Sequence alignment for CL0364

PF06434

Q7CVQ5_AGRT5/175-406VTFIAA.EGDISTDLLSPGNQAHSRSDRQLHGQCMISPEAQA...........--------------.EIVALQQQHPDK
A1TPA0_ACIAC/168-382VTVFKV.PGETNTDDLSPAPDAWSRPDIPLHYLAMLKNTRPDAAFKPEEDGKR--------------GPMQFIEDLK.KK
Q1JW62_DESAC/168-372VKVFKV.DGEINTDDFSPAGDAWSRPDIPLHSLAMGKTRFPG...........--------------.GNEEIAAWR.AE
A0B1A3_BURCH/168-380ITVFKV.TGETNTDDLSPAPDATTRPDIPMHALAMLKNARPGITPEE..DGKR--------------GPVKFIESLK.EK
A5WDW0_PSYWF/168-383YTAFKV.TGETNTDDLSPAQDAWSRPDIPLHSLAMHKNSRDGITADE..EGVR--------------GPMKQIEALK.EK
A6V736_PSEA7/168-382LTVFKV.PGETNTDDLSPAPDAWSRPDIPLHALAMLKMARDGIEPVQ..PGSV--------------GPLKQIEAVK.AK
Q0I4W3_HAES1/171-385LTVFKV.SGETNTDDLSPAQDAWSRPDIPLHALAMLKNAREGIKPDD..NGNI--------------GPIKQLETLK.QK
A5GFC4_GEOUR/167-371VKVYKV.EGEINTDDFSPAGDAWSRPDIPLHSLAMGKTRFPD...........--------------.GLATIAKYR.AD
A7BSA2_9GAMM/167-370VTVFKV.PGETNTDDLSPASEAWSRPDIPLHAKAMLSQRLDG...........--------------.ALETIAELK.QK
Q7V3U1_PROMM/169-377VTVFKV.DGETNTDDLSPATHATTRPDIPLHALAMLETRDPN...........--------------.ALATIISLK.AK
Q8DL06_THEEB/174-377VTVFKV.AGETNTDDLSPAPHATTRPDIPLHATVMLESRLPG...........--------------.ALQIIAELK.QK
Q118H1_TRIEI/169-372VTVFKV.PGETNTDDLSPAPHATTRPDIPLHALAMLESKMPE...........--------------.GLKTIAQLK.QK
Q2SK45_HAHCH/194-401ATVFKV.TGETNTDDLSPAPDAWSRPDIPLHAKAMYKMPREGIT.......NA--------------E..QQIEELK.KK
A8G7K5_PROM2/175-383CLVFKV.DGETNTDDLSPAVHATTRPDIPMHALAMLEFKKPD...........--------------.GLKILDDLK.KR
Q7UDR9_SHIFL/168-382VTVFKV.TGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPDQ..PGVV--------------GPIKQIEALQ.QK
Q1QVU9_CHRSD/173-387LTVFKV.PGETNTDDLSPAPDAWSRPDIPLHANAMLKNPRDGIEPVE..PGVT--------------GPLKQIEEVK.AK
Q65PY4_MANSM/171-385VTVFKV.SGETNTDDLSPAQDAWSRPDIPLHANAMLKMPREGIIPDQ..PTLV--------------GPIKQLESLK.QK
Q0A8N5_ALHEH/171-378VTVYKV.PGETNTDDLSPAPDAWSRPDIPLHAKAMYKMPREGVT.......NA--------------E..EQINELK.EK
A0Z071_LYNSP/169-377VTVFKV.GGETNTDDLSPAPHATTRPDIPLHALVMLESSMPE...........--------------.GIQTIAELK.QK
A6GNC8_9BURK/168-380LTVFKV.TGETNTDDLSPAPDAWSRPDIPLHALAMLKNPRPGIEADE..PGKV--------------GPIKQLQALI.AK
A4A855_9GAMM/168-381VAVFKV.TGETNTDDLSPAPDAWSRPDIPLHALAMYKMTRDGLTPEE..HGVT--------------GPMGQIKEIQ.DK
Q5GYV5_XANOR/168-382VTVFKV.PGETNTDDLSPAPDATTRPDIPLHALAMLKNKRDGAAFEPEEDGKR--------------GPIQAIADLK.DK
A3VFZ3_9RHOB/174-406VVTYIAAEGDISTDLLSPGNQAHSRSDRELHGKCMIDEAAQK...........--------------....HIEELK.LQ
Q5N4E2_SYNP6/169-372VTIFKV.PGETNTDDLSPATHATTRPDIPLHAQAMLETRLPG...........--------------.SLETIPVLK.EK
B3EGH0_CHLL2/171-373LTVFKV.PGETNTDDLSPASEAFTRSDIPLHALCMLGSKMDD...........--------------.PIGTIAALK.EK
A1VZH9_CAMJJ/166-368CIVFKV.AGETNTDDLSPAGDAFTRSDIPLHANAMLKVRQAG...........--------------.SLEKIKELK.KS
A8EUS0_ARCB4/171-373LTVYKI.PGETNTDDLSPATVAFTRADIPLHATAMLQSRMEK...........--------------.PLEKMAELK.AK
Q1Z4J1_PHOPR/168-382LTVFKV.TGETNTDDLSPAPDAWSRPDIPLHALAMLKSEREGIEPDQ..HGSI--------------GPIKQIAALQ.EK
ACON2_HELPY/171-373ACVFKI.DGETNTDDLSPASDAFTRSDIPLHAKAMLKNRIEN...........--------------.YEQRIKAIK.TK
Q1H0A3_METFK/167-370LVVFKV.DGETNTDDLSPAQEAWSRPDIPLHAKAMLINKMPG...........--------------.ALQTLEQLK.SQ
Q39UD3_GEOMG/167-371VKVFKV.EGEINTDDFSPAGDAWSRPDIPLHALAMGKTRFPN...........--------------.RLKDIADWR.AA
Q3A2K3_PELCD/167-371VKVFKV.EGEINTDDFSPAGDAWSRPDIPLHALSMGGSRFAG...........--------------.GIETIAAWR.KA
Q6F9U3_ACIAD/168-384LTVFKV.TGETNTDDLSPAQDAWSRPDIPLHANAMLKNERDGINPEK..PGEV--------------GPLSQIKELI.AK
A4SDR1_PROVI/171-373LTVFKV.PGETNTDDLSPAGEAFTRSDIPLHALSMLGSKMDD...........--------------.PIGVIAGLK.EK
A3WNJ6_9GAMM/187-393ATVFKV.TGETNTDDLSPAPDAWSRPDIPLHAKAMYKMPREGI.........T--------------NAGEQIEELK.KK
A2C5H7_PROM1/170-378VTVFKV.EGETNTDDLSPATHATTRPDIPLHALAMLETRDPN...........--------------.GLSTIEELK.KK
Q2IQ71_ANADE/167-371VKIFKV.DGEINTDDFSPAGDASTRPDIPLHALAMGKTRFPG...........--------------.GLKTIAEFR.AQ
Q3AVN1_SYNS9/169-371VTVFKV.DGETNTDDLSPATHATTRPDIPLHALAMLETRDPN...........--------------.GLNTIAKLK.EN
A0L7Y2_MAGSM/188-390VTVFKV.EGETNTDDLSPASEAWSRPDIPMHAKAMLVARMPD...........--------------.ALDKLAQLK.SK
A8FQC8_SHESH/168-382LTVFKV.SGETNTDDLSPAPDAWSRPDIPLHALAMLKNTREGIVPDE..AGVI--------------GPIKEIDQLK.TK
Q12Z08_METBU/167-371VRVFKV.DGEINTDDFSPASAAWSRPDIPLHALEMGTTRFPG...........--------------.GIEEIAKWR.GE
Q604Q3_METCA/168-375VTVFKV.PGETNTDDLSPAQDAWSRPDIPLHAKSMLKVPREGIH.......DA--------------E..AQIAELK.TK
Q01EA0_OSTTA/235-442VTVFKV.QGETNTDDLSPAQDAWSRPDIPLHALAMLKSTREGI.........E--------------EPIAQLAELK.KL
Q7VFE0_HELHP/176-382VCVFKV.DGETNTDDLSPAGDAFTRSDIPLHAKAMLKSRIEN...........--------------.FEQRIESAK.QK
Q9X5I6_NEIME/168-380VTVFKV.DGETNTDDLSPAPDAWSRPDIPLHALAMLKNPRDGITPDK..PGEV--------------GPIKLLEELK.AK
A4BJS2_9GAMM/168-380LTVFKV.SGETNTDDLSPAQDAWSRPDIPLHALAMYKMERDGLTPDK..DGEI--------------GPIAQIDKLK.EK
Q2JL67_SYNJB/170-373VTVFKV.AGEINTDDLSPAAHATTRPDIPLHAQAMLESRAPG...........--------------.SLVTIAELK.RR
A3Y383_9VIBR/168-379VKVFKV.TGETNTDDLSPAPDAWSRPDIPVHAKAMLKMERDGITPDE..QGSV--------------GPINQIEEMQ.KD
A0XX36_9GAMM/168-382VTVFKV.TGETNTDDLSPAPDAWSRPDIPLHALAMLKNERDGINPDK..AGEV--------------GPIVQLEELK.TK
A5CVN2_VESOH/165-374LTVFRV.EGEVNTDDLSPATQAWSRPDIPLHAQSMLIKKMNN...........--------------.PLKTIKKLK.QK
Q15QA4_PSEA6/168-382YSVFKV.TGETNTDDLSPAPDAWSRPDIPLHARAAYKMTRDGLTPEV..HGEI--------------GPLKQIDEIK.AK
B4S6I7_PROA2/171-373LTVFKV.PGETNTDDLSPASEAFTRSDIPLHALSMLGSKMDD...........--------------.PIGTIESLK.EH
Q31GI6_THICR/169-372VSVFKV.EGETNTDDLSPATAAWSRPDIPLHAKEMLKSRMDD...........--------------.VDGTIASLE.AK
Q3AR28_CHLCH/171-373LTVFKV.PGETNTDDLSPASEAFTRSDIPLHARCMLGTKIND...........--------------.PIGTIAALK.QK
A3J0H2_9FLAO/174-405VVTFIAGEGDISTDLLSPGNQAHSRSDRELHGKCMITPQAQE...........--------------....EIKALQ.AQ
A4C0C6_9FLAO/174-407IVTFVAGIGDISTDLLSPGGDAHSRSDRELHGQCLFEHNKAQ...........--------------..QNQLIALQ.KQ
Q0YRL9_9CHLB/171-373LTVYKV.PGETNTDDLSPASEAFTRSDIPLHALCMLGSKMTD...........--------------.PIGTIAQLK.TK
A1U1S2_MARAV/173-386MVVFKV.TGETNTDDLSPAPDAWSRPDIPLHARAAYKMERDGLKPEE..PGVT--------------GPMSQIDEIK.AK
Q6SFU1_9BACT/165-368AIVFRV.DGETNTDDLSPAIEAWSRPDIPLHANAMLIKKMDK...........--------------.PLETIKKLK.EK
Q4CAL9_CROWT/169-372VTVFKV.PGETNTDDLSPAPHATTRPDIPLHGLAMLESKMPE...........--------------.GIATIARLK.EK
A0RPN0_CAMFF/169-372AVVFKV.AGETNTDDLSPASEAFSRSDIPLHANAMLVKRQPG...........--------------.SLEKIAELK.KS
A3YGV8_9GAMM/168-382VKVFKV.TGETNTDDLSPAPDAWSRPDIPLHANAMLKMEREGINPDD..DGTI--------------GPIKQINALK.ED
A0ZJM7_NODSP/186-389VTVFKV.PGETNTDDLSPATHATTRPDIPLHALAMLESRQPG...........--------------.SLETIVELK.QK
A6ETA5_9BACT/174-407VVTFIAGVGDISTDLLSPGADAHSRSDRQLHGQCMFEHNKDM...........--------------..QNELLEIQ.KQ
A4SXE4_POLSQ/168-380LTVFKV.TGETNTDDLSPAPDAWSRPDIPLHATIMLKNPRPGIEPDE..SGVR--------------GPMKQIAALQ.KK
A7GY34_CAMC5/205-531AVVFKV.AGETNTDDLSPASEAFTRSDIPLHANAMLSKRQPG...........--------------.SLETIKELK.KS
A1AXP1_RUTMC/165-368LSVFRV.KGEINTDDLSPATQAWSRPDIPLHAQSMLIKKMNK...........--------------.PLEMIKKLK.QK
A6FBI9_9GAMM/168-376VTVFKV.PGETNTDDLSPAPDAWSRPDIPLHALAMLKNEREGVS........E--------------NPLQEIEKLK.EK
A4RSV0_OSTLU/237-444VTVFKV.PGETNTDDLSPAQDAWSRPDIPLHALAMLKSPREGI.........Q--------------NPISQIDELK.KL
Q5P0Q1_AROAE/172-388LTVFKV.TGETNTDDLSPAPDAWSRPDIPLHALAMLKNPRSGITPEE..SGVR--------------GPVKFLEDLR.AK
Q30RR3_SULDN/171-373LSVFKV.AGETNTDDLSPASEAFTRSDIPLHANSMLVAKMDN...........--------------.PIETIKKLK.EK
Q0VQ99_ALCBS/168-380LSVFKV.TGETNTDDLSPAQDAWSRPDIPLHGNAMLKNAREGIIPEK..DGEI--------------GPLTQMDELK.KK
A6DS04_9BACT/173-380TIIYKV.DGETNTDDFSPAKFAFTRADIPLHSTCMGGSLFPE...........--------------.GPETIAKLK.EQ
Q7V9G7_PROMA/170-374VTVFKV.SGETNTDDLSPATHATTRPDIPLHALAMLETRDPE...........--------------.GLKTITSLK.KK
A6VKR8_ACTSZ/171-385LTVFKV.LGETNTDDLSPAQEAWCRSDIPLHANAMLKMPREGIEPDQ..PGSV--------------GPLKQLAALK.SK
F2GA07_ALTMD/175-406VVTYIAAEGDISTDLLSPGNQAHSRADRELHGKCMITPEAQQ...........--------------....EIVELG.KK
Q7M959_WOLSU/170-372LTVFKI.EGETNTDDLSPASDAFTRSDIPLHAQSMLKNRTQN...........--------------.AFVRIEELK.KK
A1BEM7_CHLPD/171-373LTVFKV.PGETNTDDLSPASEAFTRSDIPLHARCMLGSKMDD...........--------------.PIGTITRLK.AK
A7I373_CAMHC/170-373AVVFKV.PGETNTDDLSPASEAFSRSDIPLHANAMLSKRLPG...........--------------.SLEKIAELK.KN
Q47UT3_COLP3/168-380VKVFKV.TGETNTDDLSPAPDAWSRPDVPLHAKAMLKIGRDGITPEE..DGVV--------------GPISQIEELQ.KD
A0Z918_9GAMM/168-381MVVFKV.TGETNTDDLSPAPDAWSRPDIPLHANAMYKMTRDGLEPDE..HGTT--------------GPMKQIAEIK.AK
A6Q381_NITSB/171-374AVVFKV.PGETNTDDLSPASEAWSRSDIPLHALSMLKAKMPD...........--------------.AQETIKKLK.EK
A9BDQ3_PROM4/170-378VTVFKV.DGETNTDDLSPAIHATTRPDIPLHALSMLESRVPK...........--------------.ALEKISKLK.KK
A6Q9Z4_SULNB/172-374LTVYKI.PGETNTDDLSPASEAFTRADIPLHANSFLQSRMEN...........--------------.PLETMAELK.KK
A4EYJ8_9RHOB/174-407VVTYIAGEGDISTDLLSPGNQAHSRSDRELHGKCMMSEKAQQ...........--------------....EIEALK.LQ
A1APN5_PELPD/168-373LKVYRV.QGEINTDDFSPAGDAWSRPDIPLHALVMGRRRFPD...........--------------.GLATMAAFR.EE
A1SYN8_PSYIN/168-382MSVFKV.SGETNTDDLSPAPDAWSRPDIPLHALAMLKLSREGIVADE..EGVV--------------GPVKQINALK.DK
Q3J9D3_NITOC/167-370AVVFKV.PGETNTDDLSPAQEAWSRPDIPLHAKAMLVNKMPE...........--------------.ALSAIADLK.GR
Q1YQ85_9GAMM/168-381VAVFKA.TGEINTDDLSPAQDAWSRPDIPLHARAMFKMTRDGMHPEE..HGVT--------------GPMTQIDELK.AR
A2BZ87_PROM5/175-383CLAFKI.DGETNTDDLSPAVHATSRPDIPLHALSMLEFKNQD...........--------------.GLKILADLK.KQ
A3X845_9RHOB/174-406VVTYIAGVGDISTDLLSPGAEAHSRADRELHGKCMMTPEAQA...........--------------....EIQELQ.KQ
A5GX02_SYNR3/176-378VTVFKV.EGETNTDDLSPATHATTRPDIPLHATAMLETRMPG...........--------------.GLEQLEALK.AK
A7ZDV7_CAMC1/178-384AVVFKV.PGETNTDDLSPASEAYTRADIPLHAKAMLVKKMPE...........--------------.GLEILKELK.SR
A6DD15_9PROT/172-375AIVFKV.PGETNTDDLSPASEAFTRSDIPLHALSMLKAKMPD...........--------------.AIEKINELK.KS

PF00694

D3DW85_HUMAN/767-896AAKYLTNRGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIG.KPAPKTIHFPSGQTL.......DVFEAAELYQ-KE
C4ZTX1_ECOBW/689-819AGRYLQGRGVERKDFNSYGSRRGNHEVMMRGTFANIRIRNEMVPGVEGGMTRHLPDSDVV.......SIYDAAMRYK-QE
ACON_LEGPH/689-819AGLYLKSKGVDEKDFNSYGSRRGNHEVMMRGTFANIRIRNEMTPGQEGGVTRYVPTGETM.......SIYDAAMRYQ-EN
ACOC_HUMAN/692-821AARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLN.KQAPQTIHLPSGEIL.......DVFDAAERYQ-QA
LEUD_HAEIN/1-126MAGFKQLSGLVVPLDAANVDTDAIIPKQFLQAITRIGFGKHLFHEWRYLDVEGT..KPNP.......EFVLNYPQYQ-..
ACON_YEAST/579-709MPILIKAVGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENKKANCVKNVYTGEYK.......GVPDTARDYR-DQ
LEUC_RHIPU/529-654MPKFTTLRGYAAPLDIANVDTDMIIPKQFLKTIKRTGLGTALFYNIRFDGATG..E.ENP.......DFVLNQEPYR-..
LEUC_YEAST/545-672MKPFLTLEGISAPLDKANVDTDAIIPKQFLKTIKRTGLKKGLFYEWRFRKDDQGKD.QET.......DFVLNVEPWR-..
LEUD_LACLA/1-124MEKFTIYKGTSVPVMNDNIDTDQIIPKQFLKAIDKKGFGKNLFYEWRYLKDYDE....NP.......DFILNAPKYK-..
LYS4_YEAST/484-620NPVVEEEVNAQTEAPKQSVEILEGFPREFSGELVLCDADNINTDGIYPGKYTYQDDVPKEKMAQVCMENYDAEFRTK-VH
ACON2_YEAST/585-714TNVLLKVEGKCTTDHISAAGVWLKYKGHLENISYNTLIGAQNKETGEVNKAYDLDGTEY........DIPGLMMKWK-SD
ACOC_CUCMA/696-826AAKYLLERGVDRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLDGEVGPKTVHVPTGEKL.......SVFEAAEKYK-SA
LEUD_BUCRP/1-126MFKFTEHNGVVAPLNISNIDTDAIIPKQFLQKVNKIGFGKYLFHDWRFIDKNQL..KINP.......NFILNNYVYK-..
LEUC_USTMA/542-667MEKFTTLTGIAAPLERSNVDTDLIIPKQFLKTIKRTGLGSALFWPLRYDAKTG..E.PDP.......AFVLNQKPYD-..
LEUC_PHYBL/516-641MPAFTTLKGVAAPLAISNVDTDMIIPKQFLKTIKRTGLGSALFYGLRYDPATG..A.EKP.......DFVLNQPAYR-..
ACON_BOVIN/582-712LQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINVENGKANSVRNAVTQEFG.......PVPDTARYYK-KH
ACON_GRAGA/580-710MPVLIKARGKCTTDHISMAGPWLKFRGHLDNISNNMLIGAVNDENGEINNVKNAVTGEYG.......TVPDTARAYK-AE
ACON_CAEEL/576-706MKILIKVTGKCTTDHISAAGPWLKYRGHLDNISNNLFLTAINADNGEMNKVKNQVTGEYG.......AVPATARKYK-AD

PF01989

A8MB53_CALMQ/28-107PISFLG--------DVDGARGIVKVKGMEI...N--------------------------------------------IA
A9AB42_METM6/24-104SISFLG--------GVN.EEGIVTDKENELFGKS--------------------------------------------IA
A9CH00_AGRT5/31-119ALSFWG--------GVDPATGKVIDVHHPLHGIC--------------------------------------------LT
A9A545_NITMS/19-101AINFLG--------TVDKKTGIISDKNHDLYDKS--------------------------------------------IK
A2W9E3_9BURK/126-208RISGWG--------GIDPRTGTIIETRHELRGRS--------------------------------------------FA
Q0CKP1_ASPTN/21-109PLSFWG--------GVDPTTGRIVDHHHPLNGQS--------------------------------------------MA
A6V8V2_PSEA7/27-115GLSFWG--------GVDPRSAEVIDRHHPLSGRH--------------------------------------------LH
Q7VVN5_BORPE/28-110AISMRY--------DVDASTGKVVRPSHDLYGQS--------------------------------------------IS
A7I8B4_METB6/34-116PISFLS--------GVDPETGIVVEKGHPLEGTS--------------------------------------------VA
Q98JX5_RHILO/32-120PLSFWG--------GIDAETGDIIDHSHPGLGQN--------------------------------------------VA
Y2945_UNCMA/23-105AISFLG--------GVDPGTGTVIEKGHALYGKN--------------------------------------------VK
Q2U0J1_ASPOR/23-111EISFWG--------GVNPETGQVVDRHHPLCGQS--------------------------------------------IA
A6WUT6_OCHA4/25-115PISFWG--------GVDPKSGRIADVRHPEHGRS--------------------------------------------IA
Y1248_PYRKO/23-105PLSFLG--------GVDPETGIVTDAESDIRGQS--------------------------------------------IA
Q161U5_ROSDO/23-111PLSFWG--------GVDPATSRVVLAGHPQYGVL--------------------------------------------IK
A6T0N2_JANMA/24-106GFSARY--------DLDRINGTFSRPAHKLAGLS--------------------------------------------YV
Q1YLG5_MOBAS/23-111PLSFWG--------GIDVETGTIIDHSHPSLGAR--------------------------------------------VT
A6UU66_META3/32-112SISFLG--------GVN.EEGVITDKDSKLNGQT--------------------------------------------VK
A1WSP8_VEREI/24-106GFSARY--------DLNRWTGLFSRPAHKLVGLS--------------------------------------------YV
A2SRL5_METLZ/23-105PISFLG--------GVDPKTGIVIDETHPLFGKS--------------------------------------------VA
Y244_METAC/26-108PISFLG--------SVDPKTGIVVEEKHSLAGKS--------------------------------------------IK
Q2NHJ1_METST/25-107PISFLG--------GVDPKTGIVIDKKHELYNEC--------------------------------------------IT
A7VUI2_9CLOT/26-108RISFWG--------GADVMKGIFTERGHELENCS--------------------------------------------FK
A2W099_9BURK/29-117PLSFWG--------GYDSGAGRIVDRGHPQAGAS--------------------------------------------LA
A5UMD2_METS3/22-104PISFLG--------GVDPKTGIVIDPNHELKGQS--------------------------------------------IK
A6E2Y5_9RHOB/20-108GLSVWG--------GVDPQSGRIIDAHHPQRGQS--------------------------------------------LA
A1BBM0_PARDP/23-111PLSFWG--------GVDPATGRIIDVHHPLQGRS--------------------------------------------IA
Q2USZ3_ASPOR/32-120ELSFWG--------GVDPRTGEIIDRFHPLSGRF--------------------------------------------MK
Y1486_METKA/28-110RLSFLG--------GVDPKTGEVVDPSHELCGEK--------------------------------------------LT
Y208_METTP/23-105RISFLG--------NVDPETGVVVDPAHELYGRS--------------------------------------------IA
A3MUQ8_PYRCJ/24-99PVSLLG--------DFDPETGRLL.......GVD--------------------------------------------VV
A1RYB9_THEPD/16-98PITFLG--------GVDPFTGLVVEKGHPLYGQS--------------------------------------------VS
A1WKZ3_VEREI/28-116PLSFWG--------GYDAQAGRIVEPGHPQQGMS--------------------------------------------LA
A3JUH3_9RHOB/27-115GLSFWG--------GVDPETGVIIDVHHPNHGAS--------------------------------------------LA
Q7W4E6_BORPA/31-113RISFWG--------GFDPQTGRIVDPYSSLRGRD--------------------------------------------IS
A3DM70_STAMF/24-101SISFFG--------EVDPINGIVRPE.....NIS--------------------------------------------IT
A2BN86_HYPBU/26-102SISFYG--------EVDPDTGVLKGVG......S--------------------------------------------IA
Y1530_METTH/23-105PLSFLG--------GVDPGTGRVIDQKHPLHGRS--------------------------------------------IR
Y2089_AERPE/25-101SLSFYG--------EVDPETGVTSG......GKP--------------------------------------------LA
A1DKV6_NEOFI/23-111GLSFWA--------GVDSQTGEIIDRHHPLHGQS--------------------------------------------VN
Q5ASV1_EMENI/23-111PLSFWG--------GVEQTTGDIIDHHHPLFGEN--------------------------------------------IK
Q2FUD8_METHJ/23-105PISFLS--------GVDPETGIVLEPGHPLEGKD--------------------------------------------IT
Y1407_METJA/23-103PFSFLG--------GVD.EEGNIIDKDSDLYGQS--------------------------------------------LK
A8AAC4_IGNH4/34-111PLSFLG--------EVDPLKGTLYD......GRS--------------------------------------------IK
A6UG94_SINMW/25-113ALSFWG--------GVDPDTGCVIDVHHPQHGVS--------------------------------------------LT
A3J817_9ALTE/30-118GLSFWG--------GVDPDFGSIIDVHHPNYGES--------------------------------------------VS
Q8ZVK7_PYRAE/22-97PVSLLG--------DLDPEAGKLA.......GVD--------------------------------------------VV
Y055_ARCFU/23-104YISFLG--------GIDKETGIVKE.DCEIKGES--------------------------------------------VA
Y1471_METBU/26-108ALSFLG--------NVDPKTGVVVDPGHAIYGEC--------------------------------------------IR
A1RSU8_PYRIL/31-106PVSFLG--------DLDPKTGVLA.......GIN--------------------------------------------IV
Q13MZ8_BURXL/42-130PLSFWG--------GYDAALGKIIEKSHPAHGQS--------------------------------------------LA
Q7VS11_BORPE/25-107GFSPRY--------DLDRWSGVISRIGHSAEGES--------------------------------------------IK
Q5LVT9_SILPO/20-108GLSFWG--------GVDPETGRVIDAHHPQHGAA--------------------------------------------LA
Q1M4S5_RHIL3/30-118ELSFWG--------GVDPWTGEVIDRHHPLSGRS--------------------------------------------LK
Q2FQH8_METHJ/30-113FLSHLV--------NAVNSDGVIRIFGHPLVGQS--------------------------------------------YA
Y1615_PYRAB/23-105PLSFLG--------GVDPETGIIIDPDSDIKGES--------------------------------------------IE
Q0G2A4_9RHIZ/24-112PLSFWG--------GVDPATGRIVDVHHPQHGEM--------------------------------------------AS
A0RYV0_CENSY/2-84PINFLG--------AVDKKTGEVTDSGHDLHGRS--------------------------------------------FK
A2QL18_ASPNC/27-115ELSFWG--------GVDPQTGQVIDQHHPLSGHS--------------------------------------------LE
Y391_PYRFU/23-105PLSFLG--------GVDPNTGIITDPESDIQGEK--------------------------------------------IT

PF06434

Q7CVQ5_AGRT5/175-406RVM....LIAEK-GTMGVGSSRMSGVNNVALWTGKQASPYVPFV-NYAPIVAGTNGISPIFATTVDVTGGIGINLKNWVK
A1TPA0_ACIAC/168-382GHV....VAYVG-DVVGTGSSRKSATNSV.IWATGQDIPFVPNK-RFGGVTLGGK.IAPIFFNTQEDSGSL.........
Q1JW62_DESAC/168-372GNQ....VAFVG-DVVGTGSSRKSACNSV.LWHIGEDIPAVPNK-RRAGVIIGGV.IAPIFFNTAQDSGAL.........
A0B1A3_BURCH/168-380GHL....VAYVG-DVVGTGSSRKSATNSV.LWFTGEDIPFVPNK-RFGGVCLGGK.IAPIFYNTMEDAGAL.........
A5WDW0_PSYWF/168-383GFP....LAYVG-DVVGTGSSRKSATNSV.LWLMGDDIPNVPNK-RAGGLVLGGK.IAPIFYNTMEDSGAL.........
A6V736_PSEA7/168-382GFP....VAYVG-DVVGTGSSRKSATNSV.LWFFGDDIPFVPNK-RAGGFCFGTK.IAPIFYNTMEDAGAL.........
Q0I4W3_HAES1/171-385GFP....LVYVG-DVVGTGSSRKSATNSV.LWFMGEDIPYIPNK-RAGGVVLGGK.IAPIFFNTLEDAGSL.........
A5GFC4_GEOUR/167-371GFQ....VAFAG-DVVGTGSSRKSACNSV.LWANGNDIPCVPNK-RRGGVIIGGV.IAPIFFNTAQDSGAL.........
A7BSA2_9GAMM/167-370GYP....LAYVG-DVVGTGSSRKSAINSV.LWYIGHDIPYIPNK-RQGGIILGNK.IAPIFFNTAEDAGAL.........
Q7V3U1_PROMM/169-377GHP....IAYVG-DVVGTGSSRKSAINSV.LWHIGADIPYVPNK-RSGGVILGGK.IAPIFFNTAEDSGAL.........
Q8DL06_THEEB/174-377GYP....LAYVG-DVVGTGSSRKSATNSV.IWHIGRDIPYVPNK-RTGGVCLGGK.IAPIFFNTMEDSGAL.........
Q118H1_TRIEI/169-372GHP....VAYVG-DIVGTGSSRKSACNSM.LWHIGEDIPFIPNK-RSGGYILGGK.IAPIFFNTAEDSGAL.........
Q2SK45_HAHCH/194-401GHE....VAFVG-DVVGTGSSRKSATNSV.LWYIGRDMPGVPNK-RTGGICIGGK.IAPIFFNTMEDAGAL.........
A8G7K5_PROM2/175-383DLP....IAYVG-DVVGTGSSRKSAINSL.IWHIGEDIPFVPNK-KTGGILIGSK.IAPIFFNTAQDSGAL.........
Q7UDR9_SHIFL/168-382GFP....LAYVG-DVVGTGSSRKSATNSV.LWFMGDDIPHVPNK-RGGGLCLGGK.IAPIFFNTMEDAGAL.........
Q1QVU9_CHRSD/173-387GHP....VVYVG-DVVGTGSSRKSATNSV.LWFFGDDIPNVPNK-RAGGFCFGGK.IAPIFFNTMEDSGAL.........
Q65PY4_MANSM/171-385GFP....LAYVG-DVVGTGSSRKSATNSV.LWFMGEDIPYIPNK-RAGGIVLGGK.IAPIFFNTLEDAGAL.........
Q0A8N5_ALHEH/171-378GHP....VALVG-DVVGTGSSRKSATNSV.LWYIGDDIPYVPNK-RAGGVCIGGK.IAPIFFNTMEDSGAL.........
A0Z071_LYNSP/169-377GHP....VAYVG-DVVGTGSSRKSAINSL.LWHIGDDIPCVPNK-RAGGYILGGK.IAPIFFNTAEDSGAL.........
A6GNC8_9BURK/168-380GNP....IAYVG-DVVGTGSSRKSATNSV.LWFTGEDIPFIPNK-RFGGYCLGNK.IAPIFFNTMEDAGAL.........
A4A855_9GAMM/168-381GYP....VAFVG-DVVGTGSSRKSATNSV.LWFFGDDVSGVPNK-KAGGICIGGK.VAPIFYNTMEDAGAL.........
Q5GYV5_XANOR/168-382GHL....VAYVG-DVVGTGSSRKSATNSV.LWWTGEDIPYIPNK-RFGGVCLGSK.IAPIFYNTMEDAGAL.........
A3VFZ3_9RHOB/174-406HPDKRVMLIAEK-GTMGVGSSRMSGVNNVALWTGKQASPYVPFV-NYAPVVAGTNGISPIFLTTVGVTGGIGLDLKNWVK
Q5N4E2_SYNP6/169-372GYP....LAYVG-DVVGTGSSRKSAINSV.LWHIGEDIPFVPNK-RSGGIILGGK.IAPIFFNTAEDSGAL.........
B3EGH0_CHLL2/171-373GHP....LAYVG-DVVGTGSSRKSGINSV.QWHLGEDIPAVPNK-RTGSVIIGSI.VAPIFFNTAEDSGAL.........
A1VZH9_CAMJJ/166-368GRE....VVYVG-DVVGTGSSRKSAINSI.QWHLGKEIEGVPNK-HSGGIVMGST.IAPIFFNTAQDSGAL.........
A8EUS0_ARCB4/171-373GHP....LAYVG-DVVGTGSSRKSGINSV.QWHMGRDIPGVPNK-RTGGVVIGSI.IAPIFFNTAEDSGCL.........
Q1Z4J1_PHOPR/168-382GHQ....LVYVG-DVVGTGSSRKSATNSV.LWFMGDDIPYVPNK-RAGGYVLGGK.IAPIFFNTMEDAGAL.........
ACON2_HELPY/171-373GVP....VAYVG-DVVGTGSSRKSATNSI.MWHFGKDIPFVPNK-RSGGIVIGGV.IAPIFFATCEDSGAL.........
Q1H0A3_METFK/167-370GLP....LAYVG-DVVGTGSSRKSAINSV.QWHMGNDIPYIPNK-RTGGIVLGGK.IAPIFFNTAEDSGAL.........
Q39UD3_GEOMG/167-371GHQ....VAFVG-DVVGTGSSRKSACNSV.LWHMGQDIPAVPNK-KTAGVIIGGV.IAPIFFNTAQDSGAL.........
Q3A2K3_PELCD/167-371GHQ....VAFVG-DVVGTGSSRKSACNSL.LWHIGEDIPGVPNK-RRGGVIIGGA.IAPIFFNTAQDSGAL.........
Q6F9U3_ACIAD/168-384GNQ....VAYVG-DVVGTGSSRKSATNSV.LWFFGDEIAHIPNK-KDGGYCLGSK.IAPIFFNTMEDAGAL.........
A4SDR1_PROVI/171-373GHP....LAYVG-DVVGTGSSRKSGINSV.QWHLGEDIPAVPNK-RTAGVVIGSI.IAPIFFNTAEDSGAL.........
A3WNJ6_9GAMM/187-393GHP....VAFVG-DVVGTGSSRKSATNSV.LWNIGEDMPGTPNK-RAGGICIGGK.VAPIFFNTMKDAGAL.........
A2C5H7_PROM1/170-378GYP....IAYVG-DVVGTGSSRKSAINSV.LWHTGQDIPYVPNK-RGSGVVIGGK.IAPIFFNTAEDSGAL.........
Q2IQ71_ANADE/167-371GFQ....VAFVG-DVVGTGSSRKSACNSV.LWAIGEDIPFVPNK-RRGGVIIGGV.IAPIFFNTAQDSGAL.........
Q3AVN1_SYNS9/169-371GHP....VAYVG-DVVGTGSSRKSAINSV.LWHTGNDIPHVPNK-RAGGVILGGK.IAPIFFNTAEDSGAL.........
A0L7Y2_MAGSM/188-390GYP....VAYVG-DVVGTGSSRKSAANSV.IWHTGSDIPYVPAK-RTGGVVIGGT.IAPIFFNTAEDSGML.........
A8FQC8_SHESH/168-382GFP....LVYVG-DVVGTGSSRKSATNSV.LWFMGDDIPNVPNK-RAGGFCLGGK.IAPIFFNTMEDAGAL.........
Q12Z08_METBU/167-371GHE....VAFVA-DVVGTGSSRKSACNSV.LWHIGKDIPHVPNK-RRDCVIIGTA.IAPIFFNTAEDSGAL.........
Q604Q3_METCA/168-375GFP....VAYVG-DVVGTGSSRKSATNSL.LWYIGEDIPHVPNK-RQGGVCIGGK.IAPIFFNTLEDSGAL.........
Q01EA0_OSTTA/235-442GHP....LAYVG-DVVGTGSSRKSATNSV.LWHMGEDIPNVPNK-RTGGVCIGGK.IAPIFFNTMEDSGAF.........
Q7VFE0_HELHP/176-382AAQNNAVVAYVG-DVVGTGSSRKSACNSI.MWHFGKEIPFIPNK-KSGGIVIGSV.IAPIFFNTCEDSGAL.........
Q9X5I6_NEIME/168-380GHP....VAYVG-DVVGTGSSRKSATNSV.IWHTGEDIPFVPNK-RFGGVCLGGK.IAPIFFNTQEDSGAL.........
A4BJS2_9GAMM/168-380GHP....LALVG-DVVGTGSSRKSATNSV.LWYTGQDIPNVPNK-RFGGFCLGGK.IAPIFFNTMEDAGAL.........
Q2JL67_SYNJB/170-373GHP....VAFVG-DVVGTGSSRKSALNSL.LWHIGHDIPHVPNK-RAGGVILGGT.IAPIFFNTAEDAGAL.........
A3Y383_9VIBR/168-379GIP....LAYVG-DVVGTGSSRKSATNSV.LWFMGEDIPFVPNK-RTGGVCLGGK.IAPIFYNTMEDSGAL.........
A0XX36_9GAMM/168-382GLP....LAYVG-DVVGTGSSRKSATNSV.LWFMGDDIPFVPNK-RVGGVCLGNK.IAPIFFNTMEDSGAL.........
A5CVN2_VESOH/165-374GLP....LVFVG-DIVGTGSSRKSAINSV.LWHIGQNINYIPNK-RSGGIILGGK.IAPIFFNTAQDSGAL.........
Q15QA4_PSEA6/168-382GHP....VAFVG-DVVGTGSSRKSATNSV.LWFFGEDLPGVPNK-RGGGVCIGGK.VAPIFYNTMEDAGAL.........
B4S6I7_PROA2/171-373GHP....IAFVG-DVVGTGSSRKSGINSV.QWHIGENIPAVPNK-RTGGVVIGGI.IAPIFFNTAEDSGAL.........
Q31GI6_THICR/169-372GHP....VAYVG-DVVGTGSSRKSAMNSV.MWFFGNDIPYVPNK-RQGGVVLGGK.IAPIFFNTAEDSGSL.........
Q3AR28_CHLCH/171-373GHP....LAYVG-DVVGTGSSRKSGINSV.QWHIGSDIPAVPNK-RTGGVVLGGI.IAPIFFNTAEDSGAL.........
A3J0H2_9FLAO/174-405HPDKSVMLIAEK-GTMGVGSSRMSGVNNVALWTGKQASPYVPFV-NFAPIVAGTNGISPIFLTTVDVTGGIGIDLKNWVK
A4C0C6_9FLAO/174-407HPSKRVMLIADK-GTMGVGSSRMSGVNNVALWTGIKASPYVPYI-NIAPIIAGTNGISPIFLTTVGVTGGIGIDLKNWIK
Q0YRL9_9CHLB/171-373GHP....LAYVG-DVVGTGSSRKSGINSV.QWHMGTDIPAVPNK-RTGGVVIGGI.IAPIFFNTAEDSGAL.........
A1U1S2_MARAV/173-386GLP....VAFVG-DVVGTGSSRKSATNSV.LWFFGEDIPGVPNK-RAGGVCIGNK.VAPIFFNTMEDAGAL.........
Q6SFU1_9BACT/165-368ELP....LAYVG-DVVGTGSSRKSAINSV.LWHMGEPIDYIPNK-NSGGIVLGGK.IAPIFFNTAEDSGAL.........
Q4CAL9_CROWT/169-372GYP....VAYVG-DVVGTGSSRKSAINSV.LWHIGHDIPFVPNK-RAGGYILGGK.IAPIFFNTAEDSGAF.........
A0RPN0_CAMFF/169-372GLE....VIYVG-DVVGTGSSRKSGINSI.QWHLGHEIDGIPNK-KTGGIILGSI.IAPIFFNTAEDSGAL.........
A3YGV8_9GAMM/168-382QIP....LAYVG-DVVGTGSSRKSATNSV.LWHMGDDIPFIPNK-RAGGICIGSK.IAPIFFNTMEDAGAL.........
A0ZJM7_NODSP/186-389GHP....LAYVG-DVVGTGSSRKSAINSV.LWHLGNDIPYVPNK-RAGGYILGSA.IAPIFFNTAEDAGAL.........
A6ETA5_9BACT/174-407HPDKRVMLIAEK-GTMGVGSSRMSGVNNVALWTGIPSSPYVPFI-NIAPVIAGTNGISPIFLTTVGVTGGIGIDLKNWVK
A4SXE4_POLSQ/168-380GNQ....IAYVG-DVVGTGSSRKSATNSV.LWWTGQDIPFVPNK-RFGGVCLGTN.IAPIFFNTMEDSGAL.........
A7GY34_CAMC5/205-531GRE....VVYVG-DVVGTGSSRKSGINSI.QWHLGREIEGVPNK-KTGGIVIGGV.IAPIFFNTAEDSGAL.........
A1AXP1_RUTMC/165-368GLP....LVFVG-AIVGTGSSRKSAINSV.LWHMGHAIDYVPNK-HSGGVLLGGK.IAPIFFNTAQDSGAL.........
A6FBI9_9GAMM/168-376GHQ....VAYVG-DVVGTGSSRKSATNSV.LWCMGDDIPFVPNK-RGGGICIGSK.IAPIFFNTMEDSGAL.........
A4RSV0_OSTLU/237-444GYP....LAYVG-DVVGTGSSRKSATNSV.LWHMGIDIPNVPNK-RTGGVCIGGK.IAPIFFNTMEDSGAF.........
Q5P0Q1_AROAE/172-388GNL....VAYVG-DVVGTGSSRKSATNSV.LWFTGEDIPFVPNK-RFGGVCLGSK.IAPIFFNTMEDAGAL.........
Q30RR3_SULDN/171-373GNP....IAYVG-DVVGTGSSRKSGVNSV.QWHMGEDIPGVPNK-RTGGVVLGSI.IAPIFFATCEDSGAL.........
Q0VQ99_ALCBS/168-380GYP....VAYVG-DVVGTGSSRKSATNSV.LWHFGDDIPFVPNK-RAGGVCIGGK.IAPIFFNTMEDSGAL.........
A6DS04_9BACT/173-380DLP....ISFVG-DVVGTGSSRKSACNSL.LWHIGDDIPFIPNK-RRGGVIIGGI.IAPIFFNTAEDSGAL.........
Q7V9G7_PROMA/170-374GHS....IAYVG-DVVGTGSSRKSAINSV.LWHIGEDIPYVPNK-RSGGIILGGK.IAPIFFNTAEDSGAL.........
A6VKR8_ACTSZ/171-385GFP....LVYVG-DVVGTGSSRKSATNSV.LWHMGDDIPFIPNK-RTGGFVFGGK.IAPIFFNTAEDSGAL.........
F2GA07_ALTMD/175-406HPNAKVMLIAEK-GTMGVGSSRMSGVNNVALWAGEPTSPYIPFV-NKAPIVAGTNGIAPIFLTTVDVTGGIGLDLKNWVK
Q7M959_WOLSU/170-372GFP....LVYVG-DVVGTGSSRKSACNSL.VWHMGHEIPFIPNK-KAGGVVIGTS.IAPIFFNTCEDSGTL.........
A1BEM7_CHLPD/171-373GYP....LAYVG-DVVGTGSSRKSGINSV.QWHLGEDIPAVPNK-RTGSVVIGGI.VAPIFFNTAEDSGAL.........
A7I373_CAMHC/170-373GKK....VVYVG-DVVGTGSSRKSGVNSV.QWHIGDEIKGVPNK-KTGGVIIGST.IAPIFFNTAEDSGAL.........
Q47UT3_COLP3/168-380GIP....LAYVG-DVVGTGSSRKSAANSV.LWYMGDDIPCIPNK-RGGGVCLGGK.IAPIFYNTLEDSGAL.........
A0Z918_9GAMM/168-381ELP....VAFVG-DVVGTGSSRKSATNSV.LWFFGDDMPGVPNK-RGGGVCIGSK.VAPIFYNTMEDAGAL.........
A6Q381_NITSB/171-374GLP....VAFVG-DVVGTGSSRKSGINSV.QWWIGEDIPHVPNK-RTGGIIIGGI.IAPIFFNTAEDSGAL.........
A9BDQ3_PROM4/170-378GYP....LAYVG-DVVGTGSSRKSAINSL.LWHIGNDIPYIPNK-RSGGIILGGQ.IAPIFFNTAEDSGAL.........
A6Q9Z4_SULNB/172-374GHP....LAYVG-DVVGTGSSRKSGINSV.QWHMGHDIPGIPNK-RTGGVVIGDI.IAPIFFNTAEDSGCL.........
A4EYJ8_9RHOB/174-407HPDKRVMLIAEK-GTMGVGSSRMSGVNNVALWTGKQASPYVPFV-NYAPVVAGTNGISPIFLTTVGVTGGIGLDLKNWVK
A1APN5_PELPD/168-373GCR....IAFVG-DVIGTGSSRKSACNSL.LWAIGEDIPGVPNK-RGGGVIIGGV.IAPIFFNTAQDSGAL.........
A1SYN8_PSYIN/168-382GHP....LVYVG-DVVGTGSSRKSATNSV.LWFMGNDVPFVPNK-RAGGVCIGNK.IAPIFFNTMEDSGAL.........
Q3J9D3_NITOC/167-370GLP....LAFVG-DVVGTGSSRKSAINSI.LWHMGQDIPFVPNK-RQGGIILGGK.IAPIFFNTAEDSGAL.........
Q1YQ85_9GAMM/168-381GLP....VAFIG-DVVGTGSSRKSATNSV.LWFFGEDMPGVPNK-RSGGICFGSK.VAPIFFNTMEDAGAL.........
A2BZ87_PROM5/175-383DLQ....IAYVG-DVVGTGSSRKSAINSV.IWHLGEDIPFVPNK-KTGGIIIGNK.IAPIFFNTAQDSGAL.........
A3X845_9RHOB/174-406HPDARVMLIAEK-GTMGVGSSRMSGVNNVALWTGKKASPYVPFI-NIAPVVAGTNGISPIFLTTVGVTGGIGIDLDNWVK
A5GX02_SYNR3/176-378GLP....VAYVG-DVVGTGSSRKSAINSV.LWHTGSDIPHVPNK-RSGGVILGGK.IAPIFFTTAEDSGAL.........
A7ZDV7_CAMC1/178-384GKS....VAYVG-DVVGTGSSRKSGINSI.QWHLGDEIEGVPNK-KKGGIVIGTT.IAPIFFNTAEDSGAL.........
A6DD15_9PROT/172-375GKP....VAFVG-DVVGTGSSRKSAANSV.IWHIGEEIPYVPNK-KRGGIVIGGV.IAPIFFNTLEDSGAL.........

PF00694

D3DW85_HUMAN/767-896GIP----LIILAGKKYGSGNSRDWA-------------AKGPYL-LGVKAVLAES-YEKIHKDHLIGIGIA---------
C4ZTX1_ECOBW/689-819QTP----LAVIAGKEYGSGSSRDWA-------------AKGPRL-LGIRVVIAES-FERIHRSNLIGMGIL---------
ACON_LEGPH/689-819QQD----LVIIAGKEYGTGSSRDWA-------------AKGTNL-LGVKAVITES-FERIHRSNLIGMGIL---------
ACOC_HUMAN/692-821GLP----LIVLAGKEYGAGSSRDWA-------------AKGPFL-LGIKAVLAES-YERIHRSNLVGMGVI---------
LEUD_HAEIN/1-126GAT----ILLAR.KNLGCGSSREHA-------------PWALAD-YGFKVMIAPS-FADIFYNNSLNNHML---------
ACON_YEAST/579-709GIK----WVVIGDENFGEGSSREHA-------------ALEPRF-LGGFAIITKS-FARIHETNLKKQGLL---------
LEUC_RHIPU/529-654QSR----ILVCTGPNFGCGSSREHA-------------PWAFND-FGIRSIIAPS-FADIFFNNCFKNGML---------
LEUC_YEAST/545-672EAE----ILVVTGDNFGCGSSREHA-------------PWALKD-FGIKSIIAPS-YGDIFYNNSFKNGLL---------
LEUD_LACLA/1-124KAS----LLISG.DNFGSGSSREHA-------------AWALSD-YGFRAIIAGS-YSDIFYNNALKNGLL---------
LYS4_YEAST/484-620PGD----IVVSG.FNFGTGSSREQA-------------ATALLA-KGINLVVSGS-FGNIFSRNSINNALL---------
ACON2_YEAST/585-714GRP----WTVIAEHNYGEGSAREHA-------------ALSPRF-LGGEILLVKS-FARIHETNLKKQGVL---------
ACOC_CUCMA/696-826GQD----TIVLAGAEYGSGSSRDWA-------------AKGPML-LGVKAVIAKS-FERIHRSNLVGMGII---------
LEUD_BUCRP/1-126NAS----ILLTR.ENFGCGSSREHA-------------VWSLLD-YGFKVIISSS-FSDIFFNNSFNNKLL---------
LEUC_USTMA/542-667QSK----ILVVTGPNFGCGSSREHA-------------AWSLLD-FGIRAVIAES-FGDIFRNNLTKNGQL---------
LEUC_PHYBL/516-641SSK----ILVCTGPNFGCGSSREHA-------------PWAFND-FGIRCIIATS-FADIFFNNCFKNGML---------
ACON_BOVIN/582-712GIR----WVVIGDENYGEGSSREHA-------------ALEPRH-LGGRAIITKS-FARIHETNLKKQGLL---------
ACON_GRAGA/580-710GVK----WVVIGDENYGEGSSREHA-------------ALEPRH-LGGVAVIVKS-FARIHETNLKKQGML---------
ACON_CAEEL/576-706GVR----WVAIGDENYGEGSSREHA-------------ALEPRH-LGGRAIIVKS-FARIHETNLKKQGML---------

PF01989

A8MB53_CALMQ/28-107GKI----LALPY----STGSTVGPYVMY.KLAKYGKAPLAILTI.KPDTLVLVGSIMAN......I--------------
A9AB42_METM6/24-104NKI----FVFPT----GKGSTVGSYVIY.GLAKRGLL.KGMVNF.ESEPIVATGAILGK......I--------------
A9CH00_AGRT5/31-119GGV----LFMPT----SRGSCTGSGVLL.DLILTGRAPSALVFC.EAEDVLTLGALVAAEMFDKAL--------------
A9A545_NITMS/19-101DTI----LVFPS----GVGSSVGAYTIY.SIKSNGTAPLAMICQ.KADLTVATGCALAN......I--------------
A2W9E3_9BURK/126-208NKV----LVFPG----AKGSSGWSSQFH.IARIAGTAPAAMLFN.EMTTKIALGAVVSH......A--------------
Q0CKP1_ASPTN/21-109NRI----LAIPC----GRGSCSGSTVML.ELLLNGCAPAALIFE.QREQILTLGVLVGQALFDCSI--------------
A6V8V2_PSEA7/27-115GRL----LAIPG----GRGSCTGSSVLL.ELILGGRAPAAILLR.EPDEILALGAIVAEELFGRSL--------------
Q7VVN5_BORPE/28-110GKV----LIFKN----TKGGVATGWALL.NLKSRGTAPIALVCD.TTNPVFVQGAALAG......L--------------
A7I8B4_METB6/34-116GTV----LVFPY----GKGSTVGSYVIY.ALSRNGHAPAAIVNT.EAEPIIATGAIIGN......I--------------
Q98JX5_RHILO/32-120GRI----LVMPS----GRGSSSSSSVLA.EAIRRGTAPAGILLE.RPDPILAVGAIVAEFLYDIHM--------------
Y2945_UNCMA/23-105GTV----LIFPG----GKGSTVGSYVIY.QLMKNGVAPAAMINI.KAEPIVAVGAIISG......I--------------
Q2U0J1_ASPOR/23-111GRV----LAIPC----GRGSCSGSTVML.KLLLNGCAPAALIFE.KPEQILTLGVLVGKVLLDCPI--------------
A6WUT6_OCHA4/25-115GRV----LCLPG----TIGSSSAAAVLL.ELVHSGHAPAAIVLH.EPDAILLLGLIVAREM.GHDV--------------
Y1248_PYRKO/23-105GKI----LVFPR----GKGSTVGSYVIY.ALKKNNKAPKAIIVG.EAETIVATGAIISD......I--------------
Q161U5_ROSDO/23-111GKI----VVLHE----LIGSSSSSAVLL.ELIYRDVSPLALILG.QRDAILPMGVVVARQMGWSTP--------------
A6T0N2_JANMA/24-106GKI----LVLDT----AKGGVASAWMLH.EMASRNKMPLAIVFN.TVNPILVQGAAFGG......L--------------
Q1YLG5_MOBAS/23-111GRI----LVMPG----GRGSSSSASVFA.ESIRRGTGPLGVLLA.RADPILTVGAMVAASLYGRDC--------------
A6UU66_META3/32-112NKI----FVFPT----GKGSTVGSYVIY.GLAKNNIL.KGIINA.DCEPIVATGAILGK......I--------------
A1WSP8_VEREI/24-106DRI----LILDT----AKGGVASAWMLH.EMKSRHMAPKAIVFN.TVNTILAQGAALGG......I--------------
A2SRL5_METLZ/23-105GKV----LVFPY----GKGSTVGSYVLY.ALAKNHVAPAAIINT.ECETIIATGAIIAE......I--------------
Y244_METAC/26-108GKV----LVFPH----GKGSTVGSYVMY.QLKKNGAAPVAIINL.ETEPIVAVGAIISE......I--------------
Q2NHJ1_METST/25-107DKI----LVIPS----GKGSTVGSYVIY.QMAKNNTAPRAIICQ.KAEPIIAIGAIISK......I--------------
A7VUI2_9CLOT/26-108DKI----LVFQS----TKGSSGTSGMLK.WSKINGVAPRAFINS.DLDALAVLSCVACK......F--------------
A2W099_9BURK/29-117GKV----MVMPH----AKGSSSSSSVLA.EAVRNGTGPVGIVLK.ERDLIISIGAIVAAELYAIAV--------------
A5UMD2_METS3/22-104DKV----LFIPG----GKGSTVGSYVIF.QMKKNNTAPKAIICL.NAEPIIATGAIMSD......I--------------
A6E2Y5_9RHOB/20-108GHV----VMMPT----SRGSCTGSGVLL.GLAFAGTAPKALIFR.EGEDILTLGALVATRLFDRPI--------------
A1BBM0_PARDP/23-111GRV----LMMPS----TRGSCTGSGVLL.DLVLSGRGPAALVFS.EPEDVVTLGALIAAEMFGKAL--------------
Q2USZ3_ASPOR/32-120DTI----LAIPG----GRGSCGGSVIMM.ELILNGLGPKALIFE.RREEIITLGVMVAEELFDKTA--------------
Y1486_METKA/28-110GRV----LVLPG----GRGSTVGSYVLM.EMADRGTAPAGIVVR.EAEPILVVGCVLGD......I--------------
Y208_METTP/23-105GVV----LIFPG----GKGSTVGSYVIY.QLRKRGMAPAAMINL.KSEPIVAVGAIISD......I--------------
A3MUQ8_PYRCJ/24-99GKI----VALPY----VKGSTVGPYLMW.SASRRGKIPLAVVAE.KPDLMLVTACVLAN......V--------------
A1RYB9_THEPD/16-98GKI----LVFPY----SKGSTVGSYILL.RLSKRGLAPAGIVTS.SADEVTVIGCLISN......I--------------
A1WKZ3_VEREI/28-116GRV----LLMAH----AKGSSSSSSVLA.EAIRQRTGPAAIVMC.SRDLIIGVGCIVASELYGRHV--------------
A3JUH3_9RHOB/27-115GKI----ILMPT----SRGSCSGSGVLL.QLARNGIAPAALVFR.EDEDILTLGALIAARLFDKPL--------------
Q7W4E6_BORPA/31-113DCV----LILLS----SKGSSGTSGMLS.LATRAGHAPAAMIQV.EMDPVTVMGCLVNN......I--------------
A3DM70_STAMF/24-101GKA----LIFRG----SRGSTVGSYIIY.ALRYYGKSPSCMIVE.NAEPILITGCVLSD......T--------------
A2BN86_HYPBU/26-102GKI----LVFRG----SRGSTVGPYIMY.ALRRKGLAPAGLIVP.KAEPMLVAGAVLAE......I--------------
Y1530_METTH/23-105GKV----LLIPG----GKGSTVGSYVIF.QMAKNETAPAAIICL.NAEPIIATGAIMAG......I--------------
Y2089_AERPE/25-101GRV----AAIRR----SRGSTVGSYVIY.ALKENGVAPLAILME.RAEPIVIAGCVLAG......I--------------
A1DKV6_NEOFI/23-111GRI----LAIPS----SRGSCTGSIVLI.ELLLNKCAPAGLIFQ.EPEQIITLGVIVAKTLLDLSV--------------
Q5ASV1_EMENI/23-111DRV----LVLPS----TRGSCSGSLVLI.ELLVNRVAPTALVFW.DSEAIVTTGVIVARTLLGLSL--------------
Q2FUD8_METHJ/23-105GSV----LAFEY----GKGSTVGSYILY.ALSRNGHAPAAIINQ.EAETIIVVGAIMGK......I--------------
Y1407_METJA/23-103GKI----FVFPY----GRGSTVGSYVIY.GLAKRGIL.KGIVNK.ECEPIVATGAILGG......I--------------
A8AAC4_IGNH4/34-111NKV----LVVKG----VRGSTVGSYVIY.ALRYYNNAPLAIVVEGEADPIAVAGCVMAK......L--------------
A6UG94_SINMW/25-113GAI----LMMPS----SRGSCTGSGVLL.DLLLTGRGPAALVFS.QPEDVLTLGALVAFEMFGKPL--------------
A3J817_9ALTE/30-118GKI----LMMPT----SRGSCSGSGVLL.ELSLNSLAPAALVFR.EHEEVLTLGALVSDRIFGRPL--------------
Q8ZVK7_PYRAE/22-97GKI----AALPY----VKGSTVGPYVLW.GAARRGKAPLAIVAQ.KPDLMLISACVLAG......I--------------
Y055_ARCFU/23-104GRI----LVFPG----GKGSTVGSYVLL.NLRKNGVAPKAIINK.KTETIIAVGAAMAE......I--------------
Y1471_METBU/26-108DKI----LVFPH----GKGSTVGSYVIY.QLKKNNVSPAAMINI.DSEPIVAVGAIISD......I--------------
A1RSU8_PYRIL/31-106GKI----LALPY----VKGSTVGPYVLW.NAAKRGKSPLAIVAE.KPDLMLVTACVLAG......V--------------
Q13MZ8_BURXL/42-130GKI----MVMPR----AKGSSSSSSVLA.EAIRNGTGPSGIVLR.ERDLIISIGVIVANELYGVSV--------------
Q7VS11_BORPE/25-107DRI----LVIPT----AKGGVAGGWAFY.DLLHKGIAPKALVFG.KLNPVMVQGAVLAG......M--------------
Q5LVT9_SILPO/20-108GAV----VMMPT----SRGSCSGSGVLL.ALALNGHAPAALVFR.EGEDVLTLGALVAAWMYDRPV--------------
Q1M4S5_RHIL3/30-118DHI----LAIPG----GRGSCSGSGVML.ELLLNGKGPKAMLFE.REEDILTLGVVIAEEVFGQSI--------------
Q2FQH8_METHJ/30-113GKI----VVYDT----DKFSTGGAWGLYFKAKVTNSAPKALICR.TVHPISIGGAIDAG......I--------------
Y1615_PYRAB/23-105GKI----LVFPK----GRGSTVGSYVIY.ALSRNGKAPKAIIVE.EAEPIVTVGAIISG......I--------------
Q0G2A4_9RHIZ/24-112GRV----LVMAT----SRGSCSGSGVYL.DLALAGRAPAALVFG.GPEDVLTLGALIAAEMFGVTI--------------
A0RYV0_CENSY/2-84GKI----LVFPH----GVGSSVGAYTIY.SLASHGSAPAGMVCK.KADLTVASGCALAN......I--------------
A2QL18_ASPNC/27-115GCI----LAIPG----GRGSCSGSGVML.ELLLNNRGPKAILFE.RREEILTLGVMVAEEMFDRAI--------------
Y391_PYRFU/23-105GKI----LAFPR----GKGSTVGSYVIY.ALAKKGTGPKAIIVE.EAEAIVAVGAIIAG......I--------------

PF06434

Q7CVQ5_AGRT5/175-406KLGEDGKPILNNDGNPIL.EQKYSVETGT..VLKID..AKNRKLRD.....ENG..........................
A1TPA0_ACIAC/168-382...............PIE.VDVSKLEMGD..VIDVL..PYEGKLVR......NG..........................
Q1JW62_DESAC/168-372...............PLR.MDVSSINHGD..VITIN..TAEGKVTG.....ADG..........................
A0B1A3_BURCH/168-380...............PIE.LDVSQMNMGD..VVELR..PYEGKALK......DG..........................
A5WDW0_PSYWF/168-383...............PIENVAVDNINMGD..VFDVY..PYEGKITK....HDSD..........................
A6V736_PSEA7/168-382...............PIE.FDCTNLAMGD..VIDVY..PYEGKVVR....HDSG..........................
Q0I4W3_HAES1/171-385...............PIE.VDVSRLNMGD..VIDVY..PYEGKICR....HDSN..........................
A5GFC4_GEOUR/167-371...............PLK.ADVTKMNTGD..VIIID..TVKGEIKS.....EGG..........................
A7BSA2_9GAMM/167-370...............PIE.CDVTQLNTGD..IITIY..PYKGYIIN.....EKG..........................
Q7V3U1_PROMM/169-377...............PIE.CDVSQLQSGD..VITIR..PHAGTIERAFGEDKAG..........................
Q8DL06_THEEB/174-377...............PIE.CDVSQMTMGD..VITIY..PYRGEITN.....EAG..........................
Q118H1_TRIEI/169-372...............PIE.CDVTKMETGM..VITIY..PYKGEIIN.....EAG..........................
Q2SK45_HAHCH/194-401...............PFE.CDVSQMNMGD..VIEIL..PFEGKVKN....HETG..........................
A8G7K5_PROM2/175-383...............PIE.ADVSNMNTGD..VIKIY..PYKGIIKKIEKDSNTE..........................
Q7UDR9_SHIFL/168-382...............PIE.VNVSNLNMGD..VIDVY..PYKGEVRN....HETG..........................
Q1QVU9_CHRSD/173-387...............PIE.MDVEKLEMGD..VIDVY..PYEGKVCK....HGTD..........................
Q65PY4_MANSM/171-385...............PIE.VDVSALNMGD..VIDIY..PYAGKICV....HNTD..........................
Q0A8N5_ALHEH/171-378...............PIE.MDVDAFETGD..VIDIY..PYEGKVCR....HGTD..........................
A0Z071_LYNSP/169-377...............PIE.CDVTSMNTGD..VITIH..PYKGEITKVGANGDSP..........................
A6GNC8_9BURK/168-380...............PIE.LDVSQMDMGD..EIELR..PFEGKALK......NG..........................
A4A855_9GAMM/168-381...............VFE.APVDDIGMGD..IIEIR..PYDGKILS.....ESG..........................
Q5GYV5_XANOR/168-382...............PIE.LDVSQMEHGD..VVELR..PYDGKALK......NG..........................
A3VFZ3_9RHOB/174-406KVDADGNPILNNDGNPVL.EQKYSVETGT..VLKID..TKNRKLRD.....ADG..........................
Q5N4E2_SYNP6/169-372...............PIE.CDVSALDTGM..VVTIY..PYEGVIKD.....EAG..........................
B3EGH0_CHLL2/171-373...............PIQ.ADVSAMETGD..VIDVY..PYEGKIEK......DG..........................
A1VZH9_CAMJJ/166-368...............PII.CDVTNLEMGD..EFEIH..PYEGKIIK......NG..........................
A8EUS0_ARCB4/171-373...............PIQ.ANVDSIDTGD..VITLK..PYAGVIEK......DG..........................
Q1Z4J1_PHOPR/168-382...............PIE.ADVSALNMGD..VIDVY..PFKGEVRS....HDSG..........................
ACON2_HELPY/171-373...............PIV.ADVKDLKEGD..LIKIY..PYKGEITL......ND..........................
Q1H0A3_METFK/167-370...............PIQ.CDVSAMSTGD..VIAVR..PYDGKVLN.....AAG..........................
Q39UD3_GEOMG/167-371...............PLK.ADVTKMNDGD..VITIN..TAKGEISN.....DKG..........................
Q3A2K3_PELCD/167-371...............PIH.AEVDKLEHGA..EVTIE..PLSGRILD.....SAG..........................
Q6F9U3_ACIAD/168-384...............PVE.IDVANMNMGDEIVLKID..HAAAKVTA....FKNG..........................
A4SDR1_PROVI/171-373...............PIQ.ADVSDMETGD..VIDVF..PYAGTIEK......NG..........................
A3WNJ6_9GAMM/187-393...............VFE.ADVEKMNMGD..VISIF..PYEGKIKN.....EAG..........................
A2C5H7_PROM1/170-378...............PIE.CDVSNLKTGD..VITIF..PYKGEVRRSKNKTNSG..........................
Q2IQ71_ANADE/167-371...............PIR.TDVTKLKTGD..VVVID..TKKGEVRT.....EQG..........................
Q3AVN1_SYNS9/169-371...............PIE.CDVSQLNTGD..VITIR..PHAGTVER......DG..........................
A0L7Y2_MAGSM/188-390...............PIQ.CDVTGMNTGD..VITIN..TKTGEITR......DG..........................
A8FQC8_SHESH/168-382...............PIE.LDVSKMNMGD..VIDIY..PYQGVVKR....HDSD..........................
Q12Z08_METBU/167-371...............PLQ.MDISKLQHGD..IITIN..TVKGEVTD.....EEG..........................
Q604Q3_METCA/168-375...............PIE.CDVTAMQTGD..VIDIH..PYEGVLRN....HESG..........................
Q01EA0_OSTTA/235-442...............PLE.MDVTGINMGD..ILDIF..PYERVVKK....HGTD..........................
Q7VFE0_HELHP/176-382...............PIV.ADVSELKDGD..IIEID..TLKGEIIK......EG..........................
Q9X5I6_NEIME/168-380...............PIE.VDVSALKMGD..VVDIL..PYEGKIVK......NG..........................
A4BJS2_9GAMM/168-380...............PIE.LDVSKMEMGD..VIDLY..PHEGKVEK......DG..........................
Q2JL67_SYNJB/170-373...............PIQ.CDVSRLETGM..VVTIC..PYEGVIRS.....EAG..........................
A3Y383_9VIBR/168-379...............PIE.LNVQDMNMGD..VIDIY..PYEGVVHK......NG..........................
A0XX36_9GAMM/168-382...............PIE.LNVDEFNMGD..QIDIY..PYEGVVKR....HGTD..........................
A5CVN2_VESOH/165-374...............PIE.CDVGKMRMGD..KITIY..PFKGKITN.....SKG..........................
Q15QA4_PSEA6/168-382...............VFE.ADVDNMNMGD..VIDIF..PLEGRITN....AETG..........................
B4S6I7_PROA2/171-373...............PIQ.ADVNAMETGD..VIDLY..PYEGKIEK......NG..........................
Q31GI6_THICR/169-372...............PIE.CDVEQLNTGD..VITIH..PYDGKITN.....EAG..........................
Q3AR28_CHLCH/171-373...............PIQ.ADVNALEMGD..VIEVN..LIEGTISK......DG..........................
A3J0H2_9FLAO/174-405KTDANGEVLRDENGDPVL.EQTYSVATGT..VLTIN..TKTKKLY.......NG..........................
A4C0C6_9FLAO/174-407QKDEAGNIVRDENEDVVL.KEAYSVATGT..VLTVN..TKEKKLY.......SG..........................
Q0YRL9_9CHLB/171-373...............PVQ.ADVSAMETGD..VIDLY..PFDGKIEK......NG..........................
A1U1S2_MARAV/173-386...............VFE.APVDNMNMGD..VIEIR..PYEGKILN.....EAG..........................
Q6SFU1_9BACT/165-368...............PIQ.CNVSNLNMGD..EITIH..PYKGIITD.....SSG..........................
Q4CAL9_CROWT/169-372...............PIE.CDVSDMETGD..VIIIY..PYKGEVAN.....EEG..........................
A0RPN0_CAMFF/169-372...............PIV.VNVDGLEMGD..KIEIY..PYKGEIAK......DS..........................
A3YGV8_9GAMM/168-382...............PIE.ANVEDLNMGD..VIDVY..PYEGVIKK....AGSD..........................
A0ZJM7_NODSP/186-389...............PIE.CDVSNLETGM..VITIH..PYKGEITN.....QAG..........................
A6ETA5_9BACT/174-407QKDEDGNTIVNEDGDPVL.KQEYSVETGT..VLTIN..TKTKKLY.......NG..........................
A4SXE4_POLSQ/168-380...............PIE.LDVSQMNMGD..EIELR..PYEGKVFK......DG..........................
A7GY34_CAMC5/205-531...............PII.ADVSALETGD..LIDIY..PYRGEIVRVGRNGESGVNLSGESGENEGQIYSDKACVSACQN
A1AXP1_RUTMC/165-368...............PIE.CDVTKMQMGN..EITIY..PFEGKITD.....SNN..........................
A6FBI9_9GAMM/168-376...............PLE.FDVTSLTTGD..VIDIF..PYEGVVKN....NETG..........................
A4RSV0_OSTLU/237-444...............PIE.MDVKNIHMGD..VIDIF..PYEGLVKK....HGTN..........................
Q5P0Q1_AROAE/172-388...............PIE.LDCGQLDMGD..EIELKVDAASGQVTA....LKNG..........................
Q30RR3_SULDN/171-373...............PLE.LDVSEMETGD..VITIY..PYKGEAHK......DG..........................
Q0VQ99_ALCBS/168-380...............PFE.CDVEKMNTGD..VIDVY..PFEGKVEK......DG..........................
A6DS04_9BACT/173-380...............PVQ.TDVSGLSTGQ..IITVK..PLEGKILA.....EDG..........................
Q7V9G7_PROMA/170-374...............PIE.CDVSKLRTGD..VITIH..PYEGKIER....YENG..........................
A6VKR8_ACTSZ/171-385...............PLE.LDVTALNMGD..VIDVY..PYERKICK....HGCQ..........................
F2GA07_ALTMD/175-406KTDENGEIVRDANGDPVL.EEAYSVATGT..VLTID..TKAKKLF.......NG..........................
Q7M959_WOLSU/170-372...............PIV.ADASKLNEGD..VIALY..PYEGRIEK......AG..........................
A1BEM7_CHLPD/171-373...............PIQ.TDVTAMEMGD..VIDLY..VYKGIIEK......NG..........................
A7I373_CAMHC/170-373...............PII.ANVDNLNTGD..EIEIY..PLKGEIKK......AG..........................
Q47UT3_COLP3/168-380...............PIE.LDVQKMNMGD..IIDIY..PYEGVVKN.....AAG..........................
A0Z918_9GAMM/168-381...............VFE.APVDNLKMGD..VIEIR..PYEGRILN.....ENN..........................
A6Q381_NITSB/171-374...............PIE.APVDNLETGD..VIEIR..PYEGKILK......NG..........................
A9BDQ3_PROM4/170-378...............PIE.CNVNSLKTGD..VICIH..PYEGKITRASGEENTG..........................
A6Q9Z4_SULNB/172-374...............PIQ.APVAELETGD..VITVK..PFEGVIEK......DG..........................
A4EYJ8_9RHOB/174-407KVDEDGNPILNNDGNPVL.EQKFSVATGT..VLTIN..SKTKKLYS.....EDG..........................
A1APN5_PELPD/168-373...............PIR.AEVGALSTGD..LIVVD..TVRGIISD.....EQG..........................
A1SYN8_PSYIN/168-382...............PIE.MDVSKLNTGD..VIDIY..PHQGVVKN....NATG..........................
Q3J9D3_NITOC/167-370...............PIE.CQVEGLNTGD..TVRIR..PFEGTVLS.....EAG..........................
Q1YQ85_9GAMM/168-381...............VFE.APVDNIANGD..VITIY..PYEGKILN.....EAG..........................
A2BZ87_PROM5/175-383...............PIE.TDVSKINTGD..LLKIL..PYEGVIKKIDKISNTE..........................
A3X845_9RHOB/174-406KLDADGNVVEDEEGEAVL.EEAYSVATGT..VLTIN..SKTKTLHD.....ATG..........................
A5GX02_SYNR3/176-378...............PIE.CDVTGLNSGD..VITIR..PHAGTIER......DG..........................
A7ZDV7_CAMC1/178-384...............PIA.ANVNELEMGD..EIEIY..PFKGEIYK.....LAG..........................
A6DD15_9PROT/172-375...............PIQ.APVDKLETGD..IIEIY..PYEGKIVK......NG..........................

PF00694

D3DW85_HUMAN/767-896---------------PLQ--------------------------------------------------------------
C4ZTX1_ECOBW/689-819---------------PLE--------------------------------------------------------------
ACON_LEGPH/689-819---------------PLQ--------------------------------------------------------------
ACOC_HUMAN/692-821---------------PLE--------------------------------------------------------------
LEUD_HAEIN/1-126---------------PIR--------------------------------------------------------------
ACON_YEAST/579-709---------------PLN--------------------------------------------------------------
LEUC_RHIPU/529-654---------------PIT--------------------------------------------------------------
LEUC_YEAST/545-672---------------PIR--------------------------------------------------------------
LEUD_LACLA/1-124---------------PIK--------------------------------------------------------------
LYS4_YEAST/484-620---------------TLE--------------------------------------------------------------
ACON2_YEAST/585-714---------------PLT--------------------------------------------------------------
ACOC_CUCMA/696-826---------------PLC--------------------------------------------------------------
LEUD_BUCRP/1-126---------------LVV--------------------------------------------------------------
LEUC_USTMA/542-667---------------PVV--------------------------------------------------------------
LEUC_PHYBL/516-641---------------PII--------------------------------------------------------------
ACON_BOVIN/582-712---------------PLT--------------------------------------------------------------
ACON_GRAGA/580-710---------------PLT--------------------------------------------------------------
ACON_CAEEL/576-706---------------PLT--------------------------------------------------------------

PF01989

A8MB53_CALMQ/28-107---------------PL.--------------------------------------------------------------
A9AB42_METM6/24-104---------------PL.--------------------------------------------------------------
A9CH00_AGRT5/31-119---------------PV.--------------------------------------------------------------
A9A545_NITMS/19-101---------------PL.--------------------------------------------------------------
A2W9E3_9BURK/126-208---------------PS.--------------------------------------------------------------
Q0CKP1_ASPTN/21-109---------------PV.--------------------------------------------------------------
A6V8V2_PSEA7/27-115---------------PI.--------------------------------------------------------------
Q7VVN5_BORPE/28-110---------------PI.--------------------------------------------------------------
A7I8B4_METB6/34-116---------------PM.--------------------------------------------------------------
Q98JX5_RHILO/32-120---------------PL.--------------------------------------------------------------
Y2945_UNCMA/23-105---------------PM.--------------------------------------------------------------
Q2U0J1_ASPOR/23-111---------------PV.--------------------------------------------------------------
A6WUT6_OCHA4/25-115---------------PIA--------------------------------------------------------------
Y1248_PYRKO/23-105---------------PM.--------------------------------------------------------------
Q161U5_ROSDO/23-111---------------PV.--------------------------------------------------------------
A6T0N2_JANMA/24-106---------------TM.--------------------------------------------------------------
Q1YLG5_MOBAS/23-111---------------PI.--------------------------------------------------------------
A6UU66_META3/32-112---------------PM.--------------------------------------------------------------
A1WSP8_VEREI/24-106---------------AL.--------------------------------------------------------------
A2SRL5_METLZ/23-105---------------PT.--------------------------------------------------------------
Y244_METAC/26-108---------------PL.--------------------------------------------------------------
Q2NHJ1_METST/25-107---------------PM.--------------------------------------------------------------
A7VUI2_9CLOT/26-108---------------PM.--------------------------------------------------------------
A2W099_9BURK/29-117---------------PV.--------------------------------------------------------------
A5UMD2_METS3/22-104---------------PM.--------------------------------------------------------------
A6E2Y5_9RHOB/20-108---------------AV.--------------------------------------------------------------
A1BBM0_PARDP/23-111---------------PV.--------------------------------------------------------------
Q2USZ3_ASPOR/32-120---------------AV.--------------------------------------------------------------
Y1486_METKA/28-110---------------PL.--------------------------------------------------------------
Y208_METTP/23-105---------------PL.--------------------------------------------------------------
A3MUQ8_PYRCJ/24-99---------------PL.--------------------------------------------------------------
A1RYB9_THEPD/16-98---------------PM.--------------------------------------------------------------
A1WKZ3_VEREI/28-116---------------PI.--------------------------------------------------------------
A3JUH3_9RHOB/27-115---------------AV.--------------------------------------------------------------
Q7W4E6_BORPA/31-113---------------PL.--------------------------------------------------------------
A3DM70_STAMF/24-101---------------PL.--------------------------------------------------------------
A2BN86_HYPBU/26-102---------------PL.--------------------------------------------------------------
Y1530_METTH/23-105---------------PM.--------------------------------------------------------------
Y2089_AERPE/25-101---------------PL.--------------------------------------------------------------
A1DKV6_NEOFI/23-111---------------PV.--------------------------------------------------------------
Q5ASV1_EMENI/23-111---------------PV.--------------------------------------------------------------
Q2FUD8_METHJ/23-105---------------PM.--------------------------------------------------------------
Y1407_METJA/23-103---------------PL.--------------------------------------------------------------
A8AAC4_IGNH4/34-111---------------PL.--------------------------------------------------------------
A6UG94_SINMW/25-113---------------PV.--------------------------------------------------------------
A3J817_9ALTE/30-118---------------PT.--------------------------------------------------------------
Q8ZVK7_PYRAE/22-97---------------PL.--------------------------------------------------------------
Y055_ARCFU/23-104---------------PL.--------------------------------------------------------------
Y1471_METBU/26-108---------------PL.--------------------------------------------------------------
A1RSU8_PYRIL/31-106---------------PL.--------------------------------------------------------------
Q13MZ8_BURXL/42-130---------------PL.--------------------------------------------------------------
Q7VS11_BORPE/25-107---------------PI.--------------------------------------------------------------
Q5LVT9_SILPO/20-108---------------AV.--------------------------------------------------------------
Q1M4S5_RHIL3/30-118---------------PV.--------------------------------------------------------------
Q2FQH8_METHJ/30-113---------------PA.--------------------------------------------------------------
Y1615_PYRAB/23-105---------------PL.--------------------------------------------------------------
Q0G2A4_9RHIZ/24-112---------------PV.--------------------------------------------------------------
A0RYV0_CENSY/2-84---------------PL.--------------------------------------------------------------
A2QL18_ASPNC/27-115---------------PV.--------------------------------------------------------------
Y391_PYRFU/23-105---------------PL.--------------------------------------------------------------

PF06434

Q7CVQ5_AGRT5/175-406................................................................................
A1TPA0_ACIAC/168-382................................................................................
Q1JW62_DESAC/168-372................................................................................
A0B1A3_BURCH/168-380................................................................................
A5WDW0_PSYWF/168-383................................................................................
A6V736_PSEA7/168-382................................................................................
Q0I4W3_HAES1/171-385................................................................................
A5GFC4_GEOUR/167-371................................................................................
A7BSA2_9GAMM/167-370................................................................................
Q7V3U1_PROMM/169-377................................................................................
Q8DL06_THEEB/174-377................................................................................
Q118H1_TRIEI/169-372................................................................................
Q2SK45_HAHCH/194-401................................................................................
A8G7K5_PROM2/175-383................................................................................
Q7UDR9_SHIFL/168-382................................................................................
Q1QVU9_CHRSD/173-387................................................................................
Q65PY4_MANSM/171-385................................................................................
Q0A8N5_ALHEH/171-378................................................................................
A0Z071_LYNSP/169-377................................................................................
A6GNC8_9BURK/168-380................................................................................
A4A855_9GAMM/168-381................................................................................
Q5GYV5_XANOR/168-382................................................................................
A3VFZ3_9RHOB/174-406................................................................................
Q5N4E2_SYNP6/169-372................................................................................
B3EGH0_CHLL2/171-373................................................................................
A1VZH9_CAMJJ/166-368................................................................................
A8EUS0_ARCB4/171-373................................................................................
Q1Z4J1_PHOPR/168-382................................................................................
ACON2_HELPY/171-373................................................................................
Q1H0A3_METFK/167-370................................................................................
Q39UD3_GEOMG/167-371................................................................................
Q3A2K3_PELCD/167-371................................................................................
Q6F9U3_ACIAD/168-384................................................................................
A4SDR1_PROVI/171-373................................................................................
A3WNJ6_9GAMM/187-393................................................................................
A2C5H7_PROM1/170-378................................................................................
Q2IQ71_ANADE/167-371................................................................................
Q3AVN1_SYNS9/169-371................................................................................
A0L7Y2_MAGSM/188-390................................................................................
A8FQC8_SHESH/168-382................................................................................
Q12Z08_METBU/167-371................................................................................
Q604Q3_METCA/168-375................................................................................
Q01EA0_OSTTA/235-442................................................................................
Q7VFE0_HELHP/176-382................................................................................
Q9X5I6_NEIME/168-380................................................................................
A4BJS2_9GAMM/168-380................................................................................
Q2JL67_SYNJB/170-373................................................................................
A3Y383_9VIBR/168-379................................................................................
A0XX36_9GAMM/168-382................................................................................
A5CVN2_VESOH/165-374................................................................................
Q15QA4_PSEA6/168-382................................................................................
B4S6I7_PROA2/171-373................................................................................
Q31GI6_THICR/169-372................................................................................
Q3AR28_CHLCH/171-373................................................................................
A3J0H2_9FLAO/174-405................................................................................
A4C0C6_9FLAO/174-407................................................................................
Q0YRL9_9CHLB/171-373................................................................................
A1U1S2_MARAV/173-386................................................................................
Q6SFU1_9BACT/165-368................................................................................
Q4CAL9_CROWT/169-372................................................................................
A0RPN0_CAMFF/169-372................................................................................
A3YGV8_9GAMM/168-382................................................................................
A0ZJM7_NODSP/186-389................................................................................
A6ETA5_9BACT/174-407................................................................................
A4SXE4_POLSQ/168-380................................................................................
A7GY34_CAMC5/205-531GAQSKVAQKGGDAGECKQANESQIYGGASGSRDKISNCDNQTGDVEKSQNFGSDGEFNAEQSKQQGKICGGDKFEQSKIY
A1AXP1_RUTMC/165-368................................................................................
A6FBI9_9GAMM/168-376................................................................................
A4RSV0_OSTLU/237-444................................................................................
Q5P0Q1_AROAE/172-388................................................................................
Q30RR3_SULDN/171-373................................................................................
Q0VQ99_ALCBS/168-380................................................................................
A6DS04_9BACT/173-380................................................................................
Q7V9G7_PROMA/170-374................................................................................
A6VKR8_ACTSZ/171-385................................................................................
F2GA07_ALTMD/175-406................................................................................
Q7M959_WOLSU/170-372................................................................................
A1BEM7_CHLPD/171-373................................................................................
A7I373_CAMHC/170-373................................................................................
Q47UT3_COLP3/168-380................................................................................
A0Z918_9GAMM/168-381................................................................................
A6Q381_NITSB/171-374................................................................................
A9BDQ3_PROM4/170-378................................................................................
A6Q9Z4_SULNB/172-374................................................................................
A4EYJ8_9RHOB/174-407................................................................................
A1APN5_PELPD/168-373................................................................................
A1SYN8_PSYIN/168-382................................................................................
Q3J9D3_NITOC/167-370................................................................................
Q1YQ85_9GAMM/168-381................................................................................
A2BZ87_PROM5/175-383................................................................................
A3X845_9RHOB/174-406................................................................................
A5GX02_SYNR3/176-378................................................................................
A7ZDV7_CAMC1/178-384................................................................................
A6DD15_9PROT/172-375................................................................................

PF00694

D3DW85_HUMAN/767-896--------------------------------------------------------------------------------
C4ZTX1_ECOBW/689-819--------------------------------------------------------------------------------
ACON_LEGPH/689-819--------------------------------------------------------------------------------
ACOC_HUMAN/692-821--------------------------------------------------------------------------------
LEUD_HAEIN/1-126--------------------------------------------------------------------------------
ACON_YEAST/579-709--------------------------------------------------------------------------------
LEUC_RHIPU/529-654--------------------------------------------------------------------------------
LEUC_YEAST/545-672--------------------------------------------------------------------------------
LEUD_LACLA/1-124--------------------------------------------------------------------------------
LYS4_YEAST/484-620--------------------------------------------------------------------------------
ACON2_YEAST/585-714--------------------------------------------------------------------------------
ACOC_CUCMA/696-826--------------------------------------------------------------------------------
LEUD_BUCRP/1-126--------------------------------------------------------------------------------
LEUC_USTMA/542-667--------------------------------------------------------------------------------
LEUC_PHYBL/516-641--------------------------------------------------------------------------------
ACON_BOVIN/582-712--------------------------------------------------------------------------------
ACON_GRAGA/580-710--------------------------------------------------------------------------------
ACON_CAEEL/576-706--------------------------------------------------------------------------------

PF01989

A8MB53_CALMQ/28-107--------------------------------------------------------------------------------
A9AB42_METM6/24-104--------------------------------------------------------------------------------
A9CH00_AGRT5/31-119--------------------------------------------------------------------------------
A9A545_NITMS/19-101--------------------------------------------------------------------------------
A2W9E3_9BURK/126-208--------------------------------------------------------------------------------
Q0CKP1_ASPTN/21-109--------------------------------------------------------------------------------
A6V8V2_PSEA7/27-115--------------------------------------------------------------------------------
Q7VVN5_BORPE/28-110--------------------------------------------------------------------------------
A7I8B4_METB6/34-116--------------------------------------------------------------------------------
Q98JX5_RHILO/32-120--------------------------------------------------------------------------------
Y2945_UNCMA/23-105--------------------------------------------------------------------------------
Q2U0J1_ASPOR/23-111--------------------------------------------------------------------------------
A6WUT6_OCHA4/25-115--------------------------------------------------------------------------------
Y1248_PYRKO/23-105--------------------------------------------------------------------------------
Q161U5_ROSDO/23-111--------------------------------------------------------------------------------
A6T0N2_JANMA/24-106--------------------------------------------------------------------------------
Q1YLG5_MOBAS/23-111--------------------------------------------------------------------------------
A6UU66_META3/32-112--------------------------------------------------------------------------------
A1WSP8_VEREI/24-106--------------------------------------------------------------------------------
A2SRL5_METLZ/23-105--------------------------------------------------------------------------------
Y244_METAC/26-108--------------------------------------------------------------------------------
Q2NHJ1_METST/25-107--------------------------------------------------------------------------------
A7VUI2_9CLOT/26-108--------------------------------------------------------------------------------
A2W099_9BURK/29-117--------------------------------------------------------------------------------
A5UMD2_METS3/22-104--------------------------------------------------------------------------------
A6E2Y5_9RHOB/20-108--------------------------------------------------------------------------------
A1BBM0_PARDP/23-111--------------------------------------------------------------------------------
Q2USZ3_ASPOR/32-120--------------------------------------------------------------------------------
Y1486_METKA/28-110--------------------------------------------------------------------------------
Y208_METTP/23-105--------------------------------------------------------------------------------
A3MUQ8_PYRCJ/24-99--------------------------------------------------------------------------------
A1RYB9_THEPD/16-98--------------------------------------------------------------------------------
A1WKZ3_VEREI/28-116--------------------------------------------------------------------------------
A3JUH3_9RHOB/27-115--------------------------------------------------------------------------------
Q7W4E6_BORPA/31-113--------------------------------------------------------------------------------
A3DM70_STAMF/24-101--------------------------------------------------------------------------------
A2BN86_HYPBU/26-102--------------------------------------------------------------------------------
Y1530_METTH/23-105--------------------------------------------------------------------------------
Y2089_AERPE/25-101--------------------------------------------------------------------------------
A1DKV6_NEOFI/23-111--------------------------------------------------------------------------------
Q5ASV1_EMENI/23-111--------------------------------------------------------------------------------
Q2FUD8_METHJ/23-105--------------------------------------------------------------------------------
Y1407_METJA/23-103--------------------------------------------------------------------------------
A8AAC4_IGNH4/34-111--------------------------------------------------------------------------------
A6UG94_SINMW/25-113--------------------------------------------------------------------------------
A3J817_9ALTE/30-118--------------------------------------------------------------------------------
Q8ZVK7_PYRAE/22-97--------------------------------------------------------------------------------
Y055_ARCFU/23-104--------------------------------------------------------------------------------
Y1471_METBU/26-108--------------------------------------------------------------------------------
A1RSU8_PYRIL/31-106--------------------------------------------------------------------------------
Q13MZ8_BURXL/42-130--------------------------------------------------------------------------------
Q7VS11_BORPE/25-107--------------------------------------------------------------------------------
Q5LVT9_SILPO/20-108--------------------------------------------------------------------------------
Q1M4S5_RHIL3/30-118--------------------------------------------------------------------------------
Q2FQH8_METHJ/30-113--------------------------------------------------------------------------------
Y1615_PYRAB/23-105--------------------------------------------------------------------------------
Q0G2A4_9RHIZ/24-112--------------------------------------------------------------------------------
A0RYV0_CENSY/2-84--------------------------------------------------------------------------------
A2QL18_ASPNC/27-115--------------------------------------------------------------------------------
Y391_PYRFU/23-105--------------------------------------------------------------------------------

PF06434

Q7CVQ5_AGRT5/175-406.........TE.LVDLASSFTPQKM.EFMKAGSSYAIVFGKKLQTFAAQTLGV...EATQVFAPN......KEISI.EGQ
A1TPA0_ACIAC/168-382.........E...TVAEFQLKSDVLLDEVRAGGRINLIIGRSLTAKAREFLGL...PASTAFRLP......QAPAE.SKA
Q1JW62_DESAC/168-372.........A...ELTSFDIAPSTVRDEFRAGGRTPLIIGRKLTERACAALGM...PAPDMFIQP......NNPVPKADQ
A0B1A3_BURCH/168-380.........K...VIAEFQVKSDVLFDEVRAGGRIPLIIGRGLTAKAREALGL...APSTLFRLP......HQPAD.SGK
A5WDW0_PSYWF/168-383.........E...VLSTFKLNSNTLLDEVRAGGRIPLIVGRALTNRAREYMGL...EHSDVFAKP......EQPAS.SDK
A6V736_PSEA7/168-382.........E...VVTTFELKTPVLLDEVRAGGRIPLIVGRGLTEKARAELGL...GASDLFRKP......EAPAD.SGK
Q0I4W3_HAES1/171-385.........D...ILAEFSLKTNVLLDEVRAGGRIPLIIGRGLTHKARVALGL...PESDVFAKP......QSAVQ.NQK
A5GFC4_GEOUR/167-371.........E...LLSTFKINPNTLADEFQAGGRIPLIIGRALTDRARNALGM...GATDVFTLP......VNPVPKAGQ
A7BSA2_9GAMM/167-370.........R...EISSFELRPTTLPDEVRAGGRIPLIIGRSLTDKARQTLDL...SPSSLFIRP......TPPQD.TGK
Q7V3U1_PROMM/169-377.........E...IVAHFKLKPITISDEVRAGGRISLLIGRALTDKVRSQFGL...STSDLFVRP......GDTPE.TGK
Q8DL06_THEEB/174-377.........D...VISRFTLKPDTLLDEVRAGGRILLLIGRTLTDKARSALGL...EPSPLFTRP......KPPVD.SSK
Q118H1_TRIEI/169-372.........E...IISTFTLKPETMLDEVRAGGRIPLLIGRTLTDKTRNILGL...ETSSVFTRP......QLPTD.TGK
Q2SK45_HAHCH/194-401.........E...VIGEFELKSDVLLDEVRAGGRIPLIIGRGLTDKAREAMGL...APSDVFRRP......QAAND.SGK
A8G7K5_PROM2/175-383.........K...LISQFNLYPATLTDEIQAGGRINLMIGRSLTDKIRNKLDY...QPSEIFIRP......QSPKE.SNS
Q7UDR9_SHIFL/168-382.........E...LLATFELKTDVLIDEVRAGGRIPLIIGRGLTTKAREALGL...PHSDVFRQA......KDVAE.SDR
Q1QVU9_CHRSD/173-387.........E...VLTTFELKTQLLLDEARAGGRIPLIIGRGLTAKARESLGL...APSDVFRLP......EQPAD.TGR
Q65PY4_MANSM/171-385.........Q...VLAEFSLKTDVLLDEVQAGGRIPLIIGRGLTHKARLALGL...NESEIFKKP......QAVQA.SEK
Q0A8N5_ALHEH/171-378.........E...VLTTFELRSPVLLDEVRAGGRIPLIVGRGLTDKARESLGL...AASDIFRRP......QAPAD.SGK
A0Z071_LYNSP/169-377.........E...VISTFTLKPETILDEVRAGGRIPLLIGRSLTDKTREALGY...EPSTLFTRP......ITPED.TGK
A6GNC8_9BURK/168-380.........A...VVAEFSLKTDVLFDEVRAGGRIPLIIGRGLTDRARAALGQ...GPSPVFRRP......SAQVD.STK
A4A855_9GAMM/168-381.........D...TLSEFELKSQVLLDEVQAGGRINLIIGRGLTTRAREALEL...PPSDLFRTP......EQPAD.TGK
Q5GYV5_XANOR/168-382.........Q...VIAEFAMKSDVLFDEVRAGGRIPLIVGRGLTAKAREFLGL...PASDLFRLP......MDPPD.TGK
A3VFZ3_9RHOB/174-406.........NE.LVDISSAFTPQKV.EFMKAGSSYAIVFGKMLQSFAAETLGV...EMPEVFAPS......KEVSH.EGQ
Q5N4E2_SYNP6/169-372.........T...VLSTFSLKPDTILDEVRAGGRIPLLIGRSLTDKVRSQLGL...PVSDVFVRP......QPPAD.TGK
B3EGH0_CHLL2/171-373.........E...IISRFDLTPNTLTDEVRAGGRIPLIIGRTLTKKARTFLGM...GEDSLFINP......LQPAD.SGK
A1VZH9_CAMJJ/166-368.........S...TIAEFTLSPNALLDEVRAGGRIPLIIGRGLCAKAREFLGM...ESENIFTKP......EQPKS.SSG
A8EUS0_ARCB4/171-373.........K...VVSEFKLAPNTLTDEMRAGGRIPLIIGKGLTAKARAALGL...GASTAFIAP......EQPAN.NGK
Q1Z4J1_PHOPR/168-382.........D...VVSTFALKTDVLIDEVRAGGRIPLIIGRGLTDRARQALGL...PSSDVFRRP......GTVED.TGK
ACON2_HELPY/171-373.........K...VVSTFKLEPETLLDEVRASGRIPLIIGRGLTNKARKFLGL...GESEAFKKP......SAPKS.DAK
Q1H0A3_METFK/167-370.........E...EIARFELAPLTMPDEVRAGGRIPLIVGRGLTNNARQLLGL...PPSDLFIQP......IMPQD.TGK
Q39UD3_GEOMG/167-371.........E...VISTFKISPNTLADEFRAGGRIPLIIGRAITEKARKALGL...GDTDVFTKP......VNPAPKAGQ
Q3A2K3_PELCD/167-371.........K...LLTSFELAPNTLPDEYQAGGRIPLIIGRSLTERARKVLKV...EPADFFTLP......DNPVPQPDQ
Q6F9U3_ACIAD/168-384.........E...QIAESELKTPVLLDEVRAGGRINLIVGRGLTTKAREALGL...EPSTLFRTP......VQPAA.TGK
A4SDR1_PROVI/171-373.........K...VIASFSMSPNTLGDEVRAGGRIALIIGRTLTKKARLALGL...GDDDIFQSP......EQPAD.TGK
A3WNJ6_9GAMM/187-393.........E...VIAEYDYASRVILDEVRAGGRINLIIGRGLTAKARESLGL...GASDLFLTP......EQPQD.SGK
A2C5H7_PROM1/170-378.........E...LLSKFDLKPQTITDEVRAGGRIPLMIGRALTDKVRTKLKL...PPSTLFIRP......GQPPA.SKY
Q2IQ71_ANADE/167-371.........E...VLSTFKLEPVTVPDEFRAGGRIPLIIGRALTDKARKALGL...KEIDLFAVA......KNPQPKAGQ
Q3AVN1_SYNS9/169-371.........T...VISHFDLKPSTISDEVRAGGRIPLMIGRALTDKVRNQLGL...PPSEVFIRP......STPQD.NGK
A0L7Y2_MAGSM/188-390.........A...VLSTFELKPNTLADEVRAGGRVNLIIGRKLTTQARDALGL...GPIKLFTDP......EQPAD.SGK
A8FQC8_SHESH/168-382.........E...VISEFALKTDVLMDEVRAGGRIPLIIGRGLTARAREVLKL...EASTVFVLP......QDVAD.TGK
Q12Z08_METBU/167-371.........N...VLSTLYLNPNTLPDEYRAGGRIPLIIGRSLTTRTREVLGL...PETDIFVKP......DNPIPEPGQ
Q604Q3_METCA/168-375.........V...ELCRFTLKTEILLDEVRAGGRINLIIGRGLTDRARKVLGL...PPSEVFRRP......RAPIE.TGK
Q01EA0_OSTTA/235-442.........V...VISTFSLKSDVLFDEVQAGGRIPLIIGRGLTAKARSALKM...EPSSTFRLP......CIPDA.TVK
Q7VFE0_HELHP/176-382.........K...IVATFKLNPITLADEIRSGGRIPLIIGRGLSARAREYLKL...GKSDVFKEA......KQPAQ.STK
Q9X5I6_NEIME/168-380.........E...TVAEFELKSQVLLDEVQAGGRINLIIGRGLTAKAREALKL...PASTAFRLP......QAPAE.SKA
A4BJS2_9GAMM/168-380.........E...VISEFQLKTTIILDEVRAGGRIPLIIGRGLTDRAREAMGL...EPSKVFKRP......GDIEK.SDK
Q2JL67_SYNJB/170-373.........Q...VLSTFSLRPVTLPDEVRAGGRIPLLIGRALTDKTRQALGL...PPSTLFIRP......TPPAD.TGK
A3Y383_9VIBR/168-379.........S...VISNFEL.SKVLLDEVRAGGRIPLIIGRGLTGRARDALGL...AETDLFAKP......IDPSA.SDK
A0XX36_9GAMM/168-382.........D...VISTFELKSDVILDEVRAGGRIPLIIGRGLTDKARTSLGL...GATDVFKVP......AVTEE.SDK
A5CVN2_VESOH/165-374.........E...IISTFIISPTTLPDEVRAGGRIPLIIGRGLTDKTRQDLGL...PISTTFLRPQAGTEEQSISQ.SHT
Q15QA4_PSEA6/168-382.........A...ELAKYEYKSDVLLDEVRAGGRINLIIGRGLTEKARESLGL...GASDLFRKP......DQPAD.TGK
B4S6I7_PROA2/171-373.........E...VIAEFTLEPNTLADEVRAGGRIPLIIGRTLTRQAREALGL...GEADVFKAP......DQPAD.SGK
Q31GI6_THICR/169-372.........E...TVSTFELAPDTMPDEVRAGGRVPLIIGRGLTDKSREALGL...EPSNVFIRP......TDKSQ.ADY
Q3AR28_CHLCH/171-373.........A...VVSRFELSPNTIGDEVRAGGRIPLIIGRTLTRKARTALGM...GDDTLFVRP......EQPAD.SGK
A3J0H2_9FLAO/174-405.........DKELIDISRSFTPQKM.EFIKAGGSYAIVFGKKIQTFAAKTLGI...EAPLVYAPS......KEVSV.EGQ
A4C0C6_9FLAO/174-407.........DTVLTDISEALTPQKV.EFIRAGGSYAIVFGKKLQAFAAKALDI...DLVSVYANS......KEISI.DGQ
Q0YRL9_9CHLB/171-373.........E...VIARFELTPNTLADEVRAGGRIPLIIGRNLTRKARKTLGL...GEESLFQRP......EQPAD.TGK
A1U1S2_MARAV/173-386.........E...TISEFKFKSDVILDEVQAGGRIPLIIGRGLTNKARQALGM...GATDIFRLP......KDPEA.GDK
Q6SFU1_9BACT/165-368.........N...TVSTFELAPSTMPDEVRAGGRIQLIIGRGLTDKTRSELGL...GVSDIFLRP......GDPKN.NSA
Q4CAL9_CROWT/169-372.........D...IIATFERKPETILDEVRAGGRIPLLIGRALTDKTREALGL...EPSTLFVRP......IPPSP.LSK
A0RPN0_CAMFF/169-372.........K...VVKTFKLEPNTLKDEVKAGGRIPLIIARSLCSKARAELGL...GNEDIFIKP......SQPANNDNS
A3YGV8_9GAMM/168-382.........V...VITQFELKTNVILDEVRAGGRIPLIIGRGLTTKARESLGL...GATDLFKTP......IAKED.SGK
A0ZJM7_NODSP/186-389.........E...VISTFTLKPETIFDEVRAGGRIPLLIGRTLTDKTREALGL...EASNLFIRP......QQPND.TGK
A6ETA5_9BACT/174-407.........DTELKDISTALTPQKM.EFIRAGGSYAVVFGKKLQTLAAKILET...EIPQVYASS......KEISI.EGQ
A4SXE4_POLSQ/168-380.........K...EITSFSLKSPVILDEVRAGGRIPLIIGRGLTAKARAALGL...PASTEFRLP......VNPVD.NKK
A7GY34_CAMC5/205-531NETANGSNVQTPELIAKFTLSPNTLLDEIRAGGRIPLIIGRGLCAKARAALNL...GAEQIFAKP......EQPSG.DTG
A1AXP1_RUTMC/165-368.........E...TISTFELSPTTLSDEVRAGGRIPLIIGRGLTDRTRQDLGL...PISTTFLRP......KDVTQ.NNI
A6FBI9_9GAMM/168-376.........A...VITEFKIKTDVILDEVRAGGRIPLIIGRGLTTRARTALGL...ENSTVFRLP......ADVAA.SSK
A4RSV0_OSTLU/237-444.........E...VITTFSLKSPVLLDEIQAGGRIPLIIGRSLTDKARNALGL...EPSEVFQVP......QVSKS.RSK
Q5P0Q1_AROAE/172-388.........A...VVSESQLKTLVILDEVRAGGRIPLIIGRGLTAKAREALGL...PVSTLFRLP......QAPAD.SGK
Q30RR3_SULDN/171-373.........K...CIATFKLNPNTITDEVRAGGRIPLIIGRGLTSKARGVLGL...GASDKFLTA......EQPAD.SGK
Q0VQ99_ALCBS/168-380.........E...VIAEFNLRSQVLLDEVRAGGRINLIIGRGLTTKAREALGL...APSELFRKP......EQPGD.SDK
A6DS04_9BACT/173-380.........S...EITSFEVKPNTILDEYRAGGRVPLIIGKQLTEKARGVLGLSSIEESGLFVNP......DNPAPAAGQ
Q7V9G7_PROMA/170-374.........E...NIASFELKPSTILDEIQAGGRIPLLIGRALTDKVREKLGL...EPIDIFIRP......GKQTD.NCH
A6VKR8_ACTSZ/171-385.........E...VLATFNYKTEGLLDEVRAGGRIPLIIGRSLTAKARAELGL...PESDVFVKA......PEMPD.TGK
F2GA07_ALTMD/175-406.........SEELADVSASFTPQKM.EFMKAGGSYAVVFGKQLQSFAARTLGV...EAPAVYAQS......KEVSH.EGQ
Q7M959_WOLSU/170-372.........E...GVATFNLTPNTLSDEIRAGGRINLIIGRGLTAKAQEALGI...KEDDLFIKP......QNPQG.KAR
A1BEM7_CHLPD/171-373.........A...VIAEFSISPKTLIDEVRAGGRIPLIIGRNLTRKARKTLGL...GEDSVFQRP......EQPED.TGK
A7I373_CAMHC/170-373.........K...VVSKFRLIPNTIEDEIRTGGRIPLIIARSLCVKAREFLKL...PTENIFTKP......EQPKSNENE
Q47UT3_COLP3/168-380.........D...VISEFTL.SPVLLDEVRAGGRIPLIIGRGLTGRAREALGL...PEADLFAKQ......VAVTD.TGK
A0Z918_9GAMM/168-381.........D...LLSEFTLKSEVLLDEVRAGGRINLIIGRGLTARAREALGL...PEGDLFRTP......EQPAD.SGK
A6Q381_NITSB/171-374.........E...VVSEFKLKPNTLPDEYRAGGRIPMIIGRGLTRKARAALGM...PEEDFFTRP......EQPEGKEGV
A9BDQ3_PROM4/170-378.........E...ILTHFILKPTTIIDEIQAGGRIPLMIGRALTDKIRTKLKL...NSSKVFTRP......GKRKE.VKH
A6Q9Z4_SULNB/172-374.........K...VVSEFTLEPNTLPDEMRAGGRIPLIIGKGLTAKAREALGM...SPSDMFMTP......DMPED.NGK
A4EYJ8_9RHOB/174-407.........SEELVDVAGAFTPQKM.EFMKAGGSYAIVFGKKLQTFACEALGI...ELKSAFAPS......KEISH.EGQ
A1APN5_PELPD/168-373.........A..NVLSRFSLAPATLADEFRAGGRIPLIIGRALTDRARSFLGL...PGSTLFTLP......DNPVPEPGQ
A1SYN8_PSYIN/168-382.........E...VITEFQLKTNIILDEVRAGGRIPLIIGRGLTDRARKSLGL...ETSTVFQLP......VEVKP.STK
Q3J9D3_NITOC/167-370.........K...ELSRFKLRPSTLPDEVRAGGRIPLIIGRGLTDKTRQTLGL...NPSPLFIRP......VAPTA.SGK
Q1YQ85_9GAMM/168-381.........E...VVSEFEHKSEVILDEVQADGRINLIIGRGLTQRAREHMGL...PPSEVFRHP......TAPIV.TDA
A2BZ87_PROM5/175-383.........L...TISHFNLKPSTLTDEIQAGGRINLMIGRSLTDKIRKKLEL...QPSKVFIRP......KSPKE.INT
A3X845_9RHOB/174-406.........KE.LKSVAAAFTPQKI.EFMKAGGSYAVVFGKKLQTFAAEALGQ...ELKSAYAPS......KEITA.EGQ
A5GX02_SYNR3/176-378.........E...VVARFDLKPSTISDEVRAGGRIPLMIGRALTDKVRSQLGL...PASELFIRP......TPPAD.SGK
A7ZDV7_CAMC1/178-384.........AQKKLVANFKLSPNTLSDEIRAGGRIPLMIGRQVTKKAREALGL...GEEQIFIKP......DQPKE.QGG
A6DD15_9PROT/172-375.........E...VVSEFELSPNTLPDEVRAGGRVPLIIGKNLTKKAREVLGK...EEENIFIRP......AQPEDKKGV

PF00694

D3DW85_HUMAN/767-896-------------------------------------------------------------FLPG---------------
C4ZTX1_ECOBW/689-819-------------------------------------------------------------FPQG---------------
ACON_LEGPH/689-819-------------------------------------------------------------FKEG---------------
ACOC_HUMAN/692-821-------------------------------------------------------------YLPG---------------
LEUD_HAEIN/1-126-------------------------------------------------------------LSEE---------------
ACON_YEAST/579-709-------------------------------------------------------------FKNP---------------
LEUC_RHIPU/529-654-------------------------------------------------------------LPQD---------------
LEUC_YEAST/545-672-------------------------------------------------------------LDQQ---------------
LEUD_LACLA/1-124-------------------------------------------------------------QPRE---------------
LYS4_YEAST/484-620-------------------------------------------------------------IPAL---------------
ACON2_YEAST/585-714-------------------------------------------------------------FANE---------------
ACOC_CUCMA/696-826-------------------------------------------------------------FKSG---------------
LEUD_BUCRP/1-126-------------------------------------------------------------LEKK---------------
LEUC_USTMA/542-667-------------------------------------------------------------LSRA---------------
LEUC_PHYBL/516-641-------------------------------------------------------------LSQE---------------
ACON_BOVIN/582-712-------------------------------------------------------------FADP---------------
ACON_GRAGA/580-710-------------------------------------------------------------FNNP---------------
ACON_CAEEL/576-706-------------------------------------------------------------FANP---------------

PF01989

A8MB53_CALMQ/28-107------------------------------------------------------------..VIN---------------
A9AB42_METM6/24-104------------------------------------------------------------..VDK---------------
A9CH00_AGRT5/31-119------------------------------------------------------------..IRL---------------
A9A545_NITMS/19-101------------------------------------------------------------..VVL---------------
A2W9E3_9BURK/126-208------------------------------------------------------------..LTD---------------
Q0CKP1_ASPTN/21-109------------------------------------------------------------..LVL---------------
A6V8V2_PSEA7/27-115------------------------------------------------------------..ACL---------------
Q7VVN5_BORPE/28-110------------------------------------------------------------..MDG---------------
A7I8B4_METB6/34-116------------------------------------------------------------..IDR---------------
Q98JX5_RHILO/32-120------------------------------------------------------------..VVC---------------
Y2945_UNCMA/23-105------------------------------------------------------------..VDR---------------
Q2U0J1_ASPOR/23-111------------------------------------------------------------..VVL---------------
A6WUT6_OCHA4/25-115------------------------------------------------------------IELDR---------------
Y1248_PYRKO/23-105------------------------------------------------------------..VDG---------------
Q161U5_ROSDO/23-111------------------------------------------------------------..LLV---------------
A6T0N2_JANMA/24-106------------------------------------------------------------..LAG---------------
Q1YLG5_MOBAS/23-111------------------------------------------------------------..VVC---------------
A6UU66_META3/32-112------------------------------------------------------------..VDK---------------
A1WSP8_VEREI/24-106------------------------------------------------------------..LAG---------------
A2SRL5_METLZ/23-105------------------------------------------------------------..VDR---------------
Y244_METAC/26-108------------------------------------------------------------..VDM---------------
Q2NHJ1_METST/25-107------------------------------------------------------------..VDN---------------
A7VUI2_9CLOT/26-108------------------------------------------------------------..VAE---------------
A2W099_9BURK/29-117------------------------------------------------------------..VCV---------------
A5UMD2_METS3/22-104------------------------------------------------------------..VDS---------------
A6E2Y5_9RHOB/20-108------------------------------------------------------------..LRL---------------
A1BBM0_PARDP/23-111------------------------------------------------------------..LRL---------------
Q2USZ3_ASPOR/32-120------------------------------------------------------------..VTL---------------
Y1486_METKA/28-110------------------------------------------------------------..FHR---------------
Y208_METTP/23-105------------------------------------------------------------..VDR---------------
A3MUQ8_PYRCJ/24-99------------------------------------------------------------..FQG---------------
A1RYB9_THEPD/16-98------------------------------------------------------------..MSG---------------
A1WKZ3_VEREI/28-116------------------------------------------------------------..AAV---------------
A3JUH3_9RHOB/27-115------------------------------------------------------------..LRL---------------
Q7W4E6_BORPA/31-113------------------------------------------------------------..LQA---------------
A3DM70_STAMF/24-101------------------------------------------------------------..FVT---------------
A2BN86_HYPBU/26-102------------------------------------------------------------..AEG---------------
Y1530_METTH/23-105------------------------------------------------------------..VDR---------------
Y2089_AERPE/25-101------------------------------------------------------------..YDG---------------
A1DKV6_NEOFI/23-111------------------------------------------------------------..LVL---------------
Q5ASV1_EMENI/23-111------------------------------------------------------------..YRV---------------
Q2FUD8_METHJ/23-105------------------------------------------------------------..IDR---------------
Y1407_METJA/23-103------------------------------------------------------------..VDK---------------
A8AAC4_IGNH4/34-111------------------------------------------------------------..VDK---------------
A6UG94_SINMW/25-113------------------------------------------------------------..LRL---------------
A3J817_9ALTE/30-118------------------------------------------------------------..ISL---------------
Q8ZVK7_PYRAE/22-97------------------------------------------------------------..FQG---------------
Y055_ARCFU/23-104------------------------------------------------------------..VEV---------------
Y1471_METBU/26-108------------------------------------------------------------..VDR---------------
A1RSU8_PYRIL/31-106------------------------------------------------------------..FEG---------------
Q13MZ8_BURXL/42-130------------------------------------------------------------..VVV---------------
Q7VS11_BORPE/25-107------------------------------------------------------------..MEG---------------
Q5LVT9_SILPO/20-108------------------------------------------------------------..LRL---------------
Q1M4S5_RHIL3/30-118------------------------------------------------------------..VTL---------------
Q2FQH8_METHJ/30-113------------------------------------------------------------..VDS---------------
Y1615_PYRAB/23-105------------------------------------------------------------..IAG---------------
Q0G2A4_9RHIZ/24-112------------------------------------------------------------..VRL---------------
A0RYV0_CENSY/2-84------------------------------------------------------------..YVA---------------
A2QL18_ASPNC/27-115------------------------------------------------------------..ITL---------------
Y391_PYRFU/23-105------------------------------------------------------------..VTG---------------

PF06434

Q7CVQ5_AGRT5/175-406GL
A1TPA0_ACIAC/168-382GF
Q1JW62_DESAC/168-372GY
A0B1A3_BURCH/168-380GF
A5WDW0_PSYWF/168-383GF
A6V736_PSEA7/168-382GF
Q0I4W3_HAES1/171-385GF
A5GFC4_GEOUR/167-371GY
A7BSA2_9GAMM/167-370GF
Q7V3U1_PROMM/169-377GY
Q8DL06_THEEB/174-377GY
Q118H1_TRIEI/169-372GF
Q2SK45_HAHCH/194-401GF
A8G7K5_PROM2/175-383GF
Q7UDR9_SHIFL/168-382GF
Q1QVU9_CHRSD/173-387GF
Q65PY4_MANSM/171-385GY
Q0A8N5_ALHEH/171-378GF
A0Z071_LYNSP/169-377GF
A6GNC8_9BURK/168-380GF
A4A855_9GAMM/168-381GY
Q5GYV5_XANOR/168-382GF
A3VFZ3_9RHOB/174-406GL
Q5N4E2_SYNP6/169-372GF
B3EGH0_CHLL2/171-373GY
A1VZH9_CAMJJ/166-368GY
A8EUS0_ARCB4/171-373GY
Q1Z4J1_PHOPR/168-382GY
ACON2_HELPY/171-373GY
Q1H0A3_METFK/167-370GY
Q39UD3_GEOMG/167-371GY
Q3A2K3_PELCD/167-371GY
Q6F9U3_ACIAD/168-384GF
A4SDR1_PROVI/171-373GY
A3WNJ6_9GAMM/187-393GY
A2C5H7_PROM1/170-378GF
Q2IQ71_ANADE/167-371GY
Q3AVN1_SYNS9/169-371GF
A0L7Y2_MAGSM/188-390GY
A8FQC8_SHESH/168-382GY
Q12Z08_METBU/167-371AY
Q604Q3_METCA/168-375GY
Q01EA0_OSTTA/235-442GF
Q7VFE0_HELHP/176-382GY
Q9X5I6_NEIME/168-380GF
A4BJS2_9GAMM/168-380GY
Q2JL67_SYNJB/170-373GY
A3Y383_9VIBR/168-379GY
A0XX36_9GAMM/168-382GF
A5CVN2_VESOH/165-374GY
Q15QA4_PSEA6/168-382GY
B4S6I7_PROA2/171-373GY
Q31GI6_THICR/169-372GY
Q3AR28_CHLCH/171-373GY
A3J0H2_9FLAO/174-405GL
A4C0C6_9FLAO/174-407GL
Q0YRL9_9CHLB/171-373GY
A1U1S2_MARAV/173-386GF
Q6SFU1_9BACT/165-368GF
Q4CAL9_CROWT/169-372GG
A0RPN0_CAMFF/169-372GY
A3YGV8_9GAMM/168-382GF
A0ZJM7_NODSP/186-389GY
A6ETA5_9BACT/174-407GL
A4SXE4_POLSQ/168-380GF
A7GY34_CAMC5/205-531GY
A1AXP1_RUTMC/165-368GY
A6FBI9_9GAMM/168-376GY
A4RSV0_OSTLU/237-444GF
Q5P0Q1_AROAE/172-388GF
Q30RR3_SULDN/171-373GY
Q0VQ99_ALCBS/168-380GF
A6DS04_9BACT/173-380GY
Q7V9G7_PROMA/170-374GF
A6VKR8_ACTSZ/171-385GF
F2GA07_ALTMD/175-406GL
Q7M959_WOLSU/170-372GF
A1BEM7_CHLPD/171-373GY
A7I373_CAMHC/170-373GY
Q47UT3_COLP3/168-380GF
A0Z918_9GAMM/168-381GF
A6Q381_NITSB/171-374GY
A9BDQ3_PROM4/170-378GF
A6Q9Z4_SULNB/172-374GF
A4EYJ8_9RHOB/174-407GL
A1APN5_PELPD/168-373GF
A1SYN8_PSYIN/168-382GY
Q3J9D3_NITOC/167-370GY
Q1YQ85_9GAMM/168-381GF
A2BZ87_PROM5/175-383GF
A3X845_9RHOB/174-406GL
A5GX02_SYNR3/176-378GF
A7ZDV7_CAMC1/178-384GY
A6DD15_9PROT/172-375GY

PF00694

D3DW85_HUMAN/767-896--
C4ZTX1_ECOBW/689-819--
ACON_LEGPH/689-819--
ACOC_HUMAN/692-821--
LEUD_HAEIN/1-126--
ACON_YEAST/579-709--
LEUC_RHIPU/529-654--
LEUC_YEAST/545-672--
LEUD_LACLA/1-124--
LYS4_YEAST/484-620--
ACON2_YEAST/585-714--
ACOC_CUCMA/696-826--
LEUD_BUCRP/1-126--
LEUC_USTMA/542-667--
LEUC_PHYBL/516-641--
ACON_BOVIN/582-712--
ACON_GRAGA/580-710--
ACON_CAEEL/576-706--

PF01989

A8MB53_CALMQ/28-107--
A9AB42_METM6/24-104--
A9CH00_AGRT5/31-119--
A9A545_NITMS/19-101--
A2W9E3_9BURK/126-208--
Q0CKP1_ASPTN/21-109--
A6V8V2_PSEA7/27-115--
Q7VVN5_BORPE/28-110--
A7I8B4_METB6/34-116--
Q98JX5_RHILO/32-120--
Y2945_UNCMA/23-105--
Q2U0J1_ASPOR/23-111--
A6WUT6_OCHA4/25-115--
Y1248_PYRKO/23-105--
Q161U5_ROSDO/23-111--
A6T0N2_JANMA/24-106--
Q1YLG5_MOBAS/23-111--
A6UU66_META3/32-112--
A1WSP8_VEREI/24-106--
A2SRL5_METLZ/23-105--
Y244_METAC/26-108--
Q2NHJ1_METST/25-107--
A7VUI2_9CLOT/26-108--
A2W099_9BURK/29-117--
A5UMD2_METS3/22-104--
A6E2Y5_9RHOB/20-108--
A1BBM0_PARDP/23-111--
Q2USZ3_ASPOR/32-120--
Y1486_METKA/28-110--
Y208_METTP/23-105--
A3MUQ8_PYRCJ/24-99--
A1RYB9_THEPD/16-98--
A1WKZ3_VEREI/28-116--
A3JUH3_9RHOB/27-115--
Q7W4E6_BORPA/31-113--
A3DM70_STAMF/24-101--
A2BN86_HYPBU/26-102--
Y1530_METTH/23-105--
Y2089_AERPE/25-101--
A1DKV6_NEOFI/23-111--
Q5ASV1_EMENI/23-111--
Q2FUD8_METHJ/23-105--
Y1407_METJA/23-103--
A8AAC4_IGNH4/34-111--
A6UG94_SINMW/25-113--
A3J817_9ALTE/30-118--
Q8ZVK7_PYRAE/22-97--
Y055_ARCFU/23-104--
Y1471_METBU/26-108--
A1RSU8_PYRIL/31-106--
Q13MZ8_BURXL/42-130--
Q7VS11_BORPE/25-107--
Q5LVT9_SILPO/20-108--
Q1M4S5_RHIL3/30-118--
Q2FQH8_METHJ/30-113--
Y1615_PYRAB/23-105--
Q0G2A4_9RHIZ/24-112--
A0RYV0_CENSY/2-84--
A2QL18_ASPNC/27-115--
Y391_PYRFU/23-105--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window