Sequence alignment for CL0364

PF06434

Q7CVQ5_AGRT5/175-406VTFIAA.EGDISTDLLSPGNQAHSRSDRQLHG--------QCMISPEAQA...........-------.EIVALQQQHPD
A1TPA0_ACIAC/168-382VTVFKV.PGETNTDDLSPAPDAWSRPDIPLHY--------LAMLKNTRPDAAFKPEEDGKR-------GPMQFIEDLK.K
A5WDW0_PSYWF/168-383YTAFKV.TGETNTDDLSPAQDAWSRPDIPLHS--------LAMHKNSRDGITADE..EGVR-------GPMKQIEALK.E
A5GFC4_GEOUR/167-371VKVYKV.EGEINTDDFSPAGDAWSRPDIPLHS--------LAMGKTRFPD...........-------.GLATIAKYR.A
Q7V3U1_PROMM/169-377VTVFKV.DGETNTDDLSPATHATTRPDIPLHA--------LAMLETRDPN...........-------.ALATIISLK.A
Q8DL06_THEEB/174-377VTVFKV.AGETNTDDLSPAPHATTRPDIPLHA--------TVMLESRLPG...........-------.ALQIIAELK.Q
Q118H1_TRIEI/169-372VTVFKV.PGETNTDDLSPAPHATTRPDIPLHA--------LAMLESKMPE...........-------.GLKTIAQLK.Q
Q2SK45_HAHCH/194-401ATVFKV.TGETNTDDLSPAPDAWSRPDIPLHA--------KAMYKMPREGIT.......NA-------E..QQIEELK.K
Q1QVU9_CHRSD/173-387LTVFKV.PGETNTDDLSPAPDAWSRPDIPLHA--------NAMLKNPRDGIEPVE..PGVT-------GPLKQIEEVK.A
Q65PY4_MANSM/171-385VTVFKV.SGETNTDDLSPAQDAWSRPDIPLHA--------NAMLKMPREGIIPDQ..PTLV-------GPIKQLESLK.Q
A8EUS0_ARCB4/171-373LTVYKI.PGETNTDDLSPATVAFTRADIPLHA--------TAMLQSRMEK...........-------.PLEKMAELK.A
ACON2_HELPY/171-373ACVFKI.DGETNTDDLSPASDAFTRSDIPLHA--------KAMLKNRIEN...........-------.YEQRIKAIK.T
Q1H0A3_METFK/167-370LVVFKV.DGETNTDDLSPAQEAWSRPDIPLHA--------KAMLINKMPG...........-------.ALQTLEQLK.S
Q3A2K3_PELCD/167-371VKVFKV.EGEINTDDFSPAGDAWSRPDIPLHA--------LSMGGSRFAG...........-------.GIETIAAWR.K
Q6F9U3_ACIAD/168-384LTVFKV.TGETNTDDLSPAQDAWSRPDIPLHA--------NAMLKNERDGINPEK..PGEV-------GPLSQIKELI.A
Q2IQ71_ANADE/167-371VKIFKV.DGEINTDDFSPAGDASTRPDIPLHA--------LAMGKTRFPG...........-------.GLKTIAEFR.A
A0L7Y2_MAGSM/188-390VTVFKV.EGETNTDDLSPASEAWSRPDIPMHA--------KAMLVARMPD...........-------.ALDKLAQLK.S
Q12Z08_METBU/167-371VRVFKV.DGEINTDDFSPASAAWSRPDIPLHA--------LEMGTTRFPG...........-------.GIEEIAKWR.G
Q604Q3_METCA/168-375VTVFKV.PGETNTDDLSPAQDAWSRPDIPLHA--------KSMLKVPREGIH.......DA-------E..AQIAELK.T
Q01EA0_OSTTA/235-442VTVFKV.QGETNTDDLSPAQDAWSRPDIPLHA--------LAMLKSTREGI.........E-------EPIAQLAELK.K
Q7VFE0_HELHP/176-382VCVFKV.DGETNTDDLSPAGDAFTRSDIPLHA--------KAMLKSRIEN...........-------.FEQRIESAK.Q
Q2JL67_SYNJB/170-373VTVFKV.AGEINTDDLSPAAHATTRPDIPLHA--------QAMLESRAPG...........-------.SLVTIAELK.R
Q15QA4_PSEA6/168-382YSVFKV.TGETNTDDLSPAPDAWSRPDIPLHA--------RAAYKMTRDGLTPEV..HGEI-------GPLKQIDEIK.A
B4S6I7_PROA2/171-373LTVFKV.PGETNTDDLSPASEAFTRSDIPLHA--------LSMLGSKMDD...........-------.PIGTIESLK.E
Q31GI6_THICR/169-372VSVFKV.EGETNTDDLSPATAAWSRPDIPLHA--------KEMLKSRMDD...........-------.VDGTIASLE.A
Q3AR28_CHLCH/171-373LTVFKV.PGETNTDDLSPASEAFTRSDIPLHA--------RCMLGTKIND...........-------.PIGTIAALK.Q
A1U1S2_MARAV/173-386MVVFKV.TGETNTDDLSPAPDAWSRPDIPLHA--------RAAYKMERDGLKPEE..PGVT-------GPMSQIDEIK.A
A0RPN0_CAMFF/169-372AVVFKV.AGETNTDDLSPASEAFSRSDIPLHA--------NAMLVKRQPG...........-------.SLEKIAELK.K
A4SXE4_POLSQ/168-380LTVFKV.TGETNTDDLSPAPDAWSRPDIPLHA--------TIMLKNPRPGIEPDE..SGVR-------GPMKQIAALQ.K
A1AXP1_RUTMC/165-368LSVFRV.KGEINTDDLSPATQAWSRPDIPLHA--------QSMLIKKMNK...........-------.PLEMIKKLK.Q
Q5P0Q1_AROAE/172-388LTVFKV.TGETNTDDLSPAPDAWSRPDIPLHA--------LAMLKNPRSGITPEE..SGVR-------GPVKFLEDLR.A
Q30RR3_SULDN/171-373LSVFKV.AGETNTDDLSPASEAFTRSDIPLHA--------NSMLVAKMDN...........-------.PIETIKKLK.E
Q0VQ99_ALCBS/168-380LSVFKV.TGETNTDDLSPAQDAWSRPDIPLHG--------NAMLKNAREGIIPEK..DGEI-------GPLTQMDELK.K
Q7V9G7_PROMA/170-374VTVFKV.SGETNTDDLSPATHATTRPDIPLHA--------LAMLETRDPE...........-------.GLKTITSLK.K
A6VKR8_ACTSZ/171-385LTVFKV.LGETNTDDLSPAQEAWCRSDIPLHA--------NAMLKMPREGIEPDQ..PGSV-------GPLKQLAALK.S
F2GA07_ALTMD/175-406VVTYIAAEGDISTDLLSPGNQAHSRADRELHG--------KCMITPEAQQ...........-------....EIVELG.K
Q7M959_WOLSU/170-372LTVFKI.EGETNTDDLSPASDAFTRSDIPLHA--------QSMLKNRTQN...........-------.AFVRIEELK.K
A7I373_CAMHC/170-373AVVFKV.PGETNTDDLSPASEAFSRSDIPLHA--------NAMLSKRLPG...........-------.SLEKIAELK.K
Q47UT3_COLP3/168-380VKVFKV.TGETNTDDLSPAPDAWSRPDVPLHA--------KAMLKIGRDGITPEE..DGVV-------GPISQIEELQ.K
A6Q381_NITSB/171-374AVVFKV.PGETNTDDLSPASEAWSRSDIPLHA--------LSMLKAKMPD...........-------.AQETIKKLK.E
A1APN5_PELPD/168-373LKVYRV.QGEINTDDFSPAGDAWSRPDIPLHA--------LVMGRRRFPD...........-------.GLATMAAFR.E
A1SYN8_PSYIN/168-382MSVFKV.SGETNTDDLSPAPDAWSRPDIPLHA--------LAMLKLSREGIVADE..EGVV-------GPVKQINALK.D
Q3J9D3_NITOC/167-370AVVFKV.PGETNTDDLSPAQEAWSRPDIPLHA--------KAMLVNKMPE...........-------.ALSAIADLK.G
A7ZDV7_CAMC1/178-384AVVFKV.PGETNTDDLSPASEAYTRADIPLHA--------KAMLVKKMPE...........-------.GLEILKELK.S
B2UJ92_RALPJ/168-380ITVFKV.TGETNTDDLSPAPDATTRPDIPMHA--------LAMLKNARPGITPEE..DGKR-------GPVKFIESLK.E
D4ZEL2_SHEVD/169-382.TVFKV.TGETNTDDLSPAPDAWSRPDIPLHA--------LAMLKNARDGIVPDE..AGTL-------GPIKEIEQLK.T
H8XVL5_FLAIG/175-405.VTFIAGEGDISTDLLSPGNQAHSRSDRELHG--------KCMITPQAQE...........-------.EIKALQAQHPD
ACON2_ECOLI/168-382VTVFKV.TGETNTDDLSPAPDAWSRPDIPLHA--------LAMLKNAREGIEPDQ..PGVV-------GPIKQIEALQ.Q
Q0PA55_CAMJE/167-368.IVFKV.AGETNTDDLSPAGDAFTRSDIPLHA--------NAMLKVRQTG...........-------.SLEKIKELK.K
Q31PT6_SYNE7/169-372VTIFKV.PGETNTDDLSPATHATTRPDIPLHA--------QAMLETRLPG...........-------.SLETIPVLK.E
Q3IJ30_PSEHT/183-397VTVFKV.TGETNTDDLSPAPDAWSRPDIPLHA--------LAMLKIERDGITPDK..PGEV-------GPITQLEELK.T
Q46I80_PROMT/170-378VTVFKV.EGETNTDDLSPATHATTRPDIPLHA--------LAMLETRDPN...........-------.GLRTIEELK.K
Q5R023_IDILO/169-374.TVFKV.TGETNTDDLSPAPDAWSRPDIPLHA--------KAMYKMPREGI.........T-------DAGKQIEELK.E

PF00694

ACON_LEGPH/689-819AGLYLK-SKGVDEKDFNSYGSRRGNHEVMMRGTFANIRIRNEMTPGQEGGVTRYVPTGETM.......SIYDAAMRYQ-E
ACOC_HUMAN/692-821AARYLT-NRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLN.KQAPQTIHLPSGEIL.......DVFDAAERYQ-Q
LEUD_HAEIN/1-126MAGFKQ-LSGLVVPLDAANVDTDAIIPKQFLQAITRIGFGKHLFHEWRYLDVEGT..KPNP.......EFVLNYPQYQ-.
ACON_YEAST/579-709MPILIK-AVGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENKKANCVKNVYTGEYK.......GVPDTARDYR-D
LEUC_YEAST/545-672MKPFLT-LEGISAPLDKANVDTDAIIPKQFLKTIKRTGLKKGLFYEWRFRKDDQGKD.QET.......DFVLNVEPWR-.
LEUD_LACLA/1-124MEKFTI-YKGTSVPVMNDNIDTDQIIPKQFLKAIDKKGFGKNLFYEWRYLKDYDE....NP.......DFILNAPKYK-.
LYS4_YEAST/484-620NPVVEE-EVNAQTEAPKQSVEILEGFPREFSGELVLCDADNINTDGIYPGKYTYQDDVPKEKMAQVCMENYDAEFRTK-V
ACON2_YEAST/585-714TNVLLK-VEGKCTTDHISAAGVWLKYKGHLENISYNTLIGAQNKETGEVNKAYDLDGTEY........DIPGLMMKWK-S
LEUC_USTMA/542-667MEKFTT-LTGIAAPLERSNVDTDLIIPKQFLKTIKRTGLGSALFWPLRYDAKTG..E.PDP.......AFVLNQKPYD-.
ACON_BOVIN/582-712LQILIK-VKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINVENGKANSVRNAVTQEFG.......PVPDTARYYK-K
G3WYV5_SARHA/77-203.AKYLT-NRGLTPREFNSYGARRGNDAVMTRGTFANIKLLNKFIG.KPAPKTIHFPSGQTL.......DVFEAAELYQ-R
M0Y4D6_HORVD/248-376.AKYLL-ERGVDRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKL.......SVFDAALKYK-S
ACON1_ECOLI/691-818..RYLQ-GRGVERKDFNSYGSRRGNHEVMMRGTFANIRIRNEMVPGVEGGMTRHLPDSDVV.......SIYDAAMRYK-Q

PF01989

N0BD57_9EURY/24-103FSFLGD---------VDPESGLVKAKDSDIYG---------------------------------------------KNI
Y208_METTP/24-103ISFLGN---------VDPETGVVVDPAHELYG---------------------------------------------RSI
R6ESJ9_9FIRM/32-113....HG---------VDPETGKIDDVRVSVCG---------------------------------------------QCV
B8GKJ6_METPE/22-101ISFLSG---------VDPVTGVIIEQGHPLQG---------------------------------------------RSI
G2IKN6_9SPHN/33-107ISGWGG---------VNLMNGTVIETRHELKG---------------------------------------------QSF
B7G3A0_PHATC/35-110LSFWGG---------IDPLSGIVIDSTHPLAG---------------------------------------------QSV
Q0CKP1_ASPTN/22-107LSFWGG---------VDPTTGRIVDHHHPLNG---------------------------------------------QSM
B8LC13_THAPS/7-95ISFWGG---------IHPETGKVIDTTHPLHN---------------------------------------------QSV
A8MB53_CALMQ/29-105ISFLGD---------VDGARGIVKVKGMEI..---------------------------------------------.NI
Q2FUD8_METHJ/24-103ISFLSG---------VDPETGIVLEPGHPLEG---------------------------------------------KDI
Y1486_METKA/29-108LSFLGG---------VDPKTGEVVDPSHELCG---------------------------------------------EKL
A2BN86_HYPBU/27-100ISFYGE---------VDPDTGVLKGVG.....---------------------------------------------.SI
H3ZRB4_THELN/24-103LSFLGG---------VDPKTGIVKDIESDIKG---------------------------------------------ESI
C3M8X0_RHISN/26-111LSFWGG---------LDSATGRIIDQWHPEKN---------------------------------------------EVM
B8MWK8_ASPFN/33-108LSFWGG---------VDPRTGEIIDRFHPLSG---------------------------------------------RFM
Y391_PYRFU/24-103LSFLGG---------VDPNTGIITDPESDIQG---------------------------------------------EKI
R9SH15_9EURY/23-102ISFLGG---------VDPETGKVIDIKHELKG---------------------------------------------QSI
D5EER2_AMICL/28-106.QGWSG---------VDDKTGIVIEKGHPFEG---------------------------------------------MSI
Q4W903_ASPFU/24-109LSFWAG---------VDSQTGEIIDRHHPLHG---------------------------------------------QSV
I3TCQ9_THEC1/24-98ISFFGE---------VDPAAGTLRS.....VG---------------------------------------------EQI
Q8ZVK7_PYRAE/23-95VSLLGD---------LDPEAGKLA.......G---------------------------------------------VDV
A3CV39_METMJ/22-101ISFLSG---------VDPETGIVVEHGHPLEG---------------------------------------------QSI
M4WRD4_PSEDE/16-101LSFWGG---------VEPFTGEIIDRHHPLSG---------------------------------------------SFL
Q2FQH8_METHJ/31-111LSHLVN---------AVNSDGVIRIFGHPLVG---------------------------------------------QSY
D5WW29_KYRT2/36-110......---------CDPETGQVIEDGHCLHG---------------------------------------------VSV
Q7VS11_BORPE/26-105FSPRYD---------LDRWSGVISRIGHSAEG---------------------------------------------ESI
D9PZT3_ACIS3/25-98LSFYGD---------VDPHTGRTPD......G---------------------------------------------RSV
E1QPZ0_VULDI/25-99LSFLGD---------VDGKNGIIRTINA....---------------------------------------------.SI
D3S160_FERPA/24-103ISFLGD---------VDAKSGVVVDKNSDIYG---------------------------------------------ESV
R7QWM0_9FIRM/30-105.....L---------IDPKTGVVIEPAHALEG---------------------------------------------QSM
Q7VVN5_BORPE/29-108ISMRYD---------VDASTGKVVRPSHDLYG---------------------------------------------QSI
F7XP83_METZD/27-106ISFLGN---------VDPETGIIVDPDHELYG---------------------------------------------KCI
Q98JX5_RHILO/33-118LSFWGG---------IDAETGDIIDHSHPGLG---------------------------------------------QNV
L0AAW5_CALLD/24-97ISFYGD---------INPNNGNLVD......G---------------------------------------------RNV
E3GEU4_EUBLK/27-106IQGWAG---------VSDTTGEIIEKGHAEEG---------------------------------------------KNI
I4BZ52_ANAMD/35-109......---------CDPDTGMVIEENHPLFG---------------------------------------------KSI
E3CXQ7_9BACT/34-108......---------CDPETGTVIEKNHPLQG---------------------------------------------RSI
Y2089_AERPE/26-99LSFYGE---------VDPETGVTSG......G---------------------------------------------KPL
F6D7R3_METSW/27-106ISFLGG---------VDPETGTVIDSNHELHG---------------------------------------------RKI
D7A451_STAND/26-105FSARYD---------LDRIKGVFSRPAHKLFG---------------------------------------------EDY
K0R0F5_THAOC/21-104..FGGG---------IEETTGNVIDLTHPLHV---------------------------------------------QCI
M1FJI6_9ALTE/70-152LSFWGG---------VDPASGNIIDVHHPNYG---------------------------------------------GSV
S0DMB2_GIBF5/30-115LSFWGG---------VDPQTSEIIDRHHPLSG---------------------------------------------QHL
V4L6X5_9GAMM/36-111..VWGG---------NTKSAPCTDQDNKDLYQ---------------------------------------------KDL
E0STE4_IGNAA/29-108LSFLGD---------IDKDTGLIVSEESGAKG---------------------------------------------SFI
J0S976_9EURY/24-103LSFLSG---------VDPESGVIIEEGHPLKG---------------------------------------------ESI
L0HCV8_METFS/24-103ISFLSG---------VDPKTGVIVEKGHPLQG---------------------------------------------TSI
F2K7K1_PSEBN/29-114LSFWGG---------VDPASGEVIDRHHPLSG---------------------------------------------QRL
A2SRL5_METLZ/24-103ISFLGG---------VDPKTGIVIDETHPLFG---------------------------------------------KSV
D9QPM4_ACEAZ/28-107IQGWAG---------IDDETGEIIEQGHSLEG---------------------------------------------KSI
I0A252_FERFK/24-100ISFLGE---------VNAKNGEIIFKDKKI..---------------------------------------------.SI
A1BBM0_PARDP/24-109LSFWGG---------VDPATGRIIDVHHPLQG---------------------------------------------RSI
Y1407_METJA/24-101FSFLGG---------VD.EEGNIIDKDSDLYG---------------------------------------------QSL
F2NF88_DESAR/29-109LSHLVN---------AIGSDGVIRMNGHPLKG---------------------------------------------QSY
A8AAC4_IGNH4/35-109LSFLGE---------VDPLKGTLYD......G---------------------------------------------RSI
A1WKZ3_VEREI/29-113LSFWGG---------YDAQAGRIVEPGHPQQG---------------------------------------------MSL
R6DN34_9FIRM/25-110FGFFGG---------VNPKTGEIIDKWHELYG---------------------------------------------QSI
Y244_METAC/27-106ISFLGS---------VDPKTGIVVEEKHSLAG---------------------------------------------KSI
G4RKW9_THETK/24-96ISFLGD---------LNPETGEVA.......G---------------------------------------------RSV
C5CQY5_VARPS/33-112ISGWGG---------IDPRTGTVIETRHELRG---------------------------------------------QSF
A3DM70_STAMF/25-99ISFFGE---------VDPINGIVRPENI....---------------------------------------------.SI
D5U2S3_THEAM/26-102LSFFGE---------VDPVKGVVRTDTGEV..---------------------------------------------.EI
D7DTY0_METV3/29-106ISFLGG---------VS.EEGVITDKENELYG---------------------------------------------ESI
A0RYV0_CENSY/3-82INFLGA---------VDKKTGEVTDSGHDLHG---------------------------------------------RSF
G9MVW1_HYPVG/29-114LSFWGG---------VDPQTSEVIDHHHPLSG---------------------------------------------KHL
R5C8T0_9FIRM/22-107LSFWGG---------VDAQTGCVIDQRSKLCG---------------------------------------------QSL
K0IIB4_NITGG/26-105INFLAM---------VDTKTGRITDPKHDLYG---------------------------------------------KSL
G4Q6H7_ACIIR/28-104....YL---------IDPKTGVVIEEGHSLEH---------------------------------------------KSI
A1RYB9_THEPD/17-96ITFLGG---------VDPFTGLVVEKGHPLYG---------------------------------------------QSV
D2RHH9_ARCPA/24-103FSFLGD---------VDVESGVVVAEDSDISG---------------------------------------------ERI
Q161U5_ROSDO/24-106LSFWGG---------VDPATSRVVLAGHPQYG---------------------------------------------VLI
D1Z109_METPS/24-103ISFLGG---------VDPKTGNVIEKGHALYG---------------------------------------------RNV
H1Z4A9_9EURY/26-105ISFLSG---------VDPETGIVMEKGHAIEG---------------------------------------------RSI
I0HTU3_RUBGI/27-106FSARYD---------LDRIAGVFSRPTHALAG---------------------------------------------QSY
I4CD99_DESTA/24-103FSFIGD---------FDPNSGKITIPNHSMFG---------------------------------------------QSI
Q9I485_PSEAE/28-112LSFWGG---------VDPRSAEVIDRHHPLSG---------------------------------------------RHL
Q5ASV1_EMENI/24-108LSFWGG---------VEQTTGDIIDHHHPLFG---------------------------------------------ENI
T0MXU8_9EURY/33-108.....L---------VDPLTSEILEDDHPLKG---------------------------------------------VKV
A9A545_NITMS/20-99INFLGT---------VDKKTGIISDKNHDLYD---------------------------------------------KSI
Y1471_METBU/27-106LSFLGN---------VDPKTGVVVDPGHAIYG---------------------------------------------ECI
E6SD53_INTC7/25-109LSFWGG---------SD.LAGTIIDTHHPQHG---------------------------------------------QSF
K4LI68_THEPS/27-106ISFMGS---------INPKTGYVIERGHEIEG---------------------------------------------QCL
T0LAC7_9EURY/27-103ISPLGE---------IS.RDGLITS..GPCEN---------------------------------------------VNI
F0Y7N8_AURAN/48-123LSFWGG---------VCPESGTVIDARHPLAG---------------------------------------------QCI
H6C1P1_EXODN/31-116LSFMMG---------VDPDSGKVIDTHHPLCG---------------------------------------------TSL
D4M8X2_9BACT/34-108......---------TDPITGNVIERNHAIQG---------------------------------------------KCI
G8MK88_9BURK/24-109LSFWGG---------YDAGRGVIVDATHAGLG---------------------------------------------QSL
B8D358_DESK1/20-96MSFLGE---------VDPVRGIVKTEKEEI..---------------------------------------------.SV
Q2NHJ1_METST/26-105ISFLGG---------VDPKTGIVIDKKHELYN---------------------------------------------ECI
B4EMJ9_BURCJ/30-115LSFWGG---------YDSGAGRIVDRGHPQAG---------------------------------------------ASL
Q5LVT9_RUEPO/21-101LSFWGG---------VDPETGRVIDAHHPQHG---------------------------------------------AAL
E3GYB3_METFV/22-101LSFLGG---------VDPKTGKVIDPRHPLKG---------------------------------------------KSI
R9T678_9EURY/24-101VSFLGG---------VNPADGKVADASTN..G---------------------------------------------QSA
S5Y6N5_PARAH/21-106LSFWGG---------VDPASGRVIDAHHPWHG---------------------------------------------QSL
F7PH92_9EURY/36-115ISFYGA---------VEPDTGEFIEDGHPLEG---------------------------------------------ENI
A6WUT6_OCHA4/26-109ISFWGG---------VDPKSGRIADVRHPEHG---------------------------------------------RSI
Y1530_METTH/24-103LSFLGG---------VDPGTGRVIDQKHPLHG---------------------------------------------RSI
C7Z030_NECH7/44-129ISFMMG---------VNAETGVVMDEHHHLRG---------------------------------------------VSL
A1WSP8_VEREI/25-104FSARYD---------LNRWTGLFSRPAHKLVG---------------------------------------------LSY
R7FFK0_9FIRM/29-104.....L---------VDPKTGVVIEKSHCLFG---------------------------------------------KSI
B8NAM4_ASPFN/24-109ISFWGG---------VNPETGQVVDRHHPLCG---------------------------------------------QSI
M9SG65_9EURY/24-98FSFLGG---------VDGKTGNF.....NVRD---------------------------------------------GNI
Q7VV68_BORPE/16-95ISFWGG---------FDPQTGRIVDPYSSLRG---------------------------------------------RDI
G7XQK1_ASPKW/28-113LSFWGG---------VDPQTGRVIDQHHPLNG---------------------------------------------HSL
B6JEQ3_OLICO/33-109....GA---------IANETGFVRIQDHPLSG---------------------------------------------HCI
A9CH00_AGRT5/32-117LSFWGG---------VDPATGKVIDVHHPLHG---------------------------------------------ICL
T0KFW4_COLGC/27-111LSFMMG---------VDPKTGVVVDAHHPLLG---------------------------------------------TSV
F5XKR9_MICPN/38-123LSFWGG---------VDPVSGVVIDTHHPLHG---------------------------------------------QCV
Y055_ARCFU/24-102ISFLGG---------IDKETGIVKE.DCEIKG---------------------------------------------ESV
Q13MZ8_BURXL/43-128LSFWGG---------YDAALGKIIEKSHPAHG---------------------------------------------QSL

PF06434

Q7CVQ5_AGRT5/175-406KRVM....LIAEK-GTMGVGSSRMSGVNNVALWTGKQASPYVPFV-NYAPIVAGTNGISPIFATTVDVTGGIGINLKNWV
A1TPA0_ACIAC/168-382KGHV....VAYVG-DVVGTGSSRKSATNSV.IWATGQDIPFVPNK-RFGGVTLGGK.IAPIFFNTQEDSGSL........
A5WDW0_PSYWF/168-383KGFP....LAYVG-DVVGTGSSRKSATNSV.LWLMGDDIPNVPNK-RAGGLVLGGK.IAPIFYNTMEDSGAL........
A5GFC4_GEOUR/167-371DGFQ....VAFAG-DVVGTGSSRKSACNSV.LWANGNDIPCVPNK-RRGGVIIGGV.IAPIFFNTAQDSGAL........
Q7V3U1_PROMM/169-377KGHP....IAYVG-DVVGTGSSRKSAINSV.LWHIGADIPYVPNK-RSGGVILGGK.IAPIFFNTAEDSGAL........
Q8DL06_THEEB/174-377KGYP....LAYVG-DVVGTGSSRKSATNSV.IWHIGRDIPYVPNK-RTGGVCLGGK.IAPIFFNTMEDSGAL........
Q118H1_TRIEI/169-372KGHP....VAYVG-DIVGTGSSRKSACNSM.LWHIGEDIPFIPNK-RSGGYILGGK.IAPIFFNTAEDSGAL........
Q2SK45_HAHCH/194-401KGHE....VAFVG-DVVGTGSSRKSATNSV.LWYIGRDMPGVPNK-RTGGICIGGK.IAPIFFNTMEDAGAL........
Q1QVU9_CHRSD/173-387KGHP....VVYVG-DVVGTGSSRKSATNSV.LWFFGDDIPNVPNK-RAGGFCFGGK.IAPIFFNTMEDSGAL........
Q65PY4_MANSM/171-385KGFP....LAYVG-DVVGTGSSRKSATNSV.LWFMGEDIPYIPNK-RAGGIVLGGK.IAPIFFNTLEDAGAL........
A8EUS0_ARCB4/171-373KGHP....LAYVG-DVVGTGSSRKSGINSV.QWHMGRDIPGVPNK-RTGGVVIGSI.IAPIFFNTAEDSGCL........
ACON2_HELPY/171-373KGVP....VAYVG-DVVGTGSSRKSATNSI.MWHFGKDIPFVPNK-RSGGIVIGGV.IAPIFFATCEDSGAL........
Q1H0A3_METFK/167-370QGLP....LAYVG-DVVGTGSSRKSAINSV.QWHMGNDIPYIPNK-RTGGIVLGGK.IAPIFFNTAEDSGAL........
Q3A2K3_PELCD/167-371AGHQ....VAFVG-DVVGTGSSRKSACNSL.LWHIGEDIPGVPNK-RRGGVIIGGA.IAPIFFNTAQDSGAL........
Q6F9U3_ACIAD/168-384KGNQ....VAYVG-DVVGTGSSRKSATNSV.LWFFGDEIAHIPNK-KDGGYCLGSK.IAPIFFNTMEDAGAL........
Q2IQ71_ANADE/167-371QGFQ....VAFVG-DVVGTGSSRKSACNSV.LWAIGEDIPFVPNK-RRGGVIIGGV.IAPIFFNTAQDSGAL........
A0L7Y2_MAGSM/188-390KGYP....VAYVG-DVVGTGSSRKSAANSV.IWHTGSDIPYVPAK-RTGGVVIGGT.IAPIFFNTAEDSGML........
Q12Z08_METBU/167-371EGHE....VAFVA-DVVGTGSSRKSACNSV.LWHIGKDIPHVPNK-RRDCVIIGTA.IAPIFFNTAEDSGAL........
Q604Q3_METCA/168-375KGFP....VAYVG-DVVGTGSSRKSATNSL.LWYIGEDIPHVPNK-RQGGVCIGGK.IAPIFFNTLEDSGAL........
Q01EA0_OSTTA/235-442LGHP....LAYVG-DVVGTGSSRKSATNSV.LWHMGEDIPNVPNK-RTGGVCIGGK.IAPIFFNTMEDSGAF........
Q7VFE0_HELHP/176-382KAAQNNAVVAYVG-DVVGTGSSRKSACNSI.MWHFGKEIPFIPNK-KSGGIVIGSV.IAPIFFNTCEDSGAL........
Q2JL67_SYNJB/170-373RGHP....VAFVG-DVVGTGSSRKSALNSL.LWHIGHDIPHVPNK-RAGGVILGGT.IAPIFFNTAEDAGAL........
Q15QA4_PSEA6/168-382KGHP....VAFVG-DVVGTGSSRKSATNSV.LWFFGEDLPGVPNK-RGGGVCIGGK.VAPIFYNTMEDAGAL........
B4S6I7_PROA2/171-373HGHP....IAFVG-DVVGTGSSRKSGINSV.QWHIGENIPAVPNK-RTGGVVIGGI.IAPIFFNTAEDSGAL........
Q31GI6_THICR/169-372KGHP....VAYVG-DVVGTGSSRKSAMNSV.MWFFGNDIPYVPNK-RQGGVVLGGK.IAPIFFNTAEDSGSL........
Q3AR28_CHLCH/171-373KGHP....LAYVG-DVVGTGSSRKSGINSV.QWHIGSDIPAVPNK-RTGGVVLGGI.IAPIFFNTAEDSGAL........
A1U1S2_MARAV/173-386KGLP....VAFVG-DVVGTGSSRKSATNSV.LWFFGEDIPGVPNK-RAGGVCIGNK.VAPIFFNTMEDAGAL........
A0RPN0_CAMFF/169-372SGLE....VIYVG-DVVGTGSSRKSGINSI.QWHLGHEIDGIPNK-KTGGIILGSI.IAPIFFNTAEDSGAL........
A4SXE4_POLSQ/168-380KGNQ....IAYVG-DVVGTGSSRKSATNSV.LWWTGQDIPFVPNK-RFGGVCLGTN.IAPIFFNTMEDSGAL........
A1AXP1_RUTMC/165-368KGLP....LVFVG-AIVGTGSSRKSAINSV.LWHMGHAIDYVPNK-HSGGVLLGGK.IAPIFFNTAQDSGAL........
Q5P0Q1_AROAE/172-388KGNL....VAYVG-DVVGTGSSRKSATNSV.LWFTGEDIPFVPNK-RFGGVCLGSK.IAPIFFNTMEDAGAL........
Q30RR3_SULDN/171-373KGNP....IAYVG-DVVGTGSSRKSGVNSV.QWHMGEDIPGVPNK-RTGGVVLGSI.IAPIFFATCEDSGAL........
Q0VQ99_ALCBS/168-380KGYP....VAYVG-DVVGTGSSRKSATNSV.LWHFGDDIPFVPNK-RAGGVCIGGK.IAPIFFNTMEDSGAL........
Q7V9G7_PROMA/170-374KGHS....IAYVG-DVVGTGSSRKSAINSV.LWHIGEDIPYVPNK-RSGGIILGGK.IAPIFFNTAEDSGAL........
A6VKR8_ACTSZ/171-385KGFP....LVYVG-DVVGTGSSRKSATNSV.LWHMGDDIPFIPNK-RTGGFVFGGK.IAPIFFNTAEDSGAL........
F2GA07_ALTMD/175-406KHPNAKVMLIAEK-GTMGVGSSRMSGVNNVALWAGEPTSPYIPFV-NKAPIVAGTNGIAPIFLTTVDVTGGIGLDLKNWV
Q7M959_WOLSU/170-372KGFP....LVYVG-DVVGTGSSRKSACNSL.VWHMGHEIPFIPNK-KAGGVVIGTS.IAPIFFNTCEDSGTL........
A7I373_CAMHC/170-373NGKK....VVYVG-DVVGTGSSRKSGVNSV.QWHIGDEIKGVPNK-KTGGVIIGST.IAPIFFNTAEDSGAL........
Q47UT3_COLP3/168-380DGIP....LAYVG-DVVGTGSSRKSAANSV.LWYMGDDIPCIPNK-RGGGVCLGGK.IAPIFYNTLEDSGAL........
A6Q381_NITSB/171-374KGLP....VAFVG-DVVGTGSSRKSGINSV.QWWIGEDIPHVPNK-RTGGIIIGGI.IAPIFFNTAEDSGAL........
A1APN5_PELPD/168-373EGCR....IAFVG-DVIGTGSSRKSACNSL.LWAIGEDIPGVPNK-RGGGVIIGGV.IAPIFFNTAQDSGAL........
A1SYN8_PSYIN/168-382KGHP....LVYVG-DVVGTGSSRKSATNSV.LWFMGNDVPFVPNK-RAGGVCIGNK.IAPIFFNTMEDSGAL........
Q3J9D3_NITOC/167-370RGLP....LAFVG-DVVGTGSSRKSAINSI.LWHMGQDIPFVPNK-RQGGIILGGK.IAPIFFNTAEDSGAL........
A7ZDV7_CAMC1/178-384RGKS....VAYVG-DVVGTGSSRKSGINSI.QWHLGDEIEGVPNK-KKGGIVIGTT.IAPIFFNTAEDSGAL........
B2UJ92_RALPJ/168-380KGHL....VAYVG-DVVGTGSSRKSATNSV.LWFTGEDIPYVPNK-RFGGVCLGGK.IAPIFYNTMEDAGAL........
D4ZEL2_SHEVD/169-382KGFP....LVYVG-DVVGTGSSRKSATNSV.LWFMGDDIPNVPNK-RGGGFCLGGK.IAPIFFNTMEDAGAL........
H8XVL5_FLAIG/175-405KSVM....LVAEK-GTMGVGSSRMSGVNNVALWTGKQASPYVPFV-NIAPIVAGTNGISPIFLTTVDVTGGIGIDLKNWV
ACON2_ECOLI/168-382KGFP....LAYVG-DVVGTGSSRKSATNSV.LWFMGDDIPHVPNK-RGGGLCLGGK.IAPIFFNTMEDAGAL........
Q0PA55_CAMJE/167-368SGRE....VVYVG-DVVGTGSSRKSAINSI.QWHLGKEIEGVPNK-HSGGIIMGST.IAPIFFNTAQDSGAL........
Q31PT6_SYNE7/169-372KGYP....LAYVG-DVVGTGSSRKSAINSV.LWHIGEDIPFVPNK-RSGGIILGGK.IAPIFFNTAEDSGAL........
Q3IJ30_PSEHT/183-397KGLP....LAYVG-DVVGTGSSRKSATNSV.LWFMGDDIPFVPNK-RVGGVCLGNK.IAPIFFNTMEDSGAL........
Q46I80_PROMT/170-378KGYP....IAYVG-DVVGTGSSRKSAINSV.LWHTGQDIPYVPNK-RGSGVVIGGK.IAPIFFNTAEDSGAL........
Q5R023_IDILO/169-374KGHP....VAFVG-DVVGTGSSRKSATNSV.LWNIGEDMPGTPNK-RAGGICIGSK.VAPIFFNTMKDAGAL........

PF00694

ACON_LEGPH/689-819NQQD----LVIIAGKEYGTGSSRDWA-------------AKGTNL-LGVKAVITES-FERIHRSNLIGMGIL--------
ACOC_HUMAN/692-821AGLP----LIVLAGKEYGAGSSRDWA-------------AKGPFL-LGIKAVLAES-YERIHRSNLVGMGVI--------
LEUD_HAEIN/1-126.GAT----ILLAR.KNLGCGSSREHA-------------PWALAD-YGFKVMIAPS-FADIFYNNSLNNHML--------
ACON_YEAST/579-709QGIK----WVVIGDENFGEGSSREHA-------------ALEPRF-LGGFAIITKS-FARIHETNLKKQGLL--------
LEUC_YEAST/545-672.EAE----ILVVTGDNFGCGSSREHA-------------PWALKD-FGIKSIIAPS-YGDIFYNNSFKNGLL--------
LEUD_LACLA/1-124.KAS----LLISG.DNFGSGSSREHA-------------AWALSD-YGFRAIIAGS-YSDIFYNNALKNGLL--------
LYS4_YEAST/484-620HPGD----IVVSG.FNFGTGSSREQA-------------ATALLA-KGINLVVSGS-FGNIFSRNSINNALL--------
ACON2_YEAST/585-714DGRP----WTVIAEHNYGEGSAREHA-------------ALSPRF-LGGEILLVKS-FARIHETNLKKQGVL--------
LEUC_USTMA/542-667.QSK----ILVVTGPNFGCGSSREHA-------------AWSLLD-FGIRAVIAES-FGDIFRNNLTKNGQL--------
ACON_BOVIN/582-712HGIR----WVVIGDENYGEGSSREHA-------------ALEPRH-LGGRAIITKS-FARIHETNLKKQGLL--------
G3WYV5_SARHA/77-203EGIP----LIILAGKKYGSGNSRDWA-------------AKGPYL-MGVKAVVAES-YEKIHKDHLIGIGIA--------
M0Y4D6_HORVD/248-376EGHD----TIILAGAEYGSGSSRDWA-------------AKGPML-LGVKAVIAKS-FERIHRSNLVGMGII--------
ACON1_ECOLI/691-818EQTP----LAVIAGKEYGSGSSRDWA-------------AKGPRL-LGIRVVIAES-FERIHRSNLIGMGIL--------

PF01989

N0BD57_9EURY/24-103SGKI----FAFPT----GRGSTVGTYV.LLRMKKAGSAPLAIINE.KTEAIIAVGAIIS..........DI---------
Y208_METTP/24-103AGVV----LIFPG----GKGSTVGSYV.IYQLRKRGMAPAAMINL.KSEPIVAVGAIIS..........DI---------
R6ESJ9_9FIRM/32-113KDKI----LIYPL----GKGSTSGATW.MLEAVRCGNGPKAIINK.ETELIIVAGAVLSEKLYGK....AI---------
B8GKJ6_METPE/22-101EGTI----FAFPH----GKGSTVGSYI.LYALARNHKAPAAIINQ.EAEPIIVVGAIIS..........GI---------
G2IKN6_9SPHN/33-107AGKV----LVFPG----AKGSSGWSGI.FHMAKLRGMAPVAMVFN....IMTTKAAVVM..........RT---------
B7G3A0_PHATC/35-110TDTI----LCLPS----GRGSCTASQV.LLELILNGIAPRAIVLR.DVDGLAAVGALIAQ...........---------
Q0CKP1_ASPTN/22-107ANRI----LAIPC----GRGSCSGSTV.MLELLLNGCAPAALIFE.QREQILTLGVLVGQALFDC....SI---------
B8LC13_THAPS/7-95ADKI----LVIPS----GRGSCTGSQV.LLELILNGRAPRALILR.DVDVILCTGAIVAEEFFGSESDGNV---------
A8MB53_CALMQ/29-105AGKI----LALPY----STGSTVGPYV.MYKLAKYGKAPLAILTI.KPDTLVLVGSIMA..........NI---------
Q2FUD8_METHJ/24-103TGSV----LAFEY----GKGSTVGSYI.LYALSRNGHAPAAIINQ.EAETIIVVGAIMG..........KI---------
Y1486_METKA/29-108TGRV----LVLPG----GRGSTVGSYV.LMEMADRGTAPAGIVVR.EAEPILVVGCVLG..........DI---------
A2BN86_HYPBU/27-100AGKI----LVFRG----SRGSTVGPYI.MYALRRKGLAPAGLIVP.KAEPMLVAGAVLA..........EI---------
H3ZRB4_THELN/24-103KDKI----LVFPR----GKGSTVGSYV.IYQLKKNGVAPKAIIVE.EAETIVATGAIIA..........EI---------
C3M8X0_RHISN/26-111SGRI----LVMRA----GRGSSSGSSV.LAEALRRGTGPAGIVLL.ARDAIVTVGAMVAAELYGK....TC---------
B8MWK8_ASPFN/33-108KDTI----LAIPG----GRGSCGGSVI.MMELILNGLGPKALIFE.RREEIITLGVMVAE...........---------
Y391_PYRFU/24-103TGKI----LAFPR----GKGSTVGSYV.IYALAKKGTGPKAIIVE.EAEAIVAVGAIIA..........GI---------
R9SH15_9EURY/23-102KDKI----LFIPG----GKGSTVGSYV.IFQMMKNNTAPKAIICL.KAEPIIATGAIMS..........DI---------
D5EER2_AMICL/28-106KGAV----LVLSG----GKGSNGWSCH.FHAARVGGIGPAALIFP.KMDSRTGVAAVVT..........GV---------
Q4W903_ASPFU/24-109NGRI----LAIPC----SRGSCTGSIV.LIELLLNQCAPAGLIFQ.QPEQIITLGVVVAKTLLGL....SI---------
I3TCQ9_THEC1/24-98AGVA----LAFRG----GRGSTVGSYV.IYALKYYGREPSCMLVE.EPEPIIITGCIMA..........DI---------
Q8ZVK7_PYRAE/23-95VGKI----AALPY----VKGSTVGPYV.LWGAARRGKAPLAIVAQ.KPDLMLISACVLA..........GI---------
A3CV39_METMJ/22-101AGRV----LAFPY----GKGSTVGSYV.IYALKQNGLAPAAIINT.ETEPIIAVGAIIA..........EI---------
M4WRD4_PSEDE/16-101PGRV----LAIPS----GRGSCTGSSV.MLEILLNGHAPAALLLA.EPDEILTLGVLVAQALFGR....SI---------
Q2FQH8_METHJ/31-111AGKI----VVYDT----DKFSTGGAWGLYFKAKVTNSAPKALICR.TVHPISIGGAIDA..........GI---------
D5WW29_KYRT2/36-110SGKI----LVFPS----GKGSSVVQTDGLYQLAMRGNAPKAVVVQ.HPDTVLVATCIIL..........DV---------
Q7VS11_BORPE/26-105KDRI----LVIPT----AKGGVAGGWA.FYDLLHKGIAPKALVFG.KLNPVMVQGAVLA..........GM---------
D9PZT3_ACIS3/25-98ASRV----IVARR----PRGSTVGSYV.IYALKANGAAPAAIVMS.RVDPIIVAGCVLA..........GI---------
E1QPZ0_VULDI/25-99AGKV----LVIPS----SRGSTVGPYV.MYQLSKYGKAPLVILSV.KADTMLIIGAIMA..........QI---------
D3S160_FERPA/24-103ANKV----LVFPS----GKGSTVGTYV.LLQLKKNGVAPLAIINE.KTEVIIAVGAIIA..........EI---------
R7QWM0_9FIRM/30-105AGKI----LIFPG----GKGSSVVQADGLFQLNKEENLPKAMIIQ.YPETVLVSSAIIM..........DI---------
Q7VVN5_BORPE/29-108SGKV----LIFKN----TKGGVATGWA.LLNLKSRGTAPIALVCD.TTNPVFVQGAALA..........GL---------
F7XP83_METZD/27-106KDTV----LVFPS----GKGSTVGSYV.LYQLKKNGFAPAAMVNL.ESEPIVAVGAIIS..........DI---------
Q98JX5_RHILO/33-118AGRI----LVMPS----GRGSSSSSSV.LAEAIRRGTAPAGILLE.RPDPILAVGAIVAEFLYDI....HM---------
L0AAW5_CALLD/24-97KDKI----LVAYK----PRGSTVGSYI.IYALKENGFAPKAIIMA.KSEPIIIAGCALS..........NI---------
E3GEU4_EUBLK/27-106NGKI----LVLPC----SKGSNGWSCH.FHSAMISGFKPAGWIFS.KMDSRAGVATVVI..........GS---------
I4BZ52_ANAMD/35-109AGKV----LVLQS----GKGSSVVQVDGLYQLMSKKNLPAAIIAR.EIEPVLVSAAVVV..........NV---------
E3CXQ7_9BACT/34-108AGKV----LVLQS----GKGSSVVQVDGFYQLSVKETLPAAIVVR.ETEPVLVSSAVVV..........GE---------
Y2089_AERPE/26-99AGRV----AAIRR----SRGSTVGSYV.IYALKENGVAPLAILME.RAEPIVIAGCVLA..........GI---------
F6D7R3_METSW/27-106SGKI----LFIPS----GKGSTVGSYV.IYQMAKNGTAPLAIIAL.EAEPIIATGAIMA..........EI---------
D7A451_STAND/26-105RERV----LVLNN----VKGGVASAWM.LNEMASRDVKPAAFVFN.RVNPILAQGAALA..........GL---------
K0R0F5_THAOC/21-104SDKV----LVIPG----GRGSCTGSQS.MLELILNKKSPRALVLR.DADAILCTGAVVAEEFFPP....DT---------
M1FJI6_9ALTE/70-152SGKI----LMMPT----SRGSCSGSGV.LLELSLNSLAPAALVFR.EHEEVLTLGALVSDRIFGR....PL---------
S0DMB2_GIBF5/30-115QNTV----LAIPG----GRGSCTGSGV.MLELLLNGKAPEAIIFE.RREDILTLGVMIAEEVFNQ....SI---------
V4L6X5_9GAMM/36-111AGVI----LCTPQ----CIGSSMGGGC.YMAVAGLGLAPKALLFSGHIDSVTASGVLMA..........DI---------
E0STE4_IGNAA/29-108KDHI----LVVKR----FRGSTVGTYI.IYSLYKKGIAPKAIIMG.KPDPVVLAGAVLC..........KI---------
J0S976_9EURY/24-103AGRI----FAFPY----GKGSTVGSYV.IYALARNGKAPAAIINR.EAEPIIATGAIIA..........KI---------
L0HCV8_METFS/24-103TGTV----LAFPY----GKGSTVGSYV.LYALSRNGHAPAAIVNT.EAEAIIATGAIIG..........GI---------
F2K7K1_PSEBN/29-114AGRV----LAIPS----GRGSCTGSSV.LMELISNGHAPAALVLA.EADEILTLGVLVAQVIFQR....SL---------
A2SRL5_METLZ/24-103AGKV----LVFPY----GKGSTVGSYV.LYALAKNHVAPAAIINT.ECETIIATGAIIA..........EI---------
D9QPM4_ACEAZ/28-107NDAV----VILPG----SKGSNGWSCH.FHATKIKGTHPAAWIFT.KVDSRAGVAIAVE..........DI---------
I0A252_FERFK/24-100KDKI----LIFPN----TRGSTVGSYV.IYALKYYNNAPKAIIVE.KAEPILIAGCVLS..........GI---------
A1BBM0_PARDP/24-109AGRV----LMMPS----TRGSCTGSGV.LLDLVLSGRGPAALVFS.EPEDVVTLGALIAAEMFGK....AL---------
Y1407_METJA/24-101KGKI----FVFPY----GRGSTVGSYV.IYGLAKRGIL.KGIVNK.ECEPIVATGAILG..........GI---------
F2NF88_DESAR/29-109AGKI----IVYDT----DIFSTGGALGLYFKSRIKQTGPLALICR.RVHPISVGGAVDA..........QI---------
A8AAC4_IGNH4/35-109KNKV----LVVKG----VRGSTVGSYV.IYALRYYNNAPLAIVVEGEADPIAVAGCVMA..........KL---------
A1WKZ3_VEREI/29-113AGRV----LLMAH----AKGSSSSSSV.LAEAIRQRTGPAAIVMC.SRDLIIGVGCIVASELYGR....HV---------
R6DN34_9FIRM/25-110KGKV----FVYPE----GRGSTVGAAI.ILELARTGCAPAAIINK.NIEVITAAGGLMAKTFYDV....DI---------
Y244_METAC/27-106KGKV----LVFPH----GKGSTVGSYV.MYQLKKNGAAPVAIINL.ETEPIVAVGAIIS..........EI---------
G4RKW9_THETK/24-96SGKI----LVVPY----VRGSTVGPYV.LWHAALKGKAPLAIVAK.SVDLMLVTAAVLA..........GV---------
C5CQY5_VARPS/33-112AGKV----LVFPG----AKGSSGWSAM.FHMTRLMNSAPAAFLFN.EMTTKMALGAVVT..........HS---------
A3DM70_STAMF/25-99TGKA----LIFRG----SRGSTVGSYI.IYALRYYGKSPSCMIVE.NAEPILITGCVLS..........DT---------
D5U2S3_THEAM/26-102AGKV----LVFKG----SRGSTVGSYV.IYALRKNNVNPCCMIVK.EVEPILIAGCVLA..........GI---------
D7DTY0_METV3/29-106ANKI----FVFPT----GKGSTVGSYV.IYGLAKKGLL.KGIVNQ.DCEPIVATGAILG..........KI---------
A0RYV0_CENSY/3-82KGKI----LVFPH----GVGSSVGAYT.IYSLASHGSAPAGMVCK.KADLTVASGCALA..........NI---------
G9MVW1_HYPVG/29-114KGSI----LAIPG----GRGSCSGSGV.LLELLLSGKGPKALIFS.RREDILTLGVVVAEEIFRK....SI---------
R5C8T0_9FIRM/22-107TGKI----LCMPQ----SKGSCSSTGI.LLEMIRAGIAPSGFILC.KAEGILAMGAVIGQELYGV....DV---------
K0IIB4_NITGG/26-105KGTV----LVFPY----AVGSSVGAYA.IYSLRECGTAPSAVVCS.KADITTASGCAIA..........NI---------
G4Q6H7_ACIIR/28-104SGKI----MIFPS----GKGSSVVQADGLFQLMKENSQPKGMIVE.HPETVLVTSAILF..........EI---------
A1RYB9_THEPD/17-96SGKI----LVFPY----SKGSTVGSYI.LLRLSKRGLAPAGIVTS.SADEVTVIGCLIS..........NI---------
D2RHH9_ARCPA/24-103ANKI----FIFPH----GRGSTVGTYV.LLRMKKKGTAPKAIINI.ETEPIIAVGAIIA..........EI---------
Q161U5_ROSDO/24-106KGKI----VVLHE----LIGSSSSSAV.LLELIYRDVSPLALILG.QRDAILPMGVVVARQM.GW....ST---------
D1Z109_METPS/24-103KGTV----LVFPG----GKGSTVGSYV.IYQLKKNGVAPAAIINI.RSEPIVAVGAIIS..........DI---------
H1Z4A9_9EURY/26-105AGKV----LVFPH----GKGSTVGSYI.VYALKKNGKAPAAIVNN.EAETIIATGAIIA..........DL---------
I0HTU3_RUBGI/27-106VDRI----LVLDT----AKGGVATAWM.LHEMQSRGVVPRAIVLN.TVNPILAQGAAFG..........GV---------
I4CD99_DESTA/24-103AGRI----LVCPT----GKGGTIAPFI.AYEAMKKGNAPAAILCR.EADPILCESALAI..........DI---------
Q9I485_PSEAE/28-112HGRL----LAIPG----GRGSCTGSSV.LLELILGGRAPAAILLR.EPDEILALGAIVAEELFGR....SL---------
Q5ASV1_EMENI/24-108KDRV----LVLPS----TRGSCSGSLV.LIELLVNRVAPTALVFW.DSEAIVTTGVIVARTLLGL....SL---------
T0MXU8_9EURY/33-108KGKA----LVIPS----GKGSSVVQLDGLYQLLTHDNQPSMIVVR.DPDPVIVSAAIIC..........DV---------
A9A545_NITMS/20-99KDTI----LVFPS----GVGSSVGAYT.IYSIKSNGTAPLAMICQ.KADLTVATGCALA..........NI---------
Y1471_METBU/27-106RDKI----LVFPH----GKGSTVGSYV.IYQLKKNNVSPAAMINI.DSEPIVAVGAIIS..........DI---------
E6SD53_INTC7/25-109AGRV----LAMRS----GRGSSSSSYV.LAEQLRRGTGPLAIVLA.EPDAIIVLGALVAHELYGH....SV---------
K4LI68_THEPS/27-106KGKI----LVFPS----AKGSTGGSYM.LYDLVRNGVGPTGIVNA.EADSVVVIGAIVA..........DL---------
T0LAC7_9EURY/27-103TGKI----LAFKG----GRGSTVGSYT.FLELKSKNLAPSGLINE.TAEQMVVTGAIIS..........EI---------
F0Y7N8_AURAN/48-123TGKI----LCLPS----GRGSCTGSQV.VLELVLNGVGPTAILTR.EVDDIIALGGVVAE...........---------
H6C1P1_EXODN/31-116NQSI----LALPY----GRGSCSGSGI.VLELLLNGRGPAAFIFQ.KADPILILGIMVASLMFDK....SV---------
D4M8X2_9BACT/34-108ANKI----LALKS----GKGSSVVQVDGFYQLWGKHNLPSAIIIK.ETEPVIVSAAVMV..........GC---------
G8MK88_9BURK/24-109ASRI----LVMPR----ARGSSSSSSV.LAEALRNGTGPAGIVLA.ERDLILSIGAIVANELYAS....NV---------
B8D358_DESK1/20-96EGKI----LVFKG----SRGSTVGSYV.IYAMKQYGRSPLCMLVK.EAEPILIAGCVIA..........EI---------
Q2NHJ1_METST/26-105TDKI----LVIPS----GKGSTVGSYV.IYQMAKNNTAPRAIICQ.KAEPIIAIGAIIS..........KI---------
B4EMJ9_BURCJ/30-115AGKV----MVMPH----AKGSSSSSSV.LAEAVRNGTGPVGIVLK.ERDLIISIGAIVAAELYAI....AV---------
Q5LVT9_RUEPO/21-101AGAV----VMMPT----SRGSCSGSGV.LLALALNGHAPAALVFR.EGEDVLTLGALVAAWMYDR......---------
E3GYB3_METFV/22-101KNKI----LIIPG----GKGSTVGSYV.LYQLAKNKTAPAGIICI.KAEPIVAVGAIIA..........KI---------
R9T678_9EURY/24-101KDRV----FAFPR----GKGSTVGSYV.IYDMKEHGTLPAAIINE.SAEPIVATGAVMA..........SV---------
S5Y6N5_PARAH/21-106AGRV----VMMPT----SRGSCTGSGV.LLELILSGHAPAALVFS.GPEDILTLGAMIADRLFGN....AL---------
F7PH92_9EURY/36-115AGKV----LVFPR----GKGSTVGSYV.LYGLANNGCAPAAIVNE.ETETIVATGAILG..........EI---------
A6WUT6_OCHA4/26-109AGRV----LCLPG----TIGSSSAAAV.LLELVHSGHAPAAIVLH.EPDAILLLGLIVAREM.GH....DV---------
Y1530_METTH/24-103RGKV----LLIPG----GKGSTVGSYV.IFQMAKNETAPAAIICL.NAEPIIATGAIMA..........GI---------
C7Z030_NECH7/44-129QGKA----FALRK----GRGSCASSAV.ILELLYIGKAPSALIFR.EMDPILLLGILLAGALYSK....SI---------
A1WSP8_VEREI/25-104VDRI----LILDT----AKGGVASAWM.LHEMKSRHMAPKAIVFN.TVNTILAQGAALG..........GI---------
R7FFK0_9FIRM/29-104AGKI----LVFPN----GKGSSVVQADGMYQLKMTGMEPKAMIIQ.NPDTTLVASAIIM..........EE---------
B8NAM4_ASPFN/24-109AGRV----LAIPC----GRGSCSGSTV.MLELLLNGCAPAALIFE.KPEQILTLGVLVGKVLLDC....PI---------
M9SG65_9EURY/24-98AEKV----FLFPN----GKGSTVGSYV.VYDLKVQGHAPLALVNR.SAETIVTTGAVIS..........SV---------
Q7VV68_BORPE/16-95SDCV----LILLS----SKGSSGTSGM.LSLATRAGHAPAAMIQV.EMDPVTVMGCLVN..........NI---------
G7XQK1_ASPKW/28-113EGRI----LAIPG----GRGSCSGSGV.MLELLLNNRGPKAILFE.RREDILTLGVMVAEEMFGR....AI---------
B6JEQ3_OLICO/33-109KDKI----LIYDT----DYYTTGATLSLYTKKTVFNSAPAGIIWR.KAHGIGASGAIYS..........GI---------
A9CH00_AGRT5/32-117TGGV----LFMPT----SRGSCTGSGV.LLDLILTGRAPSALVFC.EAEDVLTLGALVAAEMFDK....AL---------
T0KFW4_COLGC/27-111KGKV----LAIPC----GRGSCSGSGA.LLELILTGNAPSALIFQ.EPEMILTLGVMVADTMFDR....RI---------
F5XKR9_MICPN/38-123SGKI----LALPS----GRGSCSGSGA.IFEMLLGGTAPAALVFS.QRESILTLGVVIASELFDR....TI---------
Y055_ARCFU/24-102AGRI----LVFPG----GKGSTVGSYV.LLNLRKNGVAPKAIINK.KTETIIAVGAAMA..........EI---------
Q13MZ8_BURXL/43-128AGKI----MVMPR----AKGSSSSSSV.LAEAIRNGTGPSGIVLR.ERDLIISIGVIVANELYGV....SV---------

PF06434

Q7CVQ5_AGRT5/175-406KKLGEDGKPILNNDGNPIL.EQKYSVETGT..VLKID..AKNRKLRD.....ENGTE.LVDLASSFTPQKM.EFMKAGSS
A1TPA0_ACIAC/168-382................PIE.VDVSKLEMGD..VIDVL..PYEGKLVR......NGE...TVAEFQLKSDVLLDEVRAGGR
A5WDW0_PSYWF/168-383................PIENVAVDNINMGD..VFDVY..PYEGKITK....HDSDE...VLSTFKLNSNTLLDEVRAGGR
A5GFC4_GEOUR/167-371................PLK.ADVTKMNTGD..VIIID..TVKGEIKS.....EGGE...LLSTFKINPNTLADEFQAGGR
Q7V3U1_PROMM/169-377................PIE.CDVSQLQSGD..VITIR..PHAGTIERAFGEDKAGE...IVAHFKLKPITISDEVRAGGR
Q8DL06_THEEB/174-377................PIE.CDVSQMTMGD..VITIY..PYRGEITN.....EAGD...VISRFTLKPDTLLDEVRAGGR
Q118H1_TRIEI/169-372................PIE.CDVTKMETGM..VITIY..PYKGEIIN.....EAGE...IISTFTLKPETMLDEVRAGGR
Q2SK45_HAHCH/194-401................PFE.CDVSQMNMGD..VIEIL..PFEGKVKN....HETGE...VIGEFELKSDVLLDEVRAGGR
Q1QVU9_CHRSD/173-387................PIE.MDVEKLEMGD..VIDVY..PYEGKVCK....HGTDE...VLTTFELKTQLLLDEARAGGR
Q65PY4_MANSM/171-385................PIE.VDVSALNMGD..VIDIY..PYAGKICV....HNTDQ...VLAEFSLKTDVLLDEVQAGGR
A8EUS0_ARCB4/171-373................PIQ.ANVDSIDTGD..VITLK..PYAGVIEK......DGK...VVSEFKLAPNTLTDEMRAGGR
ACON2_HELPY/171-373................PIV.ADVKDLKEGD..LIKIY..PYKGEITL......NDK...VVSTFKLEPETLLDEVRASGR
Q1H0A3_METFK/167-370................PIQ.CDVSAMSTGD..VIAVR..PYDGKVLN.....AAGE...EIARFELAPLTMPDEVRAGGR
Q3A2K3_PELCD/167-371................PIH.AEVDKLEHGA..EVTIE..PLSGRILD.....SAGK...LLTSFELAPNTLPDEYQAGGR
Q6F9U3_ACIAD/168-384................PVE.IDVANMNMGDEIVLKID..HAAAKVTA....FKNGE...QIAESELKTPVLLDEVRAGGR
Q2IQ71_ANADE/167-371................PIR.TDVTKLKTGD..VVVID..TKKGEVRT.....EQGE...VLSTFKLEPVTVPDEFRAGGR
A0L7Y2_MAGSM/188-390................PIQ.CDVTGMNTGD..VITIN..TKTGEITR......DGA...VLSTFELKPNTLADEVRAGGR
Q12Z08_METBU/167-371................PLQ.MDISKLQHGD..IITIN..TVKGEVTD.....EEGN...VLSTLYLNPNTLPDEYRAGGR
Q604Q3_METCA/168-375................PIE.CDVTAMQTGD..VIDIH..PYEGVLRN....HESGV...ELCRFTLKTEILLDEVRAGGR
Q01EA0_OSTTA/235-442................PLE.MDVTGINMGD..ILDIF..PYERVVKK....HGTDV...VISTFSLKSDVLFDEVQAGGR
Q7VFE0_HELHP/176-382................PIV.ADVSELKDGD..IIEID..TLKGEIIK......EGK...IVATFKLNPITLADEIRSGGR
Q2JL67_SYNJB/170-373................PIQ.CDVSRLETGM..VVTIC..PYEGVIRS.....EAGQ...VLSTFSLRPVTLPDEVRAGGR
Q15QA4_PSEA6/168-382................VFE.ADVDNMNMGD..VIDIF..PLEGRITN....AETGA...ELAKYEYKSDVLLDEVRAGGR
B4S6I7_PROA2/171-373................PIQ.ADVNAMETGD..VIDLY..PYEGKIEK......NGE...VIAEFTLEPNTLADEVRAGGR
Q31GI6_THICR/169-372................PIE.CDVEQLNTGD..VITIH..PYDGKITN.....EAGE...TVSTFELAPDTMPDEVRAGGR
Q3AR28_CHLCH/171-373................PIQ.ADVNALEMGD..VIEVN..LIEGTISK......DGA...VVSRFELSPNTIGDEVRAGGR
A1U1S2_MARAV/173-386................VFE.APVDNMNMGD..VIEIR..PYEGKILN.....EAGE...TISEFKFKSDVILDEVQAGGR
A0RPN0_CAMFF/169-372................PIV.VNVDGLEMGD..KIEIY..PYKGEIAK......DSK...VVKTFKLEPNTLKDEVKAGGR
A4SXE4_POLSQ/168-380................PIE.LDVSQMNMGD..EIELR..PYEGKVFK......DGK...EITSFSLKSPVILDEVRAGGR
A1AXP1_RUTMC/165-368................PIE.CDVTKMQMGN..EITIY..PFEGKITD.....SNNE...TISTFELSPTTLSDEVRAGGR
Q5P0Q1_AROAE/172-388................PIE.LDCGQLDMGD..EIELKVDAASGQVTA....LKNGA...VVSESQLKTLVILDEVRAGGR
Q30RR3_SULDN/171-373................PLE.LDVSEMETGD..VITIY..PYKGEAHK......DGK...CIATFKLNPNTITDEVRAGGR
Q0VQ99_ALCBS/168-380................PFE.CDVEKMNTGD..VIDVY..PFEGKVEK......DGE...VIAEFNLRSQVLLDEVRAGGR
Q7V9G7_PROMA/170-374................PIE.CDVSKLRTGD..VITIH..PYEGKIER....YENGE...NIASFELKPSTILDEIQAGGR
A6VKR8_ACTSZ/171-385................PLE.LDVTALNMGD..VIDVY..PYERKICK....HGCQE...VLATFNYKTEGLLDEVRAGGR
F2GA07_ALTMD/175-406KKTDENGEIVRDANGDPVL.EEAYSVATGT..VLTID..TKAKKLF.......NGSEELADVSASFTPQKM.EFMKAGGS
Q7M959_WOLSU/170-372................PIV.ADASKLNEGD..VIALY..PYEGRIEK......AGE...GVATFNLTPNTLSDEIRAGGR
A7I373_CAMHC/170-373................PII.ANVDNLNTGD..EIEIY..PLKGEIKK......AGK...VVSKFRLIPNTIEDEIRTGGR
Q47UT3_COLP3/168-380................PIE.LDVQKMNMGD..IIDIY..PYEGVVKN.....AAGD...VISEFTL.SPVLLDEVRAGGR
A6Q381_NITSB/171-374................PIE.APVDNLETGD..VIEIR..PYEGKILK......NGE...VVSEFKLKPNTLPDEYRAGGR
A1APN5_PELPD/168-373................PIR.AEVGALSTGD..LIVVD..TVRGIISD.....EQGA..NVLSRFSLAPATLADEFRAGGR
A1SYN8_PSYIN/168-382................PIE.MDVSKLNTGD..VIDIY..PHQGVVKN....NATGE...VITEFQLKTNIILDEVRAGGR
Q3J9D3_NITOC/167-370................PIE.CQVEGLNTGD..TVRIR..PFEGTVLS.....EAGK...ELSRFKLRPSTLPDEVRAGGR
A7ZDV7_CAMC1/178-384................PIA.ANVNELEMGD..EIEIY..PFKGEIYK.....LAGAQKKLVANFKLSPNTLSDEIRAGGR
B2UJ92_RALPJ/168-380................PIE.LDVSQMNMGD..VVELR..PYEGKALK......DGK...VIAEFQVKSDVLFDEVRAGGR
D4ZEL2_SHEVD/169-382................PIE.LDVTKMDMGD..VIDIY..PYQGIVKR....HDSDE...VISEFSLKTAVLMDEVRAGGR
H8XVL5_FLAIG/175-405KKTDENGEVVRGENGEPVL.EQKYSVATGT..VLTIN..TKTKKLYN.....GDQE..LIDISRSFTPQKM.EFIKAGGS
ACON2_ECOLI/168-382................PIE.VDVSNLNMGD..VIDVY..PYKGEVRN....HETGE...LLATFELKTDVLIDEVRAGGR
Q0PA55_CAMJE/167-368................PII.CDVTNLEMGD..EFEIH..PYEGKIIK......NGS...TIAEFTLSPNTLLDEVRAGGR
Q31PT6_SYNE7/169-372................PIE.CDVSALDTGM..VVTIY..PYEGVIKD.....EAGT...VLSTFSLKPDTILDEVRAGGR
Q3IJ30_PSEHT/183-397................PIE.LNVDELNMGE..QIDIY..PYEGVVKQ....HGTDK...VISKFELKSEVILDEVRAGGR
Q46I80_PROMT/170-378................PIE.CDVSNLKTGD..VITIF..PYKGEVRRSKNETNSGE...LLSKFDLKPQTITDEVRAGGR
Q5R023_IDILO/169-374................VFE.ADVEKMNMGD..VITIY..PYEGKIEN.....EAGE...IIAEYDYASRVILDEVRAGGR

PF00694

ACON_LEGPH/689-819----------------PLQ-------------------------------------------------------------
ACOC_HUMAN/692-821----------------PLE-------------------------------------------------------------
LEUD_HAEIN/1-126----------------PIR-------------------------------------------------------------
ACON_YEAST/579-709----------------PLN-------------------------------------------------------------
LEUC_YEAST/545-672----------------PIR-------------------------------------------------------------
LEUD_LACLA/1-124----------------PIK-------------------------------------------------------------
LYS4_YEAST/484-620----------------TLE-------------------------------------------------------------
ACON2_YEAST/585-714----------------PLT-------------------------------------------------------------
LEUC_USTMA/542-667----------------PVV-------------------------------------------------------------
ACON_BOVIN/582-712----------------PLT-------------------------------------------------------------
G3WYV5_SARHA/77-203----------------PLQ-------------------------------------------------------------
M0Y4D6_HORVD/248-376----------------PMC-------------------------------------------------------------
ACON1_ECOLI/691-818----------------PLE-------------------------------------------------------------

PF01989

N0BD57_9EURY/24-103----------------PLV-------------------------------------------------------------
Y208_METTP/24-103----------------PLV-------------------------------------------------------------
R6ESJ9_9FIRM/32-113----------------PVV-------------------------------------------------------------
B8GKJ6_METPE/22-101----------------PMV-------------------------------------------------------------
G2IKN6_9SPHN/33-107----------------P..-------------------------------------------------------------
B7G3A0_PHATC/35-110----------------...-------------------------------------------------------------
Q0CKP1_ASPTN/22-107----------------PVL-------------------------------------------------------------
B8LC13_THAPS/7-95----------------PI.-------------------------------------------------------------
A8MB53_CALMQ/29-105----------------PLV-------------------------------------------------------------
Q2FUD8_METHJ/24-103----------------PMI-------------------------------------------------------------
Y1486_METKA/29-108----------------PLF-------------------------------------------------------------
A2BN86_HYPBU/27-100----------------PLA-------------------------------------------------------------
H3ZRB4_THELN/24-103----------------PMV-------------------------------------------------------------
C3M8X0_RHISN/26-111----------------PVV-------------------------------------------------------------
B8MWK8_ASPFN/33-108----------------...-------------------------------------------------------------
Y391_PYRFU/24-103----------------PLV-------------------------------------------------------------
R9SH15_9EURY/23-102----------------PMV-------------------------------------------------------------
D5EER2_AMICL/28-106----------------PTV-------------------------------------------------------------
Q4W903_ASPFU/24-109----------------PVL-------------------------------------------------------------
I3TCQ9_THEC1/24-98----------------PLF-------------------------------------------------------------
Q8ZVK7_PYRAE/23-95----------------PLF-------------------------------------------------------------
A3CV39_METMJ/22-101----------------PMI-------------------------------------------------------------
M4WRD4_PSEDE/16-101----------------PVL-------------------------------------------------------------
Q2FQH8_METHJ/31-111----------------PAV-------------------------------------------------------------
D5WW29_KYRT2/36-110----------------PMV-------------------------------------------------------------
Q7VS11_BORPE/26-105----------------PIM-------------------------------------------------------------
D9PZT3_ACIS3/25-98----------------PLV-------------------------------------------------------------
E1QPZ0_VULDI/25-99----------------PIM-------------------------------------------------------------
D3S160_FERPA/24-103----------------PLV-------------------------------------------------------------
R7QWM0_9FIRM/30-105----------------PMV-------------------------------------------------------------
Q7VVN5_BORPE/29-108----------------PIM-------------------------------------------------------------
F7XP83_METZD/27-106----------------PLV-------------------------------------------------------------
Q98JX5_RHILO/33-118----------------PLV-------------------------------------------------------------
L0AAW5_CALLD/24-97----------------PLI-------------------------------------------------------------
E3GEU4_EUBLK/27-106----------------PAV-------------------------------------------------------------
I4BZ52_ANAMD/35-109----------------VLV-------------------------------------------------------------
E3CXQ7_9BACT/34-108----------------PMV-------------------------------------------------------------
Y2089_AERPE/26-99----------------PLY-------------------------------------------------------------
F6D7R3_METSW/27-106----------------PMV-------------------------------------------------------------
D7A451_STAND/26-105----------------PLV-------------------------------------------------------------
K0R0F5_THAOC/21-104----------------RDD-------------------------------------------------------------
M1FJI6_9ALTE/70-152----------------...-------------------------------------------------------------
S0DMB2_GIBF5/30-115----------------PVV-------------------------------------------------------------
V4L6X5_9GAMM/36-111----------------...-------------------------------------------------------------
E0STE4_IGNAA/29-108----------------PIV-------------------------------------------------------------
J0S976_9EURY/24-103----------------PMI-------------------------------------------------------------
L0HCV8_METFS/24-103----------------PMI-------------------------------------------------------------
F2K7K1_PSEBN/29-114----------------PVV-------------------------------------------------------------
A2SRL5_METLZ/24-103----------------PTV-------------------------------------------------------------
D9QPM4_ACEAZ/28-107----------------PAV-------------------------------------------------------------
I0A252_FERFK/24-100----------------PLA-------------------------------------------------------------
A1BBM0_PARDP/24-109----------------PVL-------------------------------------------------------------
Y1407_METJA/24-101----------------PLV-------------------------------------------------------------
F2NF88_DESAR/29-109----------------PAV-------------------------------------------------------------
A8AAC4_IGNH4/35-109----------------PLV-------------------------------------------------------------
A1WKZ3_VEREI/29-113----------------PI.-------------------------------------------------------------
R6DN34_9FIRM/25-110----------------PMV-------------------------------------------------------------
Y244_METAC/27-106----------------PLV-------------------------------------------------------------
G4RKW9_THETK/24-96----------------PLF-------------------------------------------------------------
C5CQY5_VARPS/33-112----------------PSM-------------------------------------------------------------
A3DM70_STAMF/25-99----------------PLF-------------------------------------------------------------
D5U2S3_THEAM/26-102----------------PLF-------------------------------------------------------------
D7DTY0_METV3/29-106----------------PLV-------------------------------------------------------------
A0RYV0_CENSY/3-82----------------PLY-------------------------------------------------------------
G9MVW1_HYPVG/29-114----------------PVV-------------------------------------------------------------
R5C8T0_9FIRM/22-107----------------PVY-------------------------------------------------------------
K0IIB4_NITGG/26-105----------------PVV-------------------------------------------------------------
G4Q6H7_ACIIR/28-104----------------PMV-------------------------------------------------------------
A1RYB9_THEPD/17-96----------------PMM-------------------------------------------------------------
D2RHH9_ARCPA/24-103----------------PLM-------------------------------------------------------------
Q161U5_ROSDO/24-106----------------P..-------------------------------------------------------------
D1Z109_METPS/24-103----------------PMV-------------------------------------------------------------
H1Z4A9_9EURY/26-105----------------PMV-------------------------------------------------------------
I0HTU3_RUBGI/27-106----------------TLL-------------------------------------------------------------
I4CD99_DESTA/24-103----------------PML-------------------------------------------------------------
Q9I485_PSEAE/28-112----------------PI.-------------------------------------------------------------
Q5ASV1_EMENI/24-108----------------PV.-------------------------------------------------------------
T0MXU8_9EURY/33-108----------------PIV-------------------------------------------------------------
A9A545_NITMS/20-99----------------PLV-------------------------------------------------------------
Y1471_METBU/27-106----------------PLV-------------------------------------------------------------
E6SD53_INTC7/25-109----------------PVV-------------------------------------------------------------
K4LI68_THEPS/27-106----------------PMV-------------------------------------------------------------
T0LAC7_9EURY/27-103----------------PMV-------------------------------------------------------------
F0Y7N8_AURAN/48-123----------------...-------------------------------------------------------------
H6C1P1_EXODN/31-116----------------PVL-------------------------------------------------------------
D4M8X2_9BACT/34-108----------------TMV-------------------------------------------------------------
G8MK88_9BURK/24-109----------------PVV-------------------------------------------------------------
B8D358_DESK1/20-96----------------PLL-------------------------------------------------------------
Q2NHJ1_METST/26-105----------------PMV-------------------------------------------------------------
B4EMJ9_BURCJ/30-115----------------PVV-------------------------------------------------------------
Q5LVT9_RUEPO/21-101----------------...-------------------------------------------------------------
E3GYB3_METFV/22-101----------------PLV-------------------------------------------------------------
R9T678_9EURY/24-101----------------PMV-------------------------------------------------------------
S5Y6N5_PARAH/21-106----------------PVL-------------------------------------------------------------
F7PH92_9EURY/36-115----------------PCV-------------------------------------------------------------
A6WUT6_OCHA4/26-109----------------PI.-------------------------------------------------------------
Y1530_METTH/24-103----------------PMV-------------------------------------------------------------
C7Z030_NECH7/44-129----------------PVV-------------------------------------------------------------
A1WSP8_VEREI/25-104----------------ALL-------------------------------------------------------------
R7FFK0_9FIRM/29-104----------------PLV-------------------------------------------------------------
B8NAM4_ASPFN/24-109----------------PVV-------------------------------------------------------------
M9SG65_9EURY/24-98----------------PMV-------------------------------------------------------------
Q7VV68_BORPE/16-95----------------PLL-------------------------------------------------------------
G7XQK1_ASPKW/28-113----------------PVI-------------------------------------------------------------
B6JEQ3_OLICO/33-109----------------PAV-------------------------------------------------------------
A9CH00_AGRT5/32-117----------------PVI-------------------------------------------------------------
T0KFW4_COLGC/27-111----------------PV.-------------------------------------------------------------
F5XKR9_MICPN/38-123----------------PVV-------------------------------------------------------------
Y055_ARCFU/24-102----------------PLV-------------------------------------------------------------
Q13MZ8_BURXL/43-128----------------PLV-------------------------------------------------------------

PF06434

Q7CVQ5_AGRT5/175-406YAIVFGKKLQTFAAQTLGVEATQVFAPNKEISI.EGQGL
A1TPA0_ACIAC/168-382INLIIGRSLTAKAREFLGLPASTAFRLPQAPAE.SKAGF
A5WDW0_PSYWF/168-383IPLIVGRALTNRAREYMGLEHSDVFAKPEQPAS.SDKGF
A5GFC4_GEOUR/167-371IPLIIGRALTDRARNALGMGATDVFTLPVNPVPKAGQGY
Q7V3U1_PROMM/169-377ISLLIGRALTDKVRSQFGLSTSDLFVRPGDTPE.TGKGY
Q8DL06_THEEB/174-377ILLLIGRTLTDKARSALGLEPSPLFTRPKPPVD.SSKGY
Q118H1_TRIEI/169-372IPLLIGRTLTDKTRNILGLETSSVFTRPQLPTD.TGKGF
Q2SK45_HAHCH/194-401IPLIIGRGLTDKAREAMGLAPSDVFRRPQAAND.SGKGF
Q1QVU9_CHRSD/173-387IPLIIGRGLTAKARESLGLAPSDVFRLPEQPAD.TGRGF
Q65PY4_MANSM/171-385IPLIIGRGLTHKARLALGLNESEIFKKPQAVQA.SEKGY
A8EUS0_ARCB4/171-373IPLIIGKGLTAKARAALGLGASTAFIAPEQPAN.NGKGY
ACON2_HELPY/171-373IPLIIGRGLTNKARKFLGLGESEAFKKPSAPKS.DAKGY
Q1H0A3_METFK/167-370IPLIVGRGLTNNARQLLGLPPSDLFIQPIMPQD.TGKGY
Q3A2K3_PELCD/167-371IPLIIGRSLTERARKVLKVEPADFFTLPDNPVPQPDQGY
Q6F9U3_ACIAD/168-384INLIVGRGLTTKAREALGLEPSTLFRTPVQPAA.TGKGF
Q2IQ71_ANADE/167-371IPLIIGRALTDKARKALGLKEIDLFAVAKNPQPKAGQGY
A0L7Y2_MAGSM/188-390VNLIIGRKLTTQARDALGLGPIKLFTDPEQPAD.SGKGY
Q12Z08_METBU/167-371IPLIIGRSLTTRTREVLGLPETDIFVKPDNPIPEPGQAY
Q604Q3_METCA/168-375INLIIGRGLTDRARKVLGLPPSEVFRRPRAPIE.TGKGY
Q01EA0_OSTTA/235-442IPLIIGRGLTAKARSALKMEPSSTFRLPCIPDA.TVKGF
Q7VFE0_HELHP/176-382IPLIIGRGLSARAREYLKLGKSDVFKEAKQPAQ.STKGY
Q2JL67_SYNJB/170-373IPLLIGRALTDKTRQALGLPPSTLFIRPTPPAD.TGKGY
Q15QA4_PSEA6/168-382INLIIGRGLTEKARESLGLGASDLFRKPDQPAD.TGKGY
B4S6I7_PROA2/171-373IPLIIGRTLTRQAREALGLGEADVFKAPDQPAD.SGKGY
Q31GI6_THICR/169-372VPLIIGRGLTDKSREALGLEPSNVFIRPTDKSQ.ADYGY
Q3AR28_CHLCH/171-373IPLIIGRTLTRKARTALGMGDDTLFVRPEQPAD.SGKGY
A1U1S2_MARAV/173-386IPLIIGRGLTNKARQALGMGATDIFRLPKDPEA.GDKGF
A0RPN0_CAMFF/169-372IPLIIARSLCSKARAELGLGNEDIFIKPSQPANNDNSGY
A4SXE4_POLSQ/168-380IPLIIGRGLTAKARAALGLPASTEFRLPVNPVD.NKKGF
A1AXP1_RUTMC/165-368IPLIIGRGLTDRTRQDLGLPISTTFLRPKDVTQ.NNIGY
Q5P0Q1_AROAE/172-388IPLIIGRGLTAKAREALGLPVSTLFRLPQAPAD.SGKGF
Q30RR3_SULDN/171-373IPLIIGRGLTSKARGVLGLGASDKFLTAEQPAD.SGKGY
Q0VQ99_ALCBS/168-380INLIIGRGLTTKAREALGLAPSELFRKPEQPGD.SDKGF
Q7V9G7_PROMA/170-374IPLLIGRALTDKVREKLGLEPIDIFIRPGKQTD.NCHGF
A6VKR8_ACTSZ/171-385IPLIIGRSLTAKARAELGLPESDVFVKAPEMPD.TGKGF
F2GA07_ALTMD/175-406YAVVFGKQLQSFAARTLGVEAPAVYAQSKEVSH.EGQGL
Q7M959_WOLSU/170-372INLIIGRGLTAKAQEALGIKEDDLFIKPQNPQG.KARGF
A7I373_CAMHC/170-373IPLIIARSLCVKAREFLKLPTENIFTKPEQPKSNENEGY
Q47UT3_COLP3/168-380IPLIIGRGLTGRAREALGLPEADLFAKQVAVTD.TGKGF
A6Q381_NITSB/171-374IPMIIGRGLTRKARAALGMPEEDFFTRPEQPEGKEGVGY
A1APN5_PELPD/168-373IPLIIGRALTDRARSFLGLPGSTLFTLPDNPVPEPGQGF
A1SYN8_PSYIN/168-382IPLIIGRGLTDRARKSLGLETSTVFQLPVEVKP.STKGY
Q3J9D3_NITOC/167-370IPLIIGRGLTDKTRQTLGLNPSPLFIRPVAPTA.SGKGY
A7ZDV7_CAMC1/178-384IPLMIGRQVTKKAREALGLGEEQIFIKPDQPKE.QGGGY
B2UJ92_RALPJ/168-380IPLIIGRGLTAKAREALGLAPSTLFRLPHQPAD.SGKGF
D4ZEL2_SHEVD/169-382IPLIIGRGLTARARAVLKLEDSKVFVLPKDVAD.TGKGY
H8XVL5_FLAIG/175-405YAIVFGKKIQTFAAKTLGIEAPVVFAPSKEISN.EGQGL
ACON2_ECOLI/168-382IPLIIGRGLTTKAREALGLPHSDVFRQAKDVAE.SDRGF
Q0PA55_CAMJE/167-368IPLIIGRGLCTKAREFLGMESENIFTKPEQPKS.SSGGY
Q31PT6_SYNE7/169-372IPLLIGRSLTDKVRSQLGLPVSDVFVRPQPPAD.TGKGF
Q3IJ30_PSEHT/183-397IPLIIGRGLTDKARTSLGLGATDIFKVPTATEV.SDKGF
Q46I80_PROMT/170-378IPLMIGRALTDKVRTKLKLPPSTLFIRPGQPPA.SKYGF
Q5R023_IDILO/169-374INLIIGRGLTEKARESLGMGPSDLFRKPEQPAD.SGKGF

PF00694

ACON_LEGPH/689-819-----------------------------FKEG------
ACOC_HUMAN/692-821-----------------------------YLPG------
LEUD_HAEIN/1-126-----------------------------LSEE------
ACON_YEAST/579-709-----------------------------FKNP------
LEUC_YEAST/545-672-----------------------------LDQQ------
LEUD_LACLA/1-124-----------------------------QPRE------
LYS4_YEAST/484-620-----------------------------IPAL------
ACON2_YEAST/585-714-----------------------------FANE------
LEUC_USTMA/542-667-----------------------------LSRA------
ACON_BOVIN/582-712-----------------------------FADP------
G3WYV5_SARHA/77-203-----------------------------FL..------
M0Y4D6_HORVD/248-376-----------------------------FKA.------
ACON1_ECOLI/691-818-----------------------------FPQ.------

PF01989

N0BD57_9EURY/24-103---------------------------------------
Y208_METTP/24-103---------------------------------------
R6ESJ9_9FIRM/32-113---------------------------------------
B8GKJ6_METPE/22-101---------------------------------------
G2IKN6_9SPHN/33-107---------------------------------------
B7G3A0_PHATC/35-110---------------------------------------
Q0CKP1_ASPTN/22-107---------------------------------------
B8LC13_THAPS/7-95---------------------------------------
A8MB53_CALMQ/29-105---------------------------------------
Q2FUD8_METHJ/24-103---------------------------------------
Y1486_METKA/29-108---------------------------------------
A2BN86_HYPBU/27-100---------------------------------------
H3ZRB4_THELN/24-103---------------------------------------
C3M8X0_RHISN/26-111---------------------------------------
B8MWK8_ASPFN/33-108---------------------------------------
Y391_PYRFU/24-103---------------------------------------
R9SH15_9EURY/23-102---------------------------------------
D5EER2_AMICL/28-106---------------------------------------
Q4W903_ASPFU/24-109---------------------------------------
I3TCQ9_THEC1/24-98---------------------------------------
Q8ZVK7_PYRAE/23-95---------------------------------------
A3CV39_METMJ/22-101---------------------------------------
M4WRD4_PSEDE/16-101---------------------------------------
Q2FQH8_METHJ/31-111---------------------------------------
D5WW29_KYRT2/36-110---------------------------------------
Q7VS11_BORPE/26-105---------------------------------------
D9PZT3_ACIS3/25-98---------------------------------------
E1QPZ0_VULDI/25-99---------------------------------------
D3S160_FERPA/24-103---------------------------------------
R7QWM0_9FIRM/30-105---------------------------------------
Q7VVN5_BORPE/29-108---------------------------------------
F7XP83_METZD/27-106---------------------------------------
Q98JX5_RHILO/33-118---------------------------------------
L0AAW5_CALLD/24-97---------------------------------------
E3GEU4_EUBLK/27-106---------------------------------------
I4BZ52_ANAMD/35-109---------------------------------------
E3CXQ7_9BACT/34-108---------------------------------------
Y2089_AERPE/26-99---------------------------------------
F6D7R3_METSW/27-106---------------------------------------
D7A451_STAND/26-105---------------------------------------
K0R0F5_THAOC/21-104---------------------------------------
M1FJI6_9ALTE/70-152---------------------------------------
S0DMB2_GIBF5/30-115---------------------------------------
V4L6X5_9GAMM/36-111---------------------------------------
E0STE4_IGNAA/29-108---------------------------------------
J0S976_9EURY/24-103---------------------------------------
L0HCV8_METFS/24-103---------------------------------------
F2K7K1_PSEBN/29-114---------------------------------------
A2SRL5_METLZ/24-103---------------------------------------
D9QPM4_ACEAZ/28-107---------------------------------------
I0A252_FERFK/24-100---------------------------------------
A1BBM0_PARDP/24-109---------------------------------------
Y1407_METJA/24-101---------------------------------------
F2NF88_DESAR/29-109---------------------------------------
A8AAC4_IGNH4/35-109---------------------------------------
A1WKZ3_VEREI/29-113---------------------------------------
R6DN34_9FIRM/25-110---------------------------------------
Y244_METAC/27-106---------------------------------------
G4RKW9_THETK/24-96---------------------------------------
C5CQY5_VARPS/33-112---------------------------------------
A3DM70_STAMF/25-99---------------------------------------
D5U2S3_THEAM/26-102---------------------------------------
D7DTY0_METV3/29-106---------------------------------------
A0RYV0_CENSY/3-82---------------------------------------
G9MVW1_HYPVG/29-114---------------------------------------
R5C8T0_9FIRM/22-107---------------------------------------
K0IIB4_NITGG/26-105---------------------------------------
G4Q6H7_ACIIR/28-104---------------------------------------
A1RYB9_THEPD/17-96---------------------------------------
D2RHH9_ARCPA/24-103---------------------------------------
Q161U5_ROSDO/24-106---------------------------------------
D1Z109_METPS/24-103---------------------------------------
H1Z4A9_9EURY/26-105---------------------------------------
I0HTU3_RUBGI/27-106---------------------------------------
I4CD99_DESTA/24-103---------------------------------------
Q9I485_PSEAE/28-112---------------------------------------
Q5ASV1_EMENI/24-108---------------------------------------
T0MXU8_9EURY/33-108---------------------------------------
A9A545_NITMS/20-99---------------------------------------
Y1471_METBU/27-106---------------------------------------
E6SD53_INTC7/25-109---------------------------------------
K4LI68_THEPS/27-106---------------------------------------
T0LAC7_9EURY/27-103---------------------------------------
F0Y7N8_AURAN/48-123---------------------------------------
H6C1P1_EXODN/31-116---------------------------------------
D4M8X2_9BACT/34-108---------------------------------------
G8MK88_9BURK/24-109---------------------------------------
B8D358_DESK1/20-96---------------------------------------
Q2NHJ1_METST/26-105---------------------------------------
B4EMJ9_BURCJ/30-115---------------------------------------
Q5LVT9_RUEPO/21-101---------------------------------------
E3GYB3_METFV/22-101---------------------------------------
R9T678_9EURY/24-101---------------------------------------
S5Y6N5_PARAH/21-106---------------------------------------
F7PH92_9EURY/36-115---------------------------------------
A6WUT6_OCHA4/26-109---------------------------------------
Y1530_METTH/24-103---------------------------------------
C7Z030_NECH7/44-129---------------------------------------
A1WSP8_VEREI/25-104---------------------------------------
R7FFK0_9FIRM/29-104---------------------------------------
B8NAM4_ASPFN/24-109---------------------------------------
M9SG65_9EURY/24-98---------------------------------------
Q7VV68_BORPE/16-95---------------------------------------
G7XQK1_ASPKW/28-113---------------------------------------
B6JEQ3_OLICO/33-109---------------------------------------
A9CH00_AGRT5/32-117---------------------------------------
T0KFW4_COLGC/27-111---------------------------------------
F5XKR9_MICPN/38-123---------------------------------------
Y055_ARCFU/24-102---------------------------------------
Q13MZ8_BURXL/43-128---------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window