Sequence alignment for CL0366

PF15659

D3IMU4_9BACT/335-480NSEGKMYF...WRKTDARTTHRVFSGK.....KSITV.NKTLV...NQLVS..NATLNG.......TSA....TISDSE-
D3IMY5_9BACT/92-252NDFNTIFA....YDGQGGIDKNTKIDVPKS..FNESKTTTQVQ...GRTSK....DADG...NKISTYEFDLYTVDDEQ-
D1PWX0_9BACT/114-279NKQGKIVK.....HIKTDKHDAFYIVNYRG..KRIRGKSISFT...YGTVE.KATGQKND..RGL.LYDV..YQVRGDK-
G9S3Z7_9PORP/207-377NNKGRVVN.....HIETTEHDAFYMVDK....KGIRIKDKELIFKYGTVES..FKSQYSD..MAKTSFDW..YNIRGDS-
C6IIY2_9BACE/879-1045RKTDRIVD....VLYASGINSSQKATQPDPNWKSIRVFDKSML...QGLTA..SKGEKGRDYWDRKLYT....TTNSVY-
D0TNF7_9BACE/83-238NSAGRLFK....TVVEGSTNDRLMSIRSGV..ESITVNDKKIL...SGMYN.MQDGKSG....GLETYN....STSSLE-
E4RWK9_LEAB4/231-388KKTDDDFD....TITSTKKPD...........KSITV.AKGVL...NKVVD.VNQTNFS....YNDAHEI..FVTGNNS-
C6IJD1_9BACE/48-220.RSGRLFNETPIDKRGKGSTDNLYLSSDRS..ISVTV.NQGLL...GEMHSMQAKEQKEN..RVKKSYG....STQDLE-
I0TCD6_9BACT/325-474NKNGQISF...WRRTNAKTTDRIFSGK.....SHILI.NKGLA...SQLVK..NQTRNG.......TIA....LTNKSD-
E2NN46_9BACE/59-211.KGDRVY......YFDGEHKPKQVSGKP......ITIMDNKLM...PRMVE..NQGKEG....QTTTYG....QTSNIH-
E4RXN7_LEAB4/92-255KRTDDKFD....RLTASSGNEIKINKAKST........DGTII...SQLSK....EDSG....GF.SMG....TTTNAT-
C9L1R0_9BACE/138-300.KSGRLFNETPKNMRNRSSTDNLASFGDRS..KSIKV.KAGLL...GNMYN....SQKGN..AYIKAYG....STQDLE-
E4RWK7_LEAB4/354-517QKTEDKFD....RLTASNGNEIKINKATAS........SGSII...SQLSK....EDSG....GF.SMG....TTTNAT-

PF04002

D1N9M0_9BACT/106-227-------------------------------------------------------------------------VLDNTT.
D2BH65_DEHSV/106-228-------------------------------------------------------------------------CIKTPE.
Y1917_THICR/102-225-------------------------------------------------------------------------ALTQPE.
Q1N8A1_9SPHN/109-231-------------------------------------------------------------------------VLANWQ.
Q2N869_ERYLH/27-148-------------------------------------------------------------------------ALADPG.
Y1174_NEIMF/102-224-------------------------------------------------------------------------VLSDPD.
A6GHT1_9DELT/122-244-------------------------------------------------------------------------PLRHPR.
C0ABZ0_9BACT/117-246-------------------------------------------------------------------------ELNDGA.
Q0HVT6_SHESR/47-168-------------------------------------------------------------------------AYTNPQ.
B3EB20_GEOLS/42-163-------------------------------------------------------------------------RFTQPQ.
Q03YZ9_LEUMM/73-198-------------------------------------------------------------------------QLLNAKY
Q7P812_FUSNV/110-232-------------------------------------------------------------------------KISNKD.
Q30YK7_DESDG/103-225-------------------------------------------------------------------------LLVSSR.
Y3180_DESHY/105-227-------------------------------------------------------------------------VINSPQ.
A8ZUS2_DESOH/106-228-------------------------------------------------------------------------LLANST.
A4BXR1_9FLAO/24-149-------------------------------------------------------------------------KINKSS.
A5LVX8_STRPN/103-225-------------------------------------------------------------------------SILSSQ.
Q7NFQ9_GLOVI/117-239-------------------------------------------------------------------------VIDGPQ.
Q8ABN2_BACTN/26-150-------------------------------------------------------------------------KILSSE.
A8MGD7_ALKOO/25-146-------------------------------------------------------------------------NVYSAD.
A6EEF9_9SPHI/26-151-------------------------------------------------------------------------KVSRSH.
A3U7J3_CROAH/109-231-------------------------------------------------------------------------VITSSA.
Q5Z1A3_NOCFA/105-224-------------------------------------------------------------------------RLTHAA.
Q2SAG7_HAHCH/49-171-------------------------------------------------------------------------NMDDPG.
A5G1T0_ACICJ/119-241-------------------------------------------------------------------------VLNNWE.
A9B8G6_HERA2/79-201-------------------------------------------------------------------------PITTPM.
Q0F0W4_9PROT/139-261-------------------------------------------------------------------------LLYRPE.
A4YL64_BRASO/115-237-------------------------------------------------------------------------ALASWQ.
Y1557_THEMA/101-222-------------------------------------------------------------------------KLDSSV.
Q1NUQ1_9DELT/108-231-------------------------------------------------------------------------YLRSSR.
Y1125_HAEI8/99-221-------------------------------------------------------------------------IINDLE.
A7AJ21_9PORP/104-226-------------------------------------------------------------------------VIHSSS.
A6NZB7_9FIRM/107-229-------------------------------------------------------------------------IVDSTR.
A5ZSZ3_9FIRM/23-146-------------------------------------------------------------------------PMNNPD.
A8ZYJ4_DESOH/28-150-------------------------------------------------------------------------EISSAQ.
Y086_PSESM/102-224-------------------------------------------------------------------------ALENPA.
A4XHM1_CALS8/103-225-------------------------------------------------------------------------QLKNVE.
B2JE00_BURP8/120-242-------------------------------------------------------------------------LIDSPE.
Y611_CHLTE/100-222-------------------------------------------------------------------------KVKGAR.
Y1610_AQUAE/110-231-------------------------------------------------------------------------SIRNPQ.
B0V642_ACIBY/120-242-------------------------------------------------------------------------SLHSSH.
A4ITX8_GEOTN/9-125-------------------------------------------------------------------------HFLCDR.
Q7VMM9_HAEDU/35-157-------------------------------------------------------------------------SFGDEK.
Y491_PSYWF/102-224-------------------------------------------------------------------------SLNRSQ.
Y4865_PHOLL/108-230-------------------------------------------------------------------------IMSSPS.
Y371_SYMTH/110-232-------------------------------------------------------------------------DLCNPR.
A5Z7J1_9FIRM/22-146-------------------------------------------------------------------------QLTSPE.
Q02HM7_PSEAB/85-202-------------------------------------------------------------------------ELLSPR.
Q2S840_HAHCH/1-123-------------------------------------------------------------------------MIASPR.
A5EYF9_DICNV/276-401-------------------------------------------------------------------------QFSSAD.
A0Z2T6_9GAMM/98-220-------------------------------------------------------------------------PLKDPG.
A4NTE0_HAEIF/34-156-------------------------------------------------------------------------EFTEPS.
A6EKP4_9SPHI/26-151-------------------------------------------------------------------------KVNSTD.
Q5P8G7_AROAE/74-196-------------------------------------------------------------------------VLDAPD.
Q5PA32_ANAMM/108-230-------------------------------------------------------------------------VVNEWQ.
A3ER13_9BACT/109-231-------------------------------------------------------------------------EIRSAR.
Y1515_LACLM/103-226-------------------------------------------------------------------------QVLSSK.
A6DQ92_9BACT/32-161-------------------------------------------------------------------------QANQPE.
A9KL05_CLOPH/109-231-------------------------------------------------------------------------RYTDPS.
Q2IEL9_ANADE/81-203-------------------------------------------------------------------------RCLDPG.
Q2QJL1_ACEAC/25-147-------------------------------------------------------------------------ILAEQQ.
Y341_CARHZ/104-226-------------------------------------------------------------------------NFLNPD.
Q03EP2_PEDPA/97-219-------------------------------------------------------------------------KVLGSA.
A5KLJ1_9FIRM/109-231-------------------------------------------------------------------------DFSSPR.
A5FBM2_FLAJ1/31-156-------------------------------------------------------------------------CITSSR.
A3CRJ6_METMJ/102-223-------------------------------------------------------------------------RIARPE.
Q1Q559_9BACT/9-136-------------------------------------------------------------------------SVHGPG.
Q042N7_LACGA/84-206-------------------------------------------------------------------------SLYSSS.
Q2B8H5_9BACI/107-228-------------------------------------------------------------------------CLRSPE.
Q2LSS5_SYNAS/184-306-------------------------------------------------------------------------QISCTG.
A4SZN2_POLSQ/113-235-------------------------------------------------------------------------IFSSPG.
Y1765_PARUW/107-229-------------------------------------------------------------------------LIEHSS.
A6EEP6_9SPHI/39-153-------------------------------------------------------------------------FIQDWN.
A4XJG8_CALS8/36-160-------------------------------------------------------------------------QLKNVN.
Q11VY8_CYTH3/111-233-------------------------------------------------------------------------QVKSSE.
A0LNF4_SYNFM/102-224-------------------------------------------------------------------------TFNSTR.
A7FEQ9_YERP3/38-160-------------------------------------------------------------------------TLTSPE.
Y1850_BORPA/103-225-------------------------------------------------------------------------ALANPD.
Q8GFV0_CITFR/27-149-------------------------------------------------------------------------FITGAD.
Q5NML0_ZYMMO/19-141-------------------------------------------------------------------------CVRCLE.
Q72Q17_LEPIC/104-226-------------------------------------------------------------------------KRYSSE.
Q5FNC5_GLUOX/112-229-------------------------------------------------------------------------TLSNWE.
B8CX04_HALOH/118-240-------------------------------------------------------------------------PIVQPL.
A5TXI1_FUSNP/685-807-------------------------------------------------------------------------VIKDEN.
A5Z6A2_9FIRM/108-230-------------------------------------------------------------------------QYNIPS.
A3D8H4_SHEB5/24-146-------------------------------------------------------------------------AITRPE.
Y852_LACSS/100-222-------------------------------------------------------------------------VVASSQ.
Y2338_SALRD/110-232-------------------------------------------------------------------------QVTCPA.
Y1989_LEGPC/102-225-------------------------------------------------------------------------QLSNTQ.
Q5QX33_IDILO/36-152-------------------------------------------------------------------------GFTEPS.
B4S9N8_PROA2/42-165-------------------------------------------------------------------------AITRCD.
A0L491_MAGSM/113-235-------------------------------------------------------------------------PLNRAD.
Q6MR78_BDEBA/35-156-------------------------------------------------------------------------EVSTSL.
A9KR89_CLOPH/32-156-------------------------------------------------------------------------KLESPS.
A7V531_BACUN/74-196-------------------------------------------------------------------------QIRMSK.
Q3Z6I4_DEHE1/116-238-------------------------------------------------------------------------VCNTAQ.
A3DJW5_CLOTH/98-219-------------------------------------------------------------------------KITSAC.
A9BIK5_PETMO/98-215-------------------------------------------------------------------------KVTSPE.
Q8PA70_XANCP/37-159-------------------------------------------------------------------------RIHSPD.
Q1DAY3_MYXXD/101-223-------------------------------------------------------------------------RLRTPK.
Q2GEH3_NEOSM/114-236-------------------------------------------------------------------------TLKSWK.
Q4EAK4_9RICK/97-218-------------------------------------------------------------------------PIMDLQ.
Q6WB38_ALCFA/54-176-------------------------------------------------------------------------ALNQPP.
A7AC72_9PORP/83-208-------------------------------------------------------------------------KILSAE.
Q1WT78_LACS1/101-223-------------------------------------------------------------------------QIFSSC.
Q7WWR8_COXBE/19-137-------------------------------------------------------------------------ALKTPS.
B1YJT0_EXIS2/95-217-------------------------------------------------------------------------VVRSPD.

PF14464

O58174_PYRHO/6-109-------------------------------------------------------------------------RRELLE-
Q8TYS8_METKA/10-115-------------------------------------------------------------------------DARLLD-
Q8TQ16_METAC/27-138-------------------------------------------------------------------------LLYMQI-
O27052_METTH/16-131-------------------------------------------------------------------------FKPVRR-
B0R451_HALS3/4-126-------------------------------------------------------------------------GGRPSV-
B0R6F4_HALS3/5-124-------------------------------------------------------------------------TREGYD-
Q9I213_PSEAE/7-137-------------------------------------------------------------------------TEHALS-
Q8ZW14_PYRAE/1-111-------------------------------------------------------------------------MPKAFL-
Q9YE90_AERPE/3-117-------------------------------------------------------------------------ASIGPL-
O59157_PYRHO/36-149-------------------------------------------------------------------------LPKNII-
P73582_SYNY3/7-143-------------------------------------------------------------------------SQVHQD-
Q9S2G8_STRCO/5-111-------------------------------------------------------------------------TQALYD-
Q9RXB3_DEIRA/6-119-------------------------------------------------------------------------PAPLRR-
O67597_AQUAE/5-125-------------------------------------------------------------------------KKEVLE-
Q216W0_RHOPB/11-140-------------------------------------------------------------------------NEETLA-
B6C3F3_9GAMM/7-123-------------------------------------------------------------------------PRPLVN-
A3RXH7_RALSL/5-122-------------------------------------------------------------------------LSELVD-
Q0A9H9_ALHEH/13-128-------------------------------------------------------------------------PARERD-
Q82SH4_NITEU/5-122-------------------------------------------------------------------------HTKLIS-
Q2YAE7_NITMU/14-131-------------------------------------------------------------------------HAKLVE-
F0DZB5_9PSED/6-123-------------------------------------------------------------------------TAQALE-
Q2SI97_HAHCH/5-122-------------------------------------------------------------------------LSELVD-
Q84HF8_PSEFL/5-121-------------------------------------------------------------------------SQDIIT-
Q7BNS3_PSEST/6-123-------------------------------------------------------------------------KRQALG-
Q82D25_STRAW/5-122-------------------------------------------------------------------------TQALVD-
A1SG89_NOCSJ/5-128-------------------------------------------------------------------------ARATYD-
Q1AY15_RUBXD/6-127-------------------------------------------------------------------------GRGDVE-
D5HAX1_SALRM/4-126-------------------------------------------------------------------------TPDILD-
Q02B10_SOLUE/5-125-------------------------------------------------------------------------ESAAWA-
E2TKU9_MYCTU/5-122-------------------------------------------------------------------------RADLVN-
Q5Z0V7_NOCFA/5-122-------------------------------------------------------------------------KSDLVA-
A8L770_FRASN/19-136-------------------------------------------------------------------------DRTHYE-
Q47MB9_THEFY/5-122-------------------------------------------------------------------------DRSIYD-
Q2JEP2_FRASC/5-122-------------------------------------------------------------------------DRACYE-
Q7MRV8_WOLSU/6-118-------------------------------------------------------------------------.KALFD-
Q39VC3_GEOMG/6-119-------------------------------------------------------------------------.RAIHA-
B3EN74_CHLPB/4-118-------------------------------------------------------------------------CKSVYE-
A3DIG3_CLOTH/5-123-------------------------------------------------------------------------TKQQYQ-
B8FTM5_DESHD/5-124-------------------------------------------------------------------------TKKQME-
A6TTW0_ALKMQ/7-124-------------------------------------------------------------------------.KENYN-
A4XJZ1_CALS8/5-124-------------------------------------------------------------------------PKTLYE-
Q3AW93_SYNS9/27-153-------------------------------------------------------------------------DLQCLT-
Q3AML7_SYNSC/5-131-------------------------------------------------------------------------DHRCHT-
Q7U4L3_SYNPX/10-140-------------------------------------------------------------------------RCGCLT-
A3Z8Z4_9SYNE/8-143-------------------------------------------------------------------------GRQCLI-
A9BCQ7_PROM4/10-152-------------------------------------------------------------------------HGHSKE-
Q7V9V1_PROMA/10-154-------------------------------------------------------------------------HKDSER-
Q46IP8_PROMT/10-154-------------------------------------------------------------------------HNRTNS-
Q3MEG9_ANAVT/9-148-------------------------------------------------------------------------LPQHQQ-
B2J4Y6_NOSP7/5-138-------------------------------------------------------------------------SPEHLQ-
Q2JJY1_SYNJB/6-136-------------------------------------------------------------------------SADHLH-
Q2JS00_SYNJA/6-136-------------------------------------------------------------------------SAEHLR-
A9W9Z2_CHLAA/6-141-------------------------------------------------------------------------PDQAAA-
Q2IF99_ANADE/8-141-------------------------------------------------------------------------GAPLLA-
O64333_BPN15/2-106-------------------------------------------------------------------------RQKTID-
Q9MCU3_BPHK0/2-106-------------------------------------------------------------------------RQKTID-
Q8W6T2_9CAUD/12-125-------------------------------------------------------------------------DEQIKK-
A3EHW4_VIBCL/1-109-------------------------------------------------------------------------.MNWQS-
Q02TC3_PSEAB/4-108-------------------------------------------------------------------------SRSLQR-
Q8XYR3_RALSO/2-105-------------------------------------------------------------------------QETTLD-
C6TYU0_BURPE/2-115-------------------------------------------------------------------------DEQIKK-
A9APW0_BURM1/2-115-------------------------------------------------------------------------DERIKQ-
A4TT77_YERPP/1-112-------------------------------------------------------------------------....MQ-
Q6XQC1_BPT1/3-111-------------------------------------------------------------------------SAKIKL-
F0A4T4_NEIME/7-109-------------------------------------------------------------------------SEEARR-
D9PEJ9_ACTPL/3-105-------------------------------------------------------------------------AEHIKI-
Q3Z1B1_SHISS/1-103-------------------------------------------------------------------------MTQTES-
E6BUJ9_ECOLX/1-103-------------------------------------------------------------------------MTQTES-
Q7WX35_CUPNH/81-188-------------------------------------------------------------------------PAQLIG-
A1VVA1_POLNA/80-189-------------------------------------------------------------------------PASLWR-
A0R7L0_PELPD/81-188-------------------------------------------------------------------------PVDMIT-
Q8XYU8_RALSO/133-242-------------------------------------------------------------------------TFPMVR-
Q21Q53_RHOFD/82-191-------------------------------------------------------------------------PENLLV-
Q120V3_POLSJ/78-187-------------------------------------------------------------------------PTELRS-
Q5NUW4_RALME/76-183-------------------------------------------------------------------------PPALIG-
Q8ZSF0_NOSS1/58-173-------------------------------------------------------------------------LEPYFR-
A4JUM8_BURVG/81-187-------------------------------------------------------------------------PAALVA-
Q5NXB5_AROAE/80-200-------------------------------------------------------------------------PLSLFE-
Q11ZD2_POLSJ/78-182-------------------------------------------------------------------------PKALLD-
Q47D11_DECAR/80-200-------------------------------------------------------------------------PIRVIE-
Q8PFM8_XANAC/617-745-------------------------------------------------------------------------DEGLCE-
A1U033_MARAV/627-755-------------------------------------------------------------------------DVSIEG-
A1VVG1_POLNA/619-747-------------------------------------------------------------------------DASVEL-
Q5HY19_GLUOX/596-724-------------------------------------------------------------------------SVGVIK-
A3U023_9RHOB/617-745-------------------------------------------------------------------------DAGLRS-
Q3J4T5_RHOS4/19-143-------------------------------------------------------------------------TARAFA-
B6F186_CLOPF/572-698-------------------------------------------------------------------------YRKAYE-
A9BTW4_DELAS/624-751-------------------------------------------------------------------------LSPVAQ-
A4AAI2_9GAMM/624-751-------------------------------------------------------------------------LYPVEQ-
A1U5J0_MARAV/600-724-------------------------------------------------------------------------LDSVVS-
Q2LTW5_SYNAS/612-744-------------------------------------------------------------------------SQAALS-
Q21PA7_SACD2/610-735-------------------------------------------------------------------------EIRVLG-
Q3SNL7_NITWN/223-347-------------------------------------------------------------------------SSRVMT-
D3GMN5_9ENTR/45-166-------------------------------------------------------------------------SEVVRL-
C6YLL5_VIBCL/21-142-------------------------------------------------------------------------GHVVTR-
Q4FRY9_PSYA2/20-141-------------------------------------------------------------------------IGVANI-
Y4QB_RHISN/8-136-------------------------------------------------------------------------PESVVE-
A0AW82_ARTS2/13-145-------------------------------------------------------------------------PVPVLS-
A5G3M8_GEOUR/23-151-------------------------------------------------------------------------VEVIAS-
Q2L5J9_CLOPF/14-141-------------------------------------------------------------------------DNLIAC-
Q2NDB2_ERYLH/5-124-------------------------------------------------------------------------EASVMD-
Q2K8Q5_RHIEC/6-134-------------------------------------------------------------------------SPSELA-
Q8KGW0_RHILI/15-149-------------------------------------------------------------------------HCISTV-
Q2K2A8_RHIEC/65-199-------------------------------------------------------------------------AAVNDV-
C5ATD4_METEA/9-143-------------------------------------------------------------------------AILAET-
Q13F65_RHOPS/9-143-------------------------------------------------------------------------SVLERT-
Q6YRV1_SYNY3/11-152-------------------------------------------------------------------------.ESHLQ-
A4JA90_BURVG/13-148-------------------------------------------------------------------------SGKHRT-
A1VQ27_POLNA/13-152-------------------------------------------------------------------------.ESHEA-
Q1QNK4_NITHX/10-142-------------------------------------------------------------------------PVGVHT-
Q2IDP5_ANADE/4-131-------------------------------------------------------------------------VADWVL-

PF05021

Q380R2_ANOGA/286-599RIGFLFGKYEIHPDVPLGIRARVA-------------------------------------------------AIYEPPQ
NPL4_CRYNJ/281-610RIAFLIGREDKYEKVPMGIKVIVE-------------------------------------------------AVWEPKQ
NPL4_MAGO7/285-589RYGIMYGKYSEYEEVPLGIKAVVQ-------------------------------------------------AIYEPPQ
NPL4_PICST/268-574RFGVMYGRYEPFDKVPLGIKAVVE-------------------------------------------------AIYEPPQ
NPL4_DEBHA/260-563RFGILYGRYEQFDKVPLGIKAVVE-------------------------------------------------AIYEPPQ
NPL4_DROME/282-593RMGYLYGTYEQHTDVPLGIRAKVA-------------------------------------------------AIYEPPQ
NPL4_CANAL/286-595RFGYLYGRYAKSEKTPLGIKAIVE-------------------------------------------------TIIEPPQ
NPL4_PICGU/288-564RFGFMFGRYEVFDKVPLGIKAVVE-------------------------------------------------AIYEPPQ
Q5CYK6_CRYPI/214-488RVGWMYGYYREDSTYPMGIRAVME-------------------------------------------------AIYEPPQ
A8X418_CAEBR/151-470RVGYLIGQYQPHPEVPLGIKATVA-------------------------------------------------AIYEPPQ
NPL4_COCIM/290-605RLGFLYGTYEEYSEVPLGVKAVVQ-------------------------------------------------AIYEPPQ
NPL4_ASPOR/287-599RLGFLYGTYEEYTEVPLGVKAVVQ-------------------------------------------------AIYEPPQ
NPL41_ARATH/156-410RGGFMYGNVSEDG......QVEVN-------------------------------------------------FIYEPPQ
A7AUE8_BABBO/207-478RAGWLYGYYVEDSHYPLGIRAVCE-------------------------------------------------GIYEPPQ
NPL4_SCLS1/289-608RFGYLYGRYEEYTEVPLGVKAVVE-------------------------------------------------AIYEPPQ
Q63ZR4_XENLA/250-559RIGYLYGRYTEHKDIPLGLRAEVA-------------------------------------------------AIYEPPQ
NPL4_KLULA/265-593RFGYLYGYYKRYDNVPLGIKAVVE-------------------------------------------------AIWEPPQ
NPL4_AJECN/292-589RLGFLYGTYEEYTEVPLGIKAVVQ-------------------------------------------------AIYEPPQ
A7SZA1_NEMVE/172-484RLGFLYGRYEEHKDVPLGIRAVVA-------------------------------------------------AIYEPPQ
NPL4_VANPO/248-566RFGYLYGSYEKYDSTPLGVKAVVH-------------------------------------------------AIYEPPQ
NPL4_CANGA/260-578RFAYLYGKYEKYDATPLGIKACVH-------------------------------------------------AIYEPPQ
Q8I426_PLAF7/256-527RIGWMYGYYREDNHYNLGIRAVCE-------------------------------------------------CIYEPPQ
Q2HAC4_CHAGB/250-562RLGILYGKYMEYDVVPLGIKAVVE-------------------------------------------------AIYEPPQ
Q01AR0_OSTTA/156-409RFGWLYGTRDDEN......KVRVE-------------------------------------------------AIYEPEQ
NPL4_YEAST/259-577RFGYMYGSYSKYDNTPLGIKAVVE-------------------------------------------------AIYEPPQ
A5KB05_PLAVS/256-527RVGWMYGYYREDPHYTLGIRAVCE-------------------------------------------------CIYEPPQ
NPL4_DICDI/319-563RIGFLFGNFLSDG......SVVVD-------------------------------------------------SIYEPPQ
Q8SRJ9_ENCCU/202-474RFGFLVGRYMDHEMIPLGTKAVVS-------------------------------------------------GIWEPEQ
NPL4_ASHGO/241-560RFGYLYGRYARYDNTPLGIKAVVE-------------------------------------------------AIWEPEQ
A0C810_PARTE/307-574RMGFLYGYYAADPNYQNGVRAIVE-------------------------------------------------AIYEPPQ
A4RW87_OSTLU/156-413RFGWLYGARDDDG......KTRVD-------------------------------------------------AIYEPEQ
NPL4_PHANO/275-593RLGFLYGRYEEYTEVPLGTKAVVE-------------------------------------------------TIYEPPQ
NPL4_LODEL/287-597RFGYLYGRYEKFDKVPMGIKAVVE-------------------------------------------------AIYEPPQ
Q7RED9_PLAYO/245-516RVGWMYGYYKEDSHYNLGIRAVCE-------------------------------------------------CIYEPPQ
A5BEN5_VITVI/154-392RGGFMYGTVADDG......AVRVD-------------------------------------------------FIYEPPQ
NPL4_NEUCR/276-588RLGILYGKYLEYDVVPLGVKAVVE-------------------------------------------------AIYEPPQ

PF03665

U172_ARATH/8-208-------------------------------------------------------------------------ELKYEI-
Q4SKU7_TETNG/1-192-------------------------------------------------------------------------MGEMEL-
Q4PCQ4_USTMA/4-202-------------------------------------------------------------------------TASVRV-
Q53Y03_HUMAN/1-204-------------------------------------------------------------------------MPGVKL-
U172_DICDI/2-192-------------------------------------------------------------------------NNNISI-
F158A_HUMAN/1-193-------------------------------------------------------------------------MGEVEI-
A4H4X4_LEIBR/5-249-------------------------------------------------------------------------PSSVVA-
Q8IHW7_PLAF7/3-195-------------------------------------------------------------------------YTEITI-
U172_DROME/1-194-------------------------------------------------------------------------MCDYKV-
Q1W2L0_SALBI/3-198-------------------------------------------------------------------------ELIYEI-
Q6P4M9_XENTR/1-196-------------------------------------------------------------------------MPAFKL-
Q3B8G2_XENLA/1-193-------------------------------------------------------------------------MCEVEL-
Q4DRE9_TRYCC/6-215-------------------------------------------------------------------------TPSVVS-
A5K556_PLAVS/3-196-------------------------------------------------------------------------ETEISI-
Q17EH7_AEDAE/1-189-------------------------------------------------------------------------MSEVNF-
Q5DA93_SCHJA/2-187-------------------------------------------------------------------------TAAVHI-
Q93568_CAEEL/2-186-------------------------------------------------------------------------KHQVET-
A5APP0_VITVI/4-206-------------------------------------------------------------------------ELKYEI-
Q5TPN5_ANOGA/1-188-------------------------------------------------------------------------MSEIMF-
Q8AWD7_DANRE/1-192-------------------------------------------------------------------------MGEVEL-
Q8L439_CHLRE/2-202-------------------------------------------------------------------------TFSCSA-
A4HT47_LEIIN/5-249-------------------------------------------------------------------------STSVVA-

PF01398

D1039_DICDI/532-641-------------------------------------------------------------------------SKLRKI-
PSDE_DICDI/26-139-------------------------------------------------------------------------DTAETI-
CSN5_YEAST/66-190-------------------------------------------------------------------------PSYTHV-
PSD7_DROME/6-121-------------------------------------------------------------------------VSVNKV-
RPN8_YEAST/3-116-------------------------------------------------------------------------LQHEKV-
RPN11_SCHPO/25-138-------------------------------------------------------------------------DNSECV-
CSN5_CAEEL/51-165-------------------------------------------------------------------------HYFKQI-
EIF3F_ARATH/23-133-------------------------------------------------------------------------TSVLTA-
EIF3F_HUMAN/87-196-------------------------------------------------------------------------PGGRVV-
O59157_PYRHO/26-138-------------------------------------------------------------------------YPQQTN-
BRCC3_HUMAN/7-148-------------------------------------------------------------------------QAVQAV-
O61792_CAEEL/36-151-------------------------------------------------------------------------LPVNKV-
O27052_METTH/17-118-------------------------------------------------------------------------KPVRRV-
EIF3H_HUMAN/34-146-------------------------------------------------------------------------SAVKQV-
EIF3F_CAEEL/2-117-------------------------------------------------------------------------ASNLTV-
YPT5_CAEEL/24-137-------------------------------------------------------------------------DTSETV-
RPN8_SCHPO/12-125-------------------------------------------------------------------------IVPQQV-
EIF3F_SCHPO/18-129-------------------------------------------------------------------------SSPLNI-
MEC_MYCBO/6-114-------------------------------------------------------------------------GTVYVL-
CSN6_HUMAN/36-148-------------------------------------------------------------------------TGSVSV-
EIF3H_CAEEL/10-139-------------------------------------------------------------------------PSVKHI-
STABP_HUMAN/252-361-------------------------------------------------------------------------DGLRHV-
BRCC3_MOUSE/7-148-------------------------------------------------------------------------QAVQAV-
PSD7_ARATH/12-125-------------------------------------------------------------------------RTIEKV-
CSN6B_ARATH/6-136-------------------------------------------------------------------------SSGLTF-
CSN5B_ARATH/54-168-------------------------------------------------------------------------NYFKRV-
O13386_HYPJE/11-125-------------------------------------------------------------------------LVTRNV-
PRP8_HUMAN/2099-2205-------------------------------------------------------------------------ETGYTY-
CSN5_SCHPO/30-144-------------------------------------------------------------------------EFFRSV-
O16155_SCHMA/21-128-------------------------------------------------------------------------HDRVVV-

PF15659

D3IMU4_9BACT/335-480--DAFKFFKF----------A-----ADNTK.------------------------.VEWHLVGVK--------------
D3IMY5_9BACT/92-252--IASNIFEF----------L-----AKNSD.------------------------.VEWSNTKVS--------------
D1PWX0_9BACT/114-279--QGTSLFEY----------F-----SKNTS.------------------------.VEWSQMQTG--------------
G9S3Z7_9PORP/207-377--NGKQLFEF----------F-----ATNSS.------------------------.VEWSQLLLG--------------
C6IIY2_9BACE/879-1045--NAANVFLF----------V-----ADNTS.------------------------.VEWTLKGGY--------------
D0TNF7_9BACE/83-238--DAAAVFKF----------G-----ADNTS.------------------------.VEWKLDIYN--------------
E4RWK9_LEAB4/231-388--EAHKLFEF----------A-----AENSD.------------------------.VEFLLTTVE--------------
C6IJD1_9BACE/48-220--TAATVFKF----------A-----ADHTT.------------------------.VEWKLDVYD--------------
I0TCD6_9BACT/325-474--DAFKFFKF----------V-----ADNTN.------------------------.VEWNLIGER--------------
E2NN46_9BACE/59-211--DAANLFKF----------A-----ADNSV.------------------------.VEWKLDVYE--------------
E4RXN7_LEAB4/92-255--DARNLYNF----------M-----DANSTR------------------------GIEFSLTGSM--------------
C9L1R0_9BACE/138-300--TAAAVFKF----------A-----ADNTS.------------------------.VEWKLDVYD--------------
E4RWK7_LEAB4/354-517--DARNLYNF----------M-----DANTTR------------------------GTEFSLAGSM--------------

PF04002

D1N9M0_9BACT/106-227..KIVNFLRM..KLG.....G-----GKK...------------------------.ETFMVLFLN--------------
D2BH65_DEHSV/106-228..DVFQIIYP..LVS.....D-----EKK...------------------------.EYFFCLMLD--------------
Y1917_THICR/102-225..KVARLLQH..HIG.....H-----QSR...------------------------.EIFGLVLLD--------------
Q1N8A1_9SPHN/109-231..ALLDYLRA..DMA.....H-----LGV...------------------------.ERVRVLHLN--------------
Q2N869_ERYLH/27-148..FLQYIHS...RFA.....M-----ANE...------------------------.ERLHVVYCD--------------
Y1174_NEIMF/102-224..TVADYLRF..HLG.....Q-----EKV...------------------------.EVSVALLLN--------------
A6GHT1_9DELT/122-244..EAERFLRS..LLG.....D-----AER...------------------------.EHFMIIGLD--------------
C0ABZ0_9BACT/117-246..AVAAYMRP..QLQ.....G-----LTV...------------------------.EKCWVLCLN--------------
Q0HVT6_SHESR/47-168..ATKDFLTY..KLG.....G-----YER...------------------------.EVFAVMLLD--------------
B3EB20_GEOLS/42-163..QVFEMFR...DLR.....L-----ETK...------------------------.EHFIVLHLD--------------
Q03YZ9_LEUMM/73-198SAEIGRFAQQ..QIG.....N-----LMQ...------------------------.EQLSVALLD--------------
Q7P812_FUSNV/110-232..ILLNYLRN..KIG.....Y-----EEK...------------------------.EKFYVIYLS--------------
Q30YK7_DESDG/103-225..AVADMART..RLA.....G-----CPH...------------------------.EEVWVAYMD--------------
Y3180_DESHY/105-227..DIAHLVME..EMR.....Y-----LDR...------------------------.EHFRVVSLS--------------
A8ZUS2_DESOH/106-228..DLLNYLNH..TLR.....D-----RHR...------------------------.ETFAAIFMD--------------
A4BXR1_9FLAO/24-149..DAFKSFT...QSW.....D-----MDLIEL------------------------QEEFKILLLN--------------
A5LVX8_STRPN/103-225..KLAKKMQQ..ELG.....D-----KKQ...------------------------.EHLVALYLN--------------
Q7NFQ9_GLOVI/117-239..AVAAVLGG..ELA.....F-----ARQ...------------------------.EQFAVLLLD--------------
Q8ABN2_BACTN/26-150..TSYTYLKPFYAEC.....M-----EHH...------------------------.EESYVMFLN--------------
A8MGD7_ALKOO/25-146..EAGPIFED..FIG.....G-----ATL...------------------------.ERLALLCID--------------
A6EEF9_9SPHI/26-151..DLYQILM...NNW.....N-----QNTIGF------------------------IEEFKVILLN--------------
A3U7J3_CROAH/109-231..SVFELMQP..IIG.....D-----LDH...------------------------.EEFWVVYLN--------------
Q5Z1A3_NOCFA/105-224..EVARVAAP..LFA.....G-----ARV...------------------------.ERLLVLICD--------------
Q2SAG7_HAHCH/49-171..KVKEYLVM..HLA.....P-----EPR...------------------------.ETFVGLFLD--------------
A5G1T0_ACICJ/119-241..RLIDHLTI..AMA.....R-----EPV...------------------------.EQFRVIYLD--------------
A9B8G6_HERA2/79-201..QVVALLQA..EMS.....H-----LEQ...------------------------.EELRVISLS--------------
Q0F0W4_9PROT/139-261..RVRAYLRL..LVQ.....G-----RGM...------------------------.ECFGAMFTD--------------
A4YL64_BRASO/115-237..EVISYCRT..SMA.....F-----ADK...------------------------.EQFRLLFLD--------------
Y1557_THEMA/101-222..KVYKYCQ...EMV.....Y-----LER...------------------------.EIVKVICLD--------------
Q1NUQ1_9DELT/108-231..EVGDYLIH..ALR.....G-----MSR...------------------------.ETLMAIYLD--------------
Y1125_HAEI8/99-221..TVKLFLLT..ELQ.....H-----EER...------------------------.EVFMVLFLD--------------
A7AJ21_9PORP/104-226..DVYRIFYP..LLC.....D-----LPH...------------------------.EELWIALTN--------------
A6NZB7_9FIRM/107-229..AAREVFEP..LFY.....G-----ARN...------------------------.EMVYLLCMD--------------
A5ZSZ3_9FIRM/23-146..VAIRVMNE..FLS.....Q-----MDR...------------------------.ELFCIVNLQ--------------
A8ZYJ4_DESOH/28-150..EVYNIMKP..VFA.....E-----TDD...------------------------VETLYCLYLD--------------
Y086_PSESM/102-224..QVRNYLKA..QLR.....H-----EPH...------------------------.EVFACLFLD--------------
A4XHM1_CALS8/103-225..VAAEYIKS..LFV.....G-----RKN...------------------------.EVFYVICLD--------------
B2JE00_BURP8/120-242..AVEDYLRL..LIG.....S-----RPY...------------------------.EVFICLFLD--------------
Y611_CHLTE/100-222..DVFEYMKG..RIP.....D-----ETK...------------------------.EHLFVLFLS--------------
Y1610_AQUAE/110-231..EAFEFLKD..KF......D-----ERR...------------------------.ESLIALYLD--------------
B0V642_ACIBY/120-242..LVLDYLRY..ELK.....G-----EKQ...------------------------.EVFAVLCLD--------------
A4ITX8_GEOTN/9-125..TLQKWLNF..KLS......-----......------------------------....NTMCLN--------------
Q7VMM9_HAEDU/35-157..EASEYCQM..QLG.....F-----EER...------------------------.EVFGVLFWD--------------
Y491_PSYWF/102-224..VVKDYITT..QIR.....R-----ESK...------------------------.EVFAVLCLD--------------
Y4865_PHOLL/108-230..VTQEYLQN..LLS.....G-----RDR...------------------------.EIFVVLFLN--------------
Y371_SYMTH/110-232..AVFEFLAP..RMA.....H-----LSI...------------------------.EQFHVILLN--------------
A5Z7J1_9FIRM/22-146..KVAMVVGD..YIR.....D-----MDR...------------------------.EALCVINFN--------------
Q02HM7_PSEAB/85-202..GLRQYLRL..RLV.....G-----KSE...------------------------.EVFAAVFLD--------------
Q2S840_HAHCH/1-123..FAYDYLKL..NLA.....E-----LQH...------------------------.EAFGVLFLD--------------
A5EYF9_DICNV/276-401..DVRNFLLM..HYK.....G-----LGF...------------------------.EEVAILLLN--------------
A0Z2T6_9GAMM/98-220..SCYKYLQH..HYL.....L-----QSR...------------------------.EVFTCLFLD--------------
A4NTE0_HAEIF/34-156..IAKLYFQT..IIG.....N-----EER...------------------------.ENFVVLFLD--------------
A6EKP4_9SPHI/26-151..DVYYVLM...NHW.....N-----HNTIHL------------------------IEEFKIVLFN--------------
Q5P8G7_AROAE/74-196..VVKPFLRT..FFA.....G-----RPY...------------------------.EVFVALYLN--------------
Q5PA32_ANAMM/108-230..KLLDYLRV..KIG.....N-----SSV...------------------------.ENLCVLYLN--------------
A3ER13_9BACT/109-231..DVYDILGA..RLR.....D-----EKK...------------------------.ESFWVLLLD--------------
Y1515_LACLM/103-226..EYGMSLAF..EMQ.....N-----FEQ...------------------------.EHLTATYLD--------------
A6DQ92_9BACT/32-161..AVFDFLKT.IGVA.....D-----EAQ...------------------------.EVFIVLVLN--------------
A9KL05_CLOPH/109-231..SVAEYYMQ..DMR.....S-----LKT...------------------------.EQSRLLMFD--------------
Q2IEL9_ANADE/81-203..RVYELMR...PLA.....H-----APV...------------------------.EEFHVVLLD--------------
Q2QJL1_ACEAC/25-147..QLYAYLRA..IMG.....P-----EKR...------------------------.EQVRVLFLN--------------
Y341_CARHZ/104-226..DVYNYLRY..KIG.....H-----KKQ...------------------------.EQVVVLYLN--------------
Q03EP2_PEDPA/97-219..QLGQMMVS..RFQ.....K-----EPQ...------------------------.EHLLVLCLD--------------
A5KLJ1_9FIRM/109-231..TIADYYME..DMR.....H-----RTR...------------------------.EILKLIFLN--------------
A5FBM2_FLAJ1/31-156..DAYRILL...DSW.....D-----PGKIEF------------------------FEQFKVLLLS--------------
A3CRJ6_METMJ/102-223..DVLPLVT...EWR.....D-----KKQ...------------------------.EYFFCITLN--------------
Q1Q559_9BACT/9-136..DVATIMRS..ILAVEGEID-----RSK...------------------------.EHFWTVGLN--------------
Q042N7_LACGA/84-206..QVGCYIAD..KLC.....G-----RPQ...------------------------.EELYGIYLD--------------
Q2B8H5_9BACI/107-228..DAYHAVK...YLT.....N-----EDQ...------------------------.ETFVVLALD--------------
Q2LSS5_SYNAS/184-306..ELLDFCKT..ALG.....G-----LKD...------------------------.ENFCVLYLD--------------
A4SZN2_POLSQ/113-235..HVKEYLQS..KIG.....R-----LPH...------------------------.EVFLCLYLD--------------
Y1765_PARUW/107-229..HAYQLVKD..ELE.....N-----ENR...------------------------.EIFMAIFQD--------------
A6EEP6_9SPHI/39-153..RHKIYLI............-----......------------------------.EQFKILLID--------------
A4XJG8_CALS8/36-160..SAVEFLKKHLLLH.....C-----EPE...------------------------.EVFTVICLD--------------
Q11VY8_CYTH3/111-233..DVYNYMQS..NLA.....D-----LPY...------------------------.EEFWILLLN--------------
A0LNF4_SYNFM/102-224..GAVSYLSA..LLC.....T-----ERS...------------------------.EKFCILALN--------------
A7FEQ9_YERP3/38-160..AVKAWLQL..HLR.....P-----QGR...------------------------.ECFMVLFLD--------------
Y1850_BORPA/103-225..LVRRYCQA..ALG.....H-----RKV...------------------------.EHCIALYLD--------------
Q8GFV0_CITFR/27-149..AARSLLRF..RLV.....A-----EPR...------------------------.ESFCAFFLN--------------
Q5NML0_ZYMMO/19-141..DAIDLFKW..RFV.....G-----LDI...------------------------.EQIYIAYLT--------------
Q72Q17_LEPIC/104-226..QLLNFLAT..SLI.....P-----KNR...------------------------.ECFVLITLS--------------
Q5FNC5_GLUOX/112-229..QLMAYLD...........Q-----ALEGGI------------------------PGQFRLLYLD--------------
B8CX04_HALOH/118-240..DVYNLFC...ELN.....T-----TND...------------------------.KRLMILTLD--------------
A5TXI1_FUSNP/685-807..KIKQLLK...........I-----GSQELS------------------------YENFKIIKYD--------------
A5Z6A2_9FIRM/108-230..TIADYYME..QLR.....H-----LEQ...------------------------.ENLVVMFLD--------------
A3D8H4_SHEB5/24-146..DTAQVFN...YLK.....H-----ETK...------------------------.EMFIVANLT--------------
Y852_LACSS/100-222..MVGQRMIE..SLA.....G-----ETQ...------------------------.EQLLAVYLD--------------
Y2338_SALRD/110-232..DVADVYGP..LLR.....D-----LDK...------------------------.EVFKVVHLN--------------
Y1989_LEGPC/102-225..QTYAFLKK..RLR.....D-----YKN...------------------------.ETFAALFLD--------------
Q5QX33_IDILO/36-152..MVKEFVQ...........G-----SYQQCS------------------------TEVAGLLLLD--------------
B4S9N8_PROA2/42-165..IAYDFFCK.IGLQ.....D-----KAS...------------------------.EEFYALYLD--------------
A0L491_MAGSM/113-235..NVRDYLVP..LMA.....G-----RTE...------------------------.EVFYVLCLD--------------
Q6MR78_BDEBA/35-156..QAYEILRN..EI......N-----PHA...------------------------.EELWVIALD--------------
A9KR89_CLOPH/32-156..EIQKLMKEQFQIH.....K-----KAE...------------------------.EYVYLVSLD--------------
A7V531_BACUN/74-196..DVYELMEP..LIG.....D-----LPN...------------------------.EEFWVVSIN--------------
Q3Z6I4_DEHE1/116-238..QVFDYLYC..AMR.....G-----LKK...------------------------.EVFKVIYLD--------------
A3DJW5_CLOTH/98-219..DILPLIS...YLA.....N-----RKQ...------------------------.EHFVCVSLN--------------
A9BIK5_PETMO/98-215..EAYHVCE...DMI.....Y-----LST...------------------------.ETVRAIFLD--------------
Q8PA70_XANCP/37-159..QAGDYLVA..RCA.....H-----LPH...------------------------.EVFGVVFLD--------------
Q1DAY3_MYXXD/101-223..EIAAYLAP..VLG.....A-----LRR...------------------------.EVFHVLCFN--------------
Q2GEH3_NEOSM/114-236..SVVDYLRL..SIG.....N-----KPV...------------------------.ETIRVLFLN--------------
Q4EAK4_9RICK/97-218..GIVEYLNV..SIG.....H-----SER...------------------------.ECVKILYLN--------------
Q6WB38_ALCFA/54-176..VVEAFFKA..KLA.....G-----LGH...------------------------.ECAAVAYLD--------------
A7AC72_9PORP/83-208..NAYKILL...SVF.....D-----SETIQY------------------------KEFFKVILMN--------------
Q1WT78_LACS1/101-223..MFGNYMID..KIG.....D-----SKQ...------------------------.ELLVCVCLD--------------
Q7WWR8_COXBE/19-137..NFSTPSC............-----......------------------------.AIMKAKFLA--------------
B1YJT0_EXIS2/95-217..DAAELLME..EMR.....L-----YQQ...------------------------.EHFICLYLN--------------

PF14464

O58174_PYRHO/6-109--YLLELAKS----------F.....YPR----------------------------EVAGFLRMK--------------
Q8TYS8_METKA/10-115--SLLEASDK----------N.....HPD----------------------------EFFAMLGGS--------------
Q8TQ16_METAC/27-138--KGIARDTL----------D.....FIL----------------------------EASKSMAPE--------------
O27052_METTH/16-131--VVVDSEVM----------D.....EVL----------------------------EIARRSHPH--------------
B0R451_HALS3/4-126--LGIAEDAL----------E.....FAR----------------------------EAAQDSHPD--------------
B0R6F4_HALS3/5-124--SVLDHAQA----------D.....TPR----------------------------EACGVFVGE--------------
Q9I213_PSEAE/7-137--VIYRHACR----------T.....YPR----------------------------ECCGFVLAD--------------
Q8ZW14_PYRAE/1-111--EEARKKCA----------......PEA----------------------------ECVALIFGI--------------
Q9YE90_AERPE/3-117--RQVLKLMA----------L.....AHN----------------------------EEAGLVIGA--------------
O59157_PYRHO/36-149--EEIITRSR----------E.....SKI----------------------------EICGFIFGT--------------
P73582_SYNY3/7-143--QIYRHGER----------C.....YPE----------------------------ECCGLLLGK--------------
Q9S2G8_STRCO/5-111--QIVAHARE----------D.....HPD----------------------------EACGVVAGP--------------
Q9RXB3_DEIRA/6-119--ALWAQVRR----------E.....LPR----------------------------ECVGALGGW--------------
O67597_AQUAE/5-125--KMIKQAER----------D.....YPY----------------------------ETCGLLIGK--------------
Q216W0_RHOPB/11-140--LIVRHAEQ----------A.....YPK----------------------------ECCGFVYAD--------------
B6C3F3_9GAMM/7-123--QLLHQAQV----------K.....PQQ----------------------------EICGLISAR--------------
A3RXH7_RALSL/5-122--AVLAQARR----------D.....HPI----------------------------ETCGVIAGP--------------
Q0A9H9_ALHEH/13-128--RLARLGLA----------R.....WPE----------------------------EACGLMLGC--------------
Q82SH4_NITEU/5-122--AMITQSLK----------D.....HPI----------------------------ETCGIIAGL--------------
Q2YAE7_NITMU/14-131--AMLAQAHK----------D.....HPF----------------------------EICGVIAGP--------------
F0DZB5_9PSED/6-123--QVRHLAQA----------A.....HPI----------------------------EACGLIAAA--------------
Q2SI97_HAHCH/5-122--AMVRQAQA----------E.....HPI----------------------------ETCGVIAGR--------------
Q84HF8_PSEFL/5-121--AIFDQARQ----------A.....HPL----------------------------ECCGIIAAA--------------
Q7BNS3_PSEST/6-123--QVLAQARR----------D.....HPL----------------------------ETCGIVASS--------------
Q82D25_STRAW/5-122--QIVAHARQ----------D.....HPD----------------------------EACGVVAGP--------------
A1SG89_NOCSJ/5-128--AIVAHARR----------D.....HPD----------------------------EACGIVAGP--------------
Q1AY15_RUBXD/6-127--HIHRHARE----------A.....YPE----------------------------ECAGALVGM--------------
D5HAX1_SALRM/4-126--QIRVHGAD----------A.....YPE----------------------------EGCGFLLGT--------------
Q02B10_SOLUE/5-125--AMVKHAQA----------S.....YPN----------------------------ECCGAMLGD--------------
E2TKU9_MYCTU/5-122--AMVAHARR----------D.....HPD----------------------------EACGVLAGP--------------
Q5Z0V7_NOCFA/5-122--AMVAHARA----------D.....HPD----------------------------EACGVIAGP--------------
A8L770_FRASN/19-136--AIVAHARR----------D.....HPD----------------------------EACGVIAGP--------------
Q47MB9_THEFY/5-122--KIVAHARR----------D.....HPD----------------------------EACGIVAGP--------------
Q2JEP2_FRASC/5-122--AIVAHARR----------D.....HPD----------------------------EACGIVAGS--------------
Q7MRV8_WOLSU/6-118--SIIEHAQR----------E.....LPL----------------------------EACGYVAG.--------------
Q39VC3_GEOMG/6-119--ELIAHAQA----------D.....API----------------------------EACGILGG.--------------
B3EN74_CHLPB/4-118--KIIEHARR----------E.....TPL----------------------------EACGYLGGK--------------
A3DIG3_CLOTH/5-123--EILEHSRN----------A.....LPN----------------------------EACGLLGGR--------------
B8FTM5_DESHD/5-124--EMLAHARQ----------A.....LPN----------------------------EACGLLGGR--------------
A6TTW0_ALKMQ/7-124--QIVKQAKE----------E.....FPL----------------------------ECCGLLAGV--------------
A4XJZ1_CALS8/5-124--EMLNHCLN----------S.....LPI----------------------------EACGLLGGV--------------
Q3AW93_SYNS9/27-153--VLERSLLA----------V.....KPQ----------------------------EGCGLLLGT--------------
Q3AML7_SYNSC/5-131--DLRRILLA----------P.....HPE----------------------------EGCALLLGQ--------------
Q7U4L3_SYNPX/10-140--ILERTLLA----------S.....WPE----------------------------EGCALLIGS--------------
A3Z8Z4_9SYNE/8-143--VLKRTLAA----------P.....APE----------------------------EGCALLLGS--------------
A9BCQ7_PROM4/10-152--VLIKSLLI----------K.....FPQ----------------------------EGCALLLGK--------------
Q7V9V1_PROMA/10-154--ILSSSLLT----------V.....KPE----------------------------EGCALLLGK--------------
Q46IP8_PROMT/10-154--VLSRFLKA----------A.....EPE----------------------------EGCCILIGK--------------
Q3MEG9_ANAVT/9-148--TILSHAES----------V.....YPE----------------------------ECCGLIMGY--------------
B2J4Y6_NOSP7/5-138--TIRAHAES----------T.....YPE----------------------------ECCGIILGY--------------
Q2JJY1_SYNJB/6-136--SIRQHGEQ----------A.....FPH----------------------------ESCGILIGE--------------
Q2JS00_SYNJA/6-136--AIRQHGEQ----------A.....FPY----------------------------EGCGILIGE--------------
A9W9Z2_CHLAA/6-141--AIAAHAEA----------T.....YPD----------------------------ECVGLLVGT--------------
Q2IF99_ANADE/8-141--RISALCEA----------D.....PER----------------------------EVCGFVVRR--------------
O64333_BPN15/2-106--AIMAHAAA----------E.....YPR----------------------------ECCGVVAQK--------------
Q9MCU3_BPHK0/2-106--AIMAHAAA----------E.....YPR----------------------------ECCGVVAQK--------------
Q8W6T2_9CAUD/12-125--AIEAHALA----------E.....YPR----------------------------ECCGLVVKT--------------
A3EHW4_VIBCL/1-109--NLLLHAQT----------A.....YPQ----------------------------ECCGLLIQV--------------
Q02TC3_PSEAB/4-108--AIAAHAAR----------E.....HPR----------------------------ECCGLIVRG--------------
Q8XYR3_RALSO/2-105--AARRHAAR----------E.....HPR----------------------------EACGLVVVV--------------
C6TYU0_BURPE/2-115--AIEAHALA----------E.....YPR----------------------------ECCGLVVKT--------------
A9APW0_BURM1/2-115--AIADHALA----------E.....YPR----------------------------ECCGLIVRT--------------
A4TT77_YERPP/1-112--EIYLTAIK----------R.....YPN----------------------------EACGFLVRT--------------
Q6XQC1_BPT1/3-111--EIMTHAQE----------E.....YPR----------------------------ECCGVVTQK--------------
F0A4T4_NEIME/7-109--EMLACAEE----------A.....VPS----------------------------EMCGVLVFS--------------
D9PEJ9_ACTPL/3-105--EILAHAKK----------S.....EPQ----------------------------ESCGFVVSG--------------
Q3Z1B1_SHISS/1-103--AILAHARR----------C.....APA----------------------------ESCGFVVRT--------------
E6BUJ9_ECOLX/1-103--AILAHARR----------C.....APA----------------------------ESCGFVVST--------------
Q7WX35_CUPNH/81-188--EFAAMARA----------A.....HPK----------------------------ETGGWVVWN--------------
A1VVA1_POLNA/80-189--EFAVLAKS----------T.....LPN----------------------------EVAAAMVWN--------------
A0R7L0_PELPD/81-188--RFMVEAKE----------R.....FPL----------------------------ECAAWFTWD--------------
Q8XYU8_RALSO/133-242--AFIEAARK----------A.....APN----------------------------EHAAWVVWD--------------
Q21Q53_RHOFD/82-191--EFLHQARA----------A.....APN----------------------------ETAAWIVFN--------------
Q120V3_POLSJ/78-187--KFVQDAKA----------A.....MPN----------------------------EMAAAVIWN--------------
Q5NUW4_RALME/76-183--EFTDMARA----------A.....YPN----------------------------ETGAFVVWN--------------
Q8ZSF0_NOSS1/58-173--LKVPKVPC----------Q.....AIA----------------------------EIINAASIN--------------
A4JUM8_BURVG/81-187--EFHAMARA----------A.....LPN----------------------------EVGAWIVWN--------------
Q5NXB5_AROAE/80-200--RFAGIARE----------S.....CPL----------------------------EAAGWITWN--------------
Q11ZD2_POLSJ/78-182--RFVLQARA----------A.....TPM----------------------------ETAAWIVWE--------------
Q47D11_DECAR/80-200--AFIEAARR----------G.....LPN----------------------------EVAGALIYS--------------
Q8PFM8_XANAC/617-745--QLLGERAS----------S.....LPL----------------------------ETGGILLGV--------------
A1U033_MARAV/627-755--CMSSLREN----------E.....LPN----------------------------ETGGVLVGF--------------
A1VVG1_POLNA/619-747--QLRDLRTK----------G.....FPN----------------------------ETGGVLIGY--------------
Q5HY19_GLUOX/596-724--AMRTYRQK----------A.....APN----------------------------ETGGILIGT--------------
A3U023_9RHOB/617-745--RIAAMRDE----------C.....LPD----------------------------ETGGILLGV--------------
Q3J4T5_RHOS4/19-143--KMAEFAAK----------R.....SQR----------------------------ETGGILIGH--------------
B6F186_CLOPF/572-698--RILNELNN----------S.....KPN----------------------------ETGGILLGN--------------
A9BTW4_DELAS/624-751--AIHADALR----------W.....GAL----------------------------ETGGALIGR--------------
A4AAI2_9GAMM/624-751--AIHADALR----------W.....GAL----------------------------ETGGALVGR--------------
A1U5J0_MARAV/600-724--LMKECRAS----------A.....GKN----------------------------ETGGAIIGR--------------
Q2LTW5_SYNAS/612-744--EMHTWVRR----------SALIYGEKA----------------------------ETGGILFGG--------------
Q21PA7_SACD2/610-735--NIRDQIER----------ES..KGSSV----------------------------EQGGVLAGM--------------
Q3SNL7_NITWN/223-347--KIAEEVAR----------H.....PAV----------------------------ETGGVLVGT--------------
D3GMN5_9ENTR/45-166--LKSYRQMQ----------Y.....VST----------------------------EAGGVLIGE--------------
C6YLL5_VIBCL/21-142--LLSYRQLH----------H.....LTP----------------------------ESAGVLIGE--------------
Q4FRY9_PSYA2/20-141--LTSYRQLS----------D.....SSP----------------------------ESAGVLIGE--------------
Y4QB_RHISN/8-136--AMLKDASR----------W.....HDL----------------------------ETGGTFMGY--------------
A0AW82_ARTS2/13-145--DLVEQARL----------Y.....APA----------------------------ETGGILVGH--------------
A5G3M8_GEOUR/23-151--IHGYIQND----------R.....HKP----------------------------EGGGVMLGR--------------
Q2L5J9_CLOPF/14-141--MDSYKQLN----------S.....NDK----------------------------EKGGILIGY--------------
Q2NDB2_ERYLH/5-124--ALLAETSL----------A.....HPL----------------------------ECCGILLGE--------------
Q2K8Q5_RHIEC/6-134--TLTTALRS----------A.....GDK----------------------------EIGGQLFGE--------------
Q8KGW0_RHILI/15-149--HAHLRSVG----------R.....EGN----------------------------EGMALWVGV--------------
Q2K2A8_RHIEC/65-199--HEHLAEVG----------R.....SGY----------------------------EGLGLWVGT--------------
C5ATD4_METEA/9-143--LDRLRVGG----------R.....RGE----------------------------ERAVLWLAR--------------
Q13F65_RHOPS/9-143--ISIIRRDG----------N.....RGE----------------------------ERVALWLAT--------------
Q6YRV1_SYNY3/11-152--ELRKSLWH----------S.....DGK----------------------------EKAAYLICG--------------
A4JA90_BURVG/13-148--QLRRHLSP----------G.....DGK----------------------------EAVAIALCG--------------
A1VQ27_POLNA/13-152--ALRALLHR----------E.....NGS----------------------------EAAAYVLFG--------------
Q1QNK4_NITHX/10-142--ALRAHLFP----------G.....DGN----------------------------ESAAILLCA--------------
Q2IDP5_ANADE/4-131--RALDAELG----------G.....HPP----------------------------ERGGALLGP--------------

PF05021

Q380R2_ANOGA/286-599.ESNRDSIRL.LDD..PHDADVDELARQL..G------------------------LQRVGWIFTD--------------
NPL4_CRYNJ/281-610.EGELDGLTVETPW..SDESRVQEIAKWCDKG------------------------LSVVGMIYTD--------------
NPL4_MAGO7/285-589.VDEVDGVSL.NSW..DNEKDVNQVARLC..G------------------------LEPVGAIWTD--------------
NPL4_PICST/268-574.SGELDGITM.LPW..ENEAEVDAIASEL..G------------------------IYKVGVVFTD--------------
NPL4_DEBHA/260-563.SGELDGLTL.LPW..ENERQVDEIAASL..G------------------------LYKVGMTFTD--------------
NPL4_DROME/282-593.ESTRDSINI.QPD..EFADDVDAVASAL..G------------------------LKKIGWIFTD--------------
NPL4_CANAL/286-595.HDELDGITL.LDWDQQEEKMVDQVANKF..G------------------------LYKVGIIFTD--------------
NPL4_PICGU/288-564.AGETDGITL.LPW..ENQELVLKVAEKL..N------------------------LYPVGIAFTD--------------
Q5CYK6_CRYPI/214-488DEKAEPGKLILEND..SFKSTVDRVAQSL..G------------------------LECLGLVFTH--------------
A8X418_CAEBR/151-470.HCREDGIEF.LED..KNEKIVDKLLEML..G------------------------LQRVGWIFTD--------------
NPL4_COCIM/290-605.VDEVDGITL.REW..ENERDVDEVAKLC..G------------------------LEKVGVIFTD--------------
NPL4_ASPOR/287-599.VDEIDGVTL.HEW..HNEKEVDEVARLC..G------------------------LEKVGVIFTD--------------
NPL41_ARATH/156-410.QGMEDNLILMRDS..EEEKRVDAIALGL..G------------------------MRRVGFIFNQ--------------
A7AUE8_BABBO/207-478.HSTLCDVEF.LPD..EFISTVDAIAARL..G------------------------LERIGHILTH--------------
NPL4_SCLS1/289-608.VDELDGITL.NKW..ESEKDVDEMARLC..G------------------------MERVGVIWTD--------------
Q63ZR4_XENLA/250-559.IGTQNSLQL.LDD..PKSNVVDGIAAKL..G------------------------LRKVGWIFTD--------------
NPL4_KLULA/265-593.HDEQDGLTMDMDQVVKEVEDTDKLAREM..G------------------------LERIGMIFTD--------------
NPL4_AJECN/292-589.VGEVDGVTL.HEW..GNEKDVDEVAKFC..G------------------------LEKIGVIFTD--------------
A7SZA1_NEMVE/172-484.EGTPDSLEL.LPN..TNLDTVNKLAADL..G------------------------LRIVGWIFSD--------------
NPL4_VANPO/248-566.HDEQDGLTMDLEQVEEEMQKVDQIAMSM..G------------------------LLRVGLIFSD--------------
NPL4_CANGA/260-578.HDEQDGITMDMEQVTQELNTIDLLAKEM..G------------------------LLRVGMIFSD--------------
Q8I426_PLAF7/256-527.FCEDNKIHL.LED..DFLPTVDLIAERL..G------------------------LERIGWIFTH--------------
Q2HAC4_CHAGB/250-562.VDEVDGVSL.NPW..ENQEEINTIARYC..G------------------------LEQVGVIWTD--------------
Q01AR0_OSTTA/156-409.EGTEDDVEVLENT..QEDHNAECLASSM..G------------------------LTRVGCIIST--------------
NPL4_YEAST/259-577.HDEQDGLTMDVEQVKNEMLQIDRQAQEM..G------------------------LSRIGLIFTD--------------
A5KB05_PLAVS/256-527.INEVDKVKL.LPD..DFLPSVDVIANRL..G------------------------LERIGWIFTH--------------
NPL4_DICDI/319-563.ECKDKQTPTLLPD..PLADKIESMASML..G------------------------LTRVGWIFSH--------------
Q8SRJ9_ENCCU/202-474.EDYPDGFVI........TGSMDAPFSGT..G------------------------LEIVGMIYTD--------------
NPL4_ASHGO/241-560.HDEQDGLTMDTVAVRVSVAAVDAIAADM..G------------------------LMRLGMIFTD--------------
A0C810_PARTE/307-574.KGTFGHVDL.LQD..PAQSHADEIATSL..G------------------------MEKIGWIFTN--------------
A4RW87_OSTLU/156-413.EGTEEDVEVLEDT..LEDEKADALAGAL..G------------------------MIRVGCIIST--------------
NPL4_PHANO/275-593.VNELDGISL.GDW..DNEKEIDEIAAQC..G------------------------LQRVGVIFTD--------------
NPL4_LODEL/287-597.HDELDGLTL.LDW..EDEPIVDAIAAKL..G------------------------LQKVGIVFTD--------------
Q7RED9_PLAYO/245-516.FCEGDKVRL.LPD..DFMNNVDLIAEKL..G------------------------LEKIGIIFTH--------------
A5BEN5_VITVI/154-392.QGTEENLILMRDT..DEERLVDAIAMGL..G------------------------MXRVGFIFTQ--------------
NPL4_NEUCR/276-588.VDEIDGVTL.NAW..ENEKDVNEVARLC..G------------------------LEPVGVIWTD--------------

PF03665

U172_ARATH/8-208--SQNAYIKL----------VLHSLRHKT---------------------------AAVNGVLVGRI.............
Q4SKU7_TETNG/1-192--SCRAYVKM----------YLHCCLFPR---------------------------CSINGLLLSS..............
Q4PCQ4_USTMA/4-202--SPLAYKKL----------ILHTAKYPT---------------------------ARVLGFLVAE..............
Q53Y03_HUMAN/1-204--TTQAYCKM----------VLHGAKYPH---------------------------CAVNGLLVAE..............
U172_DICDI/2-192--TTEALSKA----------HLHSFKHHA---------------------------SSVNGILLGK..............
F158A_HUMAN/1-193--SALAYVKM----------CLHAARYPH---------------------------AAVNGLFLAP..............
A4H4X4_LEIBR/5-249--SPEAYTKA----------LLHCYKYPA---------------------------QPVMGMLVGKRLNDDAGAAAQSTG
Q8IHW7_PLAF7/3-195--DDGAYAKI----------FMHSIKYSC---------------------------DDVCGILIGKYLS...........
U172_DROME/1-194--SERAYAKL----------IFHAAKYPH---------------------------QAVNGLLLAE..............
Q1W2L0_SALBI/3-198--RQNAYLKL----------ILHALKHKA---------------------------SAVNGVLVGR..............
Q6P4M9_XENTR/1-196--TTQAFCKM----------MLHSAKYPY---------------------------CTVNGILVAQ..............
Q3B8G2_XENLA/1-193--TTRAYVKM----------FLHTARYPH---------------------------STVCGALLGH..............
Q4DRE9_TRYCC/6-215--SVEAHAKA----------LLHCQKYPT---------------------------QAVSGFLIGKRLTE..........
A5K556_PLAVS/3-196--ENAAYAKM----------FMHGLKNSY---------------------------DDVCGILIGKYSD...........
Q17EH7_AEDAE/1-189--SARAYCKM----------MLHAAKYPH---------------------------LAVNGLLLGA..............
Q5DA93_SCHJA/2-187--SELPFLKM----------ILHAAKHPE---------------------------CSVNGLLLSD..............
Q93568_CAEEL/2-186--QALPYSTI----------ILHCLKYPA---------------------------KGVFGLLIGN..............
A5APP0_VITVI/4-206--AQNAYIKL----------VLHALKHKT---------------------------AAVNAVLLGRLVT...........
Q5TPN5_ANOGA/1-188--DPRAFCKI----------MLHAAKYPH---------------------------LAVNGILLAE..............
Q8AWD7_DANRE/1-192--SCLAYAKM----------YLHASQFPR---------------------------CSVNGLLLSS..............
Q8L439_CHLRE/2-202--DQTALLKI----------LAHAAKYPS---------------------------NSVNGVLVGT..............
A4HT47_LEIIN/5-249--SPEAYTKA----------LLHCYKYPA---------------------------QPVMGMLVGKRLSDDAGAAAQSSG

PF01398

D1039_DICDI/532-641--IVHGEVFQ----------EFMRLAENNTKRS.......................IETCGILSGT--------------
PSDE_DICDI/26-139--HISSLALL----------KMLQHARAGVPL.........................EVMGLMLGE--------------
CSN5_YEAST/66-190--LISKLSCE----------KITHYAVRGGNI.........................EIMGILMGF--------------
PSD7_DROME/6-121--IVHPLVLL----------SVVDHFNRMGKIGN.....................QKRVVGVLLGC--------------
RPN8_YEAST/3-116--TIAPLVLL----------SALDHYERTQTKE......................NKRCVGVILGD--------------
RPN11_SCHPO/25-138--YISSLALL----------KMLRHGRHGTPM.........................EVMGLMLGE--------------
CSN5_CAEEL/51-165--KISAIALL----------KMTMHAKRGGNL.........................EIMGLLQGR--------------
EIF3F_ARATH/23-133--RIHPLVIF----------NVCDCFVRRPDSA.......................ERVIGTLLGS--------------
EIF3F_HUMAN/87-196--RLHPVILA----------SIVDSYERRNEGA.......................ARVIGTLLGT--------------
O59157_PYRHO/26-138--MILVLPKN----------IIEEIITRSRESK.......................IEICGFIFGT--------------
BRCC3_HUMAN/7-148--HLESDAFL----------VCLNHALSTEKE.........................EVMGLCIGE--------------
O61792_CAEEL/36-151--TVHPLVLL----------SVVDHFNRVSKTQS.....................VKRVVGVLLGS--------------
O27052_METTH/17-118--VVDSEVMD----------EVLEIARRSHPH.........................EFAALLEGR--------------
EIF3H_HUMAN/34-146--QIDGLVVL----------KIIKHYQEEGQGT.......................EVVQGVLLGL--------------
EIF3F_CAEEL/2-117--NVHPGVYM----------NVVDTHMRRTKSSAKN.................TGQEKCMGTLMGY--------------
YPT5_CAEEL/24-137--NISSLALL----------KMLRHARSGIPL.........................EVMGLMLGD--------------
RPN8_SCHPO/12-125--IVHPLVLL----------SAVDSYNRSAKGT......................KRRVVGILLGQ--------------
EIF3F_SCHPO/18-129--VIEPAVLF----------SILDHSTRKSENN.......................QRVIGTLLGT--------------
MEC_MYCBO/6-114--VIRADLVN----------AMVAHARRDHPD.........................EACGVLAGP--------------
CSN6_HUMAN/36-148--ALHPLVIL----------NISDHWIRMRSQEG....................RPVQVIGALIGK--------------
EIF3H_CAEEL/10-139--LLDSLVVM----------KIVKHVDSELHAGISE.................VSGDACAGVLTGL--------------
STABP_HUMAN/252-361--VVPGRLCP----------QFLQLASANTARG.......................VETCGILCGK--------------
BRCC3_MOUSE/7-148--HLESDAFL----------VCLNHALSTEKE.........................EVMGLCIGE--------------
PSD7_ARATH/12-125--VVHPLVLL----------SIVDHYNRVAKDS......................SKRVVGVLLGS--------------
CSN6B_ARATH/6-136--KLHPLVML----------NISDHFTRVKTQLNPPAASCATGNGSNNADAMLLQNPRVYGCVIGL--------------
CSN5B_ARATH/54-168--HISALALL----------KMVVHARSGGTI.........................EIMGLMQGK--------------
O13386_HYPJE/11-125--SVAPLVLL----------SAVDHYNRTVTSKT.....................KRRVVGVLLGQ--------------
PRP8_HUMAN/2099-2205--ILPKNVLK----------KFICISDLRAQI...........................AGYLYGV--------------
CSN5_SCHPO/30-144--KISAVALL----------KMLRHVSQGMPL.........................EVMGYVQGK--------------
O16155_SCHMA/21-128--DVSLVVDT----------KVILQNQN...............................ITFDVGH--------------

PF15659

D3IMU4_9BACT/335-480------------.--------------------DKRN-------------------------.VNFIIRTD---------
D3IMY5_9BACT/92-252------------.--------------------SKDN-------------------------.TSFNLIST---------
D1PWX0_9BACT/114-279------------.--------------------FKGK-------------------------.RGLNYITT---------
G9S3Z7_9PORP/207-377------------.--------------------ESGN-------------------------.NGLNIIST---------
C6IIY2_9BACE/879-1045------------.--------------------MDGK-------------------------.RTFILGTN---------
D0TNF7_9BACE/83-238------------.--------------------DKGD-------------------------.KTAIIGTS---------
E4RWK9_LEAB4/231-388------------.--------------------SKGG-------------------------TEVSVLRTD---------
C6IJD1_9BACE/48-220------------.--------------------DNGT-------------------------.RTAVVATD---------
I0TCD6_9BACT/325-474------------S--------------------DNGG-------------------------.VVFKLNSD---------
E2NN46_9BACE/59-211------------N--------------------ENDG-------------------------.STAIIITD---------
E4RXN7_LEAB4/92-255------------.--------------------ENGK-------------------------.VNYSVSTS---------
C9L1R0_9BACE/138-300------------.--------------------DNSI-------------------------.KTAVV.TD---------
E4RWK7_LEAB4/354-517------------.--------------------ENGR-------------------------.VNYSVSTS---------

PF04002

D1N9M0_9BACT/106-227---------------------------------AQNH-------------------------LLCFDVI.P...------
D2BH65_DEHSV/106-228---------------------------------VKSR-------------------------LIKVGHISA...------
Y1917_THICR/102-225---------------------------------QQNQ-------------------------FIQFVPLFT...------
Q1N8A1_9SPHN/109-231---------------------------------SRNM-------------------------LIRDDHMGD...------
Q2N869_ERYLH/27-148---------------------------------DRQR-------------------------YLHDETLTI...------
Y1174_NEIMF/102-224---------------------------------RQNQ-------------------------LIAVRELSR...------
A6GHT1_9DELT/122-244---------------------------------ARQR-------------------------VLLVRTIAV...------
C0ABZ0_9BACT/117-246---------------------------------ARMR-------------------------LLRCVEITS...------
Q0HVT6_SHESR/47-168---------------------------------NQHQ-------------------------LLEFKELFF...------
B3EB20_GEOLS/42-163---------------------------------GKNR-------------------------IVCFDRVSI...------
Q03YZ9_LEUMM/73-198---------------------------------TQLN-------------------------VIGWEVVFV...------
Q7P812_FUSNV/110-232---------------------------------SSNE-------------------------VIEFEENSI...------
Q30YK7_DESDG/103-225---------------------------------RQNR-------------------------LLAWERATR...------
Y3180_DESHY/105-227---------------------------------TKNH-------------------------VLGISSISV...------
A8ZUS2_DESOH/106-228---------------------------------AKNR-------------------------VIVVETLSE...------
A4BXR1_9FLAO/24-149---------------------------------NANE-------------------------VLGIHALSK...------
A5LVX8_STRPN/103-225---------------------------------TQNQ-------------------------IIHQQTIFI...------
Q7NFQ9_GLOVI/117-239---------------------------------VKNR-------------------------LIAHRIVSV...------
Q8ABN2_BACTN/26-150---------------------------------RANK-------------------------ALGISLISK...------
A8MGD7_ALKOO/25-146---------------------------------SSNY-------------------------AINVAILNI...------
A6EEF9_9SPHI/26-151---------------------------------TSGI-------------------------VLGLLPVAS...------
A3U7J3_CROAH/109-231---------------------------------NSNK-------------------------VIQQTQLSK...------
Q5Z1A3_NOCFA/105-224---------------------------------TQHR-------------------------LRRHVFVAE...------
Q2SAG7_HAHCH/49-171---------------------------------TQNR-------------------------LIAYEVLFR...------
A5G1T0_ACICJ/119-241---------------------------------NRNR-------------------------LLADEVASR...------
A9B8G6_HERA2/79-201---------------------------------TQAH-------------------------IIGMHTVVV...------
Q0F0W4_9PROT/139-261---------------------------------QQHR-------------------------LLTTQILFE...------
A4YL64_BRASO/115-237---------------------------------KRNQ-------------------------LIADEVQQT...------
Y1557_THEMA/101-222---------------------------------TKLN-------------------------VIGENTLTV...------
Q1NUQ1_9DELT/108-231---------------------------------ASYG-------------------------ILALEELAV...------
Y1125_HAEI8/99-221---------------------------------NQHR-------------------------LIKKERLFL...------
A7AJ21_9PORP/104-226---------------------------------RSSL-------------------------VIEKVKISQ...------
A6NZB7_9FIRM/107-229---------------------------------GKGK-------------------------YLGCPKVGE...------
A5ZSZ3_9FIRM/23-146---------------------------------ADLT-------------------------PINMNIVSV...------
A8ZYJ4_DESOH/28-150---------------------------------TKNR-------------------------ILAMEKMFT...------
Y086_PSESM/102-224---------------------------------NKHR-------------------------VMTFEILFR...------
A4XHM1_CALS8/103-225---------------------------------TQLN-------------------------VIHSVPLFE...------
B2JE00_BURP8/120-242---------------------------------TRHR-------------------------LIRSEENSR...------
Y611_CHLTE/100-222---------------------------------TKNQ-------------------------ILRHETITI...------
Y1610_AQUAE/110-231---------------------------------LSNR-------------------------LLDWEVVAI...------
B0V642_ACIBY/120-242---------------------------------AELR-------------------------KLHFKKLFF...------
A4ITX8_GEOTN/9-125---------------------------------TKNE-------------------------VVAVHRCHI...------
Q7VMM9_HAEDU/35-157---------------------------------TQNR-------------------------LIRFEKLFF...------
Y491_PSYWF/102-224---------------------------------NGLN-------------------------LLDYKVLFV...------
Y4865_PHOLL/108-230---------------------------------NQNR-------------------------VICHEEMFK...------
Y371_SYMTH/110-232---------------------------------AKNQ-------------------------VIDVECVSE...------
A5Z7J1_9FIRM/22-146---------------------------------SKLQ-------------------------PLNFNLVSI...------
Q02HM7_PSEAB/85-202---------------------------------AQWR-------------------------.....ALFR...------
Q2S840_HAHCH/1-123---------------------------------NQHR-------------------------VIEFDLMFR...------
A5EYF9_DICNV/276-401---------------------------------QKNQ-------------------------YLAYERIGQAFG------
A0Z2T6_9GAMM/98-220---------------------------------TQRQ-------------------------LLACRDMFF...------
A4NTE0_HAEIF/34-156---------------------------------RTHR-------------------------LIKSEVMFQ...------
A6EKP4_9SPHI/26-151---------------------------------CQSV-------------------------VLGVMTVAT...------
Q5P8G7_AROAE/74-196---------------------------------ARNH-------------------------LILAEEAFR...------
Q5PA32_ANAMM/108-230---------------------------------KKYR-------------------------IIADEIQNT...------
A3ER13_9BACT/109-231---------------------------------QRHR-------------------------LQNAVRISE...------
Y1515_LACLM/103-226---------------------------------GQNQ-------------------------IIEKKTIFI...------
A6DQ92_9BACT/32-161---------------------------------TKNF-------------------------ITGYCEVSR...------
A9KL05_CLOPH/109-231---------------------------------TKSK-------------------------LLREEIISI...------
Q2IEL9_ANADE/81-203---------------------------------VRGR-------------------------LIRTERVAQ...------
Q2QJL1_ACEAC/25-147---------------------------------DQHQ-------------------------LLADDIMGQ...------
Y341_CARHZ/104-226---------------------------------TKNQ-------------------------LCGENIVAI...------
Q03EP2_PEDPA/97-219---------------------------------TKNQ-------------------------IKREIVVFK...------
A5KLJ1_9FIRM/109-231---------------------------------TRCR-------------------------LIGECNVSE...------
A5FBM2_FLAJ1/31-156---------------------------------QSNR-------------------------VLGIYEVSS...------
A3CRJ6_METMJ/102-223---------------------------------GAGA-------------------------VIERRIVTV...------
Q1Q559_9BACT/9-136---------------------------------NKNV-------------------------IQYIELVSL...------
Q042N7_LACGA/84-206---------------------------------SKNK-------------------------IIAEKLIFQ...------
Q2B8H5_9BACI/107-228---------------------------------TKHQ-------------------------LISRKEIYK...------
Q2LSS5_SYNAS/184-306---------------------------------TQNR-------------------------IIAFETIQK...------
A4SZN2_POLSQ/113-235---------------------------------PRLH-------------------------LIECQELFR...------
Y1765_PARUW/107-229---------------------------------TKGY-------------------------LITYEVISI...------
A6EEP6_9SPHI/39-153---------------------------------KRMS-------------------------VLGIVTIGS...------
A4XJG8_CALS8/36-160---------------------------------LQLN-------------------------VTAVFEVAR...------
Q11VY8_CYTH3/111-233---------------------------------RANR-------------------------IEKKIRIST...------
A0LNF4_SYNFM/102-224---------------------------------STND-------------------------LIQMEEIQR...------
A7FEQ9_YERP3/38-160---------------------------------NRHR-------------------------LMASETVSV...------
Y1850_BORPA/103-225---------------------------------ARLK-------------------------LIICAEVAR...------
Q8GFV0_CITFR/27-149---------------------------------CHNG-------------------------VIAFEELFK...------
Q5NML0_ZYMMO/19-141---------------------------------AEGN-------------------------ILAVIGENV...------
Q72Q17_LEPIC/104-226---------------------------------PEGA-------------------------VLRAEVVAV...------
Q5FNC5_GLUOX/112-229---------------------------------NRNR-------------------------LLADEAA.....------
B8CX04_HALOH/118-240---------------------------------EDNY-------------------------LITWEFLGE...------
A5TXI1_FUSNP/685-807---------------------------------GGYN-------------------------ISEVVTISQ...------
A5Z6A2_9FIRM/108-230---------------------------------TKCH-------------------------LIKDMTITK...------
A3D8H4_SHEB5/24-146---------------------------------TQHT-------------------------INCVEVVAT...------
Y852_LACSS/100-222---------------------------------VKNQ-------------------------IIQIKQLYL...------
Y2338_SALRD/110-232---------------------------------TANV-------------------------IIGDYTVSE...------
Y1989_LEGPC/102-225---------------------------------SQHR-------------------------IIAYEELFS...------
Q5QX33_IDILO/36-152---------------------------------SQHR-------------------------LIDNVEFEE...------
B4S9N8_PROA2/42-165---------------------------------TKNK-------------------------IIGLEMISR...------
A0L491_MAGSM/113-235---------------------------------AQCR-------------------------LLFPALVTE...------
Q6MR78_BDEBA/35-156---------------------------------SQMN-------------------------LVLKEMLFR...------
A9KR89_CLOPH/32-156---------------------------------MKCN-------------------------PLGIFELSH...------
A7V531_BACUN/74-196---------------------------------QAGR-------------------------IIKKVRISV...------
Q3Z6I4_DEHE1/116-238---------------------------------SQHR-------------------------VLEVADLFS...------
A3DJW5_CLOTH/98-219---------------------------------GASE-------------------------VIATRVVSV...------
A9BIK5_PETMO/98-215---------------------------------SKLH-------------------------IITIKDISN...------
Q8PA70_XANCP/37-159---------------------------------TKHH-------------------------ILATEHLFS...------
Q1DAY3_MYXXD/101-223---------------------------------ARNV-------------------------LVHDARVAE...------
Q2GEH3_NEOSM/114-236---------------------------------KKYT-------------------------LIREYVQEL...------
Q4EAK4_9RICK/97-218---------------------------------KRRQ-------------------------LIGEES.YI...------
Q6WB38_ALCFA/54-176---------------------------------HQFR-------------------------LIRYMEISQ...------
A7AC72_9PORP/83-208---------------------------------RANK-------------------------VLGVCHISE...------
Q1WT78_LACS1/101-223---------------------------------TKNQ-------------------------VLSEKVIFK...------
Q7WWR8_COXBE/19-137---------------------------------VFFW-------------------------ITVIASFSS...------
B1YJT0_EXIS2/95-217---------------------------------TKNE-------------------------VISKKTLFI...------

PF14464

O58174_PYRHO/6-109------------DG...................VFEE-------------------------VLIVPKGFF---------
Q8TYS8_METKA/10-115------------I....................DAET-------------------------ITIDSLIVV---------
Q8TQ16_METAC/27-138------------EFAGLL...............QEQD-------------------------GIITEVLIL---------
O27052_METTH/16-131------------EFAALLEGRQ...........EGEV-------------------------LHVTGLIFL---------
B0R451_HALS3/4-126------------EYLGLLRATPASAFDLD....ADDG-------------------------YVVTDVLVI---------
B0R6F4_HALS3/5-124------------....................RDGDL-------------------------RRVTAVRRV---------
Q9I213_PSEAE/7-137------------A...................KVKEG-------------------------TNIQDELHM---------
Q8ZW14_PYRAE/1-111------------SDT...................ALS-------------------------WRWMKNVAA---------
Q9YE90_AERPE/3-117------------RR...................GDTV-------------------------YAYILYRTD---------
O59157_PYRHO/36-149------------K......................NG-------------------------ERFIGKEVE---------
P73582_SYNY3/7-143------------ILIGENGH...............RH-------------------------WQVVEVQPT---------
Q9S2G8_STRCO/5-111------------AG...................EGRP-------------------------ERFIPMLNA---------
Q9RXB3_DEIRA/6-119------------....................VRGEQ-------------------------VQAHALYPL---------
O67597_AQUAE/5-125------------.....................SEGG-------------------------IRIAYEAFE---------
Q216W0_RHOPB/11-140------------GEVRA...............CVNIQ-------------------------DDLKSID..---------
B6C3F3_9GAMM/7-123------------........................N-------------------------GLPSRCYP.---------
A3RXH7_RALSL/5-122------------V......................GS-------------------------DRPARLI..---------
Q0A9H9_ALHEH/13-128------------D.......................G-------------------------RVRRLVL..---------
Q82SH4_NITEU/5-122------------A......................GS-------------------------NLPLRLI..---------
Q2YAE7_NITMU/14-131------------E......................KS-------------------------NLPLRLI..---------
F0DZB5_9PSED/6-123------------S......................GE-------------------------PLAHRVV..---------
Q2SI97_HAHCH/5-122------------E......................GS-------------------------DRPLRLI..---------
Q84HF8_PSEFL/5-121------------I......................DS-------------------------ERATRLI..---------
Q7BNS3_PSEST/6-123------------L......................EA-------------------------QLATRVI..---------
Q82D25_STRAW/5-122------------E......................GS-------------------------GRPERFI..---------
A1SG89_NOCSJ/5-128------------E......................GS-------------------------DRPERLV..---------
Q1AY15_RUBXD/6-127------------DVGG................GTKIV-------------------------VDVWRA...---------
D5HAX1_SALRM/4-126------------VTDD................GDNRV-------------------------AALHRA...---------
Q02B10_SOLUE/5-125------------T......................DG-------------------------ETKLVR...---------
E2TKU9_MYCTU/5-122------------E......................GS-------------------------DRPERHI..---------
Q5Z0V7_NOCFA/5-122------------E......................GS-------------------------DRPERFI..---------
A8L770_FRASN/19-136------------E......................GS-------------------------DRPERHI..---------
Q47MB9_THEFY/5-122------------E......................GS-------------------------DRPERFI..---------
Q2JEP2_FRASC/5-122------------L......................GS-------------------------DRPKRFI..---------
Q7MRV8_WOLSU/6-118------------.......................VE-------------------------GEVKRLF..---------
Q39VC3_GEOMG/6-119------------.......................ID-------------------------GAVSAIF..---------
B3EN74_CHLPB/4-118------------........................G-------------------------KTVIEAY..---------
A3DIG3_CLOTH/5-123------------I....................ENGV-------------------------KYVEKVY..---------
B8FTM5_DESHD/5-124------------R....................DGDD-------------------------RWVERVY..---------
A6TTW0_ALKMQ/7-124------------K....................TDDE-------------------------ILIKKVY..---------
A4XJZ1_CALS8/5-124------------I....................EDEK-------------------------RIVKKVY..---------
Q3AW93_SYNS9/27-153------------GL................RTPRLRL-------------------------VTLWPACNA---------
Q3AML7_SYNSC/5-131------------RT................NSGCLRV-------------------------TTTWPCCNV---------
Q7U4L3_SYNPX/10-140------------QG................EGSSLRL-------------------------DHVWPGCNR---------
A3Z8Z4_9SYNE/8-143------------LV.IGGAS..........TRSTWRV-------------------------HRVWPCCNV---------
A9BCQ7_PROM4/10-152------------KKKETNLS..........KNFFYEI-------------------------SLIWPCCNI---------
Q7V9V1_PROMA/10-154------------SIKAENLE..........GRNIFQI-------------------------ELVWPCCNI---------
Q46IP8_PROMT/10-154------------TNSLTKDH..........KRNIWEV-------------------------THVWNCQNI---------
Q3MEG9_ANAVT/9-148------------V.................ANKAKIV-------------------------VEVIPTANA---------
B2J4Y6_NOSP7/5-138------------M.................AAEDKIV-------------------------VEVMPTENA---------
Q2JJY1_SYNJB/6-136------------I.................RGSDKII-------------------------HELWSVTNT---------
Q2JS00_SYNJA/6-136------------L.................KGADKIV-------------------------HELWAVANT---------
A9W9Z2_CHLAA/6-141------------L.................NGEKKTV-------------------------LQVVTLENR---------
Q2IF99_ANADE/8-141------------RG................LLEVEPI-------------------------PNAADRYHA---------
O64333_BPN15/2-106------------S....................RVER-------------------------YFPCRNLSA---------
Q9MCU3_BPHK0/2-106------------S....................RVEK-------------------------YFPCRNLAT---------
Q8W6T2_9CAUD/12-125------------A....................SGET-------------------------YVPCRNLAA---------
A3EHW4_VIBCL/1-109------------G....................SEKL-------------------------YMACRNSAN---------
Q02TC3_PSEAB/4-108------------V....................RQRR-------------------------YVACRNAAG---------
Q8XYR3_RALSO/2-105------------R....................GRER-------------------------YMACRNVA.---------
C6TYU0_BURPE/2-115------------E....................SGEI-------------------------YVRCRNLAA---------
A9APW0_BURM1/2-115------------A....................AGDV-------------------------YLPGRNVAP---------
A4TT77_YERPP/1-112------------TG...................EKYR-------------------------FMEARNVSE---------
Q6XQC1_BPT1/3-111------------G....................RVQK-------------------------YHRIDNVHR---------
F0A4T4_NEIME/7-109------------Y....................EGYE-------------------------FLPLSNCAE---------
D9PEJ9_ACTPL/3-105------------Q....................DEFF-------------------------YYPCENVAD---------
Q3Z1B1_SHISS/1-103------------P....................EGDR-------------------------YLPSENISG---------
E6BUJ9_ECOLX/1-103------------P....................EGER-------------------------YFPCVNISG---------
Q7WX35_CUPNH/81-188------------A....................DSAS-------------------------FRLVPVQ..---------
A1VVA1_POLNA/80-189------------A....................EQDT-------------------------WRLAARQ..---------
A0R7L0_PELPD/81-188------------T....................YLKR-------------------------FNYYSLH..---------
Q8XYU8_RALSO/133-242------------S....................RTGD-------------------------LAYRELQ..---------
Q21Q53_RHOFD/82-191------------E....................GDRS-------------------------LRLLPME..---------
Q120V3_POLSJ/78-187------------S....................NDHS-------------------------WRYEMRE..---------
Q5NUW4_RALME/76-183------------A....................RTQQ-------------------------FRLVPLR..---------
Q8ZSF0_NOSS1/58-173------------P.....................QQE-------------------------ILFYLGVTN---------
A4JUM8_BURVG/81-187------------S....................VTNE-------------------------FRIVALP..---------
Q5NXB5_AROAE/80-200------------E....................VSNQ-------------------------FAFREVG..---------
Q11ZD2_POLSJ/78-182------------A....................ETCQ-------------------------FRYLPLA..---------
Q47D11_DECAR/80-200------------R....................RNQS-------------------------LRLALCE..---------
Q8PFM8_XANAC/617-745------------V...................DFKLN-------------------------TIHLVDGR.---------
A1U033_MARAV/627-755------------I...................DRKIK-------------------------TISVVLAR.---------
A1VVG1_POLNA/619-747------------Y...................DFNVS-------------------------AVIVVAAL.---------
Q5HY19_GLUOX/596-724------------F...................DLVRN-------------------------ILHIVAAL.---------
A3U023_9RHOB/617-745------------V...................DIPAR-------------------------KIHLADAA.---------
Q3J4T5_RHOS4/19-143------------Y...................SEDLT-------------------------IARIEAAS.---------
B6F186_CLOPF/572-698------------I...................NKNNK-------------------------TIYVTDI..---------
A9BTW4_DELAS/624-751------------I...................SFENR-------------------------TITIAGLV.---------
A4AAI2_9GAMM/624-751------------I...................SFEDR-------------------------TIIIAGLV.---------
A1U5J0_MARAV/600-724------------Y...................DPLLQ-------------------------TVHVTGLV.---------
Q2LTW5_SYNAS/612-744------------R...................DNACR-------------------------VIWVSEVI.---------
Q21PA7_SACD2/610-735------------V...................CHLSK-------------------------TIYVTLVV.---------
Q3SNL7_NITWN/223-347------------C...................SARLR-------------------------TIIVVDLI.---------
D3GMN5_9ENTR/45-166------------R...................RGPHI-------------------------VITHISEP.---------
C6YLL5_VIBCL/21-142------------R...................RGQHL-------------------------VVCDISEP.---------
Q4FRY9_PSYA2/20-141------------R...................RDVHI-------------------------VIKTVSEP.---------
Y4QB_RHISN/8-136------------WS...................DANV-------------------------AVITKMID.---------
A0AW82_ARTS2/13-145------------YTVTKPN..............GQRD-------------------------AVVTDVIG.---------
A5G3M8_GEOUR/23-151------------YII..................DSQD-------------------------VVIDKISF.---------
Q2L5J9_CLOPF/14-141------------.IT..................TDNN-------------------------IIIEYITE.---------
Q2NDB2_ERYLH/5-124------------H.....................NHI-------------------------TAIQP....---------
Q2K8Q5_RHIEC/6-134------------QIE..................PSHF-------------------------RVSTMTIQ.---------
Q8KGW0_RHILI/15-149------------Q................QDQHFAVT-------------------------ETVIPAQR.---------
Q2K2A8_RHIEC/65-199------------V................AAEIATVE-------------------------RALIPQQR.---------
C5ATD4_METEA/9-143------------S................ASAAPTPV-------------------------QEVYEPEQ.---------
Q13F65_RHOPS/9-143------------A................AQRSPAAI-------------------------VEVYEPEQ.---------
Q6YRV1_SYNY3/11-152------------EVSIQADPWTSMP....RKKYLSVE-------------------------VIPIP.DN.---------
A4JA90_BURVG/13-148------------Q.......ASGVR....RNQLLVHE-------------------------VVEVP.YE.---------
A1VQ27_POLNA/13-152------------KAEIAADPWSKQP....RIRLISHE-------------------------VVPIT.SD.---------
Q1QNK4_NITHX/10-142------------A........GPGR....RLKLLARE-------------------------LIPVP.HE.---------
Q2IDP5_ANADE/4-131------------PG...............RPLLTRFE-------------------------PDPGA....---------

PF05021

Q380R2_ANOGA/286-599------------LLSENLASGTVKHVRNIKTHFLTAQ-------------------------ECILAGHLQNKYPNRCKD
NPL4_CRYNJ/281-610------------LTPSPDDITKTLYKRHAQSYTASSL-------------------------EMLLSAAYQLSHPLSTRM
NPL4_MAGO7/285-589------------LLDAGAGDGSVVCKRHADSYFLSSL-------------------------EVCFAARLQAQHPKPSKW
NPL4_PICST/268-574------------LTDSGQKNGTVLCKRHKDSYFLSNL-------------------------EILMAARNQIQHANITKF
NPL4_DEBHA/260-563------------LTDSGAKNGTVLCKRHKNSYFLSCL-------------------------EVIMAAKYQVSNPNITKH
NPL4_DROME/282-593------------LITDDASIGTVKQIRGIESHFITAQ-------------------------ECITAGELQNRHPNPCKY
NPL4_CANAL/286-595------------LTDAGTKNGKVLCKRHKDSYFLTNL-------------------------EIIMAAKFQLKYPNISKY
NPL4_PICGU/288-564------------LTDSGARNGTVLCKRHKDTYFLSCL-------------------------EVLMAARFQIEHPNITKH
Q5CYK6_CRYPI/214-488------------NE...............RDEVLTSN-------------------------EIVTLGKLQLEALKT.PH
A8X418_CAEBR/151-470------------CWTAARAEGTVHYTRHKDSFFLSAE-------------------------ECITAGMLQNAHPNVTDY
NPL4_COCIM/290-605------------LLDSGLGDGTVICRRHIDSYYLSSL-------------------------EVAFAARLQARYPKPSKW
NPL4_ASPOR/287-599------------LLDAGQGDGSVICKRHIDSYFLSSL-------------------------EITFAARLQAQYPKATKW
NPL41_ARATH/156-410------------TV...........TQDKKEYTLSNV-------------------------EVLLAAQLHAES......
A7AUE8_BABBO/207-478------------LP...............RENYLSPQ-------------------------DVIDSAKVQLGRVHK.TH
NPL4_SCLS1/289-608------------LLDSGAGDGTVICKRHIDSYYLSSL-------------------------EIAFAARLQAKHPKPTKW
Q63ZR4_XENLA/250-559------------LVSEDTRKGTVRYSRNKDTYFLSAE-------------------------ECITAGYFQNKYPNLCRL
NPL4_KLULA/265-593------------LTDTGLGDGSVYCKRHKDSFFLSSL-------------------------EVIMAAKHQLRHPNVSKF
NPL4_AJECN/292-589------------LLDAGAGD.................-------------------------EIVFAAQLQARYPKATKW
A7SZA1_NEMVE/172-484------------LVPDDVKKGTVKHLRDINTHFLTAE-------------------------ECIMAGDFQNQYVSPCRY
NPL4_VANPO/248-566------------LTDTGNGNGTVFCKRHKDSFFLSSL-------------------------EIIMAAKHQLAFPNASRF
NPL4_CANGA/260-578------------LTDAGNGDGTVLCKRHKDSFFLSSL-------------------------ETIMAAQHQTRHPNVSKF
Q8I426_PLAF7/256-527------------LP...............RQEYLTSD-------------------------EVVNIAKMQLTNIKKNMH
Q2HAC4_CHAGB/250-562------------LVDAGMGDGTAVCKRHADSYFLASQ-------------------------EVVFAARMQAQHPKPSKW
Q01AR0_OSTTA/156-409------------.............PKDERDFTLSAK-------------------------EVARIARLQSKY......
NPL4_YEAST/259-577------------LSDAGAGDGSVFCKRHKDSFFLSSL-------------------------EVIMAARHQTRHPNVSKY
A5KB05_PLAVS/256-527------------LP...............RKEHLTSE-------------------------EVVQIANLQLANLKKNMH
NPL4_DICDI/319-563------------PS...............RKYTMSST-------------------------EIIQAASYQNKY......
Q8SRJ9_ENCCU/202-474------------ILMER...GSVTSDKVAKGYFLSSL-------------------------EIEFIAKMQLMHPHTVRD
NPL4_ASHGO/241-560------------LTDSGSGDGSVFCKRHKDSFFLSSL-------------------------EVITAARHQLHHRNACRF
A0C810_PARTE/307-574------------VN...............HDCFLSSE-------------------------ELRQAAQYQQ......IY
A4RW87_OSTLU/156-413------------.............PKDERDFTLSAR-------------------------EVSRVARLQSKF......
NPL4_PHANO/275-593------------LLDADKGDGSVICKRHIDSYYLSSL-------------------------EIAFAARYQAKYPRPTKW
NPL4_LODEL/287-597------------LTDSGNRDGTVLCKRHKDSYFLTNL-------------------------EIIMAAKFQIKNPNITKY
Q7RED9_PLAYO/245-516------------LP...............RKEYLTSY-------------------------ELLNIAKLQLANLKNNTH
A5BEN5_VITVI/154-392------------TI...........SQNKKDYTMSNS-------------------------EVLQAAELHGES......
NPL4_NEUCR/276-588------------LLDAGKGDGSAICKRHSDSYFLAAQ-------------------------EICFAARLQAQHPKPTKW

PF03665

U172_ARATH/8-208............SPKDDGV...........VEISDSV-------------------------PLFH..SNL---------
Q4SKU7_TETNG/1-192............GPADGA............VYVTDCV-------------------------PLLH..SHL---------
Q4PCQ4_USTMA/4-202............STSSQS............IDIVDSI-------------------------PLSH..HWT---------
Q53Y03_HUMAN/1-204............KQKPRKEHLPLGGPGAHHTLFVDCI-------------------------PLFH..GTL---------
U172_DICDI/2-192............ADKNS.............ILITDII-------------------------PLFH...TQ---------
F158A_HUMAN/1-193............APRSGEC...........LCLTDCV-------------------------PLFH..SHL---------
A4H4X4_LEIBR/5-249SPNSTHPSLGAASGASSSV...........CYVSDAV-------------------------PLFHTLPMT---------
Q8IHW7_PLAF7/3-195............SNEKKKK...........CLITNYI-------------------------PLFH...TH---------
U172_DROME/1-194............KTSKGSQ...........VEIVDAI-------------------------PLFH..QCL---------
Q1W2L0_SALBI/3-198............FDANKGV...........VEISDAV-------------------------PLFH..LSI---------
Q6P4M9_XENTR/1-196............KQKRKDGHQQ........VLFVDCI-------------------------PLFH..GTV---------
Q3B8G2_XENLA/1-193............KSQHGC............VVLSDCV-------------------------PICH..LYL---------
Q4DRE9_TRYCC/6-215............SGASDS............VFVADAV-------------------------PLFHTIMMT---------
A5K556_PLAVS/3-196............VEKKKQR...........CVITDSI-------------------------PLFH...TH---------
Q17EH7_AEDAE/1-189............KGDQQK..............VVDAV-------------------------PLFH..QCL---------
Q5DA93_SCHJA/2-187............QTLDSK............IIITDYI-------------------------PLFH..SVL---------
Q93568_CAEEL/2-186............KKGDK.............VTVTSCV-------------------------PLCH..EST---------
A5APP0_VITVI/4-206............STDGSHT...........LQISDAV-------------------------PLFH..SQI---------
Q5TPN5_ANOGA/1-188............NGKTST..............IADAV-------------------------PLFH..QCL---------
Q8AWD7_DANRE/1-192............STAGGA............LCITDCV-------------------------PLLH..SHL---------
Q8L439_CHLRE/2-202............AKEGGS............VEILDAI-------------------------PLCH..TTL---------
A4HT47_LEIIN/5-249SPSSPHTSCGAASGTSSST...........CYVSDAV-------------------------PLFHTLPMT---------

PF01398

D1039_DICDI/532-641---------------------------------LSND.........................VFRITTIII---------
PSDE_DICDI/26-139---------------------------------LIDEY........................TIRVIDVFA---------
CSN5_YEAST/66-190---------------------------------TLKD.........................NIVVMDCFN---------
PSD7_DROME/6-121---------------------------------WRSKG........................VLDVSNSFA---------
RPN8_YEAST/3-116---------------------------------ANSS.........................TIRVTNSFA---------
RPN11_SCHPO/25-138---------------------------------FVDDF........................TVRVVDVFA---------
CSN5_CAEEL/51-165---------------------------------IDANS........................FI.ILDVFA---------
EIF3F_ARATH/23-133---------------------------------ILPDG........................TVDIRNSYA---------
EIF3F_HUMAN/87-196---------------------------------VDKH.........................SVEVTNCFS---------
O59157_PYRHO/26-138---------------------------------KNGER........................FIGKEVEFI---------
BRCC3_HUMAN/7-148---------------------------------LNDDT.......................RSDSKFAYTG---------
O61792_CAEEL/36-151---------------------------------MKKDK........................TLDIGNSFA---------
O27052_METTH/17-118---------------------------------QEGE.........................VLHVTGLIF---------
EIF3H_HUMAN/34-146---------------------------------VVED.........................RLEITNCFP---------
EIF3F_CAEEL/2-117---------------------------------YEKG.........................SIQVTNCFA---------
YPT5_CAEEL/24-137---------------------------------FVDDY........................TINVTDVFA---------
RPN8_SCHPO/12-125---------------------------------NNGD.........................VVNVANSYA---------
EIF3F_SCHPO/18-129---------------------------------RSEDG.......................REIEIKSCFA---------
MEC_MYCBO/6-114---------------------------------EGSDR........................PERHIPMTN---------
CSN6_HUMAN/36-148---------------------------------QEGR.........................NIEVMNSFE---------
EIF3H_CAEEL/10-139---------------------------------VFLED.......................SRLEITNCFP---------
STABP_HUMAN/252-361---------------------------------LMRNE........................FT.ITHVLI---------
BRCC3_MOUSE/7-148---------------------------------LNDDIRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVII---------
PSD7_ARATH/12-125---------------------------------SSRG.........................VVDVTNSYA---------
CSN6B_ARATH/6-136---------------------------------QRGR.........................TVEIFNSFE---------
CSN5B_ARATH/54-168---------------------------------TEGD.........................TIIVMDAFA---------
O13386_HYPJE/11-125---------------------------------NDGK.........................NVRVSNSFA---------
PRP8_HUMAN/2099-2205---------------------------------SPPDNP......................QVKEIRCIVM---------
CSN5_SCHPO/30-144---------------------------------VEGA.........................SLIILDSFA---------
O16155_SCHMA/21-128---------------------------------AEDFG........................VIKVVDVFA---------

PF15659

D3IMU4_9BACT/335-480----------------------F-STGGVGV-----------------------------D.....--------------
D3IMY5_9BACT/92-252----------------------S-HKEGSEV-----------------------------G..MRY--------------
D1PWX0_9BACT/114-279----------------------S-HQHSTET-----------------------------G..MAD--------------
G9S3Z7_9PORP/207-377----------------------S-HMTNTEQ-----------------------------S..IPF--------------
C6IIY2_9BACE/879-1045----------------------N-NRNRVSS-----------------------------MYGLTK--------------
D0TNF7_9BACE/83-238----------------------G-REDSV..-----------------------------...FAD--------------
E4RWK9_LEAB4/231-388----------------------H-RSRSV..-----------------------------...RTE--------------
C6IJD1_9BACE/48-220----------------------R-DPYGVDN-----------------------------G...VY--------------
I0TCD6_9BACT/325-474----------------------F-QSTAD.V-----------------------------N.....--------------
E2NN46_9BACE/59-211----------------------H-KEGSVES-----------------------------G...NN--------------
E4RXN7_LEAB4/92-255----------------------H-DLLSTS.-----------------------------...FGK--------------
C9L1R0_9BACE/138-300----------------------K-SEYSVNG-----------------------------T..YAQ--------------
E4RWK7_LEAB4/354-517----------------------H-EIGSTS.-----------------------------...FDK--------------

PF04002

D1N9M0_9BACT/106-227----------------------G-TVDRATV-----------------------------Y--ARE--------------
D2BH65_DEHSV/106-228----------------------G-SLDESVV-----------------------------H--PRE--------------
Y1917_THICR/102-225----------------------G-TINQATV-----------------------------H--IRE--------------
Q1N8A1_9SPHN/109-231----------------------G-SIDQAAI-----------------------------Y--TRE--------------
Q2N869_ERYLH/27-148----------------------G-GENSLVL-----------------------------R--ARP--------------
Y1174_NEIMF/102-224----------------------G-TVAENTI-----------------------------Y--IRE--------------
A6GHT1_9DELT/122-244----------------------G-SLTRVEV-----------------------------H--PRE--------------
C0ABZ0_9BACT/117-246----------------------G-TANSTLC-----------------------------H--ARE--------------
Q0HVT6_SHESR/47-168----------------------G-TLDAASV-----------------------------Y--PRE--------------
B3EB20_GEOLS/42-163----------------------G-SLNQAIV-----------------------------H--SRE--------------
Q03YZ9_LEUMM/73-198----------------------G-TLSQVQA-----------------------------S--PRE--------------
Q7P812_FUSNV/110-232----------------------G-TLDRSSV-----------------------------Y--PRE--------------
Q30YK7_DESDG/103-225----------------------G-TVNASAI-----------------------------Y--PRD--------------
Y3180_DESHY/105-227----------------------G-SLNSSLV-----------------------------H--PRE--------------
A8ZUS2_DESOH/106-228----------------------G-SLTESPV-----------------------------Y--PRE--------------
A4BXR1_9FLAO/24-149----------------------G-STRGTVV-----------------------------D--LKL--------------
A5LVX8_STRPN/103-225----------------------G-SVTRSIA-----------------------------E--PRE--------------
Q7NFQ9_GLOVI/117-239----------------------G-TIDETLA-----------------------------H--PRE--------------
Q8ABN2_BACTN/26-150----------------------G-GMAETVM-----------------------------D--VKI--------------
A8MGD7_ALKOO/25-146----------------------G-NNKNVEV-----------------------------V--PSE--------------
A6EEF9_9SPHI/26-151----------------------G-GIGGVLV-----------------------------D--IRI--------------
A3U7J3_CROAH/109-231----------------------G-GITGTLV-----------------------------D--VRL--------------
Q5Z1A3_NOCFA/105-224----------------------G-AVDRVAV-----------------------------P--VRE--------------
Q2SAG7_HAHCH/49-171----------------------G-AIDEAHI-----------------------------Y--PRE--------------
A5G1T0_ACICJ/119-241----------------------G-TVNHTQV-----------------------------Y--VRE--------------
A9B8G6_HERA2/79-201----------------------G-TLNTAYC-----------------------------R--MAD--------------
Q0F0W4_9PROT/139-261----------------------G-TVDRTAV-----------------------------Y--PRN--------------
A4YL64_BRASO/115-237----------------------G-TVDHTPV-----------------------------Y--PRE--------------
Y1557_THEMA/101-222----------------------G-TSDRSLI-----------------------------H--PRD--------------
Q1NUQ1_9DELT/108-231----------------------G-TLTAATV-----------------------------H--PRE--------------
Y1125_HAEI8/99-221----------------------G-TINVSAV-----------------------------Y--PRE--------------
A7AJ21_9PORP/104-226----------------------G-GISETSA-----------------------------D--LRI--------------
A6NZB7_9FIRM/107-229----------------------G-NVNAAEI-----------------------------N--ARV--------------
A5ZSZ3_9FIRM/23-146----------------------G-SLNEALI-----------------------------N--PRE--------------
A8ZYJ4_DESOH/28-150----------------------G-SLSSTAV-----------------------------Y--PRE--------------
Y086_PSESM/102-224----------------------G-TINASYV-----------------------------H--PRQ--------------
A4XHM1_CALS8/103-225----------------------G-TVKEAVV-----------------------------Y--PRK--------------
B2JE00_BURP8/120-242----------------------G-SLTRMAV-----------------------------Y--PRE--------------
Y611_CHLTE/100-222----------------------G-TLTASLI-----------------------------H--PRE--------------
Y1610_AQUAE/110-231----------------------G-NVNTVFS-----------------------------K--PKD--------------
B0V642_ACIBY/120-242----------------------G-SVQHCAV-----------------------------S--VNQ--------------
A4ITX8_GEOTN/9-125----------------------G-SLNASIV-----------------------------H--PRE--------------
Q7VMM9_HAEDU/35-157----------------------G-TINQASI-----------------------------H--PRE--------------
Y491_PSYWF/102-224----------------------G-GLSSCSV-----------------------------C--VKQ--------------
Y4865_PHOLL/108-230----------------------G-TINKVEV-----------------------------H--PRE--------------
Y371_SYMTH/110-232----------------------G-TLTASLV-----------------------------H--PRE--------------
A5Z7J1_9FIRM/22-146----------------------G-AIDTTIA-----------------------------S--PRE--------------
Q02HM7_PSEAB/85-202----------------------G-TVNAAPM-----------------------------Y--ARV--------------
Q2S840_HAHCH/1-123----------------------G-TYNESTV-----------------------------H--TRE--------------
A5EYF9_DICNV/276-401----------------------S-EVSQVNV-----------------------------S--CRK--------------
A0Z2T6_9GAMM/98-220----------------------G-TLNTAPV-----------------------------Y--PRE--------------
A4NTE0_HAEIF/34-156----------------------G-SVSEISV-----------------------------S--IRE--------------
A6EKP4_9SPHI/26-151----------------------G-GITHVMV-----------------------------D--PKL--------------
Q5P8G7_AROAE/74-196----------------------G-TLTQTSV-----------------------------Y--PRE--------------
Q5PA32_ANAMM/108-230----------------------G-TIDETPL-----------------------------Y--VRE--------------
A3ER13_9BACT/109-231----------------------G-SLSMTLV-----------------------------H--PRE--------------
Y1515_LACLM/103-226----------------------G-AFNHATA-----------------------------S--PRE--------------
A6DQ92_9BACT/32-161----------------------G-LVDRTHV-----------------------------A--CRE--------------
A9KL05_CLOPH/109-231----------------------G-TVNASIM-----------------------------S--PRE--------------
Q2IEL9_ANADE/81-203----------------------G-SVSQCPV-----------------------------S--PRD--------------
Q2QJL1_ACEAC/25-147----------------------G-TVDHTPV-----------------------------Y--PRE--------------
Y341_CARHZ/104-226----------------------G-GVNHAGV-----------------------------S--PGD--------------
Q03EP2_PEDPA/97-219----------------------G-GLNSAEV-----------------------------H--PRE--------------
A5KLJ1_9FIRM/109-231----------------------G-TIDSALV-----------------------------S--PRE--------------
A5FBM2_FLAJ1/31-156----------------------G-GISGTLV-----------------------------D--MRM--------------
A3CRJ6_METMJ/102-223----------------------G-ILNQSLV-----------------------------H--PRE--------------
Q1Q559_9BACT/9-136----------------------G-TLTSAVL-----------------------------G--PRE--------------
Q042N7_LACGA/84-206----------------------G-TVNRAVA-----------------------------H--PRD--------------
Q2B8H5_9BACI/107-228----------------------G-TIDAAIV-----------------------------H--PRE--------------
Q2LSS5_SYNAS/184-306----------------------G-IVNQAVV-----------------------------Y--PRQ--------------
A4SZN2_POLSQ/113-235----------------------G-SITQTAV-----------------------------Y--PRE--------------
Y1765_PARUW/107-229----------------------G-SLSQTLV-----------------------------H--PRE--------------
A6EEP6_9SPHI/39-153----------------------G-GLDGVYV-----------------------------D--PKM--------------
A4XJG8_CALS8/36-160----------------------G-TINTALV-----------------------------S--THE--------------
Q11VY8_CYTH3/111-233----------------------G-GVSGTVA-----------------------------D--PKL--------------
A0LNF4_SYNFM/102-224----------------------G-SVNRTAV-----------------------------F--PRL--------------
A7FEQ9_YERP3/38-160----------------------G-TFNATTV-----------------------------Y--PRE--------------
Y1850_BORPA/103-225----------------------G-TLTQAQI-----------------------------Y--PRE--------------
Q8GFV0_CITFR/27-149----------------------G-TISSVTV-----------------------------H--PRI--------------
Q5NML0_ZYMMO/19-141----------------------G-DCLASYL-----------------------------D--IRN--------------
Q72Q17_LEPIC/104-226----------------------G-SLEEVGV-----------------------------Q--TRD--------------
Q5FNC5_GLUOX/112-229----------------------P-EADSLAE-----------------------------R--NRA--------------
B8CX04_HALOH/118-240----------------------G-TNKPIKL-----------------------------D--PKT--------------
A5TXI1_FUSNP/685-807----------------------G-GADYAKV-----------------------------D--PKH--------------
A5Z6A2_9FIRM/108-230----------------------G-TVNQSLI-----------------------------S--SRE--------------
A3D8H4_SHEB5/24-146----------------------G-SVNGISM-----------------------------R--PVE--------------
Y852_LACSS/100-222----------------------G-TLNSSVA-----------------------------H--PRE--------------
Y2338_SALRD/110-232----------------------G-GLSSSVV-----------------------------E--PRG--------------
Y1989_LEGPC/102-225----------------------G-TINTATV-----------------------------Y--PRP--------------
Q5QX33_IDILO/36-152----------------------G-EELAASM-----------------------------V--YRE--------------
B4S9N8_PROA2/42-165----------------------G-TLNASLV-----------------------------H--PRE--------------
A0L491_MAGSM/113-235----------------------G-TIRQAHV-----------------------------H--PRQ--------------
Q6MR78_BDEBA/35-156----------------------G-TVDFCMI-----------------------------H--PRD--------------
A9KR89_CLOPH/32-156----------------------G-TVNSSLI-----------------------------M--PRE--------------
A7V531_BACUN/74-196----------------------G-GIDQTSA-----------------------------D--IRL--------------
Q3Z6I4_DEHE1/116-238----------------------G-TVASGCV-----------------------------I--PRE--------------
A3DJW5_CLOTH/98-219----------------------G-LVNNVQV-----------------------------H--PRE--------------
A9BIK5_PETMO/98-215----------------------G-TVNMSIA-----------------------------H--PRD--------------
Q8PA70_XANCP/37-159----------------------G-TIDGCDV-----------------------------H--PRV--------------
Q1DAY3_MYXXD/101-223----------------------G-TMNTCPV-----------------------------D--PRE--------------
Q2GEH3_NEOSM/114-236----------------------G-AADHTPL-----------------------------C--MRE--------------
Q4EAK4_9RICK/97-218----------------------G-EMEKAPV-----------------------------Y--IKE--------------
Q6WB38_ALCFA/54-176----------------------G-TISQASV-----------------------------Y--PRE--------------
A7AC72_9PORP/83-208----------------------G-GLNETSA-----------------------------D--IRI--------------
Q1WT78_LACS1/101-223----------------------G-TLNSATV-----------------------------H--PRE--------------
Q7WWR8_COXBE/19-137----------------------K-SFNQASV-----------------------------H--PRE--------------
B1YJT0_EXIS2/95-217----------------------G-GLNTSIV-----------------------------H--PRD--------------

PF14464

O58174_PYRHO/6-109----------------------.-...................................GE--SSV--------------
Q8TYS8_METKA/10-115----------------------P-.......................FEA.........SD--SGA--------------
Q8TQ16_METAC/27-138----------------------P-......................GTES.........SN--TNA--------------
O27052_METTH/16-131----------------------P-.......................SET.........SD--EGA--------------
B0R451_HALS3/4-126----------------------P-......................GTET.........NP--VSA--------------
B0R6F4_HALS3/5-124----------------------P-....................NVADAPRV......RYE--LDP--------------
Q9I213_PSEAE/7-137----------------------A-...................DPRRYPRTAA.....NGY--TFS--------------
Q8ZW14_PYRAE/1-111----------------------.-..................................SPV--FFK--------------
Q9YE90_AERPE/3-117----------------------N-...................LKQSPEEFES.....DPW--QVV--------------
O59157_PYRHO/36-149----------------------.-..................FIRNRLNSSVEFE...MDP--EEM--------------
P73582_SYNY3/7-143----------------------E-NCWGDVE...........EFQQNNHQGNKLHYFAIDP--KVL--------------
Q9S2G8_STRCO/5-111----------------------A-....................RSPTFYEFD.......S--QDL--------------
Q9RXB3_DEIRA/6-119----------------------P-....................NVAADPER......EYL--ADP--------------
O67597_AQUAE/5-125----------------------T-...................PNANPDRKHDRYE..IAP--KDY--------------
Q216W0_RHOPB/11-140----------------------.-.................PARYRHGATAGYTL.....S--VAD--------------
B6C3F3_9GAMM/7-123----------------------.-.................INNIAPEPQRHFFM.....D--PQG--------------
A3RXH7_RALSL/5-122----------------------.-.................PMRNAAQSIDAFRL.....D--AQE--------------
Q0A9H9_ALHEH/13-128----------------------.-.................CRNVAARRADRYLV.....H--ARD--------------
Q82SH4_NITEU/5-122----------------------.-.................PMRNVAQSENFFMF.....D--PQQ--------------
Q2YAE7_NITMU/14-131----------------------.-.................PMRNAAQSETFFKF.....D--PQE--------------
F0DZB5_9PSED/6-123----------------------.-.................PMRNQAASPTWFSF.....D--PRE--------------
Q2SI97_HAHCH/5-122----------------------.-.................PMRNAAASSDMFMF.....D--ARE--------------
Q84HF8_PSEFL/5-121----------------------.-.................PMTNSACSPVYFAF.....D--PRQ--------------
Q7BNS3_PSEST/6-123----------------------.-.................PMRNQAASQTFFRL.....D--SQE--------------
Q82D25_STRAW/5-122----------------------.-.................PMLNAARSPTFYEF.....D--SGD--------------
A1SG89_NOCSJ/5-128----------------------.-.................EMVNAAGSPTFYEF.....D--STE--------------
Q1AY15_RUBXD/6-127----------------------.-.................ENVHEEERSRRFLI.....E--PEQ--------------
D5HAX1_SALRM/4-126----------------------.-.................TNRRSEQRTRRYEL.....T--ADD--------------
Q02B10_SOLUE/5-125----------------------.-............ESIALENAFEGAQAARYEL.....R--PQD--------------
E2TKU9_MYCTU/5-122----------------------.-.................PMTNAERSPTFYRL.....D--SGE--------------
Q5Z0V7_NOCFA/5-122----------------------.-.................AMTNAERSPTFYRF.....D--SGE--------------
A8L770_FRASN/19-136----------------------.-.................PMVNAARSPTFYEF.....D--PAE--------------
Q47MB9_THEFY/5-122----------------------.-.................EMINAERSPTFYRF.....D--SLE--------------
Q2JEP2_FRASC/5-122----------------------.-.................PMENAERSPTFYRF.....D--PME--------------
Q7MRV8_WOLSU/6-118----------------------.-.................PMRNVDASPEHFSF.....D--PAE--------------
Q39VC3_GEOMG/6-119----------------------.-.................RMANTDQSDEHFMM.....D--PKE--------------
B3EN74_CHLPB/4-118----------------------.-.................CLTNIDQSREHFSF.....D--PKE--------------
A3DIG3_CLOTH/5-123----------------------.-.................LLRNIDESPEHFSM.....N--PKE--------------
B8FTM5_DESHD/5-124----------------------.-.................PLNNLDQSPEHFSM.....D--PRE--------------
A6TTW0_ALKMQ/7-124----------------------.-.................ALTNIDQSSEHFSM.....D--PKE--------------
A4XJZ1_CALS8/5-124----------------------.-.................LLTNVDQSPEHFSM.....D--PLE--------------
Q3AW93_SYNS9/27-153----------------------W-KKS............DWVNDALGDLETRFVL.....D--PRE--------------
Q3AML7_SYNSC/5-131----------------------W-GRG............ASGQRPVHDRCRRFLV.....D--PRE--------------
Q7U4L3_SYNPX/10-140----------------------W-GRQPDLQ........PWGAGETPGRDCNFLL.....D--PRE--------------
A3Z8Z4_9SYNE/8-143----------------------W-SPGLAAL........PEPPDASLTRRHRFAL.....D--PRE--------------
A9BCQ7_PROM4/10-152----------------------W-EPEMKSFSEECL..KEDLTQKPPSKTNRFAI.....D--PKE--------------
Q7V9V1_PROMA/10-154----------------------W-SNSINADSERCYELNKTTLFKEGSRENRFLI.....D--PIE--------------
Q46IP8_PROMT/10-154----------------------W-GEEESRLIDQNIEAVSNQKNLQLSKKNCFEI.....Y--AKD--------------
Q3MEG9_ANAVT/9-148----------------------W-ETEADNFTQEIN..QTNITSPASTLKRRYAI.....A--PQV--------------
B2J4Y6_NOSP7/5-138----------------------W-NTEAGA........EFSEKRTAESKRRQYAI.....A--PEV--------------
Q2JJY1_SYNJB/6-136----------------------W-DQ............AENPLADGESSRRRFLI.....D--PAD--------------
Q2JS00_SYNJA/6-136----------------------W-DQ............AENPLADGESSRRRFLI.....D--PAD--------------
A9W9Z2_CHLAA/6-141----------------------W-SGQV..........QLAATDNPHSRRDRFYL.....D--PRD--------------
Q2IF99_ANADE/8-141----------------------.-...............HDPLGFPRTSRDGYLM.....D--PRA--------------
O64333_BPN15/2-106----------------------.-....................................E--PTE--------------
Q9MCU3_BPHK0/2-106----------------------.-....................................E--PTE--------------
Q8W6T2_9CAUD/12-125----------------------.-....................................A--PTD--------------
A3EHW4_VIBCL/1-109----------------------.-....................................Q--PEQ--------------
Q02TC3_PSEAB/4-108----------------------.-....................................S--PSE--------------
Q8XYR3_RALSO/2-105----------------------.-....................................V--GTE--------------
C6TYU0_BURPE/2-115----------------------.-....................................V--PTD--------------
A9APW0_BURM1/2-115----------------------.-....................................T--PTD--------------
A4TT77_YERPP/1-112----------------------.-....................................N--PEN--------------
Q6XQC1_BPT1/3-111----------------------.-....................................D--PEN--------------
F0A4T4_NEIME/7-109----------------------.-....................................N--PHE--------------
D9PEJ9_ACTPL/3-105----------------------.-....................................D--PES--------------
Q3Z1B1_SHISS/1-103----------------------.-....................................E--PEE--------------
E6BUJ9_ECOLX/1-103----------------------.-....................................E--PEA--------------
Q7WX35_CUPNH/81-188----------------------.-....................................I--LEH--------------
A1VVA1_POLNA/80-189----------------------.-....................................S--IEA--------------
A0R7L0_PELPD/81-188----------------------.-....................................A--RQA--------------
Q8XYU8_RALSO/133-242----------------------.-....................................I--TDA--------------
Q21Q53_RHOFD/82-191----------------------.-....................................Y--DGV--------------
Q120V3_POLSJ/78-187----------------------.-....................................N--TTA--------------
Q5NUW4_RALME/76-183----------------------.-....................................I--LAQ--------------
Q8ZSF0_NOSS1/58-173----------------------D-QWWCHTP.............................L--QTA--------------
A4JUM8_BURVG/81-187----------------------.-....................................S--LSH--------------
Q5NXB5_AROAE/80-200----------------------.-....................................V--REA--------------
Q11ZD2_POLSJ/78-182----------------------.-....................................N--ISV--------------
Q47D11_DECAR/80-200----------------------.-....................................P--IEV--------------
Q8PFM8_XANAC/617-745----------------------.-...................................SA--PRD--------------
A1U033_MARAV/627-755----------------------.-...................................PA--PED--------------
A1VVG1_POLNA/619-747----------------------.-...................................PA--PPD--------------
Q5HY19_GLUOX/596-724----------------------.-...................................PA--PPD--------------
A3U023_9RHOB/617-745----------------------.-...................................KA--PAD--------------
Q3J4T5_RHOS4/19-143----------------------.-...................................DE--PPD--------------
B6F186_CLOPF/572-698----------------------.-...................................YI--PKD--------------
A9BTW4_DELAS/624-751----------------------.-...................................EA--PPD--------------
A4AAI2_9GAMM/624-751----------------------.-...................................ET--PPD--------------
A1U5J0_MARAV/600-724----------------------.-...................................EP--PAY--------------
Q2LTW5_SYNAS/612-744----------------------.-...................................GP--PAD--------------
Q21PA7_SACD2/610-735----------------------.-...................................PA--PDG--------------
Q3SNL7_NITWN/223-347----------------------.-...................................EA--PRD--------------
D3GMN5_9ENTR/45-166----------------------.-....................................G--PGD--------------
C6YLL5_VIBCL/21-142----------------------.-....................................G--SGD--------------
Q4FRY9_PSYA2/20-141----------------------.-....................................S--PWD--------------
Y4QB_RHISN/8-136----------------------.-...................................GG--SEA--------------
A0AW82_ARTS2/13-145----------------------.-...................................PG--PAA--------------
A5G3M8_GEOUR/23-151----------------------.-...................................PM--PGD--------------
Q2L5J9_CLOPF/14-141----------------------.-...................................PF--DSD--------------
Q2NDB2_ERYLH/5-124----------------------.-...................................AA--NVH--------------
Q2K8Q5_RHIEC/6-134----------------------.-...................................AR--RGT--------------
Q8KGW0_RHILI/15-149----------------------H-IRTGDGVCV..........................MV--PAE--------------
Q2K2A8_RHIEC/65-199----------------------L-IRSAAGVGV..........................HV--DGT--------------
C5ATD4_METEA/9-143----------------------A-TAE...DYF..........................HL--PPA--------------
Q13F65_RHOPS/9-143----------------------V-VEV...DSF..........................YI--PPA--------------
Q6YRV1_SYNY3/11-152----------------------E-IVSHSPQHI..........................TW--STD--------------
A4JA90_BURVG/13-148----------------------A-CRIREPDAV..........................AW--SVE--------------
A1VQ27_POLNA/13-152----------------------E-MVSSSSVHV..........................TW--STQ--------------
Q1QNK4_NITHX/10-142----------------------A-CSVRKPDRI..........................TW--PGR--------------
Q2IDP5_ANADE/4-131----------------------.-.RASASQWA..........................PS--AGL--------------

PF05021

Q380R2_ANOGA/286-599S...SNGYFGSKFVTVCVTG..D.EKKQVHMEGYAVSAQCMALVRDNCLIPTKD...APELGYIRE.........SSDK.
NPL4_CRYNJ/281-610S...PTGHYSSRFVTCCLTG..D.KDGGVDILAWQASEHAEAMVKAGIVEASVD....PAVVRVRK.........PGEG.
NPL4_MAGO7/285-589S...DTGRFGSNFVTCIISG..N.EQGEIAISSYQVSNEAVEMVRADIMEPSAD....PTVMLVREEEE..DDGSTSRT.
NPL4_PICST/268-574S...SSGQFSSKFVTCVISG..G.LNGEIEPRSYQVSTSAEALVRADIITGSTQ....PSRLYVNS........SNDR..
NPL4_DEBHA/260-563S...NSGRFSSKFVTCVISG..G.MNGEIEPRSYQVSNSAEALIKADIITGSTQ....PSMLYIND........SEGK..
NPL4_DROME/282-593A...SNGVFGSKFVTICVTG..D.KTKQVHMEGYAVSAQCMALVRDNCLIPTKD...APELGYVRE........STDK..
NPL4_CANAL/286-595STAKNNGQFSSKFVTCVISG..G.LNGEIEPRSYQVSTSAEALVKADIITGCTQ....PSQIYVNE........SNNH..
NPL4_PICGU/288-564S...NSGRFSSKFVTCVVSG..G.LEGEIEPRSFQVSTNAEALVRADIITGSTQ....PSMLYINS........SQGK..
Q5CYK6_CRYPI/214-488Y....TGYPVSSFICCTIAPCKSIQGGDPIPNAFAVSDLGLALLRDKIIDEKGLK..DDTHIVIRE........EDKG..
A8X418_CAEBR/151-470S...MDRRYGSKFVTVVASG..D.ESMHVNFHGYQVSNQCAAMVEAEILCPTLY...TPELAYVRET......PLSEA..
NPL4_COCIM/290-605S...ETGRFGSNFVTCILSG..D.ENGAISISAYQASNSAVEMVRADIVEPSAD....PSVMLVQRENELENADTGNA..
NPL4_ASPOR/287-599S...RTGRFGSNFVTCVLSG..D.EEGAISVSAYQASVAAVEMVRADIVEPSAE....PSVMLVQSEED...DSENKS..
NPL41_ARATH/156-410....ELKEWVTAVVKLEINE..D.GGADVHFEPFQMSDMCVRLFKEGWFETEIGPEDDPKLSKLKK..............
A7AUE8_BABBO/207-478Y....TRYPVSTHITCTLHP..D.SEGKPALNAFMVSDTAMALLRDGIIADVQP...DPMVISMRQP.......TNKN..
NPL4_SCLS1/289-608S...DTGKFGSNFVTCVVTA..D.ETGGIAISAYQVSNTAVEMVRADIVEPSAD....PAVMIVRSEGD..DDSDTSA..
Q63ZR4_XENLA/250-559S...PDGHFGSKFVTVVATG..G.PDNQVHFEGYQVSNQCMALVRDECFLPCRD...APELGYAKE........SSSE..
NPL4_KLULA/265-593S...ETGLFSSRFVTCCISG..N.LNQEIDIATYQVSIEAEGLVEADLISGSTH....PSQAYINE........TNDK..
NPL4_AJECN/292-589S...ETGRFGSNFVTCVLSG..D.EDGAISISAYQASNSAVEMVKADIIEPSAD....PGVMLVQQENHS.DDDASKA..
A7SZA1_NEMVE/172-484A...SSGKFGSKFVTVVVSG..N.DENQIGFDGFQVSNQCMALVRDDCLVPTLD...DPGLGYIRE........SSSE..
NPL4_VANPO/248-566S...EQGKFSSKFVTCVVSG..N.LDSEIDITSYQVSIEAEALVDAKMISGSTH....PSMAYINE........TNEE..
NPL4_CANGA/260-578S...EQGIFSSKFVTCVVSG..N.LKEEIDIASYQVSIDAEALVSADMIGGSTH....PSMAYIND........TTED..
Q8I426_PLAF7/256-527Y....TNYPISNFITCTISPDPL.LSNEPVTNAFMVSDLGMALMRDNLIEENQI...DPSHIQLRN........PNKN..
Q2HAC4_CHAGB/250-562S...DTGRFGSNFVTCIISG..N.EKGEISISAYQMSNDAVEMVRADIVEPSAD....PTQMLVRDEEED.DGSPSRT..
Q01AR0_OSTTA/156-409.....GQHFATAVMMTFEDE..D.DNWQVSFEAFQLSDLAIKIYDRGWFTGKCAVDENGEDLKGVS..............
NPL4_YEAST/259-577S...EQGFFSSKFVTCVISG..N.LEGEIDISSYQVSTEAEALVTADMISGSTF....PSMAYIND........TTDE..
A5KB05_PLAVS/256-527Y....TNYSVSNFITCTISPDPM.LSNEPVTNAFMVSDMGMALIRSSLVDSTQT...DPSHIQLRN........PVRN..
NPL4_DICDI/319-563.........GPSFVTLILSV..N.SDGQSNMEAFQVSDQALKLEKTGEFLPTQP...DPTKCKLKS..............
Q8SRJ9_ENCCU/202-474G..GREMEFGSRLATIVVTA..E.KDGSIGLQEYQVSNQCMALVKGGYILPTED....PRRFLATR..............
NPL4_ASHGO/241-560S...DQGFYSSKFVTCVVSG..N.LQGEIDVAAYQVSTDAEALVDADIISGSTH....PSMAYINE........PSAE..
A0C810_PARTE/307-574SIKHPEGCLVSKFLTVVLRTKKD.SPDEVVPEVYMVSDQGQQLENDGIFQNSGR....RKVLQVRD.........AKNEL
A4RW87_OSTLU/156-413.....GKEFVTAVVSTFEDE..D.DNWQVSFEAFQLSDAAMKVQERGWFTGECGVDEDGDELKGVS..............
NPL4_PHANO/275-593S...ETGKFGSNFVTCVISG..D.DQGQIGISSYQASNDAVEMVRADIIEPSAE....PSVMLVQSEDD..NEALNRA..
NPL4_LODEL/287-597A...NLGEFSSKFVTCVISG..G.LQGEIEPRSYQVSSSAEGLVKADIITGSTQ....PSQIYVNG........NNDT..
Q7RED9_PLAYO/245-516Y....TNYNISNFITCTISPDPS.LNNEPITNAFMVSDLGMSLVKYNLINEIQD...DPSHIKLRT........PNKY..
A5BEN5_VITVI/154-392....GLKEWVTAVVKL...................YGERGRRLFKEGWFETDIGEEVDPKLSRMKK..............
NPL4_NEUCR/276-588S...DTGRFGSNFVTCVISG..N.EQGEISISAYQMSNDAVEMVRADIIEPSTD....PGQMLVREEEED.DGSVSRT..

PF03665

U172_ARATH/8-208------------------------------------------------------------ALLPPL--------------
Q4SKU7_TETNG/1-192------------------------------------------------------------PLAPIT--------------
Q4PCQ4_USTMA/4-202------------------------------------------------------------ALAPMA--------------
Q53Y03_HUMAN/1-204------------------------------------------------------------ALAPML--------------
U172_DICDI/2-192------------------------------------------------------------TLLPMF--------------
F158A_HUMAN/1-193------------------------------------------------------------ALSVML--------------
A4H4X4_LEIBR/5-249------------------------------------------------------------APHPML--------------
Q8IHW7_PLAF7/3-195------------------------------------------------------------ILSPYL--------------
U172_DROME/1-194------------------------------------------------------------YVTPMA--------------
Q1W2L0_SALBI/3-198------------------------------------------------------------GLLPAL--------------
Q6P4M9_XENTR/1-196------------------------------------------------------------ALAPVL--------------
Q3B8G2_XENLA/1-193------------------------------------------------------------PLSLSL--------------
Q4DRE9_TRYCC/6-215------------------------------------------------------------HPHPML--------------
A5K556_PLAVS/3-196------------------------------------------------------------ILSPFL--------------
Q17EH7_AEDAE/1-189------------------------------------------------------------HVSPMA--------------
Q5DA93_SCHJA/2-187------------------------------------------------------------NLTPML--------------
Q93568_CAEEL/2-186------------------------------------------------------------PLAPPL--------------
A5APP0_VITVI/4-206------------------------------------------------------------TLLPPL--------------
Q5TPN5_ANOGA/1-188------------------------------------------------------------HVSPMA--------------
Q8AWD7_DANRE/1-192------------------------------------------------------------SLAPIT--------------
Q8L439_CHLRE/2-202------------------------------------------------------------TLAPAL--------------
A4HT47_LEIIN/5-249------------------------------------------------------------APHPML--------------

PF01398

D1039_DICDI/532-641------------------------------------------------------------P--KQE--------------
PSDE_DICDI/26-139------------------------------------------------------------M--PQS--------------
CSN5_YEAST/66-190------------------------------------------------------------L--PVV--------------
PSD7_DROME/6-121------------------------------------------------------------V--PFD--------------
RPN8_YEAST/3-116------------------------------------------------------------L--PFE--------------
RPN11_SCHPO/25-138------------------------------------------------------------M--PQS--------------
CSN5_CAEEL/51-165------------------------------------------------------------L--PVE--------------
EIF3F_ARATH/23-133------------------------------------------------------------V--PHN--------------
EIF3F_HUMAN/87-196------------------------------------------------------------V--PHN--------------
O59157_PYRHO/26-138------------------------------------------------------------R--NRL--------------
BRCC3_HUMAN/7-148------------------------------------------------------------T--EMR--------------
O61792_CAEEL/36-151------------------------------------------------------------V--PFD--------------
O27052_METTH/17-118------------------------------------------------------------L--PSE--------------
EIF3H_HUMAN/34-146------------------------------------------------------------F--PQH--------------
EIF3F_CAEEL/2-117------------------------------------------------------------I--PFN--------------
YPT5_CAEEL/24-137------------------------------------------------------------M--PQS--------------
RPN8_SCHPO/12-125------------------------------------------------------------I--PFE--------------
EIF3F_SCHPO/18-129------------------------------------------------------------V--PHN--------------
MEC_MYCBO/6-114------------------------------------------------------------A--ERS--------------
CSN6_HUMAN/36-148------------------------------------------------------------L--LSH--------------
EIF3H_CAEEL/10-139------------------------------------------------------------T--VRN--------------
STABP_HUMAN/252-361------------------------------------------------------------P--KQS--------------
BRCC3_MOUSE/7-148------------------------------------------------------------L--RRS--------------
PSD7_ARATH/12-125------------------------------------------------------------V--PFE--------------
CSN6B_ARATH/6-136------------------------------------------------------------L--IFD--------------
CSN5B_ARATH/54-168------------------------------------------------------------L--PVE--------------
O13386_HYPJE/11-125------------------------------------------------------------V--PFE--------------
PRP8_HUMAN/2099-2205------------------------------------------------------------V--PQW--------------
CSN5_SCHPO/30-144------------------------------------------------------------L--PVE--------------
O16155_SCHMA/21-128------------------------------------------------------------M--PQS--------------

PF15659

D3IMU4_9BACT/335-480.....------------------EEYY------------------------------AN-MIFH..LHNH..........
D3IMY5_9BACT/92-252TFEK.------------------YKNN------------------------------HN-FTIDYAIHSH..........
D1PWX0_9BACT/114-279LFDKQ------------------LKNG------------------------------YT-LRSN..VHSH..........
G9S3Z7_9PORP/207-377LLNS.------------------QYKY------------------------------NY-SIRG.HIHNH..........
C6IIY2_9BACE/879-1045VQEA.------------------LFPT------------------------------FI-PIID..IHSH..........
D0TNF7_9BACE/83-238KQSE.------------------LNVK------------------------------GD-KVID..MHSH..........
E4RWK9_LEAB4/231-388HLSK.------------------LENA------------------------------GF-TMKD.LKHSH..........
C6IJD1_9BACE/48-220AQNK.------------------LSVK------------------------------GE-KVID..IHSH..........
I0TCD6_9BACT/325-474.....------------------TVNA------------------------------GK-FLFM..LHSH..........
E2NN46_9BACE/59-211AKRR.------------------TAVN------------------------------GR-KKID..IHSH..........
E4RXN7_LEAB4/92-255IGIK.------------------...P------------------------------SN-LIFH..IHNHD.........
C9L1R0_9BACE/138-300KQ...------------------LQIE------------------------------GE-RIID..IHSH..........
E4RWK7_LEAB4/354-517IGIK.------------------...P------------------------------TN-LIFH..IHNHDGDLNNSTAT

PF04002

D1N9M0_9BACT/106-227VLEKA.-----------------INTK------------------------------AT-AVIL--AHNH----------
D2BH65_DEHSV/106-228VFKEA.-----------------LSAS------------------------------AA-TVIL--AHNH----------
Y1917_THICR/102-225VLKTV.-----------------LDHH------------------------------AA-AVIL--AHNH----------
Q1N8A1_9SPHN/109-231VIRRA.-----------------IDLG------------------------------SA-ALIL--VHNH----------
Q2N869_ERYLH/27-148LVHRA.-----------------LTIG------------------------------AG-GLIL--AHNH----------
Y1174_NEIMF/102-224IVKLA.-----------------LDEY------------------------------AD-SLII--AHNH----------
A6GHT1_9DELT/122-244VFRPL.-----------------VRAG------------------------------AH-TCLL--VHNH----------
C0ABZ0_9BACT/117-246VFRDA.-----------------IREA------------------------------AS-ALIL--VHNH----------
Q0HVT6_SHESR/47-168VVKAV.-----------------LAVN------------------------------AA-AVIF--AHNH----------
B3EB20_GEOLS/42-163VFKTA.-----------------CLSN------------------------------AA-AVLL--VHNH----------
Q03YZ9_LEUMM/73-198IFQRV.-----------------LKAN------------------------------AF-GFMI--AHNH----------
Q7P812_FUSNV/110-232IYKKI.-----------------INLN------------------------------AK-SVIL--AHNH----------
Q30YK7_DESDG/103-225LMEAA.-----------------LRYK------------------------------AS-GLIL--VHNH----------
Y3180_DESHY/105-227CFKEA.-----------------IRRN------------------------------SN-AIIL--LHNH----------
A8ZUS2_DESOH/106-228VVARA.-----------------LAHH------------------------------AA-ALIC--CHNH----------
A4BXR1_9FLAO/24-149LFVIA.-----------------LKSN------------------------------AT-GIII--AHNH----------
A5LVX8_STRPN/103-225ILHYA.-----------------IKHM------------------------------AT-SLIL--VHNH----------
Q7NFQ9_GLOVI/117-239IFREA.-----------------IRQG------------------------------AA-GIIV--AHNH----------
Q8ABN2_BACTN/26-150ILQTA.-----------------LKVH------------------------------AS-GIVL--SHNH----------
A8MGD7_ALKOO/25-146IFKIA.-----------------LLSN------------------------------AT-SIII--CHNH----------
A6EEF9_9SPHI/26-151ILVAA.-----------------INSG------------------------------AS-GIVL--AHNH----------
A3U7J3_CROAH/109-231LFKMV.-----------------LQVG------------------------------AV-AIIL--VHNH----------
Q5Z1A3_NOCFA/105-224ILNTV.-----------------LRHD------------------------------GR-SFAV--VHNH----------
Q2SAG7_HAHCH/49-171VVKAA.-----------------LRHN------------------------------AA-KVIV--AHNH----------
A5G1T0_ACICJ/119-241VVRRA.-----------------IETR------------------------------AT-ALIL--VHNH----------
A9B8G6_HERA2/79-201LFREP.-----------------LRRN------------------------------AA-SVIL--AHNH----------
Q0F0W4_9PROT/139-261LMKRA.-----------------LELD------------------------------AR-GMIL--FHNH----------
A4YL64_BRASO/115-237VIKRA.-----------------LELS------------------------------AT-AIIL--VHNH----------
Y1557_THEMA/101-222VFRTA.-----------------IRAN------------------------------AS-GVIV--VHNH----------
Q1NUQ1_9DELT/108-231VVAAA.-----------------LRHK------------------------------AA-AVIL--AHNH----------
Y1125_HAEI8/99-221IIKEA.-----------------LYCN------------------------------AA-ALIL--AHNH----------
A7AJ21_9PORP/104-226ILKAA.-----------------INAL------------------------------AV-GIIL--CHNH----------
A6NZB7_9FIRM/107-229IVEAA.-----------------LNHN------------------------------AS-RVIL--AHNH----------
A5ZSZ3_9FIRM/23-146IFKSA.-----------------ILSN------------------------------AH-SMML--IHNH----------
A8ZYJ4_DESOH/28-150IIKRV.-----------------IALK------------------------------SS-AVVI--THNH----------
Y086_PSESM/102-224VVKRA.-----------------LAHN------------------------------AA-SLIL--CHNH----------
A4XHM1_CALS8/103-225VVECV.-----------------LRYN------------------------------AS-SVIL--AHNH----------
B2JE00_BURP8/120-242IVRRA.-----------------LSVN------------------------------AA-SLIV--AHNH----------
Y611_CHLTE/100-222IFKAA.-----------------IRES------------------------------AH-SIIL--VHNH----------
Y1610_AQUAE/110-231ILFKA.-----------------VKLS------------------------------AN-GIII--AHNH----------
B0V642_ACIBY/120-242TLRYA.-----------------LQQH------------------------------AC-QLVI--AHNH----------
A4ITX8_GEOTN/9-125VFKAA.-----------------ILNN------------------------------AA-SIIV--AHQH----------
Q7VMM9_HAEDU/35-157IVKKA.-----------------LELN------------------------------SS-AVIL--THNH----------
Y491_PSYWF/102-224VLRHA.-----------------LEQG------------------------------AS-QIII--AHNH----------
Y4865_PHOLL/108-230IVRSA.-----------------IKVN------------------------------AS-SVIL--AHNH----------
Y371_SYMTH/110-232VFKTA.-----------------IRRS------------------------------AH-AVIL--AHNH----------
A5Z7J1_9FIRM/22-146ILKSA.-----------------ILSN------------------------------AA-NMMI--LHNH----------
Q02HM7_PSEAB/85-202VVKRA.-----------------LRHN------------------------------AV-GVVV--AHNH----------
Q2S840_HAHCH/1-123IAKKA.-----------------LSLN------------------------------AA-AVIL--AHNH----------
A5EYF9_DICNV/276-401LVKSV.-----------------LDSD------------------------------AA-AVVL--VHNH----------
A0Z2T6_9GAMM/98-220IVAMA.-----------------LKMG------------------------------AS-AIIV--AHNH----------
A4NTE0_HAEIF/34-156IIRQA.-----------------LKLN------------------------------AS-AIII--GHNH----------
A6EKP4_9SPHI/26-151IFAAA.-----------------VTSG------------------------------AT-GILL--AHNH----------
Q5P8G7_AROAE/74-196IVRRA.-----------------LELR------------------------------AA-GVIF--SHQH----------
Q5PA32_ANAMM/108-230VVKKS.-----------------LLHD------------------------------AS-YIVV--SHNH----------
A3ER13_9BACT/109-231AFQPA.-----------------IRDS------------------------------AA-AVLF--VHNH----------
Y1515_LACLM/103-226ILYHA.-----------------VKNL------------------------------SV-GLLV--AHNH----------
A6DQ92_9BACT/32-161VFRPA.-----------------LING------------------------------AS-KIIV--VHNH----------
A9KL05_CLOPH/109-231VFLLA.-----------------VKYE------------------------------AV-YIIL--LHNH----------
Q2IEL9_ANADE/81-203TLRVA.-----------------VREG------------------------------AH-GVVF--VHNH----------
Q2QJL1_ACEAC/25-147IVARA.-----------------LQLK------------------------------AT-LLVL--VHNH----------
Y341_CARHZ/104-226IFREA.-----------------VKIG------------------------------AY-AVII--AHNH----------
Q03EP2_PEDPA/97-219IMVEV.-----------------LRVS------------------------------AN-SFVL--IHNH----------
A5KLJ1_9FIRM/109-231LFIEA.-----------------FKRN------------------------------AY-GIIL--LHNH----------
A5FBM2_FLAJ1/31-156LFAAA.-----------------LKAA------------------------------AV-GIII--THNH----------
A3CRJ6_METMJ/102-223VFSDA.-----------------ITDR------------------------------AA-SVIL--VHNH----------
Q1Q559_9BACT/9-136VFRLA.-----------------VHKA------------------------------IA-NILL--VHNH----------
Q042N7_LACGA/84-206IFRWA.-----------------VIYN------------------------------ST-AFFV--AHNH----------
Q2B8H5_9BACI/107-228VFRFA.-----------------LNKS------------------------------AA-HIIV--AHQH----------
Q2LSS5_SYNAS/184-306VIERA.-----------------LSHK------------------------------SS-ALIL--VHNH----------
A4SZN2_POLSQ/113-235ILKEA.-----------------LSRN------------------------------AS-ALIV--AHNH----------
Y1765_PARUW/107-229VFYSA.-----------------IRHK------------------------------AA-SLIV--VHNH----------
A6EEP6_9SPHI/39-153VFAPA.-----------------IISG------------------------------AS-AIVL--AHNH----------
A4XJG8_CALS8/36-160IFKRV.-----------------LLTN------------------------------CN-SIII--AHNH----------
Q11VY8_CYTH3/111-233IYKYA.-----------------LENL------------------------------AS-SIIL--VHNH----------
A0LNF4_SYNFM/102-224VVEAS.-----------------LKHR------------------------------AT-AVIL--AHNH----------
A7FEQ9_YERP3/38-160VVIRA.-----------------LHHR------------------------------CA-AVVI--AHNH----------
Y1850_BORPA/103-225IVREA.-----------------LRHH------------------------------AA-ALIL--AHNH----------
Q8GFV0_CITFR/27-149VLQRA.-----------------LHHN------------------------------AA-AVVL--AHNH----------
Q5NML0_ZYMMO/19-141ILRHA.-----------------IILS------------------------------AD-SLIL--AHNH----------
Q72Q17_LEPIC/104-226LLKII.-----------------LNDA------------------------------AS-AVII--AHNH----------
Q5FNC5_GLUOX/112-229IAIRA.-----------------LALH------------------------------AT-ALIG--FHIR----------
B8CX04_HALOH/118-240IFHTSF-----------------LLEE------------------------------KT-SVII--AENM----------
A5TXI1_FUSNP/685-807IYPHL.-----------------LDEK------------------------------LK-GIIL--CHNH----------
A5Z6A2_9FIRM/108-230IFVEA.-----------------LRCD------------------------------AV-NIIL--IHNH----------
A3D8H4_SHEB5/24-146VLRTA.-----------------VILN------------------------------MP-SVIL--VHNH----------
Y852_LACSS/100-222VFKWA.-----------------VQYS------------------------------AA-KFIL--VHNH----------
Y2338_SALRD/110-232VFEQA.-----------------ILDD------------------------------AA-AVIC--LHNH----------
Y1989_LEGPC/102-225IVERV.-----------------LQLN------------------------------AA-ALIL--AHNH----------
Q5QX33_IDILO/36-152V.....-----------------LKVN------------------------------AA-AVIV--SYFS----------
B4S9N8_PROA2/42-165VFKGA.-----------------FLAN------------------------------AN-SIML--AHNH----------
A0L491_MAGSM/113-235VVELV.-----------------IRHK------------------------------AA-HVIL--AHNH----------
Q6MR78_BDEBA/35-156IFRCL.-----------------VQAN------------------------------AS-SFIL--AHNH----------
A9KR89_CLOPH/32-156IFIRA.-----------------LLSG------------------------------AV-GIII--VHNH----------
A7V531_BACUN/74-196IMRVL.-----------------IDTG------------------------------AV-QFAA--VHNH----------
Q3Z6I4_DEHE1/116-238VIGAA.-----------------ISQN------------------------------AS-ALIF--VHNH----------
A3DJW5_CLOTH/98-219VFADP.-----------------ITDR------------------------------AT-AVIV--AHNH----------
A9BIK5_PETMO/98-215IFREA.-----------------IMYN------------------------------AV-SFIL--VHNH----------
Q8PA70_XANCP/37-159VAKRA.-----------------LDLN------------------------------AV-AVIL--FHNH----------
Q1DAY3_MYXXD/101-223VFAAA.-----------------LTSR------------------------------AT-SIVL--AHNH----------
Q2GEH3_NEOSM/114-236IIKKC.-----------------LTCG------------------------------AS-AMVI--AHNH----------
Q4EAK4_9RICK/97-218ITRKA.-----------------LMKN------------------------------AT-SIIM--SHNH----------
Q6WB38_ALCFA/54-176VVKTG.-----------------LRLN------------------------------AS-AVIM--AHNH----------
A7AC72_9PORP/83-208IMQAA.-----------------ILGN------------------------------AS-AIIL--AHNH----------
Q1WT78_LACS1/101-223IFKHA.-----------------LNFS------------------------------CA-RILV--AHNH----------
Q7WWR8_COXBE/19-137IIKRA.-----------------LYHN------------------------------SA-ALIV--AHNH----------
B1YJT0_EXIS2/95-217IFREA.-----------------IRCS------------------------------AA-SFIA--VHNH----------

PF14464

O58174_PYRHO/6-109YFDL...................TLMP------------------------------HD-ESIKGTFHSH----------
Q8TYS8_METKA/10-115IFDL....................LSV------------------------------HT-CDVIGTFHSH----------
Q8TQ16_METAC/27-138VIR....................LYMM------------------------------PN-VKAVGSVHSH----------
O27052_METTH/16-131VMDV...................LMLP------------------------------PF-TGAVGSVHSH----------
B0R451_HALS3/4-126TFGS...................TQVP------------------------------ND-MRNVGSIHSH----------
B0R6F4_HALS3/5-124EATLAVFD...............EAAA------------------------------VG-REVVGFYHSH----------
Q9I213_PSEAE/7-137VTDTVFLN...............SSFK------------------------------TC-SPVSVIYHSH----------
Q8ZW14_PYRAE/1-111LDPEEVYKAIV............EAEE------------------------------RG-EELLAIFHTH----------
Q9YE90_AERPE/3-117QAHR...................AAEK------------------------------LG-LEVVGVYHTH----------
O59157_PYRHO/36-149INALE..................RAER------------------------------KG-LEVVTIFHSH----------
P73582_SYNY3/7-143LSAQK..................DCRQ------------------------------KG-LSIIGIFHSH----------
Q9S2G8_STRCO/5-111LKLYR..................EMDD------------------------------RD-EEPVVIYHSH----------
Q9RXB3_DEIRA/6-119GDLLRVVR...............AMQR------------------------------EG-LDLVALYHSH----------
O67597_AQUAE/5-125MRAED..................YAIS------------------------------KG-MEIVGVYHSH----------
Q216W0_RHOPB/11-140TLALNG.................SFET------------------------------AN-PASV.IYHSH----------
B6C3F3_9GAMM/7-123QIAAMR.................RMRE------------------------------EG-EELFGIYHSH----------
A3RXH7_RALSL/5-122QFQVWS.................EMDA------------------------------RE-EEPIVLYHSH----------
Q0A9H9_ALHEH/13-128FLRWDR.................AAHR------------------------------LG-LDILGVWHTH----------
Q82SH4_NITEU/5-122QLQVWK.................EMSA------------------------------RH-EEPVVIYHSH----------
Q2YAE7_NITMU/14-131QLQVWR.................EMEA------------------------------RG-EEPIVIYHSH----------
F0DZB5_9PSED/6-123QLQVWR.................ELDQ------------------------------RD-EDCRVIYHSH----------
Q2SI97_HAHCH/5-122QLQIWR.................EMDA------------------------------NG-EEPVVIYHSH----------
Q84HF8_PSEFL/5-121QLQVWR.................EMDA------------------------------RD-EEPRVFYHSH----------
Q7BNS3_PSEST/6-123QFQVFR.................SLDD------------------------------RN-EFQRVIYHSH----------
Q82D25_STRAW/5-122LLKLYR.................EMDD------------------------------RD-EEPVIIYHSH----------
A1SG89_NOCSJ/5-128LLQLYK.................EMWA------------------------------RD-EEPVVIYHSH----------
Q1AY15_RUBXD/6-127IRRFER.................RAAE------------------------------RD-MDVLGFYHSH----------
D5HAX1_SALRM/4-126YRAADA.................AAQE------------------------------QG-LDVVGVYHSH----------
Q02B10_SOLUE/5-125LLAADK.................AARE------------------------------RN-MDLIGIYHSH----------
E2TKU9_MYCTU/5-122QLKVWR.................AMED------------------------------AD-EVPVVIYHSH----------
Q5Z0V7_NOCFA/5-122QLKVWR.................EMDA------------------------------AD-EEPVVIYHSH----------
A8L770_FRASN/19-136QIKVWN.................EMFD------------------------------RD-EDPVVIYHSH----------
Q47MB9_THEFY/5-122QLKVWR.................EMEE------------------------------RG-EEPVVIYHSH----------
Q2JEP2_FRASC/5-122QLKVWR.................EMDD------------------------------RD-EEPVIIYHSH----------
Q7MRV8_WOLSU/6-118QFSAFK.................EAQK------------------------------EG-LRLIGCYHSH----------
Q39VC3_GEOMG/6-119QFAVVK.................ELRN------------------------------RG-LAMLAIYHSH----------
B3EN74_CHLPB/4-118QFNAVL.................TMRS------------------------------KK-QLAVAVYHSH----------
A3DIG3_CLOTH/5-123QFAAVK.................DMRN------------------------------NG-WELLGNFHSH----------
B8FTM5_DESHD/5-124QLTAVK.................DMRK------------------------------NG-WVMLGNFHSH----------
A6TTW0_ALKMQ/7-124QFAAIK.................QMRT------------------------------DG-DIVVGNYHSH----------
A4XJZ1_CALS8/5-124QFAAVK.................DMRK------------------------------NG-WVLLGNFHSH----------
Q3AW93_SYNS9/27-153QIAAQR.................WARV------------------------------HG-LEVLGVCHSH----------
Q3AML7_SYNSC/5-131QLAAQR.................WARN------------------------------RH-QYCLGVAHSH----------
Q7U4L3_SYNPX/10-140QLAAQR.................WSRQ------------------------------HQ-QWIIGVAHSH----------
A3Z8Z4_9SYNE/8-143QLHAQR.................WARA------------------------------RG-LQVLGTAHSH----------
A9BCQ7_PROM4/10-152QISAQK.................WARK------------------------------KN-LSLLGSAHSH----------
Q7V9V1_PROMA/10-154QLLAQK.................WGRS------------------------------KN-LTVLGAAHSH----------
Q46IP8_PROMT/10-154QIASQK.................WARE------------------------------ND-LEVLCCAHSH----------
Q3MEG9_ANAVT/9-148MLQVQR.................QARD------------------------------KS-LNIIGIYHSH----------
B2J4Y6_NOSP7/5-138MLKTQK.................EARN------------------------------RL-LNIIGIFHSH----------
Q2JJY1_SYNJB/6-136FKRAND.................HAVR------------------------------KG-LGILGTYHSH----------
Q2JS00_SYNJA/6-136FKRAND.................HAVR------------------------------KG-LGILGTYHSH----------
A9W9Z2_CHLAA/6-141YLRVDR.................ETRA------------------------------AG-YEIIGCYHSH----------
Q2IF99_ANADE/8-141HLQLLQ.................ALDA------------------------------EG-GEVVAVWHSH----------
O64333_BPN15/2-106HFHLSPEDY..............AAAE------------------------------DW-GTVVAIVHSH----------
Q9MCU3_BPHK0/2-106HFHLSPEDY..............AAAE------------------------------DW-GTVIAIVHSH----------
Q8W6T2_9CAUD/12-125QFALASDDY..............AAAE------------------------------DA-GEIVALVHSH----------
A3EHW4_VIBCL/1-109DFVIHPEDL..............AMFE------------------------------SM-GEIVGICHSH----------
Q02TC3_PSEAB/4-108HFVIDHQDW..............CAAE------------------------------DQ-GEVLAIVHSH----------
Q8XYR3_RALSO/2-105HFEMPAEDY..............AAAE------------------------------DL-GEVLAVVHSH----------
C6TYU0_BURPE/2-115QFALASEDY..............AAAE------------------------------DM-GEIVALVHSH----------
A9APW0_BURM1/2-115QFALAPEDY..............ADAE------------------------------DM-GEIVAMVHSH----------
A4TT77_YERPP/1-112TFVMHADDI..............IAAE------------------------------DA-GDVVAIWHSH----------
Q6XQC1_BPT1/3-111HFMMDAVQYAC............IEDD------------------------------AE-STTIAIVHSH----------
F0A4T4_NEIME/7-109TFEISADDW..............MAAE------------------------------RV-GEIVAVVHSH----------
D9PEJ9_ACTPL/3-105FFEIAPEAY..............IQAE------------------------------SL-GEIVAIVHSH----------
Q3Z1B1_SHISS/1-103RFRMAPEDW..............LRAQ------------------------------MQ-GEIVALVHSH----------
E6BUJ9_ECOLX/1-103YFRMSPEDW..............LQAE------------------------------MQ-GEIVALVHSH----------
Q7WX35_CUPNH/81-188SGGHLKYER..............PPLA------------------------------AD-DVLVVDCHSH----------
A1VVA1_POLNA/80-189NPGFVRYRE..............VELQ------------------------------EG-EHFVVDIHSH----------
A0R7L0_PELPD/81-188SLDNLDYAC..............PVLP------------------------------ET-ECLVCDIHSH----------
Q8XYU8_RALSO/133-242SPGAISYDR..............PRLE------------------------------DH-ESLVVDMHSH----------
Q21Q53_RHOFD/82-191TPVHLSILR..............PMLA------------------------------AG-EHLVVDLHSH----------
Q120V3_POLSJ/78-187STAHIDYRE..............VHLG------------------------------DG-EFLVLDLHSH----------
Q5NUW4_RALME/76-183GTGHLKYDR..............PRLG------------------------------AD-DVLVVDCHSH----------
Q8ZSF0_NOSS1/58-173SSTHVLSLES.............ALDK------------------------------SY-TDGLVEMHSH----------
A4JUM8_BURVG/81-187GPGHLVYER..............PRLA------------------------------DG-EWLVVDCHSH----------
Q5NXB5_AROAE/80-200SASRIHFDR..............PRLD------------------------------ES-EHLVVDLHSH----------
Q11ZD2_POLSJ/78-182SAGHVKFER..............PQLE------------------------------DG-VHLVMDIHSH----------
Q47D11_DECAR/80-200SPHQIDYRV..............PTMD------------------------------AD-ETLAVDLHTH----------
Q8PFM8_XANAC/617-745SVSTEADFQCGSCGVQEDITEAQRRTA------------------------------GM-VLWIGAWHSH----------
A1U033_MARAV/627-755SVSTPKEFLRGTAGVEEDIDECRRRTG------------------------------GI-VSYLGEWHSH----------
A1VVG1_POLNA/619-747SKSSPGSFERGIAGLAETVTEASRRTA------------------------------GV-VGYIGEWHSH----------
Q5HY19_GLUOX/596-724SRQAPTFFVRGALDLSPLVDKYAKATV------------------------------GR-LQYVGEWHSH----------
A3U023_9RHOB/617-745SIGSPTGFVRGTDGVQQMIDRSMAETQ------------------------------GQ-LRYVGEWHSH----------
Q3J4T5_RHOS4/19-143SRAGRTWFVRGQVGLAEILQ...RAWR------------------------------EG-RYYLGEWHSH----------
B6F186_CLOPF/572-698SKYGPYLFTKGSYGTKEYLEHVLKSTG------------------------------NI-INYVGDWHTH----------
A9BTW4_DELAS/624-751SVREAARFVLGTNGLVQNLRAANAASL------------------------------GY-LAFIGTWHSH----------
A4AAI2_9GAMM/624-751SVREAARFILGTNGLVQSLRAANEASL------------------------------GY-LAFIGTWHSH----------
A1U5J0_MARAV/600-724AQAGPSLFQIDYPYLQEVDEDTLEQTA------------------------------NT-LRVVGTWHSH----------
Q2LTW5_SYNAS/612-744SESSCAHFICGTNGVAEANEEKRQRTR------------------------------GS-TQYIGMWHTH----------
Q21PA7_SACD2/610-735TIRTPARLDIATTGLEEIFENIHSATN------------------------------GQ-ITLLGTWHSH----------
Q3SNL7_NITWN/223-347SVRSATRFVLGTAGLKAAIKARHRTSG------------------------------GT-LFDVGTWHSH----------
D3GMN5_9ENTR/45-166IRTRNRFERKGDHHQLKVDELF.EQSN------------------------------GF-LVYLGEWHTH----------
C6YLL5_VIBCL/21-142IRQRCRVDRRGVHHQSRVNEAF.ERSA------------------------------GT-HLYLGEWHTH----------
Q4FRY9_PSYA2/20-141IRSRFMVDRVSKYHQKVVDDAF.KKNN------------------------------GE-WQYLGEWHTH----------
Y4QB_RHISN/8-136IRTRKSFSPDREWEQSEIDRHY.RVSG------------------------------RV-DTYIGDWHTH----------
A0AW82_ARTS2/13-145TRSRIAFEPDTEWQTAELSRVY.ALRD------------------------------RR-VSYLGDWHTH----------
A5G3M8_GEOUR/23-151RATRTTFFRKKRAHQQVIDRAW.EASN------------------------------HT-CTYLGEWHTH----------
Q2L5J9_CLOPF/14-141ISKRFSFIRRDINHEKVLNNIW.ESNG------------------------------KM-HTYIGEWHTH----------
Q2NDB2_ERYLH/5-124PQPQTHFEIDP...QTLVDAHR.AGRN------------------------------GG-PQVLGYYHSH----------
Q2K8Q5_RHIEC/6-134FSRFLVDILQAVRDATRFFDRT.HHQY------------------------------RR-YNYIGEWHSH----------
Q8KGW0_RHILI/15-149ELHRLNV................WLYN------------------------------SG-LKLLAQIHSH----------
Q2K2A8_RHIEC/65-199ELHRINM................WLFD------------------------------NG-LRILAQIHSH----------
C5ATD4_METEA/9-143SMRALMG................HLRA------------------------------HR-LKIVAQVHTH----------
Q13F65_RHOPS/9-143SMRALMN................HLRS------------------------------TR-RRIAAQIHTH----------
Q6YRV1_SYNY3/11-152SFVRVL.................KLAQ------------------------------QK-NLTVAIIHTH----------
A4JA90_BURVG/13-148AVLPAL.................NQAI------------------------------KK-NLTVVKFHSH----------
A1VQ27_POLNA/13-152GFMRLL.................GLAQ------------------------------HR-NLVPALVHTH----------
Q1QNK4_NITHX/10-142WIEEAI.................DRGE------------------------------KE-GLHIVLVHSH----------
Q2IDP5_ANADE/4-131GARVAA.................LERG------------------------------EG-LELKGLVHSH----------

PF05021

Q380R2_ANOGA/286-599QYVPDVYYKEKDVYGNEVQRLGRP.LP------------------------------VE-YLLVDVPAST----------
NPL4_CRYNJ/281-610EYVPEVFYSYKNEYGLQVKMPAKPTFP------------------------------VE-YLYVNITHGF----------
NPL4_MAGO7/285-589RYIPDVFYRRINEYGANVQENAKPSFP------------------------------VE-YLFVTLTHGF----------
NPL4_PICST/268-574RYVPDVAYSELNEYGLEVKSNAKPTFP------------------------------VD-FLLVSLTDSF----------
NPL4_DEBHA/260-563RYVPDVFYSKINEYGLEVKTNAKPAFP------------------------------VE-FLLVSLSDSF----------
NPL4_DROME/282-593QYVPDVFYKEKDLYGNEVQRLARP.LP------------------------------VE-YLLVDVPAST----------
NPL4_CANAL/286-595RYVPDIQYSKINKYGLEVKSNAKPTFP------------------------------GE-FLLVSLTDSF----------
NPL4_PICGU/288-564RYVPDVFYSKINEYGLEVKTNAKPAFP------------------------------VD-FLLVTLSDAF----------
Q5CYK6_CRYPI/214-488EILPQILEK.....GVSTRK.....FD------------------------------AH-WLIVRINESA----------
A8X418_CAEBR/151-470HYITDVQYTEKNEYGAEVLKNGRP.LP------------------------------VE-YLLVDVPAGM----------
NPL4_COCIM/290-605RYIPEVFYRKVNEYGANVQENAKPAFP------------------------------VE-YLFVTLTHGF----------
NPL4_ASPOR/287-599RYIPEVFYRKINEYGVSAQQNAKPAFP------------------------------VE-YLLVTLTHGF----------
NPL41_ARATH/156-410....EVVVG.....VKDVKE.....VD------------------------------ND-FFLVLVKILD----------
A7AUE8_BABBO/207-478EVLPQIIES.....GKEVTS.....FD------------------------------PS-WFVIRVNDSA----------
NPL4_SCLS1/289-608RYIPEVFYRKINEYGRSVQENAKPSFP------------------------------VE-YLLVTLTHGF----------
Q63ZR4_XENLA/250-559QYVPDVFYKDIDKFGNEITQLARP.LP------------------------------VE-YLIIDITTTF----------
NPL4_KLULA/265-593RYVPEIFYTRKNEYNLTVKQNAKPAFP------------------------------VD-YLLVSLTHGF----------
NPL4_AJECN/292-589RYIPEVFYRKVNEYGANVQENAKPSFP------------------------------VE-YLLVTLTHGF----------
A7SZA1_NEMVE/172-484QYVPDVFYKDTDSYGNEVTLLARP.MP------------------------------IE-YLLVQVSAAF----------
NPL4_VANPO/248-566VYVPEIFYMKTNEYGLTVKENAKPAFP------------------------------VD-YLLVSLTHGF----------
NPL4_CANGA/260-578RYVPEIFYMKKNEYGLTVKENAKPAFP------------------------------VD-YLIVSLTHGF----------
Q8I426_PLAF7/256-527ELLPQILES.....GKETNK.....FD------------------------------TD-WFIVRVNESA----------
Q2HAC4_CHAGB/250-562RYIPEVFYRRINEYGANVQENAKPAFP------------------------------VE-YLFVTLTHGF----------
Q01AR0_OSTTA/156-409KLTNEVMVE.....RKDVFD.....VD------------------------------ND-FFLVTVPILD----------
NPL4_YEAST/259-577RYVPEIFYMKSNEYGITVKENAKPAFP------------------------------VD-YLLVTLTHGF----------
A5KB05_PLAVS/256-527ELLPLILEG.....GKETNK.....FD------------------------------TD-WFIVRINESA----------
NPL4_DICDI/319-563....PVFEE.....GTETIN.....AD------------------------------TH-FFIVTVPLKA----------
Q8SRJ9_ENCCU/202-474....DIFYRTK...AEEAMVKADPYLP------------------------------GE-FFLVKLTHG.----------
NPL4_ASHGO/241-560RYVPEIFYMRRNEYGITIKENAKPAFP------------------------------VD-YLIVSLTHGF----------
A0C810_PARTE/307-574DVLPSFVYN.....GKSVKE.....FE------------------------------PD-FFIVNVAHGY----------
A4RW87_OSTLU/156-413KLTNEVIVRDGPS.INDVNA.....VD------------------------------ND-MFLVTVPILD----------
NPL4_PHANO/275-593RYIPEVFYRRINEHGANVQENAKPDFP------------------------------VE-YLFVTLTHGF----------
NPL4_LODEL/287-597RYVPDIQYSKINEYGLEVKSNAKPTFP------------------------------GE-FLLVSLTDSF----------
Q7RED9_PLAYO/245-516ELLPQILEG.....GKETNK.....FD------------------------------TD-WLIIRVNDSA----------
A5BEN5_VITVI/154-392....DVVVG.....VKDTRE.....VD------------------------------ND-FFLVLVKILD----------
NPL4_NEUCR/276-588RYIPEVFYRKINEYGANVQENAKPAFP------------------------------VE-YLFVTLTHGF----------

PF03665

U172_ARATH/8-208EISLIMIEE--------------HYVA------------------------------QG.LSIVGYFHAN-------ERF
Q4SKU7_TETNG/1-192QLALTQVDV--------------WCSQ------------------------------TQ.QRIVGYYQAN-------ACV
Q4PCQ4_USTMA/4-202EVALALASS--------------YASS------------------------------KN.LAIVGLYEAP-------ELI
Q53Y03_HUMAN/1-204EVALTLIDS--------------WCKD------------------------------HS.YVIAGYYQAN-------ERV
U172_DICDI/2-192EVAMIQIEK--------------YCRD------------------------------NN.IDMVGYYHSN-------QCI
F158A_HUMAN/1-193EVALNQVDV--------------WGAQ------------------------------AG.LVVAGYYHAN-------AAV
A4H4X4_LEIBR/5-249EVAYAHVQY--------------ASKT------------------------------TG.QSLLGVYIAN-------ERL
Q8IHW7_PLAF7/3-195NLAFTLVEN--------------YYKD------------------------------KD.ERIIGYFHIS-------S..
U172_DROME/1-194EVALMLIDA--------------HAER------------------------------EG.LVIAGYYAAP-------ENF
Q1W2L0_SALBI/3-198EIALMQIEE--------------HYAS------------------------------QG.LSLVGYFHAN-------ERS
Q6P4M9_XENTR/1-196EVALTLIDT--------------WCKE------------------------------ND.YVIAGYYQAN-------ERL
Q3B8G2_XENLA/1-193EVALTQIDS--------------WSAL------------------------------QG.LVIAGYYQAN-------SGL
Q4DRE9_TRYCC/6-215SVAYAQVSS--------------YART------------------------------KG.LVLLGYYVAN-------ERA
A5K556_PLAVS/3-196NLAFTLVEN--------------HYKG------------------------------KE.ERIIGYYHIS-------V..
Q17EH7_AEDAE/1-189EIALIQVEA--------------KAAK------------------------------EG.LQVLGYYAAA-------ENF
Q5DA93_SCHJA/2-187ETALYHVDS--------------YCTA------------------------------KG.LRICGYFQAN-------EHV
Q93568_CAEEL/2-186ELATALVHG--------------KFG.------------------------------...ASLVGVYFSN-------ATP
A5APP0_VITVI/4-206EIALIQIEE--------------YYGA------------------------------QD.MGIVGYFHAN-------ERF
Q5TPN5_ANOGA/1-188EVALVQVEA--------------KALQ------------------------------KG.QHIVGYYVGC-------ENF
Q8AWD7_DANRE/1-192QLALTQVDV--------------WCSQ------------------------------TQ.QKIVGYYQAN-------ACV
Q8L439_CHLRE/2-202EIGLAQVES--------------YTHI------------------------------TGSVAIVGYYQSD-------ARF
A4HT47_LEIIN/5-249EVAYAHVQY--------------AAKT------------------------------TG.QSLLGVYIAN-------ERL

PF01398

D1039_DICDI/532-641GTTDTCNTIEEHEI.......FEYQLE..............................ND.LLTLGWIHTH----------
PSDE_DICDI/26-139GTSVSVEAIDPVFQ..TKMLDMLKQT...............................GRDEIVIGWYHSH----------
CSN5_YEAST/66-190GTETRVNAQLESYEYMVQYIDEMYNHNDGGDG....................RDYKGAK.LNVVGWFHSH----------
PSD7_DROME/6-121EDDKDKSVWFLDHDYLENMYGMFKKVN..............................AR.ERVVGWYHTG----------
RPN8_YEAST/3-116EDEKNSDVWFLDHNYIENMNEMCKKIN..............................AK.EKLIGWYHSG----------
RPN11_SCHPO/25-138GTGVSVEAVDPVFQ..KNMMDMLKQT...............................GRPEMVVGWYHSH----------
CSN5_CAEEL/51-165GTETRVNAQAQAYEYMTVYSEMCDTE...............................GRKEKVVGWYHSH----------
EIF3F_ARATH/23-133ESSDQ...VAVDIDYHHNMLASHLKVN..............................SK.ETIVGWYSTG----------
EIF3F_HUMAN/87-196ESEDE...VAVDMEFAKNMYELHKKVS..............................PN.ELILGWYATG----------
O59157_PYRHO/26-138NSSVEFEMDPEEMINALERAERKG....................................LEVVTIFHSH----------
BRCC3_HUMAN/7-148TVAEKVDAVRIVHI......HSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSH----------
O61792_CAEEL/36-151EDDKDKSTWFLDMDYLESMYGMFYKVA..............................AK.EKIVGWYHTG----------
O27052_METTH/17-118TSDEGAVMDVLMLP............................................PFTGAVGSVHSH----------
EIF3H_HUMAN/34-146TEDDADFDEVQYQMEMMRSLRHVNID..................................HLHVGWYQST----------
EIF3F_CAEEL/2-117ESNDDLEIDDQFNQ...QMISALKKTS..............................PN.EQPVGWFLTT----------
YPT5_CAEEL/24-137GTSVTVESVDPVYQ..TKHMDLLKLV...............................GRTENVVGWYHSH----------
RPN8_SCHPO/12-125EDEKNASVWFLDHNFMESMNEMFKKIN..............................AN.EKLVGWYHTG----------
EIF3F_SCHPO/18-129ESSEQ...VEVEMEYHRAMYHLHLKAN..............................PR.EVVVGWYATS----------
MEC_MYCBO/6-114PTFYRLDSGEQLKV...WR.AMEDAD..................................EVPVVIYHSH----------
CSN6_HUMAN/36-148TVEEK...IIIDKEYYYTKEEQFKQVF..............................KE.LEFLGWYTTG----------
EIF3H_CAEEL/10-139EPVMDDDANAAQQYEEQKQHEMLDMLRKF.........................RTMNIDYEIVGFYQSH----------
STABP_HUMAN/252-361AGSDYCNTENE........EELFLIQD..............................QQGLITLGWIHTH----------
BRCC3_MOUSE/7-148DKRKDRVEISPEQL..SAASTEAERLAE...........................LTGRPMRVVGWYHSH----------
PSD7_ARATH/12-125EDDKDPSIWFLDHNYHESMFHMFKRIN..............................AK.EHVVGWYSTG----------
CSN6B_ARATH/6-136PALDT.....LDRSFLEKKQELYKKVF..............................PD.FYVLGWYSTG----------
CSN5B_ARATH/54-168GTETRVNAQSDAYEYMVEYSQTSKLA...............................GRLENVVGWYHSH----------
O13386_HYPJE/11-125EDEKDPSVWFLDHNYVESMNDMFKKVN..............................AR.EKLVGWYHTG----------
PRP8_HUMAN/2099-2205GTHQTVHLPGQLPQ.....HEYLKE...................................MEPLGWIHTQ----------
CSN5_SCHPO/30-144GTETRVNAHEEAQEYSVQYHTLCKSV...............................YRHENVIGWYHSH----------
O16155_SCHMA/21-128GTGVSVEAVDPVFQ..AKMLDMLRQT...............................GRPEMVVGWYHSH----------

PF15659

D3IMU4_9BACT/335-480.PWGS.---------------------............-----------.NDFKKG----TRASG.....---------
D3IMY5_9BACT/92-252LPESV.---------------------....GYS.....-----------PGDIKFA----KDAKS.....---------
D1PWX0_9BACT/114-279.PENTP---------------------....YPS.....-----------GLNGGSG----....D.....---------
G9S3Z7_9PORP/207-377.PNNSP---------------------....FPSGLKTQ-----------KGDILFA----K.........---------
C6IIY2_9BACE/879-1045.PYNP.---------------------....FAS.....-----------PEDMDNA----RLLRD.....---------
D0TNF7_9BACE/83-238.PYNAQ---------------------.....AS.....-----------DQDMKNL----KIKTG.....---------
E4RWK9_LEAB4/231-388.PGGTG---------------------....TPS....G-----------FDDYGNI----NHRASSK...---------
C6IJD1_9BACE/48-220LPGGTK---------------------....GGA.....-----------GNDFNLA----KPQRK.....---------
I0TCD6_9BACT/325-474.PWGSN---------------------EGVTRASG...N-----------YNEY...----...KN.....---------
E2NN46_9BACE/59-211.PGDES---------------------...QGAS.....-----------ASDMKYI----NSRNN.....---------
E4RXN7_LEAB4/92-255GPLDHG---------------------N.VTGPS.....-----------LEDSNAA----TRTLNSVGRS---------
C9L1R0_9BACE/138-300.LSGGT---------------------...KGGA.....-----------GNDFNLA----KPKRK.....---------
E4RWK7_LEAB4/354-517YPSNA.---------------------....DKT.....-----------KVDGVLR----EVVKTS....---------

PF04002

D1N9M0_9BACT/106-227-PTGIC-------------------------EPS----------------PADIKLT....NTIRQVLQPV---------
D2BH65_DEHSV/106-228-PSGDT-------------------------EPS----------------PDDIGLS....ARLREAGSIM---------
Y1917_THICR/102-225-PSGDP-------------------------TPS----------------QSDRDLT....HQIQQGLQLI---------
Q1N8A1_9SPHN/109-231-PSGDP-------------------------SPS----------------RQDIDVT....RQIIDAGKRL---------
Q2N869_ERYLH/27-148-LSGNC-------------------------QPS----------------EKDIVAT....HRLQKLGAEL---------
Y1174_NEIMF/102-224-PGGSP-------------------------EPS----------------QEDIMFT....RRLAQAMSLV---------
A6GHT1_9DELT/122-244-PSGDA-------------------------RPS----------------EADIELT....ARMTDIGRFL---------
C0ABZ0_9BACT/117-246-PSGDP-------------------------MPS----------------SADTALT....RRLRQASEVL---------
Q0HVT6_SHESR/47-168-PSGES-------------------------EPS----------------AADKHIT....QRLTDALALI---------
B3EB20_GEOLS/42-163-PTGDP-------------------------TPS----------------QEDIAIT....RRLKESGEIL---------
Q03YZ9_LEUMM/73-198-PSGNI-------------------------MPS----------------NADITFS....QRLATIGHQM---------
Q7P812_FUSNV/110-232-PSDNI-------------------------TPS----------------KSDIELT....NEIAKGLKNF---------
Q30YK7_DESDG/103-225-PGGSA-------------------------RPS----------------APDVEVT....KLVARSAASL---------
Y3180_DESHY/105-227-PSGDP-------------------------TPS----------------SEDIDVT....RRLSDGGQIL---------
A8ZUS2_DESOH/106-228-PSGEP-------------------------EPS----------------RQDIAIT....RKLVMACKTM---------
A4BXR1_9FLAO/24-149-PSSNL-------------------------KPS----------------RSDLELT....KRIKKSGELL---------
A5LVX8_STRPN/103-225-PSGAV-------------------------APS----------------QNDDHVT....KLVKEACELM---------
Q7NFQ9_GLOVI/117-239-PSGVT-------------------------EPS----------------PEDLRLT....GQLIECGRTL---------
Q8ABN2_BACTN/26-150-PSGNL-------------------------RPS----------------EPDKKIT....TKINEACKVL---------
A8MGD7_ALKOO/25-146-PSGLL-------------------------EPS----------------QYDIEVT....KKIGRIGYLL---------
A6EEF9_9SPHI/26-151-PSMNL-------------------------APS----------------KADIDIT....NQIKQGAALL---------
A3U7J3_CROAH/109-231-PSGTL-------------------------KAS----------------QADKQLT....EKLKLAGQSL---------
Q5Z1A3_NOCFA/105-224-PSGDP-------------------------HPS----------------PDDRRAT....TLLHAAATTV---------
Q2SAG7_HAHCH/49-171-PSGDP-------------------------KPS----------------VNDQLIT....YRLLQALMLV---------
A5G1T0_ACICJ/119-241-PSGDP-------------------------SPS----------------RDDVEMT....REVQRAVALL---------
A9B8G6_HERA2/79-201-PSGMV-------------------------WAS----------------PEDILLT....KQAIQAGQLL---------
Q0F0W4_9PROT/139-261-PGGTP-------------------------HAS----------------NEDIELT....RRMAEACAPL---------
A4YL64_BRASO/115-237-PSGDP-------------------------TPS----------------QADIRMT....KTIVEIAKPL---------
Y1557_THEMA/101-222-PSGDP-------------------------TPS----------------KEDRLIT....ERLKQAGEIL---------
Q1NUQ1_9DELT/108-231-PSGNL-------------------------QPS----------------TQDRQLT....RRLFLALAFC---------
Y1125_HAEI8/99-221-PSGIT-------------------------EPS----------------YSDQLIT....KKIQDAAELM---------
A7AJ21_9PORP/104-226-PSGNP-------------------------RPS----------------RQDDLLT....QHLRDAARLL---------
A6NZB7_9FIRM/107-229-VSGLA-------------------------LPS----------------DEDKQTT....LYLRELLRQV---------
A5ZSZ3_9FIRM/23-146-PSGNL-------------------------TPS----------------TSDIQTT....ARMQELGELM---------
A8ZYJ4_DESOH/28-150-PTGDP-------------------------GPS----------------VEDTRIT....IRLLVALKSM---------
Y086_PSESM/102-224-PSGIT-------------------------TPS----------------RSDIDLT....KRLKEALKLV---------
A4XHM1_CALS8/103-225-PGGSV-------------------------KPS----------------MDDIKTT....QKIVNALSTI---------
B2JE00_BURP8/120-242-PSGAV-------------------------KPS----------------ASDRQLT....HVLRDTLALI---------
Y611_CHLTE/100-222-PSGDV-------------------------QPS----------------NADKQVT....SILKKAGDLL---------
Y1610_AQUAE/110-231-PQGEP-------------------------SPS----------------NEDLNFT....ERLKKACELL---------
B0V642_ACIBY/120-242-PFGSP-------------------------QPS----------------PEDIKLT....QQLEQACQLV---------
A4ITX8_GEOTN/9-125-PSGDV-------------------------TPS----------------KEDVEMT....KRLAEAGRIL---------
Q7VMM9_HAEDU/35-157-PSGQV-------------------------TPS----------------QSDKQTT....AKIKQACQLI---------
Y491_PSYWF/102-224-PNQDA-------------------------TPS----------------AADIHLT....QTLKLACEAI---------
Y4865_PHOLL/108-230-PSGHA-------------------------EPS----------------LADKIVT....DKVIDACNLV---------
Y371_SYMTH/110-232-PSGDP-------------------------TPS----------------REDREIT....RRLVQAGRVI---------
A5Z7J1_9FIRM/22-146-PSNIL-------------------------EPS----------------KEDIRTT....AKLVDICNLV---------
Q02HM7_PSEAB/85-202-PSGLA-------------------------TPS----------------QADIAAT....RQLKAALNLV---------
Q2S840_HAHCH/1-123-PSQNA-------------------------RPS----------------QRDIRLT....REVKRTLDLL---------
A5EYF9_DICNV/276-401-PAQST-------------------------ELS----------------ESDLQTT....KFIENFLKPL---------
A0Z2T6_9GAMM/98-220-PSGCL-------------------------APS----------------VADIQLT....DRLRRALGLI---------
A4NTE0_HAEIF/34-156-PTGNV-------------------------EPS----------------DADKYVT....KRLKEACELM---------
A6EKP4_9SPHI/26-151-PSGDL-------------------------TPS----------------IPDKQLT....KRIIKLAELH---------
Q5P8G7_AROAE/74-196-PSGAC-------------------------EPS----------------LADELLT....RTLTSALAMV---------
Q5PA32_ANAMM/108-230-PSGDP-------------------------KPS----------------KADIHIT....NRLQEACCSM---------
A3ER13_9BACT/109-231-PSGDP-------------------------EPS----------------SDDWSLT....ERLKECGELL---------
Y1515_LACLM/103-226-PSGNL-------------------------QPS----------------QADKIFT....KKIKNACDNI---------
A6DQ92_9BACT/32-161-PSGVL-------------------------TPS----------------HQDRTIT....NNLQEAGELL---------
A9KL05_CLOPH/109-231-PSGDP-------------------------TPS----------------KEDIAVT....KRMKEAGELL---------
Q2IEL9_ANADE/81-203-PSGDP-------------------------SAS----------------VEDADLT....ERLTAAAELV---------
Q2QJL1_ACEAC/25-147-PSGDP-------------------------TPS----------------ADDVVMT....NQICGAAKIM---------
Y341_CARHZ/104-226-PSGDP-------------------------TPS----------------KEDIDFT....GRVKKASEIL---------
Q03EP2_PEDPA/97-219-PSGNI-------------------------EPS----------------TNDLAFT....KKMKKVGDLM---------
A5KLJ1_9FIRM/109-231-PGGDP-------------------------TPS----------------REDVMIT....RRIYEAGELL---------
A5FBM2_FLAJ1/31-156-PSGKT-------------------------SPS----------------EADRNMT....RKIREAGKLL---------
A3CRJ6_METMJ/102-223-PSGTL-------------------------EPS----------------AQDLAIT....RQLVEAGSIL---------
Q1Q559_9BACT/9-136-PAGDP-------------------------EPS----------------KEDVSVT....QRLISAGQIL---------
Q042N7_LACGA/84-206-PSGDE-------------------------QPS----------------QHDLRFT....KKLVEASKCM---------
Q2B8H5_9BACI/107-228-PSGNC-------------------------SPS----------------RDDIEVT....KRLRKVGEEI---------
Q2LSS5_SYNAS/184-306-PSGFV-------------------------KPS----------------DADIRLT....RTITDTAKLL---------
A4SZN2_POLSQ/113-235-PSGNP-------------------------LPS----------------QADQDLT....QTLLKALQWV---------
Y1765_PARUW/107-229-PSGDP-------------------------MPS----------------NQDLKLT....QILLEGSRLL---------
A6EEP6_9SPHI/39-153-PSGEV-------------------------TPS----------------PADIKLT....NDLVTLGEIL---------
A4XJG8_CALS8/36-160-PGGSE-------------------------RPS----------------MDDINTT....KRIKEAAQLL---------
Q11VY8_CYTH3/111-233-PSGNT-------------------------KPS----------------EADYSLT....KKLCEAGTFL---------
A0LNF4_SYNFM/102-224-PGGDP-------------------------NPS----------------AADQQLT....RRLKRILNDL---------
A7FEQ9_YERP3/38-160-PAGDP-------------------------TPS----------------QADRTLT....AQLVNALNMV---------
Y1850_BORPA/103-225-PGGTA-------------------------AAS----------------AADIAMT....RQIRQALALV---------
Q8GFV0_CITFR/27-149-PSANT-------------------------APS----------------QADKLIT....ERLAQVLGMV---------
Q5NML0_ZYMMO/19-141-PSGDP-------------------------TPS----------------YMDRDTT....KRLALVTRMA---------
Q72Q17_LEPIC/104-226-PESSS-------------------------KPS----------------KEDLWIY....KNFGSLLANI---------
Q5FNC5_GLUOX/112-229-PKERP-------------------------ADL----------------SQSA.......RQLDFAMRPL---------
B8CX04_HALOH/118-240-NDNFT-------------------------RPS----------------QKDVLVT....KRLVKAGKIL---------
A5TXI1_FUSNP/685-807-PSGVA-------------------------NPS----------------RADNDLT....ENLTKRAAFF---------
A5Z6A2_9FIRM/108-230-PSGDC-------------------------TPS----------------RDDMAST....LAISKAGKII---------
A3D8H4_SHEB5/24-146-PSGDP-------------------------TPS----------------TSDIQFT....RKVIECAKVL---------
Y852_LACSS/100-222-PSGQL-------------------------APS----------------TQDINFT....KRIVNCGQLM---------
Y2338_SALRD/110-232-PSGNP-------------------------EPS----------------REDIRIT....RQLAEAGGTM---------
Y1989_LEGPC/102-225-PSGLS-------------------------DAS----------------QQDFAIT....ERIRDALDLV---------
Q5QX33_IDILO/36-152-PSKEL-------------------------NHS----------------DKEHELS.....TLKSALNLI---------
B4S9N8_PROA2/42-165-PSGNT-------------------------EPS----------------SADKLVT....SRLVKAGKLL---------
A0L491_MAGSM/113-235-PSGNP-------------------------KAS----------------QDDILLT....SHLMQALNPI---------
Q6MR78_BDEBA/35-156-PSQNV-------------------------LPS----------------EQDLILT....RRIHQLAQMF---------
A9KR89_CLOPH/32-156-PSSDI-------------------------TPS----------------KQDLLVT....EKIAQAGNMI---------
A7V531_BACUN/74-196-PSGNS-------------------------RPS----------------NEDKRLT....EQLKKAAGLF---------
Q3Z6I4_DEHE1/116-238-PSGKT-------------------------EPS----------------QADKDLT....RELVYAAMVM---------
A3DJW5_CLOTH/98-219-PSGSV-------------------------APS----------------QEDIEVT....KRLKDAGNTL---------
A9BIK5_PETMO/98-215-PSGDP-------------------------TPS----------------MHDRDIT....KKIMDSGEIL---------
Q8PA70_XANCP/37-159-PSGNP-------------------------EPS----------------EADRKVT....ERLKQALALL---------
Q1DAY3_MYXXD/101-223-PSGDP-------------------------EPS----------------VQDLGLT....RHLVAGAQLL---------
Q2GEH3_NEOSM/114-236-PSGNP-------------------------LPS----------------QEDLLIT....GKLKKICQKV---------
Q4EAK4_9RICK/97-218-PGGSL-------------------------EPS----------------EEDQAVT....KSLAAACSTV---------
Q6WB38_ALCFA/54-176-PSGSP-------------------------TPS----------------QADITLT....THLRKALALI---------
A7AC72_9PORP/83-208-PSGNI-------------------------QPS----------------MQDDQVT....KRVKEIAKLI---------
Q1WT78_LACS1/101-223-PSGNV-------------------------EPS----------------ENDIQLT....KRLINAGKMI---------
Q7WWR8_COXBE/19-137-PSGVP-------------------------DPS----------------QADRAATNPSQRKLSPWIRRA---------
B1YJT0_EXIS2/95-217-PSGDP-------------------------TPS----------------REDIEVS....ERMVEAGRLI---------

PF14464

O58174_PYRHO/6-109-PSPFP---------------------...-YPS----------------EGDLMFF----SKFG......---------
Q8TYS8_METKA/10-115-PYGDP---------------------...-VPS----------------EDDLMLF----KRLG......---------
Q8TQ16_METAC/27-138-PGANR---------------------...-RPS----------------KADLRLF----SKTG......---------
O27052_METTH/16-131-PGPVN---------------------...-LPS----------------AADLHFF----SKNG......---------
B0R451_HALS3/4-126-PNGVL---------------------...-APS----------------DADRSMF----GKG.......---------
B0R6F4_HALS3/5-124-PVGPG---------------------...-RPS----------------ATDREHA----Q.........---------
Q9I213_PSEAE/7-137-PDVGA---------------------...-YFS----------------REDIDKA----LYAGEPM...---------
Q8ZW14_PYRAE/1-111-PGPP.---------------------...-TPS----------------WEDVRHM----RL........---------
Q9YE90_AERPE/3-117-TTCPP---------------------...-SPS----------------GKDVEGM----KR........---------
O59157_PYRHO/36-149-LNCPP---------------------...-YPS----------------KKDIKGM----ENWR......---------
P73582_SYNY3/7-143-PHGQP---------------------...-IPS----------------EFDRAIA----..........---------
Q9S2G8_STRCO/5-111-TATEA---------------------...-HPS----------------RTDVTYA----N.........---------
Q9RXB3_DEIRA/6-119-PHGPA---------------------...-APS----------------ASDRRLA----A.........---------
O67597_AQUAE/5-125-PDHPD---------------------...-RPS----------------QFDLQRA----FP........---------
Q216W0_RHOPB/11-140-PDVGA---------------------...-YFS----------------QEDSDEA----LFLGTPVYP.---------
B6C3F3_9GAMM/7-123-PETAP---------------------...-LPS----------------KSDLAQA----AYP.......---------
A3RXH7_RALSL/5-122-TGTNA---------------------...-CPS----------------RDDVRFA----AEP.......---------
Q0A9H9_ALHEH/13-128-PDGGA---------------------...-RPS----------------GTDREQA----WR........---------
Q82SH4_NITEU/5-122-TGSEA---------------------...-YPS----------------RSDVELA----AEP.......---------
Q2YAE7_NITMU/14-131-THTPA---------------------...-YPS----------------RTDVQYA----SQP.......---------
F0DZB5_9PSED/6-123-TASEA---------------------...-WPS----------------REDIALA----SDP.......---------
Q2SI97_HAHCH/5-122-TASRA---------------------...-YPS----------------KDDILCA----AEP.......---------
Q84HF8_PSEFL/5-121-TASRA---------------------...-YPS----------------ATDIEFA----TDA.......---------
Q7BNS3_PSEST/6-123-TASEA---------------------...-YPS----------------REDIEYA----GYP.......---------
Q82D25_STRAW/5-122-TATEA---------------------...-YPS----------------RTDISYA----NEP.......---------
A1SG89_NOCSJ/5-128-TATEA---------------------...-YPS----------------RTDIGLA----SEP.......---------
Q1AY15_RUBXD/6-127-PDHPA---------------------...-EPS----------------EYDRQHA----WP........---------
D5HAX1_SALRM/4-126-PDHPA---------------------...-RPS----------------ATDLEEA----TFP.......---------
Q02B10_SOLUE/5-125-PDCDA---------------------...-YFS----------------KTDLQNS----CP........---------
E2TKU9_MYCTU/5-122-TATEA---------------------...-YPS----------------RTDVKLA----TEP.......---------
Q5Z0V7_NOCFA/5-122-TATEA---------------------...-YPS----------------RTDISYA----SEP.......---------
A8L770_FRASN/19-136-TATEA---------------------...-YPS----------------RTDISIA----GYP.......---------
Q47MB9_THEFY/5-122-TSTEA---------------------...-YPS----------------RTDISYA----SEP.......---------
Q2JEP2_FRASC/5-122-TATEA---------------------...-YPS----------------RTDVSLA----AEP.......---------
Q7MRV8_WOLSU/6-118-PSTPA---------------------...-RPS----------------DEDIRLA----YDS.......---------
Q39VC3_GEOMG/6-119-PETPA---------------------...-RPS----------------EEDIRLA----LTP.......---------
B3EN74_CHLPB/4-118-PVTPA---------------------...-RPS----------------QEDIRLA----FDP.......---------
A3DIG3_CLOTH/5-123-PATPS---------------------...-RPS----------------EEDIRLA----FDP.......---------
B8FTM5_DESHD/5-124-PATPA---------------------...-RPS----------------AEDKRLA----FDP.......---------
A6TTW0_ALKMQ/7-124-PYTPS---------------------...-RPS----------------EEDKRLA----YDP.......---------
A4XJZ1_CALS8/5-124-PTTPA---------------------...-RPS----------------EEDKRLA----FDK.......---------
Q3AW93_SYNS9/27-153-PKTAP---------------------...-EPS----------------TRDCAWA----EP........---------
Q3AML7_SYNSC/5-131-PASEP---------------------...-VPS----------------PHDRQWG----EA........---------
Q7U4L3_SYNPX/10-140-PHSPP---------------------...-VPS----------------AADRCRG----VP........---------
A3Z8Z4_9SYNE/8-143-PEGEP---------------------...-EPS----------------RRDLDWA----TT........---------
A9BCQ7_PROM4/10-152-SYSCA---------------------...-NPS----------------RLDLSWN----FS........---------
Q7V9V1_PROMA/10-154-PMGST---------------------...-FPS----------------QMDLSMN----FS........---------
Q46IP8_PROMT/10-154-PLNEN---------------------...-RPS----------------EMDLLFH----QP........---------
Q3MEG9_ANAVT/9-148-PDHHA---------------------...-VPS----------------ECDRLYA----WP........---------
B2J4Y6_NOSP7/5-138-PDHPA---------------------...-IPS----------------ECDRLYA----WQ........---------
Q2JJY1_SYNJB/6-136-PNHAA---------------------...-IPS----------------EFDRQHA----FPW.......---------
Q2JS00_SYNJA/6-136-PNHAA---------------------...-VPS----------------EFDRQHA----FPW.......---------
A9W9Z2_CHLAA/6-141-PDAEA---------------------...-VPS----------------ERDRIGA----QAIGGS....---------
Q2IF99_ANADE/8-141-VEVGA---------------------...-SFS----------------AKDRADA----LADGVPLLP.---------
O64333_BPN15/2-106-PDATT---------------------...-QPS----------------ELDKAQC----DATL......---------
Q9MCU3_BPHK0/2-106-PDATT---------------------...-QPS----------------ELDKAQC----DATL......---------
Q8W6T2_9CAUD/12-125-PGASA---------------------...-QPS----------------EADRAMC----ERSGI.....---------
A3EHW4_VIBCL/1-109-PDASS---------------------...-KPS----------------ERDIYNA----NALKAEYPN.---------
Q02TC3_PSEAB/4-108-PDVPA---------------------...-TPS----------------MADRVSC----ELHG......---------
Q8XYR3_RALSO/2-105-PNASA---------------------...-EPS----------------EADRVAC----EASG......---------
C6TYU0_BURPE/2-115-PGASA---------------------...-QPT----------------DEDRTMC----GRSGI.....---------
A9APW0_BURM1/2-115-PNGTA---------------------...-QPS----------------MADRTVC----ERAGI.....---------
A4TT77_YERPP/1-112-TDESA---------------------...-DAS----------------DADRAGC----EATE......---------
Q6XQC1_BPT1/3-111-TGDGA---------------------.TT-LPS----------------AHDTCMC----NEME......---------
F0A4T4_NEIME/7-109-PRGEP---------------------...-FLS----------------GADRWMQ----VETG......---------
D9PEJ9_ACTPL/3-105-PNGEP---------------------V..-.LS----------------IADRQMQ----DLSQ......---------
Q3Z1B1_SHISS/1-103-PGGLP---------------------...-WLS----------------EADRRLQ----VQSD......---------
E6BUJ9_ECOLX/1-103-PGGLP---------------------...-WLS----------------EADRRLQ----VQSD......---------
Q7WX35_CUPNH/81-188-GRHPA---------------------...-FFS----------------STDDDDD----CHDV......---------
A1VVA1_POLNA/80-189-GNHSA---------------------...-FFS----------------ETDDCDD----FGST......---------
A0R7L0_PELPD/81-188-GRHPA---------------------...-VFS----------------PEDNNDD----RGET......---------
Q8XYU8_RALSO/133-242-GALAA---------------------...-FFS----------------EQDNRDD----AGEV......---------
Q21Q53_RHOFD/82-191-HQMSA---------------------...-YFS----------------RTDDADD----IASNEV....---------
Q120V3_POLSJ/78-187-GTFSA---------------------...-FFS----------------QEDDRDD----KGSM......---------
Q5NUW4_RALME/76-183-GRYPA---------------------...-FFS----------------ATDDADD----RHDV......---------
Q8ZSF0_NOSS1/58-173-GTLAA---------------------...-YPS----------------SADNQEE----KGK.......---------
A4JUM8_BURVG/81-187-GTSPA---------------------...-FFS----------------RTDNQDD----KHDV......---------
Q5NXB5_AROAE/80-200-GASSA---------------------...-FFS----------------GTDDFDD----RGEVKLSIV.---------
Q11ZD2_POLSJ/78-182-GELPA---------------------...-FFS----------------EQDNADD----ADQL......---------
Q47D11_DECAR/80-200-GYGSA---------------------...-FWS----------------AKDDGDD----QGIKVAGVF.---------
Q8PFM8_XANAC/617-745-PKGVK---------------------.A.-VPS----------------IQDQDLL----SHLCTRLGAH---------
A1U033_MARAV/627-755-PRGCH---------------------.S.-NPS----------------THDRIQL----DYLEGVMARD---------
A1VVG1_POLNA/619-747-PPGHS---------------------.A.-SPS----------------RDDLVQL----VHLALGMADD---------
Q5HY19_GLUOX/596-724-PDGIA---------------------.A.-RPS----------------DDDEKVF----AYLCRQLAPA---------
A3U023_9RHOB/617-745-PQLVG---------------------.V.-MPS----------------VTDLSQI----NWLATIFDMD---------
Q3J4T5_RHOS4/19-143-PGASP---------------------...-APS----------------GPDLSAI----AKMARHPTFI---------
B6F186_CLOPF/572-698-PESST---------------------...-NMS----------------SKDKKSL----LELKEYLKEY---------
A9BTW4_DELAS/624-751-PKGG.---------------------...-AHS----------------GIDRNTL----RGIAEDA..G---------
A4AAI2_9GAMM/624-751-PKGG.---------------------...-AHS----------------GIDRNTL----RSIAEDA..G---------
A1U5J0_MARAV/600-724-IGAS.---------------------...-RPS----------------STDQTTF----SDLSQNL...---------
Q2LTW5_SYNAS/612-744-PTSLP---------------------...-APS----------------ETDFLAM----HALVNA....---------
Q21PA7_SACD2/610-735-TTPS.---------------------...-PPS----------------LKDRVTY----EKLAKNY...---------
Q3SNL7_NITWN/223-347-LADQ.---------------------...-GPS----------------ALDRATA----RQLAAER...---------
D3GMN5_9ENTR/45-166-PEDFP---------------------...-QPS----------------YTDMKSW----LTGLIA....---------
C6YLL5_VIBCL/21-142-PEDRP---------------------...-FPS----------------ATDRHSW----RRNIVS....---------
Q4FRY9_PSYA2/20-141-PEDVP---------------------...-KPS----------------MTDYSSW----HKNLKS....---------
Y4QB_RHISN/8-136-PNAQS---------------------G..-EPS----------------WTDRRCL----RTIIR.....---------
A0AW82_ARTS2/13-145-PTGQP---------------------...-VPS----------------LRDLKTL----ETIAA.....---------
A5G3M8_GEOUR/23-151-PEPHP---------------------...-SPS----------------SIDDTNW----KRKLK.....---------
Q2L5J9_CLOPF/14-141-PEDYP---------------------...-NFS----------------SIDKKNW----INLGK.....---------
Q2NDB2_ERYLH/5-124-PTTVP---------------------...-EPS----------------ATDAAMA----AQDGS.....---------
Q2K8Q5_RHIEC/6-134-PSFEV---------------------...-RPS----------------GVDVQSM----RDLVR.....---------
Q8KGW0_RHILI/15-149-PGRA.---------------------...-YHS----------------TTDDAYA----VATTVG....---------
Q2K2A8_RHIEC/65-199-PSDA.---------------------...-YHS----------------DTDDEYA----LATAVG....---------
C5ATD4_METEA/9-143-PGRA.---------------------...-FHS----------------EADDAWA----IVRHRG....---------
Q13F65_RHOPS/9-143-PGRA.---------------------...-YHS----------------DADAKWA----IIRHSG....---------
Q6YRV1_SYNY3/11-152-GKNGA---------------------...-RFS----------------EQDDVNE----PDLVQLAQNR---------
A4JA90_BURVG/13-148-PSGYP---------------------...-EFS----------------RYDDESD----RAFFSAVDNI---------
A1VQ27_POLNA/13-152-PGAGA---------------------...-FFS----------------DQDDRNE----AELARTTFNK---------
Q1QNK4_NITHX/10-142-PGGLF---------------------...-EFS----------------AADDASD----SVVVPGLFAA---------
Q2IDP5_ANADE/4-131-PGALD---------------------...-QPS----------------AQDAREL----AAGLAHNPHL---------

PF05021

Q380R2_ANOGA/286-599-PLVPL..........YTFLE...RKDAKQYFPVENRMIDGH........IQDFAAL----ANYLAKSR...........
NPL4_CRYNJ/281-610-PLAPS..........PLF........LSNAFPTENRPGLHDQ.....SMQVVITQL----AAILKTSDAEIGDAGTWPG
NPL4_MAGO7/285-589-PDVAK..........PMF.......SDEGAFPIENREYMGE........SQEHSAA----AKALKVHEKA........S
NPL4_PICST/268-574-PVNPT..........PMF.......DTDSNFVIENRDFFNE........LQNLHAV----SKYLNAD............
NPL4_DEBHA/260-563-PLDPS..........PMF.........RENFPIENRDFMGD........LQDLKSA----YNYLNAD............
NPL4_DROME/282-593-PLQPI..........YTFTE....YDKRQPFPIENRYIDGH........LQDFNAL----SCYLSAWG...........
NPL4_CANAL/286-595-PLQPT..........PIF.........TNSYVIENREFLGDEN....HDIQSLKTL----HNYLKSN............
NPL4_PICGU/288-564-PLNPT..........PRF.........TNGFTIENRDFMGN........LQDLRAA----YRYINSD............
Q5CYK6_CRYPI/214-488-PIQPK..........PFF........SSSQFPRENRIV...........PQKPSDV----SEFIKSRLT..........
A8X418_CAEBR/151-470-PKEPH..........YTFHIGTMTNSKNVKFNVENRQAIGQ........LQGGANL----TQYSGEFS...........
NPL4_COCIM/290-605-PTEPS..........ALF........ADTTFPIENREVIGE........SQDIRNV----AKKLLSRS...........
NPL4_ASPOR/287-599-PTESS..........PLF........VEGNFPIENREVIGE........SQELRHV----AKKLVSHG...........
NPL41_ARATH/156-410-HQGPL......................SCTFPIENRNT...........QTTMRAL----KTHMERAR...........
A7AUE8_BABBO/207-478-PINPN..........SIF........KYSDFPRENRTIR..........PITPDAV----KKFFSSRLAE.........
NPL4_SCLS1/289-608-PSDPK..........PAF.......MAKNSFTIENRLVIGQ........EQDIKDV----GKQLGLDKNGQ.......L
Q63ZR4_XENLA/250-559-PKDPV..........YTFS......TSCNLFPIENRDVLGE........TQDFHSL----ATYLSQNL...........
NPL4_KLULA/265-593-PKETDDDSTTTANTTTVF.......KTVAGFPWTNRQAMGQ........SQDYTEL----KRYVYKACTG.........
NPL4_AJECN/292-589-PTDPD..........VMF........NNSTFPIENREVIGE........SQDLRML----ADKLVSHG...........
A7SZA1_NEMVE/172-484-PVQPV..........YTFSP...PPSNGAVFPIENRENIGE........LQDFDAV----RRHLSQYP...........
NPL4_VANPO/248-566-ITEDSK.......NQIKF.......HSTGGFPWANRQAMGL........SQDYQEL----KNYLYSAATG.........
NPL4_CANGA/260-578-PKDEDT.......TTQLF.......NSVTGFPWSNRQAMGY........SQDYHEL----KRYLHSTAAS.........
Q8I426_PLAF7/256-527-PKVVR..........SIF........KNFHFPRENRQH...........SQSAFHV----KEYFRSNKL..........
Q2HAC4_CHAGB/250-562-PEAPK..........PVF........NNITFPIENREYVGE........AQEVSAV----AKALRVN............
Q01AR0_OSTTA/156-409-HEGPL......................SSTFPVENRLHP..........IQTVDDL----REALQK.............
NPL4_YEAST/259-577-PNTDTE.......TNSKF.......VSSTGFPWSNRQAMGQ........SQDYQEL----KKYLFNVASS.........
A5KB05_PLAVS/256-527-PKVVR..........SLF........KNFHFPRENRLH...........SPTAYDV----KEYFASPKL..........
NPL4_DICDI/319-563-REDKS...........IF.........NISFPVENRIP...........VNTLSDL----ASYKLEHK...........
Q8SRJ9_ENCCU/202-474-.CKPN..........PLF........RSIDFIPK...............KFGDRKM----AEYFG..............
NPL4_ASHGO/241-560-PVAADT........PPTF.......QAHTGFPWANRQAMGQ........SQDYLEL----RRVLLPSIAA.........
A0C810_PARTE/307-574-NPNSN.........YSIL........KLYDFPVENRSA...........VAKQQDL----KTFLHKHQ...........
A4RW87_OSTLU/156-413-HEGAI......................STTFPVENRLHP..........VQTVDDL----KDALRK.............
NPL4_PHANO/275-593-PTQPN..........PLF........TGGKFPIENREIMGE........MPDVSAL----GKSLNAKANGL.......A
NPL4_LODEL/287-597-PIDPK..........PLF.......TSKISYVIENREFLGHGDIDGLDHLQNLSSV----AKFIKLN............
Q7RED9_PLAYO/245-516-PKVVR..........SIF........KNYHFPRENRNK...........PQTVYDV----KEYFSSSKL..........
A5BEN5_VITVI/154-392-HQGPL......................SSTFPIENRIT...........QVTMRAL----KNHLDRAK...........
NPL4_NEUCR/276-588-PESPR..........PVF........TNDGFPIANREFVGE........AQEASSV----AKILKVN............

PF03665

U172_ARATH/8-208.DDVEL-------------------------CGV.AKNIGDHISR....YFPQAPILLLNNKKLEALSKGKERSPVMQ..
Q4SKU7_TETNG/1-192.SDSSP-------------------------TPG.ALKIADKISE....QFDNAVLLMVDGSKMSPDYRVPPIV......
Q4PCQ4_USTMA/4-202.AERDP-------------------------SAQ.ASKLAEKIAS.LS.NKAEALLLLVNNATLLKPDHHSLSGYS....
Q53Y03_HUMAN/1-204.KDASP-------------------------NQV.AEKVASRIAE....GFSDTALIMVDNTKFTMDCVAPTIH......
U172_DICDI/2-192ANELEP-------------------------EPI.AKKIADRLNN....ELNNMCFLMISKIEVNRPSGLVSID......
F158A_HUMAN/1-193.NDQSP-------------------------GPL.ALKIAGRIAE....FFPDAVLIMLDNQKLVPQPRVPPVI......
A4H4X4_LEIBR/5-249.MDSCI-------------------------SPV.TKTMLEALQARMP.SNTKLLVWFVCNEYLTSPPMGLAITCLTVDR
Q8IHW7_PLAF7/3-195.DDSKN-------------------------SDIENIKVCELISEKLIKNYNDAFVCLLEFSKYVNDEDNCLN.......
U172_DROME/1-194.YDNQV-------------------------DKTPAAKIADKIQE....NFKNACFVVVDNKLMTLQHDRAAIQ......
Q1W2L0_SALBI/3-198.DDYDL-------------------------GIV.AKNIGDHLCR....YFPQAGILLLDNRKLEALPKVKDRSHVMQ..
Q6P4M9_XENTR/1-196.KDTSP-------------------------NQV.AERIASRIAE....GFNDAALIMVDNSKFSMECISPSFH......
Q3B8G2_XENLA/1-193.RDTSL-------------------------SCT.AIRSASLIAE....YQEDAVLILLDNERMTLNPGIPPLT......
Q4DRE9_TRYCC/6-215.GDSGI-------------------------SPL.TTNVLRMLHDKVS.TGHNPLLWTIVGANRAEGVDVRPSYYMGGKN
A5K556_PLAVS/3-196.EDSKN-------------------------DDIKNVKVCELVANKLVKNYSDAMICLVQLSKLESDDANCLN.......
Q17EH7_AEDAE/1-189.YDNSL-------------------------ERAPGARIADKVAE....NVNGAVFAVIDNRAVSINMRYPALK......
Q5DA93_SCHJA/2-187.NSSMP-------------------------TNI.ALKIGEKLAE....KCGAICILGFKNDALYRLNGN..........
Q93568_CAEEL/2-186.SDTSL-------------------------NVY.ATRLADRISS..V.TSSAAILVQVMNERLVSDCEQDRLV......
A5APP0_VITVI/4-206.DDAEL-------------------------SSV.AKNIGDHIYR....YFPQAAVILLDNKKLESLPKGKDRSPVMQ..
Q5TPN5_ANOGA/1-188.YDNRF-------------------------ERAPGIRIADKIAE....SCSNACIAVIDNCSISINMRYPALK......
Q8AWD7_DANRE/1-192.SDSSP-------------------------TPC.ALKIAEKIFE....QCNNAVLLMIDGEKMFPGCRVPPIV......
Q8L439_CHLRE/2-202.GPGDL-------------------------PPL.GRKIADKVSE....HQAQAVVLVLDNKRLEQFCKAQADNPFE...
A4HT47_LEIIN/5-249.TDNGV-------------------------SPL.TKKMLDALQARLP.TSTRLLVWFVSNECLTSPPTGLAITSLTADR

PF01398

D1039_DICDI/532-641-PTQDC-------------------------FLS----------------AVDVHTH-----------------------
PSDE_DICDI/26-139-PGFGC-------------------------WLS----------------SVDVNTQ-----------------------
CSN5_YEAST/66-190-PGYDC-------------------------WLS----------------NIDIQTQ-----------------------
PSD7_DROME/6-121-PKL..-------------------------..H----------------QNDIAIN-----------------------
RPN8_YEAST/3-116-PKL..-------------------------..R----------------ASDLKIN-----------------------
RPN11_SCHPO/25-138-PGFGC-------------------------WLS----------------SVDINTQ-----------------------
CSN5_CAEEL/51-165-PGYGC-------------------------WLS----------------GIDVSTQ-----------------------
EIF3F_ARATH/23-133-AGV..-------------------------..N----------------GGSSLIH-----------------------
EIF3F_HUMAN/87-196-HDI..-------------------------..T----------------EHSVLIH-----------------------
O59157_PYRHO/26-138-LNCPP-------------------------YPS----------------KKDIKGM-----------------------
BRCC3_HUMAN/7-148-PHITV-------------------------WPS----------------HVDVRTQ-----------------------
O61792_CAEEL/36-151-PKL..-------------------------..H----------------KNDIAIN-----------------------
O27052_METTH/17-118-PGPVN-------------------------LPS----------------AADLHFF-----------------------
EIF3H_HUMAN/34-146-YYG.S-------------------------FVT----------------RALLDSQ-----------------------
EIF3F_CAEEL/2-117-SDI..-------------------------..T----------------SSCLIYH-----------------------
YPT5_CAEEL/24-137-PGFGC-------------------------WLS----------------SVDVNTQ-----------------------
RPN8_SCHPO/12-125-PQL..-------------------------..R----------------PSDLEIN-----------------------
EIF3F_SCHPO/18-129-PDL..-------------------------..D----------------AFSALIQ-----------------------
MEC_MYCBO/6-114-TATEA-------------------------YPS----------------RTDVKLA-----------------------
CSN6_HUMAN/36-148-GPP..-------------------------..D----------------PSDIHVH-----------------------
EIF3H_CAEEL/10-139-QFG.A-------------------------GFS----------------HDLVESM-----------------------
STABP_HUMAN/252-361-PTQTA-------------------------FLS----------------SVDLHTH-----------------------
BRCC3_MOUSE/7-148-PHITV-------------------------WPS----------------HVDVRTQ-----------------------
PSD7_ARATH/12-125-PKL..-------------------------..R----------------ENDLDVH-----------------------
CSN6B_ARATH/6-136-SDA..-------------------------..T----------------ESDMHIH-----------------------
CSN5B_ARATH/54-168-PGYGC-------------------------WLS----------------GIDVSTQ-----------------------
O13386_HYPJE/11-125-PKL..-------------------------..R----------------ASDLEIN-----------------------
PRP8_HUMAN/2099-2205-PNESP-------------------------QLS----------------PQDVTTH-----------------------
CSN5_SCHPO/30-144-PNYGC-------------------------WLS----------------GVDVETQ-----------------------
O16155_SCHMA/21-128-PGFGC-------------------------WLS----------------GVDMNTQ-----------------------

PF15659

D3IMU4_9BACT/335-480--..--------..-----DYKAYK-RVA....SG--ERVAN--------------------------------YYT---
D3IMY5_9BACT/92-252--..--------..-----...IYP-NI.......--..ELK--------------------------------IYN---
D1PWX0_9BACT/114-279--..--------.I-----PYAQWI-TDES...KQ--NPSFK--------------------------------IYL---
G9S3Z7_9PORP/207-377--..--------..-----YLAKYS-SKNN...KS--TPFFK--------------------------------IFI---
C6IIY2_9BACE/879-1045--..--------.I-----RYGIYY-KD.......--..NII--------------------------------NYT---
D0TNF7_9BACE/83-238--..--------..-----..TVYH-RD.......--SKVLF--------------------------------FYN---
E4RWK9_LEAB4/231-388--.G--------DL-----QTAIAF-PK.......--.ATHS--------------------------------VYD---
C6IJD1_9BACE/48-220--..--------..-----N.AVYM-KDNRVSTDK--KDMIY--------------------------------EYT---
I0TCD6_9BACT/325-474--..--------.T-----PAGELV-KQ......Y--YRDGD--------------------------------VWT---
E2NN46_9BACE/59-211--..--------..-----..AVYL-KR.......--NRTLH--------------------------------EYN---
E4RXN7_LEAB4/92-255--SS--------MF-----PRFFIS-LE......N--GNMRE--------------------------------YFH---
C9L1R0_9BACE/138-300--..--------..-----N.AVYI-RDS....GK--EGMLY--------------------------------EYN---
E4RWK7_LEAB4/354-517--.R--------FL-----PRFFLS-LE......N--GAMRE--------------------------------VYQ---

PF04002

D1N9M0_9BACT/106-227--GI--------LL-----HDHIIV.A.......P--SCYFS.FA--------------------------SR.RML---
D2BH65_DEHSV/106-228--GI--------EV-----LDHIII.G.......G--QSFTS.LK--------------------------RQ.GLL---
Y1917_THICR/102-225--ET--------RC-----LDHIIL.G......DH--GRWYS.FT--------------------------QQ.GIL---
Q1N8A1_9SPHN/109-231--NI--------SV-----HDHVII.A.......G--QGHVS.LR--------------------------AK.GLL---
Q2N869_ERYLH/27-148--EL--------TL-----IDHMIF.T.......R--DRFFS.MA--------------------------AG.GFL---
Y1174_NEIMF/102-224--DV--------SL-----LDHFIV.T.......S--QSVRS.FR--------------------------QL.GLM---
A6GHT1_9DELT/122-244--GI--------PV-----LDHVVV.S.......A--NGFVS.LA--------------------------EL.GLV---
C0ABZ0_9BACT/117-246--EI--------KL-----VDHVIV.GSPEADPTG--RGFFS.FR--------------------------EM.GLV---
Q0HVT6_SHESR/47-168--DV--------RV-----LDHIVV.G.......R--.TPVS.FA--------------------------ER.GLL---
B3EB20_GEOLS/42-163--GI--------KV-----LDHIIV.G.......D--DEFLS.FV--------------------------ER.GLL---
Q03YZ9_LEUMM/73-198--DL--------RL-----FDSFIV.T.......Q--NEYWS.MS--------------------------EN.QQL---
Q7P812_FUSNV/110-232--GA--------LL-----IEHIII.T.......K--NSYFS.FL--------------------------EE.GLI---
Q30YK7_DESDG/103-225--GM--------TL-----VDHVIV.T.......E--EGHYS.LK--------------------------ED.GLF---
Y3180_DESHY/105-227--GI--------EV-----LDHVII.G.......D--NRYIS.LK--------------------------ER.GIL---
A8ZUS2_DESOH/106-228--GI--------TV-----HEHIIV.G.......E--RGHFS.FA--------------------------DN.GYM---
A4BXR1_9FLAO/24-149--DI--------KL-----LDHLII.T.......K--DEFYS.LS--------------------------DN.DCY---
A5LVX8_STRPN/103-225--GI--------VL-----LDHLIV.S.......H--SNYFS.YR--------------------------EK.TDL---
Q7NFQ9_GLOVI/117-239--QI--------PV-----LDHVIL.G.......Q--GNFTS.LR--------------------------RL.TAL---
Q8ABN2_BACTN/26-150--DL--------HL-----LDHIIL.T.......E--ESYYS.FA--------------------------DE.GLL---
A8MGD7_ALKOO/25-146--GI--------KL-----IDSMIMGY.......N--GEYFS.MR--------------------------NE...L---
A6EEF9_9SPHI/26-151--NI--------KL-----IDHLII.S.......N--DGYLS.FA--------------------------DQ.QML---
A3U7J3_CROAH/109-231--DI--------KV-----LDHVIV.T.......Q--KAYFS.FA--------------------------DN.GIL---
Q5Z1A3_NOCFA/105-224--GL--------RF-----LDHIVL.........A--GEHWS...--------------------------.RAAPL---
Q2SAG7_HAHCH/49-171--EI--------PL-----IDHFVV.G.......G--DQVVS.MA--------------------------AQ.GIF---
A5G1T0_ACICJ/119-241--DI--------TL-----HDHVII.G.......K--AGWLS.FR--------------------------RE.GFL---
A9B8G6_HERA2/79-201--EI--------EL-----LDHLII.G.......K--GGYTS.MR--------------------------ER.RLA---
Q0F0W4_9PROT/139-261--EL--------KI-----LDHFLI.A.......D--KEVLS.FR--------------------------EH.GWF---
A4YL64_BRASO/115-237--GI--------TV-----HDHIIV.G.......R--NGHTS.LK--------------------------SN.GLM---
Y1557_THEMA/101-222--GV--------SL-----VDHVIV.S.......R--RGYFS.FR--------------------------EE.GEL---
Q1NUQ1_9DELT/108-231--EI--------QL-----LDHCVIGG.......E--ERPYS.FA--------------------------DH.GLM---
Y1125_HAEI8/99-221--EI--------RV-----LDHLIV.G.......K--SDCYS.FA--------------------------EN.CLL---
A7AJ21_9PORP/104-226--EI--------QL-----LDHIVL.A.......D--GSYYS.YS--------------------------DE.GTL---
A6NZB7_9FIRM/107-229--GV--------IL-----VDHLIF.V.......D--DDMVS.MG--------------------------DS.GFL---
A5ZSZ3_9FIRM/23-146--GI--------SL-----VDHIITGR.......N--GNYYS.FR--------------------------DK.GEF---
A8ZYJ4_DESOH/28-150--NV--------DL-----HDHIIV.........G--EGYYS.FA--------------------------DA.GVI---
Y086_PSESM/102-224--DV--------HV-----LDHVIV.G.......D--GEPLS.MV--------------------------EK.GLM---
A4XHM1_CALS8/103-225--GV--------AV-----NDHFIV.A.......K--GEYYS.FA--------------------------QN.GML---
B2JE00_BURP8/120-242--DV--------QL-----IDHLVI.G.......A--HDTFS.FA--------------------------RA.GWP---
Y611_CHLTE/100-222--QI--------EL-----LDHVIV.G.......N--NDWFS.FR--------------------------DH.ALL---
Y1610_AQUAE/110-231--GF--------EL-----LDHLIL.S.......E--GRYFS.FR--------------------------EE.GVL---
B0V642_ACIBY/120-242--EI--------RL-----LDHFII.S.......P--EGSFS.FA--------------------------EQ.QLL---
A4ITX8_GEOTN/9-125--GI--------EV-----LDHLVI.N......YK--AEYTS.LK--------------------------ER.GFF---
Q7VMM9_HAEDU/35-157--DV--------NV-----LDHIIV.S.......A--TDTYS.FC--------------------------MH.QLM---
Y491_PSYWF/102-224--DL--------RL-----TDHIIV.G.......R--NQTLS.FA--------------------------ET.ATA---
Y4865_PHOLL/108-230--GV--------KV-----LDHLVI.G.......R--QCCVS.FA--------------------------ER.GWI---
Y371_SYMTH/110-232--GI--------EV-----LDHLVV.G.......Q--GGYTS.FR--------------------------ER.GLL---
A5Z7J1_9FIRM/22-146--GI--------PL-----LDHIIV.GP.....DK--GRYFS.LR--------------------------DK.QLV---
Q02HM7_PSEAB/85-202--DI--------EL-----LDHFVI.G.......R--GEPFS.FF--------------------------DA.QLL---
Q2S840_HAHCH/1-123--EV--------RV-----LDHVII.G.......G--MEEFS.FV--------------------------EN.GIL---
A5EYF9_DICNV/276-401--GV--------RL-----LDHFVV.A.......G--NQVIS.LR--------------------------ET.GDW---
A0Z2T6_9GAMM/98-220--DI--------DL-----LDHLIV.A.......Q--GRYLS.MA--------------------------SE.GLA---
A4NTE0_HAEIF/34-156--EI--------KL-----LDHFIV.S.......G--SASFC.FT--------------------------DN.HLI---
A6EKP4_9SPHI/26-151--QI--------TV-----LDHLIV.N.......S--EDYFS.FV--------------------------EA.NLI---
Q5P8G7_AROAE/74-196--EV--------RV-----LDHFVV.A.......G--HSTVS.FA--------------------------ER.GLL---
Q5PA32_ANAMM/108-230--NI--------VL-----VDHVII.T.......P--KRHYS.FK--------------------------TN.GLL---
A3ER13_9BACT/109-231--GI--------RV-----LDHVVL.G.......D--HAWVS.LE--------------------------ER.GGL---
Y1515_LACLM/103-226--GI--------NF-----IDHIIV.G.......A--GNYYS.FR--------------------------ERDSNL---
A6DQ92_9BACT/32-161--GV--------EV-----IDHLIV.GYCL.NKQK--HHFLS.FR--------------------------QE.GFM---
A9KL05_CLOPH/109-231--GV--------TL-----MDHIII.G.......D--NRYIS.LK--------------------------EQ.GII---
Q2IEL9_ANADE/81-203--GV--------VA-----RDHVIV.A.......T--GGYFS.FV--------------------------QAGRWR---
Q2QJL1_ACEAC/25-147--NI--------HV-----WDHIIV.A.......G--EKLLC.MR--------------------------EA.GFL---
Y341_CARHZ/104-226--GI--------KL-----LDHIIL.G.......E--NKYIS.MK--------------------------AE.RLF---
Q03EP2_PEDPA/97-219--GI--------RL-----IDHLIV.G.......D--QSYWS.AA--------------------------EK.RFI---
A5KLJ1_9FIRM/109-231--GI--------RL-----FDHIVI.G.......D--NCFVS.MK--------------------------EK.GFF---
A5FBM2_FLAJ1/31-156--DI--------PL-----LDHLIV.T.......P--ETYYS.FA--------------------------DE.GAL---
A3CRJ6_METMJ/102-223--GI--------RV-----LDHIIV.T.......K--NGCAS.LK--------------------------EL.GHL---
Q1Q559_9BACT/9-136--GI--------QV-----LDHVII.G.......N--PEYYS.FK--------------------------ER.GII---
Q042N7_LACGA/84-206--GI--------DF-----LDHFIV.T.......D--NTYLS.FR--------------------------EM.ELL---
Q2B8H5_9BACI/107-228--GI--------PL-----SDHIIV.G.......R--NKYFS.MK--------------------------KQ.GHL---
Q2LSS5_SYNAS/184-306--DI--------MV-----HDHLII.G.......E--NRFFS.FR--------------------------EE.GIM---
A4SZN2_POLSQ/113-235--DI--------SL-----LDHCIV.S.......S--SGFFS.FS--------------------------ES.GLM---
Y1765_PARUW/107-229--GI--------PL-----RDHLII.G.......K--NSYVS.FK--------------------------DQ.NLL---
A6EEP6_9SPHI/39-153--HV--------KV-----LDHLIV.T.......R--GHYFS.FI--------------------------DN.QLI---
A4XJG8_CALS8/36-160--DI--------KL-----NDHIII.T.......E--NAYFS.FA--------------------------EA.GIL---
Q11VY8_CYTH3/111-233--ET--------PV-----LDHVII.C.......N--HTWYS.FA--------------------------DE.GKI---
A0LNF4_SYNFM/102-224--DI--------IV-----HDHIII.A.......G--PRYYS.FA--------------------------EH.GGL---
A7FEQ9_YERP3/38-160--DI--------RV-----LDHLII.G.......E--SEPVS.LA--------------------------EL.GWL---
Y1850_BORPA/103-225--DV--------RL-----IDHVIV.A.......G--AATVS.MA--------------------------AQ.GHL---
Q8GFV0_CITFR/27-149--DV--------KV-----LDHLIV.G.......G--SDIYS.FA--------------------------EH.GLI---
Q5NML0_ZYMMO/19-141--GI--------KL-----LDHLIF.A.......N--KKCQS.FH--------------------------SI.GLL---
Q72Q17_LEPIC/104-226--GL--------EL-----LDQWIF.G.......I--DGIYS.CK--------------------------KG.KVL---
Q5FNC5_GLUOX/112-229--SI--------TL-----HDVLIT.N.......E--GRPSS.LR--------------------------QE.GLL---
B8CX04_HALOH/118-240--GI--------DF-----LDHIVI.E.......A--DGYHS.YD--------------------------QL.NLI---
A5TXI1_FUSNP/685-807--NK--------EV-----LDHIIV.G.......K--EGVYK.YS--------------------------EN.DLI---
A5Z6A2_9FIRM/108-230--GI--------NV-----LDHIII.G.......D--RSYSS.LR--------------------------EL.KLM---
A3D8H4_SHEB5/24-146--DI--------NV-----LDHVII.G.......L--NRFTS.LR--------------------------ETHCDL---
Y852_LACSS/100-222--GI--------TC-----LDHLII.G.......S--SQYLS.LR--------------------------EE.GYL---
Y2338_SALRD/110-232--GI--------PV-----HDHLII.A.......G--TKHTS.LA--------------------------ER.GVI---
Y1989_LEGPC/102-225--DA--------RL-----LDHIVI.G.......D--NEVYSIFA--------------------------EN.KWV---
Q5QX33_IDILO/36-152--DV--------SL-----LDCMLV.........T--DEVVS.LA--------------------------ER.GLL---
B4S9N8_PROA2/42-165--DL--------QV-----LDHIIV.G.......D--KGYYS.FR--------------------------ES.GLI---
A0L491_MAGSM/113-235--DV--------QV-----LDHLII.A.......G--EKVFS.FA--------------------------SA.GMM---
Q6MR78_BDEBA/35-156--EI--------PL-----NDHLVV.C.......E--NNYFS.MA--------------------------DH.GYF---
A9KR89_CLOPH/32-156--GV--------EL-----LDHIII.G.......G--NEYCS.LK--------------------------EM.GVL---
A7V531_BACUN/74-196--NI--------RM-----IDHVII.T.......N--GGYYS.FG--------------------------DE.GLI---
Q3Z6I4_DEHE1/116-238--KI--------RA-----LDHIII.G.......D--NCYFS.FA--------------------------AA.GLM---
A3DJW5_CLOTH/98-219--GI--------KL-----IDHIIF.S.......R--KGYFS.FL--------------------------EN.GQM---
A9BIK5_PETMO/98-215--GI--------NM-----NDHIII.G.......K--DSYFS.F.--------------------------....TL---
Q8PA70_XANCP/37-159--DI--------RV-----LDHLVI.G.......G--RQHTS.LA--------------------------AR.GWV---
Q1DAY3_MYXXD/101-223--NI--------KV-----LDHVVM.G.......D--GGYVS.ML--------------------------ER.GLM---
Q2GEH3_NEOSM/114-236--DV--------QL-----VDHFIV.T.......P--HDHFS.FV--------------------------VN.GLL---
Q4EAK4_9RICK/97-218--SV--------KL-----FDHIII.T.......S--GGYFS.FR--------------------------EN.GLL---
Q6WB38_ALCFA/54-176--DL--------RL-----LDHIIV.T.......G--KGTSS.MA--------------------------SM.GLI---
A7AC72_9PORP/83-208--GI--------NL-----LDHLII.T.......D--ETYYS.YS--------------------------EN.GRI---
Q1WT78_LACS1/101-223--GI--------EL-----IDHVIV.G.......S--EVYLS.LA--------------------------EE.KIV---
Q7WWR8_COXBE/19-137--AC--------SI-----..NIIIGG.......S--EIRFS.FG--------------------------RKAGCF---
B1YJT0_EXIS2/95-217--GI--------SC-----IDHLVI.G.......H--GQFIS.MK--------------------------QR.GFM---

PF14464

O58174_PYRHO/6-109--..--------.......GIHIIAAF........--...PYDED..---..---------------....SV-KAF---
Q8TYS8_METKA/10-115--..--------.......AVHAIAAY........--...PYTPD..---..---------------....RV-EFY---
Q8TQ16_METAC/27-138--..--------.......NCHIIAGR........--...PYGRE..---..---------------....SW-TCY---
O27052_METTH/16-131--..--------.......LFHLIIAH........--...PYTME..---..---------------....TV-AAY---
B0R451_HALS3/4-126--..--------.......QLHIILGH........--...PYGPD..---..---------------....CW-RAF---
B0R6F4_HALS3/5-124--..--------.......WPDRVYVVA.......--...SLAARPP---IL---------------D...AW-LWT---
Q9I213_PSEAE/7-137--..--------.......LPVDYLVVD.......--.VAAGNVRGA---KL---------------F...AW-RNG---
Q8ZW14_PYRAE/1-111--..--------.......WPVTWIIAN.......--...VFDWHI.---..---------------S...AW-RID---
Q9YE90_AERPE/3-117--..--------.......WPGVWLIAC.......--...PGEVK..---..---------------....AW-TLE---
O59157_PYRHO/36-149--..--------.......IPWLIVSLK.......--...GD.....---..---------------....MK-AFI---
P73582_SYNY3/7-143--..--------.......WPEYIYLIA.....SG--ENGRFNTSR.---..---------------....SW-YLN---
Q9S2G8_STRCO/5-111--..--------.......EPGAHYV.........--...LV.....---..---------------....ST-ADT---
Q9RXB3_DEIRA/6-119--..--------.......YPVPYLIAD.......--...PAAE...---..---------------....VL-RAY---
O67597_AQUAE/5-125--..--------.......DLSYIIFSVQ......--KGKVASYR..---..---------------....SW-ELK---
Q216W0_RHOPB/11-140--..--------.......VDYLVVDVRR......--AKALEAKL..---..---------------....FV-WRK---
B6C3F3_9GAMM/7-123--..--------.......GALYLIISLN......--TKGVLEMR..---..---------------....GF-RLQ---
A3RXH7_RALSL/5-122--..--------.......HAHYLIVSTD......--PACGQAVR..---..---------------....SF-RIA---
Q0A9H9_ALHEH/13-128--..--------.......GWSYLIAAVD......--GRAITELR..---..---------------....SW-RLR---
Q82SH4_NITEU/5-122--..--------.......QAHYVIIPTC......--SPHKEEIR..---..---------------....SF-RIV---
Q2YAE7_NITMU/14-131--..--------.......QSHYVIVPTD......--PAYGEEIR..---..---------------....SF-RIL---
F0DZB5_9PSED/6-123--..--------.......QVHYLIVSTW......--GEARHAAR..---..---------------....SF-RII---
Q2SI97_HAHCH/5-122--..--------.......HAHYVIIPTD......--PEHGSDIR..---..---------------....SF-RIV---
Q84HF8_PSEFL/5-121--..--------.......NAHYLIVTT.......--ADYDPPLR..---..---------------....SF-RIA---
Q7BNS3_PSEST/6-123--..--------.......EAHHLIVSTW......--ENAREPAR..---..---------------....CF-RIL---
Q82D25_STRAW/5-122--..--------.......GAHYVLVSTA......--DADDAGPF..---..---------------....QF-RSF---
A1SG89_NOCSJ/5-128--..--------.......GAHYVLVSTRHGADSR--GGNNGGPV..---..---------------....EF-RSY---
Q1AY15_RUBXD/6-127--..--------.......YYSYVIVSVS......--GEEIREMR..---..---------------....SW-RLR---
D5HAX1_SALRM/4-126--..--------.......GFTYVIVSVR......--DGAPEALT..---..---------------....AW-ALA---
Q02B10_SOLUE/5-125--..--------.......WYSFVVLSIQ......--KGEFHHAN..---..---------------....SW-LPN---
E2TKU9_MYCTU/5-122--..--------.......DAHYVLVSTR......--DPHRHELR..---..---------------....SY-RIV---
Q5Z0V7_NOCFA/5-122--..--------.......NAHYVLISTR......--DPEQHELR..---..---------------....SY-RIL---
A8L770_FRASN/19-136--..--------.......EAHYVLASTR......--DPETIEFR..---..---------------....SF-RIA---
Q47MB9_THEFY/5-122--..--------.......NAHYVLVSTR......--DPETVEFR..---..---------------....SY-RIV---
Q2JEP2_FRASC/5-122--..--------.......GAHYVLASTR......--EPDVTEFR..---..---------------....SY-RIV---
Q7MRV8_WOLSU/6-118--..--------.......SLSYLIVS........--LAKEPVLN..---..---------------....SF-KIK---
Q39VC3_GEOMG/6-119--..--------.......GVSYVIASL.......--AGAEPDVK..---..---------------....AF-RIT---
B3EN74_CHLPB/4-118--..--------.......EIINVIVSL.......--AAQEPEVN..---..---------------....AF-RIV---
A3DIG3_CLOTH/5-123--..--------.......KASYLILSLK......--.DDTPVLK..---..---------------....SF-NIS---
B8FTM5_DESHD/5-124--..--------.......SLSYLIISLA......--EPQKPVCK..---..---------------....SF-LIK---
A6TTW0_ALKMQ/7-124--..--------.......KALYGILSLK......--.DQEPVLN..---..---------------....FF-KIT---
A4XJZ1_CALS8/5-124--..--------.......SLSYLILSLM......--DEKNPVLK..---..---------------....SF-RIY---
Q3AW93_SYNS9/27-153--..--------.......NQLMLILS........--.GMRELR...---..---------------....AW-WLG---
Q3AML7_SYNSC/5-131--..--------.......ESVMLILS........--.ASLGLR...---..---------------....AW-WLH---
Q7U4L3_SYNPX/10-140--..--------.......HQLMLILS........--.AQQGLR...---..---------------....AW-WLE---
A3Z8Z4_9SYNE/8-143--..--------.......PSLMLILG........--.GSGALG...---..---------------....AW-WIE---
A9BCQ7_PROM4/10-152--..--------.......PGLMIIVD........--.GSGVIR...---..---------------....AW-WIG---
Q7V9V1_PROMA/10-154--..--------.......PNLMIIVN........--.GNQKMR...---..---------------....AW-WLK---
Q46IP8_PROMT/10-154--..--------.......PGLMVISN........--.KDGDLK...---..---------------....AW-WIK---
Q3MEG9_ANAVT/9-148--..--------.......GYSYIIVSVQ......--KGIASGIL..---..---------------....SW-SLD---
B2J4Y6_NOSP7/5-138--..--------.......GYSYIIVTVQ......--NGKAGELQ..---..---------------....SW-SLD---
Q2JJY1_SYNJB/6-136--..--------.......GFSCVIVSVR......--EGKAEEVV..---..---------------....SW-VLD---
Q2JS00_SYNJA/6-136--..--------.......GFSCVIVSVR......--EGKAEEVA..---..---------------....SW-VLD---
A9W9Z2_CHLAA/6-141--..--------.......GFSFVIQSVH......--NGVATALH..---..---------------....SW-LLV---
Q2IF99_ANADE/8-141--..--------.......GAEYLVFGVR......--GGKVTEAR..---..---------------....RF-RFH---
O64333_BPN15/2-106--..--------.......LPWHIVSWPE......--....G.....---..---------------....DL-RTI---
Q9MCU3_BPHK0/2-106--..--------.......LPWHIVSW........--..PDG.....---..---------------....DL-RTI---
Q8W6T2_9CAUD/12-125--..--------.......AKWVIVSLGV..QADG--SIGVD.....---..---------------....DW-CEF---
A3EHW4_VIBCL/1-109--..--------.......ADWHIASW........--..PEG.....---..---------------....DI-HSF---
Q02TC3_PSEAB/4-108--..--------.......LPWVILSW........--..PEG.....---..---------------....DV-AHL---
Q8XYR3_RALSO/2-105--..--------.......LPWHIIAW........--..PAD.....---..---------------....DV-RTI---
C6TYU0_BURPE/2-115--..--------.......AKWVIVSL........--...GVQADGS---IG---------------ID..DW-CEF---
A9APW0_BURM1/2-115--..--------.......PQWVIVSL........--...GVQADGS---IG---------------VD..DW-NEF---
A4TT77_YERPP/1-112--..--------.......VPWLILAVRK......--...NVEGDAP---FH---------------FS..EM-NVI---
Q6XQC1_BPT1/3-111--..--------.......VTWIIVSV........--..PEG.....---..---------------....DM-RFV---
F0A4T4_NEIME/7-109--..--------.......LPWILVTQ........--...G......---..---------------....RL-KLF---
D9PEJ9_ACTPL/3-105--..--------.......LDWWLVCN........--...G......---..---------------....EL-HIF---
Q3Z1B1_SHISS/1-103--..--------.......LPWWLVCR........--...G......---..---------------....AI-HKF---
E6BUJ9_ECOLX/1-103--..--------.......LPWWLVCR........--...G......---..---------------....TI-HKF---
Q7WX35_CUPNH/81-188--..--------.......KFAFVMGNCD......--..AATPSM..---..---------------....AL-RLC---
A1VVA1_POLNA/80-189--..--------.......KVSAVLGCVG......--QGATQVRI..---..---------------....RL-MLI---
A0R7L0_PELPD/81-188--..--------.......KIAVVLGRIN......--..SSPSIA..---..---------------....FR-LCV---
Q8XYU8_RALSO/133-242--..--------.......KISCVVGDLA......--DGKTPSIQ..---..---------------....FR-LCV---
Q21Q53_RHOFD/82-191--..--------.......KIAGVVGTIH......--..QNPTWN..---..---------------....FR-MCL---
Q120V3_POLSJ/78-187--..--------.......KFSGVIGNLN......--SGNMTSVL..---..---------------....RM-NML---
Q5NUW4_RALME/76-183--..--------.......KFAFVIGNCN......--..AAVPSL..---..---------------....AL-RLC---
Q8ZSF0_NOSS1/58-173--..--------.......FRVFAIIGT.......--...LNNIPT.---..---------------....IY-TRI---
A4JUM8_BURVG/81-187--..--------.......KFALVLGHCD......--...RTPSV..---..---------------....AL-RLC---
Q5NXB5_AROAE/80-200--..--------.......LGRCDQRVVTAQRFCL--MGMFVPMQ..---..---------------....LA-SAV---
Q11ZD2_POLSJ/78-182--..--------.......CISAVLGRVS......--.....DET..---..---------------....PQ-FVS---
Q47D11_DECAR/80-200--..--------.......GCLHQPKPQALFRLVV--NGRFRPLP..---..---------------....HP-WQA---
Q8PFM8_XANAC/617-745--GL--------P.......AVMLIAGE.......--.....NG...---..---------------....ID-VFL---
A1U033_MARAV/627-755--GS--------P.......AISMIVSD.......--.....ST...---..---------------....IS-VSL---
A1VVG1_POLNA/619-747--GL--------P.......AVQLIVGE.......--.....HD...---..---------------....LQ-VLQ---
Q5HY19_GLUOX/596-724--GA--------P.......YAMLICGR.......--.....DE...---..---------------....TW-LRA---
A3U023_9RHOB/617-745--TL--------P.......GLMLIAGE.......--.....AE...---..---------------....LA-VVF---
Q3J4T5_RHOS4/19-143--CH--------R.......PILVIIGG.......--.....NF...---..---------------....HQ-QPL---
B6F186_CLOPF/572-698--SY--------P.......AHIMIFNE.......--.....KD...---..---------------....IS-SYV---
A9BTW4_DELAS/624-751--GL--------PAV....SLVWTPTGL.......--.....TC...---..---------------....AV-DRW---
A4AAI2_9GAMM/624-751--GL--------PAV....SLIWTPTGL.......--.....RC...---..---------------....AV-DRW---
A1U5J0_MARAV/600-724--GL--------PF......PVMIVYGA.......--.....DG...---..---------------....LE-ILS---
Q2LTW5_SYNAS/612-744--DE--------PSTH...KHLLLILGS.......--.....DS...---..---------------....EQ-SVE---
Q21PA7_SACD2/610-735--DL--------PV......VMLVYTGG.......--.....RI...---..---------------....ER-V..---
Q3SNL7_NITWN/223-347--PP--------PS......VLLIQAPT.......--.....RL...---..---------------....YA-LMH---
D3GMN5_9ENTR/45-166--.T--------ET......MLLIIVGR.......--.....KS...---..---------------....EW-VGI---
C6YLL5_VIBCL/21-142--.D--------ES......MLLLIVGR.......--.....KD...---..---------------....FW-LGK---
Q4FRY9_PSYA2/20-141--.S--------DP......LILIIAGR.......--.....RD...---..---------------....FW-VGK---
Y4QB_RHISN/8-136--.S--------PEARAPRPVMILLCGG.......--.....PE...---..---------------....NW-LPH---
A0AW82_ARTS2/13-145--.H--------TAARCPEPFMAILGKE.......--.....GM...---..---------------....EQ-DWN---
A5G3M8_GEOUR/23-151--.N--------DIVDSDSLFFLIVGTS.......--.....EM...---..---------------....RM-WEG---
Q2L5J9_CLOPF/14-141--.K--------IHPSKRYYINIIIGNK.......--.....DL...---..---------------....RI-WEY---
Q2NDB2_ERYLH/5-124--.I--------WAIIGQGEIIFWRDRN.......--.....DG...---..---------------....FA-QLS---
Q2K8Q5_RHIEC/6-134--.D--------PDFKGSFAVLMIVRLR.......--.....AD...---..---------------....KF-EAG---
Q8KGW0_RHILI/15-149--..--------........CLSLVVPNF...ARE--PFDFARVAAY---RL---------------DGKANW-NAL---
Q2K2A8_RHIEC/65-199--..--------........SLSLVVPDF...ATG--PTDLSQTAVY---RL---------------DKAGKW-MAV---
C5ATD4_METEA/9-143--..--------........ALSLVLPRFAATATP--GTFLEEAMVY---EL---------------SDAGLW-EHV---
Q13F65_RHOPS/9-143--..--------........ALSLVLPHFANATTV--ENFLEEVMTY---EY---------------SPAGEW-IHC---
Q6YRV1_SYNY3/11-152--NG--------QDTKL...LSLILTAD.......--.....GD...---..---------------LVGRCW-FNP---
A4JA90_BURVG/13-148--LD--------NVDRR...ASVVMLPD.......--.....GR...---..---------------PFGRHV-QNG---
A1VQ27_POLNA/13-152--GA--------QG..L...ASMVFGQH.......--.....DA...---..---------------IVGRLW-KSA---
Q1QNK4_NITHX/10-142--YD--------AR..H...GTAIMTPD.......--.....GR...---..---------------MKVRFY-DHD---
Q2IDP5_ANADE/4-131--GC--------YLGPV...VSLAPAGA.......--.....PG...---..---------------AHEVAL-PRG---

PF05021

Q380R2_ANOGA/286-599..SL--------PFLDAVSDFHLLFYLYRMEDMLP.MKSQLGPLLEA---VR....DKDKAKANEW.KTREVWKTLEELI
NPL4_CRYNJ/281-610RIKK--------DVEKWLSDWHLVTFLCMQ.GLFS..LKEQQILCRA---ATAHAHPNDTHALEEL.FASGGWQTLLTIV
NPL4_MAGO7/285-589SGSS--------KDGMKVSNFHLLCFLHQM.SVLS..KDEESLLCRV---AT....Q................HDLADAF
NPL4_PICST/268-574..TS--------GKGTSLCNFHFLVYLKRT.NILG..AQEFDLLLRF---VR....ERQYEDYLHL.VESPGWMTLITIL
NPL4_DEBHA/260-563...P--------GDGSQLFDFHFLTYIAKT.GILS..HDELKLVLSY---VR....NKDQTDYLQL.VESPGWMTFITIL
NPL4_DROME/282-593..EE--------EFLEAISDFHLLVYLYKM.DMLP.LRQHMGPLLEA---VR....TKNPNQAAQF.KVVDVWKLLESLI
NPL4_CANAL/286-595....--------..NDQIFNFHFILHLIKT.HILN..DQEIDLLIEY---IK....SKNLEDYLKL.VESNGWMTLMTIL
NPL4_PICGU/288-564...P--------GNGSCLSNFHFIVYLVTL.GILG............---......................DSELQMVF
Q5CYK6_CRYPI/214-488SVPL--------TSCNLLNDFHLLLYLAKL...FD..EATAISICES---II...............NKTAVDQHLLDIL
A8X418_CAEBR/151-470..TN--------QFLELATNFHFLLYLLTN.EMVQIPEDWVKRLCDA---VK....DQDRGKAMDWAQECEDWHQLMAVA
NPL4_COCIM/290-605.DPD--------EAIRAVSNFHLLCFMHGL.GILS..KEEEALLCTV---AR....THDPADGVQL.INTPGWATLVTIL
NPL4_ASPOR/287-599.DPD--------KAIRAVSDFHLLCFLHSL.STFS..KDEEALLGRV---AT....KHDPADGVQL.ISTPGWATLVTIL
NPL41_ARATH/156-410..SL--------PFVKRISDFHLLLFVAQF...LD.VSSDVPALAEC---VRL.QS...........HVPEGYELLIDSM
A7AUE8_BABBO/207-478GLET--------SDANIFSDFHLLIYMARV...LD..VETALAICDA---LL...............GKTTLDPIMVELL
NPL4_SCLS1/289-608TQSS--------DGVLAVSDFHLLCYIYSM.GILS..KEEMALLCRV---AT....QHDLADGYQL.IATPGWANFLAIL
Q63ZR4_XENLA/250-559..PS--------VFLDIISDFHLLQFLVTN.DVMP.LQDSISLLLDA---VR....TKNEELAETW.KKSEQWATIEQLC
NPL4_KLULA/265-593NDLA--------ELQAKLSNFHFLLYLHSI.EVLN..QQEWSLLIRT---VTAPTLHEATEPLLNL.INSPGWQTFVMIL
NPL4_AJECN/292-589.DPN--------KTICGVSDFHLLCFLNSL.GILN..KDEEFLLCTV---AR....SHDTADGMQL.INTSGWATLVTIL
A7SZA1_NEMVE/172-484..PG--------DFLSAMSNFHLLVFLATN.DMLP.LKTHMEELCAA---IK....NKDAEACDGW.RKGEQWGTVEQII
NPL4_VANPO/248-566GDYN--------LLHEKISNFHLLLYIKSL.EIFN..EKDWSLLITS---AI...SENWEQPLIQL.TTTESFNSLVLIM
NPL4_CANGA/260-578GNFN--------DLHDKLANFHLLLYIHSL.QILS..QEEWELLVKG---AL...SQDYQEPLYKL.SASPGWQTLLMII
Q8I426_PLAF7/256-527DRGT--------KGIHQCSDFHLILFVAKV...LD..IETALALCDA---TL...............NKKEIDPIIEEML
Q2HAC4_CHAGB/250-562..QK--------DDSINVSDFHLLCYIHAM.GVLA..KEEEALLCRV---AT....QNDLAESFQL.RSTTGWQTLHMIL
Q01AR0_OSTTA/156-409..DK--------PYGDRLRDFHLLLFLAKH...ID..INELVAISGA---AHE.GE...........EIPEGYRLMIDCL
NPL4_YEAST/259-577GDFN--------LLHEKISNFHLLLYINSL.QILS..PDEWKLLIES---AV...KNEWEESLLKL.VSSAGWQTLVMIL
A5KB05_PLAVS/256-527ERGT--------NGMHRCSDFHLILFVCRV...LD..METALALCDA---AL...............SKKEIDPIMEEIL
NPL4_DICDI/319-563..DV--------SPLKFFSDFHFLIFLLEN.QFLD.FQSDFPIICEN---IR...S...........RSSENLIGYLEII
Q8SRJ9_ENCCU/202-474..GD--------FSMERFSNFTLLTRIQGV.......FSNWKDLLKC---IV....ERDEDKFRAI.SSSEDFKSFVSSM
NPL4_ASHGO/241-560GDYT--------ELHRRLSSFHLLLYLHSL.QILD..ASEWRRLVTV---ATT.PAPRGVEAVYDL.ISGPGWQTLVMIL
A0C810_PARTE/307-574..KK--------PSHNRFADFHLLLYLSKL...ID..IHSVVNIAQF---IG...............SECEVPNELLDIV
A4RW87_OSTLU/156-413..DK--------PYGERLRDFHLLLFLAKH...ID..INELAVIASA---VHH.GE...........DVPEGYTLLIDCL
NPL4_PHANO/275-593LNTT--------SGLNAISNFHMLCFIHNL.GILS..KDEESLLFKV---AS....THDTSEGSAL.QHTGGWATLLTIL
NPL4_LODEL/287-597....--------..DSELFDFHWLVHVAKM.GILS..EEELSLLCKY---VK....EKKYDDYLQL.MESGGWMTFLTIL
Q7RED9_PLAYO/245-516NRGV--------NGNSRCSDFHLIIFAAKV...LD..IETALVLCDS---VV...............NNKEIDPIIEEML
A5BEN5_VITVI/154-392..NL--------PFVKRISDFHLLLLLSRF...LD.INSDVPALAEC---VQT.QS...........AVPEEAFAMEDAA
NPL4_NEUCR/276-588..QK--------SDQFDVSNFHLLCFIRQM.SVLS..KDEEALLCRV---AT....QHDLADAFQL.RATEGWRTLHMIL

PF03665

U172_ARATH/8-208............LCVKDASKNWRVVGADGGSKLLLKEPSANVVLSDY...ISSEKWKDVTDVDDHLDDVTKDW-LNPGLF
Q4SKU7_TETNG/1-192............VYE...RKDSKWTLKDKHKIMLRQWEETRAIAAQM...LESGDHTLLVDFDSHLDDITKDW-TNQKLN
Q4PCQ4_USTMA/4-202............VAATSGKGEAKPKALPGSAVALQDPRKAAELESAV...RNDSTWDKIVDFDGEYCKDSIKS-GNMDYN
Q53Y03_HUMAN/1-204............VYE...HHENRWRCRDPHHDYCEDWPEAQRISASL...LDSRSYETLVDFDNHLDDIRNDW-TNPEIN
U172_DICDI/2-192..................KVGSDWLKNRKTLITIDTTSNSEDINEILKRNLQNIKESQIYDFEEYLSNPTRDW-LNKSLV
F158A_HUMAN/1-193............VLE...NQGLRWVPKDKNLVMWRDWEESRQMVGAL...LEDRAHQHLVDFDCHLDDIRQDW-TNQRLN
A4H4X4_LEIBR/5-249CSCNKAISLPSQSSVDELMTFGRWNSDTLAPEATISEEGVMESVSNA...LDAFAHYRITDLEDHLEDPSITY-LEQPLM
Q8IHW7_PLAF7/3-195............IFMK..NDKSNWEKGN.....VVISNKNKEFLKKN...ISNQHYLNIYDFDDHLNSMKCDF-MNPDLF
U172_DROME/1-194............VFNCPGDSGARWSKAK...FTLSQASDTLEGVSLL...LKRGAMRDLVDFDNHLDNPDKNW-TNDFLN
Q1W2L0_SALBI/3-198............LYSRDGSK.WKV...EESGQLVIKEPSANVMLLDY...VSTQKWEDIVDFDDHLDDISKDW-LNSELF
Q6P4M9_XENTR/1-196............VYE...HHDNRWKSRDPHEDLFEDWPEAQKITASL...LDSRSYETLVDFDSHLDDLRNDW-ANPDIN
Q3B8G2_XENLA/1-193............VLHQ..NSNKQWVPKEKTLVMWGHWEETQRITRQL...MQAKAYNKLVDFDTHLEDIRADW-TNQELN
Q4DRE9_TRYCC/6-215............YLPAPELTFGRWNSDTLSCEAITSNTEAVEVFENA...VDAFKQFQLVDFEDHLERVQLNY-LEQTVQ
A5K556_PLAVS/3-196............VFMQD.DATEEWKNCD.....VEVTRNNKDFLKMS...LSNNEYLNLHDFDDHLNCINHDF-MNSNLF
Q17EH7_AEDAE/1-189............VWQ...SKEGRWTKVA..KCSVEDSKNTFDAVSSL...LQRGAMKELNDFDNYLDNTENDW-SNDHLN
Q5DA93_SCHJA/2-187............YFTALCKSEWKWNETK.....YTFTPNVNKKLEEI...LHSKVYRQIVDFDDHLNDVNCDF-LNLELS
Q93568_CAEEL/2-186............AYE...KDGDSWKETK....TIFQGSNFLRGLQAV...IQKKLYRELSDFENHLDNPEFDF-YNTNLS
A5APP0_VITVI/4-206............LYTKDASKNWRLAGSDGSSQLTIKEPSANVVLLDY...IASEKWQDIIDFDDHLDDISKDW-LNPELF
Q5TPN5_ANOGA/1-188............MWQ...YRDNRWSKAK...CVVENDSVTFDAVSCL...LQRGAAKELHDYDNYLDNTQNDW-DNVHLN
Q8AWD7_DANRE/1-192............MYE...RKDTRWALKDKHTIMLRQWEETCSIVNQL...FSSGDQALLVDFDSHLDDITKDW-TNQKLN
Q8L439_CHLRE/2-202............LFSKDGSKGWKRASAD.GGELALKNADWKKLREEFFVMFKQLKHRTLHDFEEHLDDAGKDW-LNKGFA
A4HT47_LEIIN/5-249CSCNKTISLPSQASADERMTFGRWNSDTLAPEATVSAESVMESVSNA...LDAFAHYRIADLEDHLEDPSITY-LEQPLM

PF01398

D1039_DICDI/532-641-------------------CSYQYL-------------------------------------------------LQE---
PSDE_DICDI/26-139-------------------QSFEQL-------------------------------------------------QSR---
CSN5_YEAST/66-190-------------------DLNQRF-------------------------------------------------QDP---
PSD7_DROME/6-121-------------------ELVRRY-------------------------------------------------CPN---
RPN8_YEAST/3-116-------------------ELFKKY-------------------------------------------------TQN---
RPN11_SCHPO/25-138-------------------QSFEQL-------------------------------------------------TPR---
CSN5_CAEEL/51-165-------------------TLNQKF-------------------------------------------------QEP---
EIF3F_ARATH/23-133-------------------DFYARE-------------------------------------------------VPN---
EIF3F_HUMAN/87-196-------------------EYYSRE-------------------------------------------------APN---
O59157_PYRHO/26-138-------------------ENWRIP-------------------------------------------------WLI---
BRCC3_HUMAN/7-148-------------------AMYQMM-------------------------------------------------DQG---
O61792_CAEEL/36-151-------------------EQLKRF-------------------------------------------------CPN---
O27052_METTH/17-118-------------------SKNGLF-------------------------------------------------HLI---
EIF3H_HUMAN/34-146-------------------FSYQHA-------------------------------------------------IEE---
EIF3F_CAEEL/2-117-------------------DYYVRV-------------------------------------------------ITE---
YPT5_CAEEL/24-137-------------------QSFEAL-------------------------------------------------HPR---
RPN8_SCHPO/12-125-------------------NLLKKY-------------------------------------------------IPN---
EIF3F_SCHPO/18-129-------------------NLYASP-------------------------------------------------AEP---
MEC_MYCBO/6-114-------------------TEPDAH-------------------------------------------------YVL---
CSN6_HUMAN/36-148-------------------KQVCEI-------------------------------------------------IES---
EIF3H_CAEEL/10-139-------------------FDYQAM-------------------------------------------------GPE---
STABP_HUMAN/252-361-------------------CSYQMM-------------------------------------------------LPE---
BRCC3_MOUSE/7-148-------------------AMYQMM-------------------------------------------------DQG---
PSD7_ARATH/12-125-------------------ALFNGY-------------------------------------------------VPN---
CSN6B_ARATH/6-136-------------------KALMDI-------------------------------------------------NES---
CSN5B_ARATH/54-168-------------------MLNQQY-------------------------------------------------QEP---
O13386_HYPJE/11-125-------------------ELFKRY-------------------------------------------------TPN---
PRP8_HUMAN/2099-2205-------------------AKIMAD-------------------------------------------------NPS---
CSN5_SCHPO/30-144-------------------RQNQKY-------------------------------------------------QDP---
O16155_SCHMA/21-128-------------------QSFEAL-------------------------------------------------SDR---

PF15659

D3IMU4_9BACT/335-480-
D3IMY5_9BACT/92-252-
D1PWX0_9BACT/114-279-
G9S3Z7_9PORP/207-377-
C6IIY2_9BACE/879-1045-
D0TNF7_9BACE/83-238-
E4RWK9_LEAB4/231-388-
C6IJD1_9BACE/48-220-
I0TCD6_9BACT/325-474-
E2NN46_9BACE/59-211-
E4RXN7_LEAB4/92-255-
C9L1R0_9BACE/138-300-
E4RWK7_LEAB4/354-517-

PF04002

D1N9M0_9BACT/106-227-
D2BH65_DEHSV/106-228-
Y1917_THICR/102-225-
Q1N8A1_9SPHN/109-231-
Q2N869_ERYLH/27-148-
Y1174_NEIMF/102-224-
A6GHT1_9DELT/122-244-
C0ABZ0_9BACT/117-246-
Q0HVT6_SHESR/47-168-
B3EB20_GEOLS/42-163-
Q03YZ9_LEUMM/73-198-
Q7P812_FUSNV/110-232-
Q30YK7_DESDG/103-225-
Y3180_DESHY/105-227-
A8ZUS2_DESOH/106-228-
A4BXR1_9FLAO/24-149-
A5LVX8_STRPN/103-225-
Q7NFQ9_GLOVI/117-239-
Q8ABN2_BACTN/26-150-
A8MGD7_ALKOO/25-146-
A6EEF9_9SPHI/26-151-
A3U7J3_CROAH/109-231-
Q5Z1A3_NOCFA/105-224-
Q2SAG7_HAHCH/49-171-
A5G1T0_ACICJ/119-241-
A9B8G6_HERA2/79-201-
Q0F0W4_9PROT/139-261-
A4YL64_BRASO/115-237-
Y1557_THEMA/101-222-
Q1NUQ1_9DELT/108-231-
Y1125_HAEI8/99-221-
A7AJ21_9PORP/104-226-
A6NZB7_9FIRM/107-229-
A5ZSZ3_9FIRM/23-146-
A8ZYJ4_DESOH/28-150-
Y086_PSESM/102-224-
A4XHM1_CALS8/103-225-
B2JE00_BURP8/120-242-
Y611_CHLTE/100-222-
Y1610_AQUAE/110-231-
B0V642_ACIBY/120-242-
A4ITX8_GEOTN/9-125-
Q7VMM9_HAEDU/35-157-
Y491_PSYWF/102-224-
Y4865_PHOLL/108-230-
Y371_SYMTH/110-232-
A5Z7J1_9FIRM/22-146-
Q02HM7_PSEAB/85-202-
Q2S840_HAHCH/1-123-
A5EYF9_DICNV/276-401-
A0Z2T6_9GAMM/98-220-
A4NTE0_HAEIF/34-156-
A6EKP4_9SPHI/26-151-
Q5P8G7_AROAE/74-196-
Q5PA32_ANAMM/108-230-
A3ER13_9BACT/109-231-
Y1515_LACLM/103-226-
A6DQ92_9BACT/32-161-
A9KL05_CLOPH/109-231-
Q2IEL9_ANADE/81-203-
Q2QJL1_ACEAC/25-147-
Y341_CARHZ/104-226-
Q03EP2_PEDPA/97-219-
A5KLJ1_9FIRM/109-231-
A5FBM2_FLAJ1/31-156-
A3CRJ6_METMJ/102-223-
Q1Q559_9BACT/9-136-
Q042N7_LACGA/84-206-
Q2B8H5_9BACI/107-228-
Q2LSS5_SYNAS/184-306-
A4SZN2_POLSQ/113-235-
Y1765_PARUW/107-229-
A6EEP6_9SPHI/39-153-
A4XJG8_CALS8/36-160-
Q11VY8_CYTH3/111-233-
A0LNF4_SYNFM/102-224-
A7FEQ9_YERP3/38-160-
Y1850_BORPA/103-225-
Q8GFV0_CITFR/27-149-
Q5NML0_ZYMMO/19-141-
Q72Q17_LEPIC/104-226-
Q5FNC5_GLUOX/112-229-
B8CX04_HALOH/118-240-
A5TXI1_FUSNP/685-807-
A5Z6A2_9FIRM/108-230-
A3D8H4_SHEB5/24-146-
Y852_LACSS/100-222-
Y2338_SALRD/110-232-
Y1989_LEGPC/102-225-
Q5QX33_IDILO/36-152-
B4S9N8_PROA2/42-165-
A0L491_MAGSM/113-235-
Q6MR78_BDEBA/35-156-
A9KR89_CLOPH/32-156-
A7V531_BACUN/74-196-
Q3Z6I4_DEHE1/116-238-
A3DJW5_CLOTH/98-219-
A9BIK5_PETMO/98-215-
Q8PA70_XANCP/37-159-
Q1DAY3_MYXXD/101-223-
Q2GEH3_NEOSM/114-236-
Q4EAK4_9RICK/97-218-
Q6WB38_ALCFA/54-176-
A7AC72_9PORP/83-208-
Q1WT78_LACS1/101-223-
Q7WWR8_COXBE/19-137-
B1YJT0_EXIS2/95-217-

PF14464

O58174_PYRHO/6-109-
Q8TYS8_METKA/10-115-
Q8TQ16_METAC/27-138-
O27052_METTH/16-131-
B0R451_HALS3/4-126-
B0R6F4_HALS3/5-124-
Q9I213_PSEAE/7-137-
Q8ZW14_PYRAE/1-111-
Q9YE90_AERPE/3-117-
O59157_PYRHO/36-149-
P73582_SYNY3/7-143-
Q9S2G8_STRCO/5-111-
Q9RXB3_DEIRA/6-119-
O67597_AQUAE/5-125-
Q216W0_RHOPB/11-140-
B6C3F3_9GAMM/7-123-
A3RXH7_RALSL/5-122-
Q0A9H9_ALHEH/13-128-
Q82SH4_NITEU/5-122-
Q2YAE7_NITMU/14-131-
F0DZB5_9PSED/6-123-
Q2SI97_HAHCH/5-122-
Q84HF8_PSEFL/5-121-
Q7BNS3_PSEST/6-123-
Q82D25_STRAW/5-122-
A1SG89_NOCSJ/5-128-
Q1AY15_RUBXD/6-127-
D5HAX1_SALRM/4-126-
Q02B10_SOLUE/5-125-
E2TKU9_MYCTU/5-122-
Q5Z0V7_NOCFA/5-122-
A8L770_FRASN/19-136-
Q47MB9_THEFY/5-122-
Q2JEP2_FRASC/5-122-
Q7MRV8_WOLSU/6-118-
Q39VC3_GEOMG/6-119-
B3EN74_CHLPB/4-118-
A3DIG3_CLOTH/5-123-
B8FTM5_DESHD/5-124-
A6TTW0_ALKMQ/7-124-
A4XJZ1_CALS8/5-124-
Q3AW93_SYNS9/27-153-
Q3AML7_SYNSC/5-131-
Q7U4L3_SYNPX/10-140-
A3Z8Z4_9SYNE/8-143-
A9BCQ7_PROM4/10-152-
Q7V9V1_PROMA/10-154-
Q46IP8_PROMT/10-154-
Q3MEG9_ANAVT/9-148-
B2J4Y6_NOSP7/5-138-
Q2JJY1_SYNJB/6-136-
Q2JS00_SYNJA/6-136-
A9W9Z2_CHLAA/6-141-
Q2IF99_ANADE/8-141-
O64333_BPN15/2-106-
Q9MCU3_BPHK0/2-106-
Q8W6T2_9CAUD/12-125-
A3EHW4_VIBCL/1-109-
Q02TC3_PSEAB/4-108-
Q8XYR3_RALSO/2-105-
C6TYU0_BURPE/2-115-
A9APW0_BURM1/2-115-
A4TT77_YERPP/1-112-
Q6XQC1_BPT1/3-111-
F0A4T4_NEIME/7-109-
D9PEJ9_ACTPL/3-105-
Q3Z1B1_SHISS/1-103-
E6BUJ9_ECOLX/1-103-
Q7WX35_CUPNH/81-188-
A1VVA1_POLNA/80-189-
A0R7L0_PELPD/81-188-
Q8XYU8_RALSO/133-242-
Q21Q53_RHOFD/82-191-
Q120V3_POLSJ/78-187-
Q5NUW4_RALME/76-183-
Q8ZSF0_NOSS1/58-173-
A4JUM8_BURVG/81-187-
Q5NXB5_AROAE/80-200-
Q11ZD2_POLSJ/78-182-
Q47D11_DECAR/80-200-
Q8PFM8_XANAC/617-745-
A1U033_MARAV/627-755-
A1VVG1_POLNA/619-747-
Q5HY19_GLUOX/596-724-
A3U023_9RHOB/617-745-
Q3J4T5_RHOS4/19-143-
B6F186_CLOPF/572-698-
A9BTW4_DELAS/624-751-
A4AAI2_9GAMM/624-751-
A1U5J0_MARAV/600-724-
Q2LTW5_SYNAS/612-744-
Q21PA7_SACD2/610-735-
Q3SNL7_NITWN/223-347-
D3GMN5_9ENTR/45-166-
C6YLL5_VIBCL/21-142-
Q4FRY9_PSYA2/20-141-
Y4QB_RHISN/8-136-
A0AW82_ARTS2/13-145-
A5G3M8_GEOUR/23-151-
Q2L5J9_CLOPF/14-141-
Q2NDB2_ERYLH/5-124-
Q2K8Q5_RHIEC/6-134-
Q8KGW0_RHILI/15-149-
Q2K2A8_RHIEC/65-199-
C5ATD4_METEA/9-143-
Q13F65_RHOPS/9-143-
Q6YRV1_SYNY3/11-152-
A4JA90_BURVG/13-148-
A1VQ27_POLNA/13-152-
Q1QNK4_NITHX/10-142-
Q2IDP5_ANADE/4-131-

PF05021

Q380R2_ANOGA/286-599E
NPL4_CRYNJ/281-610D
NPL4_MAGO7/285-589Q
NPL4_PICST/268-574E
NPL4_DEBHA/260-563E
NPL4_DROME/282-593Q
NPL4_CANAL/286-595E
NPL4_PICGU/288-564D
Q5CYK6_CRYPI/214-488M
A8X418_CAEBR/151-470H
NPL4_COCIM/290-605Q
NPL4_ASPOR/287-599Q
NPL41_ARATH/156-410A
A7AUE8_BABBO/207-478M
NPL4_SCLS1/289-608Q
Q63ZR4_XENLA/250-559S
NPL4_KLULA/265-593E
NPL4_AJECN/292-589Q
A7SZA1_NEMVE/172-484A
NPL4_VANPO/248-566E
NPL4_CANGA/260-578E
Q8I426_PLAF7/256-527T
Q2HAC4_CHAGB/250-562Q
Q01AR0_OSTTA/156-409A
NPL4_YEAST/259-577Q
A5KB05_PLAVS/256-527T
NPL4_DICDI/319-563N
Q8SRJ9_ENCCU/202-474E
NPL4_ASHGO/241-560Q
A0C810_PARTE/307-574K
A4RW87_OSTLU/156-413A
NPL4_PHANO/275-593K
NPL4_LODEL/287-597E
Q7RED9_PLAYO/245-516T
A5BEN5_VITVI/154-392Q
NPL4_NEUCR/276-588E

PF03665

U172_ARATH/8-208N
Q4SKU7_TETNG/1-192H
Q4PCQ4_USTMA/4-202T
Q53Y03_HUMAN/1-204K
U172_DICDI/2-192L
F158A_HUMAN/1-193T
A4H4X4_LEIBR/5-249A
Q8IHW7_PLAF7/3-195N
U172_DROME/1-194Q
Q1W2L0_SALBI/3-198K
Q6P4M9_XENTR/1-196K
Q3B8G2_XENLA/1-193V
Q4DRE9_TRYCC/6-215V
A5K556_PLAVS/3-196N
Q17EH7_AEDAE/1-189R
Q5DA93_SCHJA/2-187K
Q93568_CAEEL/2-186N
A5APP0_VITVI/4-206K
Q5TPN5_ANOGA/1-188G
Q8AWD7_DANRE/1-192A
Q8L439_CHLRE/2-202S
A4HT47_LEIIN/5-249A

PF01398

D1039_DICDI/532-641-
PSDE_DICDI/26-139-
CSN5_YEAST/66-190-
PSD7_DROME/6-121-
RPN8_YEAST/3-116-
RPN11_SCHPO/25-138-
CSN5_CAEEL/51-165-
EIF3F_ARATH/23-133-
EIF3F_HUMAN/87-196-
O59157_PYRHO/26-138-
BRCC3_HUMAN/7-148-
O61792_CAEEL/36-151-
O27052_METTH/17-118-
EIF3H_HUMAN/34-146-
EIF3F_CAEEL/2-117-
YPT5_CAEEL/24-137-
RPN8_SCHPO/12-125-
EIF3F_SCHPO/18-129-
MEC_MYCBO/6-114-
CSN6_HUMAN/36-148-
EIF3H_CAEEL/10-139-
STABP_HUMAN/252-361-
BRCC3_MOUSE/7-148-
PSD7_ARATH/12-125-
CSN6B_ARATH/6-136-
CSN5B_ARATH/54-168-
O13386_HYPJE/11-125-
PRP8_HUMAN/2099-2205-
CSN5_SCHPO/30-144-
O16155_SCHMA/21-128-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window