Sequence alignment for CL0363

PF01079

Q7PXI1_ANOGA/295-503SDS.......SQS.SHTSGCFTGDSTVL--TEA-G-------------VH--RKLSEL-----R----------------
HH_DROPS/255-475SDS.......SIS.SHVHGCFTPESTAL--LES-G-------------IT--KPLSEI-----S----------------
IHH_DANRE/187-398SEH.......SVA.AKTGGCFPGRALVT--MKD-G-------------SH--RQIRDL-----Q----------------
TWHH_DANRE/190-403AEN.......SVA.AKSGGCFPGSGTVT--LGD-G-------------TR--KPIKDL-----K----------------
WRT4_CAEEL/327-547APAGYAPMGFAPSGLQLYYCFPGDAMVN--VYN-G-------------GF--KRMDEL-----A----------------
Q80XI9_MOUSE/230-435SEH.......SAA.AKTGGCFPAGAQVR--LEN-G-------------ER--VALSAV-----K----------------
WRT6_CAEEL/375-583SARGYSPNLNGLFGGTGMQCFSGDMEVE--TED-G-------------.I--KMIKDL-----K----------------
A8X447_CAEBR/327-545QPAGYFPYFSAPAGLELYYCFPADATVH--VYD-Q-------------GT--KRMDEL-----E----------------
IHH_CHICK/188-394SEH.......SAA.AKTGGCFPGRALAT--LEN-G-------------AR--TPLWAL-----R----------------
SHH_CHICK/190-411AEN.......SVA.AKSGGCFPGSATVH--LEH-G-------------GT--KLVKDL-----S----------------
SHH_DANRE/187-404AEN.......SVA.AKSGGCFPGSALVS--LQD-G-------------GQ--KAVKDL-----N----------------
WRT8_CAEEL/325-538QPVGY..APYAPAGWQLHYCFPADAEVN--VYE-K-------------GV--KRMDEL-----E----------------
DHH_HUMAN/188-396ADN.......SLA.VRAGGCFPGNATVR--LWS-G-------------ER--KGLREL-----H----------------
Q175B3_AEDAE/201-412SDS.......SQS.NHASGCFTGDSTVQ--TST-G-------------ET--RKLSEL-----Q----------------
O45992_CAEEL/258-471APYSY...LPAAPQCQQYYCFPNDAVVN--VYE-K-------------AV--KRMDEL-----E----------------
B0S8K0_DANRE/187-399SEH.......SVA.AKTGGCFPASALVT--VED-G-------------SL--KTLDSL-----Q----------------
B3DJ46_DANRE/191-442ADH.......SVA.VEKGGCFSASGLVT--MAD-G-------------VQ--KPMSCL-----W----------------
HH_DROMO/248-470SDS.......SPSISHVHGCFTPESTAL--LES-G-------------AE--KALSEL-----A----------------
C3ZGW9_BRAFL/224-434AES.......DTT.ATQGGCFPAESWVT--RDD-G-------------NR--IRMRDV-----R----------------
D6WCL7_TRICA/146-345SES.......SQA.AKYGGCFSGESTVL--TST-G-------------LR--RNLSSL-----Q----------------
F6WZB6_XENTR/191-398SEH.......SAA.AKTGGCFPGGALAT--LES-G-------------EK--IPVSQL-----R----------------
F6XBS5_CIOIN/294-549SEE.......SDA.AKYGGCFPGESTVI--VPG-E-------------GH--VPISSL-----Q----------------
F6YTG6_XENTR/190-394ADN.......SLG.VRSGGCFPGTAMVM--MAS-G-------------EK--KSLSEL-----Q----------------
G3V6T0_RAT/188-423AEN.......SVA.AKSGGCFPGSATVH--LEQ-G-------------GT--KLVKDL-----S----------------
H2U1Q8_TAKRU/190-435ADH.......SVA.VEKGGCFPGWSRVT--VAG-G-------------FQ--KSLSSL-----T----------------
H2V9H2_TAKRU/190-402AEN.......SVA.AKSGGCFPGSSTVT--LQD-G-------------TK--KLVKHL-----R----------------
H2XUY9_CIOIN/97-305ADN.......SDA.AKYGGCFDGVSEVR--NES-G-------------SV--IPMNKV-----N----------------
W4Y925_STRPU/189-401SES.......AAA.KNSGGCFPGFSQAS--LEN-G-------------RT--ISMLDI-----R----------------
W5K3H2_ASTMX/187-406AEN.......SVA.AKSGGCFPGSSHVR--LKD-G-------------RQ--KALKDL-----K----------------

PF14890

M1MZU7_9CORY/77-375-----------------------DTKVP--LLD.G-------------HQ..KTLREM-----TEE..............
E3GYR2_METFV/39-446-----------------------DSLIS--LAT.G-------------EN..VKASEL-----FKKFENKGRIIKE..EK
NDRZ_PYRFU/306-755-----------------------KAKII--FENEG-------------EEHLTTMEEM-----YERYKHLGEFYDE..EY
D0MK11_RHOM4/430-853-----------------------DTLIT--LAD.G-------------RR..VPIREL-----VSQ..............
Q5JJ43_THEKO/306-755-----------------------NAKII--FENDG-------------EEHIMTMAEM-----YERYKDLGEFYDP..EY
RGYR_METJA/871-1360-----------------------DTYVV--LGD.G-------------RI..ETIEDI-----VNA..............
K9VL64_9CYAN/809-1233-----------------------DSLVM--LADTG-------------VR..VPIREL-----VGK..............
DNAB_SYNY3/385-809-----------------------DSLIS--LASTG-------------KR..VSIKDL-----LDE..............
B8HS23_CYAP4/785-1209-----------------------DSLIT--LADTG-------------KQ..VPLRQL-----IGQ..............
K9QGP4_9NOSO/889-1313-----------------------DTLIT--LADSG-------------LQ..VPIKEL-----VGK..............
B2IVH9_NOSP7/393-817-----------------------DSLVT--LVDSG-------------LQ..VPIKEL-----VGK..............
H3ZL75_THELN/500-1032-----------------------EWLPI--IEN.G-------------EIKFVKIGEF-----INSYMEKQKENV...KT
D2RI62_ARCPA/834-1317-----------------------DTYII--MHD.G-------------CI..KRIDEI-----FEG..............
Y832_METJA/1064-1591-----------------------EKILI--FEN.N-------------EYKLVKIGEF-----VEKYLNRYKDRAITYGD
DPOL_THEKO/857-1388-----------------------EWLPV--LEE.G-------------EVHFVRIGEL-----IDRMMEENAGKV...KR

PF14623

F2SQT7_TRIRC/282-454------------------PCFTGDCHIR..ISS-KESE.......VINAT--ISLENL.....R----------------
E9EQB7_METRA/537-702------------------VCFAGSTPVE..LGS-G.............RM--VHIRRL.....R----------------
Q237Q6_TETTS/509-673------------------PCFEGNSEVK..MAN-G.............TI--KKVKEI.....K----------------
Q7S708_NEUCR/636-832------------------PCFAGETNVRVGVAV-AEDVAAD.SDQLVTKE--IEISKL.....R----------------
H6C7V0_EXODN/356-526------------------PCFGGMSRII..LAN-G.............SA--IPIVTL.....Q----------------
J3PIM9_GAGT3/593-786------------------PCFAGATRVR..LAE-T............ATT--VAIRDL.....A----------------
G2XFI4_VERDV/568-734------------------PCFAGSTPVL..LAS-G.............RS--VPIRQL.....R----------------
G1XIH1_ARTOA/537-708------------------VCFTGDSPVT..LVD-G.............TK--VRIDTL.....R----------------
U7PS73_SPOS1/521-692------------------PCFASFCRVT..LVD-G.............RY--IRVNKL.....R----------------
C7YL43_NECH7/586-752------------------VCFAASTDVT..LAS-G.............RI--VQIRKL.....R----------------
R8BIW3_TOGMI/471-637------------------PCFAGCSTVT..LAN-G.............KD--IAVSTM.....R----------------
C5GK44_AJEDR/553-713------------------PCFAGHCNIR..LSE-G............NDS--VPIENL.....R----------------
S8AB86_DACHA/542-713------------------VCFTGDCLVN..LPD-G.............TH--MRIDGL.....R----------------
S3CBE6_OPHP1/613-780------------------PCFASFCRVN..MAN-G.............KV--IRVNRL.....R----------------
G3JM09_CORMM/336-505------------------ACFAHGTPVT..LES-R.............ST--VEIQDL.....R----------------
C5FLY1_ARTOC/540-711------------------PCFTGNCRVL..VSG-NDA........SSDAT--IAIENL.....R----------------
F0UB99_AJEC8/548-714------------------PCFAGHCNIR..LAE-R............NSS--LPIRDI.....R----------------
G0QP70_ICHMG/545-705------------------GCFEGNCLVY..MFD-N.............SF--VKVKDV.....R----------------
I7M030_TETTS/514-676------------------GCMHGDSLVQ..LSD-S.............SF--KMVKEV.....K----------------
M7TBR0_EUTLA/533-699------------------GCFAAWSRVL..LGD-G.............RE--MPVCRL.....R----------------
C1G4L4_PARBD/546-712------------------PCFAGHCRIR..LPE-A............NSS--LPIRDL.....R----------------
N4VVV8_COLOR/552-719------------------VCFVASTPVA..LAS-G.............RS--VPIRAL.....R----------------
Q24C76_TETTS/502-665------------------GCIHGDSLVY..LQN-G.............KT--KKVSEI.....R----------------
D2VHB8_NAEGR/586-749------------------SCFDGNSLIT..MYD-N.............SV--KKVSEI.....K----------------
G9MP19_HYPVG/551-718------------------VCFAGSTAVE..LAS-G.............KV--TEIRKL.....K----------------
T0JQ14_COLGC/569-736------------------VCFIASTPVV..LAS-G.............RK--VPIKTL.....R----------------
J4WBA6_BEAB2/688-856------------------.CFAHGTPLT..LEA-G.............VT--AEVQDL.....R----------------
I7M701_TETTS/604-769------------------PCFDGNCLVK..MAN-G.............DI--KKVMDI.....R----------------
F7VWE7_SORMK/571-774------------------PCFAGESRVK..IAV-SEEQEEDSDQAVVSRE--IAISEL.....R----------------
L8X395_THACA/606-772------------------PCFAGWCYID..TES-G..............K--IRLSEL.....G----------------
E4UR10_ARTGP/540-711------------------PCFTGSCRVR..LAG-SGSE.......RVSPT--IPIEYL.....R----------------
Q2GTB7_CHAGB/570-754------------------GCFAGCSPVL..LAG-G............KGL--VRINRL.....R----------------
E3QU32_COLGM/508-676------------------VCFASSTPVQ..LAS-G.............RT--VPIKAL.....R----------------
G0RIM5_HYPJQ/574-741------------------VCFAGSTAVE..LAS-G.............RV--TEIRRL.....R----------------
Q22N58_TETTS/494-660------------------GCIHGKCKVL..LEN-N.............QY--KNVEEI.....R----------------
A9UVU8_MONBE/587-772------------------GCYSADSLVD..LAS-VRAPGT..TGDVAQRT--GDVRNLAGAWQR----------------
J4URQ4_BEAB2/478-645------------------VCFAGSTLVQ..LAS-G.............RA--IEMRRL.....R----------------
G4NA23_MAGO7/558-749------------------PCFAGTTMVR..LAG-D............GGV--VPISWL.....R----------------

PF13403

Q1GGP9_RUEST/27-173------------------PCFTPGTLIA--TPR-G--------------E--RLVENL-----Q----------------
Q1GES6_RUEST/157-304------------------ICFTPGTRIA--TPE-G--------------P--KPVESL-----R----------------
A1AYR4_PARDP/380-527------------------LCFLRGTLIK--TAD-G--------------E--VPVEQL-----E----------------
A8LN65_DINSH/175-322------------------PCFTPGTLIE--VPG-G--------------T--CPVEAL-----Q----------------
A1B4V8_PARDP/356-503------------------PCFARGTRIA--VAD-D--------------E--VAIETL-----R----------------
A8LKN9_DINSH/122-260------------------PCFVAGTRIL--TPE-G--------------V--VPVETL-----R----------------
Q28WJ0_JANSC/241-379------------------ICFAAGTRIA--TPR-G--------------Q--VAVEDL-----R----------------
Q5LPM0_RUEPO/507-646------------------ICFTPGTLIA--TAH-G--------------P--RAIETL-----R----------------
Q28L14_JANSC/1268-1415------------------PCFTPGCRVA--TAR-G--------------T--SKVEDL-----R----------------
Q1GGN0_RUEST/194-341------------------VCFTPNAQVT--TPE-G--------------P--RRIRDL-----A----------------
Q5LSZ7_RUEPO/803-941------------------TCFCRGTLIA--TAG-G--------------E--IPVEKL-----R----------------
Q5LPJ7_RUEPO/175-322------------------PCFVAGSLID--TVE-G--------------P--RPVETL-----A----------------
Q1GMQ5_RUEST/293-432------------------PCFVAGTLID--TEA-G--------------P--IAVEDL-----T----------------
Q5LLZ7_RUEPO/144-282------------------ACFAAGTFIE--IES-G--------------P--IPVETL-----R----------------
A8LR09_DINSH/158-296------------------PCFMAGTRIR--TPD-G--------------L--RPVEAL-----R----------------
C7JHN5_ACEP3/423-565------------------VCFLSGSMIR--TPD-G--------------D--VAVEDI-----Q----------------
Q28SX3_JANSC/168-306------------------ICFAQGTLIA--TPD-G--------------D--VAVEEL-----A----------------
A8LK48_DINSH/203-343------------------PCFARGTRID--TPE-G--------------P--VRVEEL-----C----------------
Q5LMP8_RUEPO/160-307------------------ICFAAGTRIA--TPK-G--------------A--RPVETL-----A----------------
Q28UB5_JANSC/126-273------------------VCFTAGSLIE--TPS-G--------------P--RRIENL-----Q----------------
Q1GMV1_RUEST/833-976------------------PCYTPGSRVI--TAR-G--------------E--VPVEEI-----R----------------
A5FZD4_ACICJ/193-329------------------PCFAAGTQIR--TPA-G--------------E--TPVESL-----R----------------
B9JK11_AGRRK/201-336------------------SCFLRGTLIR--TPE-G--------------D--LPVEDL-----R----------------
Q28TH9_JANSC/752-887------------------VCFTRGTAIR--TPR-G--------------E--VLIEDL-----R----------------
A5G1S8_ACICJ/159-294------------------ACFAEGTRIA--TTR-G--------------D--VPVEEL-----A----------------
B0T7Q3_CAUSK/153-288------------------PCFAEGTRLT--TAR-G--------------A--VAVEDL-----V----------------
C7JE32_ACEP3/536-676------------------VCFLPGGMIA--TPD-G--------------E--HAVETL-----R----------------
B8IA31_METNO/149-285------------------PCFVSGTHIR--TAR-G--------------E--VSVEDL-----A----------------
A5G006_ACICJ/174-309------------------VCFLEGTRIF--GLN-G--------------D--IPVETM-----N----------------
A5FW80_ACICJ/285-421------------------PCFARGTLIL--TRE-G--------------L--RPVETL-----A----------------
A8LLK3_DINSH/164-305------------------PCFRAGTRIV--TPK-G--------------A--VPVESL-----R----------------
Q5FQG8_GLUOX/285-425------------------ICYLAGTMIL--TPE-G--------------E--RAIETL-----E----------------
B0UJT1_METS4/116-254------------------PCYCTGTLLR--TVD-G--------------D--VAVENL-----R----------------
Q5LUZ7_RUEPO/68-216------------------CAFSRGSLID--TDC-G--------------P--MAIEDL-----L----------------
Q0BS96_GRABC/3687-3823------------------PCYVHGTLIL--TDR-G--------------E--VPVEDL-----Q----------------
B1M2P7_METRJ/65-199------------------PCYCTGTTIR--TDR-G--------------D--VAVERL-----V----------------
A5FVL4_ACICJ/410-545------------------PCFRHGTRLL--TPS-G--------------L--RPVETL-----S----------------
A4YQ57_BRASO/106-246------------------LCFLRGTRIM--TAT-G--------------E--RAIEEL-----A----------------
A5FWA2_ACICJ/1192-1328------------------PCFARGTRLL--TAE-G--------------Y--RPVETL-----R----------------
C3KQV1_RHISN/76-214------------------MCLLRGTSIM--TPS-G--------------E--VRIEAL-----R----------------
A8LKB8_DINSH/19-167------------------TGLACDAHVR--TPC-G--------------E--RRVEFL-----R----------------
Q5LN78_RUEPO/204-343------------------PSLHPETPIA--TPD-G--------------Y--RPLSKI-----R----------------
C5AQV5_METEA/69-209------------------PCFTTGTLIR--TAR-G--------------E--VAVEDL-----I----------------
D5AV22_RHOCB/442-581------------------PCFTAGTLIE--TPR-G--------------P--VPVESL-----R----------------
Q2YL23_BRUA2/15-148------------------.CLLKGTLVT--TPN-G--------------P--VAVEKL-----C----------------
Q3J294_RHOS4/14-159------------------ACFTPGTLIA--TVR-G--------------E--VAVEAL-----A----------------

PF05203

U7Q1H8_SPOS1/262-759-------------------CFAAGTPVM--MSD-G-------------TI--QPVETI-----D----------------
Q6FQS3_CANGA/285-698-------------------CFAKGTQVL--MAD-G-------------SN--QSIENI-----K----------------
A3LP04_PICST/283-730-------------------CFAKGTKVL--MAN-G-------------DD--KNIEDI-----A----------------
J7RJ26_KAZNA/284-757-------------------CFERGTEVL--MAD-G-------------SD--KPIEQI-----T----------------
C5M9I6_CANTT/244-713-------------------CFTKGTQVM--MAD-G-------------AD--KSIESI-----E----------------
Q6CL64_KLULA/284-692-------------------CFSKGTEVM--MGD-G-------------KD--ELIENI-----Q----------------
B6JY11_SCHJY/285-759-------------------CFAKGTEVL--MAN-G-------------AD--KKIEDV-----V----------------
Q6BRM0_DEBHA/283-675-------------------CFAKGTEVL--MAD-G-------------SN--KNIEEV-----Q----------------
A5DXZ0_LODEL/280-699-------------------CFTKGTQVM--MAD-G-------------KD--KSIEDV-----Q----------------
H2APW1_KAZAF/284-774-------------------CFAKGTKVL--MAD-G-------------SD--RAIEDI-----S----------------
G7E5L8_MIXOS/284-742-------------------CFAKDTAVL--MAD-G-------------TE--KPIQDV-----A----------------
F2TVI8_SALR5/1497-1695-------------------CFRTTTELL--LAS-G-------------DI--VRASDV-----R----------------
U9UGV8_RHIID/409-843-------------------CFAKGTKIL--MYD-G-------------TH--QNVEEL-----N----------------
C5DTL5_ZYGRC/284-732-------------------CFAKGTEVM--MSD-G-------------SI--KEVEGI-----E----------------
G8JWX2_ERECY/284-671-------------------CFGEGTEVL--MAD-G-------------SI--KAIENV-----K----------------
A7TLB5_VANPO/284-715-------------------CFAKGTEVM--MAD-S-------------SI--KNIEDI-----E----------------
VATA_YEAST/284-736-------------------CFAKGTNVL--MAD-G-------------SI--ECIENI-----E----------------
M3K3J1_CANMX/284-733-------------------CFAKGTKVL--MSD-G-------------KD--RNIEDV-----A----------------
G0V8Z3_NAUCC/284-799-------------------CFAKGTEVL--MAD-G-------------SD--KAIEAI-----E----------------
C5DTQ4_ZYGRC/1-463-------------------MLEEGTKLL--MAN-G-------------QI--KDVGKL-----D----------------
G0W3J0_NAUDC/284-783-------------------CFAKGTQVM--MAD-G-------------SD--KSIEEI-----Q----------------
G8ZLC3_TORDC/1-463-------------------MFEQGTKIM--MAN-G-------------QA--KDIQDI-----A----------------
G8BNB8_TETPH/284-799-------------------CFAKGTKVL--MAD-G-------------SD--KSIEDI-----A----------------

PF07591

A3DGR7_CLOTH/105-234-------------------------LIL--TVA-G--------------L--VAIENI-----K----------------
Q5F6G7_NEIG1/1-137-------------------------MVR--TAD-G--------------Y--KAIAHI-----Q----------------
Q9K122_NEIMB/1-137-------------------------MVK--TAD-G--------------Y--KAIARI-----R----------------

PF10596

I3L3Z8_HUMAN/86-244--------------------FKQYQVLK-------------------QNP--FWWTHQ-----R----------------
A2EY65_TRIVA/1432-1590--------------------FKKYSLFK-------------------TNP--YAWTHH-----H----------------
A8BTS5_GIAIC/1337-1490--------------------..NALTLK-------------------S..--..WYNK-----K----------------
S3BP74_OPHP1/1452-1610--------------------FKLYQIMR-------------------HNP--FGWTSA-----R----------------
Q8SVU6_ENCCU/1239-1384--------------------.......K-------------------PDW--FWFTDA-----K----------------
Q5KPW2_CRYNJ/1640-1796--------------------QQKYQLFR-------------------ST.--...ASV-----R----------------
K7VI98_MAIZE/675-841--------------------FKQYQVLK-------------------QNP--FWWTHQ-----Q----------------
G0W883_NAUDC/1515-1673--------------------FKKYSLER-------------------NSP--FWWTNA-----H----------------
E6ZWZ5_SPORE/1485-1643--------------------FKKYQIAK-------------------AQP--FAWTNQ-----R----------------
E9AFM0_LEIMA/1514-1674--------------------FQRYLAGK-------------------YLK--NWWFHM-----E----------------
R0KWQ9_NOSB1/1205-1354--------------------FKKFTSLQ-------------------YDP--LPFTSL-----R----------------

PF01079

Q7PXI1_ANOGA/295-503---------IGERVQA...VD.A-----AGRTVFSEVLMFMDRDT......HQRREFVTIEAEG----------------
HH_DROPS/255-475---------IGDRVLS...MG.S-----NGQPVYSEVILFMDRNL......EQMQNFVELHTDG----------------
IHH_DANRE/187-398---------AGDLVLASEGSD.G-----TGDLIYSEVLTFLDRRP......ITQKHFYVIRTED----------------
TWHH_DANRE/190-403---------VGDRVLA...AD.E-----KGNVLISDFIMFIDHDP......TTRRQFIVIETSE----------------
WRT4_CAEEL/327-547---------VGDWVQA...LDKN-----GSQVTFIPVQYWLHRDP......KQVADFVEFTLDN----------------
Q80XI9_MOUSE/230-435---------PGDRVLA...MG.E-----DGTPTFSDVLIFLDREP......NRLRAFQVIETQD----------------
WRT6_CAEEL/375-583---------IGDKVLS...MD..-----EAFVTYSPVIMFLHKRD......EEIAEFNLIETAN----------------
A8X447_CAEBR/327-545---------VGDWVQA...FEKN-----GETVTHVPVQYWIHRDQ......TQKATFIEFSLDN----------------
IHH_CHICK/188-394---------PGQRVLA...MD.G-----AGRPTYSDFLAFLDKEP......RALTAFHVIETRQ----------------
SHH_CHICK/190-411---------PGDRVLA...AD.A-----DGRLLYSDFLTFLDRMD......SSRKLFYVIETRQ----------------
SHH_DANRE/187-404---------PGDKVLA...AD.S-----AGNLVFSDFIMFTDRDS......TTRRVFYVIETQE----------------
WRT8_CAEEL/325-538---------VGDWVQA...LH..-----GKETTYSPVKYWLHRDP......EQEAEFVEFLLEN----------------
DHH_HUMAN/188-396---------RGDWVLA...AD.A-----SGRVVPTPVLLFLDRDL......QRRASFVAVETEW----------------
Q175B3_AEDAE/201-412---------IGEQVLS...VD.S-----SGNTVYSEVIMFMDRDT......HQSREFVHIEADG----------------
O45992_CAEEL/258-471---------IGDWVEA...LDEN-----GEDITFLPVKYWLHRDP......EQEAEFLEFSLDN----------------
B0S8K0_DANRE/187-399---------PGEKVLASSESD.G-----SGTLVYSEVIAFLDRDP......SARKQFFTIETDS----------------
B3DJ46_DANRE/191-442---------PGEKVLS...VS.G-----SGEVVFSRVLLFLHLDR......ESRTSFFIITTEN----------------
HH_DROMO/248-470---------IGDRVLS...MD.T-----KGQPVYSEVILFMDRNL......EQVQNFVQLHTDG----------------
C3ZGW9_BRAFL/224-434---------PGDKVLS...MD.S-----GGHPVFSEVLTFMDRDS......RGPWVYYTIHTDD----------------
D6WCL7_TRICA/146-345---------IGEKIQA...LDPS-----TNELVFSEVLLFLDYNP......SQRRQFLHITLAS----------------
F6WZB6_XENTR/191-398---------PGLRVLA...MD.D-----SGRPTFSDFLSFLDHHP......KEEHVFQVIKTQD----------------
F6XBS5_CIOIN/294-549---------PGDQVLA...ID.K-----SGAVITDTFLSFMDARSDIVSGHQAYRQMVEITTEN----------------
F6YTG6_XENTR/190-394---------LGDTVFT...TD.E-----TGQLIPSVVLLFLHRDL......YKTATFVLIEAEG----------------
G3V6T0_RAT/188-423---------PGDRVLA...AD.D-----QGRLLYSDFLTFLDRDE......GAKKVFYVIETRE----------------
H2U1Q8_TAKRU/190-435---------PGDRVMA...LS.E-----TGQVVFSPVLLFLHRDP......ESRWRFLSLQTED----------------
H2V9H2_TAKRU/190-402---------SGDRVLA...AD.D-----DGNPTYTDFIMFVDRDS......TTRRLYHVIETDS----------------
H2XUY9_CIOIN/97-305---------VGDRILA...VDRT-----TGKPVFSEVIMFLDKQP......EIGGSYIEIRSQL----------------
W4Y925_STRPU/189-401---------VGDEVAV...VN.D-----DGALDYSDVIMIVHRKL......NDSTLFYVIETED----------------
W5K3H2_ASTMX/187-406---------PGDSVLA...AD.E-----SGNLVYSDFIMFTDRDP......STRRVFYVIETKA----------------

PF14890

M1MZU7_9CORY/77-375........GGTHWVYS---LDSE-----R.KIVPGRAV...GLKT------REDAELMRVTVSG----------------
E3GYR2_METFV/39-446NEKVIDVDGFGIHVSS---LDKK-----ENKIVKGKVTHLWKLKK------TDPL..VELHLEN----------------
NDRZ_PYRFU/306-755NRWGIDVSNVPIYVKS---FDPE-----SKRVVKGKVNVIWKYEL------GKDVTKYEIITNK----------------
D0MK11_RHOM4/430-853.........QNFSVWA---LNPQ-----TYRLERARVSRAFC...------TGIKPVYRLTTRL----------------
Q5JJ43_THEKO/306-755NRWGINVEEVPVYVKS---FDPS-----TKEITKGKVKVIWKYEL------GEDVPKYEIKTNK----------------
RGYR_METJA/871-1360.........KERNVLS---LDLD-----NLSIKIDTAIKFWKLRY------NGNL..SKITLSN----------------
K9VL64_9CYAN/809-1233.........SGFTVWA---LNEA-----TMQLEKAVVSNAFA...------TGVKPVLRLQTRL----------------
DNAB_SYNY3/385-809.........KDFEIWA---INEQ-----TMKLESAKVSRVFC...------TGKKLVYILKTRL----------------
B8HS23_CYAP4/785-1209.........SGFAVWA---LNQS-----TLKLERAIVSHAFA...------TGTKPVFRLQTAL----------------
K9QGP4_9NOSO/889-1313.........SGFAIWA---LNES-----TMQLEKANVSHTFS...------TGIKPVFTLTTRL----------------
B2IVH9_NOSP7/393-817.........SGFAVWA---LNEA-----TMQLEKAIVSNAFS...------TGIKPLFTLTTRL----------------
H3ZL75_THELN/500-1032VENTEVLEVNNLFAFS---FNKK-----IKESEVKKVKALIRHKY------KGKA..YEIQLSS----------------
D2RI62_ARCPA/834-1317...........EKVLG---LN..-----DFHEKDAHVLKFWRIPY------KGTI..KEITLDN----------------
Y832_METJA/1064-1591NNIEVYIKDENIYAPS---FDKD-----G.KIVLKPITHAIRHRG------KEI...YEIELES----------------
DPOL_THEKO/857-1388EGETEVLEVSGLEVPS---FNRR-----TKKAELKRVKALIRHDY------SGKV..YTIRLKS----------------

PF14623

F2SQT7_TRIRC/282-454---------PGMSVWT-----PH...--.G---PREVRAVLQ-TS------VNH...IDICRI.......----------
E9EQB7_METRA/537-702---------RGMKVRT-----PT...--.G---TRKVAMVLK-TA------VQE...ETLCHV.......----------
Q237Q6_TETTS/509-673---------KGDEVFC-----PNT..--GK---AEKVKCVIE-TE------VKEN.LTQLVRL.......----------
Q7S708_NEUCR/636-832---------RGMMVQT-----PK...--.G---FRKVRAVLK-TP------VCE...ERMCLVMARD...----------
H6C7V0_EXODN/356-526---------AGMSVWT-----PN...--.G---ARKVIAVVK-TR------ISSKAGQTLCRI.......----------
J3PIM9_GAGT3/593-786---------RGMRVHT-----PL...--.G---PRAVAAVLR-TR------VWR...AAVRRV.......----------
G2XFI4_VERDV/568-734---------HGVKVLT-----PR...--.G---PRRVAVVLV-TP------VRR...EVMCRV.......----------
G1XIH1_ARTOA/537-708---------RGSIIMT-----GR...--.G---AGEVSAIVK-TR------ISG..TTDICTI.......----------
U7PS73_SPOS1/521-692---------AGMSVQT-----PR...--.G---PRTVAAVMK-TP------VSS...IPMVTI.......----------
C7YL43_NECH7/586-752---------RGMKVQT-----PR...--.G---SRRVAMVLK-TP------VEQ...ELLCRM.......----------
R8BIW3_TOGMI/471-637---------KGMRVAT-----PL...--.G---PRRVVAILK-TP------VRR...EIMCKV.......----------
C5GK44_AJEDR/553-713---------AGTKVWT-----PC...--.G---PRRVRAILA-TA------VKD...TVVCNI.......----------
S8AB86_DACHA/542-713---------RGTAVLT-----AK...--.G---PAEISAIVK-TK------VSG..ETEICTI.......----------
S3CBE6_OPHP1/613-780---------KGMQVQT-----PR...--.G---PRAVSRVLK-TP------VSS...IPMVTI.......----------
G3JM09_CORMM/336-505---------AGSVVQT-----LA...--.G---PRLVVGVLR-MQ------VEN...EVMCRL.......----------
C5FLY1_ARTOC/540-711---------AGMSVWT-----PH...--.G---PREVRAVLQ-TS------VND...IDICKI.......----------
F0UB99_AJEC8/548-714---------AGIKVWT-----PL...--.G---PRRVRAVLA-TA------VKN...TILCNI.......----------
G0QP70_ICHMG/545-705---------KGFKIKA-----QD...--GQ---IHTVIAVIK-IL------FEHG.QIPLVQL.......----------
I7M030_TETTS/514-676---------KGDKVIC-----PLL.E--NQ---CVEVECVVL-SK------CEDG.TKEFVQL.......----------
M7TBR0_EUTLA/533-699---------KGVSVQT-----PL...--.G---SRRVVAVLR-IP------MRR...AVMCRV.......----------
C1G4L4_PARBD/546-712---------PGTKVWT-----PV...--.G---PRRVRAVVA-TT------VKN...MTLCKI.......----------
N4VVV8_COLOR/552-719---------RGVAVQT-----PS...--.G---ARRVVAVLK-TP------VRR...EIMCRV.......----------
Q24C76_TETTS/502-665---------KGDVVQC-----PELGQ--LQ---STEVVCIVV-SK------CENN.SHSFVQI.......----------
D2VHB8_NAEGR/586-749---------KGDRVKN-----MNG..--DS---YATILCVLK-SK------TPSP.IVKLCEM.......----------
G9MP19_HYPVG/551-718---------SGIRVRT-----PL...--.G---PRKVAMVLK-TK------VSS...EVLCRI.......----------
T0JQ14_COLGC/569-736---------RGVTVQT-----PS...--.G---PRRVVAVLK-TP------VHR...EIMCRV.......----------
J4WBA6_BEAB2/688-856---------YGDMVQT-----LA...--.G---RRLVVGVLR-TF------VEN...EVLCRL.......----------
I7M701_TETTS/604-769---------KGDLIAS-----PAI.N--GV---EAKVSCVVK-TP------CLNN.QAYFVEF.......----------
F7VWE7_SORMK/571-774---------KGMMVQT-----PK...--.G---FRKVRAVLK-TP------VEN...ERMCLVRVAEAEG----------
L8X395_THACA/606-772---------RGTIVRT-----PS...--.G---TARVAAVLR-TL------CSGQ.MTELCTI.......----------
E4UR10_ARTGP/540-711---------PPVSVWT-----PQ...--.G---PRKVRAVLQ-SI------VKD...VEICEI.......----------
Q2GTB7_CHAGB/570-754---------AGMEVVT-----PC...--.G---PRKVAAVLR-MP------VRR...VEMCLVAAAAG..----------
E3QU32_COLGM/508-676---------RGAAVRT-----PS...--.G---PRRVVAVLK-TP------VRR...EVMCRV.......----------
G0RIM5_HYPJQ/574-741---------HGTRVRT-----PL...--.G---SKKVAMVLK-TK------VSN...ETLCRI.......----------
Q22N58_TETTS/494-660---------KGDIVIC-----PRI.G--NK---AVKVVCVVK-TL------CTGS.NHSFVKL.......----------
A9UVU8_MONBE/587-772---------RADAIRA-----GDVLA--NG---AV.VDYVVA-VA------CAGG.EHDFCQL.......----------
J4URQ4_BEAB2/478-645---------RGMKLQT-----PL...--.G---SRKVAAVLR-TP------VKD...ETLCRL.......----------
G4NA23_MAGO7/558-749---------AGISVAT-----PA...--.G---PRAVRTVLR-TR------VRS...QPMVRL.......----------

PF13403

Q1GGP9_RUEST/27-173---------VGDRVIT-----RD.....NG...IQEIRWFGH.NA------MG.--------------------------
Q1GES6_RUEST/157-304---------EGDRVQT-----RD.....NG...AQVVQWIGA.RR------MS.--------------------------
A1AYR4_PARDP/380-527---------PGTKVMT-----LD.....HG...CKALRWIGK.RV------LS.--------------------------
A8LN65_DINSH/175-322---------VGDLVLT-----RD.....DG...AQPVRWVGS.AR------ID.--------------------------
A1B4V8_PARDP/356-503---------AGDLVQT-----RD.....NG...LQPIRWIGS.RK------LS.--------------------------
A8LKN9_DINSH/122-260---------PGDLVQT-----RD.....HG...AQPVLWVGR.RT------L..--------------------------
Q28WJ0_JANSC/241-379---------VGDRVVT-----RD.....GG...IQALRWIGF.RT------V..--------------------------
Q5LPM0_RUEPO/507-646---------PGDLIVT-----RD.....HG...LQPLRWVGS.RT------V..--------------------------
Q28L14_JANSC/1268-1415---------VGDLIET-----HD.....NG...LQAVRWIGA.KT------LT.--------------------------
Q1GGN0_RUEST/194-341---------VGDRVLT-----RD.....NG...YQTLRWKYH.RR------LS.--------------------------
Q5LSZ7_RUEPO/803-941---------PGDRVIT-----RD.....RG...YQRIRWIGG.TS------R..--------------------------
Q5LPJ7_RUEPO/175-322---------VGDLVPV-----ED.....GP...PQPILWIGK.RT------LS.--------------------------
Q1GMQ5_RUEST/293-432---------VGMQVMT-----RD.....HG...PQPLRWIGR.ST------R..--------------------------
Q5LLZ7_RUEPO/144-282---------PGDLVQT-----LD.....NG...LQPLLQLAK.TT------V..--------------------------
A8LR09_DINSH/158-296---------PGDRVWT-----RD.....DP...EARIRWVGQ.TV------V..--------------------------
C7JHN5_ACEP3/423-565---------IGDQVVT-----FDWKSNKTV...CRPVIWVGK.TH------ATV--------------------------
Q28SX3_JANSC/168-306---------VGGLVST-----VE.....HG...AEPIRWIGR.KT------F..--------------------------
A8LK48_DINSH/203-343---------PGDLVLT-----RD.....HG...PRPVAAVLS.RE------L..--------------------------
Q5LMP8_RUEPO/160-307---------VGDLVQT-----LD.....HG...PQPIRWIGT.RR------VG.--------------------------
Q28UB5_JANSC/126-273---------RGDLVLT-----AE.....GM...AKPVQWIGQ.RH------LS.--------------------------
Q1GMV1_RUEST/833-976---------EGDLVQT-----AD.....NG...LQPVIWVGH.RR------LS.--------------------------
A5FZD4_ACICJ/193-329---------AGDAVLT-----AT.....GA...ERRVVWIGR.RT------LD.--------------------------
B9JK11_AGRRK/201-336---------VGDLVVT-----H......KG...VAEIRWVGR.RR------LD.--------------------------
Q28TH9_JANSC/752-887---------VGDLVDT-----LD.....NG...PQRLVWIGT.RE------VS.--------------------------
A5G1S8_ACICJ/159-294---------KGDAVLL-----HG.....GG...TAPVVWIGH.RT------IE.--------------------------
B0T7Q3_CAUSK/153-288---------EGDEVVT-----AS.....GA...ARPVIWIGS.RQ------VR.--------------------------
C7JE32_ACEP3/536-676---------PGMSVLT-----FD.....NGEITPKDIVWVGC.QH------VTV--------------------------
B8IA31_METNO/149-285---------IGDVVVT-----VS.....GE...HRPIRWIGH.RA------YT.--------------------------
A5G006_ACICJ/174-309---------RGDRLIT-----KS.....GA...MRPVRWVGR.RT------ID.--------------------------
A5FW80_ACICJ/285-421---------AGDEVVT-----AD.....GK...LVPVIWTGS.RT------LD.--------------------------
A8LLK3_DINSH/164-305---------PGDEVLT-----LD.....HE...VQTVLWAGA.RQ------VS.--------------------------
Q5FQG8_GLUOX/285-425---------AGDKVMV-----YA.....NGTTSTQTILRVGH.AH------ATT--------------------------
B0UJT1_METS4/116-254---------VGDLVVT-----AS.....GE...HRPIKWIGH.SA------LD.--------------------------
Q5LUZ7_RUEPO/68-216---------PGDRVIT-----QD.....GS...AQEVVWKGS.TV------IV.--------------------------
Q0BS96_GRABC/3687-3823---------IGDHVIT-----AG.....EA...VRPIRWLGR.RS------YN.--------------------------
B1M2P7_METRJ/65-199---------VGDSVVT-----AA.....GL...RRPIRWIGR.RT------Y..--------------------------
A5FVL4_ACICJ/410-545---------EGDEVIT-----LR.....GE...VRQIAWRGR.RR------ID.--------------------------
A4YQ57_BRASO/106-246---------AGDVLPT-----VF.....GG...LRPVQWIGSFRR------YRA--------------------------
A5FWA2_ACICJ/1192-1328---------PGDRLVT-----ED.....GT...AEPVVWIGW.RS------ID.--------------------------
C3KQV1_RHISN/76-214---------IGDLVAT-----VR.....GP...AMPIKWIGR.HV------YR.--------------------------
A8LKB8_DINSH/19-167---------PGDLIVT-----RS.....DG...LQPLRHILR.TR------VS.--------------------------
Q5LN78_RUEPO/204-343---------RGDTVIV-----AS.....GE...AVPVLHRVS.RT------M..--------------------------
C5AQV5_METEA/69-209---------VGDLAVT-----AS.....GT...LRPITWIGN.RA------LD.--------------------------
D5AV22_RHOCB/442-581---------AGDLVVT-----RD.....RG...AVPVLWSGG.RS------LE.--------------------------
Q2YL23_BRUA2/15-148---------VGDLVTT-----VS.....GE...CLPIKWIGW.QN------YR.--------------------------
Q3J294_RHOS4/14-159---------AGDRIVT-----RD.....NG...LQPLRWISR.RR------LD.--------------------------

PF05203

U7Q1H8_SPOS1/262-759---------LGDHVMG-----KD-----GT---PRMVMGLPRGTE------TMYKVSMKT.QHRNENAR...........
Q6FQS3_CANGA/285-698---------IGDKVMG-----QD-----GK---PRNVTALPRGYD------DMYNVELDG........ET..........
A3LP04_PICST/283-730---------VGEEVLG-----KD-----GL---PREVVALPRGRE------TMYEVSEKT.QHRAETVFG..........
J7RJ26_KAZNA/284-757---------LGEKVMG-----KD-----GS---PRTVVGFAPRVR------TYVRRAATRRPRLGDAVHL..........
C5M9I6_CANTT/244-713---------VGDKVMG-----KD-----GM---PREVVGLPRGYD------DMYKVRQLSSTRRNAKSEG..........
Q6CL64_KLULA/284-692---------VGDEVMG-----RD-----GL---PRQVVGLPRGHD------DMYQVTEKSEDNETA..............
B6JY11_SCHJY/285-759---------IGDKVMG-----KD-----GR---PRDVVALPRGFD------TMYTVSQKISRKGAKSSN...........
Q6BRM0_DEBHA/283-675---------IGESVLG-----KD-----GE---ARNVVALPRGNE------TMYEINESTPEEEADLA............
A5DXZ0_LODEL/280-699---------LGELVMG-----KD-----GD---ARKVVGLPRGFD------TMYKVEQIGHDD.................
H2APW1_KAZAF/284-774---------INEKVMG-----KD-----GT---PRTVIGLPRGRE------TMYQVRHMTSKRSSDEAFG..........
G7E5L8_MIXOS/284-742---------IEDEVMG-----KD-----GC---GRVVVGLPRGVE------TMYDVAAIG.QHHNQAENG..........
F2TVI8_SALR5/1497-1695---------VGDKLMG-----DD-----GT---PRNVQHVVTGLS------RLYEVTVAS.........S..........
U9UGV8_RHIID/409-843---------VGNQIMG-----DD-----DN---PRTIQSTTKGEG------IMYRIIPND.KGPAKF.............
C5DTL5_ZYGRC/284-732---------VGQEVMG-----KD-----GK---PREVVRTPSGRE------KMYKVSHKT.AHRAHKSDSTSE......R
G8JWX2_ERECY/284-671---------IGEYVMG-----QH-----GQ---SQEVMALPRGRE------VMYTVKDVSSKH.................
A7TLB5_VANPO/284-715---------IGDLVMG-----QD-----GQ---PREVTQLPRGSD------KMYKVNEINENSTSE..............
VATA_YEAST/284-736---------VGNKVMG-----KD-----GR---PREVIKLPRGRE------TMYSVVQKS.QHRAHKSDSSRE......V
M3K3J1_CANMX/284-733---------VGDKVLG-----KD-----GL---PREVVGLPRGRE------VMYDVVQKT.QHQADTVDG..........
G0V8Z3_NAUCC/284-799---------VGEQVMG-----KD-----GA---PRTVIALPRGTE------TMYEVCHTT.QHRNGNEKF..........
C5DTQ4_ZYGRC/1-463---------VGEMVMC-----ED-----GS---SAKVTSVARDVQ------TTYQILQKT.KHRANEGEAAEKDPLRREI
G0W3J0_NAUDC/284-783---------IGEQVMG-----KD-----GN---PRTVIALPRGKE------TMYEVCHIT.PHRTTSGENF.........
G8ZLC3_TORDC/1-463---------INSYVLC-----AD-----GT---IDRVTSISQDVQ------TTYQILQKT.KHRANEGEPGREDPMRRQV
G8BNB8_TETPH/284-799---------IGEQVMG-----KD-----GA---PRSVVGLPRGQK------TMYHVKHTTQHKKSDQEVG..........

PF07591

A3DGR7_CLOTH/105-234---------AGDKVIA-----TNLETFEVA---EKTVLETYV-RE------TTELLHLTING...---------------
Q5F6G7_NEIG1/1-137---------AGDRVLS-----KDEASGKTG---YKPVTAQYG-NP------YQETVYIKVSDGIG---------------
Q9K122_NEIMB/1-137---------TGDRVFA-----KDEASGKTG---YKPVTARYG-NP------YQETVYIEISDGIG---------------

PF10596

I3L3Z8_HUMAN/86-244---------HDGKLWN---..LN-----NY---RTDMIQALG--------------------------------------
A2EY65_TRIVA/1432-1590---------HDGKLWN---..LK-----DY---RADVIQALG--------------------------------------
A8BTS5_GIAIC/1337-1490---------LLGSLYD---..LQ-----GY---KKIITAIFG--------------------------------------
S3BP74_OPHP1/1452-1610---------HDGKLWN---..LQ-----AY---RTDVIQALG--------------------------------------
Q8SVU6_ENCCU/1239-1384---------HDGKLWS---..ME-----RF---TLDTLEALG--------------------------------------
Q5KPW2_CRYNJ/1640-1796---------HERPSTS---....-----..---.........--------------------------------------
K7VI98_MAIZE/675-841---------HDGKLWN---..LN-----NY---RTDVIQALG--------------------------------------
G0W883_NAUDC/1515-1673---------HDGKLWN---..LN-----SY---RTDVIQALG--------------------------------------
E6ZWZ5_SPORE/1485-1643---------HDGKLYN---..LN-----QL---RTDTIAALG--------------------------------------
E9AFM0_LEIMA/1514-1674---------HDGNICG---GVME-----RY---RADMNNALG--------------------------------------
R0KWQ9_NOSB1/1205-1354---------HDGLLYN---..LD-----RY---KDSITSYLG--------------------------------------

PF01079

Q7PXI1_ANOGA/295-503---------G.ALLKVTPA--HLVMVWRRERSET........................R---------------------
HH_DROPS/255-475---------G.AVLTVTPA--HLISVWHPERQQL........................D---------------------
IHH_DANRE/187-398---------G.ASVSLTAA--HLLFMRVGNCSNRGEPKP................GAVR---------------------
TWHH_DANRE/190-403---------PFTKLTLTAA--HLVFVGNSSAASGI.......................T---------------------
WRT4_CAEEL/327-547---------G.ETFSLTEK--HLVFVTQCSVPYSEDENI.................NAN---------------------
Q80XI9_MOUSE/230-435---------PPRRLALTPA--HLLFIADNHTEPAAHF.....................R---------------------
WRT6_CAEEL/375-583---------G.HSIKLTDN--HLIYVSDCRTRSDL.......................K---------------------
A8X447_CAEBR/327-545---------G.EKFSLTEK--HMVYVSQCE.NNNYVEGI.................NSN---------------------
IHH_CHICK/188-394---------PPRRLALTPT--HLLFVADNASAPAAQF.....................R---------------------
SHH_CHICK/190-411---------PRARLLLTAA--HLLFVAPQHNQSEATGST.................SGQ---------------------
SHH_DANRE/187-404---------PVEKITLTAA--HLLFVLDNSTEDLHTM.....................T---------------------
WRT8_CAEEL/325-538---------G.ESFTLTEK--HLVFATDCQQNVKNLDD...................LN---------------------
DHH_HUMAN/188-396---------PPRKLLLTPW--HLVFAARGPAPAPGDF.....................A---------------------
Q175B3_AEDAE/201-412---------G.AHLTVTPA--HLVMVWQKNEGKS........................L---------------------
O45992_CAEEL/258-471---------G.ETFTLTEK--HLVYTTECRQNSSELKI..................SWE---------------------
B0S8K0_DANRE/187-399---------G.AKLSLTAA--HLLFVSEGNCSGSAANA..................ELR---------------------
B3DJ46_DANRE/191-442---------E.KRIALTPN--HLIFAAHNLKLHHHDY.....................E---------------------
HH_DROMO/248-470---------G.AVLTVTPA--HLIAVWQAERQTL........................E---------------------
C3ZGW9_BRAFL/224-434---------RNITVTATPS--HLVFVTESRDLSSPR......................I---------------------
D6WCL7_TRICA/146-345---------G.RTLTVTPS--HLLVLDDRT.............................---------------------
F6WZB6_XENTR/191-398---------PHRQLFLTPA--HLIFVSDNYSTPAYDF.....................Q---------------------
F6XBS5_CIOIN/294-549---------G.FSVTLTRN--HLIYVSKPTYDASLLTATSNATQQNNERLGLQDFTSPH---------------------
F6YTG6_XENTR/190-394---------HTSKLLVTPN--HLLFIKRSLSAGF........................L---------------------
G3V6T0_RAT/188-423---------PRERLLLTAA--HLLFVAPHNDSGPTPG....................PS---------------------
H2U1Q8_TAKRU/190-435---------G.RRLAVTPH--HLVFSDAHCGPDSSQY.....................Q---------------------
H2V9H2_TAKRU/190-402---------G.QKITLTAA--HLLYVARNGTEGD.GM.....................S---------------------
H2XUY9_CIOIN/97-305---------..ETIRLTAN--HMLFIATQTNCSNSFSA..................TKR---------------------
W4Y925_STRPU/189-401---------K.SVVQLTPQ--HLIYVSETESSFS.QS.....................K---------------------
W5K3H2_ASTMX/187-406---------PVQKITLTAA--HLIFILNNSTQSTQAMV...................MT---------------------

PF14890

M1MZU7_9CORY/77-375---------G-EEIICTPD--HEFMLNDGT...-------------------------.---------------------
E3GYR2_METFV/39-446---------G-NKIKTTPE--HKFLVFDNEEGI-------------------------I---------------------
NDRZ_PYRFU/306-755---------G-TKILTSPW--HPFFVLTPDFKI-------------------------V---------------------
D0MK11_RHOM4/430-853---------G-RSIRATAN--HRFLTPQG....-------------------------.---------------------
Q5JJ43_THEKO/306-755---------G-TRVLTSPW--HPFFVITQDLKI-------------------------V---------------------
RGYR_METJA/871-1360---------N-YELKATPD--HCLLVLR.DNQL-------------------------K---------------------
K9VL64_9CYAN/809-1233---------G-RAIRATGN--HKFLTIHG....-------------------------.---------------------
DNAB_SYNY3/385-809---------G-RTIKATAN--HRFLTIDG....-------------------------.---------------------
B8HS23_CYAP4/785-1209---------G-RAIRATGN--HKFLTITG....-------------------------.---------------------
K9QGP4_9NOSO/889-1313---------G-RKIRATVN--HKFLTING....-------------------------.---------------------
B2IVH9_NOSP7/393-817---------G-RKIRATGN--HKFLTING....-------------------------.---------------------
H3ZL75_THELN/500-1032---------G-RKINITAG--HSLFTVR.NGEI-------------------------K---------------------
D2RI62_ARCPA/834-1317---------N-YRIKATPD--HGLFVYR.DGKF-------------------------G---------------------
Y832_METJA/1064-1591---------G-KKVRVTGD--HSVFTINDNLDV-------------------------V---------------------
DPOL_THEKO/857-1388---------G-RRIKITSG--HSLFSVR.NGEL-------------------------V---------------------

PF14623

F2SQT7_TRIRC/282-454--.......G-.TLQITPW--HPMRIQN...A..WEFPFNITK........E----------------------------
E9EQB7_METRA/537-702--.......G-.NLLVTPW--HPISANG..KA..WDFPAFLAD.........----------------------------
Q237Q6_TETTS/509-673--.......G-KGLLITPY--HPVRIQG...K..WLFPTDIAP.........----------------------------
Q7S708_NEUCR/636-832--...DEAR.-.QLLVTPW--HPVSLDG..KD..WAFPTDVAL........G----------------------------
H6C7V0_EXODN/356-526--.......G-.ELLVTPY--HPLLQNG...S..WVFPQDVAE.........----------------------------
J3PIM9_GAGT3/593-786--.......G-.GVVVTPW--HPVRRTG.GGG..WAFPADMAE........A----------------------------
G2XFI4_VERDV/568-734--.......G-.GLVVTPW--HPLSADA..KS..WGFPAQMAD.........----------------------------
G1XIH1_ARTOA/537-708--.......G-.DMKVTPW--HPIHYDG...A..WRFPSDILQ.........----------------------------
U7PS73_SPOS1/521-692--.......G-.RLLITAW--HPVSHNG..TK..WVFPCRDPVAN.....KK----------------------------
C7YL43_NECH7/586-752--.......G-.KVLVTPW--HPVSNDR..KR..WSFPANAAE.........----------------------------
R8BIW3_TOGMI/471-637--.......G-.GLLVTPW--HPVSLDG..KS..WAFPSDIAD.........----------------------------
C5GK44_AJEDR/553-713--.......G-.SLIITPW--HPIQVAG...D..WMFPSDVSE.........----------------------------
S8AB86_DACHA/542-713--.......G-.EMKVTPW--HPIFHEG...E..WKFPADVVV.........----------------------------
S3CBE6_OPHP1/613-780--.......G-.RLLITAW--HPVSHNG..AD..WVFPCKDKAR......RD----------------------------
G3JM09_CORMM/336-505--.......G-AALLVTAW--HPVSFDG..VA..WYFPVHLTV.........----------------------------
C5FLY1_ARTOC/540-711--.......G-.SLEITPW--HPIRFQG...R..WSFPFNVAN........G----------------------------
F0UB99_AJEC8/548-714--.......G-.SLSITPW--HPIQVAG...D..WIFPSHVSE.........----------------------------
G0QP70_ICHMG/545-705--.......K-EGLLITPR--HPILING...K..WIKPDQIEK.........----------------------------
I7M030_TETTS/514-676--.......G-TDLWITPK--HPIRVNG...E..WKYPKELGQ.........----------------------------
M7TBR0_EUTLA/533-699--.......G-.RLLITPW--HPIKTED..GK..WAFPADVAE.........----------------------------
C1G4L4_PARBD/546-712--.......G-.PLLITPW--HPMQVER...G..WVFPSSVSN.........----------------------------
N4VVV8_COLOR/552-719--.......G-.DLAVTPW--HPISRDG.GNT..WVFPAHVAD.........----------------------------
Q24C76_TETTS/502-665--.......G-ENLWITPK--HPIRING...E..WIYPNKMGE.........----------------------------
D2VHB8_NAEGR/586-749--.......N-.GMYITPY--HPVRVKG...E..WKFPIDIKS.........----------------------------
G9MP19_HYPVG/551-718--.......G-.SLLVTPW--HPLSMDG..KN..WDFPANMSD.........----------------------------
T0JQ14_COLGC/569-736--.......G-.DLVVTPW--HPVSMDS.GKS..WVFPANVAL.........----------------------------
J4WBA6_BEAB2/688-856--.......G-.DVLVTAW--HPVSFDG..IA..WGFPVHLTV.........----------------------------
I7M701_TETTS/604-769--.......E-DGLIITPY--HPIRVNG...I..WQFPCQLKP.........----------------------------
F7VWE7_SORMK/571-774--RAGVGGVG-.SLLVTPW--HPISLDD.GKG..WVFPMDVAH........G----------------------------
L8X395_THACA/606-772--.......G-.QLAITPW--HPIYHNG...S..WVFPTQIQQ.........----------------------------
E4UR10_ARTGP/540-711--.......D-.CLQITPW--HPMKFQG...K..WEYPINMTN........G----------------------------
Q2GTB7_CHAGB/570-754--.PSGKGKS-.RLLVTPW--HPVELHQ.GGK..WVFPRDHAA.........----------------------------
E3QU32_COLGM/508-676--.......G-.DLVVTPW--HPLSLDG.GKT..WAFPASVAD........R----------------------------
G0RIM5_HYPJQ/574-741--.......G-.SVLVTPW--HPLSTDG..KG..WDFPASMSD.........----------------------------
Q22N58_TETTS/494-660--.......G-.NLLITPW--HPVRLMH...EQQWQFPSSLGQ.........----------------------------
A9UVU8_MONBE/587-772--.......S-PGLRITPW--HPVREPS...TKRWAFPSELVV.........----------------------------
J4URQ4_BEAB2/478-645--.......G-.AVLVTPW--HPISRDA..KA..WTFPAYTAD.........----------------------------
G4NA23_MAGO7/558-749--......PG-.GVVVTPW--HPVKMGGDGAE..WMFPAAAAAASGRDDGSV----------------------------

PF13403

Q1GGP9_RUEST/27-173---------P-QDLSHASHL.QPILIRQ----------------------------------------------------
Q1GES6_RUEST/157-304---------G-ARLFVMPAL.RPVRIRA----------------------------------------------------
A1AYR4_PARDP/380-527---------A-EELAAQPKL.RPIRIRA----------------------------------------------------
A8LN65_DINSH/175-322---------S-AKLAGNPRF.RPILLRA----------------------------------------------------
A1B4V8_PARDP/356-503---------A-AELKAMPNL.RPIRIAA----------------------------------------------------
A8LKN9_DINSH/122-260---------.-...PGSEAL.APIRFSP----------------------------------------------------
Q28WJ0_JANSC/241-379---------.-...PADGPL.APIHITK----------------------------------------------------
Q5LPM0_RUEPO/507-646---------.-...AATGNH.APIRLDP----------------------------------------------------
Q28L14_JANSC/1268-1415---------Q-IDLARAPHL.RPIRIRT----------------------------------------------------
Q1GGN0_RUEST/194-341---------R-ADLDRQPHL.APIIFEP----------------------------------------------------
Q5LSZ7_RUEPO/803-941---------.-...EAPTAV.APIRIRT----------------------------------------------------
Q5LPJ7_RUEPO/175-322---------I-ADLGANPHL.RPVRIRR----------------------------------------------------
Q1GMQ5_RUEST/293-432---------.-...LARGRN.APVLIAR----------------------------------------------------
Q5LLZ7_RUEPO/144-282---------.-...RGDGAL.APVLFRA----------------------------------------------------
A8LR09_DINSH/158-296---------.-...DGRDAL.APVEIGT----------------------------------------------------
C7JHN5_ACEP3/423-565---------R-PDLPHDEAG.YPVRVRK----------------------------------------------------
Q28SX3_JANSC/168-306---------.-...PARGAF.APVEFAP----------------------------------------------------
A8LK48_DINSH/203-343---------P-LTADTMADH.KPIEFKP----------------------------------------------------
Q5LMP8_RUEPO/160-307---------L-ATQLLSHGV.APVVIPA----------------------------------------------------
Q28UB5_JANSC/126-273---------A-RDIAQSPHL.SPVVIAA----------------------------------------------------
Q1GMV1_RUEST/833-976---------A-SDLARHPHL.RPVLLRP----------------------------------------------------
A5FZD4_ACICJ/193-329---------L-SRHPRPELV.RPVRIAA----------------------------------------------------
B9JK11_AGRRK/201-336---------P-KAIDKPRDT.LPVRMKA----------------------------------------------------
Q28TH9_JANSC/752-887---------V-AQLTIYPNL.RPIRIQR----------------------------------------------------
A5G1S8_ACICJ/159-294---------P-GRHARPNAV.QPVLIGA----------------------------------------------------
B0T7Q3_CAUSK/153-288---------C-DRHPAPALV.NPVRVRA----------------------------------------------------
C7JE32_ACEP3/536-676---------Q-RDCPPDIAG.VPIRISK----------------------------------------------------
B8IA31_METNO/149-285---------G-RFANANPDV.LPICFKA----------------------------------------------------
A5G006_ACICJ/174-309---------S-QRHPRPETV.WPVRIER----------------------------------------------------
A5FW80_ACICJ/285-421---------L-AMHPAPEKV.KPVCFAP----------------------------------------------------
A8LLK3_DINSH/164-305---------L-AEQIANARL.RPVRIAA----------------------------------------------------
Q5FQG8_GLUOX/285-425---------G-TTGHADVDA.VPVRVRA----------------------------------------------------
B0UJT1_METS4/116-254---------C-RSHANPAAA.RPIRIRK----------------------------------------------------
Q5LUZ7_RUEPO/68-216---------P-GRVSATGRDYRLTRIMA----------------------------------------------------
Q0BS96_GRABC/3687-3823---------G-RFIQGRRDV.LPVRIRQ----------------------------------------------------
B1M2P7_METRJ/65-199---------.-PGSSAPPSE.RPVRIRA----------------------------------------------------
A5FVL4_ACICJ/410-545---------C-RRHPVPESV.LPVLIEK----------------------------------------------------
A4YQ57_BRASO/106-246---------K-PDAAWPAAA.RPVRIAK----------------------------------------------------
A5FWA2_ACICJ/1192-1328---------L-SRDPAAALL.HPVVITP----------------------------------------------------
C3KQV1_RHISN/76-214---------R-SGPMWHKNV.VPVRIAR----------------------------------------------------
A8LKB8_DINSH/19-167---------L-AEMRADPAL.APIRLTP----------------------------------------------------
Q5LN78_RUEPO/204-343---------.-...PAFGSS.RPLTIRR----------------------------------------------------
C5AQV5_METEA/69-209---------A-KGEALPHNE.QPIRIRA----------------------------------------------------
D5AV22_RHOCB/442-581---------A-ADLAAEPGL.LPVAIRE----------------------------------------------------
Q2YL23_BRUA2/15-148---------A-GEADWNESV.MPIRVRR----------------------------------------------------
Q3J294_RHOS4/14-159---------H-ATLAAFPHL.KPVLIEK----------------------------------------------------

PF05203

U7Q1H8_SPOS1/262-759..LASFVCNA-SHLLVVVTP-QHIRKTTHVLRGKKM.TSVCWFDWHTAQAED...G..RPVRLVKLFTKSWDHDTHGGEA
Q6FQS3_CANGA/285-698..DLSYTCNS-NHTLVLKTE-QNVLLAG.........NTVSYFALGALIDET..NG..RAVEIVQEVQETFESNIS....
A3LP04_PICST/283-730..TASYTCNA-THKLVLQTN-QRVNITNHVLRGESQ.TSVTYFQMKTAVAD....G..REIELPKLCTKSFQHSSHGREN
J7RJ26_KAZNA/284-757........SG-NHRLVLRTE-QKIQLREHTLEGRKY.TNVSYFALQESEHGP..........VVKRLAKAFDHSVQAGSS
C5M9I6_CANTT/244-713..LMDFTVSA-DHKLILKTK-QDVKIATRKIGGNTY.TGVTFYVLEKTKTG.........IELVKAKTKVFGHHIHGQNG
Q6CL64_KLULA/284-692..KISFQCNS-SHKLVLVTP-QDIRLTESKEK.....VTVAFNRLADISVGNGTES..RTVRLVERAEKSFANAESNQAI
B6JY11_SCHJY/285-759..NLSYTCNA-THKLVLKTP-QQISLVEQVVRGKKQ.SSVSFLRLADVVVGSSRGGDRRRIQIVKKVTKSFQHEPRGVEK
Q6BRM0_DEBHA/283-675..RIAFTCNA-KHELVVNTK-QDIAVEQ.........NCVTYFALESVTDEA..NG..REFSVVKSQTKTFEESSM....
A5DXZ0_LODEL/280-699..SLNFTVSA-DHKLVLKTE-QRIEVTTRKFAGKNY.AAVNYFAMGKTKKSAG.GK..DGVEIVRVKSKVFAHHIHGKEV
H2APW1_KAZAF/284-774..SMDYVCSA-NHKLVLRTP-QRVILDSYELNNQKY.TTVTYFTLENTRYGQ..........IVKRMTKSFQHPASEIDG
G7E5L8_MIXOS/284-742..LLNFTCNA-SHKLVVCTP-QHVRLTDHMLGQKMQ.TSVSYFVMGQERVSA...D..RVISAVTLRMRSWQHELHGGHR
F2TVI8_SALR5/1497-1695.DVEPLVVTG-NHILCLKPS-AHLSVDEQQ.......EEV........................................
U9UGV8_RHIID/409-843.....FECND-QHILVLKFA-AEPYMRSEEIPIINRSPRIRLFWYEYDTQNN........MIVKKNDSFYYGPGEDYPKK
C5DTL5_ZYGRC/284-732FGLFEYTCNA-THKLVVRTS-RSCRPLVRNIQGTDY.VEVCLFNMTKKTLED...G..RVIDIVEETSDFYP.AVEGPEK
G8JWX2_ERECY/284-671....AYVCNA-SHKLVVETP-SSIKVSSQ...SGGI.LSVKYFGMCYEHTED...G..RVIEQCKQFTKSFTCIEE....
A7TLB5_VANPO/284-715..LFSFVCNA-THQLIVRTP-RNIKVQTRIIDGIEC.NEIVYTDLFKEITED...A..RIIELIKEVSKIYP.VSEGMDD
VATA_YEAST/284-736PELLKFTCNA-THELVVRTP-RSVRRLSRTIKGVEY.FEVITFEMGQKKAPD...G..RIVELVKEVSKSYP.ISEGPER
M3K3J1_CANMX/284-733..AISYTCNS-THKLVVRTN-QKVNMTNHVLRNEPQ.TSVTYFALVDDKDSN...G..REFKMVKLCTESFEHKTHGPEN
G0V8Z3_NAUCC/284-799.GLMNYVCSG-NHKLVLRTP-QLIRTTIHELRGKHY.TSVTFFVTEKSANGT..........IVKQRTKTFQHEFHGGEE
C5DTQ4_ZYGRC/1-463HHRLGFQCSV-AHELALRTS-MKPSVENCFKRNH...FKVCWKNLEDTLTLD...G..RIIKIPKTHHKDFPMTPEGQLA
G0W3J0_NAUDC/284-783.GVMDYVCSG-NHKLVLRTP-QNVTLTTHELDGQTY.TNVSYFALEESAYGQ..........IVKKKTKSYQHQRHGGKQ
G8ZLC3_TORDC/1-463FHRLGFKCTV-AHKLPLRTA-SKPTLENSFKRNN...FKVKWKNMEEHLTFD...G..RIVSLPKTHHKDFPMTSEGEFR
G8BNB8_TETPH/284-799..LMDYVCSG-NHKLVLRTP-QLISTATNRLNGKLY.TSVTYFALEDSIYGK..........IVKKKTNTYEHSAHGGKQ

PF07591

A3DGR7_CLOTH/105-234---------.-.EVIKTTFE-HPFYVKD----------------------------------------------------
Q5F6G7_NEIG1/1-137---------N-SQTLISNRI-HPFYSD.----------------------------------------------------
Q9K122_NEIMB/1-137---------N-NQTLISNKI-HPFYSQ.----------------------------------------------------

PF10596

I3L3Z8_HUMAN/86-244---------G-VEGILEHTLFKGTYF......PTW---------------------------------------------
A2EY65_TRIVA/1432-1590---------G-VEGILSHSIFKATGY......KHW---------------------------------------------
A8BTS5_GIAIC/1337-1490---------G-VEEILHHTLYPATDF......SDY---------------------------------------------
S3BP74_OPHP1/1452-1610---------S-VETILAHTLFAATGF......TSW---------------------------------------------
Q8SVU6_ENCCU/1239-1384---------G-VGGIADHTLFGATYF......RSF---------------------------------------------
Q5KPW2_CRYNJ/1640-1796---------.-...KLDTTLLRINSIELEDEPTKW---------------------------------------------
K7VI98_MAIZE/675-841---------G-VQGILEHTLFKGTYF......PTW---------------------------------------------
G0W883_NAUDC/1515-1673---------G-IETILEHTLFKGTGF......TSW---------------------------------------------
E6ZWZ5_SPORE/1485-1643---------G-VETILEHSLFAATGH......PTW---------------------------------------------
E9AFM0_LEIMA/1514-1674---------G-VEAILEHSLFKGTGF......PSW---------------------------------------------
R0KWQ9_NOSB1/1205-1354---------G-PSLILKHTLFKATFS......KIF---------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503-------------------FVFADRVREGDHI--------------LV..------------------------------
HH_DROPS/255-475-------------------YVFADRVEELNYV--------------LV..------------------------------
IHH_DANRE/187-398-------------------TIFASDAQVGQCL--------------LL..------------------------------
TWHH_DANRE/190-403-------------------ATFASNVKPGDTV--------------LV..------------------------------
WRT4_CAEEL/327-547-------------------PVPAERVNIGDCF--------------YI..------------------------------
Q80XI9_MOUSE/230-435-------------------ATFASHVQPGQYV--------------LV..------------------------------
WRT6_CAEEL/375-583-------------------LVAAKEVKMDDCI--------------HV..------------------------------
A8X447_CAEBR/327-545-------------------AVPAEKVNVGDCF--------------YV..------------------------------
IHH_CHICK/188-394-------------------PTFASHVQPGHFV--------------LV..------------------------------
SHH_CHICK/190-411-------------------ALFASNVKPGQRV--------------YV..------------------------------
SHH_DANRE/187-404-------------------AAYASSVRAGQKV--------------MV..------------------------------
WRT8_CAEEL/325-538-------------------PTSTGKINIGECF--------------FM..------------------------------
DHH_HUMAN/188-396-------------------PVFARRLRAGDSV--------------LA..------------------------------
Q175B3_AEDAE/201-412-------------------YLFADRIQEGDYI--------------LV..------------------------------
O45992_CAEEL/258-471-------------------SISAGKVNAGDCF--------------YL..------------------------------
B0S8K0_DANRE/187-399-------------------SVFASDVLPGQCV--------------VS..------------------------------
B3DJ46_DANRE/191-442-------------------TVFARNVRIGDYI--------------LT..------------------------------
HH_DROMO/248-470-------------------FVFADRVEELSQV--------------LV..------------------------------
C3ZGW9_BRAFL/224-434-------------------AKFMSDARPGEFL--------------LT..------------------------------
D6WCL7_TRICA/146-345-------------------MKYAQKLQPGDFL--------------LV..------------------------------
F6WZB6_XENTR/191-398-------------------AVFASSVRPGQYI--------------LV..------------------------------
F6XBS5_CIOIN/294-549-------------------SSFAAKVRQGDYI--------------YTLP------------------------------
F6YTG6_XENTR/190-394-------------------PTFAYRVQIGDLV--------------QI..------------------------------
G3V6T0_RAT/188-423-------------------PLFASRVRPGQRV--------------YVV.------------------------------
H2U1Q8_TAKRU/190-435-------------------AQFASRAQTGTCV--------------LV..------------------------------
H2V9H2_TAKRU/190-402-------------------AVFASQVRRGQKV--------------IV..------------------------------
H2XUY9_CIOIN/97-305-------------------AVFAGDIFSGQYV--------------YT..------------------------------
W4Y925_STRPU/189-401-------------------AMFASEVRTNQFV--------------YT..------------------------------
W5K3H2_ASTMX/187-406-------------------STFASNVVPGQKV--------------LV..------------------------------

PF14890

M1MZU7_9CORY/77-375-------------------YREARDLQFNDSL--------------MPLYR.............................
E3GYR2_METFV/39-446-------------------EKRADKIKKGDYI--------------VVARKLYHEDLTNEELKKKIIEILSKDEGFIACV
NDRZ_PYRFU/306-755-------------------EKRADELKEGDIL--------------I.................................
D0MK11_RHOM4/430-853-------------------WKRVDELQPGDYL--------------ALPRRIPTASTPTLTEAE................
Q5JJ43_THEKO/306-755-------------------EKRADELREGDML--------------V.................................
RGYR_METJA/871-1360-------------------WIPAKDIKENDYI--------------AMPFNYKVERKP.ISLLNLLKYLDI......TDV
K9VL64_9CYAN/809-1233-------------------WRGLDELKIGDRI--------------ALPRYVSSSFIQSMDNAE................
DNAB_SYNY3/385-809-------------------WKRLDELSLKEHI--------------ALPRKLESSSLQLMSDEE................
B8HS23_CYAP4/785-1209-------------------WKRLDELQPGERI--------------ALPRKIPSPDLQLMDDHE................
K9QGP4_9NOSO/889-1313-------------------WKRLDELNLKQHL--------------CLPRHIPSSGKPTMTYTE................
B2IVH9_NOSP7/393-817-------------------WKRLDELTPKEHL--------------CLPRNLPSSGKQTMTYAE................
H3ZL75_THELN/500-1032-------------------EVSGDGIKEGDLI--------------VAPKKIKLNEKGVSINIPELISDLSEEETADIVM
D2RI62_ARCPA/834-1317-------------------WVSAKNIRVGDYV--------------AVAFNTNVERRNDLSLLKLLAELGI......TDI
Y832_METJA/1064-1591-------------------EVKASDLKVGDFI--------------ITPKIIPSISKDKIYLSEI...............
DPOL_THEKO/857-1388-------------------EVTGDELKPGDLV--------------AVPRRLELPERNHVLNLVELLLGTPEEETLDIVM

PF14623

F2SQT7_TRIRC/282-454-------------------HLQSFSGDIYSVL--------------LEPDSNPEA........-----------------
E9EQB7_METRA/537-702-------------------GTVRYTGSVYSVM--------------LQRDRNSQS........-----------------
Q237Q6_TETTS/509-673-------------------TKMAQCSSVYSFL--------------LESG.............-----------------
Q7S708_NEUCR/636-832-------------------DYVSYTGDIYSVL--------------LSADSDVDA........-----------------
H6C7V0_EXODN/356-526-------------------TTESCRSSVFSVL--------------LAPSRDPAD........-----------------
J3PIM9_GAGT3/593-786-------------------RPALYTGSVFSVL--------------LEPDPRPRA........-----------------
G2XFI4_VERDV/568-734-------------------SAVRYTGCIYSVV--------------LQPDRDPAA........-----------------
G1XIH1_ARTOA/537-708-------------------PEEVECEAVYSVL--------------MMPSPYVED........-----------------
U7PS73_SPOS1/521-692-------------------TTVRYTGSIYSVL--------------LQPDEDADS........-----------------
C7YL43_NECH7/586-752-------------------GVVLYTGCVYSVL--------------LERDRNSSA........-----------------
R8BIW3_TOGMI/471-637-------------------GAVRYSGAIYSIL--------------LQKDRQVDA........-----------------
C5GK44_AJEDR/553-713-------------------RNIPFSGKVYSIL--------------LDSSPDSDA........-----------------
S8AB86_DACHA/542-713-------------------PKMEACEAVYSVL--------------LLPSPYVDA........-----------------
S3CBE6_OPHP1/613-780-------------------TPVRYTGSIYSIL--------------LEEDEDVDA........-----------------
G3JM09_CORMM/336-505-------------------DPIMYTGDVYSVL--------------LEADGSPFA........-----------------
C5FLY1_ARTOC/540-711-------------------DVHTFSGNIYSVL--------------LEPDSNPNA........-----------------
F0UB99_AJEC8/548-714-------------------QNVPFSGTVYSVL--------------LDPSPVSDA........-----------------
G0QP70_ICHMG/545-705-------------------AQLIKCDSVYNFV--------------LDKG.............-----------------
I7M030_TETTS/514-676-------------------TVVKTSDYIYQFV--------------LKTG.............-----------------
M7TBR0_EUTLA/533-699-------------------KRVKYSGAVYSLL--------------LQDHDNVDA........-----------------
C1G4L4_PARBD/546-712-------------------HNTPFTGTVYSVL--------------LDPSPNSDA........-----------------
N4VVV8_COLOR/552-719-------------------RPVSYTGCIYSVL--------------LQPDGDAKA........-----------------
Q24C76_TETTS/502-665-------------------VQQKQSDFIYQFV--------------LKSG.............-----------------
D2VHB8_NAEGR/586-749-------------------PQDVACDYVYNLV--------------VDQG.............-----------------
G9MP19_HYPVG/551-718-------------------TPVLYSGFIYSVL--------------LQPDRRADA........-----------------
T0JQ14_COLGC/569-736-------------------RPVRYTGCIYSVL--------------LQPGRDASA........-----------------
J4WBA6_BEAB2/688-856-------------------DPIMYTGDVYSIL--------------LEVDRRPFA........-----------------
I7M701_TETTS/604-769-------------------TELRECDFIYSFL--------------LESG.............-----------------
F7VWE7_SORMK/571-774-------------------DTVSYTGDMHSVL--------------LKNDPDVDA........-----------------
L8X395_THACA/606-772-------------------AKLLACNYVYSVL--------------LEPSSDSES........-----------------
E4UR10_ARTGP/540-711-------------------DAQAFSGNIYSVL--------------LEPDSNPDA........-----------------
Q2GTB7_CHAGB/570-754-------------------RSVRYTGAVYSVL--------------LERDEEPDA........-----------------
E3QU32_COLGM/508-676-------------------RSVRYTGCVYSVL--------------LQPDRDAAA........-----------------
G0RIM5_HYPJQ/574-741-------------------DAVLYTGSIYSVL--------------LQPDRRPDA........-----------------
Q22N58_TETTS/494-660-------------------TIFEQADAVYSFL--------------LEDG.............-----------------
A9UVU8_MONBE/587-772-------------------PKRHASEYMYSFV--------------LTAG.............-----------------
J4URQ4_BEAB2/478-645-------------------GAVRYTGAVYSVM--------------LQRDRSPDA........-----------------
G4NA23_MAGO7/558-749-------------------STITYSGFIYSLL--------------LEAEALPDGTKQDPVSA-----------------

PF13403

Q1GGP9_RUEST/27-173-------------------GALGNGLPERDMM--------------VSPN------------------------------
Q1GES6_RUEST/157-304-------------------GALGIDRPERELL--------------VSPE------------------------------
A1AYR4_PARDP/380-527-------------------EALGERLPERDLI--------------VSPQ------------------------------
A8LN65_DINSH/175-322-------------------GALGPGRPARDMR--------------VSRQ------------------------------
A1B4V8_PARDP/356-503-------------------GALGKGLPVADLL--------------VSPQ------------------------------
A8LKN9_DINSH/122-260-------------------DALGS...DRPLY--------------VSPQ------------------------------
Q28WJ0_JANSC/241-379-------------------GALGN...TRALT--------------VSPE------------------------------
Q5LPM0_RUEPO/507-646-------------------TLLQG..ASAPLL--------------VSPQ------------------------------
Q28L14_JANSC/1268-1415-------------------GALGPGVPNRDME--------------VSPQ------------------------------
Q1GGN0_RUEST/194-341-------------------DALAPGCPKRRLK--------------VSPQ------------------------------
Q5LSZ7_RUEPO/803-941-------------------GVLKN...TRDLL--------------VSPN------------------------------
Q5LPJ7_RUEPO/175-322-------------------DALGPSCPHRTLW--------------VSPQ------------------------------
Q1GMQ5_RUEST/293-432-------------------NALGH...HGQIA--------------LSPN------------------------------
Q5LLZ7_RUEPO/144-282-------------------GVLGN...FRDLY--------------VSQQ------------------------------
A8LR09_DINSH/158-296-------------------GVLGA...AAPLR--------------VSPQ------------------------------
C7JHN5_ACEP3/423-565-------------------DAIANGVPYKDML--------------ITAE------------------------------
Q28SX3_JANSC/168-306-------------------GAIGN...TRRLR--------------VSRQ------------------------------
A8LK48_DINSH/203-343-------------------GSLGPNQPAARLV--------------VSPQ------------------------------
Q5LMP8_RUEPO/160-307-------------------HSFAPSIPTHPLL--------------LSQQ------------------------------
Q28UB5_JANSC/126-273-------------------DALGPGMPARELR--------------VSPQ------------------------------
Q1GMV1_RUEST/833-976-------------------GGIIA..NDRAML--------------VSPQ------------------------------
A5FZD4_ACICJ/193-329-------------------GALADGVPARDLV--------------VSPD------------------------------
B9JK11_AGRRK/201-336-------------------GSIAENVPERDLL--------------ISPD------------------------------
Q28TH9_JANSC/752-887-------------------GVLGN...TRKML--------------VSRQ------------------------------
A5G1S8_ACICJ/159-294-------------------HAIADNVPARDLV--------------VSPD------------------------------
B0T7Q3_CAUSK/153-288-------------------GAFADGVPSRDLR--------------LSPG------------------------------
C7JE32_ACEP3/536-676-------------------DALAGGVPHHDLL--------------VTPE------------------------------
B8IA31_METNO/149-285-------------------GSLADGTPARDLW--------------VSPK------------------------------
A5G006_ACICJ/174-309-------------------GAIDDGLPERTLY--------------LSPD------------------------------
A5FW80_ACICJ/285-421-------------------GSMADGVPARRLR--------------LSPD------------------------------
A8LLK3_DINSH/164-305-------------------GALGPGCPARPLW--------------LSRQ------------------------------
Q5FQG8_GLUOX/285-425-------------------GALADGIPSRDLL--------------VTPE------------------------------
B0UJT1_METS4/116-254-------------------DAFGPGKPAQDLL--------------VSPA------------------------------
Q5LUZ7_RUEPO/68-216-------------------DAFGMQRPMSGVI--------------AGPS------------------------------
Q0BS96_GRABC/3687-3823-------------------GALDGVLPKRDLL--------------VSPL------------------------------
B1M2P7_METRJ/65-199-------------------SALHEGVPARDLL--------------VSPD------------------------------
A5FVL4_ACICJ/410-545-------------------DAFGVGQPCRDLY--------------LSPD------------------------------
A4YQ57_BRASO/106-246-------------------SALGPDIPKRDLY--------------VTQG------------------------------
A5FWA2_ACICJ/1192-1328-------------------GAFGPCMPSHPLT--------------LSPL------------------------------
C3KQV1_RHISN/76-214-------------------LAIDGQRPHKDLY--------------LSAG------------------------------
A8LKB8_DINSH/19-167-------------------RALGPLMPVRSLA--------------LAPD------------------------------
Q5LN78_RUEPO/204-343-------------------PYFGL...RQDIQ--------------AAPS------------------------------
C5AQV5_METEA/69-209-------------------GAFGPGLPARDLR--------------LSHG------------------------------
D5AV22_RHOCB/442-581-------------------NALGR...HGALL--------------LSPQ------------------------------
Q2YL23_BRUA2/15-148-------------------HALDGRTPHRDLY--------------LSPN------------------------------
Q3J294_RHOS4/14-159-------------------GSLGPDLPDRDMM--------------VSPN------------------------------

PF05203

U7Q1H8_SPOS1/262-759AADA.KAAAFRSELPSG..D.FEWSIEARDVS.LLGTHVRKATQQLINP..VLFQA..GHLSQ-----------------
Q6FQS3_CANGA/285-698......ASDFAANINRE..P.ISWTLEIRDID.YLSERVRMFTKQSVNP..VLLET..PTLAK-----------------
A3LP04_PICST/283-730AWKK..AEVFASTISRD..P.IDWTAEARDIS.RLGYHVRRATRQLWSP..VLVEK..EVLAP-----------------
J7RJ26_KAZNA/284-757AA....AQAFAHTIDTA..P.IEWDVLASEFV.KLGDRVRAASVQLINP..VFSES..HHLST-----------------
C5M9I6_CANTT/244-713AEEK..AATFAAGIDSK..EYIDWIIEARDYV.QVDEIVKTSTTQMINP..VHFES..GKLGN-----------------
Q6CL64_KLULA/284-692IN....AAEFVTTIDTT..S.IEWTLEARDML.LVDSSIREVTQQLINP..VLLEK..EHLAG-----------------
B6JY11_SCHJY/285-759AREL..AMEFLSTIGDD..D.IYWTIEARDYT.LVSQEVRELTQQMISP..VLFEK..ADLQN-----------------
Q6BRM0_DEBHA/283-675......AKEFASTISKN..S.IDWTIEARDVG.HMSDDVRCATQQSWAP..VLASK..EVLAP-----------------
A5DXZ0_LODEL/280-699AESK..ALEFAASVDMS..A.IEWVVEAKDYYEQVEDTVKQNSTQLINP..VFYES..NAIGK-----------------
H2APW1_KAZAF/284-774QSTR.NARTFAATIDRA..P.IDWDIEARDYE.KLGYHVKEASYQLINP..VFQES..GIFAA-----------------
G7E5L8_MIXOS/284-742AARV.KAEAFKASIDKD..EIFNWTIEAQHVA.ALNMHVRKATQQTISP..VLHEN..HRFGD-----------------
F2TVI8_SALR5/1497-1695...........................ARKLK...AAALRAATAA..................-----------------
U9UGV8_RHIID/409-843EVAKRAAIREMARRPNLVSSDFIWEIPIKDFL.TASDEIQRSC.LMFKPNQVIFKSVQGRFRV-----------------
C5DTL5_ZYGRC/284-732ALRI..LKEYAEADGGK..EYFEWTIEARDVA.LLSAQVRKATYQLSAP..VLLEN..NHFSH-----------------
G8JWX2_ERECY/284-671......LQQFCSQQPTE..N.FKWTVEARDVE.NMDPAVREATFQLVCP..ILYEG..HQLAQ-----------------
A7TLB5_VANPO/284-715......VQEFVSQYNKSLEDYFQWTVEPRDIN.RLTESIREATYQVYAP..VLYEC..ENLLQ-----------------
VATA_YEAST/284-736ANEL..VESYRKASNKA..Y.FEWTIEARDLS.LLGSHVRKATYQTYAP..ILYEN..DHFFD-----------------
M3K3J1_CANMX/284-733AVKK..AQEFKDTVSIL..D.IDWVIEARDVA.KMGYHVRRATKQLWAP..ILVEN..NVFSS-----------------
G0V8Z3_NAUCC/284-799AATK.LAADFASTIDPK..H.IDWDIEAKDYK.QLDHYVKKSSYQMINP..VFKES..GNLAN-----------------
C5DTQ4_ZYGRC/1-463......AKGFLDEKENSTGRFAEYNVQVRDLD.ILEAQVRVNSFLRFNP..LLEGN..GVLSE-----------------
G0W3J0_NAUDC/284-783ETEK.KVNEFLATINPD..S.IEWDVEAKDYK.KLGYDVKKSSHQMINP..VFKES..GNLIA-----------------
G8ZLC3_TORDC/1-463......ARSFMAEKEAEHGRYLEFSIQVRDLD.LLEAQIRVNSFLRFSP..VVTGR..GILSE-----------------
G8BNB8_TETPH/284-799EAAR.KASEFVSSLDMQ..P.IDWDIEASDYN.HLGYFVKKSTFQMINP..IFKES..GNLAS-----------------

PF07591

A3DGR7_CLOTH/105-234---------------------VGFVEAKE-----------------LQVG------------------------------
Q5F6G7_NEIG1/1-137---------------------GKWIKAED-----------------LKAG------------------------------
Q9K122_NEIMB/1-137---------------------GKWIQAGR-----------------LKKG------------------------------

PF10596

I3L3Z8_HUMAN/86-244-------------------EGLFWEK.............ASGFEESM.KW------------------------------
A2EY65_TRIVA/1432-1590-------------------EGLFWDN.............TTGFEEAL.KY------------------------------
A8BTS5_GIAIC/1337-1490-------------------KSVVWST.............ATEHETGLAKR------------------------------
S3BP74_OPHP1/1452-1610-------------------EGLFWEK.............ASGFEQSI.AA------------------------------
Q8SVU6_ENCCU/1239-1384-------------------SKVFWED.............MV....VE.KY------------------------------
Q5KPW2_CRYNJ/1640-1796-------------------SGFVVDKDSLYLRHDYLVLHNSGFEESM.KN------------------------------
K7VI98_MAIZE/675-841-------------------EGLFWEK.............ASGFEESM.KY------------------------------
G0W883_NAUDC/1515-1673-------------------EGLFWEK.............ASGFEDSL.QF------------------------------
E6ZWZ5_SPORE/1485-1643-------------------EGLFWEK.............SSSFEESM.QQ------------------------------
E9AFM0_LEIMA/1514-1674-------------------EGIEFDR.............SGGFENSK.KD------------------------------
R0KWQ9_NOSB1/1205-1354-------------------SKLFWDD..................SYL.SL------------------------------

PF01079

Q7PXI1_ANOGA/295-503--------------------------------------------------------------------------------
HH_DROPS/255-475--------------------------------------------------------------------------------
IHH_DANRE/187-398--------------------------------------------------------------------------------
TWHH_DANRE/190-403--------------------------------------------------------------------------------
WRT4_CAEEL/327-547--------------------------------------------------------------------------------
Q80XI9_MOUSE/230-435--------------------------------------------------------------------------------
WRT6_CAEEL/375-583--------------------------------------------------------------------------------
A8X447_CAEBR/327-545--------------------------------------------------------------------------------
IHH_CHICK/188-394--------------------------------------------------------------------------------
SHH_CHICK/190-411--------------------------------------------------------------------------------
SHH_DANRE/187-404--------------------------------------------------------------------------------
WRT8_CAEEL/325-538--------------------------------------------------------------------------------
DHH_HUMAN/188-396--------------------------------------------------------------------------------
Q175B3_AEDAE/201-412--------------------------------------------------------------------------------
O45992_CAEEL/258-471--------------------------------------------------------------------------------
B0S8K0_DANRE/187-399--------------------------------------------------------------------------------
B3DJ46_DANRE/191-442--------------------------------------------------------------------------------
HH_DROMO/248-470--------------------------------------------------------------------------------
C3ZGW9_BRAFL/224-434--------------------------------------------------------------------------------
D6WCL7_TRICA/146-345--------------------------------------------------------------------------------
F6WZB6_XENTR/191-398--------------------------------------------------------------------------------
F6XBS5_CIOIN/294-549--------------------------------------------------------------------------------
F6YTG6_XENTR/190-394--------------------------------------------------------------------------------
G3V6T0_RAT/188-423--------------------------------------------------------------------------------
H2U1Q8_TAKRU/190-435--------------------------------------------------------------------------------
H2V9H2_TAKRU/190-402--------------------------------------------------------------------------------
H2XUY9_CIOIN/97-305--------------------------------------------------------------------------------
W4Y925_STRPU/189-401--------------------------------------------------------------------------------
W5K3H2_ASTMX/187-406--------------------------------------------------------------------------------

PF14890

M1MZU7_9CORY/77-375................................................................................
E3GYR2_METFV/39-446NGDTCKLSFLKDKRYDNIEWISHEELFSD...................................................
NDRZ_PYRFU/306-755.................GGMPD..........................................................
D0MK11_RHOM4/430-853................................................................................
Q5JJ43_THEKO/306-755.................GGMPS..........................................................
RGYR_METJA/871-1360LIEFDENSTIFEKIAEYIRNNIKTSTKYKYLRNRRVPLKYLIEWNF..................................
K9VL64_9CYAN/809-1233................................................................................
DNAB_SYNY3/385-809................................................................................
B8HS23_CYAP4/785-1209................................................................................
K9QGP4_9NOSO/889-1313................................................................................
B2IVH9_NOSP7/393-817................................................................................
H3ZL75_THELN/500-1032TISAKGRKNFFKGMLRTLRWMFGEENRRIRTFNRYLFHLEKLGLIKLLPRGYEVTDWERLKKYKQLYEKLAGSVKYNGNK
D2RI62_ARCPA/834-1317CVEFKENSKLFEKLREKIVGIATSTKYKYLKNRVIPLKYLIEWNVN..................................
Y832_METJA/1064-1591...VKNKDKYYVKIKDHIKFIEEHEEILKESYKEYKTKWKDLKPVLKKKNA.............................
DPOL_THEKO/857-1388TIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALV.ENVRYNGNK

PF14623

F2SQT7_TRIRC/282-454--------------------------------------------------------------------------------
E9EQB7_METRA/537-702--------------------------------------------------------------------------------
Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
Q7S708_NEUCR/636-832--------------------------------------------------------------------------------
H6C7V0_EXODN/356-526--------------------------------------------------------------------------------
J3PIM9_GAGT3/593-786--------------------------------------------------------------------------------
G2XFI4_VERDV/568-734--------------------------------------------------------------------------------
G1XIH1_ARTOA/537-708--------------------------------------------------------------------------------
U7PS73_SPOS1/521-692--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
R8BIW3_TOGMI/471-637--------------------------------------------------------------------------------
C5GK44_AJEDR/553-713--------------------------------------------------------------------------------
S8AB86_DACHA/542-713--------------------------------------------------------------------------------
S3CBE6_OPHP1/613-780--------------------------------------------------------------------------------
G3JM09_CORMM/336-505--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
F0UB99_AJEC8/548-714--------------------------------------------------------------------------------
G0QP70_ICHMG/545-705--------------------------------------------------------------------------------
I7M030_TETTS/514-676--------------------------------------------------------------------------------
M7TBR0_EUTLA/533-699--------------------------------------------------------------------------------
C1G4L4_PARBD/546-712--------------------------------------------------------------------------------
N4VVV8_COLOR/552-719--------------------------------------------------------------------------------
Q24C76_TETTS/502-665--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-749--------------------------------------------------------------------------------
G9MP19_HYPVG/551-718--------------------------------------------------------------------------------
T0JQ14_COLGC/569-736--------------------------------------------------------------------------------
J4WBA6_BEAB2/688-856--------------------------------------------------------------------------------
I7M701_TETTS/604-769--------------------------------------------------------------------------------
F7VWE7_SORMK/571-774--------------------------------------------------------------------------------
L8X395_THACA/606-772--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
G0RIM5_HYPJQ/574-741--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------
J4URQ4_BEAB2/478-645--------------------------------------------------------------------------------
G4NA23_MAGO7/558-749--------------------------------------------------------------------------------

PF13403

Q1GGP9_RUEST/27-173--------------------------------------------------------------------------------
Q1GES6_RUEST/157-304--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
Q5LPM0_RUEPO/507-646--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
Q1GGN0_RUEST/194-341--------------------------------------------------------------------------------
Q5LSZ7_RUEPO/803-941--------------------------------------------------------------------------------
Q5LPJ7_RUEPO/175-322--------------------------------------------------------------------------------
Q1GMQ5_RUEST/293-432--------------------------------------------------------------------------------
Q5LLZ7_RUEPO/144-282--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
Q5LMP8_RUEPO/160-307--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
Q1GMV1_RUEST/833-976--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
Q5LUZ7_RUEPO/68-216--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
Q5LN78_RUEPO/204-343--------------------------------------------------------------------------------
C5AQV5_METEA/69-209--------------------------------------------------------------------------------
D5AV22_RHOCB/442-581--------------------------------------------------------------------------------
Q2YL23_BRUA2/15-148--------------------------------------------------------------------------------
Q3J294_RHOS4/14-159--------------------------------------------------------------------------------

PF05203

U7Q1H8_SPOS1/262-759--------------------------------------------------------------------------------
Q6FQS3_CANGA/285-698--------------------------------------------------------------------------------
A3LP04_PICST/283-730--------------------------------------------------------------------------------
J7RJ26_KAZNA/284-757--------------------------------------------------------------------------------
C5M9I6_CANTT/244-713--------------------------------------------------------------------------------
Q6CL64_KLULA/284-692--------------------------------------------------------------------------------
B6JY11_SCHJY/285-759--------------------------------------------------------------------------------
Q6BRM0_DEBHA/283-675--------------------------------------------------------------------------------
A5DXZ0_LODEL/280-699--------------------------------------------------------------------------------
H2APW1_KAZAF/284-774--------------------------------------------------------------------------------
G7E5L8_MIXOS/284-742--------------------------------------------------------------------------------
F2TVI8_SALR5/1497-1695--------------------------------------------------------------------------------
U9UGV8_RHIID/409-843--------------------------------------------------------------------------------
C5DTL5_ZYGRC/284-732--------------------------------------------------------------------------------
G8JWX2_ERECY/284-671--------------------------------------------------------------------------------
A7TLB5_VANPO/284-715--------------------------------------------------------------------------------
VATA_YEAST/284-736--------------------------------------------------------------------------------
M3K3J1_CANMX/284-733--------------------------------------------------------------------------------
G0V8Z3_NAUCC/284-799--------------------------------------------------------------------------------
C5DTQ4_ZYGRC/1-463--------------------------------------------------------------------------------
G0W3J0_NAUDC/284-783--------------------------------------------------------------------------------
G8ZLC3_TORDC/1-463--------------------------------------------------------------------------------
G8BNB8_TETPH/284-799--------------------------------------------------------------------------------

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------
Q9K122_NEIMB/1-137--------------------------------------------------------------------------------

PF10596

I3L3Z8_HUMAN/86-244--------------------------------------------------------------------------------
A2EY65_TRIVA/1432-1590--------------------------------------------------------------------------------
A8BTS5_GIAIC/1337-1490--------------------------------------------------------------------------------
S3BP74_OPHP1/1452-1610--------------------------------------------------------------------------------
Q8SVU6_ENCCU/1239-1384--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1796--------------------------------------------------------------------------------
K7VI98_MAIZE/675-841--------------------------------------------------------------------------------
G0W883_NAUDC/1515-1673--------------------------------------------------------------------------------
E6ZWZ5_SPORE/1485-1643--------------------------------------------------------------------------------
E9AFM0_LEIMA/1514-1674--------------------------------------------------------------------------------
R0KWQ9_NOSB1/1205-1354--------------------------------------------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503------------------------------------------------.......HVAGSLEPRAV--------------
HH_DROPS/255-475------------------------------------------------.....RDPQTGELRPQRV--------------
IHH_DANRE/187-398------------------------------------------------........GKLRKRFSQI--------------
TWHH_DANRE/190-403------------------------------------------------.....WEDTCESLKSVTV--------------
WRT4_CAEEL/327-547------------------------------------------------....AHRKKSQMYQRVKV--------------
Q80XI9_MOUSE/230-435------------------------------------------------.......SGVPGLQPARV--------------
WRT6_CAEEL/375-583------------------------------------------------......TTDSNVVIKKKV--------------
A8X447_CAEBR/327-545------------------------------------------------....AHRTNSKLYQHVKV--------------
IHH_CHICK/188-394------------------------------------------------......AVGSGGLQPAEV--------------
SHH_CHICK/190-411------------------------------------------------.....LGEGGQQLLPASV--------------
SHH_DANRE/187-404------------------------------------------------....VDDSGQ..LKSVIV--------------
WRT8_CAEEL/325-538------------------------------------------------....AQPENASKFQKVQI--------------
DHH_HUMAN/188-396------------------------------------------------.......PGGDALRPARV--------------
Q175B3_AEDAE/201-412------------------------------------------------.......NINSTIEPRKV--------------
O45992_CAEEL/258-471------------------------------------------------....AQSEALTKYRLVEI--------------
B0S8K0_DANRE/187-399------------------------------------------------.....TQAAGRHGRLSRV--------------
B3DJ46_DANRE/191-442------------------------------------------------......TGGDRGIQPSKV--------------
HH_DROMO/248-470------------------------------------------------......HDATGELRPQRV--------------
C3ZGW9_BRAFL/224-434------------------------------------------------.....PDSDGGGFRKVKI--------------
D6WCL7_TRICA/146-345------------------------------------------------.....SDNAKNALISEKI--------------
F6WZB6_XENTR/191-398------------------------------------------------.......SSVVGLIPAKI--------------
F6XBS5_CIOIN/294-549------------------------------------------------NSHTGPDTPSATVRPSRV--------------
F6YTG6_XENTR/190-394------------------------------------------------......YVNGTQLQPSKV--------------
G3V6T0_RAT/188-423------------------------------------------------....AERGGDRRLLPAAV--------------
H2U1Q8_TAKRU/190-435------------------------------------------------......HTAGGEVHPSRI--------------
H2V9H2_TAKRU/190-402------------------------------------------------.....SDPERSRLEPVTV--------------
H2XUY9_CIOIN/97-305------------------------------------------------....TIQARGFEIQPSRV--------------
W4Y925_STRPU/189-401------------------------------------------------....TGQNHDRGVRPKRV--------------
W5K3H2_ASTMX/187-406------------------------------------------------.....VDRNGGQLNPVVV--------------

PF14890

M1MZU7_9CORY/77-375...........................................KWQTRDGYESASTGKGSARQTHV..............
E3GYR2_METFV/39-446................................GEKLRLPDSTEEFTKFYYLAGIVKAGGNTK..................
NDRZ_PYRFU/306-755.......................................GEDYKFIFDYWLAGFIAGDGCFDKYHSHVKGHEYIYDRLRI
D0MK11_RHOM4/430-853................................................LALLGHLIGDGCTLPHHV...........IQY
Q5JJ43_THEKO/306-755.......................................DDDYEFLLDYWLAGFIAGDGSIDKYRSHVKGHEYVYDRLRI
RGYR_METJA/871-1360..............DLDEIEKEAKYIYKSVAGTKKIPLFKLDERF...WYFAGLVLGDGSIQDSKIRI......AQTP..
K9VL64_9CYAN/809-1233................................................IALLGHMIGDGCTLPRHV...........IQY
DNAB_SYNY3/385-809................................................LGLLGHLIGDGCTLPRHA...........IQY
B8HS23_CYAP4/785-1209................................................LALLGHLIGDGCTLPRHS...........IQY
K9QGP4_9NOSO/889-1313................................................VALLGHLIGDGCTLPRHA...........IQY
B2IVH9_NOSP7/393-817................................................VALLGHLIGDGCTLPRHA...........IQY
H3ZL75_THELN/500-1032REYLVMFNEIKDFISYFPQKELEEWKIGTLNGFRTNCILKVDEDF...GKLLGYYVSEGYAGAQKNKTGG...ISYSVKL
D2RI62_ARCPA/834-1317...............LQEVEREAKAIYRQRPSAKKIPIFKLNADF...WYLVGLVMGDGTVRDGKVAI......AQTD..
Y832_METJA/1064-1591.........FRLDLIEDLVDKEKIEKISYGHANYINNKIKLDEKF...GYLIGAFLSEGHWNDKC............VEI
DPOL_THEKO/857-1388REYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMSPLIEVDESL...AKLLGYYVSEGYARKQRNPKNG...WSYSVKL

PF14623

F2SQT7_TRIRC/282-454------------------------------------------------...HAIMV.ED.......--------------
E9EQB7_METRA/537-702------------------------------------------------...HALRV.AG.......--------------
Q237Q6_TETTS/509-673------------------------------------------------...HSMMI.ND.......--------------
Q7S708_NEUCR/636-832------------------------------------------------...HAIMV.EG.......--------------
H6C7V0_EXODN/356-526------------------------------------------------...HAIKI.GG.......--------------
J3PIM9_GAGT3/593-786------------------------------------------------...HAFLVAESAAGAGSP--------------
G2XFI4_VERDV/568-734------------------------------------------------...HALRV.GG.......--------------
G1XIH1_ARTOA/537-708------------------------------------------------...HSMYV.DA.......--------------
U7PS73_SPOS1/521-692------------------------------------------------...HAINI.EG.......--------------
C7YL43_NECH7/586-752------------------------------------------------...HAIRV.GD.......--------------
R8BIW3_TOGMI/471-637------------------------------------------------...HAVKA.GG.......--------------
C5GK44_AJEDR/553-713------------------------------------------------...HAIMV.EG.......--------------
S8AB86_DACHA/542-713------------------------------------------------...HTMYI.GG.......--------------
S3CBE6_OPHP1/613-780------------------------------------------------...HAMNI.EG.......--------------
G3JM09_CORMM/336-505------------------------------------------------...HTVQVAGG.......--------------
C5FLY1_ARTOC/540-711------------------------------------------------...HAIMV.ED.......--------------
F0UB99_AJEC8/548-714------------------------------------------------...HAIMV.EG.......--------------
G0QP70_ICHMG/545-705------------------------------------------------...HNILI.NN.......--------------
I7M030_TETTS/514-676------------------------------------------------...HTMNI.GG.......--------------
M7TBR0_EUTLA/533-699------------------------------------------------...HAVKV.GG.......--------------
C1G4L4_PARBD/546-712------------------------------------------------...HAIMV.GN.......--------------
N4VVV8_COLOR/552-719------------------------------------------------...HAVSV.AG.......--------------
Q24C76_TETTS/502-665------------------------------------------------...HTMNI.GG.......--------------
D2VHB8_NAEGR/586-749------------------------------------------------...HVVSI.NG.......--------------
G9MP19_HYPVG/551-718------------------------------------------------...HAIRV.GD.......--------------
T0JQ14_COLGC/569-736------------------------------------------------...HAVNV.AG.......--------------
J4WBA6_BEAB2/688-856------------------------------------------------...HTVLA.GG.......--------------
I7M701_TETTS/604-769------------------------------------------------...HSMEI.NG.......--------------
F7VWE7_SORMK/571-774------------------------------------------------...HAIMV.ED.......--------------
L8X395_THACA/606-772------------------------------------------------...HAVFI.EG.......--------------
E4UR10_ARTGP/540-711------------------------------------------------...HAIMV.ED.......--------------
Q2GTB7_CHAGB/570-754------------------------------------------------...HAILV.GG.......--------------
E3QU32_COLGM/508-676------------------------------------------------...HALSV.AG.......--------------
G0RIM5_HYPJQ/574-741------------------------------------------------...HAIRV.GD.......--------------
Q22N58_TETTS/494-660------------------------------------------------...HSMSI.EG.......--------------
A9UVU8_MONBE/587-772------------------------------------------------...GEVPV.DG.......--------------
J4URQ4_BEAB2/478-645------------------------------------------------...HALRLEGG.......--------------
G4NA23_MAGO7/558-749------------------------------------------------AEQHAFCVGSG.......--------------

PF13403

Q1GGP9_RUEST/27-173---------------------------------------------------HRVLVAND---------------------
Q1GES6_RUEST/157-304---------------------------------------------------HRMLVRGA---------------------
A1AYR4_PARDP/380-527---------------------------------------------------HRVLLRSV---------------------
A8LN65_DINSH/175-322---------------------------------------------------HRVLLEDW---------------------
A1B4V8_PARDP/356-503---------------------------------------------------HRVLVRSN---------------------
A8LKN9_DINSH/122-260---------------------------------------------------HRMLLSDP---------------------
Q28WJ0_JANSC/241-379---------------------------------------------------HRMLVQGW---------------------
Q5LPM0_RUEPO/507-646---------------------------------------------------HRMLWSGS---------------------
Q28L14_JANSC/1268-1415---------------------------------------------------HRMLIEGG---------------------
Q1GGN0_RUEST/194-341---------------------------------------------------HRILIESH---------------------
Q5LSZ7_RUEPO/803-941---------------------------------------------------HRILMMGP---------------------
Q5LPJ7_RUEPO/175-322---------------------------------------------------HRIVLQGW---------------------
Q1GMQ5_RUEST/293-432---------------------------------------------------HRVLIRSE---------------------
Q5LLZ7_RUEPO/144-282---------------------------------------------------HRMLITGW---------------------
A8LR09_DINSH/158-296---------------------------------------------------HRILMRAW---------------------
C7JHN5_ACEP3/423-565---------------------------------------------------HCLFFE..---------------------
Q28SX3_JANSC/168-306---------------------------------------------------HRLLLTGW---------------------
A8LK48_DINSH/203-343---------------------------------------------------HRMLLRT.---------------------
Q5LMP8_RUEPO/160-307---------------------------------------------------HRVLLRSR---------------------
Q28UB5_JANSC/126-273---------------------------------------------------HRLALSTG---------------------
Q1GMV1_RUEST/833-976---------------------------------------------------HRFLLPSD---------------------
A5FZD4_ACICJ/193-329---------------------------------------------------HALFLD..---------------------
B9JK11_AGRRK/201-336---------------------------------------------------HCMFME..---------------------
Q28TH9_JANSC/752-887---------------------------------------------------HGMLLGQ.---------------------
A5G1S8_ACICJ/159-294---------------------------------------------------HAFYFN..---------------------
B0T7Q3_CAUSK/153-288---------------------------------------------------HAVWLD..---------------------
C7JE32_ACEP3/536-676---------------------------------------------------HCLYLD..---------------------
B8IA31_METNO/149-285---------------------------------------------------HAMFLD..---------------------
A5G006_ACICJ/174-309---------------------------------------------------HAIYLD..---------------------
A5FW80_ACICJ/285-421---------------------------------------------------HAVWFD..---------------------
A8LLK3_DINSH/164-305---------------------------------------------------HRVLLTR.---------------------
Q5FQG8_GLUOX/285-425---------------------------------------------------HCMMLE..---------------------
B0UJT1_METS4/116-254---------------------------------------------------HAICLD..---------------------
Q5LUZ7_RUEPO/68-216---------------------------------------------------ARLLATPG---------------------
Q0BS96_GRABC/3687-3823---------------------------------------------------HAMFID..---------------------
B1M2P7_METRJ/65-199---------------------------------------------------HAVWLD..---------------------
A5FVL4_ACICJ/410-545---------------------------------------------------HAIWID..---------------------
A4YQ57_BRASO/106-246---------------------------------------------------HALLFD..---------------------
A5FWA2_ACICJ/1192-1328---------------------------------------------------HAVYAD..---------------------
C3KQV1_RHISN/76-214---------------------------------------------------HALYLD..---------------------
A8LKB8_DINSH/19-167---------------------------------------------------HPVRVPAH---------------------
Q5LN78_RUEPO/204-343---------------------------------------------------QRLLLSGT---------------------
C5AQV5_METEA/69-209---------------------------------------------------HPVLVG..---------------------
D5AV22_RHOCB/442-581---------------------------------------------------HAVLAL..---------------------
Q2YL23_BRUA2/15-148---------------------------------------------------HALFID..---------------------
Q3J294_RHOS4/14-159---------------------------------------------------HRILVSRD---------------------

PF05203

U7Q1H8_SPOS1/262-759------------------------------------------------VLERHGYESGAL....EM--------------
Q6FQS3_CANGA/285-698------------------------------------------------QLESNE....ST..ATNL--------------
A3LP04_PICST/283-730------------------------------------------------MIAKRGFDE.SI..APYM--------------
J7RJ26_KAZNA/284-757------------------------------------------------RMQALGSDD.AL..ASKL--------------
C5M9I6_CANTT/244-713------------------------------------------------WLHEHKQNK.SL..APQL--------------
Q6CL64_KLULA/284-692------------------------------------------------VLKSNDFQS.SL..APQF--------------
B6JY11_SCHJY/285-759------------------------------------------------RLVKRGISAKYA...SEA--------------
Q6BRM0_DEBHA/283-675------------------------------------------------VVQEAGFDA.TI..APYV--------------
A5DXZ0_LODEL/280-699------------------------------------------------WLADNGETKPSS..ASEL--------------
H2APW1_KAZAF/284-774------------------------------------------------KLNNFGFAK.KI..APEM--------------
G7E5L8_MIXOS/284-742------------------------------------------------ILSQHGLDP.QL..DARV--------------
F2TVI8_SALR5/1497-1695------------------------------------------------..................--------------
U9UGV8_RHIID/409-843------------------------------------------------ILSKILGVSPTNSQISAA--------------
C5DTL5_ZYGRC/284-732------------------------------------------------YLKDSNSAV.GNDTVRAL--------------
G8JWX2_ERECY/284-671------------------------------------------------YLATQKNGL.PSEAATIL--------------
A7TLB5_VANPO/284-715------------------------------------------------YLKNTKYNL.NEKSPTAL--------------
VATA_YEAST/284-736------------------------------------------------YMQKSKFHL.TIEGPKVL--------------
M3K3J1_CANMX/284-733------------------------------------------------MIEKQGSDT.SI..APEL--------------
G0V8Z3_NAUCC/284-799------------------------------------------------ILGDAGIEK.TL..AAKM--------------
C5DTQ4_ZYGRC/1-463------------------------------------------------FLTGQKGLNSPA..VLTM--------------
G0W3J0_NAUDC/284-783------------------------------------------------KLNELGFSK.EI..APQM--------------
G8ZLC3_TORDC/1-463------------------------------------------------FLTGQKHLITPY..VLDM--------------
G8BNB8_TETPH/284-799------------------------------------------------KLEKLGFEG.SL..APKI--------------

PF07591

A3DGR7_CLOTH/105-234---------------------------------------------------DKLLDSKG---------------------
Q5F6G7_NEIG1/1-137---------------------------------------------------NRLFAESG---------------------
Q9K122_NEIMB/1-137---------------------------------------------------DTLLSESG---------------------

PF10596

I3L3Z8_HUMAN/86-244---------------------------------------------------KKLTNAQRSGLNQIP--------------
A2EY65_TRIVA/1432-1590---------------------------------------------------RKLTNAQRQGMSQVP--------------
A8BTS5_GIAIC/1337-1490---------------------------------------------------TNLTRARRQGLSQIP--------------
S3BP74_OPHP1/1452-1610---------------------------------------------------KKLTNAQRQGLSAIP--------------
Q8SVU6_ENCCU/1239-1384---------------------------------------------------RKLTNAQKMGLSQIP--------------
Q5KPW2_CRYNJ/1640-1796---------------------------------------------------KRLTNAQRSGLSQIP--------------
K7VI98_MAIZE/675-841---------------------------------------------------KKLINAQRSGLNQIP--------------
G0W883_NAUDC/1515-1673---------------------------------------------------KKLTHAQRTGLSQIP--------------
E6ZWZ5_SPORE/1485-1643---------------------------------------------------KRLTNAQRSGLSQIP--------------
E9AFM0_LEIMA/1514-1674---------------------------------------------------TKLAKQQRAGLSKVP--------------
R0KWQ9_NOSB1/1205-1354---------------------------------------------------KTNTFAQKRGLNQIP--------------

PF01079

Q7PXI1_ANOGA/295-503--------------------------------------------------------------------------------
HH_DROPS/255-475--------------------------------------------------------------------------------
IHH_DANRE/187-398--------------------------------------------------------------------------------
TWHH_DANRE/190-403--------------------------------------------------------------------------------
WRT4_CAEEL/327-547--------------------------------------------------------------------------------
Q80XI9_MOUSE/230-435--------------------------------------------------------------------------------
WRT6_CAEEL/375-583--------------------------------------------------------------------------------
A8X447_CAEBR/327-545--------------------------------------------------------------------------------
IHH_CHICK/188-394--------------------------------------------------------------------------------
SHH_CHICK/190-411--------------------------------------------------------------------------------
SHH_DANRE/187-404--------------------------------------------------------------------------------
WRT8_CAEEL/325-538--------------------------------------------------------------------------------
DHH_HUMAN/188-396--------------------------------------------------------------------------------
Q175B3_AEDAE/201-412--------------------------------------------------------------------------------
O45992_CAEEL/258-471--------------------------------------------------------------------------------
B0S8K0_DANRE/187-399--------------------------------------------------------------------------------
B3DJ46_DANRE/191-442--------------------------------------------------------------------------------
HH_DROMO/248-470--------------------------------------------------------------------------------
C3ZGW9_BRAFL/224-434--------------------------------------------------------------------------------
D6WCL7_TRICA/146-345--------------------------------------------------------------------------------
F6WZB6_XENTR/191-398--------------------------------------------------------------------------------
F6XBS5_CIOIN/294-549--------------------------------------------------------------------------------
F6YTG6_XENTR/190-394--------------------------------------------------------------------------------
G3V6T0_RAT/188-423--------------------------------------------------------------------------------
H2U1Q8_TAKRU/190-435--------------------------------------------------------------------------------
H2V9H2_TAKRU/190-402--------------------------------------------------------------------------------
H2XUY9_CIOIN/97-305--------------------------------------------------------------------------------
W4Y925_STRPU/189-401--------------------------------------------------------------------------------
W5K3H2_ASTMX/187-406--------------------------------------------------------------------------------

PF14890

M1MZU7_9CORY/77-375................................................................................
E3GYR2_METFV/39-446.......................................................LKNISIFKKVVDTLFTWKFIETSPK
NDRZ_PYRFU/306-755YDYRIETFEIINDYLEKTFGRKYS..IQKDRNIYYIDIKARNITSHYLK.....LLEGI........DNGIPPQILKEGK
D0MK11_RHOM4/430-853TSRDADLATLVAHLATKVFGSKVTPQIRKELRWYQVYLRAARPLAPGKRNPISDWLRDLGIFGLRSYEKKVPALLFCQTS
Q5JJ43_THEKO/306-755YDYTTETLGIINDHLEKTFGKRYS..LQRDRNIHYIDIKAKGITSHYIE.....LLRGI........TNGIPQPILKEGR
RGYR_METJA/871-1360.......LKDVKSILDETFP..............FLHNWISGNQVIISNPIIAEILEKLGM.....RNGKLNGIIFSLPE
K9VL64_9CYAN/809-1233TTREEDLANTVANLAIEVFGERIIPRICKERDWYQVYLPAAYHLTHNVRNPVTEWLDALGVFGMRSHQKFVPNQIFEQPQ
DNAB_SYNY3/385-809TSNKIELAEKVVELAKAVFGDQINPRISQERQWYQVYIPASYRLTHNKKNPITKWLENLDVFGLRSYEKFVPNQVFEQPQ
B8HS23_CYAP4/785-1209TTRELDLAEMVSSLATKVFGKSLNPRINPEKKWYQVYLTSNQSLAPGLKNPVTKWLEHLGIFGLRSYEKFIPDQVFEQPP
K9QGP4_9NOSO/889-1313TTREIDLAENVAFLAREVFGDSIIPRISPERDWYQVYLSATKRLTHSVRNPIAKWLDSLGIFGLRSYEKFVPQELFSQPQ
B2IVH9_NOSP7/393-817TTREIDLAQNVAFLATEVFGDSIVPRISPEREWYQVYLSAAQHLTHSVRNPIAKWLDSLNVFGLRSYEKFVPRELFSQPK
H3ZL75_THELN/500-1032YNEDPNVLESMKNVAEKFFGK.....VRVDRNCVSISKKMAYLVMKCLCGALAE.............NKRIPSVILTSPE
D2RI62_ARCPA/834-1317.......VKKVESIVKDILP..............FIQTWTSGMQVFFANSIIAEILKRLDV......RGKLNGLVFSLPE
Y832_METJA/1064-1591SSTNKEFIENLVEIIEEILGKDAYYITVKGDKRRY.....KDLYVIGLNKTVAMIFESLGLNK.LSSNKEIPSILLS.NE
DPOL_THEKO/857-1388YNEDPEVLDDMERLASRFFGK.....VRRGRNYVEIPKKIGYLLFENMCGVLAE.............NKRIPEFVFTSPK

PF14623

F2SQT7_TRIRC/282-454--------------------------------------------------------------------------------
E9EQB7_METRA/537-702--------------------------------------------------------------------------------
Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
Q7S708_NEUCR/636-832--------------------------------------------------------------------------------
H6C7V0_EXODN/356-526--------------------------------------------------------------------------------
J3PIM9_GAGT3/593-786--------------------------------------------------------------------------------
G2XFI4_VERDV/568-734--------------------------------------------------------------------------------
G1XIH1_ARTOA/537-708--------------------------------------------------------------------------------
U7PS73_SPOS1/521-692--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
R8BIW3_TOGMI/471-637--------------------------------------------------------------------------------
C5GK44_AJEDR/553-713--------------------------------------------------------------------------------
S8AB86_DACHA/542-713--------------------------------------------------------------------------------
S3CBE6_OPHP1/613-780--------------------------------------------------------------------------------
G3JM09_CORMM/336-505--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
F0UB99_AJEC8/548-714--------------------------------------------------------------------------------
G0QP70_ICHMG/545-705--------------------------------------------------------------------------------
I7M030_TETTS/514-676--------------------------------------------------------------------------------
M7TBR0_EUTLA/533-699--------------------------------------------------------------------------------
C1G4L4_PARBD/546-712--------------------------------------------------------------------------------
N4VVV8_COLOR/552-719--------------------------------------------------------------------------------
Q24C76_TETTS/502-665--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-749--------------------------------------------------------------------------------
G9MP19_HYPVG/551-718--------------------------------------------------------------------------------
T0JQ14_COLGC/569-736--------------------------------------------------------------------------------
J4WBA6_BEAB2/688-856--------------------------------------------------------------------------------
I7M701_TETTS/604-769--------------------------------------------------------------------------------
F7VWE7_SORMK/571-774--------------------------------------------------------------------------------
L8X395_THACA/606-772--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
G0RIM5_HYPJQ/574-741--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------
J4URQ4_BEAB2/478-645--------------------------------------------------------------------------------
G4NA23_MAGO7/558-749--------------------------------------------------------------------------------

PF13403

Q1GGP9_RUEST/27-173--------------------------------------------------------------------------------
Q1GES6_RUEST/157-304--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
Q5LPM0_RUEPO/507-646--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
Q1GGN0_RUEST/194-341--------------------------------------------------------------------------------
Q5LSZ7_RUEPO/803-941--------------------------------------------------------------------------------
Q5LPJ7_RUEPO/175-322--------------------------------------------------------------------------------
Q1GMQ5_RUEST/293-432--------------------------------------------------------------------------------
Q5LLZ7_RUEPO/144-282--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
Q5LMP8_RUEPO/160-307--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
Q1GMV1_RUEST/833-976--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
Q5LUZ7_RUEPO/68-216--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
Q5LN78_RUEPO/204-343--------------------------------------------------------------------------------
C5AQV5_METEA/69-209--------------------------------------------------------------------------------
D5AV22_RHOCB/442-581--------------------------------------------------------------------------------
Q2YL23_BRUA2/15-148--------------------------------------------------------------------------------
Q3J294_RHOS4/14-159--------------------------------------------------------------------------------

PF05203

U7Q1H8_SPOS1/262-759--------------------------------------------------------------------------------
Q6FQS3_CANGA/285-698--------------------------------------------------------------------------------
A3LP04_PICST/283-730--------------------------------------------------------------------------------
J7RJ26_KAZNA/284-757--------------------------------------------------------------------------------
C5M9I6_CANTT/244-713--------------------------------------------------------------------------------
Q6CL64_KLULA/284-692--------------------------------------------------------------------------------
B6JY11_SCHJY/285-759--------------------------------------------------------------------------------
Q6BRM0_DEBHA/283-675--------------------------------------------------------------------------------
A5DXZ0_LODEL/280-699--------------------------------------------------------------------------------
H2APW1_KAZAF/284-774--------------------------------------------------------------------------------
G7E5L8_MIXOS/284-742--------------------------------------------------------------------------------
F2TVI8_SALR5/1497-1695--------------------------------------------------------------------------------
U9UGV8_RHIID/409-843--------------------------------------------------------------------------------
C5DTL5_ZYGRC/284-732--------------------------------------------------------------------------------
G8JWX2_ERECY/284-671--------------------------------------------------------------------------------
A7TLB5_VANPO/284-715--------------------------------------------------------------------------------
VATA_YEAST/284-736--------------------------------------------------------------------------------
M3K3J1_CANMX/284-733--------------------------------------------------------------------------------
G0V8Z3_NAUCC/284-799--------------------------------------------------------------------------------
C5DTQ4_ZYGRC/1-463--------------------------------------------------------------------------------
G0W3J0_NAUDC/284-783--------------------------------------------------------------------------------
G8ZLC3_TORDC/1-463--------------------------------------------------------------------------------
G8BNB8_TETPH/284-799--------------------------------------------------------------------------------

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------
Q9K122_NEIMB/1-137--------------------------------------------------------------------------------

PF10596

I3L3Z8_HUMAN/86-244--------------------------------------------------------------------------------
A2EY65_TRIVA/1432-1590--------------------------------------------------------------------------------
A8BTS5_GIAIC/1337-1490--------------------------------------------------------------------------------
S3BP74_OPHP1/1452-1610--------------------------------------------------------------------------------
Q8SVU6_ENCCU/1239-1384--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1796--------------------------------------------------------------------------------
K7VI98_MAIZE/675-841--------------------------------------------------------------------------------
G0W883_NAUDC/1515-1673--------------------------------------------------------------------------------
E6ZWZ5_SPORE/1485-1643--------------------------------------------------------------------------------
E9AFM0_LEIMA/1514-1674--------------------------------------------------------------------------------
R0KWQ9_NOSB1/1205-1354--------------------------------------------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503----HRISA.TLAEGVY--------------APLT-------------------------GEGTIVVD---S--------
HH_DROPS/255-475----VRVGS.VRSKGVV--------------APLT-------------------------REGTIVVN---S--------
IHH_DANRE/187-398----THVGV.REDQGLY--------------PPLT-------------------------AHGTVVVN---D--------
TWHH_DANRE/190-403----KRIYT.EEHEGSF--------------APVT-------------------------AHGTIIVD---Q--------
WRT4_CAEEL/327-547----LDINI.VQKTGIY--------------SPMT-------------------------SRGHLLVD---R--------
Q80XI9_MOUSE/230-435----AAVST.HVALGSY--------------APLT-------------------------RHGTLVVE---D--------
WRT6_CAEEL/375-583----SKISK.VIETGIY--------------SPLT-------------------------STGDIIVN---R--------
A8X447_CAEBR/327-545----LDINK.VKKTGIY--------------APMT-------------------------SVGHLLVN---R--------
IHH_CHICK/188-394----VGVRG.RTDVGAY--------------APLT-------------------------RHGTLVVD---D--------
SHH_CHICK/190-411----HSVSLREEASGAY--------------APLT-------------------------AQGTILIN---R--------
SHH_DANRE/187-404----QRIYT.EEQRGSF--------------APVT-------------------------AHGTIVVD---R--------
WRT8_CAEEL/325-538----LDIQR.VRKTGIY--------------APMT-------------------------SLGHLLVN---Q--------
DHH_HUMAN/188-396----ARVAR.EEAVGVF--------------APLT-------------------------AHGTLLVN---D--------
Q175B3_AEDAE/201-412----LRISA.KLSQGVY--------------APLT-------------------------REGTIVVD---S--------
O45992_CAEEL/258-471----LDIKR.VKKTGIY--------------APMT-------------------------SQGHLLVN---K--------
B0S8K0_DANRE/187-399----SRIQM.QEDRGVF--------------APLT-------------------------SHGTVVVN---G--------
B3DJ46_DANRE/191-442----VSVSL.EERMGVY--------------APLT-------------------------EHGNLFVD---G--------
HH_DROMO/248-470----LRVDS.VQSRGVV--------------APLT-------------------------REGTIVVN---S--------
C3ZGW9_BRAFL/224-434----VSVTM.REEKGAY--------------APLT-------------------------VHGTVVVD---N--------
D6WCL7_TRICA/146-345----VRLEA.VWRSGVF--------------APLT-------------------------GVGTLVVN---D--------
F6WZB6_XENTR/191-398----MSVSA.QTDYGAY--------------APLT-------------------------QHGTLVVD---D--------
F6XBS5_CIOIN/294-549----VSVRTIETASGAY--------------APLT-------------------------YSGTIIVG---G--------
F6YTG6_XENTR/190-394----VRVSV.EEQTGVY--------------APMT-------------------------EHGTLLVD---G--------
G3V6T0_RAT/188-423----HSVTLREEAAGAY--------------APLT-------------------------AHGTILIN---R--------
H2U1Q8_TAKRU/190-435----VSITE.EESVGAY--------------APLT-------------------------EAGSVFVD---G--------
H2V9H2_TAKRU/190-402----ERIYT.QEHVGSY--------------APVT-------------------------VQGNVVVD---E--------
H2XUY9_CIOIN/97-305----ESVTT.VTGDGLY--------------APLT-------------------------AHGTVVVD---G--------
W4Y925_STRPU/189-401----VSVTT.RLGRTAV--------------APVT-------------------------RQGSLVID---D--------
W5K3H2_ASTMX/187-406----ERIYM.EEHQGSY--------------APVT-------------------------SHGTIVVD---Q--------

PF14890

M1MZU7_9CORY/77-375.MVYEALHGAVPDDHVVH......HKNH...IHFD-------------------------NRPE....---.--------
E3GYR2_METFV/39-446KYISSFIRGYVDTRGIVK.......NNG...IYIS-------------------------SDNE.FIK---R--------
NDRZ_PYRFU/306-755NAVLSFIAGLFDAEGHVS......NKPG...IELG-------------------------MVNKRLIE---D--------
D0MK11_RHOM4/430-853EAIATFLRHLWATDGCIQMRRGKKPYPA...VYYA-------------------------TSSYQLAR---D--------
Q5JJ43_THEKO/306-755NAVLSFITGLFDAEGHVN......SKPG...VELG-------------------------MVNRKLIE---D--------
RGYR_METJA/871-1360SYINALIAGYFDTDGCFSLLYDKKAKKHNLRMVLT-------------------------SKRRDVLE---K--------
K9VL64_9CYAN/809-1233EAIALFLRHLWSTDGCIKTGRGKCHYPS...VYYA-------------------------SSSEKLAR---D--------
DNAB_SYNY3/385-809RAIAIFLRHLWSTDGCVKLIVEKSSRPV...AYYA-------------------------TSSEKLAK---D--------
B8HS23_CYAP4/785-1209AAIALFLRHLWSTDGCIRPSKKGIVYPA...IYYA-------------------------TSSERLAR---D--------
K9QGP4_9NOSO/889-1313ELIACFLRHLWSTDGCIKLVAGKRPRPI...AYYA-------------------------SSSERLAF---D--------
B2IVH9_NOSP7/393-817ELIACFLRHLWSTDGCINLIAGKKPRPI...AFYA-------------------------SSSERLAF---D--------
H3ZL75_THELN/500-1032PVRWSFLEAYFTGDGDIH......PSKR...FRLS-------------------------TKSELLAN---Q--------
D2RI62_ARCPA/834-1317EWINAMIAGYIDTDGCISLMFDKRTGKHNLRIAIS-------------------------SKDREKLE---K--------
Y832_METJA/1064-1591TFLKGLIKGYIDGDGSIYV....DESKRDYSIRLY-------------------------TTSETLRD---T--------
DPOL_THEKO/857-1388GVRLAFLEGYFIGDGDVH......PNKR...LRLS-------------------------TKSELLAN---Q--------

PF14623

F2SQT7_TRIRC/282-454----..HICVTLGHG-----------------ILT...............G.......EDIRAHELFG---D--------
E9EQB7_METRA/537-702----..IWGATLGHG-----------------LTA...............G.......NDTRAHYFFG---D--------
Q237Q6_TETTS/509-673----..IECVTFAHG-----------------FQE........................DKVKHEYFG---T--------
Q7S708_NEUCR/636-832----..VWAVTLGHG-----------------LTG..............TGEGVVTAAEDLRTHRFFG---D--------
H6C7V0_EXODN/356-526----..QVCVTLGHG-----------------VVA................G....PEDDVRAHAFFG---N--------
J3PIM9_GAGT3/593-786----PVLWGVCLGHG-----------------LAGRTRGEADGEEAAEDAG.......DDVRNHEFWG---D--------
G2XFI4_VERDV/568-734----..HWGVSLGHG-----------------VTA...............G.......GDFRAHQFFG---D--------
G1XIH1_ARTOA/537-708----..IRVATLGHG-----------------LVN................TE..NVENDVRNHEFFG---N--------
U7PS73_SPOS1/521-692----..VWVVTLGHG-----------------LTQ..............KTDDEGETNNDVRVHRFFG---D--------
C7YL43_NECH7/586-752----..MWGVTLGHG-----------------LTI...............G.......SDVRAHSFFG---D--------
R8BIW3_TOGMI/471-637----..LWGVTLGHG-----------------LLA...............G.......DDVRAHHYLG---N--------
C5GK44_AJEDR/553-713----..HVCVSLGHG-----------------VRS...............G.......NDVRAHAFFG---S--------
S8AB86_DACHA/542-713----..AKVVTLGHG-----------------LVE................KP..EAGRDVRNHEFFG---N--------
S3CBE6_OPHP1/613-780----..LWVVTLGHG-----------------LTE................KQDAPNPDDVRIHSFLG---D--------
G3JM09_CORMM/336-505----..LWGASLGHG-----------------IVA...............GA.....GEDVRAHPFFG---D--------
C5FLY1_ARTOC/540-711----..CICVTLGHG-----------------IQT...............G.......DDIRAHELFG---N--------
F0UB99_AJEC8/548-714----..HVCVSLGHG-----------------IQG......................CNDVRAHPFFG---S--------
G0QP70_ICHMG/545-705----..VTCTTFGHG-----------------FKG........................ENVHHDYFG---T--------
I7M030_TETTS/514-676----..YECICLGHN-----------------FQE........................RVAYHPYLG---S--------
M7TBR0_EUTLA/533-699----..VWGVTLGHG-----------------LLT...............G.......CDVRAHAFFG---D--------
C1G4L4_PARBD/546-712----..HVCVSLGHG-----------------VLS...............G.......SDVRAHAFFG---S--------
N4VVV8_COLOR/552-719----..ILGVTLGHG-----------------LLS...............G.......GDVRAHQFFG---S--------
Q24C76_TETTS/502-665----..FEVICLGHG-----------------FQE........................PIASHEYLG---S--------
D2VHB8_NAEGR/586-749----..VECITLGHG-----------------FTD.......................NSVVSHPYFG---T--------
G9MP19_HYPVG/551-718----..AWGVTLGHG-----------------VTR...............G.......TDVRAHEFFG---D--------
T0JQ14_COLGC/569-736----..IWGVTLGHG-----------------LVT...............G.......LDVRAHQFFG---D--------
J4WBA6_BEAB2/688-856----..LWGTTLGHG-----------------ITG...............GGE...GANDVRAHPFFG---D--------
I7M701_TETTS/604-769----..IECVTYAHN-----------------FQE........................EIVKHDFFG---T--------
F7VWE7_SORMK/571-774----..VWGVTLGHG-----------------LTG..............TGEGEVTGAEDVRTHRFFG---D--------
L8X395_THACA/606-772----..IRCVTLGHG-----------------CID........................SVRAHPFLG---D--------
E4UR10_ARTGP/540-711----..HICVTLGHG-----------------ILQ...............G........DIRAHELFG---N--------
Q2GTB7_CHAGB/570-754----..VWGVTMGHG-----------------LTT................QVL.GRRYDVRVHEFYG---A--------
E3QU32_COLGM/508-676----..VWGVTLGHG-----------------LVS...............G.......RDARAHAFFG---D--------
G0RIM5_HYPJQ/574-741----..AWGVTLGHG-----------------IMR...............G.......DDARAHGFFG---D--------
Q22N58_TETTS/494-660----..VECIALAHN-----------------ISE........................PVAQHAYYG---T--------
A9UVU8_MONBE/587-772----..HTTVGLAHE-----------------LQE........................PVAAHPFFG---S--------
J4URQ4_BEAB2/478-645----..LWGVTLGHG-----------------VTN..............GG.......GDARAHAFFG---N--------
G4NA23_MAGO7/558-749----.GVWAVAMGHG-----------------LVD...............G.......SDVRAHAFYG---D--------

PF13403

Q1GGP9_RUEST/27-173------KTALYFEDR-----------------EVL-------------------------VAAKHLTG...L--------
Q1GES6_RUEST/157-304------AARALFNES-----------------EVL-------------------------VAARDLIN...G--------
A1AYR4_PARDP/380-527------VARRMVGEA-----------------EVL-------------------------LAARHLIG...L--------
A8LN65_DINSH/175-322------RADLLFGSA-----------------QVL-------------------------AAAAHLVN...D--------
A1B4V8_PARDP/356-503------IAQKMFKTR-----------------EVL-------------------------VAAKQLVL...L--------
A8LKN9_DINSH/122-260------RLLLLFEEA-----------------EVL-------------------------AAALHLVN...G--------
Q28WJ0_JANSC/241-379------RCQVLFGRE-----------------EGL-------------------------CAAKHLVD...G--------
Q5LPM0_RUEPO/507-646------RAQMYFGES-----------------EVL-------------------------VAATHLLG...S--------
Q28L14_JANSC/1268-1415------QTELLFGED-----------------QVL-------------------------VRAKHLTH...L--------
Q1GGN0_RUEST/194-341------MSGLLFASN-----------------AIL-------------------------APAKGLVN...G--------
Q5LSZ7_RUEPO/803-941------MVEFYLGHS-----------------EVL-------------------------VAAKFLVD...G--------
Q5LPJ7_RUEPO/175-322------RAELFFGEA-----------------QVF-------------------------AAAIHLTN...D--------
Q1GMQ5_RUEST/293-432------LADLQFGQP-----------------EVL-------------------------IKAKHLVN...G--------
Q5LLZ7_RUEPO/144-282------QAELACGES-----------------EVF-------------------------VPARMLVN...G--------
A8LR09_DINSH/158-296------QAELLFGVP-----------------EVL-------------------------LAATSLTA...L--------
C7JHN5_ACEP3/423-565------.........-----------------GKF-------------------------VPVRMLVN...G--------
Q28SX3_JANSC/168-306------RAELLFGEE-----------------AVW-------------------------VPAAYFLD...R--------
A8LK48_DINSH/203-343------.....VEGR-----------------ELL-------------------------VPAKALVD...M--------
Q5LMP8_RUEPO/160-307------IARRMYGSD-----------------EIL-------------------------IAARRLTG...L--------
Q28UB5_JANSC/126-273------ASGIVLGAD-----------------AVL-------------------------AAALHMTP...R--------
Q1GMV1_RUEST/833-976------....GASRS-----------------ESF-------------------------VRARLLLELDPG--------
A5FZD4_ACICJ/193-329------.........-----------------GVL-------------------------VQAKDLVD...G--------
B9JK11_AGRRK/201-336------.........-----------------ESL-------------------------IPAKFLVN...G--------
Q28TH9_JANSC/752-887------.........-----------------DHF-------------------------ARAVHLSK..CM--------
A5G1S8_ACICJ/159-294------.........-----------------GAL-------------------------IPAKALVN...G--------
B0T7Q3_CAUSK/153-288------.........-----------------GVL-------------------------VPVGLLTN...G--------
C7JE32_ACEP3/536-676------.........-----------------GCF-------------------------VPVRMLVN...G--------
B8IA31_METNO/149-285------.........-----------------GCL-------------------------IPAVHLVN...G--------
A5G006_ACICJ/174-309------.........-----------------GCL-------------------------VPAKALVN...G--------
A5FW80_ACICJ/285-421------.........-----------------NLL-------------------------IPAKFLVN...G--------
A8LLK3_DINSH/164-305------.....ADGA-----------------ECL-------------------------VPVAKLLG...C--------
Q5FQG8_GLUOX/285-425------.........-----------------GSF-------------------------VPVRMLVN...G--------
B0UJT1_METS4/116-254------....LLG..-----------------EVL-------------------------IPASALVN...G--------
Q5LUZ7_RUEPO/68-216------HLRALAGDQ-----------------PML-------------------------TPVQHFVD...G--------
Q0BS96_GRABC/3687-3823------.........-----------------GVL-------------------------VPAGRLVN...G--------
B1M2P7_METRJ/65-199------.........-----------------GLF-------------------------VAAGHLVN...G--------
A5FVL4_ACICJ/410-545------.........-----------------GSL-------------------------VEIKRLIN...G--------
A4YQ57_BRASO/106-246------.........-----------------GLL-------------------------VPAGTLVN...G--------
A5FWA2_ACICJ/1192-1328------.........-----------------GVL-------------------------VPATLLVN...E--------
C3KQV1_RHISN/76-214------.........-----------------GVL-------------------------IRATDLVN...G--------
A8LKB8_DINSH/19-167------LLGQSVPDP-----------------TLR-------------------------LTARSLAD...Y--------
Q5LN78_RUEPO/204-343------EVEYLFGRE-----------------SVL-------------------------VPARHLTG...G--------
C5AQV5_METEA/69-209------..ADANGEG-----------------GVL-------------------------VPVMCLIN...G--------
D5AV22_RHOCB/442-581------.....TDQG-----------------ERL-------------------------VRARHLAG...L--------
Q2YL23_BRUA2/15-148------.........-----------------GVL-------------------------IRVKDLVN...G--------
Q3J294_RHOS4/14-159------RTALHFDAP-----------------EVL-------------------------VAAKHLVG...P--------

PF05203

U7Q1H8_SPOS1/262-759----AYLLGFWVGDG.YYDRAA...------.FAV-----------------------D.ARDTAIKG---R....MQEY
Q6FQS3_CANGA/285-698----AYLLGTWIASK.ATTAGT...------.ISV-----------------------P.TTKADLLS---K....VKSA
A3LP04_PICST/283-730----AYLVGLWVGDG.YSDRAT...------.FSI-----------------------D.IQDVEIHE---R....IKDF
J7RJ26_KAZNA/284-757----AWLLGTWVAVG.DVNASESAT------TFSL-----------------------SVGTHAALLD---R....ISEY
C5M9I6_CANTT/244-713----GYLLGTWAGIG.NVKSSA...------.FTM-----------------------NSKDDVKLAT---R....IMNY
Q6CL64_KLULA/284-692----SYLLGAFVGSS.GKDNSEYLQ------QLSA-----------------------Q..FDKKIVA---EKSIDVQSN
B6JY11_SCHJY/285-759----AYLLGVWVGAG.FSRSSA...------.FSL-----------------------Y.EEDSELVS---R....IISF
Q6BRM0_DEBHA/283-675----SYLLGLWIGNG.YSDRVQ...------.YLI-----------------------D.GKNTELIN---R....VREY
A5DXZ0_LODEL/280-699----AYLMGAAFNES...RESISDA------ATNT-----------------------KRTLENVEFD---D....LKSV
H2APW1_KAZAF/284-774----AWLLGFWVGAG.DMEQFS...------.FSI-----------------------A.GTETELIS---H....IVKC
G7E5L8_MIXOS/284-742----AYLVGLWLGSG.SSDEPA...------.LTI-----------------------A.SNDAKTVE---R....IDSL
F2TVI8_SALR5/1497-1695----.......TGDASVNGAAM...------.PQA-----------------------QQPQDSTLFE---M....TVEE
U9UGV8_RHIID/409-843----SWLVGVWIGGG.IVKSPI...------.IYV-----------------------N.ENEKEILR---A....IEQY
C5DTL5_ZYGRC/284-732----SYFLGLWIGDGMLNNAAT...------.FSV-----------------------D.SQNASLLN---R....INEF
G8JWX2_ERECY/284-671----AYFLGLWSGNQ..........------..SN-----------------------EIEVTAEVFS---R....LQGA
A7TLB5_VANPO/284-715----AYLLGLWTGSG.MTRRAG...------.LSV-----------------------S.TTDESLMN---N....IVAA
VATA_YEAST/284-736----AYLLGLWIGDG.LSDRAT...------.FSV-----------------------D.SRDTSLME---R....VTEY
M3K3J1_CANMX/284-733----AYLTGLWVGNG.SSESAA...------.FSV-----------------------D.SRDEEIIN---R....IQDC
G0V8Z3_NAUCC/284-799----AWLLGFWVGNG.HMETAQ...------.FPV-----------------------D.SWDTQLVD---R....ISEY
C5DTQ4_ZYGRC/1-463----AWLLGLWIGDG.TTKEPE...------.ISV-----------------------D.SHDTGLME---G....LIER
G0W3J0_NAUDC/284-783----GWLLGFWVGNG.SITTSS...------.FSI-----------------------D.SLDTQLLD---R....ITEY
G8ZLC3_TORDC/1-463----AWLLGLWLGDG.TTKEPE...------.ISV-----------------------D.SFDTCLME---G....LIER
G8BNB8_TETPH/284-799----AWMLGFWVGAG.NINQSE...------.FSI-----------------------D.PSGTQLVD---R....ISEV

PF07591

A3DGR7_CLOTH/105-234--------------------------------NVL-------------------------VVEEKKLE---I--------
Q5F6G7_NEIG1/1-137--------------------------------KTQ-------------------------TVRNIVVK---.--------
Q9K122_NEIMB/1-137--------------------------------AKQ-------------------------TVQNITLK---.--------

PF10596

I3L3Z8_HUMAN/86-244----NRRFTLWWS-------------------PTI-------------------------NRANVYVGFQVQ--------
A2EY65_TRIVA/1432-1590----NRRYTLWWS-------------------PTI-------------------------NRANVYVGFQVQ--------
A8BTS5_GIAIC/1337-1490----NRRFALWWS-------------------PTI-------------------------NRSSVYIGYRSQ--------
S3BP74_OPHP1/1452-1610----NRRFCLWWS-------------------PTI-------------------------NRGSVYVGFRVQ--------
Q8SVU6_ENCCU/1239-1384----NRRFILWWS-------------------PTI-------------------------NRGNVYVGYQVQ--------
Q5KPW2_CRYNJ/1640-1796----NRRFTMWWS-------------------PTI-------------------------NRANVYVGFQVQ--------
K7VI98_MAIZE/675-841----NRRFTLWWS-------------------PTI-------------------------NRANVYVGFQ.E--------
G0W883_NAUDC/1515-1673----NRRFTLWWS-------------------PTI-------------------------NRANVYVGFVVQ--------
E6ZWZ5_SPORE/1485-1643----NRRFTLWWS-------------------PTL-------------------------NRSSVYIGFQVQ--------
E9AFM0_LEIMA/1514-1674----NQRFALWWS-------------------PTI-------------------------NRSDIQAGFESK--------
R0KWQ9_NOSB1/1205-1354----NKRFIFWWS-------------------PTI-------------------------NRADVYVGYETI--------

PF01079

Q7PXI1_ANOGA/295-503--------------------------------------------------------------------------------
HH_DROPS/255-475--------------------------------------------------------------------------------
IHH_DANRE/187-398--------------------------------------------------------------------------------
TWHH_DANRE/190-403--------------------------------------------------------------------------------
WRT4_CAEEL/327-547--------------------------------------------------------------------------------
Q80XI9_MOUSE/230-435--------------------------------------------------------------------------------
WRT6_CAEEL/375-583--------------------------------------------------------------------------------
A8X447_CAEBR/327-545--------------------------------------------------------------------------------
IHH_CHICK/188-394--------------------------------------------------------------------------------
SHH_CHICK/190-411--------------------------------------------------------------------------------
SHH_DANRE/187-404--------------------------------------------------------------------------------
WRT8_CAEEL/325-538--------------------------------------------------------------------------------
DHH_HUMAN/188-396--------------------------------------------------------------------------------
Q175B3_AEDAE/201-412--------------------------------------------------------------------------------
O45992_CAEEL/258-471--------------------------------------------------------------------------------
B0S8K0_DANRE/187-399--------------------------------------------------------------------------------
B3DJ46_DANRE/191-442--------------------------------------------------------------------------------
HH_DROMO/248-470--------------------------------------------------------------------------------
C3ZGW9_BRAFL/224-434--------------------------------------------------------------------------------
D6WCL7_TRICA/146-345--------------------------------------------------------------------------------
F6WZB6_XENTR/191-398--------------------------------------------------------------------------------
F6XBS5_CIOIN/294-549--------------------------------------------------------------------------------
F6YTG6_XENTR/190-394--------------------------------------------------------------------------------
G3V6T0_RAT/188-423--------------------------------------------------------------------------------
H2U1Q8_TAKRU/190-435--------------------------------------------------------------------------------
H2V9H2_TAKRU/190-402--------------------------------------------------------------------------------
H2XUY9_CIOIN/97-305--------------------------------------------------------------------------------
W4Y925_STRPU/189-401--------------------------------------------------------------------------------
W5K3H2_ASTMX/187-406--------------------------------------------------------------------------------

PF14890

M1MZU7_9CORY/77-375--------------------------------------------------------------------------------
E3GYR2_METFV/39-446--------------------------------------------------------------------------------
NDRZ_PYRFU/306-755--------------------------------------------------------------------------------
D0MK11_RHOM4/430-853--------------------------------------------------------------------------------
Q5JJ43_THEKO/306-755--------------------------------------------------------------------------------
RGYR_METJA/871-1360--------------------------------------------------------------------------------
K9VL64_9CYAN/809-1233--------------------------------------------------------------------------------
DNAB_SYNY3/385-809--------------------------------------------------------------------------------
B8HS23_CYAP4/785-1209--------------------------------------------------------------------------------
K9QGP4_9NOSO/889-1313--------------------------------------------------------------------------------
B2IVH9_NOSP7/393-817--------------------------------------------------------------------------------
H3ZL75_THELN/500-1032--------------------------------------------------------------------------------
D2RI62_ARCPA/834-1317--------------------------------------------------------------------------------
Y832_METJA/1064-1591--------------------------------------------------------------------------------
DPOL_THEKO/857-1388--------------------------------------------------------------------------------

PF14623

F2SQT7_TRIRC/282-454--------------------------------------------------------------------------------
E9EQB7_METRA/537-702--------------------------------------------------------------------------------
Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
Q7S708_NEUCR/636-832--------------------------------------------------------------------------------
H6C7V0_EXODN/356-526--------------------------------------------------------------------------------
J3PIM9_GAGT3/593-786--------------------------------------------------------------------------------
G2XFI4_VERDV/568-734--------------------------------------------------------------------------------
G1XIH1_ARTOA/537-708--------------------------------------------------------------------------------
U7PS73_SPOS1/521-692--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
R8BIW3_TOGMI/471-637--------------------------------------------------------------------------------
C5GK44_AJEDR/553-713--------------------------------------------------------------------------------
S8AB86_DACHA/542-713--------------------------------------------------------------------------------
S3CBE6_OPHP1/613-780--------------------------------------------------------------------------------
G3JM09_CORMM/336-505--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
F0UB99_AJEC8/548-714--------------------------------------------------------------------------------
G0QP70_ICHMG/545-705--------------------------------------------------------------------------------
I7M030_TETTS/514-676--------------------------------------------------------------------------------
M7TBR0_EUTLA/533-699--------------------------------------------------------------------------------
C1G4L4_PARBD/546-712--------------------------------------------------------------------------------
N4VVV8_COLOR/552-719--------------------------------------------------------------------------------
Q24C76_TETTS/502-665--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-749--------------------------------------------------------------------------------
G9MP19_HYPVG/551-718--------------------------------------------------------------------------------
T0JQ14_COLGC/569-736--------------------------------------------------------------------------------
J4WBA6_BEAB2/688-856--------------------------------------------------------------------------------
I7M701_TETTS/604-769--------------------------------------------------------------------------------
F7VWE7_SORMK/571-774--------------------------------------------------------------------------------
L8X395_THACA/606-772--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
G0RIM5_HYPJQ/574-741--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------
J4URQ4_BEAB2/478-645--------------------------------------------------------------------------------
G4NA23_MAGO7/558-749--------------------------------------------------------------------------------

PF13403

Q1GGP9_RUEST/27-173--------------------------------------------------------------------------------
Q1GES6_RUEST/157-304--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
Q5LPM0_RUEPO/507-646--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
Q1GGN0_RUEST/194-341--------------------------------------------------------------------------------
Q5LSZ7_RUEPO/803-941--------------------------------------------------------------------------------
Q5LPJ7_RUEPO/175-322--------------------------------------------------------------------------------
Q1GMQ5_RUEST/293-432--------------------------------------------------------------------------------
Q5LLZ7_RUEPO/144-282--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
Q5LMP8_RUEPO/160-307--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
Q1GMV1_RUEST/833-976--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
Q5LUZ7_RUEPO/68-216--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
Q5LN78_RUEPO/204-343--------------------------------------------------------------------------------
C5AQV5_METEA/69-209--------------------------------------------------------------------------------
D5AV22_RHOCB/442-581--------------------------------------------------------------------------------
Q2YL23_BRUA2/15-148--------------------------------------------------------------------------------
Q3J294_RHOS4/14-159--------------------------------------------------------------------------------

PF05203

U7Q1H8_SPOS1/262-759GSMFDLVVDTREYKKYMYSNQADDKADPTDDSPAKEARKVLG.....................DLEVNATLNRDETSPTV
Q6FQS3_CANGA/285-698LSSLSIDYSSESINSVSTY.............................................................
A3LP04_PICST/283-730ASHAGLTPRIACYKKSR...............................................................
J7RJ26_KAZNA/284-757GKALGLSTTTVERQNRHYVDRETEEAEVAKIKT........................................GSVQEDG
C5M9I6_CANTT/244-713SSKLGMTCSSTESGELNVAENEEEFFNNLGAEK.......................................DEAGDFTF
Q6CL64_KLULA/284-692GKTVGTA.........................................................................
B6JY11_SCHJY/285-759GKALGLKAVTAEHNPRTVKIVRGE........................................................
Q6BRM0_DEBHA/283-675DEAIENNNQTSAK...................................................................
A5DXZ0_LODEL/280-699DSSLDLSMDDGYETDNT...............................................................
H2APW1_KAZAF/284-774ANLVGLTITSTEICNSFKRDQGYEEAKLAGMAKGIPEEAGVV.....................VFEDDKDGQPAENVLVA
G7E5L8_MIXOS/284-742CSALGLVASVSDEHHRAKIA............................................................
F2TVI8_SALR5/1497-1695................................................................................
U9UGV8_RHIID/409-843SEMLNWRYMK......................................................................
C5DTL5_ZYGRC/284-732AEVLGLSAEYKDSQEPKR..............................................................
G8JWX2_ERECY/284-671VELLGLHVKRQQGVSKSI..............................................................
A7TLB5_VANPO/284-715ADLLNLKSEFKQERTTTR..............................................................
VATA_YEAST/284-736AEKLNLCAEYKDRKEPQV..............................................................
M3K3J1_CANMX/284-733AEAAGLEMRGSHYKKTY...............................................................
G0V8Z3_NAUCC/284-799GKHFNLTTTTENHYRSNHVESNKDIEIFEMNEAQIEEAEQTGVVAFDSNRKGDPSETELIEAEIFNESRPSTAGLFTPAA
C5DTQ4_ZYGRC/1-463GKIWGLYPEYKDEQIPLR..............................................................
G0W3J0_NAUDC/284-783GKLFALTTTSATNHCRNYSGSGNQDIELSKINNGKVETDGTIT...................FDDDTEREPSEQELIDME
G8ZLC3_TORDC/1-463CKTWGLFPTYKDEPIPLR..............................................................
G8BNB8_TETPH/284-799GKYFNLTTATSKHYSRVFSKAQEEVEIAKLNNGKIEADGSIVFDDDIEGTPS.EEELIEIEMSSDASKASSNDASFARVN

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------
Q9K122_NEIMB/1-137--------------------------------------------------------------------------------

PF10596

I3L3Z8_HUMAN/86-244--------------------------------------------------------------------------------
A2EY65_TRIVA/1432-1590--------------------------------------------------------------------------------
A8BTS5_GIAIC/1337-1490--------------------------------------------------------------------------------
S3BP74_OPHP1/1452-1610--------------------------------------------------------------------------------
Q8SVU6_ENCCU/1239-1384--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1796--------------------------------------------------------------------------------
K7VI98_MAIZE/675-841--------------------------------------------------------------------------------
G0W883_NAUDC/1515-1673--------------------------------------------------------------------------------
E6ZWZ5_SPORE/1485-1643--------------------------------------------------------------------------------
E9AFM0_LEIMA/1514-1674--------------------------------------------------------------------------------
R0KWQ9_NOSB1/1205-1354--------------------------------------------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503------------------------------------------------------------------------------IA
HH_DROPS/255-475------------------------------------------------------------------------------VA
IHH_DANRE/187-398------------------------------------------------------------------------------VL
TWHH_DANRE/190-403------------------------------------------------------------------------------VL
WRT4_CAEEL/327-547------------------------------------------------------------------------------IH
Q80XI9_MOUSE/230-435------------------------------------------------------------------------------VV
WRT6_CAEEL/375-583------------------------------------------------------------------------------VL
A8X447_CAEBR/327-545------------------------------------------------------------------------------IH
IHH_CHICK/188-394------------------------------------------------------------------------------VV
SHH_CHICK/190-411------------------------------------------------------------------------------VL
SHH_DANRE/187-404------------------------------------------------------------------------------IL
WRT8_CAEEL/325-538------------------------------------------------------------------------------IH
DHH_HUMAN/188-396------------------------------------------------------------------------------VL
Q175B3_AEDAE/201-412------------------------------------------------------------------------------IA
O45992_CAEEL/258-471------------------------------------------------------------------------------IH
B0S8K0_DANRE/187-399------------------------------------------------------------------------------IV
B3DJ46_DANRE/191-442------------------------------------------------------------------------------VL
HH_DROMO/248-470------------------------------------------------------------------------------VA
C3ZGW9_BRAFL/224-434------------------------------------------------------------------------------VA
D6WCL7_TRICA/146-345------------------------------------------------------------------------------VV
F6WZB6_XENTR/191-398------------------------------------------------------------------------------VV
F6XBS5_CIOIN/294-549------------------------------------------------------------------------------TA
F6YTG6_XENTR/190-394------------------------------------------------------------------------------VL
G3V6T0_RAT/188-423------------------------------------------------------------------------------VL
H2U1Q8_TAKRU/190-435------------------------------------------------------------------------------VL
H2V9H2_TAKRU/190-402------------------------------------------------------------------------------IL
H2XUY9_CIOIN/97-305------------------------------------------------------------------------------IV
W4Y925_STRPU/189-401------------------------------------------------------------------------------VA
W5K3H2_ASTMX/187-406------------------------------------------------------------------------------VL

PF14890

M1MZU7_9CORY/77-375------------------------------------------------------------------------------..
E3GYR2_METFV/39-446------------------------------------------------------------------------------LQ
NDRZ_PYRFU/306-755------------------------------------------------------------------------------VT
D0MK11_RHOM4/430-853------------------------------------------------------------------------------VQ
Q5JJ43_THEKO/306-755------------------------------------------------------------------------------IT
RGYR_METJA/871-1360------------------------------------------------------------------------------IG
K9VL64_9CYAN/809-1233------------------------------------------------------------------------------VQ
DNAB_SYNY3/385-809------------------------------------------------------------------------------VQ
B8HS23_CYAP4/785-1209------------------------------------------------------------------------------VQ
K9QGP4_9NOSO/889-1313------------------------------------------------------------------------------VQ
B2IVH9_NOSP7/393-817------------------------------------------------------------------------------VQ
H3ZL75_THELN/500-1032------------------------------------------------------------------------------LV
D2RI62_ARCPA/834-1317------------------------------------------------------------------------------VG
Y832_METJA/1064-1591------------------------------------------------------------------------------LC
DPOL_THEKO/857-1388------------------------------------------------------------------------------LV

PF14623

F2SQT7_TRIRC/282-454-------------------------------------------------------------------------YQR--V-
E9EQB7_METRA/537-702-------------------------------------------------------------------------YNR--V-
Q237Q6_TETTS/509-673-------------------------------------------------------------------------.NK--V-
Q7S708_NEUCR/636-832-------------------------------------------------------------------------YKL--V-
H6C7V0_EXODN/356-526-------------------------------------------------------------------------HRR--V-
J3PIM9_GAGT3/593-786-------------------------------------------------------------------------YAR--V-
G2XFI4_VERDV/568-734-------------------------------------------------------------------------YMA--V-
G1XIH1_ARTOA/537-708-------------------------------------------------------------------------YSA--V-
U7PS73_SPOS1/521-692-------------------------------------------------------------------------YSA--V-
C7YL43_NECH7/586-752-------------------------------------------------------------------------YNN--V-
R8BIW3_TOGMI/471-637-------------------------------------------------------------------------YSA--V-
C5GK44_AJEDR/553-713-------------------------------------------------------------------------YPS--V-
S8AB86_DACHA/542-713-------------------------------------------------------------------------YEK--V-
S3CBE6_OPHP1/613-780-------------------------------------------------------------------------YAA--V-
G3JM09_CORMM/336-505-------------------------------------------------------------------------YVL--V-
C5FLY1_ARTOC/540-711-------------------------------------------------------------------------YHL--I-
F0UB99_AJEC8/548-714-------------------------------------------------------------------------YPS--V-
G0QP70_ICHMG/545-705-------------------------------------------------------------------------.NK--I-
I7M030_TETTS/514-676-------------------------------------------------------------------------.QA--V-
M7TBR0_EUTLA/533-699-------------------------------------------------------------------------RAV--V-
C1G4L4_PARBD/546-712-------------------------------------------------------------------------YSN--V-
N4VVV8_COLOR/552-719-------------------------------------------------------------------------YTK--V-
Q24C76_TETTS/502-665-------------------------------------------------------------------------.QA--V-
D2VHB8_NAEGR/586-749-------------------------------------------------------------------------.DQ--I-
G9MP19_HYPVG/551-718-------------------------------------------------------------------------YMR--V-
T0JQ14_COLGC/569-736-------------------------------------------------------------------------YGK--V-
J4WBA6_BEAB2/688-856-------------------------------------------------------------------------YLS--I-
I7M701_TETTS/604-769-------------------------------------------------------------------------.EK--I-
F7VWE7_SORMK/571-774-------------------------------------------------------------------------YDL--V-
L8X395_THACA/606-772-------------------------------------------------------------------------YAR--V-
E4UR10_ARTGP/540-711-------------------------------------------------------------------------YQL--V-
Q2GTB7_CHAGB/570-754-------------------------------------------------------------------------YDT--V-
E3QU32_COLGM/508-676-------------------------------------------------------------------------YKK--V-
G0RIM5_HYPJQ/574-741-------------------------------------------------------------------------YRR--V-
Q22N58_TETTS/494-660-------------------------------------------------------------------------.HK--I-
A9UVU8_MONBE/587-772-------------------------------------------------------------------------.PA--L-
J4URQ4_BEAB2/478-645-------------------------------------------------------------------------YVA--V-
G4NA23_MAGO7/558-749-------------------------------------------------------------------------RNA--C-

PF13403

Q1GGP9_RUEST/27-173-------------------------------------------------------------------------.TG..I.
Q1GES6_RUEST/157-304-------------------------------------------------------------------------.HT..I.
A1AYR4_PARDP/380-527-------------------------------------------------------------------------.DG..I.
A8LN65_DINSH/175-322-------------------------------------------------------------------------.DT..I.
A1B4V8_PARDP/356-503-------------------------------------------------------------------------.EG..F.
A8LKN9_DINSH/122-260-------------------------------------------------------------------------.HS..V.
Q28WJ0_JANSC/241-379-------------------------------------------------------------------------.DS..I.
Q5LPM0_RUEPO/507-646-------------------------------------------------------------------------.PA..A.
Q28L14_JANSC/1268-1415-------------------------------------------------------------------------.PG..V.
Q1GGN0_RUEST/194-341-------------------------------------------------------------------------.TS..V.
Q5LSZ7_RUEPO/803-941-------------------------------------------------------------------------.RA..I.
Q5LPJ7_RUEPO/175-322-------------------------------------------------------------------------.DT..I.
Q1GMQ5_RUEST/293-432-------------------------------------------------------------------------.DS..I.
Q5LLZ7_RUEPO/144-282-------------------------------------------------------------------------.ST..I.
A8LR09_DINSH/158-296-------------------------------------------------------------------------.PG..V.
C7JHN5_ACEP3/423-565-------------------------------------------------------------------------.VS..IF
Q28SX3_JANSC/168-306-------------------------------------------------------------------------.PG..V.
A8LK48_DINSH/203-343-------------------------------------------------------------------------.GG..V.
Q5LMP8_RUEPO/160-307-------------------------------------------------------------------------.HG..I.
Q28UB5_JANSC/126-273-------------------------------------------------------------------------.DR..I.
Q1GMV1_RUEST/833-976-------------------------------------------------------------------------.HV..H.
A5FZD4_ACICJ/193-329-------------------------------------------------------------------------.TM..I.
B9JK11_AGRRK/201-336-------------------------------------------------------------------------.TT..I.
Q28TH9_JANSC/752-887-------------------------------------------------------------------------.RG..VG
A5G1S8_ACICJ/159-294-------------------------------------------------------------------------.MT..I.
B0T7Q3_CAUSK/153-288-------------------------------------------------------------------------.AT..I.
C7JE32_ACEP3/536-676-------------------------------------------------------------------------.MT..IS
B8IA31_METNO/149-285-------------------------------------------------------------------------.VT..I.
A5G006_ACICJ/174-309-------------------------------------------------------------------------.RS..I.
A5FW80_ACICJ/285-421-------------------------------------------------------------------------.AT..I.
A8LLK3_DINSH/164-305-------------------------------------------------------------------------.AG..V.
Q5FQG8_GLUOX/285-425-------------------------------------------------------------------------.MS..IA
B0UJT1_METS4/116-254-------------------------------------------------------------------------.ST..V.
Q5LUZ7_RUEPO/68-216-------------------------------------------------------------------------.MG..II
Q0BS96_GRABC/3687-3823-------------------------------------------------------------------------.VS..I.
B1M2P7_METRJ/65-199-------------------------------------------------------------------------.TS..I.
A5FVL4_ACICJ/410-545-------------------------------------------------------------------------.LS..I.
A4YQ57_BRASO/106-246-------------------------------------------------------------------------.AT..I.
A5FWA2_ACICJ/1192-1328-------------------------------------------------------------------------.AT..I.
C3KQV1_RHISN/76-214-------------------------------------------------------------------------.TS..I.
A8LKB8_DINSH/19-167-------------------------------------------------------------------------FDE..I.
Q5LN78_RUEPO/204-343-------------------------------------------------------------------------.HS..V.
C5AQV5_METEA/69-209-------------------------------------------------------------------------.TS..V.
D5AV22_RHOCB/442-581-------------------------------------------------------------------------.NDPRF.
Q2YL23_BRUA2/15-148-------------------------------------------------------------------------.RS..I.
Q3J294_RHOS4/14-159-------------------------------------------------------------------------.RG..I.

PF05203

U7Q1H8_SPOS1/262-759KKGFTGIGDETI.......FLRSSGTFAGAGKRKPLN..........TGNVFWAVANAMGVRGPDGQ.....HAKV--VP
Q6FQS3_CANGA/285-698......RRTQSIPLMENGKHVGNANITAEQEIEETMEVL.....SLNVTNHSSKLFHDLALSMINQD.....GSRS--IP
A3LP04_PICST/283-730........DATI.......SLHNSETRGKN.VRQNLN..........TGNLLWSLLAEICGKKENEM.....LFKS--VP
J7RJ26_KAZNA/284-757SVVFEDDVC..........TKHDGNSAQSLQVTMDIDDLAI.SLTGELGNILDRIVKSFGVRVAKEGNS.DLFERT--VP
C5M9I6_CANTT/244-713DEFTDAMDELTI.......NVHGAAASK...................KNNLLWNALKSLGFRAKSTD.....IVKS--IP
Q6CL64_KLULA/284-692...................SIVISQEPVQENKRRKVA..........QVSLVSKIVQE........S.....FSSG--IP
B6JY11_SCHJY/285-759.LGVDGTFTSEVEDLVEVVDFQEGSEIPAWEQRGNLSVSF....EGNTDNVFWKLISDLGFSGA.........VKS--IP
Q6BRM0_DEBHA/283-675...............................................TVDFLWDVINSMSFKVEGKS......GKA--IP
A5DXZ0_LODEL/280-699...................SIHSVNEKESVN................VARLLKQALDHFGFSTGS........NKV--IP
H2APW1_KAZAF/284-774LDKSSVQPF..........DIHSTPSESKNNLLLSLES.......EDKGAFFNKLVDTLHLRVKSSNANGSSYVKN--VP
G7E5L8_MIXOS/284-742......RVQENV........AHSAATADDQKLHRDLHIKIVADGGETSHNVFWTTLSENGFRGASAK.....EPKA--VP
F2TVI8_SALR5/1497-1695.........................................................................YTQ--LP
U9UGV8_RHIID/409-843...................ELHKAKLDDSEWKISFMSD.......NDIENGFYVLLQTLDILDT.........KKV--TP
C5DTL5_ZYGRC/284-732........AKTV.......NLYAKAIRDEG.VRKNLD..........THNLLWDAIVDLGYLKDD........SKN--VP
G8JWX2_ERECY/284-671........RLSL...................................KNSIMADVIAKFGFTNAG........EKT--IP
A7TLB5_VANPO/284-715........VGNV.......NFYGNSTSTNQN................VDNLLWDAIQELGFIQDG........NKT--VP
VATA_YEAST/284-736........AKTV.......NLYSKVVRGNG.IRNNLN..........TENPLWDAIVGLGFLKDG........VKN--IP
M3K3J1_CANMX/284-733........DATI.......SLHNHEKRANGVVRRNQN..........TDNLFWTLLGDM.FESDGKK.....LIKT--VP
G0V8Z3_NAUCC/284-799ISPASLVTDLSV.......TLRGTGIGGAG.VSKERN..........LNNIFWDIVTSFGVRTNGQGS...TYEKS--VP
C5DTQ4_ZYGRC/1-463........AKHV.......KLFYGSECDGHRRNRHLR..........KNNPFWNCVVNLKFKRELDG......EKQ--IP
G0W3J0_NAUDC/284-783SSGCKASSEMTV.......ALGAPLVRGNA.IRQLLT..........ENNVFLKLIESFGVRKEN.GS...EYVKA--IP
G8ZLC3_TORDC/1-463........AKHT.......RLYFGQEPDGNRRNRNLR..........KDNPFWNAVINLKFKRDLDG......EKQ--VP
G8BNB8_TETPH/284-799GNGSLECTDLSV.......ILRDSVANQAKR................ENNPFWNFVESLCVKSKNIPSLNESFEKH--IP

PF07591

A3DGR7_CLOTH/105-234------------------------------------------------------------------------------TD
Q5F6G7_NEIG1/1-137------------------------------------------------------------------------------.P
Q9K122_NEIMB/1-137------------------------------------------------------------------------------.Q

PF10596

I3L3Z8_HUMAN/86-244-------------------------------------------------------------------------LDL--TG
A2EY65_TRIVA/1432-1590-------------------------------------------------------------------------LDL--TG
A8BTS5_GIAIC/1337-1490-------------------------------------------------------------------------IDL--TG
S3BP74_OPHP1/1452-1610-------------------------------------------------------------------------LDL--TG
Q8SVU6_ENCCU/1239-1384-------------------------------------------------------------------------LDQ--TG
Q5KPW2_CRYNJ/1640-1796-------------------------------------------------------------------------LDL--TG
K7VI98_MAIZE/675-841-------------------------------------------------------------------------LD.--..
G0W883_NAUDC/1515-1673-------------------------------------------------------------------------LDL--TG
E6ZWZ5_SPORE/1485-1643-------------------------------------------------------------------------LDL--CG
E9AFM0_LEIMA/1514-1674-------------------------------------------------------------------------VET--TG
R0KWQ9_NOSB1/1205-1354-------------------------------------------------------------------------LEP--TG

PF01079

Q7PXI1_ANOGA/295-503AS------------------------CYALIDSQT----VAHWS--------------------F---------------
HH_DROPS/255-475AS------------------------CYAVIDSQS----LAHWG--------------------L---------------
IHH_DANRE/187-398TS------------------------CYAAVNRQR----LAHWA--------------------F---------------
TWHH_DANRE/190-403AS------------------------CYAVIENHK----WAHWA--------------------F---------------
WRT4_CAEEL/327-547AS------------------------CHSETDNYS----LQNTF--------------------F---------------
Q80XI9_MOUSE/230-435AS------------------------CFAAVADHH----LAQLA--------------------F---------------
WRT6_CAEEL/375-583AS------------------------CHSNLALKS----LQQTF--------------------F---------------
A8X447_CAEBR/327-545TS------------------------CHSETDNHT----LQDTF--------------------F---------------
IHH_CHICK/188-394AS------------------------CFALVREQQ----LAQMA--------------------F---------------
SHH_CHICK/190-411AS------------------------CYAVIEEHS----WAHWA--------------------F---------------
SHH_DANRE/187-404AS------------------------CYAVIEDQG----LAHLA--------------------F---------------
WRT8_CAEEL/325-538TS------------------------CHSEIDHHL----LQNSF--------------------F---------------
DHH_HUMAN/188-396AS------------------------CYAVLESHQ----WAHRA--------------------F---------------
Q175B3_AEDAE/201-412AS------------------------CYALIDSQS----VAHLS--------------------F---------------
O45992_CAEEL/258-471TS------------------------CHSEVDHHI----LQNSF--------------------F---------------
B0S8K0_DANRE/187-399SS------------------------CYAAVDQHW----LAHWA--------------------F---------------
B3DJ46_DANRE/191-442AS------------------------NYATFQDHG----LAHTV--------------------F---------------
HH_DROMO/248-470AS------------------------CYAVISSQS----LAHWG--------------------L---------------
C3ZGW9_BRAFL/224-434MS------------------------CYALIESQA----LAHWV--------------------F---------------
D6WCL7_TRICA/146-345AS------------------------CYATIDSQW----LAHWA--------------------F---------------
F6WZB6_XENTR/191-398VS------------------------CFALVQKQR----LAQMV--------------------Y---------------
F6XBS5_CIOIN/294-549AS------------------------CYAVIESDV----IAHTV--------------------V---------------
F6YTG6_XENTR/190-394TS------------------------CYATVESHT----LAHAS--------------------L---------------
G3V6T0_RAT/188-423AS------------------------CYAVIEEHS----WAHRA--------------------F---------------
H2U1Q8_TAKRU/190-435AS------------------------SYALVEDHR----LAHWA--------------------F---------------
H2V9H2_TAKRU/190-402AS------------------------CYAVIEDHD----LAHWA--------------------L---------------
H2XUY9_CIOIN/97-305AS------------------------CYGVIGSET----LAHAA--------------------M---------------
W4Y925_STRPU/189-401VS------------------------SYAVMRDEW----IAHAS--------------------F---------------
W5K3H2_ASTMX/187-406AS------------------------CYAVIQDHW----LAHWA--------------------F---------------

PF14890

M1MZU7_9CORY/77-375............................NLEIMEK----GEHSR--------------------Y....HRRVGHSFDNT
E3GYR2_METFV/39-446LLLYKFDIASINEN............NGTLCITGK----SSLTR--------------------F.....KKIGFSDINK
NDRZ_PYRFU/306-755HYLNALGIKARIREKLRKDGI.....DYVLHVEEY----SSLLR--------------------F....YELIGKNLQNE
D0MK11_RHOM4/430-853SLLLRLGINARLKTVAQGEKGRV...QYHVKVSGR----EDLLR--------------------F....VEKIGA..VGA
Q5JJ43_THEKO/306-755YYLNSLGIKARMRKKPRKDGV.....DYVMHVEEY----SSLLR--------------------F....YELIGKNLQNS
RGYR_METJA/871-1360IYLNSIGILNTLHKSRE.........VYSLIISNK----.SLET--------------------F....KEKIAK.YLKI
K9VL64_9CYAN/809-1233SLLLRLGINARLFLSPQPGKGRD...QHQVWVTGR----PDLDK--------------------F....IHLIGA..VGN
DNAB_SYNY3/385-809SLLLKLGINARLSKISQNGKGRD...NYHVTITGQ----ADLQI--------------------F....VDQIGA..VDK
B8HS23_CYAP4/785-1209SLLLRLSINGRLLVSSQAGKGRD...QYHVWVSGK----SDIEK--------------------F....VQQVGA..VGQ
K9QGP4_9NOSO/889-1313TLLLRLGINAKLKIIPQIGKGRN...QYHVTITGK----PDLEL--------------------F....IQKVRA..VGE
B2IVH9_NOSP7/393-817TLLLRLGINATLRTVPQVGKGRN...QYHVIITGK----PDLQL--------------------F....IVHVGA..VGQ
H3ZL75_THELN/500-1032FLLNSLGISSV........KIGFDSGVYRVYINED----LQFPQ--------------------T....SREKNTYYSNL
D2RI62_ARCPA/834-1317YYLHSIGILNTLHEDKRNG.......VWTLIVSNR----.SLKT--------------------F....KEKIGK.YLRI
Y832_METJA/1064-1591LALKILGINYRLSIDKKSKVNENWRDCYVIKITGK----ENIEK--------------------LLDVEIKNNGGKDVIP
DPOL_THEKO/857-1388LLLNSVGVSAV........KLGHDSGVYRVYINEE----LPFVK--------------------L....DKKKNAYYSHV

PF14623

F2SQT7_TRIRC/282-454---------------------------------SR--K-LELL.--------------------P----KLP--------
E9EQB7_METRA/537-702---------------------------------GK--S-LAQL.--------------------G----VDK--------
Q237Q6_TETTS/509-673---------------------------------SR--D-LMWMK--------------------G----YFK--------
Q7S708_NEUCR/636-832---------------------------------LR--S-LERL.--------------------Q----SSP--------
H6C7V0_EXODN/356-526---------------------------------AL--G-LLQL.--------------------P----KGG--------
J3PIM9_GAGT3/593-786---------------------------------AA--E-MARLP--------------------R----GGR--------
G2XFI4_VERDV/568-734---------------------------------AK--S-LKQI.--------------------G----IRK--------
G1XIH1_ARTOA/537-708---------------------------------FD--G-LRELK--------------------G----FYE--------
U7PS73_SPOS1/521-692---------------------------------CR--S-MATL.--------------------D----VRK--------
C7YL43_NECH7/586-752---------------------------------GK--S-LLAL.--------------------G----RRR--------
R8BIW3_TOGMI/471-637---------------------------------VR--S-LKGL.--------------------R----LDH--------
C5GK44_AJEDR/553-713---------------------------------AR--S-LASL.--------------------P----RDV--------
S8AB86_DACHA/542-713---------------------------------FD--G-LRELK--------------------G----FYE--------
S3CBE6_OPHP1/613-780---------------------------------SR--S-LDTL.--------------------D----VRK--------
G3JM09_CORMM/336-505---------------------------------CE--K-MAVL.--------------------.----RPV--------
C5FLY1_ARTOC/540-711---------------------------------SK--K-LELL.--------------------P----KLS--------
F0UB99_AJEC8/548-714---------------------------------VR--S-LASL.--------------------P----RDV--------
G0QP70_ICHMG/545-705---------------------------------IS--D-LKKLK--------------------G----FQN--------
I7M030_TETTS/514-676---------------------------------VE--D-LKQMK--------------------G----WKE--------
M7TBR0_EUTLA/533-699---------------------------------IK--S-LDSL.--------------------S----SGR--------
C1G4L4_PARBD/546-712---------------------------------VR--S-LASL.--------------------P----RDT--------
N4VVV8_COLOR/552-719---------------------------------AR--S-LRRI.--------------------G----VRA--------
Q24C76_TETTS/502-665---------------------------------IN--D-LMNMK--------------------G----WKE--------
D2VHB8_NAEGR/586-749---------------------------------VK--D-LSSMK--------------------G----YDL--------
G9MP19_HYPVG/551-718---------------------------------RI--G-LMKLE--------------------E----AGR--------
T0JQ14_COLGC/569-736---------------------------------VR--S-LRRI.--------------------G----VRR--------
J4WBA6_BEAB2/688-856---------------------------------CD--K-IAVL.--------------------.----RRI--------
I7M701_TETTS/604-769---------------------------------IT--E-LKKMI--------------------G----WEN--------
F7VWE7_SORMK/571-774---------------------------------VQ--S-LAKL.--------------------Q----CNQ--------
L8X395_THACA/606-772---------------------------------VE--S-LSQLD--------------------G----YYD--------
E4UR10_ARTGP/540-711---------------------------------IK--Q-LELL.--------------------P----KLP--------
Q2GTB7_CHAGB/570-754---------------------------------SK--A-LARL.--------------------P----QRA--------
E3QU32_COLGM/508-676---------------------------------AG--D-LRAV.--------------------G----VGR--------
G0RIM5_HYPJQ/574-741---------------------------------KS--G-LMKLD--------------------S----AGR--------
Q22N58_TETTS/494-660---------------------------------VD--D-LSNLQ--------------------G----FRE--------
A9UVU8_MONBE/587-772---------------------------------RD--R-VALLA--------------------A----RAG--------
J4URQ4_BEAB2/478-645---------------------------------SK--A-LLGL.--------------------R----VGL--------
G4NA23_MAGO7/558-749---------------------------------LG--A-LATL.--------------------P----APK--------

PF13403

Q1GGP9_RUEST/27-173D.------------------------AI...V.TT..A.VTYIH--------------------F----MFN--------
Q1GES6_RUEST/157-304DV------------------------DT...T.VR..E.VTYVH--------------------L----LLE--------
A1AYR4_PARDP/380-527EV------------------------VE...D.MQ..E.VEYWH--------------------F----MFD--------
A8LN65_DINSH/175-322V.------------------------QV..YD.LE..P.VTYHH--------------------F----MFD--------
A1B4V8_PARDP/356-503DI------------------------AN...D.LQ..E.VEYFH--------------------M----LFD--------
A8LKN9_DINSH/122-260V.------------------------QA...P.RA..R.VTYIH--------------------L----LFA--------
Q28WJ0_JANSC/241-379Y.------------------------RD...P.RE..L.VTYFH--------------------V----MFD--------
Q5LPM0_RUEPO/507-646R.------------------------RV...E.GG..L.VTYMH--------------------L----MLD--------
Q28L14_JANSC/1268-1415EV------------------------VK...T.CE..R.VTYIH--------------------V----MCD--------
Q1GGN0_RUEST/194-341RQ------------------------DQ...S.GM..P.VTYVH--------------------L----MFD--------
Q5LSZ7_RUEPO/803-941V.------------------------QE...P.PG..R.VDYYH--------------------M----LFD--------
Q5LPJ7_RUEPO/175-322R.------------------------QC..RP.NR..A.VTYYH--------------------L----AFE--------
Q1GMQ5_RUEST/293-432RI------------------------LS...D.GT..Q.VCYVH--------------------I----LFD--------
Q5LLZ7_RUEPO/144-282R.------------------------IA...P.RH..K.LTYYH--------------------L----LFA--------
A8LR09_DINSH/158-296R.------------------------RV...P.KA..Q.VRYCH--------------------F----LCE--------
C7JHN5_ACEP3/423-565Y.------------------------DT...S.IT..S.YDYYH--------------------V----ETE--------
Q28SX3_JANSC/168-306R.------------------------VA...E.GG..E.VTYFH--------------------V----LLD--------
A8LK48_DINSH/203-343RV------------------------MQ...G.CR..K.ITYVH--------------------L----VFD--------
Q5LMP8_RUEPO/160-307A.------------------------LR...PATG..P.VRYIH--------------------F----ALD--------
Q28UB5_JANSC/126-273D.------------------------VE...PMPR..A.VDYVH--------------------I----LLD--------
Q1GMV1_RUEST/833-976A.------------------------EE...R.AS..G.VCYIH--------------------L----MTE--------
A5FZD4_ACICJ/193-329AP------------------------DR...R.IS..R.VTYFH--------------------V----ELD--------
B9JK11_AGRRK/201-336T.------------------------QE...TVLE..P.FEYYH--------------------I----ELE--------
Q28TH9_JANSC/752-887L.------------------------LR...P.EE..G.VTYIH--------------------L----LFE--------
A5G1S8_ACICJ/159-294R.------------------------QV...E.RR..S.VTYYH--------------------V----ELP--------
B0T7Q3_CAUSK/153-288V.------------------------QE...P.VE..T.VRYFH--------------------I----ELD--------
C7JE32_ACEP3/536-676Y.------------------------AH...E.IR..S.YKCYH--------------------I----ETR--------
B8IA31_METNO/149-285TT------------------------AE...R.VD..S.VEYWH--------------------V----ELD--------
A5G006_ACICJ/174-309V.------------------------QE...Q.RR..S.FTYYH--------------------I----ELE--------
A5FW80_ACICJ/285-421TQ------------------------DE...A.CL..A.ITYYH--------------------V----ELA--------
A8LLK3_DINSH/164-305EV------------------------AG...P.TR..H.ISYHH--------------------L----LFA--------
Q5FQG8_GLUOX/285-425Y.------------------------DH...S.IT..D.YDYYH--------------------I----ETE--------
B0UJT1_METS4/116-254T.------------------------QE...E.VE..E.VTYWH--------------------V----ELD--------
Q5LUZ7_RUEPO/68-216E.------------------------TA...P.PT..P.IEVFH--------------------I----CLR--------
Q0BS96_GRABC/3687-3823VQ------------------------EQ...H.VE..T.VSYVH--------------------I----ELD--------
B1M2P7_METRJ/65-199T.------------------------RG...EVVT..D.LTYWH--------------------V----ELD--------
A5FVL4_ACICJ/410-545R.------------------------QV...T.VP..T.VTYYH--------------------V----ELE--------
A4YQ57_BRASO/106-246T.------------------------ID...P.ASEKEVLEFFH--------------------V----KLA--------
A5FWA2_ACICJ/1192-1328LH------------------------DS...S.RF..A.VTYYH--------------------V----ELA--------
C3KQV1_RHISN/76-214T.------------------------PALPDA.RD..T.IEYFH--------------------I----VLD--------
A8LKB8_DINSH/19-167FV------------------------DM...S.AN..G.AIYHG--------------------L----VFD--------
Q5LN78_RUEPO/204-343L.------------------------PA...R.AR.LT.ATYAQ--------------------L----LLP--------
C5AQV5_METEA/69-209F.------------------------RE...P.AT..Q.VTYWH--------------------I----ELD--------
D5AV22_RHOCB/442-581RI------------------------AR...G.KR..R.VSYHH--------------------I----LLE--------
Q2YL23_BRUA2/15-148M.------------------------RI...PVER..T.LDYYN--------------------I----VLD--------
Q3J294_RHOS4/14-159R.------------------------EV...E.CS..G.TTYLH--------------------L----MFD--------

PF05203

U7Q1H8_SPOS1/262-759DV------------------------LMCEPFEVR----EQFLA--------------------G----LID.SDGHVKH
Q6FQS3_CANGA/285-698SA------------------------FTHEQLCVR----ESFVA--------------------G----ILD.MQGC...
A3LP04_PICST/283-730SF------------------------LRSESIAVR----EYFIS--------------------G----LVD.SDGHVKR
J7RJ26_KAZNA/284-757KH------------------------LASDDLAVR----ENFIA--------------------G----LVD.SIGYVDR
C5M9I6_CANTT/244-713QH------------------------IAVDDIVVR----ESLIA--------------------G----LVD.AAGNVET
Q6CL64_KLULA/284-692SF------------------------MMSENINVR----ESFLA--------------------G----IVD.SQNQKLD
B6JY11_SCHJY/285-759SH------------------------FAYESFPVR----EAFLA--------------------G----LID.ADGSVKH
Q6BRM0_DEBHA/283-675SF------------------------LRTESFEVR----EQFLA--------------------G----LID.SDGIVTK
A5DXZ0_LODEL/280-699SS------------------------IAVENIEVR----ESFLA--------------------G----FVDASQTELKQ
H2APW1_KAZAF/284-774LD------------------------LSSDDIVIR----EQFLA--------------------G----LLD.SRKC...
G7E5L8_MIXOS/284-742SW------------------------VASEPFGVR----EAFVA--------------------G----MVD.SAGQVKA
F2TVI8_SALR5/1497-1695EA------------------------VQSNLLMYR----QVV..--------------------.----...........
U9UGV8_RHIID/409-843VI------------------------MTDELDQVR----LPLLA--------------------G----ILD.ISSHLLE
C5DTL5_ZYGRC/284-732GY------------------------ICSDSFQHR----EVFLA--------------------G----IID.STGYVSD
G8JWX2_ERECY/284-671SF------------------------LRSESITSR----ECFLA--------------------G----LVD.AAGSVNE
A7TLB5_VANPO/284-715SF------------------------LSSDLIEIR----ETFLA--------------------G----LID.SNGSVDN
VATA_YEAST/284-736SF------------------------LSTDNIGTR----ETFLA--------------------G----LID.SDGYVTD
M3K3J1_CANMX/284-733SF------------------------LRAETIAVR----EQFLA--------------------G----LVD.ADGHVKK
G0V8Z3_NAUCC/284-799LH------------------------LSYDDIEVR----EQFIA--------------------G----LID.SDGYVKS
C5DTQ4_ZYGRC/1-463SF------------------------MWTEDLEVR----EAFLA--------------------G----LID.SDGYVSK
G0W3J0_NAUDC/284-783MH------------------------LSYDDIEVR----EQFIA--------------------G----LVD.SIGHVK.
G8ZLC3_TORDC/1-463SF------------------------MWTEDIEVR----EAFLA--------------------G----LID.SDGYVVK
G8BNB8_TETPH/284-799FE------------------------LSYDNMEVR----EQFIA--------------------G----LID.ATGSVKK

PF07591

A3DGR7_CLOTH/105-234EP------------------------AKVYNFKVD--DFHTYH-------------------------------------
Q5F6G7_NEIG1/1-137KP------------------------LKAYNLTVA--DWHTYF-------------------------------------
Q9K122_NEIMB/1-137QP------------------------LKAYNLTVA--DWHTYF-------------------------------------

PF10596

I3L3Z8_HUMAN/86-244IF------------------------MHGKIPTLK----ISLIQ....................I----F----------
A2EY65_TRIVA/1432-1590IF------------------------MHGKIPSLK----VSLIQ....................L----F----------
A8BTS5_GIAIC/1337-1490VY------------------------MCGKLATLK----TAYVS....................L----F----------
S3BP74_OPHP1/1452-1610IF------------------------LQAKLPTLK----ISFVQ....................I----F----------
Q8SVU6_ENCCU/1239-1384IL------------------------MHGKLPTLK----ISFIQ....................I----F----------
Q5KPW2_CRYNJ/1640-1796VF------------------------MHGKIPTLK----ISLIQ....................I----F----------
K7VI98_MAIZE/675-841..------------------------......ALE----IETVQKETIHPRKSYKMNSFCADILL----F----------
G0W883_NAUDC/1515-1673IF------------------------LHGKIPTLK----ISLVQ....................I----F----------
E6ZWZ5_SPORE/1485-1643VL------------------------MSGKMPSLK----ISYIQ....................L----F----------
E9AFM0_LEIMA/1514-1674VF------------------------MCGKLETIK----KSLIK....................I----F----------
R0KWQ9_NOSB1/1205-1354VV------------------------MHGKLPTLK----MSYLG....................I----F----------

PF01079

Q7PXI1_ANOGA/295-503------------------------LPY.RLAEK.........................VSALFDR...............
HH_DROPS/255-475------------------------APM.RILAM.........................LQSWMPAKDQL...........
IHH_DANRE/187-398------------------------APL.RLLYS.........................WTG...................
TWHH_DANRE/190-403------------------------APV.RLCHK.........................LMTWLFP...............
WRT4_CAEEL/327-547------------------------TNVLRWKSQ.........................IRNYFWT...............
Q80XI9_MOUSE/230-435------------------------WPL.RLFPS.........................LAWGSWT...............
WRT6_CAEEL/375-583------------------------SLYKRTSSV.........................FHNLMFF...............
A8X447_CAEBR/327-545------------------------ANALHFKNL.........................LMKFFGT...............
IHH_CHICK/188-394------------------------WPL.RLYHS.........................LLGGPGV...............
SHH_CHICK/190-411------------------------APF.RLAQG.........................LLAALCPD..............
SHH_DANRE/187-404------------------------APA.RLYYY.........................VSSFLFPQ..............
WRT8_CAEEL/325-538------------------------KHVLKLKNR.........................ISKYFWN...............
DHH_HUMAN/188-396------------------------APL.RLLHA.........................LGALLPG...............
Q175B3_AEDAE/201-412------------------------LPY.RAVQK.........................IMNLFRSS..............
O45992_CAEEL/258-471------------------------KHVLKWKNK.........................ITKYFWS...............
B0S8K0_DANRE/187-399------------------------GPL.RVLYN.........................WGGPVGH...............
B3DJ46_DANRE/191-442------------------------WPF.RVLFVFFNKEMEEDLQRVAVPYICSTNQTILTSVMHSRLSSVF.........
HH_DROMO/248-470------------------------APM.RLWST.........................LQSWMPAKGQLR..........
C3ZGW9_BRAFL/224-434------------------------APF.RLYYQ.........................LTSSLWD...............
D6WCL7_TRICA/146-345------------------------API.RWVAK.........................LWDSGLR...............
F6WZB6_XENTR/191-398------------------------WPL.RVLYN.........................LGIMAGT...............
F6XBS5_CIOIN/294-549------------------------SPF.RYYHW.........................LSLWFNGDSK............
F6YTG6_XENTR/190-394------------------------APL.RLFKG.........................IASMLPD...............
G3V6T0_RAT/188-423------------------------APF.RLAHA.........................LLAALAPARTDGGGG.......
H2U1Q8_TAKRU/190-435------------------------GPV.RLLSS.........................VSQLLWAEPEERSDGSKTPLQP
H2V9H2_TAKRU/190-402------------------------APV.RLAHW.........................VSSLLSR...............
H2XUY9_CIOIN/97-305------------------------LPI.RSFPY.........................LRRTNSD...............
W4Y925_STRPU/189-401------------------------APV.RWYSY.........................IRHNMLG...............
W5K3H2_ASTMX/187-406------------------------APV.RLAHS.........................LSSLLLPQ..............

PF14890

M1MZU7_9CORY/77-375S........................PEFQELRM-------------------------AGIRRRAEDPAK....RERMVE
E3GYR2_METFV/39-446KKE......FNKLLKKNIDSKIDHIPVSREISE-------------------------IINE..................
NDRZ_PYRFU/306-755EKREKLEKVLSNHKGGNFGLPLNFNAFKEWASE-------------------------YGVEFKTNGSQTIAIINDERIS
D0MK11_RHOM4/430-853RQRAALASVYDYLSVRTGNPNRDIIPVALWYEL-------------------------VREAMYQRGISH....RQLHAN
Q5JJ43_THEKO/306-755EKRIKLEELLSKHNGGSFGLTLSFEDFKAWSSK-------------------------YGVEFKTNGSQTLAIIKNEKVS
RGYR_METJA/871-1360RKEAFINGYKTYKKEHEERFECDLLPVKEVFKK-------------------------LTFEKGRKEIL.....KDSKIH
K9VL64_9CYAN/809-1233YKQQALTEIAEYIEIRSSNTNRDVIPRDVWKMY-------------------------AVPAMQQFGLTT....RQMQAQ
DNAB_SYNY3/385-809DKQASVEEIKTHIAQHQANTNRDVIPKQIWKTY-------------------------VLPQIQIKGITT....RDLQMR
B8HS23_CYAP4/785-1209YKTASLEEVKTRLEASVANTNRDIIPYTVWRSC-------------------------AVPAMQRLGITG....REMQKA
K9QGP4_9NOSO/889-1313YKLGSLQQIAQHLENSIHNPNRDVIPKDVWKTL-------------------------VIPAMPSVSLTT....RLLHSS
B2IVH9_NOSP7/393-817YKLRSLQDIFQHLENSIHNPNRDIIPKDIWKME-------------------------VVPAMQAIGFTT....RILQAS
H3ZL75_THELN/500-1032IPKEILRDVFGKEFQKN................-------------------------......................
D2RI62_ARCPA/834-1317KKERFERAYEVYTNEHK.QFESDLVPFGKLFKL-------------------------LKFKRGIKNKVL....KEFGID
Y832_METJA/1064-1591KIAEKFKEIINQYSQREWK..............-------------------------................ERFGID
DPOL_THEKO/857-1388IPKEVLSEVFGKVFQKN................-------------------------......................

PF14623

F2SQT7_TRIRC/282-454-----------------------.NGLL.HSIG-------------------------.VERSPESGRICG---------
E9EQB7_METRA/537-702-----------------------.LGVV.EGRG-------------------------.VDRD.GSGLVCG---------
Q237Q6_TETTS/509-673-----------------------.GHVK.LQNS-------------------------PSIRDQATGLVVG---------
Q7S708_NEUCR/636-832-----------------------.DGLI.LGEG-------------------------.VDRDLQTGLVKG---------
H6C7V0_EXODN/356-526-----------------------.SGHF.RCSG-------------------------.VKRDPVSGLVCG---------
J3PIM9_GAGT3/593-786-----------------------.DGVV.LCGG-------------------------.VRRSRVTGRT..---------
G2XFI4_VERDV/568-734-----------------------.GGIV.LGGG-------------------------.TRRDEKTGLVNG---------
G1XIH1_ARTOA/537-708-----------------------.DGVC.ECEG-------------------------.VLRDAETGLIKG---------
U7PS73_SPOS1/521-692-----------------------.DGLV.VNGG-------------------------.SSRS.......N---------
C7YL43_NECH7/586-752-----------------------.HGVV.IGGG-------------------------.VERDQETGLVRG---------
R8BIW3_TOGMI/471-637-----------------------.NGVA.LGGG-------------------------.VKRSKSNGLVCG---------
C5GK44_AJEDR/553-713-----------------------.NGVL.RCSG-------------------------EIRKN.......G---------
S8AB86_DACHA/542-713-----------------------.DGVC.ECEG-------------------------.IVRDAETGLIKG---------
S3CBE6_OPHP1/613-780-----------------------.DGLV.INGG-------------------------.STR........G---------
G3JM09_CORMM/336-505-----------------------.AGAY.QCYG-------------------------.VTRDQRTGLVNG---------
C5FLY1_ARTOC/540-711-----------------------.NGLL.HCIG-------------------------.VQRSPESGRVCG---------
F0UB99_AJEC8/548-714-----------------------.NGIL.RCSG-------------------------.MKRNPLTGLACG---------
G0QP70_ICHMG/545-705-----------------------.GFVE.IYNK-------------------------QFLRDQFSQK...---------
I7M030_TETTS/514-676-----------------------.GKVI.IRSR-------------------------..VRDQITNQVK.---------
M7TBR0_EUTLA/533-699-----------------------.NGTK.ECRG-------------------------.VWRDKVTGLICG---------
C1G4L4_PARBD/546-712-----------------------.NGRL.RCSG-------------------------.MKRNSLTGLACG---------
N4VVV8_COLOR/552-719-----------------------.DGIA.VGGG-------------------------.VSRHVGTGLVRG---------
Q24C76_TETTS/502-665-----------------------.GKVL.ITAR-------------------------..IKSEITGKVT.---------
D2VHB8_NAEGR/586-749-----------------------.GMIE.MNKY-------------------------DLKRDPNTKMII.---------
G9MP19_HYPVG/551-718-----------------------.KGVV.KGGG-------------------------.VDRDPMTGLVRG---------
T0JQ14_COLGC/569-736-----------------------.NGVA.TGGG-------------------------.VSRNSRTGLVRG---------
J4WBA6_BEAB2/688-856-----------------------.NGAY.QCYG-------------------------.VTRDRKTGLVNG---------
I7M701_TETTS/604-769-----------------------.GYVT.LSTD-------------------------CMIRDPTTTLVIG---------
F7VWE7_SORMK/571-774-----------------------.DGLV.MGGG-------------------------.VKRDGQTGLVNG---------
L8X395_THACA/606-772-----------------------KSGVV.DCAG-------------------------.VVRQYRVGIVCG---------
E4UR10_ARTGP/540-711-----------------------.NGLL.HCVG-------------------------.VERSPESGRICG---------
Q2GTB7_CHAGB/570-754-----------------------.GGVA.MGAG-------------------------.LTRDPVTGKVIG---------
E3QU32_COLGM/508-676-----------------------.NGVV.VGRG-------------------------.VVRNPGTGLVRG---------
G0RIM5_HYPJQ/574-741-----------------------.KGVV.QGRG-------------------------.IERDAMTGLVRG---------
Q22N58_TETTS/494-660-----------------------.GYVI.VNQQ-------------------------QTKRDKLTHEVIG---------
A9UVU8_MONBE/587-772-----------------------TARTLWLAPQ-------------------------AFVRDTATGLVKD---------
J4URQ4_BEAB2/478-645-----------------------.RGEF.IGGD-------------------------.VGRDTQSGLVC.---------
G4NA23_MAGO7/558-749-----------------------.NGVA.TSAG-------------------------.VLRD.ATGRVIG---------

PF13403

Q1GGP9_RUEST/27-173-----------------------QHEVV-LSDG-------------------------AWTESFQPVD------------
Q1GES6_RUEST/157-304-----------------------QHQVI-WANG-------------------------VETESFHPAH------------
A1AYR4_PARDP/380-527-----------------------RHEVV-FSNG-------------------------APTESLFTGP------------
A8LN65_DINSH/175-322-----------------------RHQIV-RADG-------------------------IWAESLRPGP------------
A1B4V8_PARDP/356-503-----------------------RHEVV-LSNG-------------------------AETESLYTGA------------
A8LKN9_DINSH/122-260-----------------------RHEIV-YAEG-------------------------IPSESFHPGM------------
Q28WJ0_JANSC/241-379-----------------------AHQII-LAEG-------------------------TWAESLYIGD------------
Q5LPM0_RUEPO/507-646-----------------------RHEVI-YAND-------------------------AATESFFPGD------------
Q28L14_JANSC/1268-1415-----------------------AHEVI-RVDD-------------------------AWTESFQPGD------------
Q1GGN0_RUEST/194-341-----------------------RHEVI-EADG-------------------------LYSESYHPGA------------
Q5LSZ7_RUEPO/803-941-----------------------QHELV-LSEQ-------------------------AWSESFHPGR------------
Q5LPJ7_RUEPO/175-322-----------------------RHLLL-RAHG-------------------------LLSESIFLGD------------
Q1GMQ5_RUEST/293-432-----------------------RHEIV-RANG-------------------------LDSESYHPGA------------
Q5LLZ7_RUEPO/144-282-----------------------RHEIV-FSEG-------------------------IPTESYFPGA------------
A8LR09_DINSH/158-296-----------------------SHAIV-EAEG-------------------------CLSESLYPGE------------
C7JHN5_ACEP3/423-565-----------------------QHSVI-TADG-------------------------MLTESYLDTG------------
Q28SX3_JANSC/168-306-----------------------GHRTL-LAEG-------------------------VEAESLHPGD------------
A8LK48_DINSH/203-343-----------------------RHEVV-RAEG-------------------------AWTESFFPGA------------
Q5LMP8_RUEPO/160-307-----------------------RHEIV-FANG-------------------------LPAETLLLGA------------
Q28UB5_JANSC/126-273-----------------------GHGLV-KVEG-------------------------LWAETLFLGE------------
Q1GMV1_RUEST/833-976-----------------------AHQVI-FVDG-------------------------CATETFWPGP------------
A5FZD4_ACICJ/193-329-----------------------RHDIL-LAEG-------------------------APAESFLDTG------------
B9JK11_AGRRK/201-336-----------------------QHSII-LAEG-------------------------AQTETYLDLG------------
Q28TH9_JANSC/752-887-----------------------SHQVV-FAEG-------------------------IASESFYPGP------------
A5G1S8_ACICJ/159-294-----------------------AHAIL-LAEN-------------------------MPAESYLETG------------
B0T7Q3_CAUSK/153-288-----------------------AHDVV-LAEG-------------------------LACESYLDDG------------
C7JE32_ACEP3/536-676-----------------------DHAVI-RANG-------------------------LFTESYLDTG------------
B8IA31_METNO/149-285-----------------------RHDVL-LAEG-------------------------APSESFVDDH------------
A5G006_ACICJ/174-309-----------------------THDIL-LAEG-------------------------LPTESYLDTG------------
A5FW80_ACICJ/285-421-----------------------RHDVI-LAEG-------------------------APCESYLDTG------------
A8LLK3_DINSH/164-305-----------------------QHEVL-QAEG-------------------------LACESLFWGA------------
Q5FQG8_GLUOX/285-425-----------------------QHSVL-VANG-------------------------ALSESFLDAD------------
B0UJT1_METS4/116-254-----------------------SHDIL-IANG-------------------------QPSESYLEMG------------
Q5LUZ7_RUEPO/68-216-----------------------RHAVI-NVDG-------------------------LQFETYHPGV------------
Q0BS96_GRABC/3687-3823-----------------------THDVV-FAEG-------------------------AASESYVEDN------------
B1M2P7_METRJ/65-199-----------------------SHDLL-IAEG-------------------------TPAESFLPAP------------
A5FVL4_ACICJ/410-545-----------------------SHDVV-LAEM-------------------------LPAETYLDCG------------
A4YQ57_BRASO/106-246-----------------------SHNVI-YAEG-------------------------APCETLLNVN------------
A5FWA2_ACICJ/1192-1328-----------------------RHAVI-RAEN-------------------------LPCETYRDDG------------
C3KQV1_RHISN/76-214-----------------------THEVV-LAEG-------------------------APVETCLLED------------
A8LKB8_DINSH/19-167-----------------------RPQAL-MVNG-------------------------VLVESATPDA------------
Q5LN78_RUEPO/204-343-----------------------TNEAM-ITAG-------------------------ALAESLFIGR------------
C5AQV5_METEA/69-209-----------------------AHDIL-LAEG-------------------------LAAESYYD..------------
D5AV22_RHOCB/442-581-----------------------RHGIV-TANG-------------------------LACESLYPGP------------
Q2YL23_BRUA2/15-148-----------------------RHAVV-LAEG-------------------------AAVETFLM..------------
Q3J294_RHOS4/14-159-----------------------RHEVV-LANG-------------------------AWTESFQPT.------------

PF05203

U7Q1H8_SPOS1/262-759GPP......SATIKTIYTTI...CDGVIKIARS-------------------------LGVRVSVSTEAATV..VRGVSH
Q6FQS3_CANGA/285-698.........NIENGVEIDSS...INGLAKLSRS-------------------------LGLRCNKSS.............
A3LP04_PICST/283-730DEADK..CYSATVKTIYPAV...RDGLVSVARS-------------------------LGIQTSVSVEEAK..EVNSVKH
J7RJ26_KAZNA/284-757HYGGT..VKSATIPALDMHA...VSGFVKVARS-------------------------LGIKVSIADNNDVE.K......
C5M9I6_CANTT/244-713KSNGS...IEAVVRTSFRHV...ARGLAKIAHS-------------------------LGIESSINIKDTHI.DAAGVRQ
Q6CL64_KLULA/284-692D........TVALKTLSVKT...HDGIARLARS-------------------------LGIRVSGKKQNQE.........
B6JY11_SCHJY/285-759GDLS.....SAHLSTTSPKV...RDGTVRIARS-------------------------LGISAYVSTKSEQI.....VDG
Q6BRM0_DEBHA/283-675NPL......SASVRTNSSKV...GEGVIAVSRS-------------------------LGICTSVKAENES.........
A5DXZ0_LODEL/280-699DSA......IINIGASNKSI...IANIVKLARS-------------------------LGIKAACKDDGL..........
H2APW1_KAZAF/284-774.........STDFITYSPKI...SMGVIRLARS-------------------------LGIKAAVNDGNS...DYGSVRG
G7E5L8_MIXOS/284-742SKDRAM.RRNVDILTGHASV...CDGLVRVARS-------------------------LGIRVSASMQAV..........
F2TVI8_SALR5/1497-1695................................S-------------------------LGEAGTHAEAGECT.T......
U9UGV8_RHIID/409-843E........NRNYRYVYRSLHERCEQICNLANL-------------------------SGFYSTNIVSNMKE.CSDNITT
C5DTL5_ZYGRC/284-732E........TATVKTIDQSV...MTGTVAVARS-------------------------LGINVSVDVEV....DEDGVDR
G8JWX2_ERECY/284-671ATGD.....LAAVISLPRSS...LEGASKVAGS-------------------------LGLEIKLEP.............
A7TLB5_VANPO/284-715NKQD....ISCTIELEDNKV...MSGIVSLIRS-------------------------LGLKADVTQSSGKLNDVC....
VATA_YEAST/284-736EHGI.....KATIKTIHTSV...RDGLVSLARS-------------------------LGLVVSVNAEPAKV.DMNGTKH
M3K3J1_CANMX/284-733DDVTDA.CLSATVKTIYPAI...RDGLVTLARS-------------------------LGIVASVTTEAAK..TVGGVSH
G0V8Z3_NAUCC/284-799ADNR....FSATVTTIYKGV...SEGLIRLARS-------------------------LGIRVSVSTEKEHV.DKNNVKH
C5DTQ4_ZYGRC/1-463RKNPLD.SFKVSIQTVYPSI...MGGIVHITRS-------------------------LGMPVTVTTRSAKT.ATIVGRT
G0W3J0_NAUDC/284-783.RTSNGTIECAAISTAYKSV...SEGLIRLARS-------------------------LGIKVSVTTKRECL.DKHNVKH
G8ZLC3_TORDC/1-463RNEGPD.AFKASIQTIYPSI...MNGIVHVSRS-------------------------LGIASTVTTRSART.ETIEGRK
G8BNB8_TETPH/284-799DKASN..STKATVATAFKGV...AEGLVRIARS-------------------------LGIKVYVTAEKNCM.DKNDVKH

PF07591

A3DGR7_CLOTH/105-234-----------------------VG.....NNG-------------------------ILVHNA----------------
Q5F6G7_NEIG1/1-137-----------------------VKGNQAETEG-------------------------VWVHNS----------------
Q9K122_NEIMB/1-137-----------------------VKGNRAETEG-------------------------VWVHND----------------

PF10596

I3L3Z8_HUMAN/86-244-----------------------RAHLWQKIHE-------------------------SIVMDLCQVFDQE---------
A2EY65_TRIVA/1432-1590-----------------------RGHMWQKTHE-------------------------SIVMDVMQVLDSH---------
A8BTS5_GIAIC/1337-1490-----------------------RGHAWPMIHS-------------------------SLVKTLLAILQDA---------
S3BP74_OPHP1/1452-1610-----------------------RAHLWQKIHE-------------------------SVVMDLCQVFDQE---------
Q8SVU6_ENCCU/1239-1384-----------------------RNQLWRRIHE-------------------------SVVGGLCDVFR..---------
Q5KPW2_CRYNJ/1640-1796-----------------------RAHLWQKIHE-------------------------SVVMDLCQVFDQE---------
K7VI98_MAIZE/675-841-----------------------AAHRWQMSKP-------------------------SLVSESKDVFDQK---------
G0W883_NAUDC/1515-1673-----------------------RAHLWQKIHE-------------------------SVVFDICQILDGE---------
E6ZWZ5_SPORE/1485-1643-----------------------RAHLWQKIHE-------------------------SVVMDLCQVFDQE---------
E9AFM0_LEIMA/1514-1674-----------------------SGSLWEKSHG-------------------------AVVNDVASKLKDS---------
R0KWQ9_NOSB1/1205-1354-----------------------KNNLWKKIQE-------------------------SLVYDFFKT....---------

PF01079

Q7PXI1_ANOGA/295-503...................T---------------------DSLSLPRHEGIHW--------------------------
HH_DROPS/255-475.............RSSQTEG---------------------VVSRAEQQNGIHW--------------------------
IHH_DANRE/187-398....................---------------------..PDQVLKNGLHW--------------------------
TWHH_DANRE/190-403..................AR---------------------ESNVNFQEDGIHW--------------------------
WRT4_CAEEL/327-547....................---------------------..VEDSTNED...--------------------------
Q80XI9_MOUSE/230-435....................---------------------......PSEGVHW--------------------------
WRT6_CAEEL/375-583....................---------------------...KSSTEEG...--------------------------
A8X447_CAEBR/327-545....................---------------------...ADSTKEE...--------------------------
IHH_CHICK/188-394....................---------------------......QGDGVHW--------------------------
SHH_CHICK/190-411..................GA---------------------IPTAATTTTGIHW--------------------------
SHH_DANRE/187-404................NSSS---------------------RSNATLQQEGVHW--------------------------
WRT8_CAEEL/325-538....................---------------------...EESNTEG...--------------------------
DHH_HUMAN/188-396....................---------------------...GAVQPTGMHW--------------------------
Q175B3_AEDAE/201-412.................SQS---------------------RNLSLPRHGGINW--------------------------
O45992_CAEEL/258-471....................---------------------.....YETER...--------------------------
B0S8K0_DANRE/187-399....................---------------------......QVTGIHW--------------------------
B3DJ46_DANRE/191-442...........KWQDATRAE---------------------MENAFLQQKEVYW--------------------------
HH_DROMO/248-470............SAQDKPTP---------------------KDATAQQQNGIHW--------------------------
C3ZGW9_BRAFL/224-434...................G---------------------PSHDQTLQEGVHW--------------------------
D6WCL7_TRICA/146-345....................---------------------.....KPGVGVFW--------------------------
F6WZB6_XENTR/191-398....................---------------------...EPSQQMGIHW--------------------------
F6XBS5_CIOIN/294-549..............DHRNCT---------------------HVGPVRPTDGISL--------------------------
F6YTG6_XENTR/190-394....................---------------------....LDLSDGVHW--------------------------
G3V6T0_RAT/188-423..........GSIPAPQSVA---------------------EARGAGPAAGIHW--------------------------
H2U1Q8_TAKRU/190-435HALVRGDRKVCARNSTSVRS---------------------EAGPRGRTSEVHW--------------------------
H2V9H2_TAKRU/190-402...................S---------------------QPGGGGQKDGVHW--------------------------
H2XUY9_CIOIN/97-305....................---------------------........VGIHW--------------------------
W4Y925_STRPU/189-401...................I---------------------VDTDTGQEQRVHW--------------------------
W5K3H2_ASTMX/187-406.................SSQ---------------------PSNSTTQLDGIHW--------------------------

PF14890

M1MZU7_9CORY/77-375VGTKNITAYM......EGKPEHFKEAVADN.GKRGA.....PYLTNFNTSPRACDECGEVSENPAALRWHKNREHGTNHK
E3GYR2_METFV/39-446..........DKTSISKHELRNIFNNLES....KNV.....KDLEPLVCDDVSYV........................K
NDRZ_PYRFU/306-755LGQWHTRNRVSKAVLVK.MLRKLYEATKD....EEV.....KRMLHLIEG...LE........................V
D0MK11_RHOM4/430-853LGMAYGGMTLFRQNLSRARALRLAEAAAC............PELRQLAQSDVYWD........................P
Q5JJ43_THEKO/306-755LGQWHRRGRVSKAVLVK.MLRKLYDTTKS....EDV.....KRMLHLIEG...LE........................V
RGYR_METJA/871-1360IENWYKEKTNN...IPREKLKTVLRYANN...SEHK.....EFLEKIVNGDISFV........................R
K9VL64_9CYAN/809-1233LGNLYCGTTLYKHNLGRERAFRLATIVKS............GELALLSKSDIYWD........................E
DNAB_SYNY3/385-809LGNAYCGTALYKHNLSRERAAKIATITQS............PEIEKLSQSDIYWD........................S
B8HS23_CYAP4/785-1209LGNAYCGTSLYKQNLSRERASRLAAIVNC............ETIAQLADSDVYWD........................E
K9QGP4_9NOSO/889-1313LGTSYCGSTLYKANLSRERALKVAKLVQS............NELLSLANSDVYWD........................E
B2IVH9_NOSP7/393-817IGVSYCGSTLYKVNLSRERALKVGNIVQS............SKLVTLAKSDVYWD........................E
H3ZL75_THELN/500-1032..............MTFKKFKELVDSGKL..NREKA.....KLLEFFINGDIVLD........................R
D2RI62_ARCPA/834-1317VWNW.....NDCVCIPREKLRKIVELAED...SDIK.....TFLLELLNANVTWI........................K
Y832_METJA/1064-1591VNNLHIWEDLKKGYMSRYRAKKVLNIMKNVKEIEEKYGRLLDKIGQLIDNDLLFE........................R
DPOL_THEKO/857-1388..............VSPQTFRKMVEDGRL..DPEKA.....QRLSWLIEGDVVLD........................R

PF14623

F2SQT7_TRIRC/282-454--------------------------------------------------------------------------------
E9EQB7_METRA/537-702--------------------------------------------------------------------------------
Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
Q7S708_NEUCR/636-832--------------------------------------------------------------------------------
H6C7V0_EXODN/356-526--------------------------------------------------------------------------------
J3PIM9_GAGT3/593-786--------------------------------------------------------------------------------
G2XFI4_VERDV/568-734--------------------------------------------------------------------------------
G1XIH1_ARTOA/537-708--------------------------------------------------------------------------------
U7PS73_SPOS1/521-692--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
R8BIW3_TOGMI/471-637--------------------------------------------------------------------------------
C5GK44_AJEDR/553-713--------------------------------------------------------------------------------
S8AB86_DACHA/542-713--------------------------------------------------------------------------------
S3CBE6_OPHP1/613-780--------------------------------------------------------------------------------
G3JM09_CORMM/336-505--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
F0UB99_AJEC8/548-714--------------------------------------------------------------------------------
G0QP70_ICHMG/545-705--------------------------------------------------------------------------------
I7M030_TETTS/514-676--------------------------------------------------------------------------------
M7TBR0_EUTLA/533-699--------------------------------------------------------------------------------
C1G4L4_PARBD/546-712--------------------------------------------------------------------------------
N4VVV8_COLOR/552-719--------------------------------------------------------------------------------
Q24C76_TETTS/502-665--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-749--------------------------------------------------------------------------------
G9MP19_HYPVG/551-718--------------------------------------------------------------------------------
T0JQ14_COLGC/569-736--------------------------------------------------------------------------------
J4WBA6_BEAB2/688-856--------------------------------------------------------------------------------
I7M701_TETTS/604-769--------------------------------------------------------------------------------
F7VWE7_SORMK/571-774--------------------------------------------------------------------------------
L8X395_THACA/606-772--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
G0RIM5_HYPJQ/574-741--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------
J4URQ4_BEAB2/478-645--------------------------------------------------------------------------------
G4NA23_MAGO7/558-749--------------------------------------------------------------------------------

PF13403

Q1GGP9_RUEST/27-173--------------------------------------------------------------------------------
Q1GES6_RUEST/157-304--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
Q5LPM0_RUEPO/507-646--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
Q1GGN0_RUEST/194-341--------------------------------------------------------------------------------
Q5LSZ7_RUEPO/803-941--------------------------------------------------------------------------------
Q5LPJ7_RUEPO/175-322--------------------------------------------------------------------------------
Q1GMQ5_RUEST/293-432--------------------------------------------------------------------------------
Q5LLZ7_RUEPO/144-282--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
Q5LMP8_RUEPO/160-307--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
Q1GMV1_RUEST/833-976--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
Q5LUZ7_RUEPO/68-216--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
Q5LN78_RUEPO/204-343--------------------------------------------------------------------------------
C5AQV5_METEA/69-209--------------------------------------------------------------------------------
D5AV22_RHOCB/442-581--------------------------------------------------------------------------------
Q2YL23_BRUA2/15-148--------------------------------------------------------------------------------
Q3J294_RHOS4/14-159--------------------------------------------------------------------------------

PF05203

U7Q1H8_SPOS1/262-759KKA...YAVFLSDPENTGVLASILSRCALER..KKLPAPAA.VNRKGQAMYFDLEKQ-----------------------
Q6FQS3_CANGA/285-698......NLLKLS.........GNMSNISAQSTNNWTSTEDNSSAYKAQLMDFSVQKL-----------------------
A3LP04_PICST/283-730QES...YAIYMA...NSSALDSVLSKCAAPR..KRAEEPVC.VNREPHPYTFHMVEK-----------------------
J7RJ26_KAZNA/284-757......QCVTLS....GDALVGVLSCCADKN...KADTPRS.FAREAIPFHFTLKEQ-----------------------
C5M9I6_CANTT/244-713EFA...CIVNLT....GAPLAGVLSKCALAR..NQTPVVK..FTRDPVLFNFDLIKS-----------------------
Q6CL64_KLULA/284-692......YTLTLS....GDALKSVSNWTSTSNIEKVD......VIHKAQPISFDLEKI-----------------------
B6JY11_SCHJY/285-759VYYPETYTIELE...GNEALQSVLSKSALSS..NVAPAPGS.FERKAVPMYFDLGIT-----------------------
Q6BRM0_DEBHA/283-675......YIISMT...RNSALESVLSKCALAE..KTTSVPSH.ITRTGQNFDFSVKKI-----------------------
A5DXZ0_LODEL/280-699......NRITLE....GPALAGVLSKCSSSSVDAKS......FARDAVPFNFNLLRS-----------------------
H2APW1_KAZAF/284-774DSLPPKYKIQLG....GTAIHGVYQYSFYKG....FPSVEP.FERKGIPFFFTLQEK-----------------------
G7E5L8_MIXOS/284-742.NA...YAVFLS...GGEVIQSMLSLCAVEC..NRAARPEGPVKRPGQSFNFTVTKT-----------------------
F2TVI8_SALR5/1497-1695......YKIAAV.....................RQLEQPEP................-----------------------
U9UGV8_RHIID/409-843PSC.....CTII...SGNKLEKLPLVISRKKVFRNRDHPK..FNRDMV.WGFKVEKV-----------------------
C5DTL5_ZYGRC/284-732SFV...YAIYMD...RSDALLAVLANCASNN..KQIEAPPHGVIREFNKAYFEMEEL-----------------------
G8JWX2_ERECY/284-671......GFLKIC...GGSALQSVLSICGTVA....VEKPEH.VVRKPKHLKFIVEKM-----------------------
A7TLB5_VANPO/284-715......YNVTVK...GGELLKSVLSRCSAINYTKCESRD...LLREPVEFYFELQEL-----------------------
VATA_YEAST/284-736KIS...YAIYMS...GGDVLLNVLSKCAGSK..KFRPAPAAAFARECRGFYFELQEL-----------------------
M3K3J1_CANMX/284-733QEA...YVVSLG...ASSALDSVLSKCAASR..KKAAEPVG.VSREPHQFSFYLQEK-----------------------
G0V8Z3_NAUCC/284-799KSC...YRVFLS....GEALIGVLRFCALDR..KRTAFKE..FTREAVPFYFTLQEK-----------------------
C5DTQ4_ZYGRC/1-463VSCHFTYDCHLA...GRTPMQKVLSYCRSGH..KVKTEPEY.VERSPIYFGFNEEKR-----------------------
G0W3J0_NAUDC/284-783QIC...YSICLS....GATLSGALRFCALDK..NNANSKKP.FVRGPVPFYFTLKEK-----------------------
G8ZLC3_TORDC/1-463VNCHFTYDCHIA...GRTPLQKVLSYCCSGH..KKRPVPKV.IIREPIYFGFNEEKR-----------------------
G8BNB8_TETPH/284-799QLY...YSISLS....GEALSSSLRFCSLDR...NVASLSPFFNREAVPFYFTLEEQ-----------------------

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------
Q9K122_NEIMB/1-137--------------------------------------------------------------------------------

PF10596

I3L3Z8_HUMAN/86-244--------------------------------------------------------------------------------
A2EY65_TRIVA/1432-1590--------------------------------------------------------------------------------
A8BTS5_GIAIC/1337-1490--------------------------------------------------------------------------------
S3BP74_OPHP1/1452-1610--------------------------------------------------------------------------------
Q8SVU6_ENCCU/1239-1384--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1796--------------------------------------------------------------------------------
K7VI98_MAIZE/675-841--------------------------------------------------------------------------------
G0W883_NAUDC/1515-1673--------------------------------------------------------------------------------
E6ZWZ5_SPORE/1485-1643--------------------------------------------------------------------------------
E9AFM0_LEIMA/1514-1674--------------------------------------------------------------------------------
R0KWQ9_NOSB1/1205-1354--------------------------------------------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503---------YAKSLYTIK--------------DYLIP
HH_DROPS/255-475---------YANALYKVK--------------DYVLP
IHH_DANRE/187-398---------YSQVLIGLG--------------KLLLD
TWHH_DANRE/190-403---------YSNMLFHIG--------------SWLLD
WRT4_CAEEL/327-547---------..NIGYGLN--------------GVMAV
Q80XI9_MOUSE/230-435---------YPQMLYRLG--------------RLLLE
WRT6_CAEEL/375-583---------..DLPVGVE--------------TLTSV
A8X447_CAEBR/327-545---------..NLGYGIH--------------SLLDV
IHH_CHICK/188-394---------YSGLLYRLG--------------RMLLP
SHH_CHICK/190-411---------YSRLLYRIG--------------SWVLD
SHH_DANRE/187-404---------YSRLLYQMG--------------TWLLD
WRT8_CAEEL/325-538---------..NIGTSLN--------------FLIEI
DHH_HUMAN/188-396---------YSRLLYRLA--------------EELLG
Q175B3_AEDAE/201-412---------YAKTLYAIK--------------DFVIP
O45992_CAEEL/258-471---------..NIGQSLN--------------SLIAI
B0S8K0_DANRE/187-399---------YSSLLHWIG--------------TQVLD
B3DJ46_DANRE/191-442---------YARLLHTLG--------------RIFLD
HH_DROMO/248-470---------YANALYKVK--------------DYVLP
C3ZGW9_BRAFL/224-434---------YPSFFYRYG--------------IS...
D6WCL7_TRICA/146-345---------YARLLYATA--------------DFVL.
F6WZB6_XENTR/191-398---------YSKALYHLG--------------RLIL.
F6XBS5_CIOIN/294-549---------YSKLLHQIF--------------SKVL.
F6YTG6_XENTR/190-394---------YCHILYLLA--------------KYVL.
G3V6T0_RAT/188-423---------YSQLLYHIG--------------TWLLD
H2U1Q8_TAKRU/190-435---------YAQLLHRLG--------------WIVL.
H2V9H2_TAKRU/190-402---------YSRLLYQVG--------------TWLLD
H2XUY9_CIOIN/97-305---------YAKSLAEIA--------------RIVLP
W4Y925_STRPU/189-401---------YTQGLYKLG--------------KYVM.
W5K3H2_ASTMX/187-406---------YSRLLYRMG--------------TFLLD

PF14890

M1MZU7_9CORY/77-375VIRIEHLD.ERADVYCLQVEEHNNFALAAG..VFVHN
E3GYR2_METFV/39-446VKKINRIN.DEKYVYDLTVEKYHNF.VANG..VIVHN
NDRZ_PYRFU/306-755VRHITTTN.EPRTFYDLTVENYQNYLAGENGMIFVHN
D0MK11_RHOM4/430-853IVSIEPDG..VEEVFDLTVPGPHNF.VAND..IIAHN
Q5JJ43_THEKO/306-755VKEINVTN.EPKTFYDLTVERYQNYLAGENGMVFVHN
RGYR_METJA/871-1360VKKVENIP.YDGYVYDLSIKHNQNF.ISNG..VISHN
K9VL64_9CYAN/809-1233IASIEVDG..EAEVYDLTVPALHNF.VAND..IIVHN
DNAB_SYNY3/385-809IVSITETG..VEEVFDLTVPGPHNF.VAND..IIVHN
B8HS23_CYAP4/785-1209VISITQDG..SEDVFDLTVPEHHNF.VVNN..IIVHN
K9QGP4_9NOSO/889-1313IVSIELSG..EEEVFDLTVPGLHNF.VANN..IIVHN
B2IVH9_NOSP7/393-817IVSIEYSG..EEEVFDLTVPGLHNF.VANN..IIVHN
H3ZL75_THELN/500-1032VKSVKEKD.YEGYVYDLSVEDNENF.LVGFGLLYAHN
D2RI62_ARCPA/834-1317VKDVKDRY.YNGYVYDVTTT.TSNF.FANA..MLNHN
Y832_METJA/1064-1591IKSIRVLDEIPEYVYDISVEGTENF.IGGEGFICLHN
DPOL_THEKO/857-1388VESVDVED.YDGYVYDLSVEDNENF.LVGFGLVYAHN

PF14623

F2SQT7_TRIRC/282-454-------------------------------------
E9EQB7_METRA/537-702-------------------------------------
Q237Q6_TETTS/509-673-------------------------------------
Q7S708_NEUCR/636-832-------------------------------------
H6C7V0_EXODN/356-526-------------------------------------
J3PIM9_GAGT3/593-786-------------------------------------
G2XFI4_VERDV/568-734-------------------------------------
G1XIH1_ARTOA/537-708-------------------------------------
U7PS73_SPOS1/521-692-------------------------------------
C7YL43_NECH7/586-752-------------------------------------
R8BIW3_TOGMI/471-637-------------------------------------
C5GK44_AJEDR/553-713-------------------------------------
S8AB86_DACHA/542-713-------------------------------------
S3CBE6_OPHP1/613-780-------------------------------------
G3JM09_CORMM/336-505-------------------------------------
C5FLY1_ARTOC/540-711-------------------------------------
F0UB99_AJEC8/548-714-------------------------------------
G0QP70_ICHMG/545-705-------------------------------------
I7M030_TETTS/514-676-------------------------------------
M7TBR0_EUTLA/533-699-------------------------------------
C1G4L4_PARBD/546-712-------------------------------------
N4VVV8_COLOR/552-719-------------------------------------
Q24C76_TETTS/502-665-------------------------------------
D2VHB8_NAEGR/586-749-------------------------------------
G9MP19_HYPVG/551-718-------------------------------------
T0JQ14_COLGC/569-736-------------------------------------
J4WBA6_BEAB2/688-856-------------------------------------
I7M701_TETTS/604-769-------------------------------------
F7VWE7_SORMK/571-774-------------------------------------
L8X395_THACA/606-772-------------------------------------
E4UR10_ARTGP/540-711-------------------------------------
Q2GTB7_CHAGB/570-754-------------------------------------
E3QU32_COLGM/508-676-------------------------------------
G0RIM5_HYPJQ/574-741-------------------------------------
Q22N58_TETTS/494-660-------------------------------------
A9UVU8_MONBE/587-772-------------------------------------
J4URQ4_BEAB2/478-645-------------------------------------
G4NA23_MAGO7/558-749-------------------------------------

PF13403

Q1GGP9_RUEST/27-173-------------------------------------
Q1GES6_RUEST/157-304-------------------------------------
A1AYR4_PARDP/380-527-------------------------------------
A8LN65_DINSH/175-322-------------------------------------
A1B4V8_PARDP/356-503-------------------------------------
A8LKN9_DINSH/122-260-------------------------------------
Q28WJ0_JANSC/241-379-------------------------------------
Q5LPM0_RUEPO/507-646-------------------------------------
Q28L14_JANSC/1268-1415-------------------------------------
Q1GGN0_RUEST/194-341-------------------------------------
Q5LSZ7_RUEPO/803-941-------------------------------------
Q5LPJ7_RUEPO/175-322-------------------------------------
Q1GMQ5_RUEST/293-432-------------------------------------
Q5LLZ7_RUEPO/144-282-------------------------------------
A8LR09_DINSH/158-296-------------------------------------
C7JHN5_ACEP3/423-565-------------------------------------
Q28SX3_JANSC/168-306-------------------------------------
A8LK48_DINSH/203-343-------------------------------------
Q5LMP8_RUEPO/160-307-------------------------------------
Q28UB5_JANSC/126-273-------------------------------------
Q1GMV1_RUEST/833-976-------------------------------------
A5FZD4_ACICJ/193-329-------------------------------------
B9JK11_AGRRK/201-336-------------------------------------
Q28TH9_JANSC/752-887-------------------------------------
A5G1S8_ACICJ/159-294-------------------------------------
B0T7Q3_CAUSK/153-288-------------------------------------
C7JE32_ACEP3/536-676-------------------------------------
B8IA31_METNO/149-285-------------------------------------
A5G006_ACICJ/174-309-------------------------------------
A5FW80_ACICJ/285-421-------------------------------------
A8LLK3_DINSH/164-305-------------------------------------
Q5FQG8_GLUOX/285-425-------------------------------------
B0UJT1_METS4/116-254-------------------------------------
Q5LUZ7_RUEPO/68-216-------------------------------------
Q0BS96_GRABC/3687-3823-------------------------------------
B1M2P7_METRJ/65-199-------------------------------------
A5FVL4_ACICJ/410-545-------------------------------------
A4YQ57_BRASO/106-246-------------------------------------
A5FWA2_ACICJ/1192-1328-------------------------------------
C3KQV1_RHISN/76-214-------------------------------------
A8LKB8_DINSH/19-167-------------------------------------
Q5LN78_RUEPO/204-343-------------------------------------
C5AQV5_METEA/69-209-------------------------------------
D5AV22_RHOCB/442-581-------------------------------------
Q2YL23_BRUA2/15-148-------------------------------------
Q3J294_RHOS4/14-159-------------------------------------

PF05203

U7Q1H8_SPOS1/262-759---------APAKYYGVTLADNTDHQFLLGNMMLVH-
Q6FQS3_CANGA/285-698---------PKDNYYGVTLDDDSDHQFLLSNLVLVH-
A3LP04_PICST/283-730---------EEDDFYGITLSEDSDHQFLLSNLALVH-
J7RJ26_KAZNA/284-757---------REDEYFGITLPETTDNQYLLSSLALVH-
C5M9I6_CANTT/244-713---------AKENYYGITLAEETDHQFLLSNMALVH-
Q6CL64_KLULA/284-692---------ESADYFGVTLAEESDHKFLLSNMTLVH-
B6JY11_SCHJY/285-759---------TPANYYGVTLAEDSDHQFLLSNLTLVH-
Q6BRM0_DEBHA/283-675---------EAADYYGVTLPDNSDHQFMLANQAVVH-
A5DXZ0_LODEL/280-699---------AKEDYYGITLSETSDHMFLLSNLALVH-
H2APW1_KAZAF/284-774---------PEDDYYGITLPDATDKQYLLSSLALVH-
G7E5L8_MIXOS/284-742---------DQAPYYGITLADDTDHKFLLGNLALVH-
F2TVI8_SALR5/1497-1695---------....YVGFFV..DGNKRFLRADFLVTH-
U9UGV8_RHIID/409-843---------GLGSYYGFKV..DKNERILLADLTVSH-
C5DTL5_ZYGRC/284-732---------EEDEYYGLTLSNESDHQFLLANQLVVH-
G8JWX2_ERECY/284-671---------TEDNYFGITLPEDSDRVFLLNNQVLVH-
A7TLB5_VANPO/284-715---------EEAEYYGITLPEYSDHQFMLSNQVVVH-
VATA_YEAST/284-736---------KEDDYYGITLSDDSDHQFLLANQVVVH-
M3K3J1_CANMX/284-733---------PVDDYYGITLSAESDHQFLLANTALVH-
G0V8Z3_NAUCC/284-799---------DQDEYYGITLPDETDKQYLLSSLALVH-
C5DTQ4_ZYGRC/1-463---------GSNNVVGVTT..NSDKRILLDNKIVIH-
G0W3J0_NAUDC/284-783---------DEDNYYGITLPDSTDKQYLLSSLALVH-
G8ZLC3_TORDC/1-463---------GLQPVFGITT..EQGKKILLDNKLVAH-
G8BNB8_TETPH/284-799---------EEDQYYGVTLPDSTDKQYLLSSLALVH-

PF07591

A3DGR7_CLOTH/105-234-------------------------------------
Q5F6G7_NEIG1/1-137-------------------------------------
Q9K122_NEIMB/1-137-------------------------------------

PF10596

I3L3Z8_HUMAN/86-244-------------------------------------
A2EY65_TRIVA/1432-1590-------------------------------------
A8BTS5_GIAIC/1337-1490-------------------------------------
S3BP74_OPHP1/1452-1610-------------------------------------
Q8SVU6_ENCCU/1239-1384-------------------------------------
Q5KPW2_CRYNJ/1640-1796-------------------------------------
K7VI98_MAIZE/675-841-------------------------------------
G0W883_NAUDC/1515-1673-------------------------------------
E6ZWZ5_SPORE/1485-1643-------------------------------------
E9AFM0_LEIMA/1514-1674-------------------------------------
R0KWQ9_NOSB1/1205-1354-------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window