------------------------------------------------IKQNLK-
O66560_AQUAE/87-244-------------------------------------------------------------------------LRYSLK-
A1ZVQ2_9BACT/100-263-------------------------------------------------------------------------FIENLR-
CAS6L_PYRHO/91-238-------------------------------------------------------------------------LRKVMI-
Q184H4_CLOD6/91-242-------------------------------------------------------------------------LNYITN-
A4XM43_CALS8/98-260-------------------------------------------------------------------------LNDVID-
A1ZPF3_9BACT/98-260-------------------------------------------------------------------------FLQALL-
A8F3P6_THELT/92-245-------------------------------------------------------------------------INANLI-
Q8TJV5_METAC/89-241-------------------------------------------------------------------------LHKNLV-
Q12WX9_METBU/89-240-------------------------------------------------------------------------IHTNLT-
A6DAF5_9PROT/81-224-------------------------------------------------------------------------LTNNLI-

PF10040

A1RZS7_THEPD/144-263-------------------------------------------------------------------------.LAGLV-
A4J507_DESRM/140-259-------------------------------------------------------------------------.FKSYK-
Q3M5G3_ANAVT/172-285-------------------------------------------------------------------------.FNSLL-
A0ZJZ0_NODSP/168-289-------------------------------------------------------------------------.FHSYL-
CAS6A_SULSO/138-277-------------------------------------------------------------------------.VAYAY-
Q2JNR9_SYNJB/173-292-------------------------------------------------------------------------.FHSYL-
A8ABE5_IGNH4/136-254-------------------------------------------------------------------------FSVNAY-
Q7TXS3_MYCBO/184-300-------------------------------------------------------------------------.FQSLA-
Q6ZED0_SYNY3/149-272-------------------------------------------------------------------------.LQSYL-
A0ZJ83_NODSP/132-250-------------------------------------------------------------------------.FRSWL-
A1HND4_9FIRM/191-314-------------------------------------------------------------------------LIRNLL-
Q03KT3_STRTD/120-237-------------------------------------------------------------------------.FQSLM-
B8G917_CHLAD/148-265-------------------------------------------------------------------------.FGSLL-
Q977A9_SULTO/131-247-------------------------------------------------------------------------.LLSIA-
Q72GC1_THET2/120-235-------------------------------------------------------------------------.LESLL-
A3MST1_PYRCJ/120-246-------------------------------------------------------------------------ALSAGL-
Q2FR84_METHJ/135-257-------------------------------------------------------------------------.LSASI-
A3CNA0_STRSV/121-238-------------------------------------------------------------------------.FQSLM-
A7NKQ1_ROSCS/148-265-------------------------------------------------------------------------.FGSLL-
A1HM59_9FIRM/128-245-------------------------------------------------------------------------.YQSLV-
Q9YCN0_AERPE/126-238-------------------------------------------------------------------------.VYSVF-
Q745V3_THET2/136-262-------------------------------------------------------------------------.AGSLL-
B3EIY9_CHLPB/190-323-------------------------------------------------------------------------LLKSLY-
Q8ZZK8_PYRAE/121-246-------------------------------------------------------------------------.FKSAV-
A0YW92_LYNSP/157-270-------------------------------------------------------------------------.FNSLL-
A3DLD1_STAMF/165-291-------------------------------------------------------------------------FSYNIG-
Q74DY6_GEOSL/182-301-------------------------------------------------------------------------FARALM-
A1RZX7_THEPD/116-252-------------------------------------------------------------------------AYDAAM-
B4S549_PROA2/190-323-------------------------------------------------------------------------LLKSLY-
Q4J7R1_SULAC/134-279-------------------------------------------------------------------------.FSFLA-
Q1Q3G5_9BACT/191-313-------------------------------------------------------------------------LVRNLL-
A8M9A8_CALMQ/139-276-------------------------------------------------------------------------.IFSMA-
A1RQV9_PYRIL/103-214-------------------------------------------------------------------------.AYSLA-
Q5HK95_STAEQ/125-242-------------------------------------------------------------------------.FRSIM-
A6NTQ0_9FIRM/121-240-------------------------------------------------------------------------.MQSLI-
A8AA66_IGNH4/119-232-------------------------------------------------------------------------.VYSLF-
Q01QC2_SOLUE/166-288-------------------------------------------------------------------------LFGRLR-
Q4J7D4_SULAC/139-264-------------------------------------------------------------------------.LFSIV-
Q8ZZU6_PYRAE/127-238-------------------------------------------------------------------------.AYSLA-
A2BMX9_HYPBU/151-264-------------------------------------------------------------------------.IASVA-
Q6ZEI4_SYNY3/146-257-------------------------------------------------------------------------.FNSLL-
A6DE70_9PROT/157-271-------------------------------------------------------------------------.LRSIY-
A9AZH6_HERA2/148-265-------------------------------------------------------------------------.FGSLL-
A0LHY9_SYNFM/189-312-------------------------------------------------------------------------LARNLL-
Q4J7P9_SULAC/157-283-------------------------------------------------------------------------FSTNVF-
Q0AW55_SYNWW/127-244-------------------------------------------------------------------------.VKSLN-
Q3IQ75_NATPD/155-285-------------------------------------------------------------------------.FNSLL-
A0B9F8_METTP/179-310-------------------------------------------------------------------------.FSSLL-
Q39T05_GEOMG/185-303-------------------------------------------------------------------------LMRTLI-
A4YFW1_METS5/128-262-------------------------------------------------------------------------.IASAY-
B9LJK3_CHLSY/148-265-------------------------------------------------------------------------.FGSLL-
A4YFU6_METS5/153-294-------------------------------------------------------------------------.VAYGY-
Y1859_ARCFU/176-286-------------------------------------------------------------------------VRRRLI-
A0YIK9_LYNSP/157-279-------------------------------------------------------------------------.FHSYL-
A1BI47_CHLPD/189-322-------------------------------------------------------------------------LLKSLY-
Q8TVD3_METKA/146-270-------------------------------------------------------------------------.VRNAA-
A0YUQ2_LYNSP/96-214-------------------------------------------------------------------------.FRSWL-
A3MVN5_PYRCJ/123-252-------------------------------------------------------------------------.FKSAV-
Q97YE5_SULSO/103-228-------------------------------------------------------------------------.FYSIA-
Q2FM73_METHJ/142-275-------------------------------------------------------------------------.FFSIL-
Q8ZZM1_PYRAE/124-249-------------------------------------------------------------------------.FKSAV-
A9AX64_HERA2/145-264-------------------------------------------------------------------------.FQSLL-
A8ZV96_DESOH/179-301-------------------------------------------------------------------------LVRVML-

PF03787

Q1Q3H4_9BACT/4-335.........................................................................LDEEIFQ
Q8TPH7_METAC/4-317.........................................................................ISEVIF.
O57906_PYRHO/18-333.........................................................................LEAIVF.
B3EIY8_CHLPB/11-320.........................................................................LEQACF.
A6LNL6_THEM4/4-297.........................................................................VEKKLF.
A4XFP8_CALS8/12-334.........................................................................ADKKVF.
Q3AA80_CARHZ/5-311.........................................................................AEMALT.
A7HMV5_FERNB/4-324.........................................................................IESELV.
A2VLF2_MYCTU/11-314.........................................................................FERKELR
Q0AW54_SYNWW/12-313.........................................................................VEKKVFY
Q5HK93_STAEQ/9-268................................................................................
Q03KS9_STRTD/11-288.........................................................................NKNLIPW
A2BKQ7_HYPBU/87-311.........................................................................CIERILA
Q2LQX1_SYNAS/103-281.........................................................................SVPHMF.
Q7MTH6_PORGI/59-251.........................................................................IIEKVF.
A7FVL1_CLOB1/73-293.........................................................................LTNNIFE
Q8TVU2_METKA/491-691.........................................................................RFREVF.
A1WUQ4_HALHL/82-287.........................................................................EIEALF.
A9AWU2_HERA2/90-292.........................................................................FHRELF.
Q1CW33_MYXXD/74-261.........................................................................ARRRLF.
Q977D5_SULTO/23-210.........................................................................PVCDLL.
A8A9P3_IGNH4/77-241.........................................................................AVEPLL.
A1RZR1_THEPD/18-247.........................................................................YLEKLR.
Q2RV95_RHORT/11-210.........................................................................TLEALF.
Q4J793_SULAC/8-222.........................................................................RFKKIL.
A4YFX5_METS5/9-241.........................................................................VARRVFW
Q4J7N6_SULAC/8-291.........................................................................TVKELV.
A8F3D7_THELT/30-277.........................................................................AEEELVN
A4FJY4_SACEN/194-372.........................................................................RPCLLF.
A4YFW9_METS5/24-229.........................................................................IPCIIF.
Q2RY06_RHORT/19-223.........................................................................RDRLLFG
Q2RV95_RHORT/253-439.........................................................................AVNRLF.
Q5LZX3_STRT1/11-194.........................................................................ILSRLF.
A5UWG2_ROSS1/10-302.........................................................................PVCYTF.
Q2JNS6_SYNJB/14-218.........................................................................FTDQMF.
B9LIP8_CHLSY/265-444.........................................................................MIDSIF.
A7NFU0_ROSCS/21-222.........................................................................LIDLTF.
O66706_AQUAE/7-289.........................................................................MLIDIF.
A6LNK3_THEM4/7-272.........................................................................NKEEIF.
A6UNE9_METVS/9-264.........................................................................IIDHIF.
Q2FL77_METHJ/279-403.........................................................................IIDSIF.
A1WUQ2_HALHL/9-296.........................................................................QADQLF.
Q8TVT9_METKA/8-335.........................................................................LVDAVF.
Q47PK3_THEFY/7-290.........................................................................TLKEVF.
Q2JRT2_SYNJA/7-252.........................................................................LKFELF.
A0YUX6_LYNSP/8-262.........................................................................TANLWY.
A0YQJ5_LYNSP/5-273.........................................................................LVNNWF.
A8A9P1_IGNH4/9-272.........................................................................RLCCLL.
Q97WX4_SULSO/14-302.........................................................................IIYKVL.
Q97XK7_SULSO/7-290.........................................................................ECCCLF.
A3MVP2_PYRCJ/10-303.........................................................................TFLAAF.
Q2JNS1_SYNJB/20-216.........................................................................LVCQIF.
A5UT82_ROSS1/9-185.........................................................................MVCQIF.
Q2FL76_METHJ/14-206.........................................................................LVCQIF.
B8G728_CHLAD/8-184.........................................................................VVDTIF.
Q6ZED2_SYNY3/7-200.........................................................................WINFIF.
B0K2G5_THEPX/4-192.........................................................................IVGNIF.
A9AUN2_HERA2/7-194.........................................................................MRDQLF.
Q7MC47_VIBVY/7-190.........................................................................AIELLF.
A3DH28_CLOTH/14-216.........................................................................PVCKVF.
A4YFX0_METS5/20-218.........................................................................LNCKVF.
Q2JRT5_SYNJA/129-478.........................................................................AVAPWF.
Q2FL77_METHJ/16-208.........................................................................ISCRMF.
A4TG45_MYCGI/12-250.........................................................................PLIAVF.
A4XGU1_CALS8/51-316.........................................................................FRAGIL.
Q0ATZ2_SYNWW/170-634DLIESYIADISREPKADLFKMLEKYPGGIPCFYLIDNKGNIKSIGHTPLFRLAYDKKVKDHLPAEHKSNTVIDFTEAIF.
B0K8W5_THEP3/133-594YYDILKMAKDKKVTLPNKIVELPNGVPVFYVEYNDKKGNKKIAFGHTGFFRLPYELTIGDHVPENLKSDDITDFAEAIF.
A3DH27_CLOTH/31-251.........................................................................IVSDMF.
A3DKC8_CLOTH/235-405.........................................................................ILTNIF.
Q6ZED5_SYNY3/156-674................................................HVRFWAERYTRGNFCYWRVRQIA..RHNQNL.
Q82XX3_NITEU/10-223.........................................................................LNEHIA.
A3DH32_CLOTH/9-175.........................................................................VMCTIF.
A6NTP4_9FIRM/14-168.........................................................................KTRRLF.
Q7MC49_VIBVY/10-189.........................................................................IREYWF.
A0RRG9_CAMFF/11-179.........................................................................KTDDIF.
A3DKC8_CLOTH/16-186.........................................................................NFNELF.
A0YPM8_LYNSP/30-210.........................................................................LATLLF.
D2C6C1_THENR/8-159.........................................................................PSCLIF.
Q8PRT5_METMA/8-181.........................................................................PACYLF.
O26428_METTH/15-144.........................................................................DACELF.
A7NRR3_ROSCS/6-141.........................................................................VVCELF.
C9RCS1_AMMDK/9-145.........................................................................VVCKLF.
C9RCG8_AMMDK/9-178.........................................................................AACRVF.
A5UWG6_ROSS1/4-173.........................................................................DACQVF.
A7NRS6_ROSCS/4-175.........................................................................DVCQLF.
A5D4F7_PELTS/4-177.........................................................................HVCEIF.
B3EIR8_CHLL2/6-173.........................................................................DVCQVF.
B4S552_PROA2/12-192.........................................................................DASLIF.
A6DAG1_9PROT/9-198.........................................................................TTSKIF.
C7P6D1_METFA/9-230.........................................................................LPSRIF.
B7IGV5_THEAB/8-173.........................................................................LSSKIF.
D3T315_THEIA/9-219.........................................................................VPSRLF.
O28411_ARCFU/9-154.........................................................................VEEYVF.
Q8U3V3_PYRFU/7-178.........................................................................VEEKIF.
D3T7Q1_THEIA/22-173.........................................................................EENGIF.
B0M908_9FIRM/9-142.........................................................................RESALF.
C5D4N4_GEOSW/18-161.........................................................................QEEEWF.
Q53W07_THET8/34-193.........................................................................LESALF.
A9AWU5_HERA2/41-244.........................................................................KEAQIW.
D2ZTS9_NEIMU/25-187.........................................................................AEFRLW.
D0W1J3_NEICI/30-211.........................................................................AEFRLW.
E6XI85_SHEP2/30-186.........................................................................NEEAIW.
D1Y2F0_9BACT/26-187.........................................................................KECALW.
Q1IZR9_DEIGD/24-191.........................................................................AESGLW.
D3PS14_MEIRD/23-188.........................................................................AEEAIW.
D2Z4K2_9BACT/26-193.........................................................................RESQIW.
C5BIW8_TERTT/31-214.........................................................................REAAIW.
Q9KFY9_BACHD/34-207.........................................................................AEAKIF.
C8WRP6_ALIAD/23-238.........................................................................REAWIW.
Q1CW28_MYXXD/33-206.........................................................................RERELW.
D3SNA7_THEAH/10-153.........................................................................LESELF.
Q2LQW6_SYNAS/16-162.........................................................................KENEIW.
B6IX20_RHOCS/283-454.........................................................................LETLVW.
A8DJU4_9BACT/304-514.........................................................................LEAAIW.
C8W3E8_DESAS/7-167.........................................................................KEQELF.
C0A713_9BACT/8-185.........................................................................QEAALF.
B8GSG8_THISH/11-176.........................................................................EEAALF.
B7R675_9THEO/7-162.........................................................................RESEVF.
O66703_AQUAE/10-154.........................................................................HENEIF.
Q47PK0_THEFY/7-173.........................................................................LEDEVF.
A6LNK0_THEM4/7-158.........................................................................AEELIF.
B7IFF0_THEAB/10-183.........................................................................LEDIIF.
A8UTQ9_9AQUI/7-200.........................................................................LESELF.
B2V8M0_SULSY/7-150.........................................................................LESEVF.
A8V361_9AQUI/9-167.........................................................................FEESIF.
A8M9C0_CALMQ/7-192.........................................................................KVSKIV.
Q96Z54_SULTO/9-305.........................................................................LLEDFF.
Q97WX2_SULSO/9-255.........................................................................LFEDVF.
D2PID8_SULID/27-180.........................................................................KVLEYL.
Q97Y38_SULSO/24-174.........................................................................YVFEYL.
C4KFX7_SULIK/27-177.........................................................................FVSKYL.
Q8TPH8_METAC/9-242.........................................................................IKETLYF
A6UVY5_META3/7-263.........................................................................IPKPMLK
A1KMG2_MYCBP/9-193.........................................................................VPKPLHS
Q5HK92_STAEQ/9-199.........................................................................IETLQL.
Q9X2C8_THEMA/9-196.........................................................................VSSLLFV
A3DLB2_STAMF/6-246.........................................................................KAVSLLH
B8GB50_CHLAD/99-293.........................................................................WILHLF.
A1ZVA0_9BACT/4-254.........................................................................FLSGLM.
A5ILN4_THEP1/4-318.........................................................................FLNGLFR
Q46CS3_METBF/9-174.........................................................................RDSGSFN
A6DAF6_9PROT/10-162.........................................................................FYPKID.
Q2FL73_METHJ/7-220.........................................................................NYRDLFD
A0ZJ98_NODSP/7-256.........................................................................EESAIF.
A4XGT8_CALS8/240-441.........................................................................YQTPLFI
A9AUN3_HERA2/7-220.........................................................................TAKRLF.
A3DKC7_CLOTH/8-205.........................................................................MMQGYM.
Q8TVR9_METKA/10-323.........................................................................LRATVFQ
Q8TVU2_METKA/6-335.........................................................................ALRVLF.
Q6L316_PICTO/4-317.........................................................................LDDLLFY
Q97CJ4_THEVO/4-334.........................................................................LDEAIFY
Y1667_METJA/49-345.........................................................................LEKNAI.
A6DE72_9PROT/4-332.........................................................................LEAIVFC
O27150_METTH/4-274.........................................................................IINSFF.

PF08798

C1NCW0_9ESCH/1-198-------------------------------------------------------------------------ATVIKT-
Q1GAI3_LACDA/1-205-------------------------------------------------------------------------AISKDY-
Q1EQT0_STRKN/3-219-------------------------------------------------------------------------SLSRPL-
Q8X7W1_ECO57/1-212-------------------------------------------------------------------------TFTIEC-
A4XYT8_PSEMY/1-203-------------------------------------------------------------------------EIESKP-
Q67RN9_SYMTH/1-223-------------------------------------------------------------------------PAVKRV-
Q8KB24_CHLTE/1-202-------------------------------------------------------------------------HGELVS-
A5UR13_ROSS1/1-237-------------------------------------------------------------------------PALRRI-
Q1J366_DEIGD/4-210-------------------------------------------------------------------------GWEVKT-
Q5PEG8_SALPA/1-232-------------------------------------------------------------------------LFLIET-
A5FTJ9_ACICJ/1-224-------------------------------------------------------------------------LCTVES-
A1SV70_PSYIN/1-178-------------------------------------------------------------------------AKVLAS-
Q2RXJ4_RHORT/4-241-------------------------------------------------------------------------PARLAA-
B3ENH7_CHLPB/1-201-------------------------------------------------------------------------HGRLES-
Q2JWC6_SYNJA/1-204-------------------------------------------------------------------------PEVKIF-
CSE3_THET8/1-211-------------------------------------------------------------------------AQVFPP-
A3LCN7_PSEAI/1-202-------------------------------------------------------------------------EPQSKS-
Q57KI5_SALCH/1-212-------------------------------------------------------------------------IFDVQT-
Q0W583_UNCMA/1-248-------------------------------------------------------------------------PACKAI-
A0LM55_SYNFM/1-201-------------------------------------------------------------------------VIDMRT-
Q60AD3_METCA/5-237-------------------------------------------------------------------------ADGIAF-
Q1JX12_DESAC/1-200-------------------------------------------------------------------------ASLLAT-
A1ARH5_PELPD/1-222-------------------------------------------------------------------------AIDLKE-
Q6LWA0_PHOPR/2-180-------------------------------------------------------------------------ATVLQS-
C1DSI0_AZOVD/1-204-------------------------------------------------------------------------PAECKA-
Q1EQJ3_STRKN/1-237-------------------------------------------------------------------------WQTYHY-
Q2JH26_FRASC/2-267-------------------------------------------------------------------------VLVRDY-
Q03C59_LACC3/1-212-------------------------------------------------------------------------AQTKDY-
Q3ZZ80_DEHSC/1-206-------------------------------------------------------------------------VTECKC-
A7MFK9_CROS8/1-212-------------------------------------------------------------------------LFEIQT-
Q5YRB7_NOCFA/1-222-------------------------------------------------------------------------WTTRKY-
Q7N8H4_PHOLL/1-223-------------------------------------------------------------------------LFEVET-
Q0BRF7_GRABC/2-239-------------------------------------------------------------------------LERLRS-
A6W167_MARMS/1-223-------------------------------------------------------------------------TFNVKT-
A8M405_SALAI/1-222-------------------------------------------------------------------------WATRPY-
A3EQA3_9BACT/1-214-------------------------------------------------------------------------PIDLNE-
Q1ZM76_PHOAS/1-219-------------------------------------------------------------------------QWQIQT-
Q314I5_DESDG/1-218-------------------------------------------------------------------------WWSIQI-
A0AE92_STRAM/1-253-------------------------------------------------------------------------WQTRPY-
A8LYZ8_SALAI/3-204-------------------------------------------------------------------------VDTRDV-
Q825C0_STRAW/3-217-------------------------------------------------------------------------AITRPL-
Q47PJ5_THEFY/2-225-------------------------------------------------------------------------VQMRNL-
F2GBG6_ALTMD/1-221-------------------------------------------------------------------------IFSCVT-
Q74DC7_GEOSL/1-201-------------------------------------------------------------------------VLLMGS-
Q0RTG6_FRAAA/28-266-------------------------------------------------------------------------ALVRDY-
A7BA62_9ACTO/1-248-------------------------------------------------------------------------VVIRDM-
Q1R113_CHRSD/1-229-------------------------------------------------------------------------GLDVQC-
Q6NEQ5_CORDI/5-227-------------------------------------------------------------------------SEVQHR-
Q2FNT6_METHJ/1-225-------------------------------------------------------------------------VWNILS-
A5F3T0_VIBC3/4-208-------------------------------------------------------------------------HGEVVS-

PF09559

Q1CW34_MYXXD/4-194-------------------------------------------------------------------------EVVPLL-
Q1CW45_MYXXD/31-221-------------------------------------------------------------------------EAVATL-
Q3M7D9_ANAVT/30-227-------------------------------------------------------------------------NQVRLV-
Q8F1E7_LEPIN/7-205-------------------------------------------------------------------------EQIPLV-
A0YQL0_LYNSP/20-218-------------------------------------------------------------------------SQVPLI-
Q0A841_ALHEH/18-219-------------------------------------------------------------------------DRARAA-
A1WYF2_HALHL/43-244-------------------------------------------------------------------------AHADAV-
A1AWQ7_RUTMC/19-218-------------------------------------------------------------------------DKLYET-
Q4JN26_9BACT/18-217-------------------------------------------------------------------------NQIDNI-
Q3SG16_THIDA/19-212-------------------------------------------------------------------------TRVDDM-

PF09700

Q746D9_THET2/1-351-------------------------------------------------------------------------.LKEKP-
A0B6W4_METTP/4-358-------------------------------------------------------------------------.KIDGM-
O28413_ARCFU/3-341-------------------------------------------------------------------------.EGIKF-
A6LNK2_THEM4/6-323-------------------------------------------------------------------------NMRDLK-
A6VYS5_MARMS/4-381-------------------------------------------------------------------------.IEGKP-
Q47PK4_THEFY/13-381-------------------------------------------------------------------------QVTAKA-
A4BL65_9GAMM/5-384-------------------------------------------------------------------------RIDAPA-
Q9KFY7_BACHD/8-408-------------------------------------------------------------------------QMGKVS-
A6UNE8_METVS/6-362-------------------------------------------------------------------------...EYL-
O66707_AQUAE/4-323-------------------------------------------------------------------------GDLEAY-
Q97WW9_SULSO/5-306-------------------------------------------------------------------------YEQREK-
Q1CW30_MYXXD/6-386-------------------------------------------------------------------------RRNSSG-
Q9X2B3_THEMA/6-327-------------------------------------------------------------------------.KMDSK-
A7C3N9_9GAMM/9-401-------------------------------------------------------------------------.IENAK-
Q2JN53_SYNJB/4-377-------------------------------------------------------------------------SQSSKK-
A3IZR5_9CHRO/4-391-------------------------------------------------------------------------.NETEE-
Q8U1S7_PYRFU/4-321-------------------------------------------------------------------------.....G-
A9AWU6_HERA2/68-470-------------------------------------------------------------------------.PRKPA-
A1WUQ1_HALHL/5-362-------------------------------------------------------------------------RRSDRG-
C0A715_9BACT/6-379-------------------------------------------------------------------------.LDGLK-
A5D0Z3_PELTS/4-387-------------------------------------------------------------------------.PRKPF-
A1ZP54_9BACT/3-366-------------------------------------------------------------------------PQEAQV-
Q8TVU0_METKA/10-439-------------------------------------------------------------------------RPGSDV-
Q2JRT1_SYNJA/4-372-------------------------------------------------------------------------.RPSSK-
Q6ZEA9_SYNY3/4-365-------------------------------------------------------------------------DIKRDE-
Q1IZS1_DEIGD/6-393-------------------------------------------------------------------------.PGDAF-
A7GFA9_CLOBL/4-366-------------------------------------------------------------------------PDGNEL-
A8DJU1_9BACT/6-369-------------------------------------------------------------------------KEAVVT-
Q7MTH3_PORGI/6-391-------------------------------------------------------------------------.QAGCP-
A9AVY8_HERA2/6-387-------------------------------------------------------------------------TKGKAP-
Q8R6Z6_THETN/4-372-------------------------------------------------------------------------.GKEDI-
E6XI87_SHEP2/4-375-------------------------------------------------------------------------.HGGKP-
Q1AZD9_RUBXD/4-359-------------------------------------------------------------------------EAKGFK-

PF09704

Q2MF31_STRSD/16-248-------------------------------------------------------------------------....GP-
Q7NYP8_CHRVO/13-224-------------------------------------------------------------------------....AG-
A1ARH6_PELPD/3-217-------------------------------------------------------------------------......-
Q12YA8_METBU/4-236-------------------------------------------------------------------------..TGRN-
Q0BSC7_GRABC/6-215-------------------------------------------------------------------------....SA-
A8ABL4_IGNH4/3-275-------------------------------------------------------------------------.....P-
A6W168_MARMS/4-241-------------------------------------------------------------------------....NN-
O66696_AQUAE/3-211-------------------------------------------------------------------------......-
A8ZZ17_DESOH/3-251-------------------------------------------------------------------------....VG-
Q1EQJ4_STRKN/3-213-------------------------------------------------------------------------......-
A5UR14_ROSS1/3-244-------------------------------------------------------------------------IGGVLS-
Q8Z465_SALTI/4-233-------------------------------------------------------------------------....NK-
Q3A5Z4_PELCD/3-236-------------------------------------------------------------------------....AG-
C1DSH9_AZOVD/3-205-------------------------------------------------------------------------......-
Q5YRB6_NOCFA/3-211-------------------------------------------------------------------------......-
Q1CWU1_MYXXD/10-210-------------------------------------------------------------------------......-
A3DLC5_STAMF/3-270-------------------------------------------------------------------------GKKNVV-
A4J385_DESRM/4-212-------------------------------------------------------------------------....KG-
Q65TW5_MANSM/4-216-------------------------------------------------------------------------....RK-
Q8KDC0_CHLTE/7-228-------------------------------------------------------------------------......-
Q5H4J6_XANOR/4-215-------------------------------------------------------------------------....AG-
Q9X2C0_THEMA/3-212-------------------------------------------------------------------------......-
Q03C60_LACC3/3-210-------------------------------------------------------------------------......-
Q8U334_PYRFU/3-239-------------------------------------------------------------------------......-
Q47PI7_THEFY/3-209-------------------------------------------------------------------------......-
O28407_ARCFU/3-252-------------------------------------------------------------------------...TSG-
Q2SID2_HAHCH/4-215-------------------------------------------------------------------------....AG-
CAS5_METJA/5-228-------------------------------------------------------------------------......-
Q72NC2_LEPIC/11-225-------------------------------------------------------------------------....EA-
O27159_METTH/3-241-------------------------------------------------------------------------......-
B3E5U9_GEOLS/3-263-------------------------------------------------------------------------....VG-
Q04QB7_LEPBJ/4-240-------------------------------------------------------------------------....NV-
Q60AD2_METCA/3-241-------------------------------------------------------------------------.EPGWT-
Q2RL62_MOOTA/18-224-------------------------------------------------------------------------......-
A5GBK2_GEOUR/12-223-------------------------------------------------------------------------......-
Q72WF9_DESVH/10-218-------------------------------------------------------------------------.....R-
Q0W584_UNCMA/6-214-------------------------------------------------------------------------......-
Q1NKD4_9DELT/4-199-------------------------------------------------------------------------......-
A4YFV1_METS5/10-233-------------------------------------------------------------------------......-
A8LYZ7_SALAI/3-226-------------------------------------------------------------------------......-
CASD_ECOLI/4-214-------------------------------------------------------------------------......-
Q0AZP3_SYNWW/4-212-------------------------------------------------------------------------....NG-
Q1R114_CHRSD/4-250-------------------------------------------------------------------------....QS-
CAS5C_SULSO/5-232-------------------------------------------------------------------------......-
Q2RW65_RHORT/4-212-------------------------------------------------------------------------....KG-
Q5P3Y6_AROAE/8-203-------------------------------------------------------------------------......-
Q314I4_DESDG/4-228-------------------------------------------------------------------------....RG-
A1SV73_PSYIN/3-198-------------------------------------------------------------------------......-
Q1EQS9_STRKN/13-242-------------------------------------------------------------------------......-
Q3YYA5_SHISS/4-233-------------------------------------------------------------------------....VR-
A6TNS2_ALKMQ/6-209-------------------------------------------------------------------------......-
B4SAU9_PELPB/4-206-------------------------------------------------------------------------......-
Q1H3R5_METFK/4-216-------------------------------------------------------------------------....RG-
Q67RP0_SYMTH/3-220-------------------------------------------------------------------------......-
Q2JWC5_SYNJA/3-192-------------------------------------------------------------------------......-
B1YHA3_EXIS2/4-198-------------------------------------------------------------------------......-
Q4JWK0_CORJK/4-209-------------------------------------------------------------------------......-
Q7N8H5_PHOLL/4-236-------------------------------------------------------------------------....NN-
Q60B28_METCA/3-213-------------------------------------------------------------------------....QA-
Q2LX12_SYNAS/8-216-------------------------------------------------------------------------......-
B8I205_CLOCE/4-212-------------------------------------------------------------------------....DG-
Q2RXJ5_RHORT/6-238-------------------------------------------------------------------------..RGWT-
C1DNX2_AZOVD/4-215-------------------------------------------------------------------------....AG-
Q0AA33_ALHEH/3-231-------------------------------------------------------------------------.NPGWT-
Q3ZZ79_DEHSC/6-199-------------------------------------------------------------------------......-
Q47PJ4_THEFY/3-220-------------------------------------------------------------------------......-
Q6NEQ9_CORDI/4-220-------------------------------------------------------------------------KRLLIA-
Q1JX11_DESAC/4-219-------------------------------------------------------------------------......-
Q746C2_THET2/3-211-------------------------------------------------------------------------......-
Q0RTG7_FRAAA/8-241-------------------------------------------------------------------------....RP-
Q39WR9_GEOMG/10-218-------------------------------------------------------------------------......-
Q977B3_SULTO/4-249-------------------------------------------------------------------------.....S-
Q0BRF8_GRABC/3-224-------------------------------------------------------------------------..RGWT-
CAS5B_SULSO/4-251-------------------------------------------------------------------------.....P-
Q8ZZL1_PYRAE/3-217-------------------------------------------------------------------------......-
Q3ARV4_CHLCH/4-200-------------------------------------------------------------------------......-
Q1J367_DEIGD/3-208-------------------------------------------------------------------------......-
Q9KFY3_BACHD/4-199-------------------------------------------------------------------------......-
A5V1B9_ROSS1/6-202-------------------------------------------------------------------------......-
Q04AW9_LACDB/3-211-------------------------------------------------------------------------......-
O57910_PYRHO/4-218-------------------------------------------------------------------------......-
Q184H2_CLOD6/3-221-------------------------------------------------------------------------......-
A2BKI9_HYPBU/5-261-------------------------------------------------------------------------......-
A1A2N3_BIFAA/7-207-------------------------------------------------------------------------......-
Q9YCM4_AERPE/7-241-------------------------------------------------------------------------......-
Q6LWA3_PHOPR/12-207-------------------------------------------------------------------------......-
A0AE91_STRAM/6-214-------------------------------------------------------------------------......-
Q74DC8_GEOSL/4-217-------------------------------------------------------------------------......-
Q8KB22_CHLTE/5-230-------------------------------------------------------------------------..DKWE-
Q1JAP7_STRPB/6-202-------------------------------------------------------------------------......-
Q2J7P3_FRASC/14-209-------------------------------------------------------------------------......-
Q5JGB2_PYRKO/7-237-------------------------------------------------------------------------......-
B3ENH9_CHLPB/5-225-------------------------------------------------------------------------..NPWE-
Q96X68_SULTO/5-233-------------------------------------------------------------------------......-
Q53WH0_THET8/3-225-------------------------------------------------------------------------AVSTPK-
A5D0R8_PELTS/6-219-------------------------------------------------------------------------......-
Q2RY19_RHORT/6-247-------------------------------------------------------------------------....RK-
A0LDG2_MAGSM/7-202-------------------------------------------------------------------------......-
Q3SR91_NITWN/4-221-------------------------------------------------------------------------....RG-
Q1ZM77_PHOAS/4-242-------------------------------------------------------------------------....HN-
Q9UZX1_PYRAB/18-248-------------------------------------------------------------------------......-
A4SFQ4_PROVI/7-227-------------------------------------------------------------------------......-

PF01881

A3I0J5_9BACT/85-250-----------------------------------------------TRMEKSG..WYTPEQME----------------
B4SEV7_PELPB/102-262-----------------------------------------------RKYQVL.....HGRSFV----------------
A9BGZ0_PETMO/94-248-----------------------------------------------KKYLAY.....YDSYLS----------------
B4S5I3_PROA2/102-261-----------------------------------------------GKYEAM.....HGKPYE----------------
A9BIX0_PETMO/95-244-----------------------------------------------RKASAL......GIVIK----------------
B8FSG8_DESHD/95-244-----------------------------------------------KKYRAL.....YGSEGP----------------
A5D0Y7_PELTS/95-244-----------------------------------------------KKYEAF.....YRSRPP----------------
O30164_ARCFU/94-241-----------------------------------------------KKYVLY.....YKSAPE----------------
CAS6_PYRHO/96-239-----------------------------------------------DKYVMI.....KGEKPP----------------
A7HMV7_FERNB/94-242-----------------------------------------------RKYQTI...........----------------
Q5JGA0_PYRKO/94-241-----------------------------------------------EKYVLI.....YGSKPP----------------
A1BI29_CHLPD/102-262-----------------------------------------------RKFEAL.....HGRRFD----------------
A5ILP0_THEP1/93-246-----------------------------------------------KKYRAF.....YGKEPE----------------
A4XIJ2_CALS8/97-249-----------------------------------------------KKCKLL.....IKDF..----------------
CAS6L_PYRFU/91-238-----------------------------------------------LRYHEV.....MGDLPE----------------
CAS6_PYRFU/95-238-----------------------------------------------DKYVMA.....YGDKPP----------------
O66704_AQUAE/85-236-----------------------------------------------RRYIAI.....MGSEPQ----------------
Q97CI9_THEVO/80-232-----------------------------------------------KKFNLY.....YHENIN----------------
Q6L312_PICTO/82-235-----------------------------------------------KKFNIF.....YNDEIS----------------
Y1234_METJA/81-240-----------------------------------------------KKYKAF.....YNEEPV----------------
Q6L114_PICTO/79-219-----------------------------------------------KKYSFT...........----------------
A5TU40_FUSNP/91-242-----------------------------------------------ERFKRL....GYPEDIF----------------
Q3AA81_CARHZ/95-248-----------------------------------------------RKFATY.....YGRLPV----------------
Q1AZD0_RUBXD/93-249-----------------------------------------------RKVAAL....GWAADAE----------------
Q6L357_PICTO/89-232-----------------------------------------------NAYYKN.....TGRKPE----------------
Y375_METJA/95-240-----------------------------------------------KKYEAF.....YNEKCD----------------
Q4EVR3_LISMN/89-240-----------------------------------------------PYLMDA.....FGEQAR----------------
Q2NFS1_METST/92-244-----------------------------------------------RKYILF.....NNIENT----------------
O27163_METTH/1-154-----------------------------------------------RKYREF.....YGDYDG----------------
A7GQ92_BACCN/87-233-----------------------------------------------TVLKEF.....RGYGLK----------------
O57900_PYRHO/78-237-----------------------------------------------KKFNSF.....YGDEFH----------------
A4J1X6_DESRM/95-249-----------------------------------------------KKASAF.....YGEDWS----------------
Q46FQ7_METBF/89-241-----------------------------------------------ARYEEF.....YGSKID----------------
A5UJJ7_METS3/89-241-----------------------------------------------KKYIKF.....NNLTKT----------------
Q5JHS4_PYRKO/92-239-----------------------------------------------MRYSSI.....YGRMPE----------------
Q332K8_CBCP/101-247-----------------------------------------------RKYEII.....YKKPYN----------------
O66560_AQUAE/87-244-----------------------------------------------CIFNGL...........----------------
A1ZVQ2_9BACT/100-263-----------------------------------------------SKHQTY.....LSQQLP----------------
CAS6L_PYRHO/91-238-----------------------------------------------LRYSEV.....MGETPK----------------
Q184H4_CLOD6/91-242-----------------------------------------------EVVKNY.....RGNGLK----------------
A4XM43_CALS8/98-260-----------------------------------------------FEIRNIRILRGQNRGLY----------------
A1ZPF3_9BACT/98-260-----------------------------------------------GKYVKV.....LQETNQ----------------
A8F3P6_THELT/92-245-----------------------------------------------KKYSAF.....FGKEIS----------------
Q8TJV5_METAC/89-241-----------------------------------------------ARYEEF.....YGSKIE----------------
Q12WX9_METBU/89-240-----------------------------------------------ARYEEY.....YGHKVE----------------
A6DAF5_9PROT/81-224-----------------------------------------------KKYNFI.....TGENVT----------------

PF10040

A1RZS7_THEPD/144-263-----------------------------------------------ATAHRL-----TG....................
A4J507_DESRM/140-259-----------------------------------------------NRWNTF-----CP.NHL................
Q3M5G3_ANAVT/172-285-----------------------------------------------SRWNKY-----SG.IEF................
A0ZJZ0_NODSP/168-289-----------------------------------------------RRWNDF-----SQ.IPI................
CAS6A_SULSO/138-277-----------------------------------------------NVYCNL-----IG.KK..............EVE
Q2JNR9_SYNJB/173-292-----------------------------------------------RRWNDF-----SG.LPI................
A8ABE5_IGNH4/136-254-----------------------------------------------SLFKDK-----YL....................
Q7TXS3_MYCBO/184-300-----------------------------------------------QKYGAI-----VDGEEP................
Q6ZED0_SYNY3/149-272-----------------------------------------------RRWNDF-----SG.LAF................
A0ZJ83_NODSP/132-250-----------------------------------------------ERWNNF-----AP.IYL................
A1HND4_9FIRM/191-314-----------------------------------------------RRISTL-----YYFFHG............YRQE
Q03KT3_STRTD/120-237-----------------------------------------------QKYGRL-----VENQPE................
B8G917_CHLAD/148-265-----------------------------------------------EQWNAS-----AE.LAL................
Q977A9_SULTO/131-247-----------------------------------------------RHWNAN-----MK.TKI................
Q72GC1_THET2/120-235-----------------------------------------------RRLEAF-----GP.LKA................
A3MST1_PYRCJ/120-246-----------------------------------------------HAARAL-----GPSSQE........VLGFSATE
Q2FR84_METHJ/135-257-----------------------------------------------RAYNRV-----CKFYAR...............D
A3CNA0_STRSV/121-238-----------------------------------------------QKYSRL-----VEGKAE................
A7NKQ1_ROSCS/148-265-----------------------------------------------ERWNAF-----AP.IAL................
A1HM59_9FIRM/128-245-----------------------------------------------NRWNAC-----ASGFVL................
Q9YCN0_AERPE/126-238-----------------------------------------------SALARH-----TG.LSL................
Q745V3_THET2/136-262-----------------------------------------------DKWQAH-----SP.FPY...............N
B3EIY9_CHLPB/190-323-----------------------------------------------HRAFVL-----NQ.LYG..........EGVAED
Q8ZZK8_PYRAE/121-246-----------------------------------------------KHGREL-----GL.LRL................
A0YW92_LYNSP/157-270-----------------------------------------------NRWNKY-----SG.IEF................
A3DLD1_STAMF/165-291-----------------------------------------------DLLRLT-----RDKEYI................
Q74DY6_GEOSL/182-301-----------------------------------------------RRVSAL-----AS.AYC............DREI
A1RZX7_THEPD/116-252-----------------------------------------------RGVRLA-----KA....................
B4S549_PROA2/190-323-----------------------------------------------HRAFVL-----GQ.LYG..........EGVDEA
Q4J7R1_SULAC/134-279-----------------------------------------------NLWNSI-----AD.ERE........RIVKGDLE
Q1Q3G5_9BACT/191-313-----------------------------------------------RRISSL-----SY.FHC............EERL
A8M9A8_CALMQ/139-276-----------------------------------------------RRLSDV-----LT.NNEIVIRRGNVEYVGVIGS
A1RQV9_PYRIL/103-214-----------------------------------------------KTYYQL-----YG.VSL................
Q5HK95_STAEQ/125-242-----------------------------------------------IQFDAF-----FEEYRM................
A6NTQ0_9FIRM/121-240-----------------------------------------------RRWNVC-----IP.QCP..............IE
A8AA66_IGNH4/119-232-----------------------------------------------KRMSEV-----TG.TDL................
Q01QC2_SOLUE/166-288-----------------------------------------------DRISTL-----RS.LYG............AGPL
Q4J7D4_SULAC/139-264-----------------------------------------------KHWNQN-----MD.QKI................
Q8ZZU6_PYRAE/127-238-----------------------------------------------KAYKEL-----FG.VDI................
A2BMX9_HYPBU/151-264-----------------------------------------------RRISMA-----SG....................
Q6ZEI4_SYNY3/146-257-----------------------------------------------RRWNHF-----AP.EEL................
A6DE70_9PROT/157-271-----------------------------------------------HRYLKL-----KD....................
A9AZH6_HERA2/148-265-----------------------------------------------DKWNAV-----AP.LTF................
A0LHY9_SYNFM/189-312-----------------------------------------------RRLNNL-----VA.FHC............EGNE
Q4J7P9_SULAC/157-283-----------------------------------------------EIFRET-----YK....................
Q0AW55_SYNWW/127-244-----------------------------------------------NRYCAF-----MQDVSL................
Q3IQ75_NATPD/155-285-----------------------------------------------GKWNRS-----VP.EEL.............ELD
A0B9F8_METTP/179-310-----------------------------------------------AKWNSS-----CP.DGF.............KMD
Q39T05_GEOMG/185-303-----------------------------------------------RRISSL-----AS.YYC............DDEI
A4YFW1_METS5/128-262-----------------------------------------------KTHQGL-----TR.RFD...............D
B9LJK3_CHLSY/148-265-----------------------------------------------EQWNAS-----SE.LAL................
A4YFU6_METS5/153-294-----------------------------------------------RQYLAL-----LG.KTD...........SYEND
Y1859_ARCFU/176-286-----------------------------------------------LFVNEY-----GSGEVP................
A0YIK9_LYNSP/157-279-----------------------------------------------RRWNDF-----SN.LPV................
A1BI47_CHLPD/189-322-----------------------------------------------HRAFVL-----TQ.LYG..........DLPEPA
Q8TVD3_METKA/146-270-----------------------------------------------RKFTML-----HRRFGL.............EGL
A0YUQ2_LYNSP/96-214-----------------------------------------------LSWNEF-----AP.VYL................
A3MVN5_PYRCJ/123-252-----------------------------------