Sequence alignment for CL0363

PF14623

Q237Q6_TETTS/509-673------------------PCFEGNSEVK..MANG.............TIKKVKE--I.....KKGD--------------
Q7S708_NEUCR/636-832------------------PCFAGETNVRVGVAVAEDVAADSDQLVT.KEIEISK--L.....RRGM--------------
H6C7V0_EXODN/356-526------------------PCFGGMSRII..LANG.............SAIPIVT--L.....QAGM--------------
J3PIM9_GAGT3/593-786------------------PCFAGATRVR..LAETA............TTVAIRD--L.....ARGM--------------
G2XFI4_VERDV/568-734------------------PCFAGSTPVL..LASG.............RSVPIRQ--L.....RHGV--------------
G1XIH1_ARTOA/537-708------------------VCFTGDSPVT..LVDG.............TKVRIDT--L.....RRGS--------------
U7PS73_SPOS1/521-692------------------PCFASFCRVT..LVDG.............RYIRVNK--L.....RAGM--------------
C7YL43_NECH7/586-752------------------VCFAASTDVT..LASG.............RIVQIRK--L.....RRGM--------------
R8BIW3_TOGMI/471-637------------------PCFAGCSTVT..LANG.............KDIAVST--M.....RKGM--------------
C5GK44_AJEDR/553-713------------------PCFAGHCNIR..LSEGN............DSVPIEN--L.....RAGT--------------
S8AB86_DACHA/542-713------------------VCFTGDCLVN..LPDG.............THMRIDG--L.....RRGT--------------
S3CBE6_OPHP1/613-780------------------PCFASFCRVN..MANG.............KVIRVNR--L.....RKGM--------------
G3JM09_CORMM/336-505------------------ACFAHGTPVT..LESR.............STVEIQD--L.....RAGS--------------
C5FLY1_ARTOC/540-711------------------PCFTGNCRVL..VSGNDASS.D.......ATIAIEN--L.....RAGM--------------
F0UB99_AJEC8/548-714------------------PCFAGHCNIR..LAERN............SSLPIRD--I.....RAGI--------------
G0QP70_ICHMG/545-705------------------GCFEGNCLVY..MFDN.............SFVKVKD--V.....RKGF--------------
I7M030_TETTS/514-676------------------GCMHGDSLVQ..LSDS.............SFKMVKE--V.....KKGD--------------
M7TBR0_EUTLA/533-699------------------GCFAAWSRVL..LGDG.............REMPVCR--L.....RKGV--------------
C1G4L4_PARBD/546-712------------------PCFAGHCRIR..LPEAN............SSLPIRD--L.....RPGT--------------
N4VVV8_COLOR/552-719------------------VCFVASTPVA..LASG.............RSVPIRA--L.....RRGV--------------
F2SQT7_TRIRC/537-709------------------PCFTGDCHIR..ISSKESEVIN.......ATISLEN--L.....RPGM--------------
Q24C76_TETTS/502-665------------------GCIHGDSLVY..LQNG.............KTKKVSE--I.....RKGD--------------
D2VHB8_NAEGR/586-749------------------SCFDGNSLIT..MYDN.............SVKKVSE--I.....KKGD--------------
G9MP19_HYPVG/551-718------------------VCFAGSTAVE..LASG.............KVTEIRK--L.....KSGI--------------
T0JQ14_COLGC/569-736------------------VCFIASTPVV..LASG.............RKVPIKT--L.....RRGV--------------
J4WBA6_BEAB2/688-856------------------.CFAHGTPLT..LEAG.............VTAEVQD--L.....RYGD--------------
I7M701_TETTS/604-769------------------PCFDGNCLVK..MANG.............DIKKVMD--I.....RKGD--------------
F7VWE7_SORMK/571-774------------------PCFAGESRVK..IAVSEEQEEDSDQAVVSREIAISE--L.....RKGM--------------
L8X395_THACA/606-772------------------PCFAGWCYID..TESG..............KIRLSE--L.....GRGT--------------
E4UR10_ARTGP/540-711------------------PCFTGSCRVR..LAGSGSERVS.......PTIPIEY--L.....RPPV--------------
Q2GTB7_CHAGB/570-754------------------GCFAGCSPVL..LAGGK............GLVRINR--L.....RAGM--------------
E3QU32_COLGM/508-676------------------VCFASSTPVQ..LASG.............RTVPIKA--L.....RRGA--------------
G0RIM5_HYPJQ/574-741------------------VCFAGSTAVE..LASG.............RVTEIRR--L.....RHGT--------------
Q22N58_TETTS/494-660------------------GCIHGKCKVL..LENN.............QYKNVEE--I.....RKGD--------------
A9UVU8_MONBE/587-772------------------GCYSADSLVD..LASVRAPGTTGDVAQ..RTGDVRN--LAGAWQRRAD--------------
I1RVJ3_GIBZE/578-742------------------VCFAASTEVT..LASG.............RIVQMRK--L.....RRGM--------------
E9EQB7_METAR/534-699------------------VCFAGSTPVE..LGSG.............RMVHIRR--L.....RRGM--------------
J4URQ4_BEAB2/478-645------------------VCFAGSTLVQ..LASG.............RAIEMRR--L.....RRGM--------------
G4NA23_MAGO7/558-749------------------PCFAGTTMVR..LAGDG............GVVPISW--L.....RAGI--------------

PF13403

Q1GGP9_RUEST/27-173------------------PCFTPGTLIA--TPRG--------------ERLVEN--L-----QVGD--------------
Q1GES6_RUEST/157-304------------------ICFTPGTRIA--TPEG--------------PKPVES--L-----REGD--------------
A1AYR4_PARDP/380-527------------------LCFLRGTLIK--TADG--------------EVPVEQ--L-----EPGT--------------
A8LN65_DINSH/175-322------------------PCFTPGTLIE--VPGG--------------TCPVEA--L-----QVGD--------------
A1B4V8_PARDP/356-503------------------PCFARGTRIA--VADD--------------EVAIET--L-----RAGD--------------
A8LKN9_DINSH/122-260------------------PCFVAGTRIL--TPEG--------------VVPVET--L-----RPGD--------------
Q28WJ0_JANSC/241-379------------------ICFAAGTRIA--TPRG--------------QVAVED--L-----RVGD--------------
Q5LPM0_RUEPO/507-646------------------ICFTPGTLIA--TAHG--------------PRAIET--L-----RPGD--------------
Q28L14_JANSC/1268-1415------------------PCFTPGCRVA--TARG--------------TSKVED--L-----RVGD--------------
Q1GGN0_RUEST/194-341------------------VCFTPNAQVT--TPEG--------------PRRIRD--L-----AVGD--------------
Q5LSZ7_RUEPO/803-941------------------TCFCRGTLIA--TAGG--------------EIPVEK--L-----RPGD--------------
Q5LPJ7_RUEPO/175-322------------------PCFVAGSLID--TVEG--------------PRPVET--L-----AVGD--------------
Q1GMQ5_RUEST/293-432------------------PCFVAGTLID--TEAG--------------PIAVED--L-----TVGM--------------
Q5LLZ7_RUEPO/144-282------------------ACFAAGTFIE--IESG--------------PIPVET--L-----RPGD--------------
A8LR09_DINSH/158-296------------------PCFMAGTRIR--TPDG--------------LRPVEA--L-----RPGD--------------
C7JHN5_ACEP3/423-565------------------VCFLSGSMIR--TPDG--------------DVAVED--I-----QIGD--------------
Q28SX3_JANSC/168-306------------------ICFAQGTLIA--TPDG--------------DVAVEE--L-----AVGG--------------
A8LK48_DINSH/203-343------------------PCFARGTRID--TPEG--------------PVRVEE--L-----CPGD--------------
Q5LMP8_RUEPO/160-307------------------ICFAAGTRIA--TPKG--------------ARPVET--L-----AVGD--------------
Q28UB5_JANSC/126-273------------------VCFTAGSLIE--TPSG--------------PRRIEN--L-----QRGD--------------
Q1GMV1_RUEST/833-976------------------PCYTPGSRVI--TARG--------------EVPVEE--I-----REGD--------------
A5FZD4_ACICJ/193-329------------------PCFAAGTQIR--TPAG--------------ETPVES--L-----RAGD--------------
B9JK11_AGRRK/201-336------------------SCFLRGTLIR--TPEG--------------DLPVED--L-----RVGD--------------
Q28TH9_JANSC/752-887------------------VCFTRGTAIR--TPRG--------------EVLIED--L-----RVGD--------------
A5G1S8_ACICJ/159-294------------------ACFAEGTRIA--TTRG--------------DVPVEE--L-----AKGD--------------
B0T7Q3_CAUSK/153-288------------------PCFAEGTRLT--TARG--------------AVAVED--L-----VEGD--------------
C7JE32_ACEP3/536-676------------------VCFLPGGMIA--TPDG--------------EHAVET--L-----RPGM--------------
B8IA31_METNO/149-285------------------PCFVSGTHIR--TARG--------------EVSVED--L-----AIGD--------------
A5G006_ACICJ/174-309------------------VCFLEGTRIF--GLNG--------------DIPVET--M-----NRGD--------------
A5FW80_ACICJ/285-421------------------PCFARGTLIL--TREG--------------LRPVET--L-----AAGD--------------
A8LLK3_DINSH/164-305------------------PCFRAGTRIV--TPKG--------------AVPVES--L-----RPGD--------------
Q5FQG8_GLUOX/285-425------------------ICYLAGTMIL--TPEG--------------ERAIET--L-----EAGD--------------
B0UJT1_METS4/116-254------------------PCYCTGTLLR--TVDG--------------DVAVEN--L-----RVGD--------------
Q5LUZ7_RUEPO/68-216------------------CAFSRGSLID--TDCG--------------PMAIED--L-----LPGD--------------
Q0BS96_GRABC/3687-3823------------------PCYVHGTLIL--TDRG--------------EVPVED--L-----QIGD--------------
B1M2P7_METRJ/65-199------------------PCYCTGTTIR--TDRG--------------DVAVER--L-----VVGD--------------
A5FVL4_ACICJ/410-545------------------PCFRHGTRLL--TPSG--------------LRPVET--L-----SEGD--------------
A4YQ57_BRASO/106-246------------------LCFLRGTRIM--TATG--------------ERAIEE--L-----AAGD--------------
A5FWA2_ACICJ/1192-1328------------------PCFARGTRLL--TAEG--------------YRPVET--L-----RPGD--------------
C3KQV1_RHISN/76-214------------------MCLLRGTSIM--TPSG--------------EVRIEA--L-----RIGD--------------
A8LKB8_DINSH/19-167------------------TGLACDAHVR--TPCG--------------ERRVEF--L-----RPGD--------------
Q5LN78_RUEPO/204-343------------------PSLHPETPIA--TPDG--------------YRPLSK--I-----RRGD--------------
C5AQV5_METEA/69-209------------------PCFTTGTLIR--TARG--------------EVAVED--L-----IVGD--------------
D5AV22_RHOCB/442-581------------------PCFTAGTLIE--TPRG--------------PVPVES--L-----RAGD--------------
Q2YL23_BRUA2/15-148------------------.CLLKGTLVT--TPNG--------------PVAVEK--L-----CVGD--------------
Q3J294_RHOS4/14-159------------------ACFTPGTLIA--TVRG--------------EVAVEA--L-----AAGD--------------

PF01079

Q7PXI1_ANOGA/295-503SDS.......SQS.SHTSGCFTGDSTVL--TEAG-------------VHRKLSE--L-----RIGE--------------
HH_DROPS/255-475SDS.......SIS.SHVHGCFTPESTAL--LESG-------------ITKPLSE--I-----SIGD--------------
IHH_DANRE/187-398SEH.......SVA.AKTGGCFPGRALVT--MKDG-------------SHRQIRD--L-----QAGD--------------
TWHH_DANRE/190-403AEN.......SVA.AKSGGCFPGSGTVT--LGDG-------------TRKPIKD--L-----KVGD--------------
WRT4_CAEEL/327-547APAGYAPMGFAPSGLQLYYCFPGDAMVN--VYNG-------------GFKRMDE--L-----AVGD--------------
Q80XI9_MOUSE/230-435SEH.......SAA.AKTGGCFPAGAQVR--LENG-------------ERVALSA--V-----KPGD--------------
WRT6_CAEEL/375-583SARGYSPNLNGLFGGTGMQCFSGDMEVE--TEDG-------------.IKMIKD--L-----KIGD--------------
A8X447_CAEBR/327-545QPAGYFPYFSAPAGLELYYCFPADATVH--VYDQ-------------GTKRMDE--L-----EVGD--------------
IHH_CHICK/188-394SEH.......SAA.AKTGGCFPGRALAT--LENG-------------ARTPLWA--L-----RPGQ--------------
SHH_CHICK/190-411AEN.......SVA.AKSGGCFPGSATVH--LEHG-------------GTKLVKD--L-----SPGD--------------
SHH_DANRE/187-404AEN.......SVA.AKSGGCFPGSALVS--LQDG-------------GQKAVKD--L-----NPGD--------------
WRT8_CAEEL/325-538QPVGY..APYAPAGWQLHYCFPADAEVN--VYEK-------------GVKRMDE--L-----EVGD--------------
DHH_HUMAN/188-396ADN.......SLA.VRAGGCFPGNATVR--LWSG-------------ERKGLRE--L-----HRGD--------------
Q175B3_AEDAE/201-412SDS.......SQS.NHASGCFTGDSTVQ--TSTG-------------ETRKLSE--L-----QIGE--------------
O45992_CAEEL/258-471APYSY...LPAAPQCQQYYCFPNDAVVN--VYEK-------------AVKRMDE--L-----EIGD--------------
B0S8K0_DANRE/187-399SEH.......SVA.AKTGGCFPASALVT--VEDG-------------SLKTLDS--L-----QPGE--------------
B3DJ46_DANRE/191-442ADH.......SVA.VEKGGCFSASGLVT--MADG-------------VQKPMSC--L-----WPGE--------------
HH_DROMO/248-470SDS.......SPSISHVHGCFTPESTAL--LESG-------------AEKALSE--L-----AIGD--------------
C3ZGW9_BRAFL/224-434AES.......DTT.ATQGGCFPAESWVT--RDDG-------------NRIRMRD--V-----RPGD--------------
D6WCL7_TRICA/146-345SES.......SQA.AKYGGCFSGESTVL--TSTG-------------LRRNLSS--L-----QIGE--------------
F6WZB6_XENTR/191-398SEH.......SAA.AKTGGCFPGGALAT--LESG-------------EKIPVSQ--L-----RPGL--------------
F6XBS5_CIOIN/294-549SEE.......SDA.AKYGGCFPGESTVI--VPGE-------------GHVPISS--L-----QPGD--------------
F6YTG6_XENTR/190-394ADN.......SLG.VRSGGCFPGTAMVM--MASG-------------EKKSLSE--L-----QLGD--------------
G3V6T0_RAT/188-423AEN.......SVA.AKSGGCFPGSATVH--LEQG-------------GTKLVKD--L-----SPGD--------------
H2U1Q8_TAKRU/190-435ADH.......SVA.VEKGGCFPGWSRVT--VAGG-------------FQKSLSS--L-----TPGD--------------
H2V9H2_TAKRU/190-402AEN.......SVA.AKSGGCFPGSSTVT--LQDG-------------TKKLVKH--L-----RSGD--------------
H2XUY9_CIOIN/97-305ADN.......SDA.AKYGGCFDGVSEVR--NESG-------------SVIPMNK--V-----NVGD--------------
W4Y925_STRPU/189-401SES.......AAA.KNSGGCFPGFSQAS--LENG-------------RTISMLD--I-----RVGD--------------
W5K3H2_ASTMX/187-406AEN.......SVA.AKSGGCFPGSSHVR--LKDG-------------RQKALKD--L-----KPGD--------------

PF05203

U7Q1H8_SPOS1/262-759-------------------CFAAGTPVM--MSDG-------------TIQPVET--I-----DLGD--------------
Q6FQS3_CANGA/285-698-------------------CFAKGTQVL--MADG-------------SNQSIEN--I-----KIGD--------------
A3LP04_PICST/283-730-------------------CFAKGTKVL--MANG-------------DDKNIED--I-----AVGE--------------
J7RJ26_KAZNA/284-757-------------------CFERGTEVL--MADG-------------SDKPIEQ--I-----TLGE--------------
C5M9I6_CANTT/244-713-------------------CFTKGTQVM--MADG-------------ADKSIES--I-----EVGD--------------
Q6CL64_KLULA/284-692-------------------CFSKGTEVM--MGDG-------------KDELIEN--I-----QVGD--------------
B6JY11_SCHJY/285-759-------------------CFAKGTEVL--MANG-------------ADKKIED--V-----VIGD--------------
Q6BRM0_DEBHA/283-675-------------------CFAKGTEVL--MADG-------------SNKNIEE--V-----QIGE--------------
A5DXZ0_LODEL/280-699-------------------CFTKGTQVM--MADG-------------KDKSIED--V-----QLGE--------------
H2APW1_KAZAF/284-774-------------------CFAKGTKVL--MADG-------------SDRAIED--I-----SINE--------------
G7E5L8_MIXOS/284-742-------------------CFAKDTAVL--MADG-------------TEKPIQD--V-----AIED--------------
F2TVI8_SALR5/1497-1695-------------------CFRTTTELL--LASG-------------DIVRASD--V-----RVGD--------------
U9UGV8_RHIID/409-843-------------------CFAKGTKIL--MYDG-------------THQNVEE--L-----NVGN--------------
C5DTL5_ZYGRC/284-732-------------------CFAKGTEVM--MSDG-------------SIKEVEG--I-----EVGQ--------------
G8JWX2_ERECY/284-671-------------------CFGEGTEVL--MADG-------------SIKAIEN--V-----KIGE--------------
A7TLB5_VANPO/284-715-------------------CFAKGTEVM--MADS-------------SIKNIED--I-----EIGD--------------
VATA_YEAST/284-736-------------------CFAKGTNVL--MADG-------------SIECIEN--I-----EVGN--------------
M3K3J1_CANMX/284-733-------------------CFAKGTKVL--MSDG-------------KDRNIED--V-----AVGD--------------
G0V8Z3_NAUCC/284-799-------------------CFAKGTEVL--MADG-------------SDKAIEA--I-----EVGE--------------
C5DTQ4_ZYGRC/1-463-------------------MLEEGTKLL--MANG-------------QIKDVGK--L-----DVGE--------------
E9CG65_CAPO3/761-1238-------------------CFSPETPVR--MADG-------------SVKRADA--I-----AQND--------------
G0W3J0_NAUDC/284-783-------------------CFAKGTQVM--MADG-------------SDKSIEE--I-----QIGE--------------
G8ZLC3_TORDC/1-463-------------------MFEQGTKIM--MANG-------------QAKDIQD--I-----AINS--------------
G8BNB8_TETPH/284-799-------------------CFAKGTKVL--MADG-------------SDKSIED--I-----AIGE--------------

PF07591

A3DGR7_CLOTH/105-234-------------------------LIL--TVAG--------------LVAIEN--I-----KAGD--------------
Q5F6G7_NEIG1/1-137-------------------------MVR--TADG--------------YKAIAH--I-----QAGD--------------
Q9K122_NEIMB/1-137-------------------------MVK--TADG--------------YKAIAR--I-----RTGD--------------

PF14890

DPOL_THEAG/860-1392-----------------------EWLPI--IENG-----------EVKFVKIGE--F------IDRYMEEQKDKVRTVDN
D5VTT2_METIM/75-563-----------------------DTYII--LSDG-----------..RIKKISE--L------DED..............
B7R5G0_9EURY/317-755-----------------------EHLTT--MAEM-----------YERYKHLGE--F------YDK.............N
DNAB_NOSS1/393-817-----------------------DSLVT--LAPG-----------GLQI.PIRE--L------VGK............SG
I3RCL0_9EURY/841-1358-----------------------EWIPI--LENG-----------RLKFYRIGE--F------IDNLIKRNANLVIRNGS
GLMS_METJA/76-570-----------------------DTYVI--LPDG-----------..RMKKISE--I------DED..............
DNAB_SYNY3/385-809-----------------------DSLIS--LAST-----------GKRV.SIKD--L------LDE............KD
Q9UYA0_PYRAB/317-700-----------------------EHLTT--MAEM-----------YERYRHLGE--F------YDE.............N
DPOL_THEKO/857-1388-----------------------EWLPV--LEEG-----------EVHFVRIGE--L------IDRMMEENAGKVKREGE
I6TV89_9EURY/317-755-----------------------EHLTT--MEEM-----------YERYKHLGE--F------YDE.............E
NDRZ_PYRFU/317-755-----------------------EHLTT--MEEM-----------YERYKHLGE--F------YDE.............E
F6BAJ4_METIK/76-570-----------------------DTYVI--LPDG-----------..RMKKISE--I------DKD..............

PF10596

I3L3Z8_HUMAN/86-244--------------FKQYQVLKQNPFWW--THQR-------------HDGKLWN..L-----------------------
A2EY65_TRIVA/1432-1590--------------FKKYSLFKTNPYAW--THHH-------------HDGKLWN..L-----------------------
A8BTS5_GIAIC/1337-1490--------------..NALTLKS....W--YNKK-------------LLGSLYD..L-----------------------
S3BP74_OPHP1/1452-1610--------------FKLYQIMRHNPFGW--TSAR-------------HDGKLWN..L-----------------------
Q8SVU6_ENCCU/1239-1384--------------.......KPDWFWF--TDAK-------------HDGKLWS..M-----------------------
Q5KPW2_CRYNJ/1640-1796--------------QQKYQLFRST....--ASVR-------------HERPSTS...-----------------------
K7VI98_MAIZE/675-841--------------FKQYQVLKQNPFWW--THQQ-------------HDGKLWN..L-----------------------
G0W883_NAUDC/1515-1673--------------FKKYSLERNSPFWW--TNAH-------------HDGKLWN..L-----------------------
E6ZWZ5_SPORE/1485-1643--------------FKKYQIAKAQPFAW--TNQR-------------HDGKLYN..L-----------------------
Q00RU5_OSTTA/1516-1682--------------FKEYNLTRQNPFWW--THQR-------------HDGKLWN..L-----------------------
E9AFM0_LEIMA/1514-1674--------------FQRYLAGKYLKNWW--FHME-------------HDGNICGGVM-----------------------
R0KWQ9_NOSB1/1205-1354--------------FKKFTSLQYDPLPF--TSLR-------------HDGLLYN..L-----------------------

PF14623

Q237Q6_TETTS/509-673-EVFCPN..T--GK---AEKVKCVIE-TEV------KENL.TQLVRL..............GKGLLITPY--HPVRIQG-
Q7S708_NEUCR/636-832-MVQTPK...--.G---FRKVRAVLK-TPV------CE...ERMCLVMARDDEAR........QLLVTPW--HPVSLDG-
H6C7V0_EXODN/356-526-SVWTPN...--.G---ARKVIAVVK-TRI------SSKAGQTLCRI..............G.ELLVTPY--HPLLQNG-
J3PIM9_GAGT3/593-786-RVHTPL...--.G---PRAVAAVLR-TRV------WR...AAVRRV..............G.GVVVTPW--HPVRRTG-
G2XFI4_VERDV/568-734-KVLTPR...--.G---PRRVAVVLV-TPV------RR...EVMCRV..............G.GLVVTPW--HPLSADA-
G1XIH1_ARTOA/537-708-IIMTGR...--.G---AGEVSAIVK-TRI------SGT..TDICTI..............G.DMKVTPW--HPIHYDG-
U7PS73_SPOS1/521-692-SVQTPR...--.G---PRTVAAVMK-TPV------SS...IPMVTI..............G.RLLITAW--HPVSHNG-
C7YL43_NECH7/586-752-KVQTPR...--.G---SRRVAMVLK-TPV------EQ...ELLCRM..............G.KVLVTPW--HPVSNDR-
R8BIW3_TOGMI/471-637-RVATPL...--.G---PRRVVAILK-TPV------RR...EIMCKV..............G.GLLVTPW--HPVSLDG-
C5GK44_AJEDR/553-713-KVWTPC...--.G---PRRVRAILA-TAV------KD...TVVCNI..............G.SLIITPW--HPIQVAG-
S8AB86_DACHA/542-713-AVLTAK...--.G---PAEISAIVK-TKV------SGE..TEICTI..............G.EMKVTPW--HPIFHEG-
S3CBE6_OPHP1/613-780-QVQTPR...--.G---PRAVSRVLK-TPV------SS...IPMVTI..............G.RLLITAW--HPVSHNG-
G3JM09_CORMM/336-505-VVQTLA...--.G---PRLVVGVLR-MQV------EN...EVMCRL..............GAALLVTAW--HPVSFDG-
C5FLY1_ARTOC/540-711-SVWTPH...--.G---PREVRAVLQ-TSV------ND...IDICKI..............G.SLEITPW--HPIRFQG-
F0UB99_AJEC8/548-714-KVWTPL...--.G---PRRVRAVLA-TAV------KN...TILCNI..............G.SLSITPW--HPIQVAG-
G0QP70_ICHMG/545-705-KIKAQD...--GQ---IHTVIAVIK-ILF------EHGQ.IPLVQL..............KEGLLITPR--HPILING-
I7M030_TETTS/514-676-KVICPLL.E--NQ---CVEVECVVL-SKC------EDGT.KEFVQL..............GTDLWITPK--HPIRVNG-
M7TBR0_EUTLA/533-699-SVQTPL...--.G---SRRVVAVLR-IPM------RR...AVMCRV..............G.RLLITPW--HPIKTED-
C1G4L4_PARBD/546-712-KVWTPV...--.G---PRRVRAVVA-TTV------KN...MTLCKI..............G.PLLITPW--HPMQVER-
N4VVV8_COLOR/552-719-AVQTPS...--.G---ARRVVAVLK-TPV------RR...EIMCRV..............G.DLAVTPW--HPISRDG-
F2SQT7_TRIRC/537-709-SVWTPH...--.G---PREVRAVLQ-TSV------NH...IDICRI..............G.TLQITPW--HPMRIQN-
Q24C76_TETTS/502-665-VVQCPELGQ--LQ---STEVVCIVV-SKC------ENNS.HSFVQI..............GENLWITPK--HPIRING-
D2VHB8_NAEGR/586-749-RVKNMN..G--DS---YATILCVLK-SKT------PSPI.VKLCEM..............N.GMYITPY--HPVRVKG-
G9MP19_HYPVG/551-718-RVRTPL...--.G---PRKVAMVLK-TKV------SS...EVLCRI..............G.SLLVTPW--HPLSMDG-
T0JQ14_COLGC/569-736-TVQTPS...--.G---PRRVVAVLK-TPV------HR...EIMCRV..............G.DLVVTPW--HPVSMDS-
J4WBA6_BEAB2/688-856-MVQTLA...--.G---RRLVVGVLR-TFV------EN...EVLCRL..............G.DVLVTAW--HPVSFDG-
I7M701_TETTS/604-769-LIASPAI.N--GV---EAKVSCVVK-TPC------LNNQ.AYFVEF..............EDGLIITPY--HPIRVNG-
F7VWE7_SORMK/571-774-MVQTPK...--.G---FRKVRAVLK-TPV------EN...ERMCLVRVAEAEGRAGVGGVG.SLLVTPW--HPISLDD-
L8X395_THACA/606-772-IVRTPS...--.G---TARVAAVLR-TLC------SGQM.TELCTI..............G.QLAITPW--HPIYHNG-
E4UR10_ARTGP/540-711-SVWTPQ...--.G---PRKVRAVLQ-SIV------KD...VEICEI..............D.CLQITPW--HPMKFQG-
Q2GTB7_CHAGB/570-754-EVVTPC...--.G---PRKVAAVLR-MPV------RR...VEMCLVAAAAGPSGKGK...S.RLLVTPW--HPVELHQ-
E3QU32_COLGM/508-676-AVRTPS...--.G---PRRVVAVLK-TPV------RR...EVMCRV..............G.DLVVTPW--HPLSLDG-
G0RIM5_HYPJQ/574-741-RVRTPL...--.G---SKKVAMVLK-TKV------SN...ETLCRI..............G.SVLVTPW--HPLSTDG-
Q22N58_TETTS/494-660-IVICPRI.G--NK---AVKVVCVVK-TLC------TGSN.HSFVKL..............G.NLLITPW--HPVRLMH-
A9UVU8_MONBE/587-772-AIRAGDVLA--NG---AV.VDYVVA-VAC------AGGE.HDFCQL..............SPGLRITPW--HPVREPS-
I1RVJ3_GIBZE/578-742-KVRTPR...--.G---SRRVALVLK-TPV------EQ...EVLCRV..............G.DVLVTPW--HPISSDS-
E9EQB7_METAR/534-699-KVRTPT...--.G---TRKVAMVLK-TAV------QE...ETLCHV..............G.NLLVTPW--HPISANG-
J4URQ4_BEAB2/478-645-KLQTPL...--.G---SRKVAAVLR-TPV------KD...ETLCRL..............G.AVLVTPW--HPISRDA-
G4NA23_MAGO7/558-749-SVATPA...--.G---PRAVRTVLR-TRV------RS...QPMVRLP.............G.GVVVTPW--HPVKMGG-

PF13403

Q1GGP9_RUEST/27-173-RVITRD.....NG...IQEIRWFGH.NAM------G.-----------------------PQDLSHASHL.QPILIRQ-
Q1GES6_RUEST/157-304-RVQTRD.....NG...AQVVQWIGA.RRM------S.-----------------------GARLFVMPAL.RPVRIRA-
A1AYR4_PARDP/380-527-KVMTLD.....HG...CKALRWIGK.RVL------S.-----------------------AEELAAQPKL.RPIRIRA-
A8LN65_DINSH/175-322-LVLTRD.....DG...AQPVRWVGS.ARI------D.-----------------------SAKLAGNPRF.RPILLRA-
A1B4V8_PARDP/356-503-LVQTRD.....NG...LQPIRWIGS.RKL------S.-----------------------AAELKAMPNL.RPIRIAA-
A8LKN9_DINSH/122-260-LVQTRD.....HG...AQPVLWVGR.RTL------..-----------------------....PGSEAL.APIRFSP-
Q28WJ0_JANSC/241-379-RVVTRD.....GG...IQALRWIGF.RTV------..-----------------------....PADGPL.APIHITK-
Q5LPM0_RUEPO/507-646-LIVTRD.....HG...LQPLRWVGS.RTV------..-----------------------....AATGNH.APIRLDP-
Q28L14_JANSC/1268-1415-LIETHD.....NG...LQAVRWIGA.KTL------T.-----------------------QIDLARAPHL.RPIRIRT-
Q1GGN0_RUEST/194-341-RVLTRD.....NG...YQTLRWKYH.RRL------S.-----------------------RADLDRQPHL.APIIFEP-
Q5LSZ7_RUEPO/803-941-RVITRD.....RG...YQRIRWIGG.TSR------..-----------------------....EAPTAV.APIRIRT-
Q5LPJ7_RUEPO/175-322-LVPVED.....GP...PQPILWIGK.RTL------S.-----------------------IADLGANPHL.RPVRIRR-
Q1GMQ5_RUEST/293-432-QVMTRD.....HG...PQPLRWIGR.STR------..-----------------------....LARGRN.APVLIAR-
Q5LLZ7_RUEPO/144-282-LVQTLD.....NG...LQPLLQLAK.TTV------..-----------------------....RGDGAL.APVLFRA-
A8LR09_DINSH/158-296-RVWTRD.....DP...EARIRWVGQ.TVV------..-----------------------....DGRDAL.APVEIGT-
C7JHN5_ACEP3/423-565-QVVTFDWKSNKTV...CRPVIWVGK.THA------TV-----------------------RPDLPHDEAG.YPVRVRK-
Q28SX3_JANSC/168-306-LVSTVE.....HG...AEPIRWIGR.KTF------..-----------------------....PARGAF.APVEFAP-
A8LK48_DINSH/203-343-LVLTRD.....HG...PRPVAAVLS.REL------..-----------------------PLTADTMADH.KPIEFKP-
Q5LMP8_RUEPO/160-307-LVQTLD.....HG...PQPIRWIGT.RRV------G.-----------------------LATQLLSHGV.APVVIPA-
Q28UB5_JANSC/126-273-LVLTAE.....GM...AKPVQWIGQ.RHL------S.-----------------------ARDIAQSPHL.SPVVIAA-
Q1GMV1_RUEST/833-976-LVQTAD.....NG...LQPVIWVGH.RRL------S.-----------------------ASDLARHPHL.RPVLLRP-
A5FZD4_ACICJ/193-329-AVLTAT.....GA...ERRVVWIGR.RTL------D.-----------------------LSRHPRPELV.RPVRIAA-
B9JK11_AGRRK/201-336-LVVTH......KG...VAEIRWVGR.RRL------D.-----------------------PKAIDKPRDT.LPVRMKA-
Q28TH9_JANSC/752-887-LVDTLD.....NG...PQRLVWIGT.REV------S.-----------------------VAQLTIYPNL.RPIRIQR-
A5G1S8_ACICJ/159-294-AVLLHG.....GG...TAPVVWIGH.RTI------E.-----------------------PGRHARPNAV.QPVLIGA-
B0T7Q3_CAUSK/153-288-EVVTAS.....GA...ARPVIWIGS.RQV------R.-----------------------CDRHPAPALV.NPVRVRA-
C7JE32_ACEP3/536-676-SVLTFD.....NGEITPKDIVWVGC.QHV------TV-----------------------QRDCPPDIAG.VPIRISK-
B8IA31_METNO/149-285-VVVTVS.....GE...HRPIRWIGH.RAY------T.-----------------------GRFANANPDV.LPICFKA-
A5G006_ACICJ/174-309-RLITKS.....GA...MRPVRWVGR.RTI------D.-----------------------SQRHPRPETV.WPVRIER-
A5FW80_ACICJ/285-421-EVVTAD.....GK...LVPVIWTGS.RTL------D.-----------------------LAMHPAPEKV.KPVCFAP-
A8LLK3_DINSH/164-305-EVLTLD.....HE...VQTVLWAGA.RQV------S.-----------------------LAEQIANARL.RPVRIAA-
Q5FQG8_GLUOX/285-425-KVMVYA.....NGTTSTQTILRVGH.AHA------TT-----------------------GTTGHADVDA.VPVRVRA-
B0UJT1_METS4/116-254-LVVTAS.....GE...HRPIKWIGH.SAL------D.-----------------------CRSHANPAAA.RPIRIRK-
Q5LUZ7_RUEPO/68-216-RVITQD.....GS...AQEVVWKGS.TVI------V.-----------------------PGRVSATGRDYRLTRIMA-
Q0BS96_GRABC/3687-3823-HVITAG.....EA...VRPIRWLGR.RSY------N.-----------------------GRFIQGRRDV.LPVRIRQ-
B1M2P7_METRJ/65-199-SVVTAA.....GL...RRPIRWIGR.RTY------..-----------------------.PGSSAPPSE.RPVRIRA-
A5FVL4_ACICJ/410-545-EVITLR.....GE...VRQIAWRGR.RRI------D.-----------------------CRRHPVPESV.LPVLIEK-
A4YQ57_BRASO/106-246-VLPTVF.....GG...LRPVQWIGSFRRY------RA-----------------------KPDAAWPAAA.RPVRIAK-
A5FWA2_ACICJ/1192-1328-RLVTED.....GT...AEPVVWIGW.RSI------D.-----------------------LSRDPAAALL.HPVVITP-
C3KQV1_RHISN/76-214-LVATVR.....GP...AMPIKWIGR.HVY------R.-----------------------RSGPMWHKNV.VPVRIAR-
A8LKB8_DINSH/19-167-LIVTRS.....DG...LQPLRHILR.TRV------S.-----------------------LAEMRADPAL.APIRLTP-
Q5LN78_RUEPO/204-343-TVIVAS.....GE...AVPVLHRVS.RTM------..-----------------------....PAFGSS.RPLTIRR-
C5AQV5_METEA/69-209-LAVTAS.....GT...LRPITWIGN.RAL------D.-----------------------AKGEALPHNE.QPIRIRA-
D5AV22_RHOCB/442-581-LVVTRD.....RG...AVPVLWSGG.RSL------E.-----------------------AADLAAEPGL.LPVAIRE-
Q2YL23_BRUA2/15-148-LVTTVS.....GE...CLPIKWIGW.QNY------R.-----------------------AGEADWNESV.MPIRVRR-
Q3J294_RHOS4/14-159-RIVTRD.....NG...LQPLRWISR.RRL------D.-----------------------HATLAAFPHL.KPVLIEK-

PF01079

Q7PXI1_ANOGA/295-503-RVQA...VD.AAGRTVFSEVLMFMD-RDT......HQRREFVTIEAEGG-----------.ALLKVTPA--HLVMVWR-
HH_DROPS/255-475-RVLS...MG.SNGQPVYSEVILFMD-RNL......EQMQNFVELHTDGG-----------.AVLTVTPA--HLISVWH-
IHH_DANRE/187-398-LVLASEGSD.GTGDLIYSEVLTFLD-RRP......ITQKHFYVIRTEDG-----------.ASVSLTAA--HLLFMRV-
TWHH_DANRE/190-403-RVLA...AD.EKGNVLISDFIMFID-HDP......TTRRQFIVIETSEP-----------FTKLTLTAA--HLVFVGN-
WRT4_CAEEL/327-547-WVQA...LDKNGSQVTFIPVQYWLH-RDP......KQVADFVEFTLDNG-----------.ETFSLTEK--HLVFVTQ-
Q80XI9_MOUSE/230-435-RVLA...MG.EDGTPTFSDVLIFLD-REP......NRLRAFQVIETQDP-----------PRRLALTPA--HLLFIAD-
WRT6_CAEEL/375-583-KVLS...MD..EAFVTYSPVIMFLH-KRD......EEIAEFNLIETANG-----------.HSIKLTDN--HLIYVSD-
A8X447_CAEBR/327-545-WVQA...FEKNGETVTHVPVQYWIH-RDQ......TQKATFIEFSLDNG-----------.EKFSLTEK--HMVYVSQ-
IHH_CHICK/188-394-RVLA...MD.GAGRPTYSDFLAFLD-KEP......RALTAFHVIETRQP-----------PRRLALTPT--HLLFVAD-
SHH_CHICK/190-411-RVLA...AD.ADGRLLYSDFLTFLD-RMD......SSRKLFYVIETRQP-----------RARLLLTAA--HLLFVAP-
SHH_DANRE/187-404-KVLA...AD.SAGNLVFSDFIMFTD-RDS......TTRRVFYVIETQEP-----------VEKITLTAA--HLLFVLD-
WRT8_CAEEL/325-538-WVQA...LH..GKETTYSPVKYWLH-RDP......EQEAEFVEFLLENG-----------.ESFTLTEK--HLVFATD-
DHH_HUMAN/188-396-WVLA...AD.ASGRVVPTPVLLFLD-RDL......QRRASFVAVETEWP-----------PRKLLLTPW--HLVFAAR-
Q175B3_AEDAE/201-412-QVLS...VD.SSGNTVYSEVIMFMD-RDT......HQSREFVHIEADGG-----------.AHLTVTPA--HLVMVWQ-
O45992_CAEEL/258-471-WVEA...LDENGEDITFLPVKYWLH-RDP......EQEAEFLEFSLDNG-----------.ETFTLTEK--HLVYTTE-
B0S8K0_DANRE/187-399-KVLASSESD.GSGTLVYSEVIAFLD-RDP......SARKQFFTIETDSG-----------.AKLSLTAA--HLLFVSE-
B3DJ46_DANRE/191-442-KVLS...VS.GSGEVVFSRVLLFLH-LDR......ESRTSFFIITTENE-----------.KRIALTPN--HLIFAAH-
HH_DROMO/248-470-RVLS...MD.TKGQPVYSEVILFMD-RNL......EQVQNFVQLHTDGG-----------.AVLTVTPA--HLIAVWQ-
C3ZGW9_BRAFL/224-434-KVLS...MD.SGGHPVFSEVLTFMD-RDS......RGPWVYYTIHTDDR-----------NITVTATPS--HLVFVTE-
D6WCL7_TRICA/146-345-KIQA...LDPSTNELVFSEVLLFLD-YNP......SQRRQFLHITLASG-----------.RTLTVTPS--HLLVLDD-
F6WZB6_XENTR/191-398-RVLA...MD.DSGRPTFSDFLSFLD-HHP......KEEHVFQVIKTQDP-----------HRQLFLTPA--HLIFVSD-
F6XBS5_CIOIN/294-549-QVLA...ID.KSGAVITDTFLSFMD-ARSDIVSGHQAYRQMVEITTENG-----------.FSVTLTRN--HLIYVSK-
F6YTG6_XENTR/190-394-TVFT...TD.ETGQLIPSVVLLFLH-RDL......YKTATFVLIEAEGH-----------TSKLLVTPN--HLLFIKR-
G3V6T0_RAT/188-423-RVLA...AD.DQGRLLYSDFLTFLD-RDE......GAKKVFYVIETREP-----------RERLLLTAA--HLLFVAP-
H2U1Q8_TAKRU/190-435-RVMA...LS.ETGQVVFSPVLLFLH-RDP......ESRWRFLSLQTEDG-----------.RRLAVTPH--HLVFSDA-
H2V9H2_TAKRU/190-402-RVLA...AD.DDGNPTYTDFIMFVD-RDS......TTRRLYHVIETDSG-----------.QKITLTAA--HLLYVAR-
H2XUY9_CIOIN/97-305-RILA...VDRTTGKPVFSEVIMFLD-KQP......EIGGSYIEIRSQL.-----------.ETIRLTAN--HMLFIAT-
W4Y925_STRPU/189-401-EVAV...VN.DDGALDYSDVIMIVH-RKL......NDSTLFYVIETEDK-----------.SVVQLTPQ--HLIYVSE-
W5K3H2_ASTMX/187-406-SVLA...AD.ESGNLVYSDFIMFTD-RDP......STRRVFYVIETKAP-----------VQKITLTAA--HLIFILN-

PF05203

U7Q1H8_SPOS1/262-759-HVMGKD-----GT---PRMVMGLPR-GTETMYKVSMKT.QHRNENAR.............LASFVCNAS--HLLVVVTP
Q6FQS3_CANGA/285-698-KVMGQD-----GK---PRNVTALPR-GYDDMYNVELDG........ET............DLSYTCNSN--HTLVLKTE
A3LP04_PICST/283-730-EVLGKD-----GL---PREVVALPR-GRETMYEVSEKT.QHRAETVFG............TASYTCNAT--HKLVLQTN
J7RJ26_KAZNA/284-757-KVMGKD-----GS---PRTVVGFAP-RVRTYVRRAATRRPRLGDAVHL..................SGN--HRLVLRTE
C5M9I6_CANTT/244-713-KVMGKD-----GM---PREVVGLPR-GYDDMYKVRQLSSTRRNAKSEG............LMDFTVSAD--HKLILKTK
Q6CL64_KLULA/284-692-EVMGRD-----GL---PRQVVGLPR-GHDDMYQVTEKSEDNETA................KISFQCNSS--HKLVLVTP
B6JY11_SCHJY/285-759-KVMGKD-----GR---PRDVVALPR-GFDTMYTVSQKISRKGAKSSN.............NLSYTCNAT--HKLVLKTP
Q6BRM0_DEBHA/283-675-SVLGKD-----GE---ARNVVALPR-GNETMYEINESTPEEEADLA..............RIAFTCNAK--HELVVNTK
A5DXZ0_LODEL/280-699-LVMGKD-----GD---ARKVVGLPR-GFDTMYKVEQIGHDD...................SLNFTVSAD--HKLVLKTE
H2APW1_KAZAF/284-774-KVMGKD-----GT---PRTVIGLPR-GRETMYQVRHMTSKRSSDEAFG............SMDYVCSAN--HKLVLRTP
G7E5L8_MIXOS/284-742-EVMGKD-----GC---GRVVVGLPR-GVETMYDVAAIG.QHHNQAENG............LLNFTCNAS--HKLVVCTP
F2TVI8_SALR5/1497-1695-KLMGDD-----GT---PRNVQHVVT-GLSRLYEVTVAS.........S...........DVEPLVVTGN--HILCLKPS
U9UGV8_RHIID/409-843-QIMGDD-----DN---PRTIQSTTK-GEGIMYRIIPND.KGPAKF..................FECNDQ--HILVLKFA
C5DTL5_ZYGRC/284-732-EVMGKD-----GK---PREVVRTPS-GREKMYKVSHKT.AHRAHKSDSTSE......RFGLFEYTCNAT--HKLVVRTS
G8JWX2_ERECY/284-671-YVMGQH-----GQ---SQEVMALPR-GREVMYTVKDVSSKH.....................AYVCNAS--HKLVVETP
A7TLB5_VANPO/284-715-LVMGQD-----GQ---PREVTQLPR-GSDKMYKVNEINENSTSE................LFSFVCNAT--HQLIVRTP
VATA_YEAST/284-736-KVMGKD-----GR---PREVIKLPR-GRETMYSVVQKS.QHRAHKSDSSRE......VPELLKFTCNAT--HELVVRTP
M3K3J1_CANMX/284-733-KVLGKD-----GL---PREVVGLPR-GREVMYDVVQKT.QHQADTVDG............AISYTCNST--HKLVVRTN
G0V8Z3_NAUCC/284-799-QVMGKD-----GA---PRTVIALPR-GTETMYEVCHTT.QHRNGNEKF...........GLMNYVCSGN--HKLVLRTP
C5DTQ4_ZYGRC/1-463-MVMCED-----GS---SAKVTSVAR-DVQTTYQILQKT.KHRANEGEAAEKDPLRREIHHRLGFQCSVA--HELALRTS
E9CG65_CAPO3/761-1238-RVLGAD-----GR---SLPVKRTMA-GRDAMYKISIVTPPESKAQRKDAEW......QPSESGFTCNSR--HDLVLACP
G0W3J0_NAUDC/284-783-QVMGKD-----GN---PRTVIALPR-GKETMYEVCHIT.PHRTTSGENF..........GVMDYVCSGN--HKLVLRTP
G8ZLC3_TORDC/1-463-YVLCAD-----GT---IDRVTSISQ-DVQTTYQILQKT.KHRANEGEPGREDPMRRQVFHRLGFKCTVA--HKLPLRTA
G8BNB8_TETPH/284-799-QVMGKD-----GA---PRSVVGLPR-GQKTMYHVKHTTQHKKSDQEVG............LMDYVCSGN--HKLVLRTP

PF07591

A3DGR7_CLOTH/105-234-KVIATNLETFEVA---EKTVLETYV-RET------TELLHLTING....-----------.EVIKTTFE--HPFYVKD-
Q5F6G7_NEIG1/1-137-RVLSKDEASGKTG---YKPVTAQYG-NPY------QETVYIKVSDGIGN-----------SQTLISNRI--HPFYSD.-
Q9K122_NEIMB/1-137-RVFAKDEASGKTG---YKPVTARYG-NPY------QETVYIEISDGIGN-----------NQTLISNKI--HPFYSQ.-

PF14890

DPOL_THEAG/860-1392TEVLEVD----------....NIFAFSLNKESKKSEIKKVKALIRHKYKGE..AYEVELNSGRKIHITRG--HSLFTIRN
D5VTT2_METIM/75-563.KVLSAN----------FEDLKLYS...............KKIKKFKHKAPKILYKIKTTFSELI.TTGE--HRLFVVEN
B7R5G0_9EURY/317-755YNRWGID----------VSSVPIYVKSFDPETGEVVRGRVKAIWRYELGEKVTKYNIKTNKGTRILTSPW--HPFFVLNP
DNAB_NOSS1/393-817FAIWALN----------QATLKLEK...............AIVSNAFSTGVKPVFTLTTRKGCKIRATAN--HKFLTIHG
I3RCL0_9EURY/841-1358TEVLETK----------....NIMAISFDRKTKTSRVKPIKAVIRHSYSGN..IYKIKLTSGRTIKITHG--HSLFVFRN
GLMS_METJA/76-570.EVLSVN----------FEDLKLYN...............KKIKKFKHKAPKILYKIKTAFSELI.TTGE--HKLFVVEN
DNAB_SYNY3/385-809FEIWAIN----------EQTMKLES...............AKVSRVFCTGKKLVYILKTRLGRTIKATAN--HRFLTIDG
Q9UYA0_PYRAB/317-700YNRWGID----------VSSVPIYVKSFDPETRRVVKGRVRAIWKYELGEEIPKYEIRTHKGTKILTSPW--HPFFVLTP
DPOL_THEKO/857-1388TEVLEVS----------....GLEVPSFNRRTKKAELKRVKALIRHDYSGK..VYTIRLKSGRRIKITSG--HSLFSVRN
I6TV89_9EURY/317-755YNRWGID----------VSNVPIYVKSFDPESKRVVKGKVNVIWKYELGKDVTKYEIITNKGTKILTSPW--HPFFVLTP
NDRZ_PYRFU/317-755YNRWGID----------VSNVPIYVKSFDPESKRVVKGKVNVIWKYELGKDVTKYEIITNKGTKILTSPW--HPFFVLTP
F6BAJ4_METIK/76-570.EVLSVN----------FEDLKLYN...............KKIKKFKHKAPKILYKIKTAFSELI.TTGE--HKLFVVEN

PF10596

I3L3Z8_HUMAN/86-244-NNYRTDMIQALGGVEGILEHTLFKG-TYF......PTWEGLFWEK.............ASGFEESM.KW--KKLTNAQ-
A2EY65_TRIVA/1432-1590-KDYRADVIQALGGVEGILSHSIFKA-TGY......KHWEGLFWDN.............TTGFEEAL.KY--RKLTNAQ-
A8BTS5_GIAIC/1337-1490-QGYKKIITAIFGGVEEILHHTLYPA-TDF......SDYKSVVWST.............ATEHETGLAKR--TNLTRAR-
S3BP74_OPHP1/1452-1610-QAYRTDVIQALGSVETILAHTLFAA-TGF......TSWEGLFWEK.............ASGFEQSI.AA--KKLTNAQ-
Q8SVU6_ENCCU/1239-1384-ERFTLDTLEALGGVGGIADHTLFGA-TYF......RSFSKVFWED.............MV....VE.KY--RKLTNAQ-
Q5KPW2_CRYNJ/1640-1796-................KLDTTLLRI-NSIELEDEPTKWSGFVVDKDSLYLRHDYLVLHNSGFEESM.KN--KRLTNAQ-
K7VI98_MAIZE/675-841-NNYRTDVIQALGGVQGILEHTLFKG-TYF......PTWEGLFWEK.............ASGFEESM.KY--KKLINAQ-
G0W883_NAUDC/1515-1673-NSYRTDVIQALGGIETILEHTLFKG-TGF......TSWEGLFWEK.............ASGFEDSL.QF--KKLTHAQ-
E6ZWZ5_SPORE/1485-1643-NQLRTDTIAALGGVETILEHSLFAA-TGH......PTWEGLFWEK.............SSSFEESM.QQ--KRLTNAQ-
Q00RU5_OSTTA/1516-1682-NNYRTDVIQALGGVEGILEHTLFKG-TYF......PTWEGLFWEK.............ASGFEQSM.QY--KKLTNAQ-
E9AFM0_LEIMA/1514-1674-ERYRADMNNALGGVEAILEHSLFKG-TGF......PSWEGIEFDR.............SGGFENSK.KD--TKLAKQQ-
R0KWQ9_NOSB1/1205-1354-DRYKDSITSYLGGPSLILKHTLFKA-TFS......KIFSKLFWDD..................SYL.SL--KTNTFAQ-

PF14623

Q237Q6_TETTS/509-673----------------...-------------------------------------------------------------
Q7S708_NEUCR/636-832----------------..K-------------------------------------------------------------
H6C7V0_EXODN/356-526----------------...-------------------------------------------------------------
J3PIM9_GAGT3/593-786----------------.GG-------------------------------------------------------------
G2XFI4_VERDV/568-734----------------..K-------------------------------------------------------------
G1XIH1_ARTOA/537-708----------------...-------------------------------------------------------------
U7PS73_SPOS1/521-692----------------..T-------------------------------------------------------------
C7YL43_NECH7/586-752----------------..K-------------------------------------------------------------
R8BIW3_TOGMI/471-637----------------..K-------------------------------------------------------------
C5GK44_AJEDR/553-713----------------...-------------------------------------------------------------
S8AB86_DACHA/542-713----------------...-------------------------------------------------------------
S3CBE6_OPHP1/613-780----------------..A-------------------------------------------------------------
G3JM09_CORMM/336-505----------------..V-------------------------------------------------------------
C5FLY1_ARTOC/540-711----------------...-------------------------------------------------------------
F0UB99_AJEC8/548-714----------------...-------------------------------------------------------------
G0QP70_ICHMG/545-705----------------...-------------------------------------------------------------
I7M030_TETTS/514-676----------------...-------------------------------------------------------------
M7TBR0_EUTLA/533-699----------------..G-------------------------------------------------------------
C1G4L4_PARBD/546-712----------------...-------------------------------------------------------------
N4VVV8_COLOR/552-719----------------.GN-------------------------------------------------------------
F2SQT7_TRIRC/537-709----------------...-------------------------------------------------------------
Q24C76_TETTS/502-665----------------...-------------------------------------------------------------
D2VHB8_NAEGR/586-749----------------...-------------------------------------------------------------
G9MP19_HYPVG/551-718----------------..K-------------------------------------------------------------
T0JQ14_COLGC/569-736----------------.GK-------------------------------------------------------------
J4WBA6_BEAB2/688-856----------------..I-------------------------------------------------------------
I7M701_TETTS/604-769----------------...-------------------------------------------------------------
F7VWE7_SORMK/571-774----------------.GK-------------------------------------------------------------
L8X395_THACA/606-772----------------...-------------------------------------------------------------
E4UR10_ARTGP/540-711----------------...-------------------------------------------------------------
Q2GTB7_CHAGB/570-754----------------.GG-------------------------------------------------------------
E3QU32_COLGM/508-676----------------.GK-------------------------------------------------------------
G0RIM5_HYPJQ/574-741----------------..K-------------------------------------------------------------
Q22N58_TETTS/494-660----------------...-------------------------------------------------------------
A9UVU8_MONBE/587-772----------------...-------------------------------------------------------------
I1RVJ3_GIBZE/578-742----------------..K-------------------------------------------------------------
E9EQB7_METAR/534-699----------------..K-------------------------------------------------------------
J4URQ4_BEAB2/478-645----------------..K-------------------------------------------------------------
G4NA23_MAGO7/558-749----------------DGA-------------------------------------------------------------

PF13403

Q1GGP9_RUEST/27-173--------------------------------------------------------------------------------
Q1GES6_RUEST/157-304--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
Q5LPM0_RUEPO/507-646--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
Q1GGN0_RUEST/194-341--------------------------------------------------------------------------------
Q5LSZ7_RUEPO/803-941--------------------------------------------------------------------------------
Q5LPJ7_RUEPO/175-322--------------------------------------------------------------------------------
Q1GMQ5_RUEST/293-432--------------------------------------------------------------------------------
Q5LLZ7_RUEPO/144-282--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
Q5LMP8_RUEPO/160-307--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
Q1GMV1_RUEST/833-976--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
Q5LUZ7_RUEPO/68-216--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
Q5LN78_RUEPO/204-343--------------------------------------------------------------------------------
C5AQV5_METEA/69-209--------------------------------------------------------------------------------
D5AV22_RHOCB/442-581--------------------------------------------------------------------------------
Q2YL23_BRUA2/15-148--------------------------------------------------------------------------------
Q3J294_RHOS4/14-159--------------------------------------------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503----------------RER-------------------------------------------------------------
HH_DROPS/255-475----------------PER-------------------------------------------------------------
IHH_DANRE/187-398----------------GNC-------------------------------------------------------------
TWHH_DANRE/190-403----------------SSA-------------------------------------------------------------
WRT4_CAEEL/327-547----------------CSV-------------------------------------------------------------
Q80XI9_MOUSE/230-435----------------NHT-------------------------------------------------------------
WRT6_CAEEL/375-583----------------CRT-------------------------------------------------------------
A8X447_CAEBR/327-545----------------CE.-------------------------------------------------------------
IHH_CHICK/188-394----------------NAS-------------------------------------------------------------
SHH_CHICK/190-411----------------QHN-------------------------------------------------------------
SHH_DANRE/187-404----------------NST-------------------------------------------------------------
WRT8_CAEEL/325-538----------------CQQ-------------------------------------------------------------
DHH_HUMAN/188-396----------------GPA-------------------------------------------------------------
Q175B3_AEDAE/201-412----------------KNE-------------------------------------------------------------
O45992_CAEEL/258-471----------------CRQ-------------------------------------------------------------
B0S8K0_DANRE/187-399----------------GNC-------------------------------------------------------------
B3DJ46_DANRE/191-442----------------NLK-------------------------------------------------------------
HH_DROMO/248-470----------------AER-------------------------------------------------------------
C3ZGW9_BRAFL/224-434----------------SRD-------------------------------------------------------------
D6WCL7_TRICA/146-345----------------RT.-------------------------------------------------------------
F6WZB6_XENTR/191-398----------------NYS-------------------------------------------------------------
F6XBS5_CIOIN/294-549----------------PTY-------------------------------------------------------------
F6YTG6_XENTR/190-394----------------SLS-------------------------------------------------------------
G3V6T0_RAT/188-423----------------HND-------------------------------------------------------------
H2U1Q8_TAKRU/190-435----------------HCG-------------------------------------------------------------
H2V9H2_TAKRU/190-402----------------NGT-------------------------------------------------------------
H2XUY9_CIOIN/97-305----------------QTN-------------------------------------------------------------
W4Y925_STRPU/189-401----------------TES-------------------------------------------------------------
W5K3H2_ASTMX/187-406----------------NST-------------------------------------------------------------

PF05203

U7Q1H8_SPOS1/262-759QHIRKTTHVLRGKKM.TSV-------------------------------------------------------------
Q6FQS3_CANGA/285-698QNVLLAG.........NTV-------------------------------------------------------------
A3LP04_PICST/283-730QRVNITNHVLRGESQ.TSV-------------------------------------------------------------
J7RJ26_KAZNA/284-757QKIQLREHTLEGRKY.TNV-------------------------------------------------------------
C5M9I6_CANTT/244-713QDVKIATRKIGGNTY.TGV-------------------------------------------------------------
Q6CL64_KLULA/284-692QDIRLTESKEK.....VTV-------------------------------------------------------------
B6JY11_SCHJY/285-759QQISLVEQVVRGKKQ.SSV-------------------------------------------------------------
Q6BRM0_DEBHA/283-675QDIAVEQ.........NCV-------------------------------------------------------------
A5DXZ0_LODEL/280-699QRIEVTTRKFAGKNY.AAV-------------------------------------------------------------
H2APW1_KAZAF/284-774QRVILDSYELNNQKY.TTV-------------------------------------------------------------
G7E5L8_MIXOS/284-742QHVRLTDHMLGQKMQ.TSV-------------------------------------------------------------
F2TVI8_SALR5/1497-1695AHLSVDEQQ.......EEV-------------------------------------------------------------
U9UGV8_RHIID/409-843AEPYMRSEEIPIINRSPRI-------------------------------------------------------------
C5DTL5_ZYGRC/284-732RSCRPLVRNIQGTDY.VEV-------------------------------------------------------------
G8JWX2_ERECY/284-671SSIKVSSQ...SGGI.LSV-------------------------------------------------------------
A7TLB5_VANPO/284-715RNIKVQTRIIDGIEC.NEI-------------------------------------------------------------
VATA_YEAST/284-736RSVRRLSRTIKGVEY.FEV-------------------------------------------------------------
M3K3J1_CANMX/284-733QKVNMTNHVLRNEPQ.TSV-------------------------------------------------------------
G0V8Z3_NAUCC/284-799QLIRTTIHELRGKHY.TSV-------------------------------------------------------------
C5DTQ4_ZYGRC/1-463MKPSVENCFKRNH...FKV-------------------------------------------------------------
E9CG65_CAPO3/761-1238HIDTVHVHHDAASRT.FTV-------------------------------------------------------------
G0W3J0_NAUDC/284-783QNVTLTTHELDGQTY.TNV-------------------------------------------------------------
G8ZLC3_TORDC/1-463SKPTLENSFKRNN...FKV-------------------------------------------------------------
G8BNB8_TETPH/284-799QLISTATNRLNGKLY.TSV-------------------------------------------------------------

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------
Q9K122_NEIMB/1-137--------------------------------------------------------------------------------

PF14890

DPOL_THEAG/860-1392.GKIKEIWGEEVKVGDLII..VPKKVKLNEKEAVINIPELISKLPDEDTADVVMTTPVKGRKNFFKGMLRTLKWIFGEES
D5VTT2_METIM/75-563.GKIVEKCVKDLNGNELIG..IVRKLNFNFNNGV.............KFKDVSVEKHYKLDESVRNELRKV.....REKL
B7R5G0_9EURY/317-755DFKVVEKRADELSEGDMLVGGMP........................EDDN.............................
DNAB_NOSS1/393-817.....WRRLDELSIRQHLC..LPRHI.....................PSFD.............................
I3RCL0_9EURY/841-1358.GDLIEVKGEEVREGDLIA..VPMRIKLPEKPERINIVEILLSLPPEETSDVTMTIPIKGRENFFNEMLRTLRWIFGEE.
GLMS_METJA/76-570.GKIVEKCVKDLNGSELIG..VVRKLNYSFNDNV.............EFKDVYVERHYKLDETIRNKLRKV.....REKL
DNAB_SYNY3/385-809.....WKRLDELSLKEHIA..LPRKL.....................ESSS.............................
Q9UYA0_PYRAB/317-700DFEVIEKRADELKVGDILIGGMP........................DGED.............................
DPOL_THEKO/857-1388.GELVEVTGDELKPGDLVA..VPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEE.
I6TV89_9EURY/317-755DFKIVEKRADELKEGDILIGGMP........................DGED.............................
NDRZ_PYRFU/317-755DFKIVEKRADELKEGDILIGGMP........................DGED.............................
F6BAJ4_METIK/76-570.GKIVEKCVKDLNGNELIG..IVRKLNYNFNDSV.............EFKDVYVERHYKLDETIRNKLRKV.....REKL

PF10596

I3L3Z8_HUMAN/86-244--------------------------------------------------------------------------------
A2EY65_TRIVA/1432-1590--------------------------------------------------------------------------------
A8BTS5_GIAIC/1337-1490--------------------------------------------------------------------------------
S3BP74_OPHP1/1452-1610--------------------------------------------------------------------------------
Q8SVU6_ENCCU/1239-1384--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1796--------------------------------------------------------------------------------
K7VI98_MAIZE/675-841--------------------------------------------------------------------------------
G0W883_NAUDC/1515-1673--------------------------------------------------------------------------------
E6ZWZ5_SPORE/1485-1643--------------------------------------------------------------------------------
Q00RU5_OSTTA/1516-1682--------------------------------------------------------------------------------
E9AFM0_LEIMA/1514-1674--------------------------------------------------------------------------------
R0KWQ9_NOSB1/1205-1354--------------------------------------------------------------------------------

PF14623

Q237Q6_TETTS/509-673------------------------K..WLFPTDIAP.........TKMAQCSSVYSFLLESG................HS
Q7S708_NEUCR/636-832------------------------D..WAFPTDVALG........DYVSYTGDIYSVLLSADSDVDA...........HA
H6C7V0_EXODN/356-526------------------------S..WVFPQDVAE.........TTESCRSSVFSVLLAPSRDPAD...........HA
J3PIM9_GAGT3/593-786------------------------G..WAFPADMAEA........RPALYTGSVFSVLLEPDPRPRA...........HA
G2XFI4_VERDV/568-734------------------------S..WGFPAQMAD.........SAVRYTGCIYSVVLQPDRDPAA...........HA
G1XIH1_ARTOA/537-708------------------------A..WRFPSDILQ.........PEEVECEAVYSVLMMPSPYVED...........HS
U7PS73_SPOS1/521-692------------------------K..WVFPCRDPVANKK.....TTVRYTGSIYSVLLQPDEDADS...........HA
C7YL43_NECH7/586-752------------------------R..WSFPANAAE.........GVVLYTGCVYSVLLERDRNSSA...........HA
R8BIW3_TOGMI/471-637------------------------S..WAFPSDIAD.........GAVRYSGAIYSILLQKDRQVDA...........HA
C5GK44_AJEDR/553-713------------------------D..WMFPSDVSE.........RNIPFSGKVYSILLDSSPDSDA...........HA
S8AB86_DACHA/542-713------------------------E..WKFPADVVV.........PKMEACEAVYSVLLLPSPYVDA...........HT
S3CBE6_OPHP1/613-780------------------------D..WVFPCKDKARRD......TPVRYTGSIYSILLEEDEDVDA...........HA
G3JM09_CORMM/336-505------------------------A..WYFPVHLTV.........DPIMYTGDVYSVLLEADGSPFA...........HT
C5FLY1_ARTOC/540-711------------------------R..WSFPFNVANG........DVHTFSGNIYSVLLEPDSNPNA...........HA
F0UB99_AJEC8/548-714------------------------D..WIFPSHVSE.........QNVPFSGTVYSVLLDPSPVSDA...........HA
G0QP70_ICHMG/545-705------------------------K..WIKPDQIEK.........AQLIKCDSVYNFVLDKG................HN
I7M030_TETTS/514-676------------------------E..WKYPKELGQ.........TVVKTSDYIYQFVLKTG................HT
M7TBR0_EUTLA/533-699------------------------K..WAFPADVAE.........KRVKYSGAVYSLLLQDHDNVDA...........HA
C1G4L4_PARBD/546-712------------------------G..WVFPSSVSN.........HNTPFTGTVYSVLLDPSPNSDA...........HA
N4VVV8_COLOR/552-719------------------------T..WVFPAHVAD.........RPVSYTGCIYSVLLQPDGDAKA...........HA
F2SQT7_TRIRC/537-709------------------------A..WEFPFNITKE........HLQSFSGDIYSVLLEPDSNPEA...........HA
Q24C76_TETTS/502-665------------------------E..WIYPNKMGE.........VQQKQSDFIYQFVLKSG................HT
D2VHB8_NAEGR/586-749------------------------E..WKFPIDIKS.........PQDVACDYVYNLVVDQG................HV
G9MP19_HYPVG/551-718------------------------N..WDFPANMSD.........TPVLYSGFIYSVLLQPDRRADA...........HA
T0JQ14_COLGC/569-736------------------------S..WVFPANVAL.........RPVRYTGCIYSVLLQPGRDASA...........HA
J4WBA6_BEAB2/688-856------------------------A..WGFPVHLTV.........DPIMYTGDVYSILLEVDRRPFA...........HT
I7M701_TETTS/604-769------------------------I..WQFPCQLKP.........TELRECDFIYSFLLESG................HS
F7VWE7_SORMK/571-774------------------------G..WVFPMDVAHG........DTVSYTGDMHSVLLKNDPDVDA...........HA
L8X395_THACA/606-772------------------------S..WVFPTQIQQ.........AKLLACNYVYSVLLEPSSDSES...........HA
E4UR10_ARTGP/540-711------------------------K..WEYPINMTNG........DAQAFSGNIYSVLLEPDSNPDA...........HA
Q2GTB7_CHAGB/570-754------------------------K..WVFPRDHAA.........RSVRYTGAVYSVLLERDEEPDA...........HA
E3QU32_COLGM/508-676------------------------T..WAFPASVADR........RSVRYTGCVYSVLLQPDRDAAA...........HA
G0RIM5_HYPJQ/574-741------------------------G..WDFPASMSD.........DAVLYTGSIYSVLLQPDRRPDA...........HA
Q22N58_TETTS/494-660------------------------EQQWQFPSSLGQ.........TIFEQADAVYSFLLEDG................HS
A9UVU8_MONBE/587-772------------------------TKRWAFPSELVV.........PKRHASEYMYSFVLTAG................GE
I1RVJ3_GIBZE/578-742------------------------R..WDFPANEAT.........AVVMYTGCIYSILLERDASVAA...........HA
E9EQB7_METAR/534-699------------------------A..WDFPAFLAD.........GTVRYTGSVYSVMLQRDRNSQS...........HA
J4URQ4_BEAB2/478-645------------------------A..WTFPAYTAD.........GAVRYTGAVYSVMLQRDRSPDA...........HA
G4NA23_MAGO7/558-749------------------------E..WMFPAAAAAASGRDDGSVSTITYSGFIYSLLLEAEALPDGTKQDPVSAAEQHA

PF13403

Q1GGP9_RUEST/27-173---------------------------------------------GALGNGLPERDMMVSPN----------------HR
Q1GES6_RUEST/157-304---------------------------------------------GALGIDRPERELLVSPE----------------HR
A1AYR4_PARDP/380-527---------------------------------------------EALGERLPERDLIVSPQ----------------HR
A8LN65_DINSH/175-322---------------------------------------------GALGPGRPARDMRVSRQ----------------HR
A1B4V8_PARDP/356-503---------------------------------------------GALGKGLPVADLLVSPQ----------------HR
A8LKN9_DINSH/122-260---------------------------------------------DALGS...DRPLYVSPQ----------------HR
Q28WJ0_JANSC/241-379---------------------------------------------GALGN...TRALTVSPE----------------HR
Q5LPM0_RUEPO/507-646---------------------------------------------TLLQG..ASAPLLVSPQ----------------HR
Q28L14_JANSC/1268-1415---------------------------------------------GALGPGVPNRDMEVSPQ----------------HR
Q1GGN0_RUEST/194-341---------------------------------------------DALAPGCPKRRLKVSPQ----------------HR
Q5LSZ7_RUEPO/803-941---------------------------------------------GVLKN...TRDLLVSPN----------------HR
Q5LPJ7_RUEPO/175-322---------------------------------------------DALGPSCPHRTLWVSPQ----------------HR
Q1GMQ5_RUEST/293-432---------------------------------------------NALGH...HGQIALSPN----------------HR
Q5LLZ7_RUEPO/144-282---------------------------------------------GVLGN...FRDLYVSQQ----------------HR
A8LR09_DINSH/158-296---------------------------------------------GVLGA...AAPLRVSPQ----------------HR
C7JHN5_ACEP3/423-565---------------------------------------------DAIANGVPYKDMLITAE----------------HC
Q28SX3_JANSC/168-306---------------------------------------------GAIGN...TRRLRVSRQ----------------HR
A8LK48_DINSH/203-343---------------------------------------------GSLGPNQPAARLVVSPQ----------------HR
Q5LMP8_RUEPO/160-307---------------------------------------------HSFAPSIPTHPLLLSQQ----------------HR
Q28UB5_JANSC/126-273---------------------------------------------DALGPGMPARELRVSPQ----------------HR
Q1GMV1_RUEST/833-976---------------------------------------------GGIIA..NDRAMLVSPQ----------------HR
A5FZD4_ACICJ/193-329---------------------------------------------GALADGVPARDLVVSPD----------------HA
B9JK11_AGRRK/201-336---------------------------------------------GSIAENVPERDLLISPD----------------HC
Q28TH9_JANSC/752-887---------------------------------------------GVLGN...TRKMLVSRQ----------------HG
A5G1S8_ACICJ/159-294---------------------------------------------HAIADNVPARDLVVSPD----------------HA
B0T7Q3_CAUSK/153-288---------------------------------------------GAFADGVPSRDLRLSPG----------------HA
C7JE32_ACEP3/536-676---------------------------------------------DALAGGVPHHDLLVTPE----------------HC
B8IA31_METNO/149-285---------------------------------------------GSLADGTPARDLWVSPK----------------HA
A5G006_ACICJ/174-309---------------------------------------------GAIDDGLPERTLYLSPD----------------HA
A5FW80_ACICJ/285-421---------------------------------------------GSMADGVPARRLRLSPD----------------HA
A8LLK3_DINSH/164-305---------------------------------------------GALGPGCPARPLWLSRQ----------------HR
Q5FQG8_GLUOX/285-425---------------------------------------------GALADGIPSRDLLVTPE----------------HC
B0UJT1_METS4/116-254---------------------------------------------DAFGPGKPAQDLLVSPA----------------HA
Q5LUZ7_RUEPO/68-216---------------------------------------------DAFGMQRPMSGVIAGPS----------------AR
Q0BS96_GRABC/3687-3823---------------------------------------------GALDGVLPKRDLLVSPL----------------HA
B1M2P7_METRJ/65-199---------------------------------------------SALHEGVPARDLLVSPD----------------HA
A5FVL4_ACICJ/410-545---------------------------------------------DAFGVGQPCRDLYLSPD----------------HA
A4YQ57_BRASO/106-246---------------------------------------------SALGPDIPKRDLYVTQG----------------HA
A5FWA2_ACICJ/1192-1328---------------------------------------------GAFGPCMPSHPLTLSPL----------------HA
C3KQV1_RHISN/76-214---------------------------------------------LAIDGQRPHKDLYLSAG----------------HA
A8LKB8_DINSH/19-167---------------------------------------------RALGPLMPVRSLALAPD----------------HP
Q5LN78_RUEPO/204-343---------------------------------------------PYFGL...RQDIQAAPS----------------QR
C5AQV5_METEA/69-209---------------------------------------------GAFGPGLPARDLRLSHG----------------HP
D5AV22_RHOCB/442-581---------------------------------------------NALGR...HGALLLSPQ----------------HA
Q2YL23_BRUA2/15-148---------------------------------------------HALDGRTPHRDLYLSPN----------------HA
Q3J294_RHOS4/14-159---------------------------------------------GSLGPDLPDRDMMVSPN----------------HR

PF01079

Q7PXI1_ANOGA/295-503------------------------SET........................RFVFADRVREG----------------DH
HH_DROPS/255-475------------------------QQL........................DYVFADRVEEL----------------NY
IHH_DANRE/187-398------------------------SNRGEPKP................GAVRTIFASDAQVG----------------QC
TWHH_DANRE/190-403------------------------ASGI.......................TATFASNVKPG----------------DT
WRT4_CAEEL/327-547------------------------PYSEDENI.................NANPVPAERVNIG----------------DC
Q80XI9_MOUSE/230-435------------------------EPAAHF.....................RATFASHVQPG----------------QY
WRT6_CAEEL/375-583------------------------RSDL.......................KLVAAKEVKMD----------------DC
A8X447_CAEBR/327-545------------------------NNNYVEGI.................NSNAVPAEKVNVG----------------DC
IHH_CHICK/188-394------------------------APAAQF.....................RPTFASHVQPG----------------HF
SHH_CHICK/190-411------------------------QSEATGST.................SGQALFASNVKPG----------------QR
SHH_DANRE/187-404------------------------EDLHTM.....................TAAYASSVRAG----------------QK
WRT8_CAEEL/325-538------------------------NVKNLDD...................LNPTSTGKINIG----------------EC
DHH_HUMAN/188-396------------------------PAPGDF.....................APVFARRLRAG----------------DS
Q175B3_AEDAE/201-412------------------------GKS........................LYLFADRIQEG----------------DY
O45992_CAEEL/258-471------------------------NSSELKI..................SWESISAGKVNAG----------------DC
B0S8K0_DANRE/187-399------------------------SGSAANA..................ELRSVFASDVLPG----------------QC
B3DJ46_DANRE/191-442------------------------LHHHDY.....................ETVFARNVRIG----------------DY
HH_DROMO/248-470------------------------QTL........................EFVFADRVEEL----------------SQ
C3ZGW9_BRAFL/224-434------------------------LSSPR......................IAKFMSDARPG----------------EF
D6WCL7_TRICA/146-345------------------------............................MKYAQKLQPG----------------DF
F6WZB6_XENTR/191-398------------------------TPAYDF.....................QAVFASSVRPG----------------QY
F6XBS5_CIOIN/294-549------------------------DASLLTATSNATQQNNERLGLQDFTSPHSSFAAKVRQG----------------DY
F6YTG6_XENTR/190-394------------------------AGF........................LPTFAYRVQIG----------------DL
G3V6T0_RAT/188-423------------------------SGPTPG....................PSPLFASRVRPG----------------QR
H2U1Q8_TAKRU/190-435------------------------PDSSQY.....................QAQFASRAQTG----------------TC
H2V9H2_TAKRU/190-402------------------------EGD.GM.....................SAVFASQVRRG----------------QK
H2XUY9_CIOIN/97-305------------------------CSNSFSA..................TKRAVFAGDIFSG----------------QY
W4Y925_STRPU/189-401------------------------SFS.QS.....................KAMFASEVRTN----------------QF
W5K3H2_ASTMX/187-406------------------------QSTQAMV...................MTSTFASNVVPG----------------QK

PF05203

U7Q1H8_SPOS1/262-759------------------------CWFDWHTAQAED...G..RPVRLVKLFTKSWDHDTHGGEAAADA.KAAAFRSELPS
Q6FQS3_CANGA/285-698------------------------SYFALGALIDET..NG..RAVEIVQEVQETFESNIS..........ASDFAANINR
A3LP04_PICST/283-730------------------------TYFQMKTAVAD....G..REIELPKLCTKSFQHSSHGRENAWKK..AEVFASTISR
J7RJ26_KAZNA/284-757------------------------SYFALQESEHGP..........VVKRLAKAFDHSVQAGSSAA....AQAFAHTIDT
C5M9I6_CANTT/244-713------------------------TFYVLEKTKTG.........IELVKAKTKVFGHHIHGQNGAEEK..AATFAAGIDS
Q6CL64_KLULA/284-692------------------------AFNRLADISVGNGTES..RTVRLVERAEKSFANAESNQAIIN....AAEFVTTIDT
B6JY11_SCHJY/285-759------------------------SFLRLADVVVGSSRGGDRRRIQIVKKVTKSFQHEPRGVEKAREL..AMEFLSTIGD
Q6BRM0_DEBHA/283-675------------------------TYFALESVTDEA..NG..REFSVVKSQTKTFEESSM..........AKEFASTISK
A5DXZ0_LODEL/280-699------------------------NYFAMGKTKKSAG.GK..DGVEIVRVKSKVFAHHIHGKEVAESK..ALEFAASVDM
H2APW1_KAZAF/284-774------------------------TYFTLENTRYGQ..........IVKRMTKSFQHPASEIDGQSTR.NARTFAATIDR
G7E5L8_MIXOS/284-742------------------------SYFVMGQERVSA...D..RVISAVTLRMRSWQHELHGGHRAARV.KAEAFKASIDK
F2TVI8_SALR5/1497-1695------------------------........................................................
U9UGV8_RHIID/409-843------------------------RLFWYEYDTQNN........MIVKKNDSFYYGPGEDYPKKEVAKRAAIREMARRPN
C5DTL5_ZYGRC/284-732------------------------CLFNMTKKTLED...G..RVIDIVEETSDFYP.AVEGPEKALRI..LKEYAEADGG
G8JWX2_ERECY/284-671------------------------KYFGMCYEHTED...G..RVIEQCKQFTKSFTCIEE..........LQQFCSQQPT
A7TLB5_VANPO/284-715------------------------VYTDLFKEITED...A..RIIELIKEVSKIYP.VSEGMDD......VQEFVSQYNK
VATA_YEAST/284-736------------------------ITFEMGQKKAPD...G..RIVELVKEVSKSYP.ISEGPERANEL..VESYRKASNK
M3K3J1_CANMX/284-733------------------------TYFALVDDKDSN...G..REFKMVKLCTESFEHKTHGPENAVKK..AQEFKDTVSI
G0V8Z3_NAUCC/284-799------------------------TFFVTEKSANGT..........IVKQRTKTFQHEFHGGEEAATK.LAADFASTIDP
C5DTQ4_ZYGRC/1-463------------------------CWKNLEDTLTLD...G..RIIKIPKTHHKDFPMTPEGQLA......AKGFLDEKEN
E9CG65_CAPO3/761-1238------------------------RHAALRKYSGPV...K..GLETSMQQVSSTFSYS............ATFVAAENDR
G0W3J0_NAUDC/284-783------------------------SYFALEESAYGQ..........IVKKKTKSYQHQRHGGKQETEK.KVNEFLATINP
G8ZLC3_TORDC/1-463------------------------KWKNMEEHLTFD...G..RIVSLPKTHHKDFPMTSEGEFR......ARSFMAEKEA
G8BNB8_TETPH/284-799------------------------TYFALEDSIYGK..........IVKKKTNTYEHSAHGGKQEAAR.KASEFVSSLDM

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------VGFVEAKELQVG----------------DK
Q5F6G7_NEIG1/1-137--------------------------------------------------GKWIKAEDLKAG----------------NR
Q9K122_NEIMB/1-137--------------------------------------------------GKWIQAGRLKKG----------------DT

PF14890

DPOL_THEAG/860-1392KRIRTFNRYLFHLEELGFVKLLPRGYEVTDWEGLKRYRQLYEKLVKNLRYNGNKREYLVRFNDIKDSVSCFPRKELEEWK
D5VTT2_METIM/75-563RLTRKDVEKITGLKESYITKIENGILESVEEERLKKLCSFYN................ISFEDIVEK......NPIKFPK
B7R5G0_9EURY/317-755.........................HEFIFDYWLA.............................................
DNAB_NOSS1/393-817.........................KQTMTYAEVA.............................................
I3RCL0_9EURY/841-1358ERPKTAKRYLEHLERLNYLKLTKTGYKVLNEDALREYRKLYERLVKVIQYNKDKGEYLVNFNAIRDVLPLMPEKELKEWY
GLMS_METJA/76-570GLTRKDVEKLCGVKEIYIVKIETGKLESIEEERLKKLCSLYG................INFEEIIYRDNLHYTNPVKFPK
DNAB_SYNY3/385-809.........................LQLMSDEELG.............................................
Q9UYA0_PYRAB/317-700.........................HELIFDYWLA.............................................
DPOL_THEKO/857-1388KRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWK
I6TV89_9EURY/317-755.........................YKFIFDYWLA.............................................
NDRZ_PYRFU/317-755.........................YKFIFDYWLA.............................................
F6BAJ4_METIK/76-570RLTRKDIEKLEGVKEIYITKIENGKLESIEEERLKKLCSLYG................INFEEVINENNLHYTNPVKFPK

PF10596

I3L3Z8_HUMAN/86-244-------------------------------------------RSGLNQIPNRRFTLWWSPT------------------
A2EY65_TRIVA/1432-1590-------------------------------------------RQGMSQVPNRRYTLWWSPT------------------
A8BTS5_GIAIC/1337-1490-------------------------------------------RQGLSQIPNRRFALWWSPT------------------
S3BP74_OPHP1/1452-1610-------------------------------------------RQGLSAIPNRRFCLWWSPT------------------
Q8SVU6_ENCCU/1239-1384-------------------------------------------KMGLSQIPNRRFILWWSPT------------------
Q5KPW2_CRYNJ/1640-1796-------------------------------------------RSGLSQIPNRRFTMWWSPT------------------
K7VI98_MAIZE/675-841-------------------------------------------RSGLNQIPNRRFTLWWSPT------------------
G0W883_NAUDC/1515-1673-------------------------------------------RTGLSQIPNRRFTLWWSPT------------------
E6ZWZ5_SPORE/1485-1643-------------------------------------------RSGLSQIPNRRFTLWWSPT------------------
Q00RU5_OSTTA/1516-1682-------------------------------------------RSGLNQIPNRRFTLWWSPT------------------
E9AFM0_LEIMA/1514-1674-------------------------------------------RAGLSKVPNQRFALWWSPT------------------
R0KWQ9_NOSB1/1205-1354-------------------------------------------KRGLNQIPNKRFIFWWSPT------------------

PF14623

Q237Q6_TETTS/509-673M----MI------.ND.........IECVTFA--------------------------------HGFQE...........
Q7S708_NEUCR/636-832I----MV------.EG.........VWAVTLG--------------------------------HGLTG...........
H6C7V0_EXODN/356-526I----KI------.GG.........QVCVTLG--------------------------------HGVVA...........
J3PIM9_GAGT3/593-786F----LV------AESAAGAGSPPVLWGVCLG--------------------------------HGLAGRTRGEADGEEA
G2XFI4_VERDV/568-734L----RV------.GG.........HWGVSLG--------------------------------HGVTA...........
G1XIH1_ARTOA/537-708M----YV------.DA.........IRVATLG--------------------------------HGLVN...........
U7PS73_SPOS1/521-692I----NI------.EG.........VWVVTLG--------------------------------HGLTQ...........
C7YL43_NECH7/586-752I----RV------.GD.........MWGVTLG--------------------------------HGLTI...........
R8BIW3_TOGMI/471-637V----KA------.GG.........LWGVTLG--------------------------------HGLLA...........
C5GK44_AJEDR/553-713I----MV------.EG.........HVCVSLG--------------------------------HGVRS...........
S8AB86_DACHA/542-713M----YI------.GG.........AKVVTLG--------------------------------HGLVE...........
S3CBE6_OPHP1/613-780M----NI------.EG.........LWVVTLG--------------------------------HGLTE...........
G3JM09_CORMM/336-505V----QV------AGG.........LWGASLG--------------------------------HGIVA...........
C5FLY1_ARTOC/540-711I----MV------.ED.........CICVTLG--------------------------------HGIQT...........
F0UB99_AJEC8/548-714I----MV------.EG.........HVCVSLG--------------------------------HGIQG...........
G0QP70_ICHMG/545-705I----LI------.NN.........VTCTTFG--------------------------------HGFKG...........
I7M030_TETTS/514-676M----NI------.GG.........YECICLG--------------------------------HNFQE...........
M7TBR0_EUTLA/533-699V----KV------.GG.........VWGVTLG--------------------------------HGLLT...........
C1G4L4_PARBD/546-712I----MV------.GN.........HVCVSLG--------------------------------HGVLS...........
N4VVV8_COLOR/552-719V----SV------.AG.........ILGVTLG--------------------------------HGLLS...........
F2SQT7_TRIRC/537-709I----MV------.ED.........HICVTLG--------------------------------HGILT...........
Q24C76_TETTS/502-665M----NI------.GG.........FEVICLG--------------------------------HGFQE...........
D2VHB8_NAEGR/586-749V----SI------.NG.........VECITLG--------------------------------HGFTD...........
G9MP19_HYPVG/551-718I----RV------.GD.........AWGVTLG--------------------------------HGVTR...........
T0JQ14_COLGC/569-736V----NV------.AG.........IWGVTLG--------------------------------HGLVT...........
J4WBA6_BEAB2/688-856V----LA------.GG.........LWGTTLG--------------------------------HGITG...........
I7M701_TETTS/604-769M----EI------.NG.........IECVTYA--------------------------------HNFQE...........
F7VWE7_SORMK/571-774I----MV------.ED.........VWGVTLG--------------------------------HGLTG...........
L8X395_THACA/606-772V----FI------.EG.........IRCVTLG--------------------------------HGCID...........
E4UR10_ARTGP/540-711I----MV------.ED.........HICVTLG--------------------------------HGILQ...........
Q2GTB7_CHAGB/570-754I----LV------.GG.........VWGVTMG--------------------------------HGLTT...........
E3QU32_COLGM/508-676L----SV------.AG.........VWGVTLG--------------------------------HGLVS...........
G0RIM5_HYPJQ/574-741I----RV------.GD.........AWGVTLG--------------------------------HGIMR...........
Q22N58_TETTS/494-660M----SI------.EG.........VECIALA--------------------------------HNISE...........
A9UVU8_MONBE/587-772V----PV------.DG.........HTTVGLA--------------------------------HELQE...........
I1RVJ3_GIBZE/578-742I----RV------.GD.........MWGVTLG--------------------------------HGLTS...........
E9EQB7_METAR/534-699L----RV------.AG.........IWGATLG--------------------------------HGLTA...........
J4URQ4_BEAB2/478-645L----RL------EGG.........LWGVTLG--------------------------------HGVTN...........
G4NA23_MAGO7/558-749F----CV------GSGG........VWAVAMG--------------------------------HGLVD...........

PF13403

Q1GGP9_RUEST/27-173V----LV------AND---------KTALYFE--------------------------------DREVL-----------
Q1GES6_RUEST/157-304M----LV------RGA---------AARALFN--------------------------------ESEVL-----------
A1AYR4_PARDP/380-527V----LL------RSV---------VARRMVG--------------------------------EAEVL-----------
A8LN65_DINSH/175-322V----LL------EDW---------RADLLFG--------------------------------SAQVL-----------
A1B4V8_PARDP/356-503V----LV------RSN---------IAQKMFK--------------------------------TREVL-----------
A8LKN9_DINSH/122-260M----LL------SDP---------RLLLLFE--------------------------------EAEVL-----------
Q28WJ0_JANSC/241-379M----LV------QGW---------RCQVLFG--------------------------------REEGL-----------
Q5LPM0_RUEPO/507-646M----LW------SGS---------RAQMYFG--------------------------------ESEVL-----------
Q28L14_JANSC/1268-1415M----LI------EGG---------QTELLFG--------------------------------EDQVL-----------
Q1GGN0_RUEST/194-341I----LI------ESH---------MSGLLFA--------------------------------SNAIL-----------
Q5LSZ7_RUEPO/803-941I----LM------MGP---------MVEFYLG--------------------------------HSEVL-----------
Q5LPJ7_RUEPO/175-322I----VL------QGW---------RAELFFG--------------------------------EAQVF-----------
Q1GMQ5_RUEST/293-432V----LI------RSE---------LADLQFG--------------------------------QPEVL-----------
Q5LLZ7_RUEPO/144-282M----LI------TGW---------QAELACG--------------------------------ESEVF-----------
A8LR09_DINSH/158-296I----LM------RAW---------QAELLFG--------------------------------VPEVL-----------
C7JHN5_ACEP3/423-565L----FF------E..---------.......--------------------------------..GKF-----------
Q28SX3_JANSC/168-306L----LL------TGW---------RAELLFG--------------------------------EEAVW-----------
A8LK48_DINSH/203-343M----LL------RT.---------.....VE--------------------------------GRELL-----------
Q5LMP8_RUEPO/160-307V----LL------RSR---------IARRMYG--------------------------------SDEIL-----------
Q28UB5_JANSC/126-273L----AL------STG---------ASGIVLG--------------------------------ADAVL-----------
Q1GMV1_RUEST/833-976F----LL------PSD---------....GAS--------------------------------RSESF-----------
A5FZD4_ACICJ/193-329L----FL------D..---------.......--------------------------------..GVL-----------
B9JK11_AGRRK/201-336M----FM------E..---------.......--------------------------------..ESL-----------
Q28TH9_JANSC/752-887M----LL------GQ.---------.......--------------------------------..DHF-----------
A5G1S8_ACICJ/159-294F----YF------N..---------.......--------------------------------..GAL-----------
B0T7Q3_CAUSK/153-288V----WL------D..---------.......--------------------------------..GVL-----------
C7JE32_ACEP3/536-676L----YL------D..---------.......--------------------------------..GCF-----------
B8IA31_METNO/149-285M----FL------D..---------.......--------------------------------..GCL-----------
A5G006_ACICJ/174-309I----YL------D..---------.......--------------------------------..GCL-----------
A5FW80_ACICJ/285-421V----WF------D..---------.......--------------------------------..NLL-----------
A8LLK3_DINSH/164-305V----LL------TR.---------.....AD--------------------------------GAECL-----------
Q5FQG8_GLUOX/285-425M----ML------E..---------.......--------------------------------..GSF-----------
B0UJT1_METS4/116-254I----CL------D..---------....LLG--------------------------------..EVL-----------
Q5LUZ7_RUEPO/68-216L----LA------TPG---------HLRALAG--------------------------------DQPML-----------
Q0BS96_GRABC/3687-3823M----FI------D..---------.......--------------------------------..GVL-----------
B1M2P7_METRJ/65-199V----WL------D..---------.......--------------------------------..GLF-----------
A5FVL4_ACICJ/410-545I----WI------D..---------.......--------------------------------..GSL-----------
A4YQ57_BRASO/106-246L----LF------D..---------.......--------------------------------..GLL-----------
A5FWA2_ACICJ/1192-1328V----YA------D..---------.......--------------------------------..GVL-----------
C3KQV1_RHISN/76-214L----YL------D..---------.......--------------------------------..GVL-----------
A8LKB8_DINSH/19-167V----RV------PAH---------LLGQSVP--------------------------------DPTLR-----------
Q5LN78_RUEPO/204-343L----LL------SGT---------EVEYLFG--------------------------------RESVL-----------
C5AQV5_METEA/69-209V----LV------G..---------..ADANG--------------------------------EGGVL-----------
D5AV22_RHOCB/442-581V----LA------L..---------.....TD--------------------------------QGERL-----------
Q2YL23_BRUA2/15-148L----FI------D..---------.......--------------------------------..GVL-----------
Q3J294_RHOS4/14-159I----LV------SRD---------RTALHFD--------------------------------APEVL-----------

PF01079

Q7PXI1_ANOGA/295-503I----LV.........---------HVAGSLE--------------------------------PRAVH-----------
HH_DROPS/255-475V----LV.......RD---------PQTGELR--------------------------------PQRVV-----------
IHH_DANRE/187-398L----LL.........---------.GKLRKR--------------------------------FSQIT-----------
TWHH_DANRE/190-403V----LV.......WE---------DTCESLK--------------------------------SVTVK-----------
WRT4_CAEEL/327-547F----YI......AHR---------KKSQMYQ--------------------------------RVKVL-----------
Q80XI9_MOUSE/230-435V----LV.........---------SGVPGLQ--------------------------------PARVA-----------
WRT6_CAEEL/375-583I----HV........T---------TDSNVVI--------------------------------KKKVS-----------
A8X447_CAEBR/327-545F----YV......AHR---------TNSKLYQ--------------------------------HVKVL-----------
IHH_CHICK/188-394V----LV........A---------VGSGGLQ--------------------------------PAEVV-----------
SHH_CHICK/190-411V----YV.......LG---------EGGQQLL--------------------------------PASVH-----------
SHH_DANRE/187-404V----MV......VDD---------SGQ..LK--------------------------------SVIVQ-----------
WRT8_CAEEL/325-538F----FM......AQP---------ENASKFQ--------------------------------KVQIL-----------
DHH_HUMAN/188-396V----LA.........---------PGGDALR--------------------------------PARVA-----------
Q175B3_AEDAE/201-412I----LV.........---------NINSTIE--------------------------------PRKVL-----------
O45992_CAEEL/258-471F----YL......AQS---------EALTKYR--------------------------------LVEIL-----------
B0S8K0_DANRE/187-399V----VS.......TQ---------AAGRHGR--------------------------------LSRVS-----------
B3DJ46_DANRE/191-442I----LT........T---------GGDRGIQ--------------------------------PSKVV-----------
HH_DROMO/248-470V----LV........H---------DATGELR--------------------------------PQRVL-----------
C3ZGW9_BRAFL/224-434L----LT.......PD---------SDGGGFR--------------------------------KVKIV-----------
D6WCL7_TRICA/146-345L----LV.......SD---------NAKNALI--------------------------------SEKIV-----------
F6WZB6_XENTR/191-398I----LV.........---------SSVVGLI--------------------------------PAKIM-----------
F6XBS5_CIOIN/294-549I----YTLPNSHTGPD---------TPSATVR--------------------------------PSRVV-----------
F6YTG6_XENTR/190-394V----QI........Y---------VNGTQLQ--------------------------------PSKVV-----------
G3V6T0_RAT/188-423V----YVV.....AER---------GGDRRLL--------------------------------PAAVH-----------
H2U1Q8_TAKRU/190-435V----LV........H---------TAGGEVH--------------------------------PSRIV-----------
H2V9H2_TAKRU/190-402V----IV.......SD---------PERSRLE--------------------------------PVTVE-----------
H2XUY9_CIOIN/97-305V----YT......TIQ---------ARGFEIQ--------------------------------PSRVE-----------
W4Y925_STRPU/189-401V----YT......TGQ---------NHDRGVR--------------------------------PKRVV-----------
W5K3H2_ASTMX/187-406V----LV.......VD---------RNGGQLN--------------------------------PVVVE-----------

PF05203

U7Q1H8_SPOS1/262-759G..D.FEWSIEARDVS.LLGTHVRKATQQLIN................................P..VLFQA..GHLSQV
Q6FQS3_CANGA/285-698E..P.ISWTLEIRDID.YLSERVRMFTKQSVN................................P..VLLET..PTLAKQ
A3LP04_PICST/283-730D..P.IDWTAEARDIS.RLGYHVRRATRQLWS................................P..VLVEK..EVLAPM
J7RJ26_KAZNA/284-757A..P.IEWDVLASEFV.KLGDRVRAASVQLIN................................P..VFSES..HHLSTR
C5M9I6_CANTT/244-713K..EYIDWIIEARDYV.QVDEIVKTSTTQMIN................................P..VHFES..GKLGNW
Q6CL64_KLULA/284-692T..S.IEWTLEARDML.LVDSSIREVTQQLIN................................P..VLLEK..EHLAGV
B6JY11_SCHJY/285-759D..D.IYWTIEARDYT.LVSQEVRELTQQMIS................................P..VLFEK..ADLQNR
Q6BRM0_DEBHA/283-675N..S.IDWTIEARDVG.HMSDDVRCATQQSWA................................P..VLASK..EVLAPV
A5DXZ0_LODEL/280-699S..A.IEWVVEAKDYYEQVEDTVKQNSTQLIN................................P..VFYES..NAIGKW
H2APW1_KAZAF/284-774A..P.IDWDIEARDYE.KLGYHVKEASYQLIN................................P..VFQES..GIFAAK
G7E5L8_MIXOS/284-742D..EIFNWTIEAQHVA.ALNMHVRKATQQTIS................................P..VLHEN..HRFGDI
F2TVI8_SALR5/1497-1695...........ARKLK...AAALRAATAA...................................................
U9UGV8_RHIID/409-843LVSSDFIWEIPIKDFL.TASDEIQRSC.LMFK................................PNQVIFKSVQGRFRVI
C5DTL5_ZYGRC/284-732K..EYFEWTIEARDVA.LLSAQVRKATYQLSA................................P..VLLEN..NHFSHY
G8JWX2_ERECY/284-671E..N.FKWTVEARDVE.NMDPAVREATFQLVC................................P..ILYEG..HQLAQY
A7TLB5_VANPO/284-715SLEDYFQWTVEPRDIN.RLTESIREATYQVYA................................P..VLYEC..ENLLQY
VATA_YEAST/284-736A..Y.FEWTIEARDLS.LLGSHVRKATYQTYA................................P..ILYEN..DHFFDY
M3K3J1_CANMX/284-733L..D.IDWVIEARDVA.KMGYHVRRATKQLWA................................P..ILVEN..NVFSSM
G0V8Z3_NAUCC/284-799K..H.IDWDIEAKDYK.QLDHYVKKSSYQMIN................................P..VFKES..GNLANI
C5DTQ4_ZYGRC/1-463STGRFAEYNVQVRDLD.ILEAQVRVNSFLRFN................................P..LLEGN..GVLSEF
E9CG65_CAPO3/761-1238R....FATETAARDAATTFANECRAAQPVLWTVGTAAFVRFAAAHPTQAGHMRMIRSGCIEWPVPASVDLSQVIEQVVPA
G0W3J0_NAUDC/284-783D..S.IEWDVEAKDYK.KLGYDVKKSSHQMIN................................P..VFKES..GNLIAK
G8ZLC3_TORDC/1-463EHGRYLEFSIQVRDLD.LLEAQIRVNSFLRFS................................P..VVTGR..GILSEF
G8BNB8_TETPH/284-799Q..P.IDWDIEASDYN.HLGYFVKKSTFQMIN................................P..IFKES..GNLASK

PF07591

A3DGR7_CLOTH/105-234L----LD------------------SKGNVLV--------------------------------VEEKK-----------
Q5F6G7_NEIG1/1-137L----FA------------------ESGKTQT--------------------------------VRNIV-----------
Q9K122_NEIMB/1-137L----LS------------------ESGAKQT--------------------------------VQNIT-----------

PF14890

DPOL_THEAG/860-1392I----GTXKGFRXKCILKVDEDFGKFLGYYVS--------------------------------EGYAGAQKNKTGGMS.
D5VTT2_METIM/75-563V----PS.............PELMQIIGYIIG--------------------------------DGYFPSNRS.......
B7R5G0_9EURY/317-755.----......................GFIAG--------------------------------DGSFDKQRSHVKGHEY
DNAB_NOSS1/393-817.----....................LLGHLIG--------------------------------DGCTLPRHA.......
I3RCL0_9EURY/841-1358I----SSNNGFRMKPFIELDNDFAKLLGHYVR--------------------------------EGSAEKLRNSQNCM..
GLMS_METJA/76-570T----PT.............PELMQIIGYIIG--------------------------------DGHFPSNRM.......
DNAB_SYNY3/385-809.----....................LLGHLIG--------------------------------DGCTLPRHA.......
Q9UYA0_PYRAB/317-700.----......................GFIAG--------------------------------NGNLDDSEREYKA...
DPOL_THEKO/857-1388I----GTLNGFRMSPLIEVDESLAKLLGYYVS--------------------------------EGYARKQRNPKNGWS.
I6TV89_9EURY/317-755.----......................GFIAG--------------------------------DGCFDKYHSHVKGHEY
NDRZ_PYRFU/317-755.----......................GFIAG--------------------------------DGCFDKYHSHVKGHEY
F6BAJ4_METIK/76-570T----PT.............PELMQIIGYIIG--------------------------------DGYFSSNRT.......

PF10596

I3L3Z8_HUMAN/86-244-----IN------------------RANVYVG------------------------------------------------
A2EY65_TRIVA/1432-1590-----IN------------------RANVYVG------------------------------------------------
A8BTS5_GIAIC/1337-1490-----IN------------------RSSVYIG------------------------------------------------
S3BP74_OPHP1/1452-1610-----IN------------------RGSVYVG------------------------------------------------
Q8SVU6_ENCCU/1239-1384-----IN------------------RGNVYVG------------------------------------------------
Q5KPW2_CRYNJ/1640-1796-----IN------------------RANVYVG------------------------------------------------
K7VI98_MAIZE/675-841-----IN------------------RANVYVG------------------------------------------------
G0W883_NAUDC/1515-1673-----IN------------------RANVYVG------------------------------------------------
E6ZWZ5_SPORE/1485-1643-----LN------------------RSSVYIG------------------------------------------------
Q00RU5_OSTTA/1516-1682-----IN------------------RXXXXXX------------------------------------------------
E9AFM0_LEIMA/1514-1674-----IN------------------RSDIQAG------------------------------------------------
R0KWQ9_NOSB1/1205-1354-----IN------------------RADVYVG------------------------------------------------

PF14623

Q237Q6_TETTS/509-673.............DKVK-HEYFG---T.N---------------------------------------------------
Q7S708_NEUCR/636-832...TGEGVVTAAEDLRT-HRFFG---DYK---------------------------------------------------
H6C7V0_EXODN/356-526.........GPEDDVRA-HAFFG---NHR---------------------------------------------------
J3PIM9_GAGT3/593-786AEDAG.......DDVRN-HEFWG---DYA---------------------------------------------------
G2XFI4_VERDV/568-734....G.......GDFRA-HQFFG---DYM---------------------------------------------------
G1XIH1_ARTOA/537-708.......TENVENDVRN-HEFFG---NYS---------------------------------------------------
U7PS73_SPOS1/521-692...KTDDEGETNNDVRV-HRFFG---DYS---------------------------------------------------
C7YL43_NECH7/586-752....G.......SDVRA-HSFFG---DYN---------------------------------------------------
R8BIW3_TOGMI/471-637....G.......DDVRA-HHYLG---NYS---------------------------------------------------
C5GK44_AJEDR/553-713....G.......NDVRA-HAFFG---SYP---------------------------------------------------
S8AB86_DACHA/542-713.......KPEAGRDVRN-HEFFG---NYE---------------------------------------------------
S3CBE6_OPHP1/613-780.....KQDAPNPDDVRI-HSFLG---DYA---------------------------------------------------
G3JM09_CORMM/336-505....G..AG...EDVRA-HPFFG---DYV---------------------------------------------------
C5FLY1_ARTOC/540-711....G.......DDIRA-HELFG---NYH---------------------------------------------------
F0UB99_AJEC8/548-714...........CNDVRA-HPFFG---SYP---------------------------------------------------
G0QP70_ICHMG/545-705.............ENVH-HDYFG---T.N---------------------------------------------------
I7M030_TETTS/514-676.............RVAY-HPYLG---S.Q---------------------------------------------------
M7TBR0_EUTLA/533-699....G.......CDVRA-HAFFG---DRA---------------------------------------------------
C1G4L4_PARBD/546-712....G.......SDVRA-HAFFG---SYS---------------------------------------------------
N4VVV8_COLOR/552-719....G.......GDVRA-HQFFG---SYT---------------------------------------------------
F2SQT7_TRIRC/537-709....G.......EDIRA-HELFG---DYQ---------------------------------------------------
Q24C76_TETTS/502-665.............PIAS-HEYLG---S.Q---------------------------------------------------
D2VHB8_NAEGR/586-749............NSVVS-HPYFG---T.D---------------------------------------------------
G9MP19_HYPVG/551-718....G.......TDVRA-HEFFG---DYM---------------------------------------------------
T0JQ14_COLGC/569-736....G.......LDVRA-HQFFG---DYG---------------------------------------------------
J4WBA6_BEAB2/688-856....GGEGA...NDVRA-HPFFG---DYL---------------------------------------------------
I7M701_TETTS/604-769.............EIVK-HDFFG---T.E---------------------------------------------------
F7VWE7_SORMK/571-774...TGEGEVTGAEDVRT-HRFFG---DYD---------------------------------------------------
L8X395_THACA/606-772.............SVRA-HPFLG---DYA---------------------------------------------------
E4UR10_ARTGP/540-711....G........DIRA-HELFG---NYQ---------------------------------------------------
Q2GTB7_CHAGB/570-754......QVLGRRYDVRV-HEFYG---AYD---------------------------------------------------
E3QU32_COLGM/508-676....G.......RDARA-HAFFG---DYK---------------------------------------------------
G0RIM5_HYPJQ/574-741....G.......DDARA-HGFFG---DYR---------------------------------------------------
Q22N58_TETTS/494-660.............PVAQ-HAYYG---T.H---------------------------------------------------
A9UVU8_MONBE/587-772.............PVAA-HPFFG---S.P---------------------------------------------------
I1RVJ3_GIBZE/578-742....G.......SDVRA-HEFFG---DYN---------------------------------------------------
E9EQB7_METAR/534-699....G.......NDTRA-HYFFG---DYN---------------------------------------------------
J4URQ4_BEAB2/478-645...GG.......GDARA-HAFFG---NYV---------------------------------------------------
G4NA23_MAGO7/558-749....G.......SDVRA-HAFYG---DRN---------------------------------------------------

PF13403

Q1GGP9_RUEST/27-173--------------VAA-KHLTG...L.T---------------------------------------------------
Q1GES6_RUEST/157-304--------------VAA-RDLIN...G.H---------------------------------------------------
A1AYR4_PARDP/380-527--------------LAA-RHLIG...L.D---------------------------------------------------
A8LN65_DINSH/175-322--------------AAA-AHLVN...D.D---------------------------------------------------
A1B4V8_PARDP/356-503--------------VAA-KQLVL...L.E---------------------------------------------------
A8LKN9_DINSH/122-260--------------AAA-LHLVN...G.H---------------------------------------------------
Q28WJ0_JANSC/241-379--------------CAA-KHLVD...G.D---------------------------------------------------
Q5LPM0_RUEPO/507-646--------------VAA-THLLG...S.P---------------------------------------------------
Q28L14_JANSC/1268-1415--------------VRA-KHLTH...L.P---------------------------------------------------
Q1GGN0_RUEST/194-341--------------APA-KGLVN...G.T---------------------------------------------------
Q5LSZ7_RUEPO/803-941--------------VAA-KFLVD...G.R---------------------------------------------------
Q5LPJ7_RUEPO/175-322--------------AAA-IHLTN...D.D---------------------------------------------------
Q1GMQ5_RUEST/293-432--------------IKA-KHLVN...G.D---------------------------------------------------
Q5LLZ7_RUEPO/144-282--------------VPA-RMLVN...G.S---------------------------------------------------
A8LR09_DINSH/158-296--------------LAA-TSLTA...L.P---------------------------------------------------
C7JHN5_ACEP3/423-565--------------VPV-RMLVN...G.V---------------------------------------------------
Q28SX3_JANSC/168-306--------------VPA-AYFLD...R.P---------------------------------------------------
A8LK48_DINSH/203-343--------------VPA-KALVD...M.G---------------------------------------------------
Q5LMP8_RUEPO/160-307--------------IAA-RRLTG...L.H---------------------------------------------------
Q28UB5_JANSC/126-273--------------AAA-LHMTP...R.D---------------------------------------------------
Q1GMV1_RUEST/833-976--------------VRA-RLLLELDPG.H---------------------------------------------------
A5FZD4_ACICJ/193-329--------------VQA-KDLVD...G.T---------------------------------------------------
B9JK11_AGRRK/201-336--------------IPA-KFLVN...G.T---------------------------------------------------
Q28TH9_JANSC/752-887--------------ARA-VHLSK..CM.R---------------------------------------------------
A5G1S8_ACICJ/159-294--------------IPA-KALVN...G.M---------------------------------------------------
B0T7Q3_CAUSK/153-288--------------VPV-GLLTN...G.A---------------------------------------------------
C7JE32_ACEP3/536-676--------------VPV-RMLVN...G.M---------------------------------------------------
B8IA31_METNO/149-285--------------IPA-VHLVN...G.V---------------------------------------------------
A5G006_ACICJ/174-309--------------VPA-KALVN...G.R---------------------------------------------------
A5FW80_ACICJ/285-421--------------IPA-KFLVN...G.A---------------------------------------------------
A8LLK3_DINSH/164-305--------------VPV-AKLLG...C.A---------------------------------------------------
Q5FQG8_GLUOX/285-425--------------VPV-RMLVN...G.M---------------------------------------------------
B0UJT1_METS4/116-254--------------IPA-SALVN...G.S---------------------------------------------------
Q5LUZ7_RUEPO/68-216--------------TPV-QHFVD...G.M---------------------------------------------------
Q0BS96_GRABC/3687-3823--------------VPA-GRLVN...G.V---------------------------------------------------
B1M2P7_METRJ/65-199--------------VAA-GHLVN...G.T---------------------------------------------------
A5FVL4_ACICJ/410-545--------------VEI-KRLIN...G.L---------------------------------------------------
A4YQ57_BRASO/106-246--------------VPA-GTLVN...G.A---------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------VPA-TLLVN...E.A---------------------------------------------------
C3KQV1_RHISN/76-214--------------IRA-TDLVN...G.T---------------------------------------------------
A8LKB8_DINSH/19-167--------------LTA-RSLAD...YFD---------------------------------------------------
Q5LN78_RUEPO/204-343--------------VPA-RHLTG...G.H---------------------------------------------------
C5AQV5_METEA/69-209--------------VPV-MCLIN...G.T---------------------------------------------------
D5AV22_RHOCB/442-581--------------VRA-RHLAG...L.N---------------------------------------------------
Q2YL23_BRUA2/15-148--------------IRV-KDLVN...G.R---------------------------------------------------
Q3J294_RHOS4/14-159--------------VAA-KHLVG...P.R---------------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503-------------RISA.TLAEG---VYA---------------------------------------------------
HH_DROPS/255-475-------------RVGS.VRSKG---VVA---------------------------------------------------
IHH_DANRE/187-398-------------HVGV.REDQG---LYP---------------------------------------------------
TWHH_DANRE/190-403-------------RIYT.EEHEG---SFA---------------------------------------------------
WRT4_CAEEL/327-547-------------DINI.VQKTG---IYS---------------------------------------------------
Q80XI9_MOUSE/230-435-------------AVST.HVALG---SYA---------------------------------------------------
WRT6_CAEEL/375-583-------------KISK.VIETG---IYS---------------------------------------------------
A8X447_CAEBR/327-545-------------DINK.VKKTG---IYA---------------------------------------------------
IHH_CHICK/188-394-------------GVRG.RTDVG---AYA---------------------------------------------------
SHH_CHICK/190-411-------------SVSLREEASG---AYA---------------------------------------------------
SHH_DANRE/187-404-------------RIYT.EEQRG---SFA---------------------------------------------------
WRT8_CAEEL/325-538-------------DIQR.VRKTG---IYA---------------------------------------------------
DHH_HUMAN/188-396-------------RVAR.EEAVG---VFA---------------------------------------------------
Q175B3_AEDAE/201-412-------------RISA.KLSQG---VYA---------------------------------------------------
O45992_CAEEL/258-471-------------DIKR.VKKTG---IYA---------------------------------------------------
B0S8K0_DANRE/187-399-------------RIQM.QEDRG---VFA---------------------------------------------------
B3DJ46_DANRE/191-442-------------SVSL.EERMG---VYA---------------------------------------------------
HH_DROMO/248-470-------------RVDS.VQSRG---VVA---------------------------------------------------
C3ZGW9_BRAFL/224-434-------------SVTM.REEKG---AYA---------------------------------------------------
D6WCL7_TRICA/146-345-------------RLEA.VWRSG---VFA---------------------------------------------------
F6WZB6_XENTR/191-398-------------SVSA.QTDYG---AYA---------------------------------------------------
F6XBS5_CIOIN/294-549-------------SVRTIETASG---AYA---------------------------------------------------
F6YTG6_XENTR/190-394-------------RVSV.EEQTG---VYA---------------------------------------------------
G3V6T0_RAT/188-423-------------SVTLREEAAG---AYA---------------------------------------------------
H2U1Q8_TAKRU/190-435-------------SITE.EESVG---AYA---------------------------------------------------
H2V9H2_TAKRU/190-402-------------RIYT.QEHVG---SYA---------------------------------------------------
H2XUY9_CIOIN/97-305-------------SVTT.VTGDG---LYA---------------------------------------------------
W4Y925_STRPU/189-401-------------SVTT.RLGRT---AVA---------------------------------------------------
W5K3H2_ASTMX/187-406-------------RIYM.EEHQG---SYA---------------------------------------------------

PF05203

U7Q1H8_SPOS1/262-759LERHGYESGAL....EM-AYLLGFWVGDG.YYDRAA....FAVD.ARDTAIKGR....MQEYGSMFDLVVDTREYKKYMY
Q6FQS3_CANGA/285-698LESNE....ST..ATNL-AYLLGTWIASK.ATTAGT....ISVP.TTKADLLSK....VKSALSSLSIDYSSESINSVST
A3LP04_PICST/283-730IAKRGFDE.SI..APYM-AYLVGLWVGDG.YSDRAT....FSID.IQDVEIHER....IKDFASHAGLTPRIACYKKSR.
J7RJ26_KAZNA/284-757MQALGSDD.AL..ASKL-AWLLGTWVAVG.DVNASESATTFSLSVGTHAALLDR....ISEYGKALGLSTTTVERQNRHY
C5M9I6_CANTT/244-713LHEHKQNK.SL..APQL-GYLLGTWAGIG.NVKSSA....FTMNSKDDVKLATR....IMNYSSKLGMTCSSTESGELNV
Q6CL64_KLULA/284-692LKSNDFQS.SL..APQF-SYLLGAFVGSS.GKDNSEYLQQLSAQ..FDKKIVAEKSIDVQSNGKTVGTA...........
B6JY11_SCHJY/285-759LVKRGISAKYA...SEA-AYLLGVWVGAG.FSRSSA....FSLY.EEDSELVSR....IISFGKALGLKAVTAEHNPRTV
Q6BRM0_DEBHA/283-675VQEAGFDA.TI..APYV-SYLLGLWIGNG.YSDRVQ....YLID.GKNTELINR....VREYDEAIENNNQTSAK.....
A5DXZ0_LODEL/280-699LADNGETKPSS..ASEL-AYLMGAAFNES...RESISDAATNTKRTLENVEFDD....LKSVDSSLDLSMDDGYETDNT.
H2APW1_KAZAF/284-774LNNFGFAK.KI..APEM-AWLLGFWVGAG.DMEQFS....FSIA.GTETELISH....IVKCANLVGLTITSTEICNSFK
G7E5L8_MIXOS/284-742LSQHGLDP.QL..DARV-AYLVGLWLGSG.SSDEPA....LTIA.SNDAKTVER....IDSLCSALGLVASVSDEHHRAK
F2TVI8_SALR5/1497-1695.................-.......TGDASVNGAAM....PQAQQPQDSTLFEM....TVEE..................
U9UGV8_RHIID/409-843LSKILGVSPTNSQISAA-SWLVGVWIGGG.IVKSPI....IYVN.ENEKEILRA....IEQYSEMLNWRYMK........
C5DTL5_ZYGRC/284-732LKDSNSAV.GNDTVRAL-SYFLGLWIGDGMLNNAAT....FSVD.SQNASLLNR....INEFAEVLGLSAEYKDSQEPKR
G8JWX2_ERECY/284-671LATQKNGL.PSEAATIL-AYFLGLWSGNQ............SNEIEVTAEVFSR....LQGAVELLGLHVKRQQGVSKSI
A7TLB5_VANPO/284-715LKNTKYNL.NEKSPTAL-AYLLGLWTGSG.MTRRAG....LSVS.TTDESLMNN....IVAAADLLNLKSEFKQERTTTR
VATA_YEAST/284-736MQKSKFHL.TIEGPKVL-AYLLGLWIGDG.LSDRAT....FSVD.SRDTSLMER....VTEYAEKLNLCAEYKDRKEPQV
M3K3J1_CANMX/284-733IEKQGSDT.SI..APEL-AYLTGLWVGNG.SSESAA....FSVD.SRDEEIINR....IQDCAEAAGLEMRGSHYKKTY.
G0V8Z3_NAUCC/284-799LGDAGIEK.TL..AAKM-AWLLGFWVGNG.HMETAQ....FPVD.SWDTQLVDR....ISEYGKHFNLTTTTENHYRSNH
C5DTQ4_ZYGRC/1-463LTGQKGLNSPA..VLTM-AWLLGLWIGDG.TTKEPE....ISVD.SHDTGLMEG....LIERGKIWGLYPEYKDEQIPLR
E9CG65_CAPO3/761-1238ISSNEPRPTP....ETL-GYLLGLHLADG.SAERAS....FFVG.HAESSLLAY....LDEVAPQFGLVSHRVSQPDMYE
G0W3J0_NAUDC/284-783LNELGFSK.EI..APQM-GWLLGFWVGNG.SITTSS....FSID.SLDTQLLDR....ITEYGKLFALTTTSATNHCRNY
G8ZLC3_TORDC/1-463LTGQKHLITPY..VLDM-AWLLGLWLGDG.TTKEPE....ISVD.SFDTCLMEG....LIERCKTWGLFPTYKDEPIPLR
G8BNB8_TETPH/284-799LEKLGFEG.SL..APKI-AWMLGFWVGAG.NINQSE....FSID.PSGTQLVDR....ISEVGKYFNLTTATSKHYSRVF

PF07591

A3DGR7_CLOTH/105-234--------------LEITDEPAK---VYN---------------------------------------------------
Q5F6G7_NEIG1/1-137--------------VK..PKPLK---AYN---------------------------------------------------
Q9K122_NEIMB/1-137--------------LK..QQPLK---AYN---------------------------------------------------

PF14890

DPOL_THEAG/860-1392..YSVKLYNENPNVLKDMKNIAEKFFGK.....VRVGKNCVDIPKKMAYLLAKSLCGVTAE.............------
D5VTT2_METIM/75-563....LRLKDERKEVLEKYKELFKNIFNLEGN..IRKGDGNYYILEINSKYLVDWFRENVPEVFNKT.......G------
B7R5G0_9EURY/317-755IYDRLRIYDYRVETFETINKYLEETFGKRYS..LQRDRNIYYIDIKA.....REITSHYRKLLDGI........------
DNAB_NOSS1/393-817....IQYTTREIDLAENVFFLAKEVFGDAITPRISPERSWYQVYLSATQRLTRNLRNPVAKWLDSLGVFGLRSY------
I3RCL0_9EURY/841-1358....VRLYSRDSKALNDIEKLAIKFFGK.....IKRAQDYIEIPEKTAYLLFKGLCGNHLE.............------
GLMS_METJA/76-570....LRLKDERKEVLEEYNQLFKTVFNLEGN..IKKGDGNYYILEINSKYLIDWFRENIPELFNKT.......G------
DNAB_SYNY3/385-809....IQYTSNKIELAEKVVELAKAVFGDQINPRISQERQWYQVYIPASYRLTHNKKNPITKWLENLDVFGLRSY------
Q9UYA0_PYRAB/317-700...........................................................RELLDGI........------
DPOL_THEKO/857-1388..YSVKLYNEDPEVLDDMERLASRFFGK.....VRRGRNYVEIPKKIGYLLFENMCGVLAE.............------
I6TV89_9EURY/317-755IYDRLRIYDYRIETFEIINDYLEKTFGRKYS..IQKDRNIYYIDIKA.....RNITSHYLKLLEGI........------
NDRZ_PYRFU/317-755IYDRLRIYDYRIETFEIINDYLEKTFGRKYS..IQKDRNIYYIDIKA.....RNITSHYLKLLEGI........------
F6BAJ4_METIK/76-570....LRLKDERKEVLEEYNQLFKNVFNLEGN..IKKGEGNHYILEINSKYLVDWFKENIPELFNKT.......G------

PF10596

I3L3Z8_HUMAN/86-244--------------FQVQLDLTGIFMH-----------------------------------------------------
A2EY65_TRIVA/1432-1590--------------FQVQLDLTGIFMH-----------------------------------------------------
A8BTS5_GIAIC/1337-1490--------------YRSQIDLTGVYMC-----------------------------------------------------
S3BP74_OPHP1/1452-1610--------------FRVQLDLTGIFLQ-----------------------------------------------------
Q8SVU6_ENCCU/1239-1384--------------YQVQLDQTGILMH-----------------------------------------------------
Q5KPW2_CRYNJ/1640-1796--------------FQVQLDLTGVFMH-----------------------------------------------------
K7VI98_MAIZE/675-841--------------FQ.ELD.......-----------------------------------------------------
G0W883_NAUDC/1515-1673--------------FVVQLDLTGIFLH-----------------------------------------------------
E6ZWZ5_SPORE/1485-1643--------------FQVQLDLCGVLMS-----------------------------------------------------
Q00RU5_OSTTA/1516-1682--------------XA...DSTTPLIR-----------------------------------------------------
E9AFM0_LEIMA/1514-1674--------------FESKVETTGVFMC-----------------------------------------------------
R0KWQ9_NOSB1/1205-1354--------------YETILEPTGVVMH-----------------------------------------------------

PF14623

Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
Q7S708_NEUCR/636-832--------------------------------------------------------------------------------
H6C7V0_EXODN/356-526--------------------------------------------------------------------------------
J3PIM9_GAGT3/593-786--------------------------------------------------------------------------------
G2XFI4_VERDV/568-734--------------------------------------------------------------------------------
G1XIH1_ARTOA/537-708--------------------------------------------------------------------------------
U7PS73_SPOS1/521-692--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
R8BIW3_TOGMI/471-637--------------------------------------------------------------------------------
C5GK44_AJEDR/553-713--------------------------------------------------------------------------------
S8AB86_DACHA/542-713--------------------------------------------------------------------------------
S3CBE6_OPHP1/613-780--------------------------------------------------------------------------------
G3JM09_CORMM/336-505--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
F0UB99_AJEC8/548-714--------------------------------------------------------------------------------
G0QP70_ICHMG/545-705--------------------------------------------------------------------------------
I7M030_TETTS/514-676--------------------------------------------------------------------------------
M7TBR0_EUTLA/533-699--------------------------------------------------------------------------------
C1G4L4_PARBD/546-712--------------------------------------------------------------------------------
N4VVV8_COLOR/552-719--------------------------------------------------------------------------------
F2SQT7_TRIRC/537-709--------------------------------------------------------------------------------
Q24C76_TETTS/502-665--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-749--------------------------------------------------------------------------------
G9MP19_HYPVG/551-718--------------------------------------------------------------------------------
T0JQ14_COLGC/569-736--------------------------------------------------------------------------------
J4WBA6_BEAB2/688-856--------------------------------------------------------------------------------
I7M701_TETTS/604-769--------------------------------------------------------------------------------
F7VWE7_SORMK/571-774--------------------------------------------------------------------------------
L8X395_THACA/606-772--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
G0RIM5_HYPJQ/574-741--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------
I1RVJ3_GIBZE/578-742--------------------------------------------------------------------------------
E9EQB7_METAR/534-699--------------------------------------------------------------------------------
J4URQ4_BEAB2/478-645--------------------------------------------------------------------------------
G4NA23_MAGO7/558-749--------------------------------------------------------------------------------

PF13403

Q1GGP9_RUEST/27-173--------------------------------------------------------------------------------
Q1GES6_RUEST/157-304--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
Q5LPM0_RUEPO/507-646--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
Q1GGN0_RUEST/194-341--------------------------------------------------------------------------------
Q5LSZ7_RUEPO/803-941--------------------------------------------------------------------------------
Q5LPJ7_RUEPO/175-322--------------------------------------------------------------------------------
Q1GMQ5_RUEST/293-432--------------------------------------------------------------------------------
Q5LLZ7_RUEPO/144-282--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
Q5LMP8_RUEPO/160-307--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
Q1GMV1_RUEST/833-976--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
Q5LUZ7_RUEPO/68-216--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
Q5LN78_RUEPO/204-343--------------------------------------------------------------------------------
C5AQV5_METEA/69-209--------------------------------------------------------------------------------
D5AV22_RHOCB/442-581--------------------------------------------------------------------------------
Q2YL23_BRUA2/15-148--------------------------------------------------------------------------------
Q3J294_RHOS4/14-159--------------------------------------------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503--------------------------------------------------------------------------------
HH_DROPS/255-475--------------------------------------------------------------------------------
IHH_DANRE/187-398--------------------------------------------------------------------------------
TWHH_DANRE/190-403--------------------------------------------------------------------------------
WRT4_CAEEL/327-547--------------------------------------------------------------------------------
Q80XI9_MOUSE/230-435--------------------------------------------------------------------------------
WRT6_CAEEL/375-583--------------------------------------------------------------------------------
A8X447_CAEBR/327-545--------------------------------------------------------------------------------
IHH_CHICK/188-394--------------------------------------------------------------------------------
SHH_CHICK/190-411--------------------------------------------------------------------------------
SHH_DANRE/187-404--------------------------------------------------------------------------------
WRT8_CAEEL/325-538--------------------------------------------------------------------------------
DHH_HUMAN/188-396--------------------------------------------------------------------------------
Q175B3_AEDAE/201-412--------------------------------------------------------------------------------
O45992_CAEEL/258-471--------------------------------------------------------------------------------
B0S8K0_DANRE/187-399--------------------------------------------------------------------------------
B3DJ46_DANRE/191-442--------------------------------------------------------------------------------
HH_DROMO/248-470--------------------------------------------------------------------------------
C3ZGW9_BRAFL/224-434--------------------------------------------------------------------------------
D6WCL7_TRICA/146-345--------------------------------------------------------------------------------
F6WZB6_XENTR/191-398--------------------------------------------------------------------------------
F6XBS5_CIOIN/294-549--------------------------------------------------------------------------------
F6YTG6_XENTR/190-394--------------------------------------------------------------------------------
G3V6T0_RAT/188-423--------------------------------------------------------------------------------
H2U1Q8_TAKRU/190-435--------------------------------------------------------------------------------
H2V9H2_TAKRU/190-402--------------------------------------------------------------------------------
H2XUY9_CIOIN/97-305--------------------------------------------------------------------------------
W4Y925_STRPU/189-401--------------------------------------------------------------------------------
W5K3H2_ASTMX/187-406--------------------------------------------------------------------------------

PF05203

U7Q1H8_SPOS1/262-759SNQADDKADPTDDSPAKEARKVLGDL......................EVNATLNRDETSPTVKKGFTGIGDETI.....
Q6FQS3_CANGA/285-698YRR....................................................................TQSIPLMEN
A3LP04_PICST/283-730.......................................................................DATI.....
J7RJ26_KAZNA/284-757VDRETEEAEVAKIKTG.........................................SVQEDGSVVFEDDVC........
C5M9I6_CANTT/244-713AENEEEFFNNLGAEKDE........................................AGDFTFDEFTDAMDELTI.....
Q6CL64_KLULA/284-692................................................................................
B6JY11_SCHJY/285-759KIVRGELG..........................................................VDGTFTSEVEDLVE
Q6BRM0_DEBHA/283-675................................................................................
A5DXZ0_LODEL/280-699................................................................................
H2APW1_KAZAF/284-774RDQGYEEAKLAGMAKGIPEEAGVVVF......................EDDKDGQPAENVLVALDKSSVQPF........
G7E5L8_MIXOS/284-742IAR...................................................................VQENV.....
F2TVI8_SALR5/1497-1695................................................................................
U9UGV8_RHIID/409-843................................................................................
C5DTL5_ZYGRC/284-732.......................................................................AKTV.....
G8JWX2_ERECY/284-671.......................................................................RLSL.....
A7TLB5_VANPO/284-715.......................................................................VGNV.....
VATA_YEAST/284-736.......................................................................AKTV.....
M3K3J1_CANMX/284-733.......................................................................DATI.....
G0V8Z3_NAUCC/284-799V.ESNKDIEIFEMNEAQIEEAEQTGVVAFDSNRKGDPSETELIEAEIFNESRPSTAGLFTPAAISPASLVTDLSV.....
C5DTQ4_ZYGRC/1-463.......................................................................AKHV.....
E9CG65_CAPO3/761-1238VSLTRA..............................................................LGSE........
G0W3J0_NAUDC/284-783SGSGNQDIELSKINNGKVETDGTITFD....................DDTEREPSEQELIDMESSGCKASSEMTV.....
G8ZLC3_TORDC/1-463.......................................................................AKHT.....
G8BNB8_TETPH/284-799S.KAQEEVEIAKLNNGKIEADGSIVFDDDIEGTPSE.EELIEIEMSSDASKASSNDASFARVNGNGSLECTDLSV.....

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------
Q9K122_NEIMB/1-137--------------------------------------------------------------------------------

PF14890

DPOL_THEAG/860-1392--------------------------------------------------------------------------------
D5VTT2_METIM/75-563--------------------------------------------------------------------------------
B7R5G0_9EURY/317-755--------------------------------------------------------------------------------
DNAB_NOSS1/393-817--------------------------------------------------------------------------------
I3RCL0_9EURY/841-1358--------------------------------------------------------------------------------
GLMS_METJA/76-570--------------------------------------------------------------------------------
DNAB_SYNY3/385-809--------------------------------------------------------------------------------
Q9UYA0_PYRAB/317-700--------------------------------------------------------------------------------
DPOL_THEKO/857-1388--------------------------------------------------------------------------------
I6TV89_9EURY/317-755--------------------------------------------------------------------------------
NDRZ_PYRFU/317-755--------------------------------------------------------------------------------
F6BAJ4_METIK/76-570--------------------------------------------------------------------------------

PF10596

I3L3Z8_HUMAN/86-244--------------------------------------------------------------------------------
A2EY65_TRIVA/1432-1590--------------------------------------------------------------------------------
A8BTS5_GIAIC/1337-1490--------------------------------------------------------------------------------
S3BP74_OPHP1/1452-1610--------------------------------------------------------------------------------
Q8SVU6_ENCCU/1239-1384--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1796--------------------------------------------------------------------------------
K7VI98_MAIZE/675-841--------------------------------------------------------------------------------
G0W883_NAUDC/1515-1673--------------------------------------------------------------------------------
E6ZWZ5_SPORE/1485-1643--------------------------------------------------------------------------------
Q00RU5_OSTTA/1516-1682--------------------------------------------------------------------------------
E9AFM0_LEIMA/1514-1674--------------------------------------------------------------------------------
R0KWQ9_NOSB1/1205-1354--------------------------------------------------------------------------------

PF14623

Q237Q6_TETTS/509-673--------------------------------------------------------K--V----------SR--D-LMWM
Q7S708_NEUCR/636-832--------------------------------------------------------L--V----------LR--S-LERL
H6C7V0_EXODN/356-526--------------------------------------------------------R--V----------AL--G-LLQL
J3PIM9_GAGT3/593-786--------------------------------------------------------R--V----------AA--E-MARL
G2XFI4_VERDV/568-734--------------------------------------------------------A--V----------AK--S-LKQI
G1XIH1_ARTOA/537-708--------------------------------------------------------A--V----------FD--G-LREL
U7PS73_SPOS1/521-692--------------------------------------------------------A--V----------CR--S-MATL
C7YL43_NECH7/586-752--------------------------------------------------------N--V----------GK--S-LLAL
R8BIW3_TOGMI/471-637--------------------------------------------------------A--V----------VR--S-LKGL
C5GK44_AJEDR/553-713--------------------------------------------------------S--V----------AR--S-LASL
S8AB86_DACHA/542-713--------------------------------------------------------K--V----------FD--G-LREL
S3CBE6_OPHP1/613-780--------------------------------------------------------A--V----------SR--S-LDTL
G3JM09_CORMM/336-505--------------------------------------------------------L--V----------CE--K-MAVL
C5FLY1_ARTOC/540-711--------------------------------------------------------L--I----------SK--K-LELL
F0UB99_AJEC8/548-714--------------------------------------------------------S--V----------VR--S-LASL
G0QP70_ICHMG/545-705--------------------------------------------------------K--I----------IS--D-LKKL
I7M030_TETTS/514-676--------------------------------------------------------A--V----------VE--D-LKQM
M7TBR0_EUTLA/533-699--------------------------------------------------------V--V----------IK--S-LDSL
C1G4L4_PARBD/546-712--------------------------------------------------------N--V----------VR--S-LASL
N4VVV8_COLOR/552-719--------------------------------------------------------K--V----------AR--S-LRRI
F2SQT7_TRIRC/537-709--------------------------------------------------------R--V----------SR--K-LELL
Q24C76_TETTS/502-665--------------------------------------------------------A--V----------IN--D-LMNM
D2VHB8_NAEGR/586-749--------------------------------------------------------Q--I----------VK--D-LSSM
G9MP19_HYPVG/551-718--------------------------------------------------------R--V----------RI--G-LMKL
T0JQ14_COLGC/569-736--------------------------------------------------------K--V----------VR--S-LRRI
J4WBA6_BEAB2/688-856--------------------------------------------------------S--I----------CD--K-IAVL
I7M701_TETTS/604-769--------------------------------------------------------K--I----------IT--E-LKKM
F7VWE7_SORMK/571-774--------------------------------------------------------L--V----------VQ--S-LAKL
L8X395_THACA/606-772--------------------------------------------------------R--V----------VE--S-LSQL
E4UR10_ARTGP/540-711--------------------------------------------------------L--V----------IK--Q-LELL
Q2GTB7_CHAGB/570-754--------------------------------------------------------T--V----------SK--A-LARL
E3QU32_COLGM/508-676--------------------------------------------------------K--V----------AG--D-LRAV
G0RIM5_HYPJQ/574-741--------------------------------------------------------R--V----------KS--G-LMKL
Q22N58_TETTS/494-660--------------------------------------------------------K--I----------VD--D-LSNL
A9UVU8_MONBE/587-772--------------------------------------------------------A--L----------RD--R-VALL
I1RVJ3_GIBZE/578-742--------------------------------------------------------V--V----------GK--S-LLGL
E9EQB7_METAR/534-699--------------------------------------------------------R--V----------GK--S-LAQL
J4URQ4_BEAB2/478-645--------------------------------------------------------A--V----------SK--A-LLGL
G4NA23_MAGO7/558-749--------------------------------------------------------A--C----------LG--A-LATL

PF13403

Q1GGP9_RUEST/27-173--------------------------------------------------------G..I.D.AI...V.TT..A.VTYI
Q1GES6_RUEST/157-304--------------------------------------------------------T..I.DVDT...T.VR..E.VTYV
A1AYR4_PARDP/380-527--------------------------------------------------------G..I.EVVE...D.MQ..E.VEYW
A8LN65_DINSH/175-322--------------------------------------------------------T..I.V.QV..YD.LE..P.VTYH
A1B4V8_PARDP/356-503--------------------------------------------------------G..F.DIAN...D.LQ..E.VEYF
A8LKN9_DINSH/122-260--------------------------------------------------------S..V.V.QA...P.RA..R.VTYI
Q28WJ0_JANSC/241-379--------------------------------------------------------S..I.Y.RD...P.RE..L.VTYF
Q5LPM0_RUEPO/507-646--------------------------------------------------------A..A.R.RV...E.GG..L.VTYM
Q28L14_JANSC/1268-1415--------------------------------------------------------G..V.EVVK...T.CE..R.VTYI
Q1GGN0_RUEST/194-341--------------------------------------------------------S..V.RQDQ...S.GM..P.VTYV
Q5LSZ7_RUEPO/803-941--------------------------------------------------------A..I.V.QE...P.PG..R.VDYY
Q5LPJ7_RUEPO/175-322--------------------------------------------------------T..I.R.QC..RP.NR..A.VTYY
Q1GMQ5_RUEST/293-432--------------------------------------------------------S..I.RILS...D.GT..Q.VCYV
Q5LLZ7_RUEPO/144-282--------------------------------------------------------T..I.R.IA...P.RH..K.LTYY
A8LR09_DINSH/158-296--------------------------------------------------------G..V.R.RV...P.KA..Q.VRYC
C7JHN5_ACEP3/423-565--------------------------------------------------------S..IFY.DT...S.IT..S.YDYY
Q28SX3_JANSC/168-306--------------------------------------------------------G..V.R.VA...E.GG..E.VTYF
A8LK48_DINSH/203-343--------------------------------------------------------G..V.RVMQ...G.CR..K.ITYV
Q5LMP8_RUEPO/160-307--------------------------------------------------------G..I.A.LR...PATG..P.VRYI
Q28UB5_JANSC/126-273--------------------------------------------------------R..I.D.VE...PMPR..A.VDYV
Q1GMV1_RUEST/833-976--------------------------------------------------------V..H.A.EE...R.AS..G.VCYI
A5FZD4_ACICJ/193-329--------------------------------------------------------M..I.APDR...R.IS..R.VTYF
B9JK11_AGRRK/201-336--------------------------------------------------------T..I.T.QE...TVLE..P.FEYY
Q28TH9_JANSC/752-887--------------------------------------------------------G..VGL.LR...P.EE..G.VTYI
A5G1S8_ACICJ/159-294--------------------------------------------------------T..I.R.QV...E.RR..S.VTYY
B0T7Q3_CAUSK/153-288--------------------------------------------------------T..I.V.QE...P.VE..T.VRYF
C7JE32_ACEP3/536-676--------------------------------------------------------T..ISY.AH...E.IR..S.YKCY
B8IA31_METNO/149-285--------------------------------------------------------T..I.TTAE...R.VD..S.VEYW
A5G006_ACICJ/174-309--------------------------------------------------------S..I.V.QE...Q.RR..S.FTYY
A5FW80_ACICJ/285-421--------------------------------------------------------T..I.TQDE...A.CL..A.ITYY
A8LLK3_DINSH/164-305--------------------------------------------------------G..V.EVAG...P.TR..H.ISYH
Q5FQG8_GLUOX/285-425--------------------------------------------------------S..IAY.DH...S.IT..D.YDYY
B0UJT1_METS4/116-254--------------------------------------------------------T..V.T.QE...E.VE..E.VTYW
Q5LUZ7_RUEPO/68-216--------------------------------------------------------G..IIE.TA...P.PT..P.IEVF
Q0BS96_GRABC/3687-3823--------------------------------------------------------S..I.VQEQ...H.VE..T.VSYV
B1M2P7_METRJ/65-199--------------------------------------------------------S..I.T.RG...EVVT..D.LTYW
A5FVL4_ACICJ/410-545--------------------------------------------------------S..I.R.QV...T.VP..T.VTYY
A4YQ57_BRASO/106-246--------------------------------------------------------T..I.T.ID...P.ASEKEVLEFF
A5FWA2_ACICJ/1192-1328--------------------------------------------------------T..I.LHDS...S.RF..A.VTYY
C3KQV1_RHISN/76-214--------------------------------------------------------S..I.T.PALPDA.RD..T.IEYF
A8LKB8_DINSH/19-167--------------------------------------------------------E..I.FVDM...S.AN..G.AIYH
Q5LN78_RUEPO/204-343--------------------------------------------------------S..V.L.PA...R.AR.LT.ATYA
C5AQV5_METEA/69-209--------------------------------------------------------S..V.F.RE...P.AT..Q.VTYW
D5AV22_RHOCB/442-581--------------------------------------------------------DPRF.RIAR...G.KR..R.VSYH
Q2YL23_BRUA2/15-148--------------------------------------------------------S..I.M.RI...PVER..T.LDYY
Q3J294_RHOS4/14-159--------------------------------------------------------G..I.R.EV...E.CS..G.TTYL

PF01079

Q7PXI1_ANOGA/295-503--------------------------------------------------------P--L---TGEGTIVVD--SIAASC
HH_DROPS/255-475--------------------------------------------------------P--L---TREGTIVVN--SVAASC
IHH_DANRE/187-398--------------------------------------------------------P--L---TAHGTVVVN--DVLTSC
TWHH_DANRE/190-403--------------------------------------------------------P--V---TAHGTIIVD--QVLASC
WRT4_CAEEL/327-547--------------------------------------------------------P--M---TSRGHLLVD--RIHASC
Q80XI9_MOUSE/230-435--------------------------------------------------------P--L---TRHGTLVVE--DVVASC
WRT6_CAEEL/375-583--------------------------------------------------------P--L---TSTGDIIVN--RVLASC
A8X447_CAEBR/327-545--------------------------------------------------------P--M---TSVGHLLVN--RIHTSC
IHH_CHICK/188-394--------------------------------------------------------P--L---TRHGTLVVD--DVVASC
SHH_CHICK/190-411--------------------------------------------------------P--L---TAQGTILIN--RVLASC
SHH_DANRE/187-404--------------------------------------------------------P--V---TAHGTIVVD--RILASC
WRT8_CAEEL/325-538--------------------------------------------------------P--M---TSLGHLLVN--QIHTSC
DHH_HUMAN/188-396--------------------------------------------------------P--L---TAHGTLLVN--DVLASC
Q175B3_AEDAE/201-412--------------------------------------------------------P--L---TREGTIVVD--SIAASC
O45992_CAEEL/258-471--------------------------------------------------------P--M---TSQGHLLVN--KIHTSC
B0S8K0_DANRE/187-399--------------------------------------------------------P--L---TSHGTVVVN--GIVSSC
B3DJ46_DANRE/191-442--------------------------------------------------------P--L---TEHGNLFVD--GVLASN
HH_DROMO/248-470--------------------------------------------------------P--L---TREGTIVVN--SVAASC
C3ZGW9_BRAFL/224-434--------------------------------------------------------P--L---TVHGTVVVD--NVAMSC
D6WCL7_TRICA/146-345--------------------------------------------------------P--L---TGVGTLVVN--DVVASC
F6WZB6_XENTR/191-398--------------------------------------------------------P--L---TQHGTLVVD--DVVVSC
F6XBS5_CIOIN/294-549--------------------------------------------------------P--L---TYSGTIIVG--GTAASC
F6YTG6_XENTR/190-394--------------------------------------------------------P--M---TEHGTLLVD--GVLTSC
G3V6T0_RAT/188-423--------------------------------------------------------P--L---TAHGTILIN--RVLASC
H2U1Q8_TAKRU/190-435--------------------------------------------------------P--L---TEAGSVFVD--GVLASS
H2V9H2_TAKRU/190-402--------------------------------------------------------P--V---TVQGNVVVD--EILASC
H2XUY9_CIOIN/97-305--------------------------------------------------------P--L---TAHGTVVVD--GIVASC
W4Y925_STRPU/189-401--------------------------------------------------------P--V---TRQGSLVID--DVAVSS
W5K3H2_ASTMX/187-406--------------------------------------------------------P--V---TSHGTIVVD--QVLASC

PF05203

U7Q1H8_SPOS1/262-759..FLRSSGTFAGAGKRKPLN..........TGNVFWAVANAMGVRGPDGQ.....HAKVVPDVLMCEPFEVR----EQFL
Q6FQS3_CANGA/285-698GKHVGNANITAEQEIEETMEVL.....SLNVTNHSSKLFHDLALSMINQD.....GSRSIPSAFTHEQLCVR----ESFV
A3LP04_PICST/283-730..SLHNSETRGKN.VRQNLN..........TGNLLWSLLAEICGKKENEM.....LFKSVPSFLRSESIAVR----EYFI
J7RJ26_KAZNA/284-757..TKHDGNSAQSLQVTMDIDDLAI.SLTGELGNILDRIVKSFGVRVAKEGNS.DLFERTVPKHLASDDLAVR----ENFI
C5M9I6_CANTT/244-713..NVHGAAASK...................KNNLLWNALKSLGFRAKSTD.....IVKSIPQHIAVDDIVVR----ESLI
Q6CL64_KLULA/284-692..SIVISQEPVQENKRRKVA..........QVSLVSKIVQE........S.....FSSGIPSFMMSENINVR----ESFL
B6JY11_SCHJY/285-759VVDFQEGSEIPAWEQRGNLSVSF....EGNTDNVFWKLISDLGFSGA.........VKSIPSHFAYESFPVR----EAFL
Q6BRM0_DEBHA/283-675..............................TVDFLWDVINSMSFKVEGKS......GKAIPSFLRTESFEVR----EQFL
A5DXZ0_LODEL/280-699..SIHSVNEKESVN................VARLLKQALDHFGFSTGS........NKVIPSSIAVENIEVR----ESFL
H2APW1_KAZAF/284-774..DIHSTPSESKNNLLLSLES.......EDKGAFFNKLVDTLHLRVKSSNANGSSYVKNVPLDLSSDDIVIR----EQFL
G7E5L8_MIXOS/284-742...AHSAATADDQKLHRDLHIKIVADGGETSHNVFWTTLSENGFRGASAK.....EPKAVPSWVASEPFGVR----EAFV
F2TVI8_SALR5/1497-1695........................................................YTQLPEAVQSNLLMYR----QVV.
U9UGV8_RHIID/409-843..ELHKAKLDDSEWKISFMSD.......NDIENGFYVLLQTLDILDT.........KKVTPVIMTDELDQVR----LPLL
C5DTL5_ZYGRC/284-732..NLYAKAIRDEG.VRKNLD..........THNLLWDAIVDLGYLKDD........SKNVPGYICSDSFQHR----EVFL
G8JWX2_ERECY/284-671..............................KNSIMADVIAKFGFTNAG........EKTIPSFLRSESITSR----ECFL
A7TLB5_VANPO/284-715..NFYGNSTSTNQN................VDNLLWDAIQELGFIQDG........NKTVPSFLSSDLIEIR----ETFL
VATA_YEAST/284-736..NLYSKVVRGNG.IRNNLN..........TENPLWDAIVGLGFLKDG........VKNIPSFLSTDNIGTR----ETFL
M3K3J1_CANMX/284-733..SLHNHEKRANGVVRRNQN..........TDNLFWTLLGDM.FESDGKK.....LIKTVPSFLRAETIAVR----EQFL
G0V8Z3_NAUCC/284-799..TLRGTGIGGAG.VSKERN..........LNNIFWDIVTSFGVRTNGQGS...TYEKSVPLHLSYDDIEVR----EQFI
C5DTQ4_ZYGRC/1-463..KLFYGSECDGHRRNRHLR..........KNNPFWNCVVNLKFKRELDG......EKQIPSFMWTEDLEVR----EAFL
E9CG65_CAPO3/761-1238..............................KQNPLLAAFRGLGYLRKPVKD....ISASFVRNVLTQSVSVR----RAVL
G0W3J0_NAUDC/284-783..ALGAPLVRGNA.IRQLLT..........ENNVFLKLIESFGVRKEN.GS...EYVKAIPMHLSYDDIEVR----EQFI
G8ZLC3_TORDC/1-463..RLYFGQEPDGNRRNRNLR..........KDNPFWNAVINLKFKRDLDG......EKQVPSFMWTEDIEVR----EAFL
G8BNB8_TETPH/284-799..ILRDSVANQAKR................ENNPFWNFVESLCVKSKNIPSLNESFEKHIPFELSYDNMEVR----EQFI

PF07591

A3DGR7_CLOTH/105-234----------------------------------------------------------------------FK----VDDF
Q5F6G7_NEIG1/1-137----------------------------------------------------------------------LT----VADW
Q9K122_NEIMB/1-137----------------------------------------------------------------------LT----VADW

PF14890

DPOL_THEAG/860-1392--------------------------------------------------------NKRIPSIIFDSSEPVR----WAFL
D5VTT2_METIM/75-563--------------------------------------------------------SKRTPEFIFKLDDDLV----ASYL
B7R5G0_9EURY/317-755--------------------------------------------------------DTGIPPEILRKGRAAV----LSFI
DNAB_NOSS1/393-817--------------------------------------------------------EKFVPQELFSQPIELI----SCFL
I3RCL0_9EURY/841-1358--------------------------------------------------------.KKIPEQIFTSPYNVR----LAFL
GLMS_METJA/76-570--------------------------------------------------------NERTPEFVFRLNNDLV----ASYL
DNAB_SYNY3/385-809--------------------------------------------------------EKFVPNQVFEQPQRAI----AIFL
Q9UYA0_PYRAB/317-700--------------------------------------------------------ENGIPPKILRKGKNAV----LSFI
DPOL_THEKO/857-1388--------------------------------------------------------NKRIPEFVFTSPKGVR----LAFL
I6TV89_9EURY/317-755--------------------------------------------------------DNGIPPQILKEGKNAV----LSFI
NDRZ_PYRFU/317-755--------------------------------------------------------DNGIPPQILKEGKNAV----LSFI
F6BAJ4_METIK/76-570--------------------------------------------------------NERTPKFVFRLNNDLV----ASYL

PF10596

I3L3Z8_HUMAN/86-244--------------------------------------------------------GKI.........PTLK----ISLI
A2EY65_TRIVA/1432-1590--------------------------------------------------------GKI.........PSLK----VSLI
A8BTS5_GIAIC/1337-1490--------------------------------------------------------GKL.........ATLK----TAYV
S3BP74_OPHP1/1452-1610--------------------------------------------------------AKL.........PTLK----ISFV
Q8SVU6_ENCCU/1239-1384--------------------------------------------------------GKL.........PTLK----ISFI
Q5KPW2_CRYNJ/1640-1796--------------------------------------------------------GKI.........PTLK----ISLI
K7VI98_MAIZE/675-841--------------------------------------------------------.............ALE----IETV
G0W883_NAUDC/1515-1673--------------------------------------------------------GKI.........PTLK----ISLV
E6ZWZ5_SPORE/1485-1643--------------------------------------------------------GKM.........PSLK----ISYI
Q00RU5_OSTTA/1516-1682--------------------------------------------------------TQLQAWEPDVETPSLG----DSLP
E9AFM0_LEIMA/1514-1674--------------------------------------------------------GKL.........ETIK----KSLI
R0KWQ9_NOSB1/1205-1354--------------------------------------------------------GKL.........PTLK----MSYL

PF14623

Q237Q6_TETTS/509-673KG-------------------YFK--------------------------------------.GHVK.LQNSPSIRDQAT
Q7S708_NEUCR/636-832.Q-------------------SSP--------------------------------------.DGLI.LGEG.VDRDLQT
H6C7V0_EXODN/356-526.P-------------------KGG--------------------------------------.SGHF.RCSG.VKRDPVS
J3PIM9_GAGT3/593-786PR-------------------GGR--------------------------------------.DGVV.LCGG.VRRSRVT
G2XFI4_VERDV/568-734.G-------------------IRK--------------------------------------.GGIV.LGGG.TRRDEKT
G1XIH1_ARTOA/537-708KG-------------------FYE--------------------------------------.DGVC.ECEG.VLRDAET
U7PS73_SPOS1/521-692.D-------------------VRK--------------------------------------.DGLV.VNGG.SSRS...
C7YL43_NECH7/586-752.G-------------------RRR--------------------------------------.HGVV.IGGG.VERDQET
R8BIW3_TOGMI/471-637.R-------------------LDH--------------------------------------.NGVA.LGGG.VKRSKSN
C5GK44_AJEDR/553-713.P-------------------RDV--------------------------------------.NGVL.RCSGEIRKN...
S8AB86_DACHA/542-713KG-------------------FYE--------------------------------------.DGVC.ECEG.IVRDAET
S3CBE6_OPHP1/613-780.D-------------------VRK--------------------------------------.DGLV.INGG.STR....
G3JM09_CORMM/336-505..-------------------RPV--------------------------------------.AGAY.QCYG.VTRDQRT
C5FLY1_ARTOC/540-711.P-------------------KLS--------------------------------------.NGLL.HCIG.VQRSPES
F0UB99_AJEC8/548-714.P-------------------RDV--------------------------------------.NGIL.RCSG.MKRNPLT
G0QP70_ICHMG/545-705KG-------------------FQN--------------------------------------.GFVE.IYNKQFLRDQFS
I7M030_TETTS/514-676KG-------------------WKE--------------------------------------.GKVI.IRSR..VRDQIT
M7TBR0_EUTLA/533-699.S-------------------SGR--------------------------------------.NGTK.ECRG.VWRDKVT
C1G4L4_PARBD/546-712.P-------------------RDT--------------------------------------.NGRL.RCSG.MKRNSLT
N4VVV8_COLOR/552-719.G-------------------VRA--------------------------------------.DGIA.VGGG.VSRHVGT
F2SQT7_TRIRC/537-709.P-------------------KLP--------------------------------------.NGLL.HSIG.VERSPES
Q24C76_TETTS/502-665KG-------------------WKE--------------------------------------.GKVL.ITAR..IKSEIT
D2VHB8_NAEGR/586-749KG-------------------YDL--------------------------------------.GMIE.MNKYDLKRDPNT
G9MP19_HYPVG/551-718EE-------------------AGR--------------------------------------.KGVV.KGGG.VDRDPMT
T0JQ14_COLGC/569-736.G-------------------VRR--------------------------------------.NGVA.TGGG.VSRNSRT
J4WBA6_BEAB2/688-856..-------------------RRI--------------------------------------.NGAY.QCYG.VTRDRKT
I7M701_TETTS/604-769IG-------------------WEN--------------------------------------.GYVT.LSTDCMIRDPTT
F7VWE7_SORMK/571-774.Q-------------------CNQ--------------------------------------.DGLV.MGGG.VKRDGQT
L8X395_THACA/606-772DG-------------------YYD--------------------------------------KSGVV.DCAG.VVRQYRV
E4UR10_ARTGP/540-711.P-------------------KLP--------------------------------------.NGLL.HCVG.VERSPES
Q2GTB7_CHAGB/570-754.P-------------------QRA--------------------------------------.GGVA.MGAG.LTRDPVT
E3QU32_COLGM/508-676.G-------------------VGR--------------------------------------.NGVV.VGRG.VVRNPGT
G0RIM5_HYPJQ/574-741DS-------------------AGR--------------------------------------.KGVV.QGRG.IERDAMT
Q22N58_TETTS/494-660QG-------------------FRE--------------------------------------.GYVI.VNQQQTKRDKLT
A9UVU8_MONBE/587-772AA-------------------RAG--------------------------------------TARTLWLAPQAFVRDTAT
I1RVJ3_GIBZE/578-742.E-------------------RRS--------------------------------------.NGVV.VGNG.VERD.ES
E9EQB7_METAR/534-699.G-------------------VDK--------------------------------------.LGVV.EGRG.VDRD.GS
J4URQ4_BEAB2/478-645.R-------------------VGL--------------------------------------.RGEF.IGGD.VGRDTQS
G4NA23_MAGO7/558-749.P-------------------APK--------------------------------------.NGVA.TSAG.VLRD.AT

PF13403

Q1GGP9_RUEST/27-173HF-------------------MFN--------------------------------------QHEVV-LSDGAWTESFQP
Q1GES6_RUEST/157-304HL-------------------LLE--------------------------------------QHQVI-WANGVETESFHP
A1AYR4_PARDP/380-527HF-------------------MFD--------------------------------------RHEVV-FSNGAPTESLFT
A8LN65_DINSH/175-322HF-------------------MFD--------------------------------------RHQIV-RADGIWAESLRP
A1B4V8_PARDP/356-503HM-------------------LFD--------------------------------------RHEVV-LSNGAETESLYT
A8LKN9_DINSH/122-260HL-------------------LFA--------------------------------------RHEIV-YAEGIPSESFHP
Q28WJ0_JANSC/241-379HV-------------------MFD--------------------------------------AHQII-LAEGTWAESLYI
Q5LPM0_RUEPO/507-646HL-------------------MLD--------------------------------------RHEVI-YANDAATESFFP
Q28L14_JANSC/1268-1415HV-------------------MCD--------------------------------------AHEVI-RVDDAWTESFQP
Q1GGN0_RUEST/194-341HL-------------------MFD--------------------------------------RHEVI-EADGLYSESYHP
Q5LSZ7_RUEPO/803-941HM-------------------LFD--------------------------------------QHELV-LSEQAWSESFHP
Q5LPJ7_RUEPO/175-322HL-------------------AFE--------------------------------------RHLLL-RAHGLLSESIFL
Q1GMQ5_RUEST/293-432HI-------------------LFD--------------------------------------RHEIV-RANGLDSESYHP
Q5LLZ7_RUEPO/144-282HL-------------------LFA--------------------------------------RHEIV-FSEGIPTESYFP
A8LR09_DINSH/158-296HF-------------------LCE--------------------------------------SHAIV-EAEGCLSESLYP
C7JHN5_ACEP3/423-565HV-------------------ETE--------------------------------------QHSVI-TADGMLTESYLD
Q28SX3_JANSC/168-306HV-------------------LLD--------------------------------------GHRTL-LAEGVEAESLHP
A8LK48_DINSH/203-343HL-------------------VFD--------------------------------------RHEVV-RAEGAWTESFFP
Q5LMP8_RUEPO/160-307HF-------------------ALD--------------------------------------RHEIV-FANGLPAETLLL
Q28UB5_JANSC/126-273HI-------------------LLD--------------------------------------GHGLV-KVEGLWAETLFL
Q1GMV1_RUEST/833-976HL-------------------MTE--------------------------------------AHQVI-FVDGCATETFWP
A5FZD4_ACICJ/193-329HV-------------------ELD--------------------------------------RHDIL-LAEGAPAESFLD
B9JK11_AGRRK/201-336HI-------------------ELE--------------------------------------QHSII-LAEGAQTETYLD
Q28TH9_JANSC/752-887HL-------------------LFE--------------------------------------SHQVV-FAEGIASESFYP
A5G1S8_ACICJ/159-294HV-------------------ELP--------------------------------------AHAIL-LAENMPAESYLE
B0T7Q3_CAUSK/153-288HI-------------------ELD--------------------------------------AHDVV-LAEGLACESYLD
C7JE32_ACEP3/536-676HI-------------------ETR--------------------------------------DHAVI-RANGLFTESYLD
B8IA31_METNO/149-285HV-------------------ELD--------------------------------------RHDVL-LAEGAPSESFVD
A5G006_ACICJ/174-309HI-------------------ELE--------------------------------------THDIL-LAEGLPTESYLD
A5FW80_ACICJ/285-421HV-------------------ELA--------------------------------------RHDVI-LAEGAPCESYLD
A8LLK3_DINSH/164-305HL-------------------LFA--------------------------------------QHEVL-QAEGLACESLFW
Q5FQG8_GLUOX/285-425HI-------------------ETE--------------------------------------QHSVL-VANGALSESFLD
B0UJT1_METS4/116-254HV-------------------ELD--------------------------------------SHDIL-IANGQPSESYLE
Q5LUZ7_RUEPO/68-216HI-------------------CLR--------------------------------------RHAVI-NVDGLQFETYHP
Q0BS96_GRABC/3687-3823HI-------------------ELD--------------------------------------THDVV-FAEGAASESYVE
B1M2P7_METRJ/65-199HV-------------------ELD--------------------------------------SHDLL-IAEGTPAESFLP
A5FVL4_ACICJ/410-545HV-------------------ELE--------------------------------------SHDVV-LAEMLPAETYLD
A4YQ57_BRASO/106-246HV-------------------KLA--------------------------------------SHNVI-YAEGAPCETLLN
A5FWA2_ACICJ/1192-1328HV-------------------ELA--------------------------------------RHAVI-RAENLPCETYRD
C3KQV1_RHISN/76-214HI-------------------VLD--------------------------------------THEVV-LAEGAPVETCLL
A8LKB8_DINSH/19-167GL-------------------VFD--------------------------------------RPQAL-MVNGVLVESATP
Q5LN78_RUEPO/204-343QL-------------------LLP--------------------------------------TNEAM-ITAGALAESLFI
C5AQV5_METEA/69-209HI-------------------ELD--------------------------------------AHDIL-LAEGLAAESYYD
D5AV22_RHOCB/442-581HI-------------------LLE--------------------------------------RHGIV-TANGLACESLYP
Q2YL23_BRUA2/15-148NI-------------------VLD--------------------------------------RHAVV-LAEGAAVETFLM
Q3J294_RHOS4/14-159HL-------------------MFD--------------------------------------RHEVV-LANGAWTESFQP

PF01079

Q7PXI1_ANOGA/295-503YA-------------------LID--------------------------------------SQTVAHWSFLPY.RLAEK
HH_DROPS/255-475YA-------------------VID--------------------------------------SQSLAHWGLAPM.RILAM
IHH_DANRE/187-398YA-------------------AVN--------------------------------------RQRLAHWAFAPL.RLLYS
TWHH_DANRE/190-403YA-------------------VIE--------------------------------------NHKWAHWAFAPV.RLCHK
WRT4_CAEEL/327-547HS-------------------ETD--------------------------------------NYSLQNTFFTNVLRWKSQ
Q80XI9_MOUSE/230-435FA-------------------AVA--------------------------------------DHHLAQLAFWPL.RLFPS
WRT6_CAEEL/375-583HS-------------------NLA--------------------------------------LKSLQQTFFSLYKRTSSV
A8X447_CAEBR/327-545HS-------------------ETD--------------------------------------NHTLQDTFFANALHFKNL
IHH_CHICK/188-394FA-------------------LVR--------------------------------------EQQLAQMAFWPL.RLYHS
SHH_CHICK/190-411YA-------------------VIE--------------------------------------EHSWAHWAFAPF.RLAQG
SHH_DANRE/187-404YA-------------------VIE--------------------------------------DQGLAHLAFAPA.RLYYY
WRT8_CAEEL/325-538HS-------------------EID--------------------------------------HHLLQNSFFKHVLKLKNR
DHH_HUMAN/188-396YA-------------------VLE--------------------------------------SHQWAHRAFAPL.RLLHA
Q175B3_AEDAE/201-412YA-------------------LID--------------------------------------SQSVAHLSFLPY.RAVQK
O45992_CAEEL/258-471HS-------------------EVD--------------------------------------HHILQNSFFKHVLKWKNK
B0S8K0_DANRE/187-399YA-------------------AVD--------------------------------------QHWLAHWAFGPL.RVLYN
B3DJ46_DANRE/191-442YA-------------------TFQ--------------------------------------DHGLAHTVFWPF.RVLFV
HH_DROMO/248-470YA-------------------VIS--------------------------------------SQSLAHWGLAPM.RLWST
C3ZGW9_BRAFL/224-434YA-------------------LIE--------------------------------------SQALAHWVFAPF.RLYYQ
D6WCL7_TRICA/146-345YA-------------------TID--------------------------------------SQWLAHWAFAPI.RWVAK
F6WZB6_XENTR/191-398FA-------------------LVQ--------------------------------------KQRLAQMVYWPL.RVLYN
F6XBS5_CIOIN/294-549YA-------------------VIE--------------------------------------SDVIAHTVVSPF.RYYHW
F6YTG6_XENTR/190-394YA-------------------TVE--------------------------------------SHTLAHASLAPL.RLFKG
G3V6T0_RAT/188-423YA-------------------VIE--------------------------------------EHSWAHRAFAPF.RLAHA
H2U1Q8_TAKRU/190-435YA-------------------LVE--------------------------------------DHRLAHWAFGPV.RLLSS
H2V9H2_TAKRU/190-402YA-------------------VIE--------------------------------------DHDLAHWALAPV.RLAHW
H2XUY9_CIOIN/97-305YG-------------------VIG--------------------------------------SETLAHAAMLPI.RSFPY
W4Y925_STRPU/189-401YA-------------------VMR--------------------------------------DEWIAHASFAPV.RWYSY
W5K3H2_ASTMX/187-406YA-------------------VIQ--------------------------------------DHWLAHWAFAPV.RLAHS

PF05203

U7Q1H8_SPOS1/262-759AG-------------------LID.SDGHVKHGPP......SATIKTI.......YTTI...CDGVIKIARSLGVRVSVS
Q6FQS3_CANGA/285-698AG-------------------ILD.MQGC............NIENGVE.......IDSS...INGLAKLSRSLGLRCNKS
A3LP04_PICST/283-730SG-------------------LVD.SDGHVKRDEADKC..YSATVKTI.......YPAV...RDGLVSVARSLGIQTSVS
J7RJ26_KAZNA/284-757AG-------------------LVD.SIGYVDRHYGGTV..KSATIPAL.......DMHA...VSGFVKVARSLGIKVSIA
C5M9I6_CANTT/244-713AG-------------------LVD.AAGNVETKSNGS...IEAVVRTS.......FRHV...ARGLAKIAHSLGIESSIN
Q6CL64_KLULA/284-692AG-------------------IVD.SQNQKLDD........TVALKTL.......SVKT...HDGIARLARSLGIRVSGK
B6JY11_SCHJY/285-759AG-------------------LID.ADGSVKHGDLS.....SAHLSTT.......SPKV...RDGTVRIARSLGISAYVS
Q6BRM0_DEBHA/283-675AG-------------------LID.SDGIVTKNPL......SASVRTN.......SSKV...GEGVIAVSRSLGICTSVK
A5DXZ0_LODEL/280-699AG-------------------FVDASQTELKQDSA......IINIGAS.......NKSI...IANIVKLARSLGIKAACK
H2APW1_KAZAF/284-774AG-------------------LLD.SRKC............STDFITY.......SPKI...SMGVIRLARSLGIKAAVN
G7E5L8_MIXOS/284-742AG-------------------MVD.SAGQVKASKDRAM.RRNVDILTG.......HASV...CDGLVRVARSLGIRVSAS
F2TVI8_SALR5/1497-1695..-------------------..................................................SLGEAGTHA
U9UGV8_RHIID/409-843AG-------------------ILD.ISSHLLEE........NRNYRYV.......YRSLHERCEQICNLANLSGFYSTNI
C5DTL5_ZYGRC/284-732AG-------------------IID.STGYVSDE........TATVKTI.......DQSV...MTGTVAVARSLGINVSVD
G8JWX2_ERECY/284-671AG-------------------LVD.AAGSVNEATGD.....LAAVISL.......PRSS...LEGASKVAGSLGLEIKLE
A7TLB5_VANPO/284-715AG-------------------LID.SNGSVDNNKQDI....SCTIELE.......DNKV...MSGIVSLIRSLGLKADVT
VATA_YEAST/284-736AG-------------------LID.SDGYVTDEHGI.....KATIKTI.......HTSV...RDGLVSLARSLGLVVSVN
M3K3J1_CANMX/284-733AG-------------------LVD.ADGHVKKDDVTDA.CLSATVKTI.......YPAI...RDGLVTLARSLGIVASVT
G0V8Z3_NAUCC/284-799AG-------------------LID.SDGYVKSADNRF....SATVTTI.......YKGV...SEGLIRLARSLGIRVSVS
C5DTQ4_ZYGRC/1-463AG-------------------LID.SDGYVSKRKNPLD.SFKVSIQTV.......YPSI...MGGIVHITRSLGMPVTVT
E9CG65_CAPO3/761-1238AG-------------------FLD.GEGSLVACNSCGSACAYSAVQAVGAARSAHHGDI...LRLIQHVARSLGLLCNVY
G0W3J0_NAUDC/284-783AG-------------------LVD.SIGHVK..RTSNGTIECAAISTA.......YKSV...SEGLIRLARSLGIKVSVT
G8ZLC3_TORDC/1-463AG-------------------LID.SDGYVVKRNEGPD.AFKASIQTI.......YPSI...MNGIVHVSRSLGIASTVT
G8BNB8_TETPH/284-799AG-------------------LID.ATGSVKKDKASNS..TKATVATA.......FKGV...AEGLVRIARSLGIKVYVT

PF07591

A3DGR7_CLOTH/105-234HT-------------------YHV---------------------------------------G.....NNGILVHNA--
Q5F6G7_NEIG1/1-137HT-------------------YFV---------------------------------------KGNQAETEGVWVHNS--
Q9K122_NEIMB/1-137HT-------------------YFV---------------------------------------KGNRAETEGVWVHND--

PF14890

DPOL_THEAG/860-1392RA-------------------YFVGDGDI......HPSKRLRLSTKSELL------------ANQLVFLLNSLGVSSI..
D5VTT2_METIM/75-563RG-------------------LFDAEGCV.....GTDAKEISIVMTSEQL------------IREIQFLLLRFGILASYS
B7R5G0_9EURY/317-755TG-------------------LFDAEGHV......NSKPGVELGMVNRKL------------IEDIAHYLSSLGIKARMR
DNAB_NOSS1/393-817RH-------------------LWSTDGSIKLVGGKKPRPIAYYATSSYRL------------AVDVQTLLLKLGINATLK
I3RCL0_9EURY/841-1358EG-------------------YL..NGNI......HTSKFL...IKSELL------------TNEIIFLLNSLGVSSI..
GLMS_METJA/76-570RG-------------------IFDAEGYI.....RAEAKQIGIGMTSKCF------------IKEIQFLLLRFGILASYS
DNAB_SYNY3/385-809RH-------------------LWSTDGCVKLIVEKSSRPVAYYATSSEKL------------AKDVQSLLLKLGINARLS
Q9UYA0_PYRAB/317-700TG-------------------LFDAEGHV......NDKSGIELGMVNKKL------------IEAVTHYLNSLGIKARMR
DPOL_THEKO/857-1388EG-------------------YFIGDGDV......HPNKRLRLSTKSELL------------ANQLVLLLNSVGVSAV..
I6TV89_9EURY/317-755AG-------------------LFDAEGHV......SNKPGIELGMVNKRL------------IEDVTHYLNALGIKARIR
NDRZ_PYRFU/317-755AG-------------------LFDAEGHV......SNKPGIELGMVNKRL------------IEDVTHYLNALGIKARIR
F6BAJ4_METIK/76-570RG-------------------IFDAEGYM.....GVNTKQIGIEMTSECL------------IKEIQFLLLRFGILASYS

PF10596

I3L3Z8_HUMAN/86-244Q....................IFR--------------------------------------AHLWQKIHESIVMDLCQV
A2EY65_TRIVA/1432-1590Q....................LFR--------------------------------------GHMWQKTHESIVMDVMQV
A8BTS5_GIAIC/1337-1490S....................LFR--------------------------------------GHAWPMIHSSLVKTLLAI
S3BP74_OPHP1/1452-1610Q....................IFR--------------------------------------AHLWQKIHESVVMDLCQV
Q8SVU6_ENCCU/1239-1384Q....................IFR--------------------------------------NQLWRRIHESVVGGLCDV
Q5KPW2_CRYNJ/1640-1796Q....................IFR--------------------------------------AHLWQKIHESVVMDLCQV
K7VI98_MAIZE/675-841QKETIHPRKSYKMNSFCADILLFA--------------------------------------AHRWQMSKPSLVSESKDV
G0W883_NAUDC/1515-1673Q....................IFR--------------------------------------AHLWQKIHESVVFDICQI
E6ZWZ5_SPORE/1485-1643Q....................LFR--------------------------------------AHLWQKIHESVVMDLCQV
Q00RU5_OSTTA/1516-1682GTPS.................ATK--------------------------------------NSPLSKWHGAAAR.LMAN
E9AFM0_LEIMA/1514-1674K....................IFS--------------------------------------GSLWEKSHGAVVNDVASK
R0KWQ9_NOSB1/1205-1354G....................IFK--------------------------------------NNLWKKIQESLVYDFFKT

PF14623

Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
Q7S708_NEUCR/636-832--------------------------------------------------------------------------------
H6C7V0_EXODN/356-526--------------------------------------------------------------------------------
J3PIM9_GAGT3/593-786--------------------------------------------------------------------------------
G2XFI4_VERDV/568-734--------------------------------------------------------------------------------
G1XIH1_ARTOA/537-708--------------------------------------------------------------------------------
U7PS73_SPOS1/521-692--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
R8BIW3_TOGMI/471-637--------------------------------------------------------------------------------
C5GK44_AJEDR/553-713--------------------------------------------------------------------------------
S8AB86_DACHA/542-713--------------------------------------------------------------------------------
S3CBE6_OPHP1/613-780--------------------------------------------------------------------------------
G3JM09_CORMM/336-505--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
F0UB99_AJEC8/548-714--------------------------------------------------------------------------------
G0QP70_ICHMG/545-705--------------------------------------------------------------------------------
I7M030_TETTS/514-676--------------------------------------------------------------------------------
M7TBR0_EUTLA/533-699--------------------------------------------------------------------------------
C1G4L4_PARBD/546-712--------------------------------------------------------------------------------
N4VVV8_COLOR/552-719--------------------------------------------------------------------------------
F2SQT7_TRIRC/537-709--------------------------------------------------------------------------------
Q24C76_TETTS/502-665--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-749--------------------------------------------------------------------------------
G9MP19_HYPVG/551-718--------------------------------------------------------------------------------
T0JQ14_COLGC/569-736--------------------------------------------------------------------------------
J4WBA6_BEAB2/688-856--------------------------------------------------------------------------------
I7M701_TETTS/604-769--------------------------------------------------------------------------------
F7VWE7_SORMK/571-774--------------------------------------------------------------------------------
L8X395_THACA/606-772--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
G0RIM5_HYPJQ/574-741--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------
I1RVJ3_GIBZE/578-742--------------------------------------------------------------------------------
E9EQB7_METAR/534-699--------------------------------------------------------------------------------
J4URQ4_BEAB2/478-645--------------------------------------------------------------------------------
G4NA23_MAGO7/558-749--------------------------------------------------------------------------------

PF13403

Q1GGP9_RUEST/27-173--------------------------------------------------------------------------------
Q1GES6_RUEST/157-304--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
Q5LPM0_RUEPO/507-646--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
Q1GGN0_RUEST/194-341--------------------------------------------------------------------------------
Q5LSZ7_RUEPO/803-941--------------------------------------------------------------------------------
Q5LPJ7_RUEPO/175-322--------------------------------------------------------------------------------
Q1GMQ5_RUEST/293-432--------------------------------------------------------------------------------
Q5LLZ7_RUEPO/144-282--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
Q5LMP8_RUEPO/160-307--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
Q1GMV1_RUEST/833-976--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
Q5LUZ7_RUEPO/68-216--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
Q5LN78_RUEPO/204-343--------------------------------------------------------------------------------
C5AQV5_METEA/69-209--------------------------------------------------------------------------------
D5AV22_RHOCB/442-581--------------------------------------------------------------------------------
Q2YL23_BRUA2/15-148--------------------------------------------------------------------------------
Q3J294_RHOS4/14-159--------------------------------------------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503.................------------...------------------------------------------------
HH_DROPS/255-475.................------------...------------------------------------------------
IHH_DANRE/187-398.................------------...------------------------------------------------
TWHH_DANRE/190-403.................------------...------------------------------------------------
WRT4_CAEEL/327-547.................------------...------------------------------------------------
Q80XI9_MOUSE/230-435.................------------...------------------------------------------------
WRT6_CAEEL/375-583.................------------...------------------------------------------------
A8X447_CAEBR/327-545.................------------...------------------------------------------------
IHH_CHICK/188-394.................------------...------------------------------------------------
SHH_CHICK/190-411.................------------...------------------------------------------------
SHH_DANRE/187-404.................------------...------------------------------------------------
WRT8_CAEEL/325-538.................------------...------------------------------------------------
DHH_HUMAN/188-396.................------------...------------------------------------------------
Q175B3_AEDAE/201-412.................------------...------------------------------------------------
O45992_CAEEL/258-471.................------------...------------------------------------------------
B0S8K0_DANRE/187-399.................------------...------------------------------------------------
B3DJ46_DANRE/191-442FFNKEMEEDLQRVAVPY------------ICS------------------------------------------------
HH_DROMO/248-470.................------------...------------------------------------------------
C3ZGW9_BRAFL/224-434.................------------...------------------------------------------------
D6WCL7_TRICA/146-345.................------------...------------------------------------------------
F6WZB6_XENTR/191-398.................------------...------------------------------------------------
F6XBS5_CIOIN/294-549.................------------...------------------------------------------------
F6YTG6_XENTR/190-394.................------------...------------------------------------------------
G3V6T0_RAT/188-423.................------------...------------------------------------------------
H2U1Q8_TAKRU/190-435.................------------...------------------------------------------------
H2V9H2_TAKRU/190-402.................------------...------------------------------------------------
H2XUY9_CIOIN/97-305.................------------...------------------------------------------------
W4Y925_STRPU/189-401.................------------...------------------------------------------------
W5K3H2_ASTMX/187-406.................------------...------------------------------------------------

PF05203

U7Q1H8_SPOS1/262-759TEAATV..VRGVSHKKA...YAVFLSDPENTG------------------------------------------------
Q6FQS3_CANGA/285-698S...................NLLKLS......------------------------------------------------
A3LP04_PICST/283-730VEEAK..EVNSVKHQES...YAIYMA...NSS------------------------------------------------
J7RJ26_KAZNA/284-757DNNDVE.K............QCVTLS....GD------------------------------------------------
C5M9I6_CANTT/244-713IKDTHI.DAAGVRQEFA...CIVNLT....GA------------------------------------------------
Q6CL64_KLULA/284-692KQNQE...............YTLTLS....GD------------------------------------------------
B6JY11_SCHJY/285-759TKSEQI.....VDGVYYPETYTIELE...GNE------------------------------------------------
Q6BRM0_DEBHA/283-675AENES...............YIISMT...RNS------------------------------------------------
A5DXZ0_LODEL/280-699DDGL................NRITLE....GP------------------------------------------------
H2APW1_KAZAF/284-774DGNS...DYGSVRGDSLPPKYKIQLG....GT------------------------------------------------
G7E5L8_MIXOS/284-742MQAV...........NA...YAVFLS...GGE------------------------------------------------
F2TVI8_SALR5/1497-1695EAGECT.T............YKIAAV......------------------------------------------------
U9UGV8_RHIID/409-843VSNMKE.CSDNITTPSC.....CTII...SGN------------------------------------------------
C5DTL5_ZYGRC/284-732VEV....DEDGVDRSFV...YAIYMD...RSD------------------------------------------------
G8JWX2_ERECY/284-671P...................GFLKIC...GGS------------------------------------------------
A7TLB5_VANPO/284-715QSSGKLNDVC..........YNVTVK...GGE------------------------------------------------
VATA_YEAST/284-736AEPAKV.DMNGTKHKIS...YAIYMS...GGD------------------------------------------------
M3K3J1_CANMX/284-733TEAAK..TVGGVSHQEA...YVVSLG...ASS------------------------------------------------
G0V8Z3_NAUCC/284-799TEKEHV.DKNNVKHKSC...YRVFLS....GE------------------------------------------------
C5DTQ4_ZYGRC/1-463TRSAKT.ATIVGRTVSCHFTYDCHLA...GRT------------------------------------------------
E9CG65_CAPO3/761-1238ARKTASFTA....................SSQ------------------------------------------------
G0W3J0_NAUDC/284-783TKRECL.DKHNVKHQIC...YSICLS....GA------------------------------------------------
G8ZLC3_TORDC/1-463TRSART.ETIEGRKVNCHFTYDCHIA...GRT------------------------------------------------
G8BNB8_TETPH/284-799AEKNCM.DKNDVKHQLY...YSISLS....GE------------------------------------------------

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------
Q9K122_NEIMB/1-137--------------------------------------------------------------------------------

PF14890

DPOL_THEAG/860-1392...KIGFD.SGVYRVYINEDLPFLQTSRQKNTYYPNLIPKEVLEEIFGR...............................
D5VTT2_METIM/75-563RARGKKESWKDSHTLIISDKKSLELFKKYIGF..TAEDKMEKLDKILSKMKGLNFKYISVPLTKKEIIEFLDVSLKT...
B7R5G0_9EURY/317-755EKPR..KD.GVDYIVHVEEYSSLLRFYELIGKNLQNEEKRKKLETLLEKHKGGTFGLSLNFEAFKRWASKHGVEFKTNGS
DNAB_NOSS1/393-817LVPQVGKG.RNQYHVKITGKPDLDLFIKKVGA..VGEYKLNSLQQIFEYLENCIHNTNRDIIPKDVWKKIVVPAMQSVQL
I3RCL0_9EURY/841-1358...KIDKD.SNSYSVYINEELS.....EKKNAYNPYSLPKDVLEEVLRK...............................
GLMS_METJA/76-570KIKRKEENWNNTHKLLISDKKSFELFKKYIGF..TAKDKMEKLEAILNKMKGLNFRYISIPLTKKEIREFVGVPLKT...
DNAB_SYNY3/385-809KISQNGKG.RDNYHVTITGQADLQIFVDQIGA..VDKDKQASVEEIKTHIAQHQANTNRDVIPKQIWKTYVLPQIQIKGI
Q9UYA0_PYRAB/317-700EKRR..KN.GIDYIMHVEEYSSLLRFYELIGKHLQNNEKKEKLEILLHKHNGGAFDLSLNFNAFKEWASRYGVEFKTNGN
DPOL_THEKO/857-1388...KLGHD.SGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGK...............................
I6TV89_9EURY/317-755EKLR..KD.GIDYVLHVEEYSSLLRFYELIGKNLQNEEKREKLEKVLSNHKGGNFGLPLNFNAFKEWASEYGVEFKTNGS
NDRZ_PYRFU/317-755EKLR..KD.GIDYVLHVEEYSSLLRFYELIGKNLQNEEKREKLEKVLSNHKGGNFGLPLNFNAFKEWASEYGVEFKTNGS
F6BAJ4_METIK/76-570KMERKEKNWNDSHKLLISDKKSFELFKKYIGF..TAKDKMEKLNGILNKMKGLNFRYISVPLTKKEIIEFVGVPLKT...

PF10596

I3L3Z8_HUMAN/86-244FDQE----------------------------------------------------------------------------
A2EY65_TRIVA/1432-1590LDSH----------------------------------------------------------------------------
A8BTS5_GIAIC/1337-1490LQDA----------------------------------------------------------------------------
S3BP74_OPHP1/1452-1610FDQE----------------------------------------------------------------------------
Q8SVU6_ENCCU/1239-1384FR..----------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1796FDQE----------------------------------------------------------------------------
K7VI98_MAIZE/675-841FDQK----------------------------------------------------------------------------
G0W883_NAUDC/1515-1673LDGE----------------------------------------------------------------------------
E6ZWZ5_SPORE/1485-1643FDQE----------------------------------------------------------------------------
Q00RU5_OSTTA/1516-1682RESE----------------------------------------------------------------------------
E9AFM0_LEIMA/1514-1674LKDS----------------------------------------------------------------------------
R0KWQ9_NOSB1/1205-1354....----------------------------------------------------------------------------

PF14623

Q237Q6_TETTS/509-673--------------------------------------------------------------------------------
Q7S708_NEUCR/636-832--------------------------------------------------------------------------------
H6C7V0_EXODN/356-526--------------------------------------------------------------------------------
J3PIM9_GAGT3/593-786--------------------------------------------------------------------------------
G2XFI4_VERDV/568-734--------------------------------------------------------------------------------
G1XIH1_ARTOA/537-708--------------------------------------------------------------------------------
U7PS73_SPOS1/521-692--------------------------------------------------------------------------------
C7YL43_NECH7/586-752--------------------------------------------------------------------------------
R8BIW3_TOGMI/471-637--------------------------------------------------------------------------------
C5GK44_AJEDR/553-713--------------------------------------------------------------------------------
S8AB86_DACHA/542-713--------------------------------------------------------------------------------
S3CBE6_OPHP1/613-780--------------------------------------------------------------------------------
G3JM09_CORMM/336-505--------------------------------------------------------------------------------
C5FLY1_ARTOC/540-711--------------------------------------------------------------------------------
F0UB99_AJEC8/548-714--------------------------------------------------------------------------------
G0QP70_ICHMG/545-705--------------------------------------------------------------------------------
I7M030_TETTS/514-676--------------------------------------------------------------------------------
M7TBR0_EUTLA/533-699--------------------------------------------------------------------------------
C1G4L4_PARBD/546-712--------------------------------------------------------------------------------
N4VVV8_COLOR/552-719--------------------------------------------------------------------------------
F2SQT7_TRIRC/537-709--------------------------------------------------------------------------------
Q24C76_TETTS/502-665--------------------------------------------------------------------------------
D2VHB8_NAEGR/586-749--------------------------------------------------------------------------------
G9MP19_HYPVG/551-718--------------------------------------------------------------------------------
T0JQ14_COLGC/569-736--------------------------------------------------------------------------------
J4WBA6_BEAB2/688-856--------------------------------------------------------------------------------
I7M701_TETTS/604-769--------------------------------------------------------------------------------
F7VWE7_SORMK/571-774--------------------------------------------------------------------------------
L8X395_THACA/606-772--------------------------------------------------------------------------------
E4UR10_ARTGP/540-711--------------------------------------------------------------------------------
Q2GTB7_CHAGB/570-754--------------------------------------------------------------------------------
E3QU32_COLGM/508-676--------------------------------------------------------------------------------
G0RIM5_HYPJQ/574-741--------------------------------------------------------------------------------
Q22N58_TETTS/494-660--------------------------------------------------------------------------------
A9UVU8_MONBE/587-772--------------------------------------------------------------------------------
I1RVJ3_GIBZE/578-742--------------------------------------------------------------------------------
E9EQB7_METAR/534-699--------------------------------------------------------------------------------
J4URQ4_BEAB2/478-645--------------------------------------------------------------------------------
G4NA23_MAGO7/558-749--------------------------------------------------------------------------------

PF13403

Q1GGP9_RUEST/27-173--------------------------------------------------------------------------------
Q1GES6_RUEST/157-304--------------------------------------------------------------------------------
A1AYR4_PARDP/380-527--------------------------------------------------------------------------------
A8LN65_DINSH/175-322--------------------------------------------------------------------------------
A1B4V8_PARDP/356-503--------------------------------------------------------------------------------
A8LKN9_DINSH/122-260--------------------------------------------------------------------------------
Q28WJ0_JANSC/241-379--------------------------------------------------------------------------------
Q5LPM0_RUEPO/507-646--------------------------------------------------------------------------------
Q28L14_JANSC/1268-1415--------------------------------------------------------------------------------
Q1GGN0_RUEST/194-341--------------------------------------------------------------------------------
Q5LSZ7_RUEPO/803-941--------------------------------------------------------------------------------
Q5LPJ7_RUEPO/175-322--------------------------------------------------------------------------------
Q1GMQ5_RUEST/293-432--------------------------------------------------------------------------------
Q5LLZ7_RUEPO/144-282--------------------------------------------------------------------------------
A8LR09_DINSH/158-296--------------------------------------------------------------------------------
C7JHN5_ACEP3/423-565--------------------------------------------------------------------------------
Q28SX3_JANSC/168-306--------------------------------------------------------------------------------
A8LK48_DINSH/203-343--------------------------------------------------------------------------------
Q5LMP8_RUEPO/160-307--------------------------------------------------------------------------------
Q28UB5_JANSC/126-273--------------------------------------------------------------------------------
Q1GMV1_RUEST/833-976--------------------------------------------------------------------------------
A5FZD4_ACICJ/193-329--------------------------------------------------------------------------------
B9JK11_AGRRK/201-336--------------------------------------------------------------------------------
Q28TH9_JANSC/752-887--------------------------------------------------------------------------------
A5G1S8_ACICJ/159-294--------------------------------------------------------------------------------
B0T7Q3_CAUSK/153-288--------------------------------------------------------------------------------
C7JE32_ACEP3/536-676--------------------------------------------------------------------------------
B8IA31_METNO/149-285--------------------------------------------------------------------------------
A5G006_ACICJ/174-309--------------------------------------------------------------------------------
A5FW80_ACICJ/285-421--------------------------------------------------------------------------------
A8LLK3_DINSH/164-305--------------------------------------------------------------------------------
Q5FQG8_GLUOX/285-425--------------------------------------------------------------------------------
B0UJT1_METS4/116-254--------------------------------------------------------------------------------
Q5LUZ7_RUEPO/68-216--------------------------------------------------------------------------------
Q0BS96_GRABC/3687-3823--------------------------------------------------------------------------------
B1M2P7_METRJ/65-199--------------------------------------------------------------------------------
A5FVL4_ACICJ/410-545--------------------------------------------------------------------------------
A4YQ57_BRASO/106-246--------------------------------------------------------------------------------
A5FWA2_ACICJ/1192-1328--------------------------------------------------------------------------------
C3KQV1_RHISN/76-214--------------------------------------------------------------------------------
A8LKB8_DINSH/19-167--------------------------------------------------------------------------------
Q5LN78_RUEPO/204-343--------------------------------------------------------------------------------
C5AQV5_METEA/69-209--------------------------------------------------------------------------------
D5AV22_RHOCB/442-581--------------------------------------------------------------------------------
Q2YL23_BRUA2/15-148--------------------------------------------------------------------------------
Q3J294_RHOS4/14-159--------------------------------------------------------------------------------

PF01079

Q7PXI1_ANOGA/295-503---------------------.....VSALFDR..................................TDSLSLPRHEGIH
HH_DROPS/255-475---------------------.....LQSWMPAKDQL........................RSSQTEGVVSRAEQQNGIH
IHH_DANRE/187-398---------------------.....WTG.........................................PDQVLKNGLH
TWHH_DANRE/190-403---------------------.....LMTWLFP.................................ARESNVNFQEDGIH
WRT4_CAEEL/327-547---------------------.....IRNYFWT.....................................VEDSTNED..
Q80XI9_MOUSE/230-435---------------------.....LAWGSWT.........................................PSEGVH
WRT6_CAEEL/375-583---------------------.....FHNLMFF......................................KSSTEEG..
A8X447_CAEBR/327-545---------------------.....LMKFFGT......................................ADSTKEE..
IHH_CHICK/188-394---------------------.....LLGGPGV.........................................QGDGVH
SHH_CHICK/190-411---------------------.....LLAALCPD................................GAIPTAATTTTGIH
SHH_DANRE/187-404---------------------.....VSSFLFPQ..............................NSSSRSNATLQQEGVH
WRT8_CAEEL/325-538---------------------.....ISKYFWN......................................EESNTEG..
DHH_HUMAN/188-396---------------------.....LGALLPG......................................GAVQPTGMH
Q175B3_AEDAE/201-412---------------------.....IMNLFRSS...............................SQSRNLSLPRHGGIN
O45992_CAEEL/258-471---------------------.....ITKYFWS........................................YETER..
B0S8K0_DANRE/187-399---------------------.....WGGPVGH.........................................QVTGIH
B3DJ46_DANRE/191-442---------------------TNQTILTSVMHSRLSSVF....................KWQDATRAEMENAFLQQKEVY
HH_DROMO/248-470---------------------.....LQSWMPAKGQLR......................SAQDKPTPKDATAQQQNGIH
C3ZGW9_BRAFL/224-434---------------------.....LTSSLWD..................................GPSHDQTLQEGVH
D6WCL7_TRICA/146-345---------------------.....LWDSGLR........................................KPGVGVF
F6WZB6_XENTR/191-398---------------------.....LGIMAGT......................................EPSQQMGIH
F6XBS5_CIOIN/294-549---------------------.....LSLWFNGDSK..........................DHRNCTHVGPVRPTDGIS
F6YTG6_XENTR/190-394---------------------.....IASMLPD.......................................LDLSDGVH
G3V6T0_RAT/188-423---------------------.....LLAALAPARTDGGGG.................GSIPAPQSVAEARGAGPAAGIH
H2U1Q8_TAKRU/190-435---------------------.....VSQLLWAEPEERSDGSKTPLQPHALVRGDRKVCARNSTSVRSEAGPRGRTSEVH
H2V9H2_TAKRU/190-402---------------------.....VSSLLSR..................................SQPGGGGQKDGVH
H2XUY9_CIOIN/97-305---------------------.....LRRTNSD...........................................VGIH
W4Y925_STRPU/189-401---------------------.....IRHNMLG..................................IVDTDTGQEQRVH
W5K3H2_ASTMX/187-406---------------------.....LSSLLLPQ...............................SSQPSNSTTQLDGIH

PF05203

U7Q1H8_SPOS1/262-759---------------------VLASILSRCALER.........KKLPAPAA.VNRKGQAMYFDLEKQAPA.KYYGVTLAD
Q6FQS3_CANGA/285-698---------------------...GNMSNISAQST.......NNWTSTEDNSSAYKAQLMDFSVQKLPKD.NYYGVTLDD
A3LP04_PICST/283-730---------------------ALDSVLSKCAAPR.........KRAEEPVC.VNREPHPYTFHMVEKEED.DFYGITLSE
J7RJ26_KAZNA/284-757---------------------ALVGVLSCCADKN..........KADTPRS.FAREAIPFHFTLKEQRED.EYFGITLPE
C5M9I6_CANTT/244-713---------------------PLAGVLSKCALAR.........NQTPVVK..FTRDPVLFNFDLIKSAKE.NYYGITLAE
Q6CL64_KLULA/284-692---------------------ALKSVSNWTSTSNI.......EKVD......VIHKAQPISFDLEKIESA.DYFGVTLAE
B6JY11_SCHJY/285-759---------------------ALQSVLSKSALSS.........NVAPAPGS.FERKAVPMYFDLGITTPA.NYYGVTLAE
Q6BRM0_DEBHA/283-675---------------------ALESVLSKCALAE.........KTTSVPSH.ITRTGQNFDFSVKKIEAA.DYYGVTLPD
A5DXZ0_LODEL/280-699---------------------ALAGVLSKCSSSSV.......DAKS......FARDAVPFNFNLLRSAKE.DYYGITLSE
H2APW1_KAZAF/284-774---------------------AIHGVYQYSFYKG...........FPSVEP.FERKGIPFFFTLQEKPED.DYYGITLPD
G7E5L8_MIXOS/284-742---------------------VIQSMLSLCAVEC.........NRAARPEGPVKRPGQSFNFTVTKTDQA.PYYGITLAD
F2TVI8_SALR5/1497-1695---------------------......................RQLEQPEP.....................YVGFFV..
U9UGV8_RHIID/409-843---------------------KLEKLPLVISRKKV.......FRNRDHPK..FNRDMV.WGFKVEKVGLG.SYYGFKV..
C5DTL5_ZYGRC/284-732---------------------ALLAVLANCASNN.........KQIEAPPHGVIREFNKAYFEMEELEED.EYYGLTLSN
G8JWX2_ERECY/284-671---------------------ALQSVLSICGTVA...........VEKPEH.VVRKPKHLKFIVEKMTED.NYFGITLPE
A7TLB5_VANPO/284-715---------------------LLKSVLSRCSAINY.......TKCESRD...LLREPVEFYFELQELEEA.EYYGITLPE
VATA_YEAST/284-736---------------------VLLNVLSKCAGSK.........KFRPAPAAAFARECRGFYFELQELKED.DYYGITLSD
M3K3J1_CANMX/284-733---------------------ALDSVLSKCAASR.........KKAAEPVG.VSREPHQFSFYLQEKPVD.DYYGITLSA
G0V8Z3_NAUCC/284-799---------------------ALIGVLRFCALDR.........KRTAFKE..FTREAVPFYFTLQEKDQD.EYYGITLPD
C5DTQ4_ZYGRC/1-463---------------------PMQKVLSYCRSGH.........KVKTEPEY.VERSPIYFGFNEEKRGSN.NVVGVTT..
E9CG65_CAPO3/761-1238---------------------ALRRLTCRLSGDGIHLLPCKQKPMMAEHTCAEARERRFVKFTVSRVSESGPYVGFEL..
G0W3J0_NAUDC/284-783---------------------TLSGALRFCALDK.........NNANSKKP.FVRGPVPFYFTLKEKDED.NYYGITLPD
G8ZLC3_TORDC/1-463---------------------PLQKVLSYCCSGH.........KKRPVPKV.IIREPIYFGFNEEKRGLQ.PVFGITT..
G8BNB8_TETPH/284-799---------------------ALSSSLRFCSLDR..........NVASLSPFFNREAVPFYFTLEEQEED.QYYGVTLPD

PF07591

A3DGR7_CLOTH/105-234--------------------------------------------------------------------------------
Q5F6G7_NEIG1/1-137--------------------------------------------------------------------------------
Q9K122_NEIMB/1-137--------------------------------------------------------------------------------

PF14890

DPOL_THEAG/860-1392.....................KFQKNITFEKFKELADSGKLDKRKVKLLDFLLNGDIVLDRVKNVEKREYEGYVYDLSVE
D5VTT2_METIM/75-563..........IKNKEEYCTDYTIEKIIEELNNKGLH.......DKANYLKKFLDGDIVWTRFKIEKVESDVDYVYDLEVD
B7R5G0_9EURY/317-755QTLAIIKGEKISLGQWHTRGRVSKAVLVK.MLRKLY.....DATGVEDVKRMLHLVEGLEVVKEITTTNEPKTFYDLTVE
DNAB_NOSS1/393-817T....TRELHSNIGTSYCGLALYKANLSRERALKVA.....EVVQSSELLTLAKSDVYWDEIVSIEYSGEEE.VFDLTVP
I3RCL0_9EURY/841-1358.....................TLKKDIGYEKVQELIESGELDEGKAKKIEWLLKGDIALDRVKSVEVEDYEGYVYDLSVE
GLMS_METJA/76-570..........IKNGDNYCTDYTIEKIIEELNSKGLY.......DKAEYLKRFLDADIVWTKFKIEEVESDVEYVYDLEVE
DNAB_SYNY3/385-809T....TRDLQMRLGNAYCGTALYKHNLSRERAAKIA.....TITQSPEIEKLSQSDIYWDSIVSITETGVEE.VFDLTVP
Q9UYA0_PYRAB/317-700QILAIIGNEKVSLGQWHARGHVSKAVLVK.MLRKLY.....EVTKNDEVKEMLHLIESLEVVKEITITNEPKTFYDLTVD
DPOL_THEKO/857-1388.....................VFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVE
I6TV89_9EURY/317-755QTIAIINDERISLGQWHTRNRVSKAVLVK.MLRKLY.....EATKDEEVKRMLHLIEGLEVVRHITTTNEPRTFYDLTVE
NDRZ_PYRFU/317-755QTIAIINDERISLGQWHTRNRVSKAVLVK.MLRKLY.....EATKDEEVKRMLHLIEGLEVVRHITTTNEPRTFYDLTVE
F6BAJ4_METIK/76-570..........IKNGDNYCTDYTIEKIIEELNSRGLY.......DKANYLKKFLDGDVVWTKFEIEKIESDVEYVYDLEVE

PF10596

I3L3Z8_HUMAN/86-244--------------------------------------------------------------------------------
A2EY65_TRIVA/1432-1590--------------------------------------------------------------------------------
A8BTS5_GIAIC/1337-1490--------------------------------------------------------------------------------
S3BP74_OPHP1/1452-1610--------------------------------------------------------------------------------
Q8SVU6_ENCCU/1239-1384--------------------------------------------------------------------------------
Q5KPW2_CRYNJ/1640-1796--------------------------------------------------------------------------------
K7VI98_MAIZE/675-841--------------------------------------------------------------------------------
G0W883_NAUDC/1515-1673--------------------------------------------------------------------------------
E6ZWZ5_SPORE/1485-1643--------------------------------------------------------------------------------
Q00RU5_OSTTA/1516-1682--------------------------------------------------------------------------------
E9AFM0_LEIMA/1514-1674--------------------------------------------------------------------------------
R0KWQ9_NOSB1/1205-1354--------------------------------------------------------------------------------

PF14623

Q237Q6_TETTS/509-673----------GLVVG--
Q7S708_NEUCR/636-832----------GLVKG--
H6C7V0_EXODN/356-526----------GLVCG--
J3PIM9_GAGT3/593-786----------GRT..--
G2XFI4_VERDV/568-734----------GLVNG--
G1XIH1_ARTOA/537-708----------GLIKG--
U7PS73_SPOS1/521-692----------....N--
C7YL43_NECH7/586-752----------GLVRG--
R8BIW3_TOGMI/471-637----------GLVCG--
C5GK44_AJEDR/553-713----------....G--
S8AB86_DACHA/542-713----------GLIKG--
S3CBE6_OPHP1/613-780----------....G--
G3JM09_CORMM/336-505----------GLVNG--
C5FLY1_ARTOC/540-711----------GRVCG--
F0UB99_AJEC8/548-714----------GLACG--
G0QP70_ICHMG/545-705----------QK...--
I7M030_TETTS/514-676----------NQVK.--
M7TBR0_EUTLA/533-699----------GLICG--
C1G4L4_PARBD/546-712----------GLACG--
N4VVV8_COLOR/552-719----------GLVRG--
F2SQT7_TRIRC/537-709----------GRICG--
Q24C76_TETTS/502-665----------GKVT.--
D2VHB8_NAEGR/586-749----------KMII.--
G9MP19_HYPVG/551-718----------GLVRG--
T0JQ14_COLGC/569-736----------GLVRG--
J4WBA6_BEAB2/688-856----------GLVNG--
I7M701_TETTS/604-769----------TLVIG--
F7VWE7_SORMK/571-774----------GLVNG--
L8X395_THACA/606-772----------GIVCG--
E4UR10_ARTGP/540-711----------GRICG--
Q2GTB7_CHAGB/570-754----------GKVIG--
E3QU32_COLGM/508-676----------GLVRG--
G0RIM5_HYPJQ/574-741----------GLVRG--
Q22N58_TETTS/494-660----------HEVIG--
A9UVU8_MONBE/587-772----------GLVKD--
I1RVJ3_GIBZE/578-742----------GLVM.--
E9EQB7_METAR/534-699----------GLVCG--
J4URQ4_BEAB2/478-645----------GLVC.--
G4NA23_MAGO7/558-749----------GRVIG--

PF13403

Q1GGP9_RUEST/27-173----------VD-----
Q1GES6_RUEST/157-304----------AH-----
A1AYR4_PARDP/380-527----------GP-----
A8LN65_DINSH/175-322----------GP-----
A1B4V8_PARDP/356-503----------GA-----
A8LKN9_DINSH/122-260----------GM-----
Q28WJ0_JANSC/241-379----------GD-----
Q5LPM0_RUEPO/507-646----------GD-----
Q28L14_JANSC/1268-1415----------GD-----
Q1GGN0_RUEST/194-341----------GA-----
Q5LSZ7_RUEPO/803-941----------GR-----
Q5LPJ7_RUEPO/175-322----------GD-----
Q1GMQ5_RUEST/293-432----------GA-----
Q5LLZ7_RUEPO/144-282----------GA-----
A8LR09_DINSH/158-296----------GE-----
C7JHN5_ACEP3/423-565----------TG-----
Q28SX3_JANSC/168-306----------GD-----
A8LK48_DINSH/203-343----------GA-----
Q5LMP8_RUEPO/160-307----------GA-----
Q28UB5_JANSC/126-273----------GE-----
Q1GMV1_RUEST/833-976----------GP-----
A5FZD4_ACICJ/193-329----------TG-----
B9JK11_AGRRK/201-336----------LG-----
Q28TH9_JANSC/752-887----------GP-----
A5G1S8_ACICJ/159-294----------TG-----
B0T7Q3_CAUSK/153-288----------DG-----
C7JE32_ACEP3/536-676----------TG-----
B8IA31_METNO/149-285----------DH-----
A5G006_ACICJ/174-309----------TG-----
A5FW80_ACICJ/285-421----------TG-----
A8LLK3_DINSH/164-305----------GA-----
Q5FQG8_GLUOX/285-425----------AD-----
B0UJT1_METS4/116-254----------MG-----
Q5LUZ7_RUEPO/68-216----------GV-----
Q0BS96_GRABC/3687-3823----------DN-----
B1M2P7_METRJ/65-199----------AP-----
A5FVL4_ACICJ/410-545----------CG-----
A4YQ57_BRASO/106-246----------VN-----
A5FWA2_ACICJ/1192-1328----------DG-----
C3KQV1_RHISN/76-214----------ED-----
A8LKB8_DINSH/19-167----------DA-----
Q5LN78_RUEPO/204-343----------GR-----
C5AQV5_METEA/69-209----------..-----
D5AV22_RHOCB/442-581----------GP-----
Q2YL23_BRUA2/15-148----------..-----
Q3J294_RHOS4/14-159----------T.-----

PF01079

Q7PXI1_ANOGA/295-503WYAKSLYTIKDYLIP--
HH_DROPS/255-475WYANALYKVKDYVLP--
IHH_DANRE/187-398WYSQVLIGLGKLLLD--
TWHH_DANRE/190-403WYSNMLFHIGSWLLD--
WRT4_CAEEL/327-547...NIGYGLNGVMAV--
Q80XI9_MOUSE/230-435WYPQMLYRLGRLLLE--
WRT6_CAEEL/375-583...DLPVGVETLTSV--
A8X447_CAEBR/327-545...NLGYGIHSLLDV--
IHH_CHICK/188-394WYSGLLYRLGRMLLP--
SHH_CHICK/190-411WYSRLLYRIGSWVLD--
SHH_DANRE/187-404WYSRLLYQMGTWLLD--
WRT8_CAEEL/325-538...NIGTSLNFLIEI--
DHH_HUMAN/188-396WYSRLLYRLAEELLG--
Q175B3_AEDAE/201-412WYAKTLYAIKDFVIP--
O45992_CAEEL/258-471...NIGQSLNSLIAI--
B0S8K0_DANRE/187-399WYSSLLHWIGTQVLD--
B3DJ46_DANRE/191-442WYARLLHTLGRIFLD--
HH_DROMO/248-470WYANALYKVKDYVLP--
C3ZGW9_BRAFL/224-434WYPSFFYRYGIS...--
D6WCL7_TRICA/146-345WYARLLYATADFVL.--
F6WZB6_XENTR/191-398WYSKALYHLGRLIL.--
F6XBS5_CIOIN/294-549LYSKLLHQIFSKVL.--
F6YTG6_XENTR/190-394WYCHILYLLAKYVL.--
G3V6T0_RAT/188-423WYSQLLYHIGTWLLD--
H2U1Q8_TAKRU/190-435WYAQLLHRLGWIVL.--
H2V9H2_TAKRU/190-402WYSRLLYQVGTWLLD--
H2XUY9_CIOIN/97-305WYAKSLAEIARIVLP--
W4Y925_STRPU/189-401WYTQGLYKLGKYVM.--
W5K3H2_ASTMX/187-406WYSRLLYRMGTFLLD--

PF05203

U7Q1H8_SPOS1/262-759NTDHQFLLGNMMLVH--
Q6FQS3_CANGA/285-698DSDHQFLLSNLVLVH--
A3LP04_PICST/283-730DSDHQFLLSNLALVH--
J7RJ26_KAZNA/284-757TTDNQYLLSSLALVH--
C5M9I6_CANTT/244-713ETDHQFLLSNMALVH--
Q6CL64_KLULA/284-692ESDHKFLLSNMTLVH--
B6JY11_SCHJY/285-759DSDHQFLLSNLTLVH--
Q6BRM0_DEBHA/283-675NSDHQFMLANQAVVH--
A5DXZ0_LODEL/280-699TSDHMFLLSNLALVH--
H2APW1_KAZAF/284-774ATDKQYLLSSLALVH--
G7E5L8_MIXOS/284-742DTDHKFLLGNLALVH--
F2TVI8_SALR5/1497-1695DGNKRFLRADFLVTH--
U9UGV8_RHIID/409-843DKNERILLADLTVSH--
C5DTL5_ZYGRC/284-732ESDHQFLLANQLVVH--
G8JWX2_ERECY/284-671DSDRVFLLNNQVLVH--
A7TLB5_VANPO/284-715YSDHQFMLSNQVVVH--
VATA_YEAST/284-736DSDHQFLLANQVVVH--
M3K3J1_CANMX/284-733ESDHQFLLANTALVH--
G0V8Z3_NAUCC/284-799ETDKQYLLSSLALVH--
C5DTQ4_ZYGRC/1-463NSDKRILLDNKIVIH--
E9CG65_CAPO3/761-1238DGSPLFLLDNWLVVH--
G0W3J0_NAUDC/284-783STDKQYLLSSLALVH--
G8ZLC3_TORDC/1-463EQGKKILLDNKLVAH--
G8BNB8_TETPH/284-799STDKQYLLSSLALVH--

PF07591

A3DGR7_CLOTH/105-234-----------------
Q5F6G7_NEIG1/1-137-----------------
Q9K122_NEIMB/1-137-----------------

PF14890

DPOL_THEAG/860-1392DNENFLVGF.GLLYAHN
D5VTT2_METIM/75-563EYHNFIGNL...IVNHN
B7R5G0_9EURY/317-755NYQNYLAGENGMVFVHN
DNAB_NOSS1/393-817GLHNFIANN...IVVHN
I3RCL0_9EURY/841-1358EDENFLVGF.GLLYAHN
GLMS_METJA/76-570DYHNFIGNL...IINHN
DNAB_SYNY3/385-809GPHNFVAND...IIVHN
Q9UYA0_PYRAB/317-700KYQNYLAGENGMIFVHN
DPOL_THEKO/857-1388DNENFLVGF.GLVYAHN
I6TV89_9EURY/317-755NYQNYLAGENGMIFVHN
NDRZ_PYRFU/317-755NYQNYLAGENGMIFVHN
F6BAJ4_METIK/76-570DYHNFIGNL...IINHN

PF10596

I3L3Z8_HUMAN/86-244-----------------
A2EY65_TRIVA/1432-1590-----------------
A8BTS5_GIAIC/1337-1490-----------------
S3BP74_OPHP1/1452-1610-----------------
Q8SVU6_ENCCU/1239-1384-----------------
Q5KPW2_CRYNJ/1640-1796-----------------
K7VI98_MAIZE/675-841-----------------
G0W883_NAUDC/1515-1673-----------------
E6ZWZ5_SPORE/1485-1643-----------------
Q00RU5_OSTTA/1516-1682-----------------
E9AFM0_LEIMA/1514-1674-----------------
R0KWQ9_NOSB1/1205-1354-----------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window