Sequence alignment for CL0363

PF13403

A3PK18_RHOS1/14-160------------------ACFTPGTLIATVRG.E-------------V---------AVEA--L--AAGDRIVT---RD.
A3SZU1_9RHOB/393-539------------------ICFTPGTTIATRRG.E-------------I---------PVQQ--I--KVGDLVVT---RD.
Q1GGP9_SILST/27-173------------------PCFTPGTLIATPRG.E-------------R---------LVEN--L--QVGDRVIT---RD.
C8RY14_9RHOB/1350-1496------------------PCFTPGTLILTAHG.E-------------V---------RVED--L--VVDDQVLT---RD.
Q1GES6_SILST/157-304------------------ICFTPGTRIATPEG.P-------------K---------PVES--L--REGDRVQT---RD.
A3SNQ6_9RHOB/641-788------------------ICFTPGTLIATPEG.C-------------R---------PVED--L--RPGDRVMT---RD.
A3SUS4_9RHOB/185-331------------------PCFTAGSLIATAKG.D-------------T---------PVEH--L--KAGDAVIT---RD.
D0CP51_9RHOB/143-290------------------PCFTAGTLIETPGG.A-------------K---------AIED--L--AEGDLVLT---LD.
C7DAD7_9RHOB/178-316------------------VCFTRGTLIKTDQG.E-------------R---------PIEE--L--AAGDMVLT---MD.
A9GA60_9RHOB/583-733------------------PCFTPGSLVLTPGG.A-------------V---------PVEA--L--EVGDRVVT---RD.
A1AYR4_PARDP/380-527------------------LCFLRGTLIKTADG.E-------------V---------PVEQ--L--EPGTKVMT---LD.
A6DV24_9RHOB/336-474------------------PCFVAGTMIRTPKG.E-------------V---------PVDR--L--QPGDLVVT---QD.
A3VAW0_9RHOB/105-251------------------PCFTRGTLIDTPHG.P-------------R---------PVEE--L--RAGDEVLT---VD.
A3TXC6_9RHOB/29-175------------------ACFSAGTRILTPQG.Q-------------R---------AVET--L--VPGDKVMT---RD.
A8LN65_DINSH/175-322------------------PCFTPGTLIEVPGG.T-------------C---------PVEA--L--QVGDLVLT---RD.
A1B4V8_PARDP/356-503------------------PCFARGTRIAVADD.E-------------V---------AIET--L--RAGDLVQT---RD.
A3K5E2_9RHOB/849-996------------------PCFTPGTRLKTLRG.E-------------V---------PVED--I--QVGDRLLT---RD.
B6BC88_9RHOB/475-613------------------ICFTAGTRIATPAG.L-------------R---------AIET--L--QPGDEVIT---RD.
A4EMR4_9RHOB/71-217------------------PCFTPGTAIATPNG.E-------------V---------LVEK--L--RSGDRILT---RD.
A3V1Q6_9RHOB/111-258------------------FCFAAGTLIETETG.P-------------R---------LIEE--L--LPGDRILT---CD.
B7QV02_9RHOB/335-473------------------PCFVAGSRILTDRG.Q-------------M---------PVEE--L--RVGDLVLT---RD.
C9D0M9_9RHOB/1229-1376------------------ICFTKGTMIMTITG.E-------------R---------PVEE--L--KTGELVLT---SD.
Q0FQ52_9RHOB/227-374------------------ACLTTGTPVATLAG.D-------------V---------AVEN--L--RAGHRVLT---MD.
D0CWS5_9RHOB/173-320------------------PCFVRGTRILTPQG.E-------------V---------PVQH--L--RPGALVCT---ES.
D0CQ11_9RHOB/159-297------------------TCFTQGTRIRTESG.D-------------R---------LVET--L--KPGDMVAT---VD.
A8LKN9_DINSH/122-260------------------PCFVAGTRILTPEG.V-------------V---------PVET--L--RPGDLVQT---RD.
A3JWU1_9RHOB/200-347------------------VCFAAGTLIKTIKG.E-------------C---------EIES--L--SVGDQVLT---MD.
A3VI53_9RHOB/624-762------------------ICFTGGTAIDTPSG.P-------------C---------PVEH--L--RPGDLVLT---RD.
A3SQF1_9RHOB/126-264------------------VCFLSGTLIHTAKG.P-------------R---------PIET--L--RPGDLVQT---YD.
B5K4Q3_9RHOB/102-249------------------ICFTPGTMIRTGDG.V-------------M---------RVED--I--NEGTKVQT---KD.
A3JUC9_9RHOB/546-693------------------VCFARGTLIRTDLG.D-------------V---------AVQN--L--KSGDMVQT---KD.
A3W238_9RHOB/563-702------------------ICFTPGIRLLTPNG.E-------------R---------NVET--L--RAGDLVLT---RD.
B9NR62_9RHOB/115-262------------------VCFTAGTLIETADG.P-------------R---------AIEH--L--RVNDEVRT---AD.
C7D8K4_9RHOB/545-684------------------ICFTKGAMIATPRG.A-------------R---------AIED--L--RIGDLVVT---RD.
Q28WJ0_JANSC/241-379------------------ICFAAGTRIATPRG.Q-------------V---------AVED--L--RVGDRVVT---RD.
A4EIH6_9RHOB/690-837------------------VCFAEGTLIKTDQG.L-------------R---------PIEY--L--QVGDLVAT---LD.
B5J379_9RHOB/742-889------------------VCFVLGTLIATAGG.E-------------I---------PVEH--L--KVGDLVQT---RD.
C9CTM7_9RHOB/120-267------------------VCFVRGTMIEADTG.L-------------T---------AVED--L--RAGTLVRT---SD.
A4EL36_9RHOB/35-182------------------FCFSRGSRIETPHG.P-------------R---------AVED--L--AIGDLVVT---KD.
C9D2P0_9RHOB/151-297------------------VCFCAGTLIETAQG.Q-------------R---------PVED--L--RPGDMIVT---A..
A3V7F0_9RHOB/249-396------------------VCFTKGTMIATASG.A-------------K---------AVED--L--QPGDLVLT---RD.
A3XC10_9RHOB/338-477------------------ACFMAGTRIETEQG.P-------------V---------AIEN--L--EPGMMIQT---YD.
A3JZG9_9RHOB/189-327------------------LCFARGTLIETPGG.P-------------R---------FVET--L--KEGDLVVT---QD.
A3W5R9_9RHOB/184-322------------------VCFVSGTLIETPTG.P-------------Q---------SIET--L--QVGDLVNT---MD.
Q5LPM0_SILPO/507-646------------------ICFTPGTLIATAHG.P-------------R---------AIET--L--RPGDLIVT---RD.
A3SHB9_9RHOB/143-290------------------ACFTPGTMIETAEG.P-------------R---------AIET--L--RPGDLIET---RD.
A3TTF8_9RHOB/31-178------------------VCLAAGTRVLTTRG.E-------------R---------AIEN--L--AVGDLVVT---AD.
B6BEV2_9RHOB/337-476------------------PCFLRGTLIRVPGG.E-------------V---------PVED--L--RPGMEVLT---LD.
A3JMU4_9RHOB/108-255------------------PCFSAGTMIETNRG.Q-------------V---------LVEN--L--SAGDMVRT---MD.
C9CXZ7_9RHOB/141-288------------------ACFTPGTRIETQNG.A-------------V---------PIEA--L--QPGDMIAT---RD.
Q28L14_JANSC/1268-1415------------------PCFTPGCRVATARG.T-------------S---------KVED--L--RVGDLIET---HD.
D0CSG1_9RHOB/199-337------------------PCFTRDTLIETPNG.P-------------T---------PVQD--L--RAGDLVET---VD.
Q1GGN0_SILST/194-341------------------VCFTPNAQVTTPEG.P-------------R---------RIRD--L--AVGDRVLT---RD.
B6AV64_9RHOB/37-183------------------PYFTPDTLIKTDFG.E-------------V---------PVEM--I--AVGTRVLT---RD.
Q5LSZ7_SILPO/803-941------------------TCFCRGTLIATAGG.E-------------I---------PVEK--L--RPGDRVIT---RD.
C9CRM1_9RHOB/318-465------------------ICFCAGTCIETARG.H-------------R---------PVEE--L--QPGDLVKT---VD.
A3K151_9RHOB/707-851------------------ICYTPGTRILTTAG.Y-------------R---------AVET--L--RPGDLIVT---RD.
A3SL99_9RHOB/129-267------------------PCFVAGTMIATQKG.E-------------V---------AVED--L--RAGDMVLT---RD.
A3JLQ1_9RHOB/336-475------------------ACFVAGSLITTPLG.P-------------I---------PIEN--L--NVGDRVVT---LD.
A6FVP9_9RHOB/45-184------------------ICFTPGTMILTETG.E-------------C---------PIET--L--RPSDRVIT---RD.
Q6SF13_9BACT/2229-2376------------------VCFAKGTLLRTVTG.D-------------K---------PVEQ--V--TSGDLVWT---QD.
Q5LPJ7_SILPO/175-322------------------PCFVAGSLIDTVEG.P-------------R---------PVET--L--AVGDLVPV---ED.
A3VA21_9RHOB/151-298------------------VCFGSDTRIETPDG.L-------------R---------KVVR--L--KPGDLVNT---VD.
B6AYB0_9RHOB/160-302------------------TCFTTGALIATRNG.A-------------L---------SVED--L--RVGDELPT---RD.
Q2CAT6_9RHOB/160-307------------------ICFTPGTLIRTERG.A-------------L---------PVER--I--AEGTRVQT---KD.
B6B317_9RHOB/170-318------------------LCFGSGTLITTIDG.E-------------T---------PVEN--L--KLTDQILT---LD.
B9NQR9_9RHOB/142-290------------------PCFTAGTRILTDKG.E-------------V---------LVEH--L--KPGDRLVT---LD.
A3SR39_9RHOB/268-419------------------HCLVAGCSVSTPTG.A-------------R---------QVET--L--REGDEVSL---WH.
B9NUP1_9RHOB/171-309------------------PCFVAGTLVDTPDG.P-------------R---------RVET--L--APGDHVLT---VD.
B6AZD3_9RHOB/512-660------------------LCFASGTMIKTIDG.E-------------R---------AIET--L--TVGDRVLT---MD.
B6B2Z4_9RHOB/167-315------------------PCFESGTLIETLQG.P-------------V---------RIEN--L--KVSDLVLS---YD.
A3SQF2_9RHOB/166-304------------------VCFMAGTLIATDRG.P-------------R---------RIET--L--QPGDRLRT---LD.
A3XDE7_9RHOB/339-478------------------PCFVAGTLIDTPTG.L-------------V---------AIEH--L--EPGDLVLT---RD.
B5KDV6_9RHOB/120-258------------------PCFTAGTLIETDRG.M-------------T---------PVEQ--I--QVGDLVRT---LD.
A3SHZ7_9RHOB/146-292------------------VCFVDGTAIDTPDG.P-------------V---------PVEN--L--QIGDQVST---.E.
A3JSG0_9RHOB/151-289------------------ACFTKGTFIMTPTG.N-------------R---------LIEE--L--RCGDLVNT---LD.
A3JT50_9RHOB/142-280------------------ACFAEGMRIDTPTG.P-------------K---------LVQD--L--QIGDLVLT---KD.
Q1GMQ5_SILST/293-432------------------PCFVAGTLIDTEAG.P-------------I---------AVED--L--TVGMQVMT---RD.
C7DBW6_9RHOB/268-415------------------PCFTAGTMIETDTG.P-------------Q---------LVQF--L--KPGDMLRT---YD.
A9DWF7_9RHOB/194-340------------------ACFTRGTLITTDRG.D-------------L---------PVEA--L--SPGMRVLT---.Q.
B7QQ35_9RHOB/162-309------------------VCFAQGTRLRTPAG.E-------------V---------AVEN--M--QIGEYLQT---LD.
Q5LLZ7_SILPO/144-282------------------ACFAAGTFIEIESG.P-------------I---------PVET--L--RPGDLVQT---LD.
B7RNT5_9RHOB/692-831------------------VCFAAGTVILTPEG.E-------------V---------PIEA--L--RPGDLVVT---RD.
B7RP36_9RHOB/563-698------------------VCFTTGTAIRTPRG.D-------------V---------LIET--L--RVGDLVVT---AD.
A3JVK2_9RHOB/381-520------------------ACFVAGTEVMTPDG.P-------------R---------LIEK--L--VAGDLVNT---RD.
B5KCW8_9RHOB/153-299------------------VCLTKDTLIDTPNG.P-------------T---------LVQD--L--RAGSIVDT---L..
C8RZS8_9RHOB/219-358------------------VCFVAGTQIATPQG.P-------------R---------AVQD--L--RAGDLVCT---LD.
A8LR09_DINSH/158-296------------------PCFMAGTRIRTPDG.L-------------R---------PVEA--L--RPGDRVWT---RD.
A3VAC1_9RHOB/181-319------------------PCFLAGTRIDVASG.T-------------K---------PVER--L--RPGDLVHT---LD.
C7JHN5_ACEP3/423-565------------------VCFLSGSMIRTPDG.D-------------V---------AVED--I--QIGDQVVT---FDW
A3VHZ3_9RHOB/168-315------------------VCFAAGTSIDTPTG.P-------------R---------PVET--I--AVGDLVVT---LD.
Q28SX3_JANSC/168-306------------------ICFAQGTLIATPDG.D-------------V---------AVEE--L--AVGGLVST---VE.
A8LK48_DINSH/203-343------------------PCFARGTRIDTPEG.P-------------V---------RVEE--L--CPGDLVLT---RD.
A3JYU7_9RHOB/143-282------------------TSFTAGTLITMASGAQ-------------K---------PVEE--L--AAGDRVLT---RD.
Q5LMP8_SILPO/160-307------------------ICFAAGTRIATPKG.A-------------R---------PVET--L--AVGDLVQT---LD.
Q2CD05_9RHOB/27-169------------------VSFAAGTCIATPRG.E-------------I---------AIER--L--AVGDRVLT---RD.
A9EEF5_9RHOB/1099-1235------------------VCFTAGTAIRTPKG.E-------------V---------QITD--L--QVGDLVCT---LD.
Q2CCZ2_9RHOB/165-310------------------ACFTAGTLIETPMG.A-------------V---------AVEL--L--RPGDLVST---VD.
A6FPB3_9RHOB/928-1068------------------ICFADGTLIETPRG.L-------------V---------PVEK--L--AAGDMVRT---ID.
Q28UB5_JANSC/126-273------------------VCFTAGSLIETPSG.P-------------R---------RIEN--L--QRGDLVLT---AE.
B6AZM7_9RHOB/573-711------------------ICFTPGTMIDTPFG.Q-------------R---------AVET--L--KAGDLVTT---LD.
A3VMW9_9RHOB/142-280------------------VCFAAETRIETDRG.L-------------V---------RIDE--I--AVGDRVAT---LD.
Q1GMV1_SILST/833-976------------------PCYTPGSRVITARG.E-------------V---------PVEE--I--REGDLVQT---AD.
B6B239_9RHOB/383-521------------------ACFTAGTLIDTDEG.P-------------I---------AVEH--L--TSDMRLTT---KD.
A5FZD4_ACICJ/193-329------------------PCFAAGTQIRTPAG.E-------------T---------PVES--L--RAGDAVLT---AT.
A3W415_9RHOB/142-281------------------VCFAAGTGIATPKG.A-------------R---------RVET--L--EPGDRVET---RD.
B1ZBT1_METPB/133-268------------------VCFVTGTRIRTERG.E-------------V---------AVED--L--QIGDLAVT---AS.
C7CEK6_METED/138-280------------------PCFTTGTLIRTARG.E-------------V---------AVED--L--RVGDLAIT---AS.
A4ESK2_9RHOB/784-931------------------PCFTPEVLLATMRG.A-------------V---------PAGE--I--QVGDLLQT---AD.
B6B425_9RHOB/122-269------------------VCFAEGTMIETDQG.P-------------C---------LVER--L--EPDARIAL---AG.
B9JK11_AGRRK/201-336------------------SCFLRGTLIRTPEG.D-------------L---------PVED--L--RVGDLVVT---H..
C8S0F9_9RHOB/2250-2389------------------PCFATDTRILTPQG.E-------------R---------LVQD--L--RAGDLVQT---LD.
A3VJF5_9RHOB/166-311------------------VCFTAGTMIDTPSG.P-------------V---------PAER--L--GPGDLVRT---LD.
C9CXD1_9RHOB/645-786------------------PCFTAGTLIETARG.P-------------C---------PVET--L--RVGDQLQT---AD.
Q28TH9_JANSC/752-887------------------VCFTRGTAIRTPRG.E-------------V---------LIED--L--RVGDLVDT---LD.
A5G1S8_ACICJ/159-294------------------ACFAEGTRIATTRG.D-------------V---------PVEE--L--AKGDAVLL---HG.
B0T7Q3_CAUSK/153-288------------------PCFAEGTRLTTARG.A-------------V---------AVED--L--VEGDEVVT---AS.
C7JE32_ACEP3/536-676------------------VCFLPGGMIATPDG.E-------------H---------AVET--L--RPGMSVLT---FD.
B7KU45_METC4/258-393------------------ICFTPGTRIATPDG.E-------------R---------AIEH--L--QPGDVVSL---AD.
B8IA31_METNO/149-285------------------PCFVSGTHIRTARG.E-------------V---------SVED--L--AIGDVVVT---VS.
A5G006_ACICJ/174-309------------------VCFLEGTRIFGLNG.D-------------I---------PVET--M--NRGDRLIT---KS.
A3VFB5_9RHOB/155-300------------------ACFGPDTLIETPSG.A-------------R---------RVCD--L--RAGDKALT---LD.
D2CKZ0_9GAMM/93-241------------------CAMARGSLIATIDG.P-------------V---------AIED--L--LPGTLVHT---RN.
B6AU02_9RHOB/46-193------------------VCFNHGTIIATESG.P-------------V---------LVEN--L--QSGGMIRT---MN.
A5FW80_ACICJ/285-421------------------PCFARGTLILTREG.L-------------R---------PVET--L--AAGDEVVT---AD.
A3VJV0_9RHOB/145-290------------------VCLTAGAMVATPDG.P-------------V---------RTDR--L--RRGDAVLT---LD.
A8LLK3_DINSH/164-305------------------PCFRAGTRIVTPKG.A-------------V---------PVES--L--RPGDEVLT---LD.
Q5FQG8_GLUOX/285-425------------------ICYLAGTMILTPEG.E-------------R---------AIET--L--EAGDKVMV---YA.
C8RY96_9RHOB/128-267------------------LAFVRGTRITLAGGAQ-------------V---------AIEA--L--QPGDRVLT---RD.
B0UJT1_METS4/116-254------------------PCYCTGTLLRTVDG.D-------------V---------AVEN--L--RVGDLVVT---AS.
A3JW88_9RHOB/167-310------------------VCFAAGTMIKTPYG.D-------------R---------PIEN--L--CVGDQIFV---HN.
B2SAQ3_BRUA1/14-150------------------RCLLKGTLVTTPNG.P-------------V---------AVEK--L--CVGDLVTT---VS.
Q2CAV0_9RHOB/70-218------------------AAFARGTLIATERG.P-------------V---------AIED--L--LPGDEVKT---VD.
O68085_RHOCA/442-581------------------PCFTAGTLIETPRG.P-------------V---------PVES--L--RAGDLVVT---RD.
D0CWR5_9RHOB/156-294------------------ICYGPGTLIETERG.P-------------V---------AVED--L--VVGDRVWT---LD.
Q5LUZ7_SILPO/68-216------------------CAFSRGSLIDTDCG.P-------------M---------AIED--L--LPGDRVIT---QD.
A3W580_9RHOB/62-208------------------SAFARGTLITTTRG.P-------------V---------AIED--L--LPGDLVDT---AA.
D0D5E7_9RHOB/33-180------------------TAFARGTLIPTVRG.P-------------V---------AIED--L--LPGDYVQS---.S.
Q0BS96_GRABC/3687-3823------------------PCYVHGTLILTDRG.E-------------V---------PVED--L--QIGDHVIT---AG.
B1M2P7_METRJ/65-199------------------PCYCTGTTIRTDRG.D-------------V---------AVER--L--VVGDSVVT---AA.
A3W8K4_9RHOB/154-299------------------ICYAEGTDILTLTG.H-------------K---------KVES--L--QPGDYVMT---LD.
A3VEX8_9RHOB/9-155------------------PGFGPGTHVMTTDG.E-------------L---------PVEW--L--ATGDRVLT---RD.
A3JSM6_9RHOB/118-255------------------NCFTAGTQIATAQG.N-------------A---------LVED--I--VAGDVIKT---AD.
A3SRN1_9RHOB/161-308------------------LCLTSEVPVRTPLG.Y-------------R---------PCHK--L--RAGDLVWT---LD.
Q1N7J0_9SPHN/211-348------------------VCFLRGTMIDTDQG.E-------------I---------AVED--I--KAGDRVLC---R..
A9DUV0_9RHOB/49-194------------------AAFARGTLIQTVQG.D-------------I---------AIED--L--QPGDIINT---SS.
A6FV85_9RHOB/70-218------------------SAFARGTLIRTTQG.Q-------------V---------AVED--L--MPGCEIDT---AE.
A3JS61_9RHOB/164-301------------------SCFLAGTHISTPKG.D-------------V---------AIET--L--KAGDEILT---AD.
A3VAX2_9RHOB/110-257------------------LCFGAGTLIATAEG.E-------------A---------RVED--L--GPGDRVLD---AF.
A6E265_9RHOB/196-333------------------NCFFAGSRIATPSG.M-------------K---------AIEE--L--AVGDQIMT---AS.
C7D8E1_9RHOB/33-181------------------AAFGRGTIFETEFG.P-------------T---------AVED--L--LPGDKVMT---QD.
Q1MD68_RHIL3/83-221------------------NCFLRGTAILTDCG.E-------------K---------PVEN--L--SIGDRVAL---PD.
A5FVL4_ACICJ/410-545------------------PCFRHGTRLLTPSG.L-------------R---------PVET--L--SEGDEVIT---LR.
A3JWF1_9RHOB/121-260------------------TCFAAGTAIGTPTG.E-------------T---------LVEG--L--QIGDLITT---MD.
A4YQ57_BRASO/106-246------------------LCFLRGTRIMTATG.E-------------R---------AIEE--L--AAGDVLPT---VF.
B6B9L0_9RHOB/67-214------------------CAFSRGSLVETASG.P-------------I---------AVED--L--LPGDEILT---SG.
A3JPL6_9RHOB/158-295------------------QCFAPDTMIATENG.N-------------K---------TVQE--I--VVGDVLRK---AR.
A5FWA2_ACICJ/1192-1328------------------PCFARGTRLLTAEG.Y-------------R---------PVET--L--RPGDRLVT---ED.
A3S7N1_9RHOB/69-214------------------SAFAHGTLIRTTQG.E-------------I---------PVED--L--CPGDRIVQ---AD.
A3V9D9_9RHOB/136-275------------------GSFARGTRITMADGQM-------------R---------GVET--L--VPGDLVLT---RD.
A9GL51_9RHOB/726-866------------------PCFTAGTLIDTPTG.P-------------V---------RAED--L--SPGDYVTT---LG.
B6AWU4_9RHOB/33-181------------------SAFARGALISTPMG.P-------------V---------AIED--L--YPGDLVDT---VD.
C3KQV1_RHISN/76-214------------------MCLLRGTSIMTPSG.E-------------V---------RIEA--L--RIGDLVAT---VR.
B7RGP3_9RHOB/19-157------------------TGLTAGTSIETANG.N-------------R---------TIDW--L--RLGDLIET---LD.
A3VKC8_9RHOB/32-181------------------SGLAPSAVVETIDG.P-------------K---------LSRD--L--KAGDQVIT---RD.
B7RR26_9RHOB/132-273------------------ICFLKGTHILTPHG.W-------------Q---------TVEL--L--RCGDLVTD---VK.
A3JPP3_9RHOB/102-239------------------ACFSEGALIATPTG.E-------------L---------AIES--L--SINDEILT---AD.
A9G7V6_9RHOB/181-329------------------AGLIPETKIATPDG.E-------------T---------SLGQ--L--RRGDLVLT---PE.
A3TTS1_9RHOB/32-176------------------NAFAHGSLIATETG.D-------------V---------AVED--L--RPGMQVLT---RE.
B5J8X8_9RHOB/33-181------------------GSLARGALLKTDRG.V-------------V---------AIED--I--LPGDKVKT---AT.
A3W2P6_9RHOB/178-317------------------PGLSASVPVCTPQG.Y-------------V---------PAGH--L--KRGDLVDT---DE.
A3SKF2_9RHOB/139-280------------------ICYARGTRVETDDG.P-------------A---------RVEE--L--RRGDRVRV---LG.
A3JS38_9RHOB/159-295------------------NCFLTGTRILTPTG.Y-------------K---------AVET--L--AQGDLITT---AA.
A6DXP5_9RHOB/101-239------------------ACFAEGTRIATAEG.D-------------I---------NVED--L--EIGTQVVK---SD.
A3SRA3_9RHOB/68-209------------------SAFARGTLITTTQG.P-------------V---------AVED--L--VPGMLIQT---RE.
A8LKB8_DINSH/19-167------------------TGLACDAHVRTPCG.E-------------R---------RVEF--L--RPGDLIVT---RS.
A3SI78_9RHOB/178-317------------------PGICASVPIATPEG.P-------------R---------PISL--L--RRGDQVLT---AC.
A3V3N0_9RHOB/64-210------------------GALGRGTILQTRHG.P-------------V---------AVED--L--LPGDSLRL---ID.
A3JS40_9RHOB/158-295------------------NCFTAGTKIDTPSG.P-------------K---------NIEN--L--AKGDFVTT---MQ.
A3Z148_9SYNE/71-210------------------VCILAGTLLATPSG.D-------------R---------AIES--L--KPGDQIIT---AD.
A3JT43_9RHOB/20-157------------------KCFLQNTHVTTLRG.E-------------I---------QVEH--L--DNADFVQT---PD.
A4EJ24_9RHOB/71-219------------------AALGHSAIVQTQNG.H-------------M---------SVED--V--LPGDEVRL---SD.
C9CYM4_9RHOB/179-319------------------PGLFADTPVETETG.L-------------R---------PIGA--V--RRGDLLRC---AN.
C7D959_9RHOB/18-157------------------GGLAIGTLIETGSG.P-------------H---------RVEH--L--MRGDLVKT---LD.
A3XDE1_9RHOB/175-315------------------PGLDPATPVATPQG.Y-------------R---------RVDS--L--KRGDLVLS---ET.
Q5LN78_SILPO/204-343------------------PSLHPETPIATPDG.Y-------------R---------PLSK--I--RRGDTVIV---AS.
A6FNZ8_9RHOB/22-159------------------TGLLAHSIILTLDG.A-------------K---------PVGH--V--QAGDRVIT---RD.
A6DX68_9RHOB/142-284------------------LGLVAGTGILTPTG.E-------------R---------NVQT--L--VAGDRVLD---TS.
C7DFW9_9RHOB/173-311------------------PGLSGAARIRTTKG.I-------------V---------AANK--V--RPGDLVQM---HD.
B7QV01_9RHOB/186-327------------------AGLAPETLVATPSG.P-------------T---------QISQ--L--KRGDLILS---ET.
B7RNA8_9RHOB/11-157------------------SGFGPGAMIMTMEG.E-------------L---------PVEW--L--ESGDRLIT---RD.
A6E3T2_9RHOB/4-141------------------CGLLADSIILTLDG.E-------------R---------RVAD--L--NVGDRVIT---RD.
A3X8D5_9RHOB/25-168------------------GGFLSGTHVASNLG.W-------------R---------PVEA--L--CAGDKVLT---FD.
A3JQA1_9RHOB/57-194------------------SCLPELALMQTPDG.I-------------R---------TLDE--L--YAGDKLLT---KD.

PF05203

Q8J0G3_ZYGBI/11-460-------------------CFAKGTEVMMSDASV-------------K---------TVES--V--KVGEQVMG---KD-
Q8J0G2_ZYGRO/19-468-------------------CFAKGTEVMMSDGSI-------------K---------EVEG--I--EVGQEVMG---KD-
Q8J0G5_9SACH/19-473-------------------CFAKGTKVLLHDGSL-------------R---------AIES--I--EVGEDVMG---VD-
Q8J0G6_9SACH/19-474-------------------CFAKGTPVMMHDGSV-------------K---------AIET--I--NVGEEVMG---AD-
Q8J0G4_ZYGBA/19-474-------------------CFAKGTEVMMHDGSV-------------K---------AIET--I--EAGEAVMG---TD-
Q9P986_SACPS/1-465-------------------MLSENTTILMANGEI-------------K---------DIAN--V--TANSYVMC---AD-
A7TIB9_VANPO/1-464-------------------MFEEGTRIIMADGTS-------------K---------DISE--I--IPNDFIMC---ED-
C5DTQ4_ZYGRC/1-464-------------------MLEEGTKLLMANGQI-------------K---------DVGK--L--DVGEMVMC---ED-
Q707W4_KLUDE/1-464-------------------MFDINTTVVMANGEI-------------K---------KVCE--L--TVNSLVMC---DD-
Q707W9_CANGB/1-464-------------------MFEKGTFILMADGHL-------------E---------DISA--I--KSNSYVMC---ED-
Q6TER1_CRYNE/36-207-------------------CLQNGTRLLRADGSE-------------V---------LVED--V--QEGDQLLG---PD-
Q1KMS2_AJECA/5-539-------------------CLAKGTQLLRYDGTK-------------V---------GVEN--V--REGDLLLG---PD-
Q1MSX1_PENEN/51-212-------------------CLAKGTRLLRYDGTE-------------I---------NVED--V--REGDQLLG---PD-
C5FT71_ARTOC/1506-2056-------------------CLANGTMLLRYDHSQ-------------V---------AVED--V--KEGDLLLG---PD-
Q1A775_9EURO/44-198-------------------CLAKGTRLLRYDGSE-------------I---------EVQD--V--KEGDLLLG---PD-
Q1ECT9_EMEND/1526-2130-------------------CLANGTQLLRYDGTK-------------V---------NVED--V--KEGDLLLG---PD-
Q1A774_ASPGI/56-222-------------------CLAKGTRLLQYDGSE-------------I---------EVQD--V--KEGDLLLG---PD-
B9XA08_9BACT/492-829-------------------CHEKGAMILLADGSV-------------K---------KVED--V--RVGDELQG---WD-
A6QC64_SULNB/206-549-------------------CLGKGTNVLMYDGTL-------------K---------KVED--V--KVGDQLMG---DD-
Q2S6J9_SALRD/231-574-------------------CLGKGTPVMMYDGRT-------------K---------PVEK--V--EVGDRLMG---DD-
A3EZR5_9CAUD/34-380-------------------CLKRGTEVIMFDGTT-------------K---------KVED--V--IVGDVLMG---PD-
Q5G7M7_9CAUD/35-373-------------------CHAYGHDIMMSDGTK-------------K---------QVQD--I--AVGDKVMG---PD-
A8BML4_GIAIC/4-440-------------------GLAKEQKVRLYLGGL-------------K---------NVEQ--L--MKGDVLMG---DD-
A1ZUM1_9BACT/19-423-------------------GFVAGTQILMKDGSS-------------K---------NIED--I--KDGEEVMS---PD-
Q6BRM0_DEBHA/283-676-------------------CFAKGTEVLMADGSN-------------K---------NIEE--V--QIGESVLG---KD-
Q874G6_KLULC/277-686-------------------CFSKGTEVMMGDGKD-------------E---------LIEN--I--QVGDEVMG---RD-
Q874G7_CANGB/277-691-------------------CFAKGTQVLMADGSN-------------Q---------SIEN--I--KIGDKVMG---QD-
B6JY11_SCHJY/278-753-------------------CFAKGTEVLMANGAD-------------K---------KIED--V--VIGDKVMG---KD-
Q8J0G9_9SACH/19-519-------------------CFAKGTQVMMADGSD-------------K---------SIEE--I--QIGEQVMG---KD-
Q874G5_NAUCA/266-782-------------------CFAKGTEVLMADGSD-------------K---------AIEA--I--EVGEQVMG---KD-
Q874G1_9SACH/246-659-------------------CFEKGTEVLMADGTD-------------K---------VIED--I--TIGEQVMG---KD-
Q8J0G8_SACEX/19-520-------------------CFAKGTQVMMADGTD-------------K---------SIED--I--QLGENVMG---KD-
C5M9I6_CANTT/244-714-------------------CFTKGTQVMMADGAD-------------K---------SIES--I--EVGDKVMG---KD-
A5DXZ0_LODEL/280-700-------------------CFTKGTQVMMADGKD-------------K---------SIED--V--QLGELVMG---KD-
A3LP04_PICST/283-731-------------------CFAKGTKVLMANGDD-------------K---------NIED--I--AVGEEVLG---KD-
A7TLB5_VANPO/284-716-------------------CFAKGTEVMMADSSI-------------K---------NIED--I--EIGDLVMG---QD-
E9P8D3_YEASX/259-712-------------------CFAKGTNVLMADGSI-------------E---------CIEN--I--EVGNKVMG---KD-

PF01079

Q7PXI1_ANOGA/295-503SDS.......SQS.SHTSGCFTGDSTVLTEAGVH-------------R---------KLSE--L--RIGERVQA...VD.
HH_DROHY/253-475SDS.......SPSISHMHGCFTPESTALLESGAE-------------K---------ALGE--L--AIGDRVLS...MD.
HH_DROPS/255-475SDS.......SIS.SHVHGCFTPESTALLESGIT-------------K---------PLSE--I--SIGDRVLS...MG.
Q1HEQ6_TRICA/99-299SES.......SQA.AKYGGCFSGESTVLTSTGLR-------------R---------NLSS--L--QIGEKIQA...LDP
SHH_CYNPY/190-418AEN.......SVA.AKSGGCFPGSATVALEQGVR-------------I---------PVKD--L--RPGDRVLA...AD.
A0JM37_XENTR/187-392ADN.......SLG.VRSGGCFPGTAMVMMASGEK-------------K---------SLSE--L--QLGDTVFT...TD.
Q2QJG8_9ANNE/186-383SDS.......SIT.AKTGGCFSADDTVKRVDGSS-------------L---------PIQH--L--RIGDAIQA...ST.
IHH_DANRE/187-398SEH.......SVA.AKTGGCFPGRALVTMKDGSH-------------R---------QIRD--L--QAGDLVLASEGSD.
Q708D0_9MYRI/276-506SES.......SPA.AKSGGCFHGNSTVMTRRGGA-------------K---------LMSQ--V--SIGDELLA...LS.
TWHH_DANRE/190-403AEN.......SVA.AKSGGCFPGSGTVTLGDGTR-------------K---------PIKD--L--KVGDRVLA...AD.
WRT4_CAEEL/327-547APAGYAPMGFAPSGLQLYYCFPGDAMVNVYNGGF-------------K---------RMDE--L--AVGDWVQA...LDK
Q8AXT0_TAKRU/187-399AEN.......SVA.AKSGGCFPGSSTVTLQDGTK-------------K---------LVKH--L--RSGDRVLA...AD.
Q6BCD0_MERUN/188-423AEN.......SVA.AKSGGCFPGSATVHLEQGGT-------------K---------LVKD--L--RPGDRVLA...AD.
Q80XI9_MOUSE/230-435SEH.......SAA.AKTGGCFPAGAQVRLENGER-------------V---------ALSA--V--KPGDRVLA...MG.
Q75UQ8_PARTP/185-402SES.......ADA.GRSGGCFDGDSTVRTEAGPK-------------K---------.MSD--L--QVGERVQV...AR.
Q7Z264_9SCOR/158-375SES.......ADA.AKSGGCFQGNSVVLTKNGAK-------------K---------.MSE--L--DVGNEVLD...CS.
Q8MWG6_PATVU/190-409SDS.......SVA.IKIGGCFPGTGVLQTETG.W-------------K---------TMSQ--V--VAGDSVLS...MN.
WRT6_CAEEL/375-583SARGYSPNLNGLFGGTGMQCFSGDMEVETEDG.I-------------K---------MIKD--L--KIGDKVLS...MD.
A3KNS3_DANRE/187-399SEH.......SVA.AKTGGCFPASALVTIEDGRL-------------K---------TLES--L--QPGEKVLASSESD.
Q5UVJ3_STRPU/189-402SES.......AAA.KNSGGCFPGFSQASLENGRT-------------I---------SMLD--I--RVGDEVAV...VN.
O73803_TAKRU/190-436ADH.......SVA.VEKGGCFPGWSRVTVAGGFQ-------------K---------SLSS--L--TPGDRVMA...LS.
A8X447_CAEBR/327-545QPAGYFPYFSAPAGLELYYCFPADATVHVYDQGT-------------K---------RMDE--L--EVGDWVQA...FEK
IHH_CHICK/188-394SEH.......SAA.AKTGGCFPGRALATLENGAR-------------T---------PLWA--L--RPGQRVLA...MD.
SHH_XENLA/188-430AEN.......SVA.AKSGGCFPAGARVMVEFGGT-------------K---------AVKD--L--RPGDRVLS...SD.
SHH_CHICK/190-411AEN.......SVA.AKSGGCFPGSATVHLEHGGT-------------K---------LVKD--L--SPGDRVLA...AD.
Q1PHR2_SACKO/171-384AES.......SLA.AKSGSCFPGDATVTLENGLT-------------K---------SLDQ--L--TIGEKVMA...VN.
SHH_DANRE/187-404AEN.......SVA.AKSGGCFPGSALVSLQDGGQ-------------K---------AVKD--L--NPGDKVLA...AD.
IHH_XENLA/187-395SEH.......SAA.AKTGGCFPGEALATLESGEK-------------I---------PVSQ--L--SPGLRVLA...MD.
A2I5E3_LEUER/186-403AEN.......SVA.AKSGGCFPASARVSLENGDT-------------K---------QVKD--L--TPGDRVLA...AD.
O57567_NOTVI/188-392SEH.......SAA.AKTGGCFPARALATLESGEK-------------I---------PIAD--L--EPGHRVLC...MD.
WRT8_CAEEL/325-538QPVGY..APYAPAGWQLHYCFPADAEVNVYEKGV-------------K---------RMDE--L--EVGDWVQA...LH.
Q22872_CAEEL/566-779AAAAAAANPLSALVAATGACFSLDTWVTTPTG.K-------------K---------RMDQ--I--DIGDYVLT...AD.
Q49QW4_9MOLL/164-385SDS.......VAA.SNYGGCFPMNGQVTVQGKGT-------------V---------QLSQ--L--KVGDEVLA...LN.
DHH_HUMAN/188-396ADN.......SLA.VRAGGCFPGNATVRLWSGER-------------K---------GLRE--L--HRGDWVLA...AD.
Q8MY56_CIOIN/186-395ADN.......SDA.AKYGGCFDGVSEVRNESGSV-------------I---------PMNK--V--NVGDRILA...VDR
Q175B3_AEDAE/201-412SDS.......SQS.NHASGCFTGDSTVQTSTGET-------------R---------KLSE--L--QIGEQVLS...VD.
A2I5D9_POLSP/90-308AEN.......SVA.AKSGGCFPGSASVILQDGRN-------------K---------LVKD--L--NPGDKVLA...AD.
Q66PH6_9TELE/184-413AEN.......SVA.AKSGGCFPGSSHVRLKDSRQ-------------K---------ALKD--L--KPGDSVLS...AD.
A4UYK7_9ACTI/187-406AEN.......SVA.AKSGGCFPGSASVALKDGPQ-------------K---------TVKD--L--ARGDKVLA...AE.
Q9GRA8_GRYBI/198-413SES.......SQA.AKSGGCFAAESTVQTPGG.L-------------C---------ALAE--L--RVGRRGAG...AGP
Q9U5Z6_BRABE/191-404AES.......DTT.ATQGGCFPEESWVTRDDGKR-------------I---------RMRD--V--RPGDKVLS...MD.
Q4PLX3_DANRE/191-442ADH.......SVA.VEKGGCFSASGLVTMADGVQ-------------K---------PMSC--L--WPGEKVLS...VS.
O45992_CAEEL/258-471APYSY...LPAAPQCQQYYCFPNDAVVNVYEKAV-------------K---------RMDE--L--EIGDWVEA...LDE
Q8MY57_CIOIN/294-550SEE.......SDA.AKYGGCFPGESTVIVPGEGH-------------V---------PMSS--L--QPGDQVLA...ID.
Q9W7Q9_PAROL/187-400AEN.......SVA.AKSGGCFPGSSTVTLQDGTK-------------K---------PVKA--L--QTGDRVLA...AD.
Q7Z263_ARTSF/158-415SES.......SSA.ARSGGCFTGDSLVTLQDGEQ-------------V---------KMSD--V--RIGDRVLA...VD.

PF14623

F0YDN2_AURAN/823-991------------------GCVSGGSLVVRYGDRAP............L.........RADA--V--VAGDVLLD---A..
C0NJD1_AJECG/548-714------------------PCFAGHCNIRLAERNSS............L.........PIRD--I--RAGIKVWT---PL.
E4UR10_ARTGP/540-711------------------PCFTGSCRVRLAGSGSERVSPT.......I.........PIEY--L--RPPVSVWT---PQ.
D2VHB8_NAEGR/586-750------------------SCFDGNSLITMYDNSV.............K.........KVSE--I--KKGDRVKN---MN.
Q2GTB7_CHAGB/570-754------------------GCFAGCSPVLLAGGKGL............V.........RINR--L--RAGMEVVT---PC.
Q22N58_TETTS/494-660------------------GCIHGKCKVLLENNQY.............K.........NVEE--I--RKGDIVIC---PRI
E9EQB7_METAR/534-699------------------VCFAGSTPVELGSGRM.............V.........HIRR--L--RRGMKVRT---PT.
F2SQT7_TRIRC/537-709------------------PCFTGDCHIRISSKESEVINAT.......I.........SLEN--L--RPGMSVWT---PH.
C7YL43_NECH7/586-752------------------VCFAASTDVTLASGRI.............V.........QIRK--L--RRGMKVQT---PR.
E3QU32_COLGM/508-676------------------VCFASSTPVQLASGRT.............V.........PIKA--L--RRGAAVRT---PS.
Q237Q6_TETTS/509-673------------------PCFEGNSEVKMANGTI.............K.........KVKE--I--KKGDEVFC---PN.
C5FLY1_ARTOC/540-711------------------PCFTGNCRVLVSGNDASS.DAT.......I.........AIEN--L--RAGMSVWT---PH.
Q24C76_TETTS/502-666------------------GCIHGDSLVYLQNGKT.............K.........KVSE--I--RKGDVVQC---PEL
A9UVU8_MONBE/587-772------------------GCYSADSLVDLASVRAPGTTGDVAQRTGDVRNLAGAWQRRADA--I--RAGDVLAN---G..

PF07591

A3DGR7_CLOTH/105-234-------------------------LILTVAGLV-----------------------AIEN--I--KAGDKVIA---TNL
A5Z4R4_9FIRM/129-258-------------------------LVSTISGRC-----------------------AIDK--I--NVGDKVLS---ANP
A1KVQ7_NEIMF/353-489-------------------------LVKTADGYK-----------------------AIAH--I--RVGESVFA---KDE
Q5F6G7_NEIG1/1-137-------------------------MVRTADGYK-----------------------AIAH--I--QAGDRVLS---KDE

PF14890

A9B528_HERA2/384-526-----------------------DTQIYLPDQGHY------------V---------RIDQ--LVGQQGFNVLALNQAT-
DNAB_SYNY3/385-808-----------------------DSLISLASTGKR------------V---------SIKD--LLDEKDFEIWAINEQT-
GLMS_METJA/76-569-----------------------DTYVILPDG...------------.---------RMKK--ISEIDEDEVLSVNFED-
D7E146_NOSA0/393-538-----------------------DSLVRLTARGLQ------------V---------PMKE--LVGKSGFPVWALNEKT-
B5W0N0_SPIMA/394-525-----------------------DSLVTLADSRLP------------V---------PIRE--LVGKSDFSVVAINPDT-

PF10596

A6S230_BOTFB/991-1164--------------MWVPSHSRKTPMLVAQMFGN-------------V---------KEVP.CLLLRKKGSERY---IP-
Q5KPW2_CRYNJ/1640-1797--------------QQKYQLFRSTASVRHERPST-------------S---------KLDT.TLLR........---..-
A6R4K4_AJECN/1351-1497--------------FKTYQLMKSNPFWWTSQRHD-------------G---------KLWN..LNAYRTDVIQA---LG-
Q00RU5_OSTTA/1516-1683--------------FKEYNLTRQNPFWWTHQRHD-------------G---------KLWN..LNNYRTDVIQA---LG-
A8BTS5_GIAIC/1331-1491--------------KGISIGNALTLKSWYNKKLL-------------G---------SLYD..LQGYKKIITAI---FG-
A4IBT3_LEIIN/1514-1675--------------FQRYLAGKYLKNWWFHMEHD-------------G---------NICGGVMERYRADMNNA---LG-
Q9AW36_GUITH/1259-1418--------------LSRYILSTNNSFWWTSPKHE-------------G---------KLYN..LSSYNNQMIFR---LG-
Q3LWH1_BIGNA/1383-1542--------------FKKFYILKYNPFWWTDQKHD-------------G---------KLWN..LFNYKTDIIQA---LG-
Q6FQZ4_CANGA/1515-1674--------------FKQFSLDRPLAFWWTNAHHD-------------G---------KLWN..LNNYRTDVIQA---LG-
Q9XYM9_TRIVA/1432-1591--------------FKKYSLFKTNPYAWTHHHHD-------------G---------KLWN..LKDYRADVIQA---LG-
Q4PEC7_USTMA/1470-1629--------------FKKYQIAKAQPFAWTNQRHD-------------G---------KLHN..LNQLRTDTIAA---LG-

PF13403

A3PK18_RHOS1/14-160....NG...LQ--------P------------------------------------------------------------
A3SZU1_9RHOB/393-539....NG...LQ--------P------------------------------------------------------------
Q1GGP9_SILST/27-173....NG...IQ--------E------------------------------------------------------------
C8RY14_9RHOB/1350-1496....HG...LQ--------T------------------------------------------------------------
Q1GES6_SILST/157-304....NG...AQ--------V------------------------------------------------------------
A3SNQ6_9RHOB/641-788....NG...IR--------E------------------------------------------------------------
A3SUS4_9RHOB/185-331....NG...MQ--------K------------------------------------------------------------
D0CP51_9RHOB/143-290....HG...PQ--------P------------------------------------------------------------
C7DAD7_9RHOB/178-316....HG...YQ--------P------------------------------------------------------------
A9GA60_9RHOB/583-733....GG...PQ--------T------------------------------------------------------------
A1AYR4_PARDP/380-527....HG...CK--------A------------------------------------------------------------
A6DV24_9RHOB/336-474....DG...AQ--------P------------------------------------------------------------
A3VAW0_9RHOB/105-251....MG...VQ--------R------------------------------------------------------------
A3TXC6_9RHOB/29-175....HG...LQ--------T------------------------------------------------------------
A8LN65_DINSH/175-322....DG...AQ--------P------------------------------------------------------------
A1B4V8_PARDP/356-503....NG...LQ--------P------------------------------------------------------------
A3K5E2_9RHOB/849-996....NG...YQ--------P------------------------------------------------------------
B6BC88_9RHOB/475-613....NG...MQ--------P------------------------------------------------------------
A4EMR4_9RHOB/71-217....NG...IQ--------T------------------------------------------------------------
A3V1Q6_9RHOB/111-258....AG...LQ--------E------------------------------------------------------------
B7QV02_9RHOB/335-473....AG...LQ--------P------------------------------------------------------------
C9D0M9_9RHOB/1229-1376....AG...FQ--------P------------------------------------------------------------
Q0FQ52_9RHOB/227-374....NG...YQ--------P------------------------------------------------------------
D0CWS5_9RHOB/173-320....GA...AA--------P------------------------------------------------------------
D0CQ11_9RHOB/159-297....HG...LQ--------P------------------------------------------------------------
A8LKN9_DINSH/122-260....HG...AQ--------P------------------------------------------------------------
A3JWU1_9RHOB/200-347....AG...YQ--------P------------------------------------------------------------
A3VI53_9RHOB/624-762....RG...PQ--------P------------------------------------------------------------
A3SQF1_9RHOB/126-264....NG...YQ--------P------------------------------------------------------------
B5K4Q3_9RHOB/102-249....NG...CQ--------E------------------------------------------------------------
A3JUC9_9RHOB/546-693....DG...FR--------P------------------------------------------------------------
A3W238_9RHOB/563-702....HG...PQ--------P------------------------------------------------------------
B9NR62_9RHOB/115-262....HG...MQ--------P------------------------------------------------------------
C7D8K4_9RHOB/545-684....HG...LQ--------P------------------------------------------------------------
Q28WJ0_JANSC/241-379....GG...IQ--------A------------------------------------------------------------
A4EIH6_9RHOB/690-837....NG...AQ--------P------------------------------------------------------------
B5J379_9RHOB/742-889....RG...LQ--------P------------------------------------------------------------
C9CTM7_9RHOB/120-267....GG...FK--------P------------------------------------------------------------
A4EL36_9RHOB/35-182....SG...VQ--------A------------------------------------------------------------
C9D2P0_9RHOB/151-297....RG...LR--------P------------------------------------------------------------
A3V7F0_9RHOB/249-396....HG...LQ--------P------------------------------------------------------------
A3XC10_9RHOB/338-477....NG...FQ--------P------------------------------------------------------------
A3JZG9_9RHOB/189-327....DG...PQ--------P------------------------------------------------------------
A3W5R9_9RHOB/184-322....EG...AK--------P------------------------------------------------------------
Q5LPM0_SILPO/507-646....HG...LQ--------P------------------------------------------------------------
A3SHB9_9RHOB/143-290....HG...LQ--------P------------------------------------------------------------
A3TTF8_9RHOB/31-178....RG...AV--------P------------------------------------------------------------
B6BEV2_9RHOB/337-476....NG...PQ--------V------------------------------------------------------------
A3JMU4_9RHOB/108-255....AG...FQ--------P------------------------------------------------------------
C9CXZ7_9RHOB/141-288....RG...YQ--------P------------------------------------------------------------
Q28L14_JANSC/1268-1415....NG...LQ--------A------------------------------------------------------------
D0CSG1_9RHOB/199-337....NG...TK--------P------------------------------------------------------------
Q1GGN0_SILST/194-341....NG...YQ--------T------------------------------------------------------------
B6AV64_9RHOB/37-183....NG...YQ--------T------------------------------------------------------------
Q5LSZ7_SILPO/803-941....RG...YQ--------R------------------------------------------------------------
C9CRM1_9RHOB/318-465....NG...LQ--------P------------------------------------------------------------
A3K151_9RHOB/707-851....DG...PQ--------P------------------------------------------------------------
A3SL99_9RHOB/129-267....AG...YQ--------P------------------------------------------------------------
A3JLQ1_9RHOB/336-475....GG...IQ--------K------------------------------------------------------------
A6FVP9_9RHOB/45-184....SG...VQ--------E------------------------------------------------------------
Q6SF13_9BACT/2229-2376....AG...YQ--------P------------------------------------------------------------
Q5LPJ7_SILPO/175-322....GP...PQ--------P------------------------------------------------------------
A3VA21_9RHOB/151-298....HG...PQ--------P------------------------------------------------------------
B6AYB0_9RHOB/160-302....RG...LQ--------T------------------------------------------------------------
Q2CAT6_9RHOB/160-307....NG...CR--------P------------------------------------------------------------
B6B317_9RHOB/170-318....DG...HQ--------P------------------------------------------------------------
B9NQR9_9RHOB/142-290....DD..APQ--------P------------------------------------------------------------
A3SR39_9RHOB/268-419....GG...QA--------I------------------------------------------------------------
B9NUP1_9RHOB/171-309....DG...AC--------P------------------------------------------------------------
B6AZD3_9RHOB/512-660....GN...YQ--------E------------------------------------------------------------
B6B2Z4_9RHOB/167-315....NG...YK--------P------------------------------------------------------------
A3SQF2_9RHOB/166-304....HG...WQ--------P------------------------------------------------------------
A3XDE7_9RHOB/339-478....SG...AQ--------P------------------------------------------------------------
B5KDV6_9RHOB/120-258....NG...LQ--------P------------------------------------------------------------
A3SHZ7_9RHOB/146-292....QG...PR--------A------------------------------------------------------------
A3JSG0_9RHOB/151-289....SG...RQ--------P------------------------------------------------------------
A3JT50_9RHOB/142-280....NG...AK--------P------------------------------------------------------------
Q1GMQ5_SILST/293-432....HG...PQ--------P------------------------------------------------------------
C7DBW6_9RHOB/268-415....GD...FK--------P------------------------------------------------------------
A9DWF7_9RHOB/194-340....GG...YQ--------E------------------------------------------------------------
B7QQ35_9RHOB/162-309....NG...PQ--------P------------------------------------------------------------
Q5LLZ7_SILPO/144-282....NG...LQ--------P------------------------------------------------------------
B7RNT5_9RHOB/692-831....NG...PK--------P------------------------------------------------------------
B7RP36_9RHOB/563-698....NG...PQ--------P------------------------------------------------------------
A3JVK2_9RHOB/381-520....DG...PQ--------P------------------------------------------------------------
B5KCW8_9RHOB/153-299....NG...AR--------P------------------------------------------------------------
C8RZS8_9RHOB/219-358....DG...AQ--------P------------------------------------------------------------
A8LR09_DINSH/158-296....DP...EA--------R------------------------------------------------------------
A3VAC1_9RHOB/181-319....HG...LQ--------P------------------------------------------------------------
C7JHN5_ACEP3/423-565KSNKTV...CR--------P------------------------------------------------------------
A3VHZ3_9RHOB/168-315....HG...PR--------P------------------------------------------------------------
Q28SX3_JANSC/168-306....HG...AE--------P------------------------------------------------------------
A8LK48_DINSH/203-343....HG...PR--------P------------------------------------------------------------
A3JYU7_9RHOB/143-282....DG...PQ--------E------------------------------------------------------------
Q5LMP8_SILPO/160-307....HG...PQ--------P------------------------------------------------------------
Q2CD05_9RHOB/27-169....SG...LR--------A------------------------------------------------------------
A9EEF5_9RHOB/1099-1235....NG...PQ--------P------------------------------------------------------------
Q2CCZ2_9RHOB/165-310....DG...PR--------P------------------------------------------------------------
A6FPB3_9RHOB/928-1068....HG...FR--------P------------------------------------------------------------
Q28UB5_JANSC/126-273....GM...AK--------P------------------------------------------------------------
B6AZM7_9RHOB/573-711....AG...AQ--------P------------------------------------------------------------
A3VMW9_9RHOB/142-280....HG...YQ--------E------------------------------------------------------------
Q1GMV1_SILST/833-976....NG...LQ--------P------------------------------------------------------------
B6B239_9RHOB/383-521....NG...FQ--------P------------------------------------------------------------
A5FZD4_ACICJ/193-329....GA...ER--------R------------------------------------------------------------
A3W415_9RHOB/142-281....HG...VQ--------R------------------------------------------------------------
B1ZBT1_METPB/133-268....GA...HK--------P------------------------------------------------------------
C7CEK6_METED/138-280....GT...LR--------P------------------------------------------------------------
A4ESK2_9RHOB/784-931....NG...FQ--------P------------------------------------------------------------
B6B425_9RHOB/122-269....GG...FV--------S------------------------------------------------------------
B9JK11_AGRRK/201-336....KG...VA--------E------------------------------------------------------------
C8S0F9_9RHOB/2250-2389....DG...PQ--------P------------------------------------------------------------
A3VJF5_9RHOB/166-311....HG...AQ--------V------------------------------------------------------------
C9CXD1_9RHOB/645-786....NG...LQ--------Q------------------------------------------------------------
Q28TH9_JANSC/752-887....NG...PQ--------R------------------------------------------------------------
A5G1S8_ACICJ/159-294....GG...TA--------P------------------------------------------------------------
B0T7Q3_CAUSK/153-288....GA...AR--------P------------------------------------------------------------
C7JE32_ACEP3/536-676....NGEITPK--------D------------------------------------------------------------
B7KU45_METC4/258-393....GA...VA--------T------------------------------------------------------------
B8IA31_METNO/149-285....GE...HR--------P------------------------------------------------------------
A5G006_ACICJ/174-309....GA...MR--------P------------------------------------------------------------
A3VFB5_9RHOB/155-300....NG...AQ--------E------------------------------------------------------------
D2CKZ0_9GAMM/93-241....NG...PQ--------P------------------------------------------------------------
B6AU02_9RHOB/46-193....HG...YQ--------S------------------------------------------------------------
A5FW80_ACICJ/285-421....GK...LV--------P------------------------------------------------------------
A3VJV0_9RHOB/145-290....SG...PQ--------P------------------------------------------------------------
A8LLK3_DINSH/164-305....HE...VQ--------T------------------------------------------------------------
Q5FQG8_GLUOX/285-425....NGTTSTQ--------T------------------------------------------------------------
C8RY96_9RHOB/128-267....HG...GQ--------P------------------------------------------------------------
B0UJT1_METS4/116-254....GE...HR--------P------------------------------------------------------------
A3JW88_9RHOB/167-310....EG...LQ--------V------------------------------------------------------------
B2SAQ3_BRUA1/14-150....GE...CL--------P------------------------------------------------------------
Q2CAV0_9RHOB/70-218....DG...YQ--------P------------------------------------------------------------
O68085_RHOCA/442-581....RG...AV--------P------------------------------------------------------------
D0CWR5_9RHOB/156-294....DG...LQ--------P------------------------------------------------------------
Q5LUZ7_SILPO/68-216....GS...AQ--------E------------------------------------------------------------
A3W580_9RHOB/62-208....HG...PL--------P------------------------------------------------------------
D0D5E7_9RHOB/33-180....EG...AQ--------P------------------------------------------------------------
Q0BS96_GRABC/3687-3823....EA...VR--------P------------------------------------------------------------
B1M2P7_METRJ/65-199....GL...RR--------P------------------------------------------------------------
A3W8K4_9RHOB/154-299....NG...SQ--------E------------------------------------------------------------
A3VEX8_9RHOB/9-155....HG...VQ--------P------------------------------------------------------------
A3JSM6_9RHOB/118-255....GK...MA--------T------------------------------------------------------------
A3SRN1_9RHOB/161-308....HG...YQ--------P------------------------------------------------------------
Q1N7J0_9SPHN/211-348....GG...LR--------T------------------------------------------------------------
A9DUV0_9RHOB/49-194....GE...PA--------Q------------------------------------------------------------
A6FV85_9RHOB/70-218....YG...PQ--------K------------------------------------------------------------
A3JS61_9RHOB/164-301....GR...QT--------K------------------------------------------------------------
A3VAX2_9RHOB/110-257....GK...VH--------E------------------------------------------------------------
A6E265_9RHOB/196-333....GR...IV--------P------------------------------------------------------------
C7D8E1_9RHOB/33-181....AG...LQ--------V------------------------------------------------------------
Q1MD68_RHIL3/83-221....GS...TR--------P------------------------------------------------------------
A5FVL4_ACICJ/410-545....GE...VR--------Q------------------------------------------------------------
A3JWF1_9RHOB/121-260....GR...DV--------P------------------------------------------------------------
A4YQ57_BRASO/106-246....GG...LR--------P------------------------------------------------------------
B6B9L0_9RHOB/67-214....GG...SQ--------P------------------------------------------------------------
A3JPL6_9RHOB/158-295....GG...LT--------T------------------------------------------------------------
A5FWA2_ACICJ/1192-1328....GT...AE--------P------------------------------------------------------------
A3S7N1_9RHOB/69-214....GL...HT--------P------------------------------------------------------------
A3V9D9_9RHOB/136-275....AG...KQ--------P------------------------------------------------------------
A9GL51_9RHOB/726-866....AG...VQ--------R------------------------------------------------------------
B6AWU4_9RHOB/33-181....GD...PM--------P------------------------------------------------------------
C3KQV1_RHISN/76-214....GP...AM--------P------------------------------------------------------------
B7RGP3_9RHOB/19-157....DG...LQ--------P------------------------------------------------------------
A3VKC8_9RHOB/32-181....NG...TA--------T------------------------------------------------------------
B7RR26_9RHOB/132-273....GT...VH--------P------------------------------------------------------------
A3JPP3_9RHOB/102-239....GQ...II--------T------------------------------------------------------------
A9G7V6_9RHOB/181-329....GD...AV--------P------------------------------------------------------------
A3TTS1_9RHOB/32-176....RG...PQ--------P------------------------------------------------------------
B5J8X8_9RHOB/33-181....ND...FQ--------T------------------------------------------------------------
A3W2P6_9RHOB/178-317....GQ...IV--------P------------------------------------------------------------
A3SKF2_9RHOB/139-280....GG...SA--------R------------------------------------------------------------
A3JS38_9RHOB/159-295....GG...TT--------V------------------------------------------------------------
A6DXP5_9RHOB/101-239....GT...LT--------R------------------------------------------------------------
A3SRA3_9RHOB/68-209....RG...PS--------P------------------------------------------------------------
A8LKB8_DINSH/19-167....DG...LQ--------P------------------------------------------------------------
A3SI78_9RHOB/178-317....GK...TA--------P------------------------------------------------------------
A3V3N0_9RHOB/64-210....GS...FA--------P------------------------------------------------------------
A3JS40_9RHOB/158-295....GD...AI--------E------------------------------------------------------------
A3Z148_9SYNE/71-210.....G...VM--------A------------------------------------------------------------
A3JT43_9RHOB/20-157....GD...WA--------A------------------------------------------------------------
A4EJ24_9RHOB/71-219....GS...YE--------T------------------------------------------------------------
C9CYM4_9RHOB/179-319....GD...LV--------P------------------------------------------------------------
C7D959_9RHOB/18-157....NG...FI--------P------------------------------------------------------------
A3XDE1_9RHOB/175-315....GG...SL--------P------------------------------------------------------------
Q5LN78_SILPO/204-343....GE...AV--------P------------------------------------------------------------
A6FNZ8_9RHOB/22-159....SG...MA--------I------------------------------------------------------------
A6DX68_9RHOB/142-284....GA...ER--------V------------------------------------------------------------
C7DFW9_9RHOB/173-311....GD...IA--------Q------------------------------------------------------------
B7QV01_9RHOB/186-327....GD...YI--------P------------------------------------------------------------
B7RNA8_9RHOB/11-157....HG...AQ--------P------------------------------------------------------------
A6E3T2_9RHOB/4-141....SG...TA--------V------------------------------------------------------------
A3X8D5_9RHOB/25-168....HG...MQ--------T------------------------------------------------------------
A3JQA1_9RHOB/57-194....GR...AV--------T------------------------------------------------------------

PF05203

Q8J0G3_ZYGBI/11-460----GK---PR..KVVAT.PSGCEKMYKVTQKVAHKRTHT........LNEPRGLSEYTCNATHKLVVRTPRICRSVIRK
Q8J0G2_ZYGRO/19-468----GK---PR..EVVGT.PSGREKMYKVSHKTAHRAHKSD......STSERFGLFEYTCNATHKLVVRTSRSCRPLVRN
Q8J0G5_9SACH/19-473----GE---RR..KVVGL.PRGREVMYKVSQKTTNRAHETA.....ETRSEPLGLFEYTCNATHKLVVRTPRSCRLLTRN
Q8J0G6_9SACH/19-474----GL---GR..KIVGL.PRGREVMYKVSQKTEHRAYETD.....ETRSAPVGLFEYTCNATHKLVVRTPRSCRTLNRT
Q8J0G4_ZYGBA/19-474----GQ---PR..KVVGL.PRGREVMYKVSQKTAHRVHKTD.....ETRAAPVALFEYNCNATHKLVVRTPRSCRSITRK
Q9P986_SACPS/1-465----GS---AA..RVINV.TQGYQEIYNIQQKTKHRAFEGEPGRLDPRRRTVYQRLALQCTAGHKLSVRVP.TKPLLEKS
A7TIB9_VANPO/1-464----GS---AA..KVTEV.SQDNQTTYQIVHNTKHRANEGDAARKDPLRKEIYQRLELNCTVAHELSLRTP.ATVNLENS
C5DTQ4_ZYGRC/1-464----GS---SA..KVTSV.ARDVQTTYQILQKTKHRANEGEAAEKDPLRREIHHRLGFQCSVAHELALRTS.MKPSVENC
Q707W4_KLUDE/1-464----GT---PA..RITHI.SSAHHTTYEIYQKTKHRANEGEPGRLDPRRKTVYQRLGFNCTGSHLIPLRVP.AIACLENS
Q707W9_CANGB/1-464----GT---PG..RVAYT.TKAKQTIYEIVQKTKHRANEGEPGRLDPRRRTVYNRLGFNCSATHKLVLKTP.SIPTLENN
Q6TER1_CRYNE/36-207----GT---SR..TASKI.VRGEERLYRIKTHE....................GLEDLVCTHNHILSMY...........
Q1KMS2_AJECA/5-539----GE---PR..RAFNI.VSGRDRLYRISIDA....................DKEDLVVTPNHILVLH...........
Q1MSX1_PENEN/51-212----GE---PR..RAFNI.VNGIDRLYRIKIAG....................EKEDLVVTPNHILVLY...........
C5FT71_ARTOC/1506-2056----GG---PR..RAFNI.VSGKDRLYRIKIES....................RKEDLVVTANHILVLH...........
Q1A775_9EURO/44-198----GG---PR..RAFNI.VSGEDRLYRIKIDG....................SVEDLVVTPNHILVLH...........
Q1ECT9_EMEND/1526-2130----GG---PR..RAFNV.VSGKDRLYRIKIDG....................DKEDLVVTANHILVLH...........
Q1A774_ASPGI/56-222----GG---PR..RAFNI.VNGEDRLYRIKIGG....................SQEDLVVTPNHILVLY...........
B9XA08_9BACT/492-829----GT---PR..RVLEL.RRGQDEMMRIVPT.....................KGEPFVVNINHILTLVRTNKS......
A6QC64_SULNB/206-549----ST---PR..NVLSL.ARGREEMYWVRQN.....................KGIDYRVNKSHILSLKRS.........
Q2S6J9_SALRD/231-574----GS---PR..TVQSL.ARGREQMYWVRQK.....................RGMDYRVNESHILSLKKS.........
A3EZR5_9CAUD/34-380----ST---PR..NVLSL.GRGREMMYEVKPR.....................KGESYTVNESHILSLRTTTGIA.....
Q5G7M7_9CAUD/35-373----GN---PR..KVIRL.VKGQDEMFRVTPT.....................KGESFVVNGGHILSLYQTPR.......
A8BML4_GIAIC/4-440----GN---PR..TISAV.HSSMSKTYTITYSSYLD...............VKDDRSFVCGDDAVLILIPDGNREVNRII
A1ZUM1_9BACT/19-423----GS---ERVLKVIQPSLHMRRNLYHIANQNGQ..................KVENFMFVDSQVFLTG...........
Q6BRM0_DEBHA/283-676----GE---AR..NVVAL.PRGNETMYEINESTPEEE.............ADLARIAFTCNAKHELVVNTKQDIAVEQNC
Q874G6_KLULC/277-686----GL---PR..QVVGL.PRGHDDMYQVTEKSEDN...............ETAKISFQCNSSHKLVLVTPQDIRLTESK
Q874G7_CANGB/277-691----GK---PR..NVTAL.PRGYDDMYNVELDGE...................TDLSYTCNSNHTLVLKTEQNVLLAGNT
B6JY11_SCHJY/278-753----GR---PR..DVVAL.PRGFDTMYTVSQKISRKGA............KSSNNLSYTCNATHKLVLKTPQQISLVEQV
Q8J0G9_9SACH/19-519----GN---PR..TVIAL.PRGKETMYEVCHITPHRTTS..........GENFGVMDYVCSGNHKLVLRTPQNVTLTTHE
Q874G5_NAUCA/266-782----GA---PR..TVIAL.PRGTETMYEVCHTTQHRNG...........NEKFGLMNYVCSGNHKLVLRTPQLIRTTIHE
Q874G1_9SACH/246-659----GQ---PR..EVVGL.PRGKMTMYQVCHKATEQN..............EIALMDYVCSGNHKFVLVTPQNVKITEHM
Q8J0G8_SACEX/19-520----GT---PR..TVISL.PRGKETMYEVCHSSIKGT.............TNETLMNYVCSGNHKIVMQTPQQIGITEHA
C5M9I6_CANTT/244-714----GM---PR..EVVGL.PRGYDDMYKVRQLSSTRRN...........AKSEGLMDFTVSADHKLILKTKQDVKIATRK
A5DXZ0_LODEL/280-700----GD---AR..KVVGL.PRGFDTMYKVEQIGHD..................DSLNFTVSADHKLVLKTEQRIEVTTRK
A3LP04_PICST/283-731----GL---PR..EVVAL.PRGRETMYEVSEKTQHRAE............TVFGTASYTCNATHKLVLQTNQRVNITNHV
A7TLB5_VANPO/284-716----GQ---PR..EVTQL.PRGSDKMYKVNEINENS...............TSELFSFVCNATHQLIVRTPRNIKVQTRI
E9P8D3_YEASX/259-712----GR---PR..EVIKL.PRGRETMYSVVQKSQHRAHKSD......SSREVPELLKFTCNATHELVVRTPRSVRRLSRT

PF01079

Q7PXI1_ANOGA/295-503A---AGRTVFS--------E------------------------------------------------------------
HH_DROHY/253-475V---KGQPVYS--------E------------------------------------------------------------
HH_DROPS/255-475S---NGQPVYS--------E------------------------------------------------------------
Q1HEQ6_TRICA/99-299S---TNELVFS--------E------------------------------------------------------------
SHH_CYNPY/190-418G---LGKLVYS--------D------------------------------------------------------------
A0JM37_XENTR/187-392E---TGQLIPS--------V------------------------------------------------------------
Q2QJG8_9ANNE/186-383D---NGDVVYS--------P------------------------------------------------------------
IHH_DANRE/187-398G---TGDLIYS--------E------------------------------------------------------------
Q708D0_9MYRI/276-506S---DGSPVFS--------E------------------------------------------------------------
TWHH_DANRE/190-403E---KGNVLIS--------D------------------------------------------------------------
WRT4_CAEEL/327-547N---GSQVTFI--------P------------------------------------------------------------
Q8AXT0_TAKRU/187-399D---DGNPTYT--------D------------------------------------------------------------
Q6BCD0_MERUN/188-423D---QGRLLYS--------D------------------------------------------------------------
Q80XI9_MOUSE/230-435E---DGTPTFS--------D------------------------------------------------------------
Q75UQ8_PARTP/185-402T---DGQTDYS--------E------------------------------------------------------------
Q7Z264_9SCOR/158-375R---NGFFTYS--------Q------------------------------------------------------------
Q8MWG6_PATVU/190-409S---NGKLEYS--------P------------------------------------------------------------
WRT6_CAEEL/375-583.---EAFVTYS--------P------------------------------------------------------------
A3KNS3_DANRE/187-399G---SGTLVYS--------E------------------------------------------------------------
Q5UVJ3_STRPU/189-402D---DGALDYS--------D------------------------------------------------------------
O73803_TAKRU/190-436E---TGQVVFS--------P------------------------------------------------------------
A8X447_CAEBR/327-545N---GETVTHV--------P------------------------------------------------------------
IHH_CHICK/188-394G---AGRPTYS--------D------------------------------------------------------------
SHH_XENLA/188-430P---QGNLLYS--------D------------------------------------------------------------
SHH_CHICK/190-411A---DGRLLYS--------D------------------------------------------------------------
Q1PHR2_SACKO/171-384E---DGTIVYS--------D------------------------------------------------------------
SHH_DANRE/187-404S---AGNLVFS--------D------------------------------------------------------------
IHH_XENLA/187-395N---SGRPTYS--------D------------------------------------------------------------
A2I5E3_LEUER/186-403E---RGNLLYS--------D------------------------------------------------------------
O57567_NOTVI/188-392E---GGRRTYS--------D------------------------------------------------------------
WRT8_CAEEL/325-538.---GKETTYS--------P------------------------------------------------------------
Q22872_CAEEL/566-779.---LEKTYFT--------P------------------------------------------------------------
Q49QW4_9MOLL/164-385S---QGKLVYS--------E------------------------------------------------------------
DHH_HUMAN/188-396A---SGRVVPT--------P------------------------------------------------------------
Q8MY56_CIOIN/186-395T---TGKPVFS--------E------------------------------------------------------------
Q175B3_AEDAE/201-412S---SGNTVYS--------E------------------------------------------------------------
A2I5D9_POLSP/90-308D---QGNLVLS--------D------------------------------------------------------------
Q66PH6_9TELE/184-413E---SGNLVYS--------D------------------------------------------------------------
A4UYK7_9ACTI/187-406S---LGKRRFS--------D------------------------------------------------------------
Q9GRA8_GRYBI/198-413G---HGRLAFS--------P------------------------------------------------------------
Q9U5Z6_BRABE/191-404S---AGHPVFS--------E------------------------------------------------------------
Q4PLX3_DANRE/191-442G---SGEVVFS--------R------------------------------------------------------------
O45992_CAEEL/258-471N---GEDITFL--------P------------------------------------------------------------
Q8MY57_CIOIN/294-550K---SGAVITD--------T------------------------------------------------------------
Q9W7Q9_PAROL/187-400A---HGQPVYT--------D------------------------------------------------------------
Q7Z263_ARTSF/158-415E---DGNLIYS--------E------------------------------------------------------------

PF14623

F0YDN2_AURAN/823-991...TGG---PA--------T------------------------------------------------------------
C0NJD1_AJECG/548-714...GP.---.R--------R------------------------------------------------------------
E4UR10_ARTGP/540-711...GP.---.R--------K------------------------------------------------------------
D2VHB8_NAEGR/586-750...GDS---YA--------T------------------------------------------------------------
Q2GTB7_CHAGB/570-754...GP.---.R--------K------------------------------------------------------------
Q22N58_TETTS/494-660...GNK---AV--------K------------------------------------------------------------
E9EQB7_METAR/534-699...GT.---.R--------K------------------------------------------------------------
F2SQT7_TRIRC/537-709...GP.---.R--------E------------------------------------------------------------
C7YL43_NECH7/586-752...GS.---.R--------R------------------------------------------------------------
E3QU32_COLGM/508-676...GP.---.R--------R------------------------------------------------------------
Q237Q6_TETTS/509-673...TGK---AE--------K------------------------------------------------------------
C5FLY1_ARTOC/540-711...GP.---.R--------E------------------------------------------------------------
Q24C76_TETTS/502-666GQLQS.---.T--------E------------------------------------------------------------
A9UVU8_MONBE/587-772......---.A--------V------------------------------------------------------------

PF07591

A3DGR7_CLOTH/105-234ETFEVA---EK--------T------------------------------------------------------------
A5Z4R4_9FIRM/129-258ETLDKK---YK--------C------------------------------------------------------------
A1KVQ7_NEIMF/353-489TSGKTG---YK--------P------------------------------------------------------------
Q5F6G7_NEIG1/1-137ASGKTG---YK--------P------------------------------------------------------------

PF14890

A9B528_HERA2/384-526---------WK--------L------------------------------------------------------------
DNAB_SYNY3/385-808---------MK--------L------------------------------------------------------------
GLMS_METJA/76-569---------LK--------L------------------------------------------------------------
D7E146_NOSA0/393-538---------MK--------V------------------------------------------------------------
B5W0N0_SPIMA/394-525---------HN--------L------------------------------------------------------------

PF10596

A6S230_BOTFB/991-1164----QMHSFMIKDITLESEA------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1797----......INSIELEDEP------------------------------------------------------------
A6R4K4_AJECN/1351-1497----GVETILEHTLFKATAF------------------------------------------------------------
Q00RU5_OSTTA/1516-1683----GVEGILEHTLFKGTYF------------------------------------------------------------
A8BTS5_GIAIC/1331-1491----GVEEILHHTLYPATDF------------------------------------------------------------
A4IBT3_LEIIN/1514-1675----GVEAILEHSLFKGTGF------------------------------------------------------------
Q9AW36_GUITH/1259-1418----GIKNILEHTLFKATFY------------------------------------------------------------
Q3LWH1_BIGNA/1383-1542----GIHGMLEHTLFKGTYF------------------------------------------------------------
Q6FQZ4_CANGA/1515-1674----GIETILEHTLFKGTGF------------------------------------------------------------
Q9XYM9_TRIVA/1432-1591----GVEGILSHSIFKATGY------------------------------------------------------------
Q4PEC7_USTMA/1470-1629----GVETILEHSLFAATGH------------------------------------------------------------

PF13403

A3PK18_RHOS1/14-160-------------------------------------------------------------------LRWISR.RR..LD
A3SZU1_9RHOB/393-539-------------------------------------------------------------------VRWVGR.RN..LG
Q1GGP9_SILST/27-173-------------------------------------------------------------------IRWFGH.NA..MG
C8RY14_9RHOB/1350-1496-------------------------------------------------------------------IRWVGR.RD..LS
Q1GES6_SILST/157-304-------------------------------------------------------------------VQWIGA.RR..MS
A3SNQ6_9RHOB/641-788-------------------------------------------------------------------LCWTGR.KD..LT
A3SUS4_9RHOB/185-331-------------------------------------------------------------------VSWVGA.RQ..LT
D0CP51_9RHOB/143-290-------------------------------------------------------------------IRWIGS.RT..LT
C7DAD7_9RHOB/178-316-------------------------------------------------------------------IRWIGS.SK..R.
A9GA60_9RHOB/583-733-------------------------------------------------------------------LRWTAR.RT..VT
A1AYR4_PARDP/380-527-------------------------------------------------------------------LRWIGK.RV..LS
A6DV24_9RHOB/336-474-------------------------------------------------------------------LRWIGR.RR..V.
A3VAW0_9RHOB/105-251-------------------------------------------------------------------ILWAGS.KR..ID
A3TXC6_9RHOB/29-175-------------------------------------------------------------------LRWIGC.RH..VA
A8LN65_DINSH/175-322-------------------------------------------------------------------VRWVGS.AR..ID
A1B4V8_PARDP/356-503-------------------------------------------------------------------IRWIGS.RK..LS
A3K5E2_9RHOB/849-996-------------------------------------------------------------------VRWCGA.KS..LS
B6BC88_9RHOB/475-613-------------------------------------------------------------------VRWISQ.SA..V.
A4EMR4_9RHOB/71-217-------------------------------------------------------------------ISWVGT.KR..LD
A3V1Q6_9RHOB/111-258-------------------------------------------------------------------LRWVGR.RH..IS
B7QV02_9RHOB/335-473-------------------------------------------------------------------IRWIGS.RS..V.
C9D0M9_9RHOB/1229-1376-------------------------------------------------------------------LRWIGN.RR..LS
Q0FQ52_9RHOB/227-374-------------------------------------------------------------------IRWIGC.RH..LE
D0CWS5_9RHOB/173-320-------------------------------------------------------------------IQWIGR.RR..LA
D0CQ11_9RHOB/159-297-------------------------------------------------------------------LRWIGR.RT..V.
A8LKN9_DINSH/122-260-------------------------------------------------------------------VLWVGR.RT..L.
A3JWU1_9RHOB/200-347-------------------------------------------------------------------ISWIGR.RH..LN
A3VI53_9RHOB/624-762-------------------------------------------------------------------IRWIGR.RT..V.
A3SQF1_9RHOB/126-264-------------------------------------------------------------------LMMMAM.RR..V.
B5K4Q3_9RHOB/102-249-------------------------------------------------------------------VLWTGS.RR..VT
A3JUC9_9RHOB/546-693-------------------------------------------------------------------LRWIGS.RK..LC
A3W238_9RHOB/563-702-------------------------------------------------------------------VRWTGR.RT..V.
B9NR62_9RHOB/115-262-------------------------------------------------------------------IRWIES.SR..LS
C7D8K4_9RHOB/545-684-------------------------------------------------------------------IRWMGN.RT..V.
Q28WJ0_JANSC/241-379-------------------------------------------------------------------LRWIGF.RT..V.
A4EIH6_9RHOB/690-837-------------------------------------------------------------------IRWIGR.RF..VT
B5J379_9RHOB/742-889-------------------------------------------------------------------LRWTGR.RD..VD
C9CTM7_9RHOB/120-267-------------------------------------------------------------------LRLSLS.RK..IS
A4EL36_9RHOB/35-182-------------------------------------------------------------------IKWIGR.KK..VS
C9D2P0_9RHOB/151-297-------------------------------------------------------------------LRWMGR.RP..LS
A3V7F0_9RHOB/249-396-------------------------------------------------------------------IRWAGH.WQ..AD
A3XC10_9RHOB/338-477-------------------------------------------------------------------LRWIGH.SQ..V.
A3JZG9_9RHOB/189-327-------------------------------------------------------------------VIWAGS.DR..Q.
A3W5R9_9RHOB/184-322-------------------------------------------------------------------IRWIGG.AS..V.
Q5LPM0_SILPO/507-646-------------------------------------------------------------------LRWVGS.RT..V.
A3SHB9_9RHOB/143-290-------------------------------------------------------------------LRLLPS.RH..IS
A3TTF8_9RHOB/31-178-------------------------------------------------------------------IRWIGS.ST..YL
B6BEV2_9RHOB/337-476-------------------------------------------------------------------LQWTGS.RR..T.
A3JMU4_9RHOB/108-255-------------------------------------------------------------------IQWVGT.KH..LD
C9CXZ7_9RHOB/141-288-------------------------------------------------------------------LRLLLR.TY..VS
Q28L14_JANSC/1268-1415-------------------------------------------------------------------VRWIGA.KT..LT
D0CSG1_9RHOB/199-337-------------------------------------------------------------------LLWAGK.TR..V.
Q1GGN0_SILST/194-341-------------------------------------------------------------------LRWKYH.RR..LS
B6AV64_9RHOB/37-183-------------------------------------------------------------------VKWVGR.RD..LD
Q5LSZ7_SILPO/803-941-------------------------------------------------------------------IRWIGG.TS..R.
C9CRM1_9RHOB/318-465-------------------------------------------------------------------ILWIGS.RI..LT
A3K151_9RHOB/707-851-------------------------------------------------------------------LRWIGE.SR..R.
A3SL99_9RHOB/129-267-------------------------------------------------------------------IRWISG.RT..I.
A3JLQ1_9RHOB/336-475-------------------------------------------------------------------ICWIGS.SR..P.
A6FVP9_9RHOB/45-184-------------------------------------------------------------------IRWIGK.RR..V.
Q6SF13_9BACT/2229-2376-------------------------------------------------------------------VRWIGS.RY..LS
Q5LPJ7_SILPO/175-322-------------------------------------------------------------------ILWIGK.RT..LS
A3VA21_9RHOB/151-298-------------------------------------------------------------------IRWVAM.RR..LG
B6AYB0_9RHOB/160-302-------------------------------------------------------------------IRWIGA.TT..C.
Q2CAT6_9RHOB/160-307-------------------------------------------------------------------VLWTGR.RR..IS
B6B317_9RHOB/170-318-------------------------------------------------------------------LRWIGS.NW..LN
B9NQR9_9RHOB/142-290-------------------------------------------------------------------LQLVLS.RR..VR
A3SR39_9RHOB/268-419-------------------------------------------------------------------LRKVLH.RR..LS
B9NUP1_9RHOB/171-309-------------------------------------------------------------------VRWVGS.RE..I.
B6AZD3_9RHOB/512-660-------------------------------------------------------------------IRWIDS.LG..LD
B6B2Z4_9RHOB/167-315-------------------------------------------------------------------IRWIGS.CS..IS
A3SQF2_9RHOB/166-304-------------------------------------------------------------------LRWLGQ.ME..V.
A3XDE7_9RHOB/339-478-------------------------------------------------------------------LRWIGS.S...LR
B5KDV6_9RHOB/120-258-------------------------------------------------------------------VRWHGS.RG..V.
A3SHZ7_9RHOB/146-292-------------------------------------------------------------------IRWIGQ.RQ..IT
A3JSG0_9RHOB/151-289-------------------------------------------------------------------IRWIGD.RQ..L.
A3JT50_9RHOB/142-280-------------------------------------------------------------------VEWIGS.RK..V.
Q1GMQ5_SILST/293-432-------------------------------------------------------------------LRWIGR.ST..R.
C7DBW6_9RHOB/268-415-------------------------------------------------------------------VKLVLQ.RR..LT
A9DWF7_9RHOB/194-340-------------------------------------------------------------------LVTALR.RC..VD
B7QQ35_9RHOB/162-309-------------------------------------------------------------------VVWIGQ.EE..V.
Q5LLZ7_SILPO/144-282-------------------------------------------------------------------LLQLAK.TT..V.
B7RNT5_9RHOB/692-831-------------------------------------------------------------------LVWVGM.RR..LM
B7RP36_9RHOB/563-698-------------------------------------------------------------------IRWIGT.RH..LD
A3JVK2_9RHOB/381-520-------------------------------------------------------------------LMWVGR.SH..C.
B5KCW8_9RHOB/153-299-------------------------------------------------------------------LRWIGC.KS..LT
C8RZS8_9RHOB/219-358-------------------------------------------------------------------LRWVGG.GN..V.
A8LR09_DINSH/158-296-------------------------------------------------------------------IRWVGQ.TV..V.
A3VAC1_9RHOB/181-319-------------------------------------------------------------------LRWVGH.ST..V.
C7JHN5_ACEP3/423-565-------------------------------------------------------------------VIWVGK.TH..AT
A3VHZ3_9RHOB/168-315-------------------------------------------------------------------VLWVGH.KT..LP
Q28SX3_JANSC/168-306-------------------------------------------------------------------IRWIGR.KT..F.
A8LK48_DINSH/203-343-------------------------------------------------------------------VAAVLS.RE..L.
A3JYU7_9RHOB/143-282-------------------------------------------------------------------IRWIGH.HT..S.
Q5LMP8_SILPO/160-307-------------------------------------------------------------------IRWIGT.RR..VG
Q2CD05_9RHOB/27-169-------------------------------------------------------------------ICWVGA.VT..VA
A9EEF5_9RHOB/1099-1235-------------------------------------------------------------------IRWIGQ.RE..VD
Q2CCZ2_9RHOB/165-310-------------------------------------------------------------------VLWAGR.SA..LA
A6FPB3_9RHOB/928-1068-------------------------------------------------------------------LIWASH.TK..MS
Q28UB5_JANSC/126-273-------------------------------------------------------------------VQWIGQ.RH..LS
B6AZM7_9RHOB/573-711-------------------------------------------------------------------IAWTGS.RT..I.
A3VMW9_9RHOB/142-280-------------------------------------------------------------------VRWVGH.SR..T.
Q1GMV1_SILST/833-976-------------------------------------------------------------------VIWVGH.RR..LS
B6B239_9RHOB/383-521-------------------------------------------------------------------VRAVVS.RV..V.
A5FZD4_ACICJ/193-329-------------------------------------------------------------------VVWIGR.RT..LD
A3W415_9RHOB/142-281-------------------------------------------------------------------VLWVGR.RV..V.
B1ZBT1_METPB/133-268-------------------------------------------------------------------IRWIGH.RL..VE
C7CEK6_METED/138-280-------------------------------------------------------------------ITWIGN.RA..LD
A4ESK2_9RHOB/784-931-------------------------------------------------------------------VIWVGK.RT..LS
B6B425_9RHOB/122-269-------------------------------------------------------------------LRLNLL.SA..VS
B9JK11_AGRRK/201-336-------------------------------------------------------------------IRWVGR.RR..LD
C8S0F9_9RHOB/2250-2389-------------------------------------------------------------------VLWAGG.RQ..IG
A3VJF5_9RHOB/166-311-------------------------------------------------------------------LRWTGA.RR..VT
C9CXD1_9RHOB/645-786-------------------------------------------------------------------VMWVGI.SH..IE
Q28TH9_JANSC/752-887-------------------------------------------------------------------LVWIGT.RE..VS
A5G1S8_ACICJ/159-294-------------------------------------------------------------------VVWIGH.RT..IE
B0T7Q3_CAUSK/153-288-------------------------------------------------------------------VIWIGS.RQ..VR
C7JE32_ACEP3/536-676-------------------------------------------------------------------IVWVGC.QH..VT
B7KU45_METC4/258-393-------------------------------------------------------------------VRWIGR.RF..LD
B8IA31_METNO/149-285-------------------------------------------------------------------IRWIGH.RA..YT
A5G006_ACICJ/174-309-------------------------------------------------------------------VRWVGR.RT..ID
A3VFB5_9RHOB/155-300-------------------------------------------------------------------VLWIGA.RE..VQ
D2CKZ0_9GAMM/93-241-------------------------------------------------------------------VLWIGS.MS..IA
B6AU02_9RHOB/46-193-------------------------------------------------------------------LSLVLK.RK..LP
A5FW80_ACICJ/285-421-------------------------------------------------------------------VIWTGS.RT..LD
A3VJV0_9RHOB/145-290-------------------------------------------------------------------IRWIGK.RR..IR
A8LLK3_DINSH/164-305-------------------------------------------------------------------VLWAGA.RQ..VS
Q5FQG8_GLUOX/285-425-------------------------------------------------------------------ILRVGH.AH..AT
C8RY96_9RHOB/128-267-------------------------------------------------------------------LRWLGR.AT..L.
B0UJT1_METS4/116-254-------------------------------------------------------------------IKWIGH.SA..LD
A3JW88_9RHOB/167-310-------------------------------------------------------------------IRWIHS.D...LH
B2SAQ3_BRUA1/14-150-------------------------------------------------------------------IKWIGW.QN..YR
Q2CAV0_9RHOB/70-218-------------------------------------------------------------------LLWRGC.TS..IV
O68085_RHOCA/442-581-------------------------------------------------------------------VLWSGG.RS..LE
D0CWR5_9RHOB/156-294-------------------------------------------------------------------VCWVGR.QS..V.
Q5LUZ7_SILPO/68-216-------------------------------------------------------------------VVWKGS.TV..IV
A3W580_9RHOB/62-208-------------------------------------------------------------------VIWIGQ.IT..LR
D0D5E7_9RHOB/33-180-------------------------------------------------------------------VTWIGS.TS..YV
Q0BS96_GRABC/3687-3823-------------------------------------------------------------------IRWLGR.RS..YN
B1M2P7_METRJ/65-199-------------------------------------------------------------------IRWIGR.RT..Y.
A3W8K4_9RHOB/154-299-------------------------------------------------------------------ILWTRV.NE..Q.
A3VEX8_9RHOB/9-155-------------------------------------------------------------------VLWVGR.IR..VS
A3JSM6_9RHOB/118-255-------------------------------------------------------------------VKWVGV.QN..V.
A3SRN1_9RHOB/161-308-------------------------------------------------------------------LRWIGQ.AK..MP
Q1N7J0_9SPHN/211-348-------------------------------------------------------------------VRWVGH.RHDWVD
A9DUV0_9RHOB/49-194-------------------------------------------------------------------LIWIGS.SN..FI
A6FV85_9RHOB/70-218-------------------------------------------------------------------LIWIGS.MT..LV
A3JS61_9RHOB/164-301-------------------------------------------------------------------VKWLGV.QD..V.
A3VAX2_9RHOB/110-257-------------------------------------------------------------------VIWQGG.RV..LD
A6E265_9RHOB/196-333-------------------------------------------------------------------IVWLAR.QT..LS
C7D8E1_9RHOB/33-181-------------------------------------------------------------------LKWVGR.MT..LI
Q1MD68_RHIL3/83-221-------------------------------------------------------------------IKWVGR.QS..FK
A5FVL4_ACICJ/410-545-------------------------------------------------------------------IAWRGR.RR..ID
A3JWF1_9RHOB/121-260-------------------------------------------------------------------VKWVGR.QT..VN
A4YQ57_BRASO/106-246-------------------------------------------------------------------VQWIGSFRR..YR
B6B9L0_9RHOB/67-214-------------------------------------------------------------------LVWIGR.TS..LL
A3JPL6_9RHOB/158-295-------------------------------------------------------------------VRWTGN.QT..IE
A5FWA2_ACICJ/1192-1328-------------------------------------------------------------------VVWIGW.RS..ID
A3S7N1_9RHOB/69-214-------------------------------------------------------------------LLWVGS.SK..FV
A3V9D9_9RHOB/136-275-------------------------------------------------------------------LRHVTQ.AT..M.
A9GL51_9RHOB/726-866-------------------------------------------------------------------VLWVGA.SF..ST
B6AWU4_9RHOB/33-181-------------------------------------------------------------------VTWIGS.TS..FV
C3KQV1_RHISN/76-214-------------------------------------------------------------------IKWIGR.HV..YR
B7RGP3_9RHOB/19-157-------------------------------------------------------------------LRSINR.QK..M.
A3VKC8_9RHOB/32-181-------------------------------------------------------------------VRWVGE.SM..SV
B7RR26_9RHOB/132-273-------------------------------------------------------------------IIWIGS.SK..IS
A3JPP3_9RHOB/102-239-------------------------------------------------------------------VKWIGL.HK..VM
A9G7V6_9RHOB/181-329-------------------------------------------------------------------VLHRID.RR..V.
A3TTS1_9RHOB/32-176-------------------------------------------------------------------VQWIGI.MT..H.
B5J8X8_9RHOB/33-181-------------------------------------------------------------------VFWRGA.MT..LV
A3W2P6_9RHOB/178-317-------------------------------------------------------------------VLQTVA.RR..V.
A3SKF2_9RHOB/139-280-------------------------------------------------------------------LRWVGH.QV..IR
A3JS38_9RHOB/159-295-------------------------------------------------------------------LKWRGE.QK..I.
A6DXP5_9RHOB/101-239-------------------------------------------------------------------VMWVGK.QT..T.
A3SRA3_9RHOB/68-209-------------------------------------------------------------------LLWIGS.MQ..LA
A8LKB8_DINSH/19-167-------------------------------------------------------------------LRHILR.TR..VS
A3SI78_9RHOB/178-317-------------------------------------------------------------------VLQALR.LT..V.
A3V3N0_9RHOB/64-210-------------------------------------------------------------------LLWRGM.MT..IT
A3JS40_9RHOB/158-295-------------------------------------------------------------------IQNIGR.QT..VF
A3Z148_9SYNE/71-210-------------------------------------------------------------------VRFISR.TC..HT
A3JT43_9RHOB/20-157-------------------------------------------------------------------VEWVGF.KK..IA
A4EJ24_9RHOB/71-219-------------------------------------------------------------------LQWRGR.IT..LG
C9CYM4_9RHOB/179-319-------------------------------------------------------------------VLHMIE.RE..V.
C7D959_9RHOB/18-157-------------------------------------------------------------------LRDVRV.TA..C.
A3XDE1_9RHOB/175-315-------------------------------------------------------------------VLHVLH.RE..V.
Q5LN78_SILPO/204-343-------------------------------------------------------------------VLHRVS.RT..M.
A6FNZ8_9RHOB/22-159-------------------------------------------------------------------VKAVHR.RQ..I.
A6DX68_9RHOB/142-284-------------------------------------------------------------------VIWAGV.TD..VD
C7DFW9_9RHOB/173-311-------------------------------------------------------------------VRWCGS.VD....
B7QV01_9RHOB/186-327-------------------------------------------------------------------VLHKLM.RQ....
B7RNA8_9RHOB/11-157-------------------------------------------------------------------ILAIKR.SR..AI
A6E3T2_9RHOB/4-141-------------------------------------------------------------------LRGIAR.HR..L.
A3X8D5_9RHOB/25-168-------------------------------------------------------------------VVEMVR.ET..VH
A3JQA1_9RHOB/57-194-------------------------------------------------------------------IRWMGT.GY..VR

PF05203

Q8J0G3_ZYGBI/11-460FKGTNYID....VIFFNKVKGSVEDGRV.IDIVQEASMSYPAVE..GPERALRAIKEYAEADGAREFFEWTIEARD--IS
Q8J0G2_ZYGRO/19-468IQGTDYVE....VCLFNMTKKTLEDGRV.IDIVEETSDFYPAVE..GPEKALRILKEYAEADGGKEYFEWTIEARD--VA
Q8J0G5_9SACH/19-473ENGADYYD....VAFFDLVKTKLKDGRE.IEIVKEMSNSYLATE..GPEKAAQMVKEYQEASEGKEFFEWTIEARD--VA
Q8J0G6_9SACH/19-474MKGVEYYE....VVFFDLAKEKLKDGRE.IEVVKEISRSYPVTE..GPERAAEIMKEYQEAGAGKQFFEWTIEARD--VG
Q8J0G4_ZYGBA/19-474MQGVDYNE....VIFFDLKKKKLEDGRE.IEIVKEVSRSYPAAE..GAEKAAQMVKDYYDAARGKEFFEWTIEARD--VX
Q9P986_SACPS/1-465GRNATKYK....VRWRNLQQCQTLDGKI.IIIPKNHHKTFQMTV.EGEFAAKRFIEEMERS..KGEYFNFDIEVRD--LD
A7TIB9_VANPO/1-464FRTNHYKV.....RWRNLEETLTVDGRM.ICIPKNHHKDFPMTP.EGELSARAFMAEMEAE..NGEYFEFNLQVRD--LD
C5DTQ4_ZYGRC/1-464FKRNHFKV.....CWKNLEDTLTLDGRI.IKIPKTHHKDFPMTP.EGQLAAKGFLDEKENS..TGRFAEYNVQVRD--LD
Q707W4_KLUDE/1-464TIKPNLTV.....RWRCLEDVVTNDGRL.ISIPKNHHKNFPKTQ.EGFLLADNFIKERSAI..TGDYIDYLIEVRD--LD
Q707W9_CANGB/1-464PRRPNLTV.....KWRCLEEILTTDGRA.ITVPKNHHKNFPKTK.EGQLQAQNFMRDKRLI..WGPDIDYEIQVRD--LE
Q6TER1_CRYNE/36-207..........................K...............ERSGSERAHSPSAD....LSLTDSHERVDVTVDD--FV
Q1KMS2_AJECA/5-539..........................H...............EK......ENQKRQSELSASATERYDTVEMTAAD--FA
Q1MSX1_PENEN/51-212..........................R...........................EEEASDGPKNAERQTVEITAAE--FA
C5FT71_ARTOC/1506-2056..........................K...............EK.SG........K....VSASDQYETVEMTASE--FH
Q1A775_9EURO/44-198..........................R.................................EKATDSYDTVEMTAAE--FA
Q1ECT9_EMEND/1526-2130..........................RA.KAMNTSVCFDRSKEQQGGAGEQLDISE....VSAAERYDTVEMTAAE--FA
Q1A774_ASPGI/56-222..........................R....................EKETNEVPE.....ASTERYDTVEITAAE--FA
B9XA08_9BACT/492-829..........................R..................................NEASKATVIDVSVKD--WL
A6QC64_SULNB/206-549..........................R................................NENGHHHGDVLNIEVSE--YI
Q2S6J9_SALRD/231-574..........................R................................REGARDRGSIADISVRD--YL
A3EZR5_9CAUD/34-380..........................K..................................GSWPDNTVFDISVRD--WL
Q5G7M7_9CAUD/35-373..........................R...................................AGQTPGYTEISVNE--YI
A8BML4_GIAIC/4-440NTGADNQYVVEFVEPVTDAMKSISGVK................L..QWKVFAQADDALSYVDRSLPNFLYESKLSD--FI
A1ZUM1_9BACT/19-423..........................RK.DVGEGVFAAAEPQQVKNPLMRMKGVGDIEGSVLVSHEHLPFGTVAKS--LV
Q6BRM0_DEBHA/283-676VTYFA...........LESVTDEANGRE.FSVVKSQTKTFEESS.........MAKEFASTISKNS.IDWTIEARD--VG
Q874G6_KLULC/277-686EKVTVAFN.....RLADISVGNGTESRT.VRLVERAEKSFANAE...SNQAIINAAEFVTTIDTTS.IEWTLEARD--ML
Q874G7_CANGB/277-691VSYFA...........LGALIDETNGRA.VEIVQEVQETFESNI.........SASDFAANINREP.ISWTLEIRD--ID
B6JY11_SCHJY/278-753VRGKKQSSVSFLRLADVVVGSSRGGDRRRIQIVKKVTKSFQHEP.RGVEKARELAMEFLSTIGDDD.IYWTIEARD--YT
Q8J0G9_9SACH/19-519LDGQTYT.......NVSYFALEESAYG...QIVXKKTKSYQHQRHGGKQETEKKVNEFLATINPDS.IEWDVEAKD--YK
Q874G5_NAUCA/266-782LRGKHYT.......SVTFFVTEKSANG...TIVKQRTKTFQHEFHGGEEAATKLAADFASTIDPKH.IDWDIEAKD--YK
Q874G1_9SACH/246-659LRGKMYT.......SVNYFVANDFENG...QVVKLRTKTFQHDIHGGADGAKVEAQKFASTIDLSP.ISWEIEASK--YV
Q8J0G8_SACEX/19-520IDGKTYT.......SVSYFALRDSQDG..YPIVKKLTKSFEHQQNGGKEQTLITVNNFVASLKSEP.INWDVEAKH--YE
C5M9I6_CANTT/244-714IGGNTY........TGVTFYVLEKTKTG.IELVKAKTKVFGHHI.HGQNGAEEKAATFAAGIDSKEYIDWIIEARD--YV
A5DXZ0_LODEL/280-700FAGKNYAAV...NYFAMGKTKKSAGGKDGVEIVRVKSKVFAHHI.HGKEVAESKALEFAASVDMSA.IEWVVEAKD--YY
A3LP04_PICST/283-731LRGESQTS.....VTYFQMKTAVADGRE.IELPKLCTKSFQHSS.HGRENAWKKAEVFASTISRDP.IDWTAEARD--IS
A7TLB5_VANPO/284-716IDGIECNE....IVYTDLFKEITEDARI.IELIKEVSKIYPVSE..GMDDVQEFVSQYNKS..LEDYFQWTVEPRD--IN
E9P8D3_YEASX/259-712IKGVEYFE....VITFEMGQKKAPDGRI.VELVKEVSKSYPISE..GPERANELVESYRKA.SNKAYFEWTIEARD--LS

PF01079

Q7PXI1_ANOGA/295-503-------------------------------------------------------------------VLMFMD-RD----
HH_DROHY/253-475-------------------------------------------------------------------VILFMD-RN----
HH_DROPS/255-475-------------------------------------------------------------------VILFMD-RN----
Q1HEQ6_TRICA/99-299-------------------------------------------------------------------VLLFLD-YN----
SHH_CYNPY/190-418-------------------------------------------------------------------FLLFMD-KE----
A0JM37_XENTR/187-392-------------------------------------------------------------------VLLFLH-RD----
Q2QJG8_9ANNE/186-383-------------------------------------------------------------------VILFLH-RE----
IHH_DANRE/187-398-------------------------------------------------------------------VLTFLD-RR----
Q708D0_9MYRI/276-506-------------------------------------------------------------------VLLFLD-RQ----
TWHH_DANRE/190-403-------------------------------------------------------------------FIMFID-HD----
WRT4_CAEEL/327-547-------------------------------------------------------------------VQYWLH-RD----
Q8AXT0_TAKRU/187-399-------------------------------------------------------------------FIMFVD-RD----
Q6BCD0_MERUN/188-423-------------------------------------------------------------------FLTFLD-RD----
Q80XI9_MOUSE/230-435-------------------------------------------------------------------VLIFLD-RE----
Q75UQ8_PARTP/185-402-------------------------------------------------------------------VILFLD-RN----
Q7Z264_9SCOR/158-375-------------------------------------------------------------------VIMFLD-WD----
Q8MWG6_PATVU/190-409-------------------------------------------------------------------VIAFID-RN----
WRT6_CAEEL/375-583-------------------------------------------------------------------VIMFLH-KR----
A3KNS3_DANRE/187-399-------------------------------------------------------------------VIAFLD-RD----
Q5UVJ3_STRPU/189-402-------------------------------------------------------------------VIMIVH-RK----
O73803_TAKRU/190-436-------------------------------------------------------------------VLLFLH-RD----
A8X447_CAEBR/327-545-------------------------------------------------------------------VQYWIH-RD----
IHH_CHICK/188-394-------------------------------------------------------------------FLAFLD-KE----
SHH_XENLA/188-430-------------------------------------------------------------------FLMFID-QE----
SHH_CHICK/190-411-------------------------------------------------------------------FLTFLD-RM----
Q1PHR2_SACKO/171-384-------------------------------------------------------------------VIMMMD-SK----
SHH_DANRE/187-404-------------------------------------------------------------------FIMFTD-RD----
IHH_XENLA/187-395-------------------------------------------------------------------FLSFLD-HS----
A2I5E3_LEUER/186-403-------------------------------------------------------------------FVMFLD-RA----
O57567_NOTVI/188-392-------------------------------------------------------------------FLTFLD-RD----
WRT8_CAEEL/325-538-------------------------------------------------------------------VKYWLH-RD----
Q22872_CAEEL/566-779-------------------------------------------------------------------ITLWIH-RE----
Q49QW4_9MOLL/164-385-------------------------------------------------------------------VIAFLD-IK----
DHH_HUMAN/188-396-------------------------------------------------------------------VLLFLD-RD----
Q8MY56_CIOIN/186-395-------------------------------------------------------------------VIMFLD-KQ----
Q175B3_AEDAE/201-412-------------------------------------------------------------------VIMFMD-RD----
A2I5D9_POLSP/90-308-------------------------------------------------------------------FMMFID-KD----
Q66PH6_9TELE/184-413-------------------------------------------------------------------FIMFTD-RD----
A4UYK7_9ACTI/187-406-------------------------------------------------------------------FIMFSD-QD----
Q9GRA8_GRYBI/198-413-------------------------------------------------------------------VLLFLD-RD----
Q9U5Z6_BRABE/191-404-------------------------------------------------------------------VLTFMD-RD----
Q4PLX3_DANRE/191-442-------------------------------------------------------------------VLLFLH-LD----
O45992_CAEEL/258-471-------------------------------------------------------------------VKYWLH-RD----
Q8MY57_CIOIN/294-550-------------------------------------------------------------------FLSFMD-AR----
Q9W7Q9_PAROL/187-400-------------------------------------------------------------------FIMFID-QD----
Q7Z263_ARTSF/158-415-------------------------------------------------------------------VLLFLD-RD----

PF14623

F0YDN2_AURAN/823-991-------------------------------------------------------------------VQCVVATAV--ER
C0NJD1_AJECG/548-714-------------------------------------------------------------------VRAVLATAV--KN
E4UR10_ARTGP/540-711-------------------------------------------------------------------VRAVLQSIV--KD
D2VHB8_NAEGR/586-750-------------------------------------------------------------------ILCVLKSKT--PS
Q2GTB7_CHAGB/570-754-------------------------------------------------------------------VAAVLRMPV--RR
Q22N58_TETTS/494-660-------------------------------------------------------------------VVCVVKTLC--TG
E9EQB7_METAR/534-699-------------------------------------------------------------------VAMVLKTAV--QE
F2SQT7_TRIRC/537-709-------------------------------------------------------------------VRAVLQTSV--NH
C7YL43_NECH7/586-752-------------------------------------------------------------------VAMVLKTPV--EQ
E3QU32_COLGM/508-676-------------------------------------------------------------------VVAVLKTPV--RR
Q237Q6_TETTS/509-673-------------------------------------------------------------------VKCVIETEV--KE
C5FLY1_ARTOC/540-711-------------------------------------------------------------------VRAVLQTSV--ND
Q24C76_TETTS/502-666-------------------------------------------------------------------VVCIVVSKC--EN
A9UVU8_MONBE/587-772-------------------------------------------------------------------VDYVVAVAC--AG

PF07591

A3DGR7_CLOTH/105-234-------------------------------------------------------------------VLETYV-RE----
A5Z4R4_9FIRM/129-258-------------------------------------------------------------------VEKVFR-RK----
A1KVQ7_NEIMF/353-489-------------------------------------------------------------------VTARYG-NP----
Q5F6G7_NEIG1/1-137-------------------------------------------------------------------VTAQYG-NP----

PF14890

A9B528_HERA2/384-526-------------------------------------------------------------------ESWPVT-HA----
DNAB_SYNY3/385-808-------------------------------------------------------------------ESAKVS-RV----
GLMS_METJA/76-569-------------------------------------------------------------------YNKKIK-KF----
D7E146_NOSA0/393-538-------------------------------------------------------------------ETAIVS-NA----
B5W0N0_SPIMA/394-525-------------------------------------------------------------------EKATVQ-RV----

PF10596

A6S230_BOTFB/991-1164-------------------------------------------------------------------TNWAGFRVD----
Q5KPW2_CRYNJ/1640-1797-------------------------------------------------------------------TKWSGFVVD----
A6R4K4_AJECN/1351-1497-------------------------------------------------------------------PSWEGLFWE----
Q00RU5_OSTTA/1516-1683-------------------------------------------------------------------PTWEGLFWE----
A8BTS5_GIAIC/1331-1491-------------------------------------------------------------------SDYKSVVWS----
A4IBT3_LEIIN/1514-1675-------------------------------------------------------------------PSWEGIEFD----
Q9AW36_GUITH/1259-1418-------------------------------------------------------------------SNWEGLFWE----
Q3LWH1_BIGNA/1383-1542-------------------------------------------------------------------PSWEGLFWE----
Q6FQZ4_CANGA/1515-1674-------------------------------------------------------------------HSWEGLFWE----
Q9XYM9_TRIVA/1432-1591-------------------------------------------------------------------KHWEGLFWD----
Q4PEC7_USTMA/1470-1629-------------------------------------------------------------------PTWEGLFWE----

PF13403

A3PK18_RHOS1/14-160..HA..TL-----------.AA---FPHL..K.PVLI-------E..KGSLGPD.....LP------DRDMM--------
A3SZU1_9RHOB/393-539..RD..NL-----------.LR---TPGF..N.PVRI-------K..AGAFGEG.....VP------QRDMM--------
Q1GGP9_SILST/27-173..PQ..DL-----------.SH---ASHL..Q.PILI-------R..QGALGNG.....LP------ERDMM--------
C8RY14_9RHOB/1350-1496..RA..DL-----------.AR---QPRL..S.PVRI-------R..KGALGGA.....LP------DRDML--------
Q1GES6_SILST/157-304..GA..RL-----------.FV---MPAL..R.PVRI-------R..AGALGID.....RP------ERELL--------
A3SNQ6_9RHOB/641-788..PA..ML-----------.DA---NTQL..R.PVRI-------R..KDSLGPG.....LP------EQDML--------
A3SUS4_9RHOB/185-331..AA..EL-----------.VV---YPHL..R.PVLI-------T..AGALGAG.....TP------ERDLI--------
D0CP51_9RHOB/143-290..SV..EL-----------.RA---KPRL..R.PICV-------S..AGALGAG.....LP------RRDLR--------
C7DAD7_9RHOB/178-316........-----------.AA---TGDL..A.PILI-------R..KGALGN........------DRDLR--------
A9GA60_9RHOB/583-733..NT..DL-----------.AR---RPQF..Q.PILI-------E..AGALGSDGG.ELVP------NRDLM--------
A1AYR4_PARDP/380-527..AE..EL-----------.AA---QPKL..R.PIRI-------R..AEALGER.....LP------ERDLI--------
A6DV24_9RHOB/336-474........-----------.AA---VGDF..A.PIRI-------A..SDTFGR........------HRALL--------
A3VAW0_9RHOB/105-251..LT..GA-----------.AS---DARL..R.PIRV-------T..AGSIAPG.....VP------ERDLL--------
A3TXC6_9RHOB/29-175..AD..EL-----------.AE---HDSL..R.PVRI-------E..KGALGPN.....MP------DRDLL--------
A8LN65_DINSH/175-322..SA..KL-----------.AG---NPRF..R.PILL-------R..AGALGPG.....RP------ARDMR--------
A1B4V8_PARDP/356-503..AA..EL-----------.KA---MPNL..R.PIRI-------A..AGALGKG.....LP------VADLL--------
A3K5E2_9RHOB/849-996..AR..QL-----------.AG---EQAF..C.PILI-------R..KGALGPG.....YP------ERDMM--------
B6BC88_9RHOB/475-613........-----------.PA---TGNL..A.PVRI-------P..AGLFGA........------ERDLL--------
A4EMR4_9RHOB/71-217..FA..DL-----------.KT---APQL..R.PIKI-------L..AGALGDN.....MP------ERDML--------
A3V1Q6_9RHOB/111-258..SD..VL-----------.SR---MPKW..C.PVRI-------S..AGALGAG.....LP------KRDMM--------
B7QV02_9RHOB/335-473........-----------.AA---QGRL..A.PICI-------A..KNALGD........------HDELW--------
C9D0M9_9RHOB/1229-1376..AA..QL-----------.AQ---SPNL..R.PIRI-------R..RGTLGSD.....LP------TRDLI--------
Q0FQ52_9RHOB/227-374..EE..DL-----------.ER---NPEL..R.PIRI-------R..ANALGKG.....RP------ERDIV--------
D0CWS5_9RHOB/173-320..AP..AL-----------.CD---NPKL..M.PVRI-------M..ARALGAG.....LP------ARDLL--------
D0CQ11_9RHOB/159-297........-----------.RA---QGAF..A.PVLF-------R..RGAIGN........------DRDLL--------
A8LKN9_DINSH/122-260........-----------.PG---SEAL..A.PIRF-------S..PDALGS........------DRPLY--------
A3JWU1_9RHOB/200-347..RR..DL-----------.AK---NQKL..R.PIRI-------K..AGALGPN.....LP------TKDLL--------
A3VI53_9RHOB/624-762........-----------.PG---TGTF..A.PIRF-------E..RGAFGN........------VAPLM--------
A3SQF1_9RHOB/126-264........-----------.PG---RGAF..A.PVRI-------R..EGALGN........------SRDLW--------
B5K4Q3_9RHOB/102-249..GA..RL-----------.YA---TPHL..C.PIRL-------R..AGSLDND.....VP------DAGLL--------
A3JUC9_9RHOB/546-693..KA..TL-----------.TD---HANL..R.PIRI-------Q..AGALDGL.....LP------ERDLI--------
A3W238_9RHOB/563-702........-----------.PG---LDRF..A.PVRV-------A..AHVLDG.......A------RAPLL--------
B9NR62_9RHOB/115-262..PD..RL-----------.RA---NPAM..R.PVRL-------A..AGSLGPG.....MP------ARDLR--------
C7D8K4_9RHOB/545-684........-----------.PA---MDKF..A.PVQI-------S..QSVLPG.......S------ERDIL--------
Q28WJ0_JANSC/241-379........-----------.PA---DGPL..A.PIHI-------T..KGALGN........------TRALT--------
A4EIH6_9RHOB/690-837..VA..NL-----------.EA---KPNL..Q.PIRI-------K..AGTLADG.....VP------SKDLI--------
B5J379_9RHOB/742-889..AS..EL-----------.SE---NENL..R.PIRI-------R..KDVISAG.....CG------VGDLV--------
C9CTM7_9RHOB/120-267..AT..AL-----------.RT---NPKL..A.PVRI-------M..AGALGNS.....LP------QRDLL--------
A4EL36_9RHOB/35-182..AQ..RL-----------.AT---EQNL..R.PVRL-------L..KDAFGDG.....IP------CRDMM--------
C9D2P0_9RHOB/151-297..RQ..HL-----------.AQ---NPKL..R.PVRI-------G..RGALGGG.....LP------QQPLY--------
A3V7F0_9RHOB/249-396..AA..KL-----------.AL---QPSL..Q.PVLI-------R..KGALGRD.....MP------ASDMM--------
A3XC10_9RHOB/338-477........-----------.PV---TATT..A.PIRF-------A..KGQFGA........------DADLW--------
A3JZG9_9RHOB/189-327........-----------.AG---VGPN..A.PVRI-------R..AGALGN........------LRDLV--------
A3W5R9_9RHOB/184-322........-----------.AG---GCAN..A.PVRI-------K..RGAIGN........------VRDLW--------
Q5LPM0_SILPO/507-646........-----------.AA---TGNH..A.PIRL-------D..PTLLQG.......A------SAPLL--------
A3SHB9_9RHOB/143-290..AE..EL-----------.HQ---RPNL..R.PVRI-------R..ADSLAPG.....VP------ERDTL--------
A3TTF8_9RHOB/31-178..AR..DF-----------.AV---DPRH..L.PIRI-------K..AGCLGND.....VP------SRDLV--------
B6BEV2_9RHOB/337-476........-----------.AC---TART..A.PIRF-------A..AGSFGN........------SCDLY--------
A3JMU4_9RHOB/108-255..NA..GL-----------.SK---KPKL..R.PVRI-------K..DGALGNG.....LP------RVELR--------
C9CXZ7_9RHOB/141-288..RE..RL-----------.VT---HPNL..R.PIRI-------T..AGALGLG.....LP------TRDLL--------
Q28L14_JANSC/1268-1415..QI..DL-----------.AR---APHL..R.PIRI-------R..TGALGPG.....VP------NRDME--------
D0CSG1_9RHOB/199-337........-----------.PA---TGKT..A.PIRF-------A..AGVLGL........------DRETL--------
Q1GGN0_SILST/194-341..RA..DL-----------.DR---QPHL..A.PIIF-------E..PDALAPG.....CP------KRRLK--------
B6AV64_9RHOB/37-183..ET..VL-----------.AK---IPAL..I.PIRI-------A..QGALGPD.....LP------ERDTV--------
Q5LSZ7_SILPO/803-941........-----------.EA---PTAV..A.PIRI-------R..TGVLKN........------TRDLL--------
C9CRM1_9RHOB/318-465..PE..EL-----------.NS---DLRQ..V.PVCL-------A..SGALGEG.....YP------ERELC--------
A3K151_9RHOB/707-851........-----------.LA---RGKM..A.PVRL-------A..PHTLPTDP..SLRD------PRPLL--------
A3SL99_9RHOB/129-267........-----------.QS---TRTT..A.PIVF-------G..EGTLGA........------CRELR--------
A3JLQ1_9RHOB/336-475........-----------.IA---KGRD..A.PIHF-------S..ANAIGN........------HHAVT--------
A6FVP9_9RHOB/45-184........-----------.AG---HGDM..A.PVSI-------G..ANVFEG.......A------QDALL--------
Q6SF13_9BACT/2229-2376..AQ..DL-----------.ED---HPKL..M.PVRI-------R..AGALGCG.....LP------KRDLV--------
Q5LPJ7_SILPO/175-322..IA..DL-----------.GA---NPHL..R.PVRI-------R..RDALGPS.....CP------HRTLW--------
A3VA21_9RHOB/151-298..PL..EL-----------.RA---NPAI..R.PIRV-------K..KGALGHG.....LP------ERDVL--------
B6AYB0_9RHOB/160-302........-----------.TA---LGDF..L.PVRI-------K..AGALGQG.....LP------HRDLI--------
Q2CAT6_9RHOB/160-307..GA..RL-----------.RA---MPEL..A.PVRF-------R..PGAVASD.....VP------DGELL--------
B6B317_9RHOB/170-318..NN..HL-----------.KH---NPEI..R.PIRI-------Q..ADALGEG.....FP------KKDLI--------
B9NQR9_9RHOB/142-290..YA..DL-----------.IK---APEL..R.PVRI-------V..AGALGQN.....LP------ERDML--------
A3SR39_9RHOB/268-419..AE..AL-----------.AQ---DAKL..V.PVKI-------E..TGALGQG.....LP------ERDLL--------
B9NUP1_9RHOB/171-309........-----------.GG---QGRF..A.PVQI-------A..AGVLGA........------QCDIG--------
B6AZD3_9RHOB/512-660..SI..DL-----------.QM---NPRL..K.PIII-------R..ADALGAG.....FP------EQDLI--------
B6B2Z4_9RHOB/167-315..GA..QI-----------.QA---NPNI..R.PILI-------R..ADALGMG.....YP------KLDLI--------
A3SQF2_9RHOB/166-304........-----------.LG---VGRL..A.PVRI-------A..RGALGN........------DRTLW--------
A3XDE7_9RHOB/339-478........-----------.RA---EAAE..A.PVRF-------A..AGALGD........------HAELE--------
B5KDV6_9RHOB/120-258........-----------.PA---LDKR..A.PIRF-------A..PGAIGN........------VRELL--------
A3SHZ7_9RHOB/146-292..PE..DI-----------.AS---SPRL..R.PIKI-------S..AGALGQG.....LP------RADLW--------
A3JSG0_9RHOB/151-289........-----------.PA---VGKM..A.PIVF-------S..KNAYGN........------GRELV--------
A3JT50_9RHOB/142-280........-----------.AA---KAAF..A.PVVI-------S..AGALGN........------ENDLV--------
Q1GMQ5_SILST/293-432........-----------.LA---RGRN..A.PVLI-------A..RNALGH........------HGQIA--------
C7DBW6_9RHOB/268-415..AA..DL-----------.AE---HPNL..M.PIRI-------D..AGALGSK.....LP------NRTMH--------
A9DWF7_9RHOB/194-340..AP..EL-----------.AR---NPKL..Y.PIRI-------T..AGALGAG.....LP------KRDLI--------
B7QQ35_9RHOB/162-309........-----------.HA---SPRT..A.PIHI-------A..AGALGRDGAGRPLP------AVALR--------
Q5LLZ7_SILPO/144-282........-----------.RG---DGAL..A.PVLF-------R..AGVLGN........------FRDLY--------
B7RNT5_9RHOB/692-831..AD..AL-----------.TR---MPHL..K.PIEI-------K..AGAFGN........------HSPLV--------
B7RP36_9RHOB/563-698..HR..AL-----------.RA---APNL..R.PILI-------K..ADALGN........------VRPLF--------
A3JVK2_9RHOB/381-520........-----------.KV---SPEN..R.PIRI-------K..AGTLET........------TKDLV--------
B5KCW8_9RHOB/153-299..AD..DL-----------.TK---NEKL..R.PVLI-------R..ADALGHG.....VP------ARDMR--------
C8RZS8_9RHOB/219-358........-----------.IA---TGAA..C.PVRI-------A..AGVLDN........------DRDLA--------
A8LR09_DINSH/158-296........-----------.DG---RDAL..A.PVEI-------G..TGVLGA........------AAPLR--------
A3VAC1_9RHOB/181-319........-----------.PG---DGPL..A.PVRL-------K..AGALGN........------RRALC--------
C7JHN5_ACEP3/423-565.VRP..DL-----------.PH---DEAG..Y.PVRV-------R..KDAIANG.....VP------YKDML--------
A3VHZ3_9RHOB/168-315..LD..NA-----------.MR---RKRN..A.PVRF-------K..RGAFGAG.....MP------ERDLI--------
Q28SX3_JANSC/168-306........-----------.PA---RGAF..A.PVEF-------A..PGAIGN........------TRRLR--------
A8LK48_DINSH/203-343..PL..TA-----------.DT---MADH..K.PIEF-------K..PGSLGPN.....QP------AARLV--------
A3JYU7_9RHOB/143-282........-----------.RA---SGTF..A.PILI-------R..EGALNN........------ARDLY--------
Q5LMP8_SILPO/160-307..LA..TQ-----------.LL---SHGV..A.PVVI-------P..AHSFAPS.....IP------THPLL--------
Q2CD05_9RHOB/27-169........-----------.VA---GADE..R.PVLI-------R..AGALGPR.....LP------ETDLV--------
A9EEF5_9RHOB/1099-1235..NA..AL-----------.TA---NDTL..R.PVLI-------P..KGSFGA........------TRDLL--------
Q2CCZ2_9RHOB/165-310......FT-----------.DK---GIDN..R.PVRL-------P..ADCLGPG.....VP------RRDLV--------
A6FPB3_9RHOB/928-1068..WD....-----------.AS---PHSD..K.PIII-------K..AGALGHG.....LP------ATDLK--------
Q28UB5_JANSC/126-273..AR..DI-----------.AQ---SPHL..S.PVVI-------A..ADALGPG.....MP------ARELR--------
B6AZM7_9RHOB/573-711........-----------.PC---TPAT..T.PIQF-------E..MGSIDG.......L------SAPLK--------
A3VMW9_9RHOB/142-280........-----------.RA---KGDA..A.PIKF-------E..AGAMGP........------HKTLR--------
Q1GMV1_SILST/833-976..AS..DL-----------.AR---HPHL..R.PVLL-------R..PGGIIA.......N------DRAML--------
B6B239_9RHOB/383-521........-----------.PG---QCRF..A.PIVI-------S..KGALGN........------NRELV--------
A5FZD4_ACICJ/193-329..LS..RH-----------.PR---PELV..R.PVRI-------A..AGALADG.....VP------ARDLV--------
A3W415_9RHOB/142-281........-----------.RG---IGAD..A.PVRF-------E..PGSIGN........------RDMLL--------
B1ZBT1_METPB/133-268..AA..DH-----------.AD---PLAV..W.PVRI-------T..AGALAMG.....VP------VRDLL--------
C7CEK6_METED/138-280..AK..GE-----------.AL---PHNE..Q.PIRI-------R..AGAFGPG.....LP------ARDLR--------
A4ESK2_9RHOB/784-931..PA..EL-----------.AR---KPHL..R.PYCV-------R..PGGILS.......P------ERPML--------
B6B425_9RHOB/122-269..AA..QM-----------.QE---FETL..R.PVMV-------R..AGALGGG.....LP------LRDLR--------
B9JK11_AGRRK/201-336..PK..AI-----------.DK---PRDT..L.PVRM-------K..AGSIAEN.....VP------ERDLL--------
C8S0F9_9RHOB/2250-2389..AV..EL-----------.AA---RPEL..R.PVLI-------R..DGALGN........------RGDLL--------
A3VJF5_9RHOB/166-311..LG..RF-----------.P.---.NRN..R.PVSF-------A..PGSLGGG.....WP------RRTLV--------
C9CXD1_9RHOB/645-786..GA..AL-----------.RA---NPRL..R.PVTL-------Q..PGGILN......LP------.HPMT--------
Q28TH9_JANSC/752-887..VA..QL-----------.TI---YPNL..R.PIRI-------Q..RGVLGN........------TRKML--------
A5G1S8_ACICJ/159-294..PG..RH-----------.AR---PNAV..Q.PVLI-------G..AHAIADN.....VP------ARDLV--------
B0T7Q3_CAUSK/153-288..CD..RH-----------.PA---PALV..N.PVRV-------R..AGAFADG.....VP------SRDLR--------
C7JE32_ACEP3/536-676.VQR..DC-----------.PP---DIAG..V.PIRI-------S..KDALAGG.....VP------HHDLL--------
B7KU45_METC4/258-393..LR..TH-----------.PQ---PTTA..H.PVRI-------A..AGAFGQS.....LP------VRDLI--------
B8IA31_METNO/149-285..GR..FA-----------.NA---NPDV..L.PICF-------K..AGSLADG.....TP------ARDLW--------
A5G006_ACICJ/174-309..SQ..RH-----------.PR---PETV..W.PVRI-------E..RGAIDDG.....LP------ERTLY--------
A3VFB5_9RHOB/155-300..L....T-----------.GA---RKPQ..T.PLLF-------P..KGSLAPG.....MP------HSDLI--------
D2CKZ0_9GAMM/93-241.PNA..EN-----------.QT---DGMG..K.LSRI-------T..ADSFGLG.....RP------MPDLL--------
B6AU02_9RHOB/46-193..QC..AL-----------.VE---NEKL..R.PVRI-------S..TGALGNN.....LQ------ETDLL--------
A5FW80_ACICJ/285-421..LA..MH-----------.PA---PEKV..K.PVCF-------A..PGSMADG.....VP------ARRLR--------
A3VJV0_9RHOB/145-290......FD-----------.PR---PHPG..Q.PVHI-------A..KGAFGPG.....LP------TRDLI--------
A8LLK3_DINSH/164-305..LA..EQ-----------.IA---NARL..R.PVRI-------A..AGALGPG.....CP------ARPLW--------
Q5FQG8_GLUOX/285-425.TGT..TG-----------.HA---DVDA..V.PVRV-------R..AGALADG.....IP------SRDLL--------
C8RY96_9RHOB/128-267........-----------.RG---VGAF..A.PVVI-------G..KGVLGN........------EGDLI--------
B0UJT1_METS4/116-254..CR..SH-----------.AN---PAAA..R.PIRI-------R..KDAFGPG.....KP------AQDLL--------
A3JW88_9RHOB/167-310..P.....-----------.ID---GDDD..Y.PILI-------K..AGALGDG.....VP------YSDII--------
B2SAQ3_BRUA1/14-150..AG..EA-----------.DW---NESV..M.PIRV-------R..RHALDGR.....TP------HRDLY--------
Q2CAV0_9RHOB/70-218.PKA..RG-----------.QA---EHMG..R.LTRI-------A..ADALGIA.....RP------MPDLV--------
O68085_RHOCA/442-581..AA..DL-----------.AA---EPGL..L.PVAI-------R..ENALGR........------HGALL--------
D0CWR5_9RHOB/156-294........-----------.IA---AGRF..R.MVTI-------P..AGTLGN........------TAPLC--------
Q5LUZ7_SILPO/68-216..PG..RV-----------.SA---TGRD.YR.LTRI-------M..ADAFGMQ.....RP------MSGVI--------
A3W580_9RHOB/62-208..PQ..DI-----------..A---ERSV..K.LTRI-------M..ADAFGIA.....RP------MADFL--------
D0D5E7_9RHOB/33-180..PG.VEN-----------.GE---TTVV..Q.LSRI-------T..ADAFGPT.....RP------QADVL--------
Q0BS96_GRABC/3687-3823..GR..FI-----------.QG---RRDV..L.PVRI-------R..QGALDGV.....LP------KRDLL--------
B1M2P7_METRJ/65-199...P..GS-----------.SA---PPSE..R.PVRI-------R..ASALHEG.....VP------ARDLL--------
A3W8K4_9RHOB/154-299...P..LE-----------.EV---EPDA..K.PVLI-------K..AGSLGPG.....RP------AYDLI--------
A3VEX8_9RHOB/9-155..PG..DA-----------.AL---QPDL..A.LVEI-------A..EGALGDG.....GP------THATW--------
A3JSM6_9RHOB/118-255..NT..RL-----------.TD---PKKV..N.PIRI-------C..AGALGNG.....LP------LRDLE--------
A3SRN1_9RHOB/161-308..AA..LF-----------.AA---EPKT..R.PILL-------R..RDALAPG.....VP------LADLY--------
Q1N7J0_9SPHN/211-348..RI..PQ-----------.AH---LDDM..W.PILI-------E..ANAISDA.....VP------SRDIR--------
A9DUV0_9RHOB/49-194..PA....-----------.DT---GRRL..P.LIRI-------M..PDSFGEG.....RP------SSFLT--------
A6FV85_9RHOB/70-218..P...NV-----------.AG---VPALACR.VTRI-------M..PDAFGME.....RP------MSNLM--------
A3JS61_9RHOB/164-301..NT..KL-----------.SN---PANV..N.PILI-------K..ANALADG.....VP------ARDMR--------
A3VAX2_9RHOB/110-257..IP..DA-----------.PD---FEKW..R.PVRV-------R..AHAFGPG.....CP------ARDTF--------
A6E265_9RHOB/196-333......TK-----------.FG---RPDA..L.PVRI-------M..AGALGEG.....LP------IADLT--------
C7D8E1_9RHOB/33-181..PD.FTR-----------.QS---PEMG..K.LTRV-------T..ADRFGLG.....KP------MHDLV--------
Q1MD68_RHIL3/83-221..KS..GA-----------.RW---HKDV..V.PIRV-------S..RHALDGH.....TP------HSDLY--------
A5FVL4_ACICJ/410-545..CR..RH-----------.PV---PESV..L.PVLI-------E..KDAFGVG.....QP------CRDLY--------
A3JWF1_9RHOB/121-260..TA..MA-----------.EV---PQNM..E.LVRI-------A..SGALDEN.....LP------VRDLI--------
A4YQ57_BRASO/106-246.AKP..DA-----------.AW---PAAA..R.PVRI-------A..KSALGPD.....IP------KRDLY--------
B6B9L0_9RHOB/67-214..PA..RQ-----------GSR---GRSH..R.LTSF-------M..ADSLGLQ.....KP------ASSVV--------
A3JPL6_9RHOB/158-295...T..RF-----------.TN---PKMI..N.PICI-------S..AGALDEN.....VP------SRDLL--------
A5FWA2_ACICJ/1192-1328..LS..RD-----------.PA---AALL..H.PVVI-------T..PGAFGPC.....MP------SHPLT--------
A3S7N1_9RHOB/69-214..PA..DI-----------...---GHRT..P.LVRV-------M..ADSLGLA.....RP------SGFLT--------
A3V9D9_9RHOB/136-275........-----------.RA---TGRF..A.PVVI-------T..QGTLHN........------DADLV--------
A9GL51_9RHOB/726-866..TA..RK-----------.QL---PEAL..M.PVRL-------S..SDAFGS........------DEAPV--------
B6AWU4_9RHOB/33-181..PA.QAL-----------.PT---SSLK..G.LVRL-------V..ADGYSNS.....SA------LGDLL--------
C3KQV1_RHISN/76-214..RS..GP-----------.MW---HKNV..V.PVRI-------A..RLAIDGQ.....RP------HKDLY--------
B7RGP3_9RHOB/19-157........-----------.FG---KGGN..A.PIRI-------A..SGVLGN........------VAPLL--------
A3VKC8_9RHOB/32-181YDNE.NEN-----------.AQ---AAER..G.PVRI-------K..AGALGTD.....PE------AGNLV--------
B7RR26_9RHOB/132-273...A..DR-----------.AN---QMKK..A.PIRI-------A..KDAFGKG.....CP------VDDVF--------
A3JPP3_9RHOB/102-239......PI-----------.FA---GSKT..D.PVRF-------M..ASSLGDS.....VP------SQDLI--------
A9G7V6_9RHOB/181-329........-----------.PA---IGHD..A.PMRL-------R..APFFGL........------TEDLL--------
A3TTS1_9RHOB/32-176.......I-----------.PS---PHSG..KLLTRV-------T..AGRFGTA.....QP------ELDLL--------
B5J8X8_9RHOB/33-181.PGA..PG-----------.QD---ARMG..K.MIRF-------S..TGALGIG.....RP------MPDLL--------
A3W2P6_9RHOB/178-317........-----------.PA---MGSF..R.PVRL-------R..APYFGL........------RHDIV--------
A3SKF2_9RHOB/139-280..ARNGRD-----------.AG---QGDT..R.LVRI-------P..RGAFGN........------REAVF--------
A3JS38_9RHOB/159-295..AS..AF-----------.KN---PDDV..N.PICI-------R..ANALGLG.....YP------EQDFY--------
A6DXP5_9RHOB/101-239..ST..RF-----------.GS---AARN..D.LIRV-------D..QGALENG.....LP------VRDLT--------
A3SRA3_9RHOB/68-209..PD..NI-----------.A.---.PVA..P.LTRV-------M..TDAFGLG.....RP------SPDFL--------
A8LKB8_DINSH/19-167..LA..EM-----------.RA---DPAL..A.PIRL-------T..PRALGPL.....MP------VRSLA--------
A3SI78_9RHOB/178-317........-----------.PA---RGAF..R.PIRL-------R..APYYGL........------TEDIH--------
A3V3N0_9RHOB/64-210..PS..DA-----------..G---SVRH..G.LTRI-------T..ADALGIG.....RP------LQDLV--------
A3JS40_9RHOB/158-295...P..TF-----------.QA---PSLI..N.PICI-------M..KGALGYG.....FP------SADLF--------
A3Z148_9SYNE/71-210..PE..SL-----------..E---EIDS..M.PILI-------K..QDALGNG.....LP------CRDLY--------
A3JT43_9RHOB/20-157...P..RL-----------.SP---ASMV..N.PICI-------C..AGALGDN.....VP------SRDLF--------
A4EJ24_9RHOB/71-219.PVA..NT-----------.AN---VKQT..I.MTRI-------T..ADALGDN.....RP------SQDLV--------
C9CYM4_9RHOB/179-319........-----------.PA---YGSF..C.PVRL-------R..APYFGL........------TQDIT--------
C7D959_9RHOB/18-157........-----------..P---VIAN..R.PIKV-------A..KNAIAPG.....VP------ARDTV--------
A3XDE1_9RHOB/175-315........-----------.PA---LGIF..R.PVTL-------R..APFFGL........------QQGIQ--------
Q5LN78_SILPO/204-343........-----------.PA---FGSS..R.PLTI-------R..RPYFGL........------RQDIQ--------
A6FNZ8_9RHOB/22-159........-----------...---..RT..A.AVRI-------A..AGSLGQS.....RP------DRDVT--------
A6DX68_9RHOB/142-284..LD..PL-----------..T---SNSV..A.PVRF-------E..VGALGAG.....HP------MRPLK--------
C7DFW9_9RHOB/173-311.......L-----------.PA---RGQF..Q.PLRV-------R..APYFGA........------THDVY--------
B7QV01_9RHOB/186-327.......R-----------.PA---VGHD..T.PVRL-------R..APFLGL........------DEDII--------
B7RNA8_9RHOB/11-157..GP....-----------.DG---LPLL..P.PLRL-------RPRENAATDG.....L.------QEPLR--------
A6E3T2_9RHOB/4-141........-----------...---..RT..A.AVRI-------M..AGTLGHT.....RP------ERDVT--------
A3X8D5_9RHOB/25-168..LE..AG-----------.EI---DPTR..C.PMHI-------P..RDALNNR.....VP------...MW--------
A3JQA1_9RHOB/57-194..SA..AF-----------.PM---NSQC..D.DIII-------P..KNSLGLG.....LP------LMDLQ--------

PF05203

Q8J0G3_ZYGBI/11-460.LLDENVR-----------AAT...YQLR--A-PVLL-------Q--NDFFSQYVSNSKFA------SGTEA...TRALS
Q8J0G2_ZYGRO/19-468.LLSAQVR-----------KAT...YQLS--A-PVLL-------E--NNHFSHYLKDSNSA------VGNDT...VRALS
Q8J0G5_9SACH/19-473.VLGADVR-----------EAT...YQVY--S-PVLY-------E--SDFFSQYVKDSKFG------LTSEA...PLALA
Q8J0G6_9SACH/19-474.ALGAHVR-----------KAT...HQVY--A-PVLY-------E--SDFFFHYVKDSKFC------LKSEA...PFALA
Q8J0G4_ZYGBA/19-474.ELGAHVR-----------KAT...HQVY--A-PVLY-------E--SDFFFHYVKNSKFA------LRSEA...STALA
Q9P986_SACPS/1-465.YLDAQLR-----------ISS...CIRF--G-PVLA-------G--NGVLSKFLTGRSDL------V.TPA...VKSMA
A7TIB9_VANPO/1-464.LLSPQIR-----------VTS...FLHF--N-PIIK-------G--NGILSEFLTGEKHL------I.TTG...VLQMA
C5DTQ4_ZYGRC/1-464.ILEAQVR-----------VNS...FLRF--N-PLLE-------G--NGVLSEFLTGQKGL------N.SPA...VLTMA
Q707W4_KLUDE/1-464.YLDTSMR-----------VTS...ALKC--S-PILC-------G--NGILSKFLSGKPHL------I.TPS...ITAMA
Q707W9_CANGB/1-464.YLDASMR-----------VTS...TLKC--N-PVFS-------G--NGILSNFLSGQRHL------I.TPA...IVSMA
Q6TER1_CRYNE/36-207.RLPQQEQ-----------QKY...QLFR--S-TAS.-------.--..............------.............
Q1KMS2_AJECA/5-539.ALDPEER-----------RWY...RLFR--S-PGF.-------.--..ELGQQNVP....------.........I.DP
Q1MSX1_PENEN/51-212.ALSTEER-----------GLH...SAFT--S-SRV.-------.--..............------.............
C5FT71_ARTOC/1506-2056.ALKHEER-----------RKY...RLFR--S-PGF.-------.--..DLPEQSVP....------.........C.NP
Q1A775_9EURO/44-198.TLSAEER-----------GRY...RAFR--S-PSF.-------.--..............------.............
Q1ECT9_EMEND/1526-2130.ALHPQER-----------SWY...RAIR--C-PGF.-------.--..ELPEQDVP....------.........V.NP
Q1A774_ASPGI/56-222.AFSPEER-----------NQH...RVFK--S-SCL.-------.--..............------.............
B9XA08_9BACT/492-829.SWNTTQK-----------HIH...KLFR--V-PV..-------.--..QWPEVRQPIT..------............P
A6QC64_SULNB/206-549.TKSDKFK-----------SNY...KGYK--V-AV..-------.--..DFPEKVLEVE..------............P
Q2S6J9_SALRD/231-574.DQSDKWK-----------DDN...KGFK--V-AA..-------.--..EFPDQPVPLD..------............P
A3EZR5_9CAUD/34-380.KLPKYVT-----------GPNGYLKGWR--V-PVDF-------P--RKEQDEALLP....------............P
Q5G7M7_9CAUD/35-373.RSSSTFK-----------HRS...KLQR--F-GF..-------.--..DLPGKNLPIP..------............P
A8BML4_GIAIC/4-440.KLEPKLQ-----------RMFKLVRPLL--P-IRFV-------D--AVTVIQDETKTDVD------ILKNMDIRPTDLP
A1ZUM1_9BACT/19-423KDVPP...-----------......QQVY--H-LMLD-------H--QDYFFAGNATQKFM------VLAYC...PKLLD
Q6BRM0_DEBHA/283-676.HMSDDVR-----------CAT...QQSW--A-PVLA-------S--KEVLAPVVQEAGFD------A.TIA...PY.VS
Q874G6_KLULC/277-686.LVDSSIR-----------EVT...QQLI--N-PVLL-------E--KEHLAGVLKSNDFQ------S.SLA...PQ.FS
Q874G7_CANGB/277-691.YLSERVR-----------MFT...KQSV--N-PVLL-------E--TPTLAKQLESNE..------..STA...TN.LA
B6JY11_SCHJY/278-753.LVSQEVR-----------ELT...QQMI--S-PVLF-------E--KADLQNRLVKRGIS------A.KYA...SE.AA
Q8J0G9_9SACH/19-519.KLGYNVK-----------KSS...HQMI--N-PVFK-------E--SGNLIAKLNELGFS------K.EIA...PQ.MG
Q874G5_NAUCA/266-782.QLDHYVK-----------KSS...YQMI--N-PVFK-------E--SGNLANILGDAGIE------K.TLA...AK.MA
Q874G1_9SACH/246-659.ELDVNVR-----------NAT...TQLI--N-PVFY-------E--SGKLASRLQTKNID------Q.TSA...DK.LA
Q8J0G8_SACEX/19-520.SLGHYVK-----------KCS...YQLI--N-PVFH-------Q--SGKLAQEIASLNYS------K.DKA...PL.LA
C5M9I6_CANTT/244-714.QVDEIVK-----------TST...TQMI--N-PVHF-------E--SGKLGNWLHEHKQN------K.SLA...PQ.LG
A5DXZ0_LODEL/280-700EQVEDTVK-----------QNS...TQLI--N-PVFY-------E--SNAIGKWLADNGET------KPSSA...SE.LA
A3LP04_PICST/283-731.RLGYHVR-----------RAT...RQLW--S-PVLV-------E--KEVLAPMIAKRGFD------E.SIA...PY.MA
A7TLB5_VANPO/284-716.RLTESIR-----------EAT...YQVY--A-PVLY-------E--CENLLQYLKNTKYN------LNEKS...PTALA
E9P8D3_YEASX/259-712.LLGSHVR-----------KAT...YQTY--A-PILY-------E--NDHFFDYMQKSKFH------LTIEG...PKVLA

PF01079

Q7PXI1_ANOGA/295-503--T.....-----------.HQ---RREF--V-TIEA-------E--------------GG------.ALLK--------
HH_DROHY/253-475--L.....-----------.EQ---VENF--V-QLHT-------D--------------GG------.AVLT--------
HH_DROPS/255-475--L.....-----------.EQ---MQNF--V-ELHT-------D--------------GG------.AVLT--------
Q1HEQ6_TRICA/99-299--P.....-----------.SQ---KRQF--L-HITL-------A--------------SG------.RTLT--------
SHH_CYNPY/190-418--E.....-----------.TV---RKVF--Y-VIET-------S--------------R.------.ERVR--------
A0JM37_XENTR/187-392--L.....-----------.YK---TATF--V-LIEA-------E--------------GH------TSKLL--------
Q2QJG8_9ANNE/186-383--E.....-----------.NA---VASF--V-TLKT-------E--------------GG------.RSLT--------
IHH_DANRE/187-398--P.....-----------.IT---QKHF--Y-VIRT-------E--------------DG------.ASVS--------
Q708D0_9MYRI/276-506--P.....-----------.SS---RRLF--R-VIET-------E--------------GG------.HSVT--------
TWHH_DANRE/190-403--P.....-----------.TT---RRQF--I-VIET-------S--------------EP------FTKLT--------
WRT4_CAEEL/327-547--P.....-----------.KQ---VADF--V-EFTL-------D--------------NG------.ETFS--------
Q8AXT0_TAKRU/187-399--S.....-----------.TT---RRLY--H-VIET-------D--------------SG------.QKIT--------
Q6BCD0_MERUN/188-423--E.....-----------.GA---KKVF--Y-VIET-------R--------------EP------RERLL--------
Q80XI9_MOUSE/230-435--P.....-----------.NR---LRAF--Q-VIET-------Q--------------DP------PRRLA--------
Q75UQ8_PARTP/185-402--E.....-----------.TQ---QRLY--N-TLET-------E--------------NG------.RSIT--------
Q7Z264_9SCOR/158-375--P.....-----------.KT---NRQF--Y-VLHT-------N--------------TG------.RSIT--------
Q8MWG6_PATVU/190-409--E.....-----------.RE---LERY--I-TLHT-------E--------------DK------.KDIT--------
WRT6_CAEEL/375-583--D.....-----------.EE---IAEF--N-LIET-------A--------------NG------.HSIK--------
A3KNS3_DANRE/187-399--P.....-----------.SA---RKQF--F-TIET-------D--------------SG------.AKLS--------
Q5UVJ3_STRPU/189-402--L.....-----------.ND---STLF--Y-VIET-------E--------------DK------.SVVQ--------
O73803_TAKRU/190-436--P.....-----------.ES---RWRF--L-SLQT-------E--------------DG------.RRLA--------
A8X447_CAEBR/327-545--Q.....-----------.TQ---KATF--I-EFSL-------D--------------NG------.EKFS--------
IHH_CHICK/188-394--P.....-----------.RA---LTAF--H-VIET-------R--------------QP------PRRLA--------
SHH_XENLA/188-430--R.....-----------.DV---KKLF--Y-VIET-------S--------------Q.------.RKIR--------
SHH_CHICK/190-411--D.....-----------.SS---RKLF--Y-VIET-------R--------------QP------RARLL--------
Q1PHR2_SACKO/171-384--P.....-----------.NR---RQRF--H-VIET-------E--------------DG------.QKLT--------
SHH_DANRE/187-404--S.....-----------.TT---RRVF--Y-VIET-------Q--------------EP------VEKIT--------
IHH_XENLA/187-395--P.....-----------.KE---EHMF--Q-VIKT-------Q--------------DP------HRRLF--------
A2I5E3_LEUER/186-403--E.....-----------.EV---EKVF--Y-VVET-------R--------------EP------RRKLA--------
O57567_NOTVI/188-392--S.....-----------.TA---VKEF--Y-VVET-------R--------------DP------PRRLA--------
WRT8_CAEEL/325-538--P.....-----------.EQ---EAEF--V-EFLL-------E--------------NG------.ESFT--------
Q22872_CAEEL/566-779--P.....-----------.EK---VQEF--L-TIMT-------E--------------YG------.KTLR--------
Q49QW4_9MOLL/164-385--N.....-----------.DT---SGHF--Y-VLET-------E--------------NG------.HKVH--------
DHH_HUMAN/188-396--L.....-----------.QR---RASF--V-AVET-------E--------------WP------PRKLL--------
Q8MY56_CIOIN/186-395--P.....-----------.EI---GGSY--I-EIRS-------Q--------------L.------.ETIR--------
Q175B3_AEDAE/201-412--T.....-----------.HQ---SREF--V-HIEA-------D--------------GG------.AHLT--------
A2I5D9_POLSP/90-308--P.....-----------.ES---RRVF--Y-VIET-------E--------------EP------HKQIA--------
Q66PH6_9TELE/184-413--P.....-----------.ST---RRVF--Y-VIET-------K--------------AP------VQKIT--------
A4UYK7_9ACTI/187-406--S.....-----------.AT---RRVF--Y-VIET-------K--------------EP------VEKIT--------
Q9GRA8_GRYBI/198-413--P.....-----------..A---PRTL--L-RVRT-------A--------------SG------.RTLA--------
Q9U5Z6_BRABE/191-404--S.....-----------.RG---PWVY--Y-TIKT-------E--------------DR------NITVT--------
Q4PLX3_DANRE/191-442--R.....-----------.ES---RTSF--F-IITT-------E--------------NE------.KRIA--------
O45992_CAEEL/258-471--P.....-----------.EQ---EAEF--L-EFSL-------D--------------NG------.ETFT--------
Q8MY57_CIOIN/294-550--SDIVSG-----------HQA---YRQM--V-EITT-------E--------------NG------.FSVT--------
Q9W7Q9_PAROL/187-400--S.....-----------.TT---RRLF--Y-VIET-------D--------------SG------.QKIT--------
Q7Z263_ARTSF/158-415--V.....-----------.TD---NRQF--V-KLTT-------E--------------SG------.ETVE--------

PF14623

F0YDN2_AURAN/823-991GFADLVRV...........GPDVALTPWH----PVRA..GGA..WAFPADLGAEARVPCDA......LISLL--------
C0NJD1_AJECG/548-714..TILCNI...........G.SLSITPWH----PIQV..AGD..WIFPSHVS.....EQNV.PFSGTVYSVL--------
E4UR10_ARTGP/540-711..VEICEI...........D.CLQITPWH----PMKF..QGK..WEYPINMT.....NGDAQAFSGNIYSVL--------
D2VHB8_NAEGR/586-750PIVKLCEM...........N.GMYITPYH----PVRV..KGE..WKFPIDIKSPQDVACDY......VYNLV--------
Q2GTB7_CHAGB/570-754..VEMCLVAAAAGPSGKGKS.RLLVTPWH----PVELHQGGK..WVFPRDHA.....ARSV.RYTGAVYSVL--------
Q22N58_TETTS/494-660SNHSFVKL...........G.NLLITPWH----PVRL..MHEQQWQFPSSLGQTIFEQADA......VYSFL--------
E9EQB7_METAR/534-699..ETLCHV...........G.NLLVTPWH----PISA.NGKA..WDFPAFLA.....DGTV.RYTGSVYSVM--------
F2SQT7_TRIRC/537-709..IDICRI...........G.TLQITPWH----PMRI..QNA..WEFPFNIT.....KEHLQSFSGDIYSVL--------
C7YL43_NECH7/586-752..ELLCRM...........G.KVLVTPWH----PVSN.DRKR..WSFPANAA.....EGVV.LYTGCVYSVL--------
E3QU32_COLGM/508-676..EVMCRV...........G.DLVVTPWH----PLSLDGGKT..WAFPASVA.....DRRSVRYTGCVYSVL--------
Q237Q6_TETTS/509-673NLTQLVRL...........GKGLLITPYH----PVRI..QGK..WLFPTDIAPTKMAQCSS......VYSFL--------
C5FLY1_ARTOC/540-711..IDICKI...........G.SLEITPWH----PIRF..QGR..WSFPFNVA.....NGDVHTFSGNIYSVL--------
Q24C76_TETTS/502-666NSHSFVQI...........GENLWITPKH----PIRI..NGE..WIYPNKMGEVQQKQSDF......IYQFV--------
A9UVU8_MONBE/587-772GEHDFCQL...........SPGLRITPWH----PVRE..PSTKRWAFPSELVVPKRHASEY......MYSFV--------

PF07591

A3DGR7_CLOTH/105-234-------------------------TTEL--L-HLTI----------NG....--------------.EVIK--------
A5Z4R4_9FIRM/129-258-------------------------VKKL--I-HLVV----------DD....--------------.EELV--------
A1KVQ7_NEIMF/353-489-------------------------YQET--V-YIEI----------SDGIGN--------------SQTLI--------
Q5F6G7_NEIG1/1-137-------------------------YQET--V-YIKV----------SDGIGN--------------SQTLI--------

PF14890

A9B528_HERA2/384-526--------------------FTTGTKPVF--KLRTKL------------------------------GRSIR--------
DNAB_SYNY3/385-808--------------------FCTGKKLVY--ILKTRL------------------------------GRTIK--------
GLMS_METJA/76-569--------------------KHKAPKILY--KIKTAF------------------------------SELIT--------
D7E146_NOSA0/393-538--------------------FCTGIKPVF--TLTTRL------------------------------GKKIR--------
B5W0N0_SPIMA/394-525--------------------FATGVKPTF--DLKTRL------------------------------GYTIT--------

PF10596

A6S230_BOTFB/991-1164------KDQLYLRHDYLVLHNSGFEESM.--K-FKKL----------TNAQRSGLNQIPNR------RFTLW--------
Q5KPW2_CRYNJ/1640-1797------KDSLYLRHDYLVLHNSGFEESM.--K-NKRL----------TNAQRSGLSQIPNR------RFTMW--------
A6R4K4_AJECN/1351-1497------R..................ACLA--K-GTQL----------LRYDGTKVRVEDVR------EGNLL--------
Q00RU5_OSTTA/1516-1683------K.............ASGFEQSM.--Q-YKKL----------TNAQRSGLNQIPNR------RFTLW--------
A8BTS5_GIAIC/1331-1491------T.............ATEHETGLA--K-RTNL----------TRARRQGLSQIPNR------RFALW--------
A4IBT3_LEIIN/1514-1675------R.............SGGFENSK.--K-DTKL----------AKQQRAGLSKVPNQ------RFALW--------
Q9AW36_GUITH/1259-1418------K.............RSKFENLI.--R-NKKL----------TNAQKLGLNQIPNR------RFTLW--------
Q3LWH1_BIGNA/1383-1542------K.............SSGFEETM.--K-FRKL----------TNAQRTGLNQIPNR------RFTLW--------
Q6FQZ4_CANGA/1515-1674------K.............ASGFEDSM.--Q-FKRL----------THAQRTGLSQIPNR------RFTLW--------
Q9XYM9_TRIVA/1432-1591------N.............TTGFEEAL.--K-YRKL----------TNAQRQGMSQVPNR------RYTLW--------
Q4PEC7_USTMA/1470-1629------K.............SSSFEESM.--Q-QKRL----------TNAQRSGLSQIPNR------RFTLW--------

PF13403

A3PK18_RHOS1/14-160-----------VSPN-----HRILVSRD.----------------RTALH------------------------------
A3SZU1_9RHOB/393-539-----------VSPN-----HRMLVASE.----------------TAEVM------------------------------
Q1GGP9_SILST/27-173-----------VSPN-----HRVLVAND.----------------KTALY------------------------------
C8RY14_9RHOB/1350-1496-----------VSPQ-----HRMLFSGA.----------------RAEMF------------------------------
Q1GES6_SILST/157-304-----------VSPE-----HRMLVRGA.----------------AARAL------------------------------
A3SNQ6_9RHOB/641-788-----------VSPN-----HRMLLVSG.----------------MAEIM------------------------------
A3SUS4_9RHOB/185-331-----------VSPN-----HRIFISDA.----------------RSMLH------------------------------
D0CP51_9RHOB/143-290-----------VSPQ-----HRMLVRSA.----------------IAVRM------------------------------
C7DAD7_9RHOB/178-316-----------VSPQ-----HRMLLQGW.----------------QAELL------------------------------
A9GA60_9RHOB/583-733-----------VSPQ-----HRMLLTGS.----------------RAELL------------------------------
A1AYR4_PARDP/380-527-----------VSPQ-----HRVLLRSV.----------------VARRM------------------------------
A6DV24_9RHOB/336-474-----------LSPL-----HRVLIRDS.----------------LAELL------------------------------
A3VAW0_9RHOB/105-251-----------VSPM-----HRILIDGP.----------------EAQLY------------------------------
A3TXC6_9RHOB/29-175-----------VSPE-----HRVMVAGN.----------------HVEAV------------------------------
A8LN65_DINSH/175-322-----------VSRQ-----HRVLLEDW.----------------RADLL------------------------------
A1B4V8_PARDP/356-503-----------VSPQ-----HRVLVRSN.----------------IAQKM------------------------------
A3K5E2_9RHOB/849-996-----------VSPQ-----HRVVMTGA.----------------PVELL------------------------------
B6BC88_9RHOB/475-613-----------VSPQ-----HRMLYSGQ.----------------AATLL------------------------------
A4EMR4_9RHOB/71-217-----------VSPS-----HRMLIVSH.----------------QAEFY------------------------------
A3V1Q6_9RHOB/111-258-----------VSPQ-----HRVLIRSR.----------------IAQRM------------------------------
B7QV02_9RHOB/335-473-----------VSPQ-----HRVLLSDA.----------------MAEIL------------------------------
C9D0M9_9RHOB/1229-1376-----------LSPQ-----HRVLIATP.----------------AVERM------------------------------
Q0FQ52_9RHOB/227-374-----------VSPQ-----HRVLVSNA.----------------VAERM------------------------------
D0CWS5_9RHOB/173-320-----------VSRQ-----HRMLAQSP.----------------IARRM------------------------------
D0CQ11_9RHOB/159-297-----------VSQQ-----HRMLVRDW.----------------RVELN------------------------------
A8LKN9_DINSH/122-260-----------VSPQ-----HRMLLSDP.----------------RLLLL------------------------------
A3JWU1_9RHOB/200-347-----------VSPQ-----HRVLIASP.----------------IAVRM------------------------------
A3VI53_9RHOB/624-762-----------VSPQ-----HRMVYSGS.----------------RANLY------------------------------
A3SQF1_9RHOB/126-264-----------VSPQ-----HRMLLSDW.----------------QVELA------------------------------
B5K4Q3_9RHOB/102-249-----------VSPD-----HRVMVRGA.----------------RAQAL------------------------------
A3JUC9_9RHOB/546-693-----------VSPQ-----HRIMVRSK.----------------IANRM------------------------------
A3W238_9RHOB/563-702-----------VSPQ-----HRFLFTGY.----------------KAELL------------------------------
B9NR62_9RHOB/115-262-----------VSQQ-----HRILIKGP.----------------KVEML------------------------------
C7D8K4_9RHOB/545-684-----------VSPQ-----HRMLFQGY.----------------RAELL------------------------------
Q28WJ0_JANSC/241-379-----------VSPE-----HRMLVQGW.----------------RCQVL------------------------------
A4EIH6_9RHOB/690-837-----------VSPQ-----HRIFVKSK.----------------IAIRM------------------------------
B5J379_9RHOB/742-889-----------VSPQ-----HRVLITSK.----------------VAQRM------------------------------
C9CTM7_9RHOB/120-267-----------VSRQ-----HRMLVSSK.----------------ICERM------------------------------
A4EL36_9RHOB/35-182-----------ISPQ-----HKILISDW.----------------RAEMY------------------------------
C9D2P0_9RHOB/151-297-----------VSRQ-----HRMLVRSR.----------------IAERM------------------------------
A3V7F0_9RHOB/249-396-----------VSGQ-----HRIMVASA.----------------IVERM------------------------------
A3XC10_9RHOB/338-477-----------VSPN-----HRMLVTGQ.----------------FAELL------------------------------
A3JZG9_9RHOB/189-327-----------VSQN-----HRMLFGGP.----------------RAELM------------------------------
A3W5R9_9RHOB/184-322-----------VSQN-----HRLLVSGA.----------------HAELL------------------------------
Q5LPM0_SILPO/507-646-----------VSPQ-----HRMLWSGS.----------------RAQMY------------------------------
A3SHB9_9RHOB/143-290-----------VSPQ-----HRILSQSL.----------------IARRL------------------------------
A3TTF8_9RHOB/31-178-----------VSPQ-----HRILLASK.----------------VVERM------------------------------
B6BEV2_9RHOB/337-476-----------VSPQ-----HRMVVSGP.----------------LAELL------------------------------
A3JMU4_9RHOB/108-255-----------VSPQ-----HRVLIDSP.----------------IAKDL------------------------------
C9CXZ7_9RHOB/141-288-----------VSPQ-----HRFLTISP.----------------IAKRM------------------------------
Q28L14_JANSC/1268-1415-----------VSPQ-----HRMLIEGG.----------------QTELL------------------------------
D0CSG1_9RHOB/199-337-----------VSPQ-----HRMLIDDW.----------------RAEYF------------------------------
Q1GGN0_SILST/194-341-----------VSPQ-----HRILIESH.----------------MSGLL------------------------------
B6AV64_9RHOB/37-183-----------VSPQ-----HRMLLNNA.----------------QIRDW------------------------------
Q5LSZ7_SILPO/803-941-----------VSPN-----HRILMMGP.----------------MVEFY------------------------------
C9CRM1_9RHOB/318-465-----------VSPQ-----HRILVKSK.----------------IAERI------------------------------
A3K151_9RHOB/707-851-----------VSPQ-----HRLLIEGF.----------------EAELL------------------------------
A3SL99_9RHOB/129-267-----------VSPN-----HRMLISTA.----------------EAELY------------------------------
A3JLQ1_9RHOB/336-475-----------FSQN-----HRVLIRDA.----------------LAELL------------------------------
A6FVP9_9RHOB/45-184-----------VSPH-----HRILYSGY.----------------VAELL------------------------------
Q6SF13_9BACT/2229-2376-----------VSPQ-----HRMLVQAQ.----------------LSDSS------------------------------
Q5LPJ7_SILPO/175-322-----------VSPQ-----HRIVLQGW.----------------RAELF------------------------------
A3VA21_9RHOB/151-298-----------LSPQ-----HRVLVRSR.----------------LAMRM------------------------------
B6AYB0_9RHOB/160-302-----------VSQQ-----HRMLISSH.----------------IARRI------------------------------
Q2CAT6_9RHOB/160-307-----------VSPG-----HRVLVGGR.----------------RAEAM------------------------------
B6B317_9RHOB/170-318-----------VSPQ-----HRVLVRSK.----------------IAERI------------------------------
B9NQR9_9RHOB/142-290-----------VSRQ-----HRMLTRSA.----------------IAQRM------------------------------
A3SR39_9RHOB/268-419-----------VSPQ-----HRMMISSP.----------------VVQRM------------------------------
B9NUP1_9RHOB/171-309-----------VSPQ-----HRVLVTGW.----------------QAQLW------------------------------
B6AZD3_9RHOB/512-660-----------VSPQ-----HRIFVRSM.----------------IAERM------------------------------
B6B2Z4_9RHOB/167-315-----------VSPQ-----HRILLSSP.----------------IAKRI------------------------------
A3SQF2_9RHOB/166-304-----------VSPQ-----HRMLVSDW.----------------RAELL------------------------------
A3XDE7_9RHOB/339-478-----------LSPS-----HRVLIQDQ.----------------WAEVL------------------------------
B5KDV6_9RHOB/120-258-----------VSAQ-----HKILVSGW.----------------RAELF------------------------------
A3SHZ7_9RHOB/146-292-----------ISRQ-----HRMLVHSP.----------------LCRRL------------------------------
A3JSG0_9RHOB/151-289-----------VSPN-----HRMLFTGY.----------------KAELL------------------------------
A3JT50_9RHOB/142-280-----------FSPE-----HRVLLTGA.----------------AIELA------------------------------
Q1GMQ5_SILST/293-432-----------LSPN-----HRVLIRSE.----------------LADLQ------------------------------
C7DBW6_9RHOB/268-415-----------VSPQ-----HRMLIASR.----------------LVART------------------------------
A9DWF7_9RHOB/194-340-----------VSRQ-----HRMVARSG.----------------IVKRM------------------------------
B7QQ35_9RHOB/162-309-----------VSPQ-----HRVLIASR.----------------VAERL------------------------------
Q5LLZ7_SILPO/144-282-----------VSQQ-----HRMLITGW.----------------QAELA------------------------------
B7RNT5_9RHOB/692-831-----------VSPQ-----HGILLS...----------------.....------------------------------
B7RP36_9RHOB/563-698-----------VSPQ-----HSMMVGE..----------------.....------------------------------
A3JVK2_9RHOB/381-520-----------VSPN-----HRMLITDV.----------------WAELL------------------------------
B5KCW8_9RHOB/153-299-----------VSRQ-----HRMMVSSI.----------------IAQRM------------------------------
C8RZS8_9RHOB/219-358-----------VSGQ-----HLLLLSGV.----------------DCELL------------------------------
A8LR09_DINSH/158-296-----------VSPQ-----HRILMRAW.----------------QAELL------------------------------
A3VAC1_9RHOB/181-319-----------VSPN-----HRILIRAA.----------------VAEFY------------------------------
C7JHN5_ACEP3/423-565-----------ITAE-----HCLFFE...----------------.....------------------------------
A3VHZ3_9RHOB/168-315-----------VSPH-----HRMFVASR.----------------IAGRM------------------------------
Q28SX3_JANSC/168-306-----------VSRQ-----HRLLLTGW.----------------RAELL------------------------------
A8LK48_DINSH/203-343-----------VSPQ-----HRMLLRT..----------------.....------------------------------
A3JYU7_9RHOB/143-282-----------VSPD-----HRLFIYQR.----------------RDELG------------------------------
Q5LMP8_SILPO/160-307-----------LSQQ-----HRVLLRSR.----------------IARRM------------------------------
Q2CD05_9RHOB/27-169-----------LAPT-----HRVLLSGN.----------------QALEM------------------------------
A9EEF5_9RHOB/1099-1235-----------VSRQ-----HAILIDA..----------------.....------------------------------
Q2CCZ2_9RHOB/165-310-----------VSSQ-----HRILLRGR.----------------DVRRR------------------------------
A6FPB3_9RHOB/928-1068-----------VSPQ-----HRILLPDT.----------------D....------------------------------
Q28UB5_JANSC/126-273-----------VSPQ-----HRLALSTG.----------------ASGIV------------------------------
B6AZM7_9RHOB/573-711-----------VSPQ-----HKMLVSHF.----------------SCDLL------------------------------
A3VMW9_9RHOB/142-280-----------LSPN-----HRVVLRDQ.----------------KMKQA------------------------------
Q1GMV1_SILST/833-976-----------VSPQ-----HRFLLPSD.----------------....G------------------------------
B6B239_9RHOB/383-521-----------VSPA-----HRMMISGW.----------------RTELM------------------------------
A5FZD4_ACICJ/193-329-----------VSPD-----HALFLD...----------------.....------------------------------
A3W415_9RHOB/142-281-----------LSPQ-----HRVMIRSP.----------------MAELL------------------------------
B1ZBT1_METPB/133-268-----------VSPD-----HCLVFD...----------------.....------------------------------
C7CEK6_METED/138-280-----------LSHG-----HPVLVGA..----------------...DA------------------------------
A4ESK2_9RHOB/784-931-----------LSPQ-----HRLLVNRH.----------------SFEQA------------------------------
B6B425_9RHOB/122-269-----------VSRQ-----HRMQVSSA.----------------ITERM------------------------------
B9JK11_AGRRK/201-336-----------ISPD-----HCMFME...----------------.....------------------------------
C8S0F9_9RHOB/2250-2389-----------VSPQ-----HCLLVER..----------------.....------------------------------
A3VJF5_9RHOB/166-311-----------VSPQ-----HRVLLRGG.----------------EVRRS------------------------------
C9CXD1_9RHOB/645-786-----------VSRQ-----HRFVLND..----------------.....------------------------------
Q28TH9_JANSC/752-887-----------VSRQ-----HGMLLGQ..----------------.....------------------------------
A5G1S8_ACICJ/159-294-----------VSPD-----HAFYFN...----------------.....------------------------------
B0T7Q3_CAUSK/153-288-----------LSPG-----HAVWLD...----------------.....------------------------------
C7JE32_ACEP3/536-676-----------VTPE-----HCLYLD...----------------.....------------------------------
B7KU45_METC4/258-393-----------VSPG-----HGLYCD...----------------.....------------------------------
B8IA31_METNO/149-285-----------VSPK-----HAMFLD...----------------.....------------------------------
A5G006_ACICJ/174-309-----------LSPD-----HAIYLD...----------------.....------------------------------
A3VFB5_9RHOB/155-300-----------LSPF-----HRVMVSSH.----------------KNDRV------------------------------
D2CKZ0_9GAMM/93-241-----------LGPR-----ARLFRQDA.----------------SLITA------------------------------
B6AU02_9RHOB/46-193-----------ISRQ-----HRMMVSSP.----------------ICKRM------------------------------
A5FW80_ACICJ/285-421-----------LSPD-----HAVWFD...----------------.....------------------------------
A3VJV0_9RHOB/145-290-----------LSPN-----HRVLMQTA.----------------PCHAL------------------------------
A8LLK3_DINSH/164-305-----------LSRQ-----HRVLLTR..----------------.....------------------------------
Q5FQG8_GLUOX/285-425-----------VTPE-----HCMMLE...----------------.....------------------------------
C8RY96_9RHOB/128-267-----------VSQH-----HRMFLYQR.----------------DRSPG------------------------------
B0UJT1_METS4/116-254-----------VSPA-----HAICLD...----------------....L------------------------------
A3JW88_9RHOB/167-310-----------VSPQ-----HRILVGETG----------------QLEHL------------------------------
B2SAQ3_BRUA1/14-150-----------LSPN-----HALFID...----------------.....------------------------------
Q2CAV0_9RHOB/70-218-----------LGPR-----ARLYHRSQ.----------------AIQRY------------------------------
O68085_RHOCA/442-581-----------LSPQ-----HAVLAL...----------------.....------------------------------
D0CWR5_9RHOB/156-294-----------VSQQ-----HRLLIAHP.----------------SVELM------------------------------
Q5LUZ7_SILPO/68-216-----------AGPS-----ARLLATPG.----------------HLRAL------------------------------
A3W580_9RHOB/62-208-----------AGPG-----ARILTRPR.----------------NLRAS------------------------------
D0D5E7_9RHOB/33-180-----------VGPA-----ARMVLRRS.----------------RLKSL------------------------------
Q0BS96_GRABC/3687-3823-----------VSPL-----HAMFID...----------------.....------------------------------
B1M2P7_METRJ/65-199-----------VSPD-----HAVWLD...----------------.....------------------------------
A3W8K4_9RHOB/154-299-----------VSPQ-----HRILVGGQ.----------------GQIDG------------------------------
A3VEX8_9RHOB/9-155-----------LAPA-----HRVLLSGA.----------------AVELH------------------------------
A3JSM6_9RHOB/118-255-----------LSQD-----HTIAID...----------------.....------------------------------
A3SRN1_9RHOB/161-308-----------LSRQ-----HRVLLRSK.----------------VADHM------------------------------
Q1N7J0_9SPHN/211-348-----------VSPW-----HHLYVD...----------------.....------------------------------
A9DUV0_9RHOB/49-194-----------VGPA-----ARVLHTPH.----------------HLRAE------------------------------
A6FV85_9RHOB/70-218-----------AGPG-----ARLLSRPA.----------------NLRDS------------------------------
A3JS61_9RHOB/164-301-----------ISGD-----HALAID...----------------.....------------------------------
A3VAX2_9RHOB/110-257-----------LSQQ-----HRVYFEHP.----------------GLTVP------------------------------
A6E265_9RHOB/196-333-----------LTAD-----HAVVID...----------------.....------------------------------
C7D8E1_9RHOB/33-181-----------LGPR-----ARMLYKSP.----------------SCQVR------------------------------
Q1MD68_RHIL3/83-221-----------LSPG-----HALYLN...----------------.....------------------------------
A5FVL4_ACICJ/410-545-----------LSPD-----HAIWID...----------------.....------------------------------
A3JWF1_9RHOB/121-260-----------VTGD-----HAMYMD...----------------.....------------------------------
A4YQ57_BRASO/106-246-----------VTQG-----HALLFD...----------------.....------------------------------
B6B9L0_9RHOB/67-214-----------AGPA-----ARLLRTPP.----------------HL.QS------------------------------
A3JPL6_9RHOB/158-295-----------VSPD-----HAILID...----------------.....------------------------------
A5FWA2_ACICJ/1192-1328-----------LSPL-----HAVYAD...----------------.....------------------------------
A3S7N1_9RHOB/69-214-----------FGPA-----ARILHTPQ.----------------SLRGA------------------------------
A3V9D9_9RHOB/136-275-----------LRPD-----HRIFVYQR.----------------SDLLG------------------------------
A9GL51_9RHOB/726-866-----------VSPQ-----HCILMKHR.----------------S....------------------------------
B6AWU4_9RHOB/33-181-----------LGQN-----ARLLQSSP.----------------VLKEK------------------------------
C3KQV1_RHISN/76-214-----------LSAG-----HALYLD...----------------.....------------------------------
B7RGP3_9RHOB/19-157-----------LAPQ-----HRVLMSGW.----------------QAELY------------------------------
A3VKC8_9RHOB/32-181-----------LNAG-----QRLLVRNP.----------------VNELY------------------------------
B7RR26_9RHOB/132-273-----------LSQQ-----HRIVLRET.----------------....G------------------------------
A3JPP3_9RHOB/102-239-----------VTSD-----HGMILD...----------------.....------------------------------
A9G7V6_9RHOB/181-329-----------LAPQ-----QRLVISGT.----------------DVDYL------------------------------
A3TTS1_9RHOB/32-176-----------AGPG-----ARMLHRPT.----------------GDRFA------------------------------
B5J8X8_9RHOB/33-181-----------VGPS-----ARLFQHSA.----------------ALQRV------------------------------
A3W2P6_9RHOB/178-317-----------VSPQ-----QRLVIRGS.----------------EVEYL------------------------------
A3SKF2_9RHOB/139-280-----------VTVQ-----HRLALA...----------------.....------------------------------
A3JS38_9RHOB/159-295-----------LTGD-----HALGID...----------------.....------------------------------
A6DXP5_9RHOB/101-239-----------LTAD-----HALFID...----------------.....------------------------------
A3SRA3_9RHOB/68-209-----------AGPG-----ARLLQRT..----------------...TG------------------------------
A8LKB8_DINSH/19-167-----------LAPD-----HPVRVPAH.----------------LLGQS------------------------------
A3SI78_9RHOB/178-317-----------LAPQ-----ERLILSGS.----------------DVEYL------------------------------
A3V3N0_9RHOB/64-210-----------LGPA-----ARLYHATS.----------------NVAKL------------------------------
A3JS40_9RHOB/158-295-----------MSSD-----HGIEID...----------------.....------------------------------
A3Z148_9SYNE/71-210-----------VSPD-----HAVLVD...----------------.....------------------------------
A3JT43_9RHOB/20-157-----------VSPD-----HGILVD...----------------.....------------------------------
A4EJ24_9RHOB/71-219-----------LGPS-----ARLLHRAT.----------------GIRKV------------------------------
C9CYM4_9RHOB/179-319-----------VAPF-----QRMVLTGS.----------------EVEYL------------------------------
C7D959_9RHOB/18-157-----------LAPS-----HKLLLTNW.----------------KAQMY------------------------------
A3XDE1_9RHOB/175-315-----------VSAS-----QRVVVSGS.----------------EVEYL------------------------------
Q5LN78_SILPO/204-343-----------AAPS-----QRLLLSGT.----------------EVEYL------------------------------
A6FNZ8_9RHOB/22-159-----------LPAR-----QMVLMRDW.----------------RAQAL------------------------------
A6DX68_9RHOB/142-284-----------LSPF-----HHLPVPEP.----------------G....------------------------------
C7DFW9_9RHOB/173-311-----------VAAE-----QHMLFSGS.----------------EVEYL------------------------------
B7QV01_9RHOB/186-327-----------VAPY-----QQLVVTGS.----------------DVDYL------------------------------
B7RNA8_9RHOB/11-157-----------LSPH-----HQVLVNSP.----------------HVPLH------------------------------
A6E3T2_9RHOB/4-141-----------LPAG-----QLLLVRDW.----------------RAKAL------------------------------
A3X8D5_9RHOB/25-168-----------LMPD-----QGVLMESD.----------------LIEDH------------------------------
A3JQA1_9RHOB/57-194-----------IPGN-----QLVQLSE..----------------.....------------------------------

PF05203

Q8J0G3_ZYGBI/11-460YFLGLWIGGG.LTDK-----TTLSVDSED----------------.TSLF..DRINQFAE..ILGLSAEQEAKEESKRAK
Q8J0G2_ZYGRO/19-468YFLGLWIGDGMLNNA-----ATFSVDSQN----------------.ASLL..NRINEFAE..VLGLSAEYKDSQEPKRAK
Q8J0G5_9SACH/19-473YLLGLWAGDV.SSEE-----TVFSVNSED----------------.GSLY..ERITQFAD..ILGLSAEFKDREAPKQGK
Q8J0G6_9SACH/19-474YLLGLWVGDG.LSDR-----AVFSVDSED----------------.TTLF..DRIIDFAD..ILDLSAEYKDREIPKRAK
Q8J0G4_ZYGBA/19-474YLLGLWVGDG.LSDR-----AVLSVDSED----------------.SSLL..ERITGYAD..ILDLSAEYKDREIPKRAK
Q9P986_SACPS/1-465WMLGLWLGDD.TTKE-----PEISVDSLD----------------.PKLM..ESLRENAK..IWGLYLTVCDDHVPLRAK
A7TIB9_VANPO/1-464WLLGLWIGDG.TTKE-----PEITVDSHD----------------.TELM..KGLHECGK..TWGLYPTYKDEKIPLRAK
C5DTQ4_ZYGRC/1-464WLLGLWIGDG.TTKE-----PEISVDSHD----------------.TGLM..EGLIERGK..IWGLYPEYKDEQIPLRAK
Q707W4_KLUDE/1-464WLLGLWIGDG.TTKE-----PEITMDSLD----------------.APLM..NSLIVLGR..KWGIYPTYKDEKVPLRAK
Q707W9_CANGB/1-464WLLGLWIGDG.TTKE-----PEITVDSVD----------------.EKLM..ESLTVLGR..YWGLYPTYKDEKVPLRAK
Q6TER1_CRYNE/36-207...............-----.........----------------...................................
Q1KMS2_AJECA/5-539YFVGFWLCDGIRAS.-----TTIYT.SPE----------------.EATR..EFIINHAAELDLQLASKEYMQHSVG..R
Q1MSX1_PENEN/51-212...............-----.........----------------...................................
C5FT71_ARTOC/1506-2056YFLGLWLGDGNRRS.-----AAIDN.SHE----------------.AEIR..EFLVRHAAELDLQSALHGQLGYATV..G
Q1A775_9EURO/44-198...............-----.........----------------...................................
Q1ECT9_EMEND/1526-2130YFLGLWLGDESRNQ.-----SAIYS.NHE----------------.EALR..EFLVSHAAELDMHLVYHGQSAYSTVCNK
Q1A774_ASPGI/56-222...............-----.........----------------...................................
B9XA08_9BACT/492-829YFLGLLLGDG.FLKE-----GQLSFSKPD----------------.PETE..QFVRLHSRRNGWGIRKSQRGPGNPT...
A6QC64_SULNB/206-549YFLGLWLGDG...RS-----SDVRIATED----------------.DEVV..EYLQAYAFRLDKKVHRYAADGKCTMYGI
Q2S6J9_SALRD/231-574YFLGLWLGDG...KS-----DNARIYTTD----------------.EEVI..TGLQEIAEKRGDTISVSDEHRRCPAYLV
A3EZR5_9CAUD/34-380YLMGLWLGDG.TSSS-----GAITSGENE----------------.KEIR..AYLESYAARNGMQIRKEGLTWSISHG..
Q5G7M7_9CAUD/35-373YILGLLLGDGCITGV-----GQMSFTSQD----------------.HAAI..TEIERYLMSIGASNRLHFDSREAVG...
A8BML4_GIAIC/4-440WLCGLYLITGICIDE-----RSFRFHLKE----------------LNSNI.AGEVKRIFRCLNSYYEIQFDEASENYTIR
A1ZUM1_9BACT/19-423YQTGL.......TKK-----IHSVVASLE----------------.QENK..NEISKLTLDNLWELERKGLLVNEKLLIN
Q6BRM0_DEBHA/283-676YLLGLWIGNG.YSDR-----VQYLIDGKN----------------.TELI..NRVREYDE....................
Q874G6_KLULC/277-686YLLGAFVGSS.....-----......GKD----------------NSEYL..QQLSAQFDKKIVAEKSIDVQSNGKTVGT
Q874G7_CANGB/277-691YLLGTWIASK.ATTA-----GTISVPTTK----------------.ADLL..SKVKSALSSLSIDYSSESINSVSTYRRT
B6JY11_SCHJY/278-753YLLGVWVGAG.FSRS-----SAFSLYEED----------------.SELV..SRIISFGK..ALGLKAVTAEHNPRTVKI
Q8J0G9_9SACH/19-519WLLGFWVGNG.SITT-----SSFSIDSLD----------------.TQLL..DRITEYGK..LFALTTTSATNHCRNYSG
Q874G5_NAUCA/266-782WLLGFWVGNG.HMET-----AQFPVDSWD----------------.TQLV..DRISEYGK..HFNLTTTTENHYRSNHVE
Q874G1_9SACH/246-659YVMGSWVGAG.SMDQ-----PTFAGNQLD----------------.EEFV..SRLTEYGSG...................
Q8J0G8_SACEX/19-520WLIGFWVGNG.AMRH-----SQFVIDSQD----------------.IELV..NRIQEIAT..LLNLSATTACYYSGSVDD
C5M9I6_CANTT/244-714YLLGTWAGIG.NVKS-----SAFTMNSKD----------------DVKLA..TRIMNYSS..KLGMTCSSTESGELNVAE
A5DXZ0_LODEL/280-700YLMGAAFNES.RESI-----SDAATNTKR----------------TLENVEFDDLKSVDSSLDLSMDDGYETDNTS....
A3LP04_PICST/283-731YLVGLWVGDG.YSDR-----ATFSIDIQD----------------.VEIH..ERIKDFAS..HAGLTPRIACYKKSRDAT
A7TLB5_VANPO/284-716YLLGLWTGSG.MTRR-----AGLSVSTTD----------------.ESLM..NNIVAAAD..LLNLKSEFKQERTTTRVG
E9P8D3_YEASX/259-712YLLGLWIGDG.LSDR-----ATFSVDSRD----------------.TSLM..ERVTEYAE..KLNLCAEYKDRKEPQVAK

PF01079

Q7PXI1_ANOGA/295-503-----------VTPA-----HLVMVWRRE................RSET........................RF-----
HH_DROHY/253-475-----------VTPA-----HLISVWQPE................RQTL........................NF-----
HH_DROPS/255-475-----------VTPA-----HLISVWHPE................RQQL........................DY-----
Q1HEQ6_TRICA/99-299-----------VTPS-----HLLVLDDR.............................................TM-----
SHH_CYNPY/190-418-----------LTAA-----HLLFVGQAH................PGNDSGGDFRSV..........FGSAGFRS-----
A0JM37_XENTR/187-392-----------VTPN-----HLLFIKRSL................SAGF........................LP-----
Q2QJG8_9ANNE/186-383-----------LSPS-----HLIHTAEH.............................................GE-----
IHH_DANRE/187-398-----------LTAA-----HLLFMRVGN................CSNRGEPKP................GAVRT-----
Q708D0_9MYRI/276-506-----------LTPT-----HLIYVAVGP................GEQS........................EA-----
TWHH_DANRE/190-403-----------LTAA-----HLVFVGNSS................AASGI.......................TA-----
WRT4_CAEEL/327-547-----------LTEK-----HLVFVTQCS................VPYSEDENI.................NANP-----
Q8AXT0_TAKRU/187-399-----------LTAA-----HLLYVARNG................TEGDGM......................SA-----
Q6BCD0_MERUN/188-423-----------LTAA-----HLLFVAPHN................GSGPTPG....................PGP-----
Q80XI9_MOUSE/230-435-----------LTPA-----HLLFIADNH................TEPAAHF.....................RA-----
Q75UQ8_PARTP/185-402-----------LTPT-----HLIFTASPH................QTTP........................QA-----
Q7Z264_9SCOR/158-375-----------LTPS-----HLIFVVGGN................KT..........................RV-----
Q8MWG6_PATVU/190-409-----------LTSK-----HLIYMSTSN................VTTDDVTD..................SFNV-----
WRT6_CAEEL/375-583-----------LTDN-----HLIYVSDCR................TRSDL.......................KL-----
A3KNS3_DANRE/187-399-----------LTAA-----HLLFVSEGN................CSGSAANA..................ELRS-----
Q5UVJ3_STRPU/189-402-----------LTPQ-----HLIYVSETE................SSFSQS......................KA-----
O73803_TAKRU/190-436-----------VTPH-----HLVFSDAHC................GPDSSQY.....................QA-----
A8X447_CAEBR/327-545-----------LTEK-----HMVYVSQCE.................NNNYVEGI.................NSNA-----
IHH_CHICK/188-394-----------LTPT-----HLLFVADNA................SAPAAQF.....................RP-----
SHH_XENLA/188-430-----------LTAA-----HLLFVAQTK................VNGTRSF.....................KS-----
SHH_CHICK/190-411-----------LTAA-----HLLFVAPQH................NQSEATGST.................SGQA-----
Q1PHR2_SACKO/171-384-----------LTPQ-----HLVYASRSN................VTFDPGS....................VSP-----
SHH_DANRE/187-404-----------LTAA-----HLLFVLDNS................TEDLHTM.....................TA-----
IHH_XENLA/187-395-----------LTPA-----HLIFVSDNY................STPASEF.....................QA-----
A2I5E3_LEUER/186-403-----------LTAA-----HLLFVGHAT................NDGQLGL.....................KA-----
O57567_NOTVI/188-392-----------LTAA-----HLLFVADNF................TVPLTDF.....................ST-----
WRT8_CAEEL/325-538-----------LTEK-----HLVFATDCQ................QNVKNLDD...................LNP-----
Q22872_CAEEL/566-779-----------ITSR-----HFMYRNKCG................KSYPQYIKML..............PHDGEA-----
Q49QW4_9MOLL/164-385-----------LTGK-----HLIYTSETN................RTSFVLDSAS...............SRFEA-----
DHH_HUMAN/188-396-----------LTPW-----HLVFAARGP................APAPGDF.....................AP-----
Q8MY56_CIOIN/186-395-----------LTAN-----HMLFIATQT................NCSNSFSA..................TKRA-----
Q175B3_AEDAE/201-412-----------VTPA-----HLVMVWQKN................EGKS........................LY-----
A2I5D9_POLSP/90-308-----------LTAA-----HLLFVADSN................TTAGFHS....................VKA-----
Q66PH6_9TELE/184-413-----------LTAA-----HLIFILNNS................TQSTQANANYANG.........AQAMVMTS-----
A4UYK7_9ACTI/187-406-----------LTAA-----HLLFVLDNS................TDVVSTM.....................TA-----
Q9GRA8_GRYBI/198-413-----------LTPS-----HLLPVARAG................GGEP........................EA-----
Q9U5Z6_BRABE/191-404-----------ATPS-----HLVFVTESR................DLSAPR......................VA-----
Q4PLX3_DANRE/191-442-----------LTPN-----HLIFAAHNL................KLHHHDY.....................ET-----
O45992_CAEEL/258-471-----------LTEK-----HLVYTTECR................QNSSELKI..................SWES-----
Q8MY57_CIOIN/294-550-----------LTRN-----HLIYVSKPT................YDASLLTATSNATQQNNERLGLQDFTSPHS-----
Q9W7Q9_PAROL/187-400-----------LTAA-----HLLFVGHSN................STERAHRG...................MSA-----
Q7Z263_ARTSF/158-415-----------LTAS-----HLIFTVQSNEYETMAKLLENENIDSSIEENEITELSDNEGDLFVSKLQFHTLVAE-----

PF14623

F0YDN2_AURAN/823-991-----------FAGR.....NAAYST------------------------------------------------------
C0NJD1_AJECG/548-714-----------LDPSPVSDAHAIMV.------------------------------------------------------
E4UR10_ARTGP/540-711-----------LEPDSNPDAHAIMV.------------------------------------------------------
D2VHB8_NAEGR/586-750-----------VDQG.....HVVSI.------------------------------------------------------
Q2GTB7_CHAGB/570-754-----------LERDEEPDAHAILV.------------------------------------------------------
Q22N58_TETTS/494-660-----------LEDG.....HSMSI.------------------------------------------------------
E9EQB7_METAR/534-699-----------LQRDRNSQSHALRV.------------------------------------------------------
F2SQT7_TRIRC/537-709-----------LEPDSNPEAHAIMV.------------------------------------------------------
C7YL43_NECH7/586-752-----------LERDRNSSAHAIRV.------------------------------------------------------
E3QU32_COLGM/508-676-----------LQPDRDAAAHALSV.------------------------------------------------------
Q237Q6_TETTS/509-673-----------LESG.....HSMMI.------------------------------------------------------
C5FLY1_ARTOC/540-711-----------LEPDSNPNAHAIMV.------------------------------------------------------
Q24C76_TETTS/502-666-----------LKSG.....HTMNI.------------------------------------------------------
A9UVU8_MONBE/587-772-----------LT.......AGGEVP------------------------------------------------------

PF07591

A3DGR7_CLOTH/105-234-----------TTFE-----HPFYVKDVG---------------------------------------------------
A5Z4R4_9FIRM/129-258-----------TTEN-----HPFYVMERG---------------------------------------------------
A1KVQ7_NEIMF/353-489-----------SNRI-----HPFYSQ.GK---------------------------------------------------
Q5F6G7_NEIG1/1-137-----------SNRI-----HPFYSD.GK---------------------------------------------------

PF14890

A9B528_HERA2/384-526-----------ATVN-----HKFLTIDGWQ---------------RLDQ....LHQTSQIAIS.................
DNAB_SYNY3/385-808-----------ATAN-----HRFLTIDGWK---------------RLDE...............................
GLMS_METJA/76-569-----------.TGE-----HKLFVVENGK---------------IVEKCVKDLNGSELIGVVRKLNYSFNDNVEFKDVY
D7E146_NOSA0/393-538-----------ATAN-----HKFLTIHGWK---------------KLDE....LNPQQHLCLP.................
B5W0N0_SPIMA/394-525-----------ATAN-----HQFFTLTGWE---------------RLDK....LTTGCQIACT.................

PF10596

A6S230_BOTFB/991-1164-----------WSPT-----------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1797-----------WSPT-----------------------------------------------------------------
A6R4K4_AJECN/1351-1497-----------LGPD-----------------------------------------------------------------
Q00RU5_OSTTA/1516-1683-----------WSPT-----------------------------------------------------------------
A8BTS5_GIAIC/1331-1491-----------WSPT-----------------------------------------------------------------
A4IBT3_LEIIN/1514-1675-----------WSPT-----------------------------------------------------------------
Q9AW36_GUITH/1259-1418-----------WSPT-----------------------------------------------------------------
Q3LWH1_BIGNA/1383-1542-----------WSPT-----------------------------------------------------------------
Q6FQZ4_CANGA/1515-1674-----------WSPT-----------------------------------------------------------------
Q9XYM9_TRIVA/1432-1591-----------WSPT-----------------------------------------------------------------
Q4PEC7_USTMA/1470-1629-----------WSPT-----------------------------------------------------------------

PF13403

A3PK18_RHOS1/14-160--------------------------------------------------------------------------------
A3SZU1_9RHOB/393-539--------------------------------------------------------------------------------
Q1GGP9_SILST/27-173--------------------------------------------------------------------------------
C8RY14_9RHOB/1350-1496--------------------------------------------------------------------------------
Q1GES6_SILST/157-304--------------------------------------------------------------------------------
A3SNQ6_9RHOB/641-788--------------------------------------------------------------------------------
A3SUS4_9RHOB/185-331--------------------------------------------------------------------------------
D0CP51_9RHOB/143-290--------------------------------------------------------------------------------
C7DAD7_9RHOB/178-316--------------------------------------------------------------------------------
A9GA60_9RHOB/583-733--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A6DV24_9RHOB/336-474--------------------------------------------------------------------------------
A3VAW0_9RHOB/105-251--------------------------------------------------------------------------------
A3TXC6_9RHOB/29-175--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A3K5E2_9RHOB/849-996--------------------------------------------------------------------------------
B6BC88_9RHOB/475-613--------------------------------------------------------------------------------
A4EMR4_9RHOB/71-217--------------------------------------------------------------------------------
A3V1Q6_9RHOB/111-258--------------------------------------------------------------------------------
B7QV02_9RHOB/335-473--------------------------------------------------------------------------------
C9D0M9_9RHOB/1229-1376--------------------------------------------------------------------------------
Q0FQ52_9RHOB/227-374--------------------------------------------------------------------------------
D0CWS5_9RHOB/173-320--------------------------------------------------------------------------------
D0CQ11_9RHOB/159-297--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
A3JWU1_9RHOB/200-347--------------------------------------------------------------------------------
A3VI53_9RHOB/624-762--------------------------------------------------------------------------------
A3SQF1_9RHOB/126-264--------------------------------------------------------------------------------
B5K4Q3_9RHOB/102-249--------------------------------------------------------------------------------
A3JUC9_9RHOB/546-693--------------------------------------------------------------------------------
A3W238_9RHOB/563-702--------------------------------------------------------------------------------
B9NR62_9RHOB/115-262--------------------------------------------------------------------------------
C7D8K4_9RHOB/545-684--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
A4EIH6_9RHOB/690-837--------------------------------------------------------------------------------
B5J379_9RHOB/742-889--------------------------------------------------------------------------------
C9CTM7_9RHOB/120-267--------------------------------------------------------------------------------
A4EL36_9RHOB/35-182--------------------------------------------------------------------------------
C9D2P0_9RHOB/151-297--------------------------------------------------------------------------------
A3V7F0_9RHOB/249-396--------------------------------------------------------------------------------
A3XC10_9RHOB/338-477--------------------------------------------------------------------------------
A3JZG9_9RHOB/189-327--------------------------------------------------------------------------------
A3W5R9_9RHOB/184-322--------------------------------------------------------------------------------
Q5LPM0_SILPO/507-646--------------------------------------------------------------------------------
A3SHB9_9RHOB/143-290--------------------------------------------------------------------------------
A3TTF8_9RHOB/31-178--------------------------------------------------------------------------------
B6BEV2_9RHOB/337-476--------------------------------------------------------------------------------
A3JMU4_9RHOB/108-255--------------------------------------------------------------------------------
C9CXZ7_9RHOB/141-288--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
D0CSG1_9RHOB/199-337--------------------------------------------------------------------------------
Q1GGN0_SILST/194-341--------------------------------------------------------------------------------
B6AV64_9RHOB/37-183--------------------------------------------------------------------------------
Q5LSZ7_SILPO/803-941--------------------------------------------------------------------------------
C9CRM1_9RHOB/318-465--------------------------------------------------------------------------------
A3K151_9RHOB/707-851--------------------------------------------------------------------------------
A3SL99_9RHOB/129-267--------------------------------------------------------------------------------
A3JLQ1_9RHOB/336-475--------------------------------------------------------------------------------
A6FVP9_9RHOB/45-184--------------------------------------------------------------------------------
Q6SF13_9BACT/2229-2376--------------------------------------------------------------------------------
Q5LPJ7_SILPO/175-322--------------------------------------------------------------------------------
A3VA21_9RHOB/151-298--------------------------------------------------------------------------------
B6AYB0_9RHOB/160-302--------------------------------------------------------------------------------
Q2CAT6_9RHOB/160-307--------------------------------------------------------------------------------
B6B317_9RHOB/170-318--------------------------------------------------------------------------------
B9NQR9_9RHOB/142-290--------------------------------------------------------------------------------
A3SR39_9RHOB/268-419--------------------------------------------------------------------------------
B9NUP1_9RHOB/171-309--------------------------------------------------------------------------------
B6AZD3_9RHOB/512-660--------------------------------------------------------------------------------
B6B2Z4_9RHOB/167-315--------------------------------------------------------------------------------
A3SQF2_9RHOB/166-304--------------------------------------------------------------------------------
A3XDE7_9RHOB/339-478--------------------------------------------------------------------------------
B5KDV6_9RHOB/120-258--------------------------------------------------------------------------------
A3SHZ7_9RHOB/146-292--------------------------------------------------------------------------------
A3JSG0_9RHOB/151-289--------------------------------------------------------------------------------
A3JT50_9RHOB/142-280--------------------------------------------------------------------------------
Q1GMQ5_SILST/293-432--------------------------------------------------------------------------------
C7DBW6_9RHOB/268-415--------------------------------------------------------------------------------
A9DWF7_9RHOB/194-340--------------------------------------------------------------------------------
B7QQ35_9RHOB/162-309--------------------------------------------------------------------------------
Q5LLZ7_SILPO/144-282--------------------------------------------------------------------------------
B7RNT5_9RHOB/692-831--------------------------------------------------------------------------------
B7RP36_9RHOB/563-698--------------------------------------------------------------------------------
A3JVK2_9RHOB/381-520--------------------------------------------------------------------------------
B5KCW8_9RHOB/153-299--------------------------------------------------------------------------------
C8RZS8_9RHOB/219-358--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
A3VAC1_9RHOB/181-319--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
A3VHZ3_9RHOB/168-315--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
A3JYU7_9RHOB/143-282--------------------------------------------------------------------------------
Q5LMP8_SILPO/160-307--------------------------------------------------------------------------------
Q2CD05_9RHOB/27-169--------------------------------------------------------------------------------
A9EEF5_9RHOB/1099-1235--------------------------------------------------------------------------------
Q2CCZ2_9RHOB/165-310--------------------------------------------------------------------------------
A6FPB3_9RHOB/928-1068--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
B6AZM7_9RHOB/573-711--------------------------------------------------------------------------------
A3VMW9_9RHOB/142-280--------------------------------------------------------------------------------
Q1GMV1_SILST/833-976--------------------------------------------------------------------------------
B6B239_9RHOB/383-521--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
A3W415_9RHOB/142-281--------------------------------------------------------------------------------
B1ZBT1_METPB/133-268--------------------------------------------------------------------------------
C7CEK6_METED/138-280--------------------------------------------------------------------------------
A4ESK2_9RHOB/784-931--------------------------------------------------------------------------------
B6B425_9RHOB/122-269--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
C8S0F9_9RHOB/2250-2389--------------------------------------------------------------------------------
A3VJF5_9RHOB/166-311--------------------------------------------------------------------------------
C9CXD1_9RHOB/645-786--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B7KU45_METC4/258-393--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A3VFB5_9RHOB/155-300--------------------------------------------------------------------------------
D2CKZ0_9GAMM/93-241--------------------------------------------------------------------------------
B6AU02_9RHOB/46-193--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A3VJV0_9RHOB/145-290--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
C8RY96_9RHOB/128-267--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
A3JW88_9RHOB/167-310--------------------------------------------------------------------------------
B2SAQ3_BRUA1/14-150--------------------------------------------------------------------------------
Q2CAV0_9RHOB/70-218--------------------------------------------------------------------------------
O68085_RHOCA/442-581--------------------------------------------------------------------------------
D0CWR5_9RHOB/156-294--------------------------------------------------------------------------------
Q5LUZ7_SILPO/68-216--------------------------------------------------------------------------------
A3W580_9RHOB/62-208--------------------------------------------------------------------------------
D0D5E7_9RHOB/33-180--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A3W8K4_9RHOB/154-299--------------------------------------------------------------------------------
A3VEX8_9RHOB/9-155--------------------------------------------------------------------------------
A3JSM6_9RHOB/118-255--------------------------------------------------------------------------------
A3SRN1_9RHOB/161-308--------------------------------------------------------------------------------
Q1N7J0_9SPHN/211-348--------------------------------------------------------------------------------
A9DUV0_9RHOB/49-194--------------------------------------------------------------------------------
A6FV85_9RHOB/70-218--------------------------------------------------------------------------------
A3JS61_9RHOB/164-301--------------------------------------------------------------------------------
A3VAX2_9RHOB/110-257--------------------------------------------------------------------------------
A6E265_9RHOB/196-333--------------------------------------------------------------------------------
C7D8E1_9RHOB/33-181--------------------------------------------------------------------------------
Q1MD68_RHIL3/83-221--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A3JWF1_9RHOB/121-260--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
B6B9L0_9RHOB/67-214--------------------------------------------------------------------------------
A3JPL6_9RHOB/158-295--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
A3S7N1_9RHOB/69-214--------------------------------------------------------------------------------
A3V9D9_9RHOB/136-275--------------------------------------------------------------------------------
A9GL51_9RHOB/726-866--------------------------------------------------------------------------------
B6AWU4_9RHOB/33-181--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
B7RGP3_9RHOB/19-157--------------------------------------------------------------------------------
A3VKC8_9RHOB/32-181--------------------------------------------------------------------------------
B7RR26_9RHOB/132-273--------------------------------------------------------------------------------
A3JPP3_9RHOB/102-239--------------------------------------------------------------------------------
A9G7V6_9RHOB/181-329--------------------------------------------------------------------------------
A3TTS1_9RHOB/32-176--------------------------------------------------------------------------------
B5J8X8_9RHOB/33-181--------------------------------------------------------------------------------
A3W2P6_9RHOB/178-317--------------------------------------------------------------------------------
A3SKF2_9RHOB/139-280--------------------------------------------------------------------------------
A3JS38_9RHOB/159-295--------------------------------------------------------------------------------
A6DXP5_9RHOB/101-239--------------------------------------------------------------------------------
A3SRA3_9RHOB/68-209--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
A3SI78_9RHOB/178-317--------------------------------------------------------------------------------
A3V3N0_9RHOB/64-210--------------------------------------------------------------------------------
A3JS40_9RHOB/158-295--------------------------------------------------------------------------------
A3Z148_9SYNE/71-210--------------------------------------------------------------------------------
A3JT43_9RHOB/20-157--------------------------------------------------------------------------------
A4EJ24_9RHOB/71-219--------------------------------------------------------------------------------
C9CYM4_9RHOB/179-319--------------------------------------------------------------------------------
C7D959_9RHOB/18-157--------------------------------------------------------------------------------
A3XDE1_9RHOB/175-315--------------------------------------------------------------------------------
Q5LN78_SILPO/204-343--------------------------------------------------------------------------------
A6FNZ8_9RHOB/22-159--------------------------------------------------------------------------------
A6DX68_9RHOB/142-284--------------------------------------------------------------------------------
C7DFW9_9RHOB/173-311--------------------------------------------------------------------------------
B7QV01_9RHOB/186-327--------------------------------------------------------------------------------
B7RNA8_9RHOB/11-157--------------------------------------------------------------------------------
A6E3T2_9RHOB/4-141--------------------------------------------------------------------------------
A3X8D5_9RHOB/25-168--------------------------------------------------------------------------------
A3JQA1_9RHOB/57-194--------------------------------------------------------------------------------

PF05203

Q8J0G3_ZYGBI/11-460.......................................................................KVNLHPKTN
Q8J0G2_ZYGRO/19-468.......................................................................TVNLYAKAI
Q8J0G5_9SACH/19-473.......................................................................TVYLHPKAI
Q8J0G6_9SACH/19-474.......................................................................TVGLFPKTI
Q8J0G4_ZYGBA/19-474.......................................................................TVCLYPKTI
Q9P986_SACPS/1-465......................................................................HVRLHYGDGP
A7TIB9_VANPO/1-464......................................................................HVRLYYGKEA
C5DTQ4_ZYGRC/1-464......................................................................HVKLFYGSEC
Q707W4_KLUDE/1-464......................................................................HVRLYYGNEP
Q707W9_CANGB/1-464......................................................................HVRLYYGKGP
Q6TER1_CRYNE/36-207................................................................................
Q1KMS2_AJECA/5-539VARQTILEQRLAVQCT......................................APQETEGTLLSHILQKPAKSGLASST
Q1MSX1_PENEN/51-212................................................................................
C5FT71_ARTOC/1506-2056KTSLASRPYPQATRSTITERERHVSRHTIIAKR....LAAGWTVQSGREPGEARIWGPPDEGFSDAIPPSRPIAAVKHSL
Q1A775_9EURO/44-198................................................................................
Q1ECT9_EMEND/1526-2130DRPTNKRIGPANQTQTVRPTIRQTRRTIRQQRLAAEHAAAEYTTQRETASLTPLLESPTSDKHGLLSSVETPGRLSDSVT
Q1A774_ASPGI/56-222................................................................................
B9XA08_9BACT/492-829................................................................................
A6QC64_SULNB/206-549TS.................................................................IQKEG........
Q2S6J9_SALRD/231-574KS..................................................................GDRG........
A3EZR5_9CAUD/34-380................................................................................
Q5G7M7_9CAUD/35-373................................................................................
A8BML4_GIAIC/4-440.......................................................................F........
A1ZUM1_9BACT/19-423.........................................................................RLSEKKG
Q6BRM0_DEBHA/283-676...............................................................................A
Q874G6_KLULC/277-686.......................................................................ASIVISQEP
Q874G7_CANGB/277-691QSIPLM.........................................................ENGKHVGNANITAEQEI
B6JY11_SCHJY/278-753VRGELGVDGTFTS............................................EVEDLVEVVDFQEGSEIPAWEQR
Q8J0G9_9SACH/19-519SGNQDIELSKINNGKVETDGTITFD....................DDTEREPSEQELIDMESSGCKASSEMTVALGAPLV
Q874G5_NAUCA/266-782SNKDIEIFEMNEAQIEEAEQTGVVAFDSNRKGDP.SETELIEAEIFNESRPSTAGLFTPAAISPASLVTDLSVTLRGTGI
Q874G1_9SACH/246-659................................................................................
Q8J0G8_SACEX/19-520QDKLAKLNTATGEGFEDD..................................LQSNPTAKELADMDILSESKTATLPTAF
C5M9I6_CANTT/244-714NEEEFFNNLGA................................................EKDEAGDFTFDEFTDAMDELT
A5DXZ0_LODEL/280-700...............................................................................I
A3LP04_PICST/283-731........................................................................ISLHNSET
A7TLB5_VANPO/284-716.......................................................................NVNFY....
E9P8D3_YEASX/259-712.......................................................................TVNLYSKVV

PF01079

Q7PXI1_ANOGA/295-503--------------------------------------------------------------------------------
HH_DROHY/253-475--------------------------------------------------------------------------------
HH_DROPS/255-475--------------------------------------------------------------------------------
Q1HEQ6_TRICA/99-299--------------------------------------------------------------------------------
SHH_CYNPY/190-418--------------------------------------------------------------------------------
A0JM37_XENTR/187-392--------------------------------------------------------------------------------
Q2QJG8_9ANNE/186-383--------------------------------------------------------------------------------
IHH_DANRE/187-398--------------------------------------------------------------------------------
Q708D0_9MYRI/276-506--------------------------------------------------------------------------------
TWHH_DANRE/190-403--------------------------------------------------------------------------------
WRT4_CAEEL/327-547--------------------------------------------------------------------------------
Q8AXT0_TAKRU/187-399--------------------------------------------------------------------------------
Q6BCD0_MERUN/188-423--------------------------------------------------------------------------------
Q80XI9_MOUSE/230-435--------------------------------------------------------------------------------
Q75UQ8_PARTP/185-402--------------------------------------------------------------------------------
Q7Z264_9SCOR/158-375--------------------------------------------------------------------------------
Q8MWG6_PATVU/190-409--------------------------------------------------------------------------------
WRT6_CAEEL/375-583--------------------------------------------------------------------------------
A3KNS3_DANRE/187-399--------------------------------------------------------------------------------
Q5UVJ3_STRPU/189-402--------------------------------------------------------------------------------
O73803_TAKRU/190-436--------------------------------------------------------------------------------
A8X447_CAEBR/327-545--------------------------------------------------------------------------------
IHH_CHICK/188-394--------------------------------------------------------------------------------
SHH_XENLA/188-430--------------------------------------------------------------------------------
SHH_CHICK/190-411--------------------------------------------------------------------------------
Q1PHR2_SACKO/171-384--------------------------------------------------------------------------------
SHH_DANRE/187-404--------------------------------------------------------------------------------
IHH_XENLA/187-395--------------------------------------------------------------------------------
A2I5E3_LEUER/186-403--------------------------------------------------------------------------------
O57567_NOTVI/188-392--------------------------------------------------------------------------------
WRT8_CAEEL/325-538--------------------------------------------------------------------------------
Q22872_CAEEL/566-779--------------------------------------------------------------------------------
Q49QW4_9MOLL/164-385--------------------------------------------------------------------------------
DHH_HUMAN/188-396--------------------------------------------------------------------------------
Q8MY56_CIOIN/186-395--------------------------------------------------------------------------------
Q175B3_AEDAE/201-412--------------------------------------------------------------------------------
A2I5D9_POLSP/90-308--------------------------------------------------------------------------------
Q66PH6_9TELE/184-413--------------------------------------------------------------------------------
A4UYK7_9ACTI/187-406--------------------------------------------------------------------------------
Q9GRA8_GRYBI/198-413--------------------------------------------------------------------------------
Q9U5Z6_BRABE/191-404--------------------------------------------------------------------------------
Q4PLX3_DANRE/191-442--------------------------------------------------------------------------------
O45992_CAEEL/258-471--------------------------------------------------------------------------------
Q8MY57_CIOIN/294-550--------------------------------------------------------------------------------
Q9W7Q9_PAROL/187-400--------------------------------------------------------------------------------
Q7Z263_ARTSF/158-415--------------------------------------------------------------------------------

PF14623

F0YDN2_AURAN/823-991--------------------------------------------------------------------------------
C0NJD1_AJECG/548-714--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-750--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
E9EQB7_METAR/534-699--------------------------------------------------------------------------------
F2SQT7_TRIRC/537-709--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
Q24C76_TETTS/502-666--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
A5Z4R4_9FIRM/129-258--------------------------------------------------------------------------------
A1KVQ7_NEIMF/353-489--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------

PF14890

A9B528_HERA2/384-526................................................................................
DNAB_SYNY3/385-808...........................................................................LSLKE
GLMS_METJA/76-569VERHYKLDETIRNKLRKVREKLGLTRKDVEKLCGVKEIYIVKIETGKLESIEEERLKKLCSLYGINFEEIIYRDNLHYTN
D7E146_NOSA0/393-538................................................................................
B5W0N0_SPIMA/394-525................................................................................

PF10596

A6S230_BOTFB/991-1164--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1797--------------------------------------------------------------------------------
A6R4K4_AJECN/1351-1497--------------------------------------------------------------------------------
Q00RU5_OSTTA/1516-1683--------------------------------------------------------------------------------
A8BTS5_GIAIC/1331-1491--------------------------------------------------------------------------------
A4IBT3_LEIIN/1514-1675--------------------------------------------------------------------------------
Q9AW36_GUITH/1259-1418--------------------------------------------------------------------------------
Q3LWH1_BIGNA/1383-1542--------------------------------------------------------------------------------
Q6FQZ4_CANGA/1515-1674--------------------------------------------------------------------------------
Q9XYM9_TRIVA/1432-1591--------------------------------------------------------------------------------
Q4PEC7_USTMA/1470-1629--------------------------------------------------------------------------------

PF13403

A3PK18_RHOS1/14-160--------------------------------------------------------------------------------
A3SZU1_9RHOB/393-539--------------------------------------------------------------------------------
Q1GGP9_SILST/27-173--------------------------------------------------------------------------------
C8RY14_9RHOB/1350-1496--------------------------------------------------------------------------------
Q1GES6_SILST/157-304--------------------------------------------------------------------------------
A3SNQ6_9RHOB/641-788--------------------------------------------------------------------------------
A3SUS4_9RHOB/185-331--------------------------------------------------------------------------------
D0CP51_9RHOB/143-290--------------------------------------------------------------------------------
C7DAD7_9RHOB/178-316--------------------------------------------------------------------------------
A9GA60_9RHOB/583-733--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A6DV24_9RHOB/336-474--------------------------------------------------------------------------------
A3VAW0_9RHOB/105-251--------------------------------------------------------------------------------
A3TXC6_9RHOB/29-175--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A3K5E2_9RHOB/849-996--------------------------------------------------------------------------------
B6BC88_9RHOB/475-613--------------------------------------------------------------------------------
A4EMR4_9RHOB/71-217--------------------------------------------------------------------------------
A3V1Q6_9RHOB/111-258--------------------------------------------------------------------------------
B7QV02_9RHOB/335-473--------------------------------------------------------------------------------
C9D0M9_9RHOB/1229-1376--------------------------------------------------------------------------------
Q0FQ52_9RHOB/227-374--------------------------------------------------------------------------------
D0CWS5_9RHOB/173-320--------------------------------------------------------------------------------
D0CQ11_9RHOB/159-297--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
A3JWU1_9RHOB/200-347--------------------------------------------------------------------------------
A3VI53_9RHOB/624-762--------------------------------------------------------------------------------
A3SQF1_9RHOB/126-264--------------------------------------------------------------------------------
B5K4Q3_9RHOB/102-249--------------------------------------------------------------------------------
A3JUC9_9RHOB/546-693--------------------------------------------------------------------------------
A3W238_9RHOB/563-702--------------------------------------------------------------------------------
B9NR62_9RHOB/115-262--------------------------------------------------------------------------------
C7D8K4_9RHOB/545-684--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
A4EIH6_9RHOB/690-837--------------------------------------------------------------------------------
B5J379_9RHOB/742-889--------------------------------------------------------------------------------
C9CTM7_9RHOB/120-267--------------------------------------------------------------------------------
A4EL36_9RHOB/35-182--------------------------------------------------------------------------------
C9D2P0_9RHOB/151-297--------------------------------------------------------------------------------
A3V7F0_9RHOB/249-396--------------------------------------------------------------------------------
A3XC10_9RHOB/338-477--------------------------------------------------------------------------------
A3JZG9_9RHOB/189-327--------------------------------------------------------------------------------
A3W5R9_9RHOB/184-322--------------------------------------------------------------------------------
Q5LPM0_SILPO/507-646--------------------------------------------------------------------------------
A3SHB9_9RHOB/143-290--------------------------------------------------------------------------------
A3TTF8_9RHOB/31-178--------------------------------------------------------------------------------
B6BEV2_9RHOB/337-476--------------------------------------------------------------------------------
A3JMU4_9RHOB/108-255--------------------------------------------------------------------------------
C9CXZ7_9RHOB/141-288--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
D0CSG1_9RHOB/199-337--------------------------------------------------------------------------------
Q1GGN0_SILST/194-341--------------------------------------------------------------------------------
B6AV64_9RHOB/37-183--------------------------------------------------------------------------------
Q5LSZ7_SILPO/803-941--------------------------------------------------------------------------------
C9CRM1_9RHOB/318-465--------------------------------------------------------------------------------
A3K151_9RHOB/707-851--------------------------------------------------------------------------------
A3SL99_9RHOB/129-267--------------------------------------------------------------------------------
A3JLQ1_9RHOB/336-475--------------------------------------------------------------------------------
A6FVP9_9RHOB/45-184--------------------------------------------------------------------------------
Q6SF13_9BACT/2229-2376--------------------------------------------------------------------------------
Q5LPJ7_SILPO/175-322--------------------------------------------------------------------------------
A3VA21_9RHOB/151-298--------------------------------------------------------------------------------
B6AYB0_9RHOB/160-302--------------------------------------------------------------------------------
Q2CAT6_9RHOB/160-307--------------------------------------------------------------------------------
B6B317_9RHOB/170-318--------------------------------------------------------------------------------
B9NQR9_9RHOB/142-290--------------------------------------------------------------------------------
A3SR39_9RHOB/268-419--------------------------------------------------------------------------------
B9NUP1_9RHOB/171-309--------------------------------------------------------------------------------
B6AZD3_9RHOB/512-660--------------------------------------------------------------------------------
B6B2Z4_9RHOB/167-315--------------------------------------------------------------------------------
A3SQF2_9RHOB/166-304--------------------------------------------------------------------------------
A3XDE7_9RHOB/339-478--------------------------------------------------------------------------------
B5KDV6_9RHOB/120-258--------------------------------------------------------------------------------
A3SHZ7_9RHOB/146-292--------------------------------------------------------------------------------
A3JSG0_9RHOB/151-289--------------------------------------------------------------------------------
A3JT50_9RHOB/142-280--------------------------------------------------------------------------------
Q1GMQ5_SILST/293-432--------------------------------------------------------------------------------
C7DBW6_9RHOB/268-415--------------------------------------------------------------------------------
A9DWF7_9RHOB/194-340--------------------------------------------------------------------------------
B7QQ35_9RHOB/162-309--------------------------------------------------------------------------------
Q5LLZ7_SILPO/144-282--------------------------------------------------------------------------------
B7RNT5_9RHOB/692-831--------------------------------------------------------------------------------
B7RP36_9RHOB/563-698--------------------------------------------------------------------------------
A3JVK2_9RHOB/381-520--------------------------------------------------------------------------------
B5KCW8_9RHOB/153-299--------------------------------------------------------------------------------
C8RZS8_9RHOB/219-358--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
A3VAC1_9RHOB/181-319--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
A3VHZ3_9RHOB/168-315--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
A3JYU7_9RHOB/143-282--------------------------------------------------------------------------------
Q5LMP8_SILPO/160-307--------------------------------------------------------------------------------
Q2CD05_9RHOB/27-169--------------------------------------------------------------------------------
A9EEF5_9RHOB/1099-1235--------------------------------------------------------------------------------
Q2CCZ2_9RHOB/165-310--------------------------------------------------------------------------------
A6FPB3_9RHOB/928-1068--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
B6AZM7_9RHOB/573-711--------------------------------------------------------------------------------
A3VMW9_9RHOB/142-280--------------------------------------------------------------------------------
Q1GMV1_SILST/833-976--------------------------------------------------------------------------------
B6B239_9RHOB/383-521--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
A3W415_9RHOB/142-281--------------------------------------------------------------------------------
B1ZBT1_METPB/133-268--------------------------------------------------------------------------------
C7CEK6_METED/138-280--------------------------------------------------------------------------------
A4ESK2_9RHOB/784-931--------------------------------------------------------------------------------
B6B425_9RHOB/122-269--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
C8S0F9_9RHOB/2250-2389--------------------------------------------------------------------------------
A3VJF5_9RHOB/166-311--------------------------------------------------------------------------------
C9CXD1_9RHOB/645-786--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B7KU45_METC4/258-393--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A3VFB5_9RHOB/155-300--------------------------------------------------------------------------------
D2CKZ0_9GAMM/93-241--------------------------------------------------------------------------------
B6AU02_9RHOB/46-193--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A3VJV0_9RHOB/145-290--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
C8RY96_9RHOB/128-267--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
A3JW88_9RHOB/167-310--------------------------------------------------------------------------------
B2SAQ3_BRUA1/14-150--------------------------------------------------------------------------------
Q2CAV0_9RHOB/70-218--------------------------------------------------------------------------------
O68085_RHOCA/442-581--------------------------------------------------------------------------------
D0CWR5_9RHOB/156-294--------------------------------------------------------------------------------
Q5LUZ7_SILPO/68-216--------------------------------------------------------------------------------
A3W580_9RHOB/62-208--------------------------------------------------------------------------------
D0D5E7_9RHOB/33-180--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A3W8K4_9RHOB/154-299--------------------------------------------------------------------------------
A3VEX8_9RHOB/9-155--------------------------------------------------------------------------------
A3JSM6_9RHOB/118-255--------------------------------------------------------------------------------
A3SRN1_9RHOB/161-308--------------------------------------------------------------------------------
Q1N7J0_9SPHN/211-348--------------------------------------------------------------------------------
A9DUV0_9RHOB/49-194--------------------------------------------------------------------------------
A6FV85_9RHOB/70-218--------------------------------------------------------------------------------
A3JS61_9RHOB/164-301--------------------------------------------------------------------------------
A3VAX2_9RHOB/110-257--------------------------------------------------------------------------------
A6E265_9RHOB/196-333--------------------------------------------------------------------------------
C7D8E1_9RHOB/33-181--------------------------------------------------------------------------------
Q1MD68_RHIL3/83-221--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A3JWF1_9RHOB/121-260--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
B6B9L0_9RHOB/67-214--------------------------------------------------------------------------------
A3JPL6_9RHOB/158-295--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
A3S7N1_9RHOB/69-214--------------------------------------------------------------------------------
A3V9D9_9RHOB/136-275--------------------------------------------------------------------------------
A9GL51_9RHOB/726-866--------------------------------------------------------------------------------
B6AWU4_9RHOB/33-181--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
B7RGP3_9RHOB/19-157--------------------------------------------------------------------------------
A3VKC8_9RHOB/32-181--------------------------------------------------------------------------------
B7RR26_9RHOB/132-273--------------------------------------------------------------------------------
A3JPP3_9RHOB/102-239--------------------------------------------------------------------------------
A9G7V6_9RHOB/181-329--------------------------------------------------------------------------------
A3TTS1_9RHOB/32-176--------------------------------------------------------------------------------
B5J8X8_9RHOB/33-181--------------------------------------------------------------------------------
A3W2P6_9RHOB/178-317--------------------------------------------------------------------------------
A3SKF2_9RHOB/139-280--------------------------------------------------------------------------------
A3JS38_9RHOB/159-295--------------------------------------------------------------------------------
A6DXP5_9RHOB/101-239--------------------------------------------------------------------------------
A3SRA3_9RHOB/68-209--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
A3SI78_9RHOB/178-317--------------------------------------------------------------------------------
A3V3N0_9RHOB/64-210--------------------------------------------------------------------------------
A3JS40_9RHOB/158-295--------------------------------------------------------------------------------
A3Z148_9SYNE/71-210--------------------------------------------------------------------------------
A3JT43_9RHOB/20-157--------------------------------------------------------------------------------
A4EJ24_9RHOB/71-219--------------------------------------------------------------------------------
C9CYM4_9RHOB/179-319--------------------------------------------------------------------------------
C7D959_9RHOB/18-157--------------------------------------------------------------------------------
A3XDE1_9RHOB/175-315--------------------------------------------------------------------------------
Q5LN78_SILPO/204-343--------------------------------------------------------------------------------
A6FNZ8_9RHOB/22-159--------------------------------------------------------------------------------
A6DX68_9RHOB/142-284--------------------------------------------------------------------------------
C7DFW9_9RHOB/173-311--------------------------------------------------------------------------------
B7QV01_9RHOB/186-327--------------------------------------------------------------------------------
B7RNA8_9RHOB/11-157--------------------------------------------------------------------------------
A6E3T2_9RHOB/4-141--------------------------------------------------------------------------------
A3X8D5_9RHOB/25-168--------------------------------------------------------------------------------
A3JQA1_9RHOB/57-194--------------------------------------------------------------------------------

PF05203

Q8J0G3_ZYGBI/11-460GAEDAD..........................................................................
Q8J0G2_ZYGRO/19-468RDEGVR..........................................................................
Q8J0G5_9SACH/19-473GGNDIQ..........................................................................
Q8J0G6_9SACH/19-474RGNDIG..........................................................................
Q8J0G4_ZYGBA/19-474RGNDIR..........................................................................
Q9P986_SACPS/1-465DENRKT..........................................................................
A7TIB9_VANPO/1-464PENRKY..........................................................................
C5DTQ4_ZYGRC/1-464DGHRRN..........................................................................
Q707W4_KLUDE/1-464EEKRKT..........................................................................
Q707W9_CANGB/1-464EERRKT..........................................................................
Q6TER1_CRYNE/36-207................................................................................
Q1KMS2_AJECA/5-539RTMSTSRNRQPLSETSAATSMNILPGFASNSTSVVSPGIHSHEILSLRSSCPQLVQIAEKSGLREECMI...........
Q1MSX1_PENEN/51-212................................................................................
C5FT71_ARTOC/1506-2056SSNPASSPPLPPQHHHLHKPSQDLDASFASSLSIKDRTSSPVDAIPKDTPPQPRSDDLLMSLVSEPEVA...........
Q1A775_9EURO/44-198................................................................................
Q1ECT9_EMEND/1526-2130TELPMSRSASAMRSIRTASGLSEFNDVTNVSASMPDIQNSGIKNQGRIAKVTRQQDSKGEVDFRQQYSQAIKDDLELLET
Q1A774_ASPGI/56-222................................................................................
B9XA08_9BACT/492-829................................................................................
A6QC64_SULNB/206-549................................................................................
Q2S6J9_SALRD/231-574................................................................................
A3EZR5_9CAUD/34-380................................................................................
Q5G7M7_9CAUD/35-373................................................................................
A8BML4_GIAIC/4-440................................................................................
A1ZUM1_9BACT/19-423VQAVTA..........................................................................
Q6BRM0_DEBHA/283-676IENNNQ..........................................................................
Q874G6_KLULC/277-686VQENKR..........................................................................
Q874G7_CANGB/277-691EETMEV..........................................................................
B6JY11_SCHJY/278-753GNLSVS..........................................................................
Q8J0G9_9SACH/19-519RGNAIR..........................................................................
Q874G5_NAUCA/266-782GGAGVS..........................................................................
Q874G1_9SACH/246-659................................................................................
Q8J0G8_SACEX/19-520GVEKIDELI.......................................................................
C5M9I6_CANTT/244-714INVHGA..........................................................................
A5DXZ0_LODEL/280-700HSVNEK..........................................................................
A3LP04_PICST/283-731RGKNVR..........................................................................
A7TLB5_VANPO/284-716.GNSTS..........................................................................
E9P8D3_YEASX/259-712RGNGIP..........................................................................

PF01079

Q7PXI1_ANOGA/295-503--------------------------------------------------------------------------------
HH_DROHY/253-475--------------------------------------------------------------------------------
HH_DROPS/255-475--------------------------------------------------------------------------------
Q1HEQ6_TRICA/99-299--------------------------------------------------------------------------------
SHH_CYNPY/190-418--------------------------------------------------------------------------------
A0JM37_XENTR/187-392--------------------------------------------------------------------------------
Q2QJG8_9ANNE/186-383--------------------------------------------------------------------------------
IHH_DANRE/187-398--------------------------------------------------------------------------------
Q708D0_9MYRI/276-506--------------------------------------------------------------------------------
TWHH_DANRE/190-403--------------------------------------------------------------------------------
WRT4_CAEEL/327-547--------------------------------------------------------------------------------
Q8AXT0_TAKRU/187-399--------------------------------------------------------------------------------
Q6BCD0_MERUN/188-423--------------------------------------------------------------------------------
Q80XI9_MOUSE/230-435--------------------------------------------------------------------------------
Q75UQ8_PARTP/185-402--------------------------------------------------------------------------------
Q7Z264_9SCOR/158-375--------------------------------------------------------------------------------
Q8MWG6_PATVU/190-409--------------------------------------------------------------------------------
WRT6_CAEEL/375-583--------------------------------------------------------------------------------
A3KNS3_DANRE/187-399--------------------------------------------------------------------------------
Q5UVJ3_STRPU/189-402--------------------------------------------------------------------------------
O73803_TAKRU/190-436--------------------------------------------------------------------------------
A8X447_CAEBR/327-545--------------------------------------------------------------------------------
IHH_CHICK/188-394--------------------------------------------------------------------------------
SHH_XENLA/188-430--------------------------------------------------------------------------------
SHH_CHICK/190-411--------------------------------------------------------------------------------
Q1PHR2_SACKO/171-384--------------------------------------------------------------------------------
SHH_DANRE/187-404--------------------------------------------------------------------------------
IHH_XENLA/187-395--------------------------------------------------------------------------------
A2I5E3_LEUER/186-403--------------------------------------------------------------------------------
O57567_NOTVI/188-392--------------------------------------------------------------------------------
WRT8_CAEEL/325-538--------------------------------------------------------------------------------
Q22872_CAEEL/566-779--------------------------------------------------------------------------------
Q49QW4_9MOLL/164-385--------------------------------------------------------------------------------
DHH_HUMAN/188-396--------------------------------------------------------------------------------
Q8MY56_CIOIN/186-395--------------------------------------------------------------------------------
Q175B3_AEDAE/201-412--------------------------------------------------------------------------------
A2I5D9_POLSP/90-308--------------------------------------------------------------------------------
Q66PH6_9TELE/184-413--------------------------------------------------------------------------------
A4UYK7_9ACTI/187-406--------------------------------------------------------------------------------
Q9GRA8_GRYBI/198-413--------------------------------------------------------------------------------
Q9U5Z6_BRABE/191-404--------------------------------------------------------------------------------
Q4PLX3_DANRE/191-442--------------------------------------------------------------------------------
O45992_CAEEL/258-471--------------------------------------------------------------------------------
Q8MY57_CIOIN/294-550--------------------------------------------------------------------------------
Q9W7Q9_PAROL/187-400--------------------------------------------------------------------------------
Q7Z263_ARTSF/158-415--------------------------------------------------------------------------------

PF14623

F0YDN2_AURAN/823-991--------------------------------------------------------------------------------
C0NJD1_AJECG/548-714--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-750--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
E9EQB7_METAR/534-699--------------------------------------------------------------------------------
F2SQT7_TRIRC/537-709--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
Q24C76_TETTS/502-666--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
A5Z4R4_9FIRM/129-258--------------------------------------------------------------------------------
A1KVQ7_NEIMF/353-489--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------

PF14890

A9B528_HERA2/384-526................................................................................
DNAB_SYNY3/385-808HIALPRKLESSSLQLMSDEELGLLGHLIGDGCTLPRHAIQYTSNKIELAEKVVELAKAVFGDQINPRISQERQWYQVYIP
GLMS_METJA/76-569PVKFP........KTPTPELMQIIGYIIGDGHFPSNRMLRLKDERKEVLEEYNQLFKTVFNLEGNIKKGDGN........
D7E146_NOSA0/393-538................................................................................
B5W0N0_SPIMA/394-525................................................................................

PF10596

A6S230_BOTFB/991-1164--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1797--------------------------------------------------------------------------------
A6R4K4_AJECN/1351-1497--------------------------------------------------------------------------------
Q00RU5_OSTTA/1516-1683--------------------------------------------------------------------------------
A8BTS5_GIAIC/1331-1491--------------------------------------------------------------------------------
A4IBT3_LEIIN/1514-1675--------------------------------------------------------------------------------
Q9AW36_GUITH/1259-1418--------------------------------------------------------------------------------
Q3LWH1_BIGNA/1383-1542--------------------------------------------------------------------------------
Q6FQZ4_CANGA/1515-1674--------------------------------------------------------------------------------
Q9XYM9_TRIVA/1432-1591--------------------------------------------------------------------------------
Q4PEC7_USTMA/1470-1629--------------------------------------------------------------------------------

PF13403

A3PK18_RHOS1/14-160--------------------------------------------------------------------------------
A3SZU1_9RHOB/393-539--------------------------------------------------------------------------------
Q1GGP9_SILST/27-173--------------------------------------------------------------------------------
C8RY14_9RHOB/1350-1496--------------------------------------------------------------------------------
Q1GES6_SILST/157-304--------------------------------------------------------------------------------
A3SNQ6_9RHOB/641-788--------------------------------------------------------------------------------
A3SUS4_9RHOB/185-331--------------------------------------------------------------------------------
D0CP51_9RHOB/143-290--------------------------------------------------------------------------------
C7DAD7_9RHOB/178-316--------------------------------------------------------------------------------
A9GA60_9RHOB/583-733--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A6DV24_9RHOB/336-474--------------------------------------------------------------------------------
A3VAW0_9RHOB/105-251--------------------------------------------------------------------------------
A3TXC6_9RHOB/29-175--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A3K5E2_9RHOB/849-996--------------------------------------------------------------------------------
B6BC88_9RHOB/475-613--------------------------------------------------------------------------------
A4EMR4_9RHOB/71-217--------------------------------------------------------------------------------
A3V1Q6_9RHOB/111-258--------------------------------------------------------------------------------
B7QV02_9RHOB/335-473--------------------------------------------------------------------------------
C9D0M9_9RHOB/1229-1376--------------------------------------------------------------------------------
Q0FQ52_9RHOB/227-374--------------------------------------------------------------------------------
D0CWS5_9RHOB/173-320--------------------------------------------------------------------------------
D0CQ11_9RHOB/159-297--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
A3JWU1_9RHOB/200-347--------------------------------------------------------------------------------
A3VI53_9RHOB/624-762--------------------------------------------------------------------------------
A3SQF1_9RHOB/126-264--------------------------------------------------------------------------------
B5K4Q3_9RHOB/102-249--------------------------------------------------------------------------------
A3JUC9_9RHOB/546-693--------------------------------------------------------------------------------
A3W238_9RHOB/563-702--------------------------------------------------------------------------------
B9NR62_9RHOB/115-262--------------------------------------------------------------------------------
C7D8K4_9RHOB/545-684--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
A4EIH6_9RHOB/690-837--------------------------------------------------------------------------------
B5J379_9RHOB/742-889--------------------------------------------------------------------------------
C9CTM7_9RHOB/120-267--------------------------------------------------------------------------------
A4EL36_9RHOB/35-182--------------------------------------------------------------------------------
C9D2P0_9RHOB/151-297--------------------------------------------------------------------------------
A3V7F0_9RHOB/249-396--------------------------------------------------------------------------------
A3XC10_9RHOB/338-477--------------------------------------------------------------------------------
A3JZG9_9RHOB/189-327--------------------------------------------------------------------------------
A3W5R9_9RHOB/184-322--------------------------------------------------------------------------------
Q5LPM0_SILPO/507-646--------------------------------------------------------------------------------
A3SHB9_9RHOB/143-290--------------------------------------------------------------------------------
A3TTF8_9RHOB/31-178--------------------------------------------------------------------------------
B6BEV2_9RHOB/337-476--------------------------------------------------------------------------------
A3JMU4_9RHOB/108-255--------------------------------------------------------------------------------
C9CXZ7_9RHOB/141-288--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
D0CSG1_9RHOB/199-337--------------------------------------------------------------------------------
Q1GGN0_SILST/194-341--------------------------------------------------------------------------------
B6AV64_9RHOB/37-183--------------------------------------------------------------------------------
Q5LSZ7_SILPO/803-941--------------------------------------------------------------------------------
C9CRM1_9RHOB/318-465--------------------------------------------------------------------------------
A3K151_9RHOB/707-851--------------------------------------------------------------------------------
A3SL99_9RHOB/129-267--------------------------------------------------------------------------------
A3JLQ1_9RHOB/336-475--------------------------------------------------------------------------------
A6FVP9_9RHOB/45-184--------------------------------------------------------------------------------
Q6SF13_9BACT/2229-2376--------------------------------------------------------------------------------
Q5LPJ7_SILPO/175-322--------------------------------------------------------------------------------
A3VA21_9RHOB/151-298--------------------------------------------------------------------------------
B6AYB0_9RHOB/160-302--------------------------------------------------------------------------------
Q2CAT6_9RHOB/160-307--------------------------------------------------------------------------------
B6B317_9RHOB/170-318--------------------------------------------------------------------------------
B9NQR9_9RHOB/142-290--------------------------------------------------------------------------------
A3SR39_9RHOB/268-419--------------------------------------------------------------------------------
B9NUP1_9RHOB/171-309--------------------------------------------------------------------------------
B6AZD3_9RHOB/512-660--------------------------------------------------------------------------------
B6B2Z4_9RHOB/167-315--------------------------------------------------------------------------------
A3SQF2_9RHOB/166-304--------------------------------------------------------------------------------
A3XDE7_9RHOB/339-478--------------------------------------------------------------------------------
B5KDV6_9RHOB/120-258--------------------------------------------------------------------------------
A3SHZ7_9RHOB/146-292--------------------------------------------------------------------------------
A3JSG0_9RHOB/151-289--------------------------------------------------------------------------------
A3JT50_9RHOB/142-280--------------------------------------------------------------------------------
Q1GMQ5_SILST/293-432--------------------------------------------------------------------------------
C7DBW6_9RHOB/268-415--------------------------------------------------------------------------------
A9DWF7_9RHOB/194-340--------------------------------------------------------------------------------
B7QQ35_9RHOB/162-309--------------------------------------------------------------------------------
Q5LLZ7_SILPO/144-282--------------------------------------------------------------------------------
B7RNT5_9RHOB/692-831--------------------------------------------------------------------------------
B7RP36_9RHOB/563-698--------------------------------------------------------------------------------
A3JVK2_9RHOB/381-520--------------------------------------------------------------------------------
B5KCW8_9RHOB/153-299--------------------------------------------------------------------------------
C8RZS8_9RHOB/219-358--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
A3VAC1_9RHOB/181-319--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
A3VHZ3_9RHOB/168-315--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
A3JYU7_9RHOB/143-282--------------------------------------------------------------------------------
Q5LMP8_SILPO/160-307--------------------------------------------------------------------------------
Q2CD05_9RHOB/27-169--------------------------------------------------------------------------------
A9EEF5_9RHOB/1099-1235--------------------------------------------------------------------------------
Q2CCZ2_9RHOB/165-310--------------------------------------------------------------------------------
A6FPB3_9RHOB/928-1068--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
B6AZM7_9RHOB/573-711--------------------------------------------------------------------------------
A3VMW9_9RHOB/142-280--------------------------------------------------------------------------------
Q1GMV1_SILST/833-976--------------------------------------------------------------------------------
B6B239_9RHOB/383-521--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
A3W415_9RHOB/142-281--------------------------------------------------------------------------------
B1ZBT1_METPB/133-268--------------------------------------------------------------------------------
C7CEK6_METED/138-280--------------------------------------------------------------------------------
A4ESK2_9RHOB/784-931--------------------------------------------------------------------------------
B6B425_9RHOB/122-269--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
C8S0F9_9RHOB/2250-2389--------------------------------------------------------------------------------
A3VJF5_9RHOB/166-311--------------------------------------------------------------------------------
C9CXD1_9RHOB/645-786--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B7KU45_METC4/258-393--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A3VFB5_9RHOB/155-300--------------------------------------------------------------------------------
D2CKZ0_9GAMM/93-241--------------------------------------------------------------------------------
B6AU02_9RHOB/46-193--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A3VJV0_9RHOB/145-290--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
C8RY96_9RHOB/128-267--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
A3JW88_9RHOB/167-310--------------------------------------------------------------------------------
B2SAQ3_BRUA1/14-150--------------------------------------------------------------------------------
Q2CAV0_9RHOB/70-218--------------------------------------------------------------------------------
O68085_RHOCA/442-581--------------------------------------------------------------------------------
D0CWR5_9RHOB/156-294--------------------------------------------------------------------------------
Q5LUZ7_SILPO/68-216--------------------------------------------------------------------------------
A3W580_9RHOB/62-208--------------------------------------------------------------------------------
D0D5E7_9RHOB/33-180--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A3W8K4_9RHOB/154-299--------------------------------------------------------------------------------
A3VEX8_9RHOB/9-155--------------------------------------------------------------------------------
A3JSM6_9RHOB/118-255--------------------------------------------------------------------------------
A3SRN1_9RHOB/161-308--------------------------------------------------------------------------------
Q1N7J0_9SPHN/211-348--------------------------------------------------------------------------------
A9DUV0_9RHOB/49-194--------------------------------------------------------------------------------
A6FV85_9RHOB/70-218--------------------------------------------------------------------------------
A3JS61_9RHOB/164-301--------------------------------------------------------------------------------
A3VAX2_9RHOB/110-257--------------------------------------------------------------------------------
A6E265_9RHOB/196-333--------------------------------------------------------------------------------
C7D8E1_9RHOB/33-181--------------------------------------------------------------------------------
Q1MD68_RHIL3/83-221--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A3JWF1_9RHOB/121-260--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
B6B9L0_9RHOB/67-214--------------------------------------------------------------------------------
A3JPL6_9RHOB/158-295--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
A3S7N1_9RHOB/69-214--------------------------------------------------------------------------------
A3V9D9_9RHOB/136-275--------------------------------------------------------------------------------
A9GL51_9RHOB/726-866--------------------------------------------------------------------------------
B6AWU4_9RHOB/33-181--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
B7RGP3_9RHOB/19-157--------------------------------------------------------------------------------
A3VKC8_9RHOB/32-181--------------------------------------------------------------------------------
B7RR26_9RHOB/132-273--------------------------------------------------------------------------------
A3JPP3_9RHOB/102-239--------------------------------------------------------------------------------
A9G7V6_9RHOB/181-329--------------------------------------------------------------------------------
A3TTS1_9RHOB/32-176--------------------------------------------------------------------------------
B5J8X8_9RHOB/33-181--------------------------------------------------------------------------------
A3W2P6_9RHOB/178-317--------------------------------------------------------------------------------
A3SKF2_9RHOB/139-280--------------------------------------------------------------------------------
A3JS38_9RHOB/159-295--------------------------------------------------------------------------------
A6DXP5_9RHOB/101-239--------------------------------------------------------------------------------
A3SRA3_9RHOB/68-209--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
A3SI78_9RHOB/178-317--------------------------------------------------------------------------------
A3V3N0_9RHOB/64-210--------------------------------------------------------------------------------
A3JS40_9RHOB/158-295--------------------------------------------------------------------------------
A3Z148_9SYNE/71-210--------------------------------------------------------------------------------
A3JT43_9RHOB/20-157--------------------------------------------------------------------------------
A4EJ24_9RHOB/71-219--------------------------------------------------------------------------------
C9CYM4_9RHOB/179-319--------------------------------------------------------------------------------
C7D959_9RHOB/18-157--------------------------------------------------------------------------------
A3XDE1_9RHOB/175-315--------------------------------------------------------------------------------
Q5LN78_SILPO/204-343--------------------------------------------------------------------------------
A6FNZ8_9RHOB/22-159--------------------------------------------------------------------------------
A6DX68_9RHOB/142-284--------------------------------------------------------------------------------
C7DFW9_9RHOB/173-311--------------------------------------------------------------------------------
B7QV01_9RHOB/186-327--------------------------------------------------------------------------------
B7RNA8_9RHOB/11-157--------------------------------------------------------------------------------
A6E3T2_9RHOB/4-141--------------------------------------------------------------------------------
A3X8D5_9RHOB/25-168--------------------------------------------------------------------------------
A3JQA1_9RHOB/57-194--------------------------------------------------------------------------------

PF05203

Q8J0G3_ZYGBI/11-460....................................................................RSLNIGNPLWNA
Q8J0G2_ZYGRO/19-468....................................................................KNLDTHNLLWDA
Q8J0G5_9SACH/19-473....................................................................ENSNNDNPLRNA
Q8J0G6_9SACH/19-474....................................................................RNLNTDNPLWNA
Q8J0G4_ZYGBA/19-474....................................................................RNLNTDNPVWNA
Q9P986_SACPS/1-465....................................................................RNLRKNNPFWKA
A7TIB9_VANPO/1-464....................................................................RHFRKHNPFWNA
C5DTQ4_ZYGRC/1-464....................................................................RHLRKNNPFWNC
Q707W4_KLUDE/1-464....................................................................RNLRKNNPFWNT
Q707W9_CANGB/1-464....................................................................RNLRKNNPFWNT
Q6TER1_CRYNE/36-207................................................................................
Q1KMS2_AJECA/5-539.....NPPSSREDLGLDLFDTHIEADEIQGLDENLTGQKHRLRTGCRAYGDLTVHEEEQILDNIISRPVGTPDIGTLLRA
Q1MSX1_PENEN/51-212................................................................................
C5FT71_ARTOC/1506-2056.....EEDDLDSVYLDILDTISEIGDGQFDDDPPQTQQTVRLRTGLSAYGTLEEEEQEQLLKQTTGLPPNNSGINSLLQA
Q1A775_9EURO/44-198................................................................................
Q1ECT9_EMEND/1526-2130DIEDDVASSDEIEDVCVVGSENELIGSEKQDQSGRRRQIHRLRTGHRGYGDLSDDEQEQLLDSVVERYAGDSRLNTLQQE
Q1A774_ASPGI/56-222................................................................................
B9XA08_9BACT/492-829....................................................................FHFTKCDSLRRS
A6QC64_SULNB/206-549....................................................................ALKDVSDSLQGK
Q2S6J9_SALRD/231-574....................................................................GAMATRESVQGA
A3EZR5_9CAUD/34-380....................................................................NTGHKKHGFTHA
Q5G7M7_9CAUD/35-373....................................................................VCFRDYHRLEDH
A8BML4_GIAIC/4-440....................................................................QGASETNDFFKR
A1ZUM1_9BACT/19-423....................................................................TPMHSVNLGWKM
Q6BRM0_DEBHA/283-676....................................................................TSAKTVDFLWDV
Q874G6_KLULC/277-686....................................................................RKVAQVSLVSKI
Q874G7_CANGB/277-691....................................................................LSLNVTNHSSKL
B6JY11_SCHJY/278-753....................................................................FEGNTDNVFWKL
Q8J0G9_9SACH/19-519....................................................................QLLTENNVFLKL
Q874G5_NAUCA/266-782....................................................................KERNLNNIFWDI
Q874G1_9SACH/246-659....................................................................LDLTKNNSVWDI
Q8J0G8_SACEX/19-520................................................................ISLGEGRGNGNVFAQV
C5M9I6_CANTT/244-714....................................................................AASKKNNLLWNA
A5DXZ0_LODEL/280-700....................................................................ESVNVARLLKQA
A3LP04_PICST/283-731....................................................................QNLNTGNLLWSL
A7TLB5_VANPO/284-716....................................................................TNQNVDNLLWDA
E9P8D3_YEASX/259-712....................................................................NNLNTENPLWDA

PF01079

Q7PXI1_ANOGA/295-503--------------------------------------------------------------------------------
HH_DROHY/253-475--------------------------------------------------------------------------------
HH_DROPS/255-475--------------------------------------------------------------------------------
Q1HEQ6_TRICA/99-299--------------------------------------------------------------------------------
SHH_CYNPY/190-418--------------------------------------------------------------------------------
A0JM37_XENTR/187-392--------------------------------------------------------------------------------
Q2QJG8_9ANNE/186-383--------------------------------------------------------------------------------
IHH_DANRE/187-398--------------------------------------------------------------------------------
Q708D0_9MYRI/276-506--------------------------------------------------------------------------------
TWHH_DANRE/190-403--------------------------------------------------------------------------------
WRT4_CAEEL/327-547--------------------------------------------------------------------------------
Q8AXT0_TAKRU/187-399--------------------------------------------------------------------------------
Q6BCD0_MERUN/188-423--------------------------------------------------------------------------------
Q80XI9_MOUSE/230-435--------------------------------------------------------------------------------
Q75UQ8_PARTP/185-402--------------------------------------------------------------------------------
Q7Z264_9SCOR/158-375--------------------------------------------------------------------------------
Q8MWG6_PATVU/190-409--------------------------------------------------------------------------------
WRT6_CAEEL/375-583--------------------------------------------------------------------------------
A3KNS3_DANRE/187-399--------------------------------------------------------------------------------
Q5UVJ3_STRPU/189-402--------------------------------------------------------------------------------
O73803_TAKRU/190-436--------------------------------------------------------------------------------
A8X447_CAEBR/327-545--------------------------------------------------------------------------------
IHH_CHICK/188-394--------------------------------------------------------------------------------
SHH_XENLA/188-430--------------------------------------------------------------------------------
SHH_CHICK/190-411--------------------------------------------------------------------------------
Q1PHR2_SACKO/171-384--------------------------------------------------------------------------------
SHH_DANRE/187-404--------------------------------------------------------------------------------
IHH_XENLA/187-395--------------------------------------------------------------------------------
A2I5E3_LEUER/186-403--------------------------------------------------------------------------------
O57567_NOTVI/188-392--------------------------------------------------------------------------------
WRT8_CAEEL/325-538--------------------------------------------------------------------------------
Q22872_CAEEL/566-779--------------------------------------------------------------------------------
Q49QW4_9MOLL/164-385--------------------------------------------------------------------------------
DHH_HUMAN/188-396--------------------------------------------------------------------------------
Q8MY56_CIOIN/186-395--------------------------------------------------------------------------------
Q175B3_AEDAE/201-412--------------------------------------------------------------------------------
A2I5D9_POLSP/90-308--------------------------------------------------------------------------------
Q66PH6_9TELE/184-413--------------------------------------------------------------------------------
A4UYK7_9ACTI/187-406--------------------------------------------------------------------------------
Q9GRA8_GRYBI/198-413--------------------------------------------------------------------------------
Q9U5Z6_BRABE/191-404--------------------------------------------------------------------------------
Q4PLX3_DANRE/191-442--------------------------------------------------------------------------------
O45992_CAEEL/258-471--------------------------------------------------------------------------------
Q8MY57_CIOIN/294-550--------------------------------------------------------------------------------
Q9W7Q9_PAROL/187-400--------------------------------------------------------------------------------
Q7Z263_ARTSF/158-415--------------------------------------------------------------------------------

PF14623

F0YDN2_AURAN/823-991--------------------------------------------------------------------------------
C0NJD1_AJECG/548-714--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-750--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
E9EQB7_METAR/534-699--------------------------------------------------------------------------------
F2SQT7_TRIRC/537-709--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
Q24C76_TETTS/502-666--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
A5Z4R4_9FIRM/129-258--------------------------------------------------------------------------------
A1KVQ7_NEIMF/353-489--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------

PF14890

A9B528_HERA2/384-526................................................................................
DNAB_SYNY3/385-808ASYRLTHNKKNPITKWLENLDVFGLRSYEKFVPNQVFEQPQRAIAIFLRHLWSTDGCVKLIVEKSSRPVAYYATSSEKLA
GLMS_METJA/76-569.YYILEINSKYLIDWFRENIPELFNKTGNERTPEFVFRLNNDLVASYLRGIFDAEGYIRAEAKQIG.....IGMTSKCFI
D7E146_NOSA0/393-538................................................................................
B5W0N0_SPIMA/394-525................................................................................

PF10596

A6S230_BOTFB/991-1164--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1797--------------------------------------------------------------------------------
A6R4K4_AJECN/1351-1497--------------------------------------------------------------------------------
Q00RU5_OSTTA/1516-1683--------------------------------------------------------------------------------
A8BTS5_GIAIC/1331-1491--------------------------------------------------------------------------------
A4IBT3_LEIIN/1514-1675--------------------------------------------------------------------------------
Q9AW36_GUITH/1259-1418--------------------------------------------------------------------------------
Q3LWH1_BIGNA/1383-1542--------------------------------------------------------------------------------
Q6FQZ4_CANGA/1515-1674--------------------------------------------------------------------------------
Q9XYM9_TRIVA/1432-1591--------------------------------------------------------------------------------
Q4PEC7_USTMA/1470-1629--------------------------------------------------------------------------------

PF13403

A3PK18_RHOS1/14-160--------------------------------------------------------------------------------
A3SZU1_9RHOB/393-539--------------------------------------------------------------------------------
Q1GGP9_SILST/27-173--------------------------------------------------------------------------------
C8RY14_9RHOB/1350-1496--------------------------------------------------------------------------------
Q1GES6_SILST/157-304--------------------------------------------------------------------------------
A3SNQ6_9RHOB/641-788--------------------------------------------------------------------------------
A3SUS4_9RHOB/185-331--------------------------------------------------------------------------------
D0CP51_9RHOB/143-290--------------------------------------------------------------------------------
C7DAD7_9RHOB/178-316--------------------------------------------------------------------------------
A9GA60_9RHOB/583-733--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A6DV24_9RHOB/336-474--------------------------------------------------------------------------------
A3VAW0_9RHOB/105-251--------------------------------------------------------------------------------
A3TXC6_9RHOB/29-175--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A3K5E2_9RHOB/849-996--------------------------------------------------------------------------------
B6BC88_9RHOB/475-613--------------------------------------------------------------------------------
A4EMR4_9RHOB/71-217--------------------------------------------------------------------------------
A3V1Q6_9RHOB/111-258--------------------------------------------------------------------------------
B7QV02_9RHOB/335-473--------------------------------------------------------------------------------
C9D0M9_9RHOB/1229-1376--------------------------------------------------------------------------------
Q0FQ52_9RHOB/227-374--------------------------------------------------------------------------------
D0CWS5_9RHOB/173-320--------------------------------------------------------------------------------
D0CQ11_9RHOB/159-297--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
A3JWU1_9RHOB/200-347--------------------------------------------------------------------------------
A3VI53_9RHOB/624-762--------------------------------------------------------------------------------
A3SQF1_9RHOB/126-264--------------------------------------------------------------------------------
B5K4Q3_9RHOB/102-249--------------------------------------------------------------------------------
A3JUC9_9RHOB/546-693--------------------------------------------------------------------------------
A3W238_9RHOB/563-702--------------------------------------------------------------------------------
B9NR62_9RHOB/115-262--------------------------------------------------------------------------------
C7D8K4_9RHOB/545-684--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
A4EIH6_9RHOB/690-837--------------------------------------------------------------------------------
B5J379_9RHOB/742-889--------------------------------------------------------------------------------
C9CTM7_9RHOB/120-267--------------------------------------------------------------------------------
A4EL36_9RHOB/35-182--------------------------------------------------------------------------------
C9D2P0_9RHOB/151-297--------------------------------------------------------------------------------
A3V7F0_9RHOB/249-396--------------------------------------------------------------------------------
A3XC10_9RHOB/338-477--------------------------------------------------------------------------------
A3JZG9_9RHOB/189-327--------------------------------------------------------------------------------
A3W5R9_9RHOB/184-322--------------------------------------------------------------------------------
Q5LPM0_SILPO/507-646--------------------------------------------------------------------------------
A3SHB9_9RHOB/143-290--------------------------------------------------------------------------------
A3TTF8_9RHOB/31-178--------------------------------------------------------------------------------
B6BEV2_9RHOB/337-476--------------------------------------------------------------------------------
A3JMU4_9RHOB/108-255--------------------------------------------------------------------------------
C9CXZ7_9RHOB/141-288--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
D0CSG1_9RHOB/199-337--------------------------------------------------------------------------------
Q1GGN0_SILST/194-341--------------------------------------------------------------------------------
B6AV64_9RHOB/37-183--------------------------------------------------------------------------------
Q5LSZ7_SILPO/803-941--------------------------------------------------------------------------------
C9CRM1_9RHOB/318-465--------------------------------------------------------------------------------
A3K151_9RHOB/707-851--------------------------------------------------------------------------------
A3SL99_9RHOB/129-267--------------------------------------------------------------------------------
A3JLQ1_9RHOB/336-475--------------------------------------------------------------------------------
A6FVP9_9RHOB/45-184--------------------------------------------------------------------------------
Q6SF13_9BACT/2229-2376--------------------------------------------------------------------------------
Q5LPJ7_SILPO/175-322--------------------------------------------------------------------------------
A3VA21_9RHOB/151-298--------------------------------------------------------------------------------
B6AYB0_9RHOB/160-302--------------------------------------------------------------------------------
Q2CAT6_9RHOB/160-307--------------------------------------------------------------------------------
B6B317_9RHOB/170-318--------------------------------------------------------------------------------
B9NQR9_9RHOB/142-290--------------------------------------------------------------------------------
A3SR39_9RHOB/268-419--------------------------------------------------------------------------------
B9NUP1_9RHOB/171-309--------------------------------------------------------------------------------
B6AZD3_9RHOB/512-660--------------------------------------------------------------------------------
B6B2Z4_9RHOB/167-315--------------------------------------------------------------------------------
A3SQF2_9RHOB/166-304--------------------------------------------------------------------------------
A3XDE7_9RHOB/339-478--------------------------------------------------------------------------------
B5KDV6_9RHOB/120-258--------------------------------------------------------------------------------
A3SHZ7_9RHOB/146-292--------------------------------------------------------------------------------
A3JSG0_9RHOB/151-289--------------------------------------------------------------------------------
A3JT50_9RHOB/142-280--------------------------------------------------------------------------------
Q1GMQ5_SILST/293-432--------------------------------------------------------------------------------
C7DBW6_9RHOB/268-415--------------------------------------------------------------------------------
A9DWF7_9RHOB/194-340--------------------------------------------------------------------------------
B7QQ35_9RHOB/162-309--------------------------------------------------------------------------------
Q5LLZ7_SILPO/144-282--------------------------------------------------------------------------------
B7RNT5_9RHOB/692-831--------------------------------------------------------------------------------
B7RP36_9RHOB/563-698--------------------------------------------------------------------------------
A3JVK2_9RHOB/381-520--------------------------------------------------------------------------------
B5KCW8_9RHOB/153-299--------------------------------------------------------------------------------
C8RZS8_9RHOB/219-358--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
A3VAC1_9RHOB/181-319--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
A3VHZ3_9RHOB/168-315--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
A3JYU7_9RHOB/143-282--------------------------------------------------------------------------------
Q5LMP8_SILPO/160-307--------------------------------------------------------------------------------
Q2CD05_9RHOB/27-169--------------------------------------------------------------------------------
A9EEF5_9RHOB/1099-1235--------------------------------------------------------------------------------
Q2CCZ2_9RHOB/165-310--------------------------------------------------------------------------------
A6FPB3_9RHOB/928-1068--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
B6AZM7_9RHOB/573-711--------------------------------------------------------------------------------
A3VMW9_9RHOB/142-280--------------------------------------------------------------------------------
Q1GMV1_SILST/833-976--------------------------------------------------------------------------------
B6B239_9RHOB/383-521--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
A3W415_9RHOB/142-281--------------------------------------------------------------------------------
B1ZBT1_METPB/133-268--------------------------------------------------------------------------------
C7CEK6_METED/138-280--------------------------------------------------------------------------------
A4ESK2_9RHOB/784-931--------------------------------------------------------------------------------
B6B425_9RHOB/122-269--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
C8S0F9_9RHOB/2250-2389--------------------------------------------------------------------------------
A3VJF5_9RHOB/166-311--------------------------------------------------------------------------------
C9CXD1_9RHOB/645-786--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B7KU45_METC4/258-393--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A3VFB5_9RHOB/155-300--------------------------------------------------------------------------------
D2CKZ0_9GAMM/93-241--------------------------------------------------------------------------------
B6AU02_9RHOB/46-193--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A3VJV0_9RHOB/145-290--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
C8RY96_9RHOB/128-267--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
A3JW88_9RHOB/167-310--------------------------------------------------------------------------------
B2SAQ3_BRUA1/14-150--------------------------------------------------------------------------------
Q2CAV0_9RHOB/70-218--------------------------------------------------------------------------------
O68085_RHOCA/442-581--------------------------------------------------------------------------------
D0CWR5_9RHOB/156-294--------------------------------------------------------------------------------
Q5LUZ7_SILPO/68-216--------------------------------------------------------------------------------
A3W580_9RHOB/62-208--------------------------------------------------------------------------------
D0D5E7_9RHOB/33-180--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A3W8K4_9RHOB/154-299--------------------------------------------------------------------------------
A3VEX8_9RHOB/9-155--------------------------------------------------------------------------------
A3JSM6_9RHOB/118-255--------------------------------------------------------------------------------
A3SRN1_9RHOB/161-308--------------------------------------------------------------------------------
Q1N7J0_9SPHN/211-348--------------------------------------------------------------------------------
A9DUV0_9RHOB/49-194--------------------------------------------------------------------------------
A6FV85_9RHOB/70-218--------------------------------------------------------------------------------
A3JS61_9RHOB/164-301--------------------------------------------------------------------------------
A3VAX2_9RHOB/110-257--------------------------------------------------------------------------------
A6E265_9RHOB/196-333--------------------------------------------------------------------------------
C7D8E1_9RHOB/33-181--------------------------------------------------------------------------------
Q1MD68_RHIL3/83-221--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A3JWF1_9RHOB/121-260--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
B6B9L0_9RHOB/67-214--------------------------------------------------------------------------------
A3JPL6_9RHOB/158-295--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
A3S7N1_9RHOB/69-214--------------------------------------------------------------------------------
A3V9D9_9RHOB/136-275--------------------------------------------------------------------------------
A9GL51_9RHOB/726-866--------------------------------------------------------------------------------
B6AWU4_9RHOB/33-181--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
B7RGP3_9RHOB/19-157--------------------------------------------------------------------------------
A3VKC8_9RHOB/32-181--------------------------------------------------------------------------------
B7RR26_9RHOB/132-273--------------------------------------------------------------------------------
A3JPP3_9RHOB/102-239--------------------------------------------------------------------------------
A9G7V6_9RHOB/181-329--------------------------------------------------------------------------------
A3TTS1_9RHOB/32-176--------------------------------------------------------------------------------
B5J8X8_9RHOB/33-181--------------------------------------------------------------------------------
A3W2P6_9RHOB/178-317--------------------------------------------------------------------------------
A3SKF2_9RHOB/139-280--------------------------------------------------------------------------------
A3JS38_9RHOB/159-295--------------------------------------------------------------------------------
A6DXP5_9RHOB/101-239--------------------------------------------------------------------------------
A3SRA3_9RHOB/68-209--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
A3SI78_9RHOB/178-317--------------------------------------------------------------------------------
A3V3N0_9RHOB/64-210--------------------------------------------------------------------------------
A3JS40_9RHOB/158-295--------------------------------------------------------------------------------
A3Z148_9SYNE/71-210--------------------------------------------------------------------------------
A3JT43_9RHOB/20-157--------------------------------------------------------------------------------
A4EJ24_9RHOB/71-219--------------------------------------------------------------------------------
C9CYM4_9RHOB/179-319--------------------------------------------------------------------------------
C7D959_9RHOB/18-157--------------------------------------------------------------------------------
A3XDE1_9RHOB/175-315--------------------------------------------------------------------------------
Q5LN78_SILPO/204-343--------------------------------------------------------------------------------
A6FNZ8_9RHOB/22-159--------------------------------------------------------------------------------
A6DX68_9RHOB/142-284--------------------------------------------------------------------------------
C7DFW9_9RHOB/173-311--------------------------------------------------------------------------------
B7QV01_9RHOB/186-327--------------------------------------------------------------------------------
B7RNA8_9RHOB/11-157--------------------------------------------------------------------------------
A6E3T2_9RHOB/4-141--------------------------------------------------------------------------------
A3X8D5_9RHOB/25-168--------------------------------------------------------------------------------
A3JQA1_9RHOB/57-194--------------------------------------------------------------------------------

PF05203

Q8J0G3_ZYGBI/11-460IV.DLEYLK........DGSKNV..PAYLSSDCFENREMFLAGLVDSEGHV..RGE.....VATINTCHHSVMTGVVAVA
Q8J0G2_ZYGRO/19-468IV.DLGYLK........DDSKNV..PGYICSDSFQHREVFLAGIIDSTGYV..SDE.....TATVKTIDQSVMTGTVAVA
Q8J0G5_9SACH/19-473IV.DLGYLT........DGVKNV..PTYLLSDAIPHREIFLAGLIDSDGFV..RSEDGC..SATIKTTLKTVMAGTVAVA
Q8J0G6_9SACH/19-474IV.DLGYLK........GGVKHV..PSYLLTDSIPHREVFLAGLIDSDGYV..RGEEAP..AATIKTIHKTVMEGTVAVA
Q8J0G4_ZYGBA/19-474IV.DLGYLK........DGVKNV..PSYLFSDSICHREVFLAGLIDSDGHV..RGDDGL..SVTIKTIHKTVMEGTVAVA
Q9P986_SACPS/1-465VT.ILKFKR......DLDGEKQI..PEFMYGEHIEVREAFLAGLIDSDGYVVKKGEGPESYKIAIQTVYSSIMDGIVHIS
A7TIB9_VANPO/1-464VT.CLKFKR......DGDGAKQI..PTFMWSEDVEVREAFMAGLIDADGYVVKRKEGPDSFKVAIQTIYPSIMNGVINIS
C5DTQ4_ZYGRC/1-464VV.NLKFKR......ELDGEKQI..PSFMWTEDLEVREAFLAGLIDSDGYVSKRKNPLDSFKVSIQTVYPSIMGGIVHIT
Q707W4_KLUDE/1-464VL.ALGFKK......ENSGEKYV..PEFMWTEDIEIREAFLAGLIDSDGYVSKRKDNPDVYKVSIQTIYPCIMDAVVHIA
Q707W9_CANGB/1-464IQ.NLGIKR......EIDGEKQV..PEFMWHEDIEIREAFLAGLIDSDGYVVKRKENPDVYKVSIQTIYPSVMNAIVHIA
Q6TER1_CRYNE/36-207................................................................................
Q1KMS2_AJECA/5-539LE.ELGLPTNRAEEGHRIENKRI..PLMYMKSSRSIRLALLAGLIDSDGWY..CQPQNTFFFGESERISPTLFWDIVTLA
Q1MSX1_PENEN/51-212................................................................................
C5FT71_ARTOC/1506-2056LR.GVGVLAEPGSTEPETDRKRI..PAVFLNNSRAVRLAVLAGLIDSDG.............CKSERWHSALFWDTVALA
Q1A775_9EURO/44-198................................................................................
Q1ECT9_EMEND/1526-2130LS.KMGILNPE..TGPINDKKRI..PQVFMQNSRSVRLSVLAGLLDSDGWY..IYPENMFGFAQSELCHKELFWDVVTLA
Q1A774_ASPGI/56-222................................................................................
B9XA08_9BACT/492-829LF.RLGLAG......KHSGNKFI..PEVFKVCSINQRLEVLA