Sequence alignment for CL0366

PF01398

D1039_DICDI/532-641-------------------------------------------S--KLRKIIVHGEV--F---------QEF--M---RL
PSDE_DICDI/26-139-------------------------------------------D--TAETIHISSLA--L---------LKM--L---QH
CSN5_YEAST/66-190-------------------------------------------P--SYTHVLISKLS--C---------EKI--T---HY
PSMD7_DROME/6-121-------------------------------------------V--SVNKVIVHPLV--L---------LSV--V---DH
RPN8_YEAST/3-116-------------------------------------------L--QHEKVTIAPLV--L---------LSA--L---DH
RPN11_SCHPO/25-138-------------------------------------------D--NSECVYISSLA--L---------LKM--L---RH
CSN5_CAEEL/51-165-------------------------------------------H--YFKQIKISAIA--L---------LKM--T---MH
EIF3F_ARATH/23-133-------------------------------------------T--SVLTARIHPLV--I---------FNV--C---DC
EIF3F_HUMAN/87-196-------------------------------------------P--GGRVVRLHPVI--L---------ASI--V---DS
BRCC3_HUMAN/7-148-------------------------------------------Q--AVQAVHLESDA--F---------LVC--L---NH
O61792_CAEEL/36-151-------------------------------------------L--PVNKVTVHPLV--L---------LSV--V---DH
EIF3H_HUMAN/34-146-------------------------------------------S--AVKQVQIDGLV--V---------LKI--I---KH
EIF3F_CAEEL/2-117-------------------------------------------A--SNLTVNVHPGV--Y---------MNV--V---DT
YPT5_CAEEL/24-137-------------------------------------------D--TSETVNISSLA--L---------LKM--L---RH
RPN8_SCHPO/12-125-------------------------------------------I--VPQQVIVHPLV--L---------LSA--V---DS
EIF3F_SCHPO/18-129-------------------------------------------S--SPLNIVIEPAV--L---------FSI--L---DH
CSN6_HUMAN/36-148-------------------------------------------T--GSVSVALHPLV--I---------LNI--S---DH
EIF3H_CAEEL/10-139-------------------------------------------P--SVKHILLDSLV--V---------MKI--V---KH
STABP_HUMAN/252-361-------------------------------------------D--GLRHVVVPGRL--C---------PQF--L---QL
BRCC3_MOUSE/7-148-------------------------------------------Q--AVQAVHLESDA--F---------LVC--L---NH
PSD7A_ARATH/12-125-------------------------------------------R--TIEKVVVHPLV--L---------LSI--V---DH
CSN6B_ARATH/6-136-------------------------------------------S--SGLTFKLHPLV--M---------LNI--S---DH
CSN5B_ARATH/54-168-------------------------------------------N--YFKRVHISALA--L---------LKM--V---VH
PRP8_HUMAN/2099-2205-------------------------------------------E--TGYTYILPKNV--L---------KKF--I---CI
CSN5_SCHPO/30-144-------------------------------------------E--FFRSVKISAVA--L---------LKM--L---RH
G0RSA9_HYPJQ/14-125-------------------------------------------.--..RNVSVAPLV--L---------LSA--V---DH

PF14464

Q8TYS8_METKA/10-115-----------------------------------------------------DARL--L---------DSL--L---EA
Q8TQ16_METAC/27-138-----------------------------------------------------LLYM--Q---------IKG--I---AR
O27052_METTH/16-131-----------------------------------------------------FKPV--R---------RVV--V---DS
Q9I213_PSEAE/7-137-----------------------------------------------------TEHA--L---------SVI--Y---RH
Q8ZW14_PYRAE/1-111-----------------------------------------------------MPKA--F---------LEE--A---RK
Q9YE90_AERPE/3-117-----------------------------------------------------ASIG--P---------LRQ--V---LK
P73582_SYNY3/7-143-----------------------------------------------------SQVH--Q---------DQI--Y---RH
Q9S2G8_STRCO/5-111-----------------------------------------------------TQAL--Y---------DQI--V---AH
Q9RXB3_DEIRA/6-119-----------------------------------------------------PAPL--R---------RAL--W---AQ
O67597_AQUAE/5-125-----------------------------------------------------KKEV--L---------EKM--I---KQ
Q216W0_RHOPB/11-140-----------------------------------------------------NEET--L---------ALI--V---RH
Q0A9H9_ALKEH/13-128-----------------------------------------------------PARE--R---------DRL--A---RL
Q82SH4_NITEU/5-122-----------------------------------------------------HTKL--I---------SAM--I---TQ
Q2YAE7_NITMU/14-131-----------------------------------------------------HAKL--V---------EAM--L---AQ
Q2SI97_HAHCH/5-122-----------------------------------------------------LSEL--V---------DAM--V---RQ
Q82D25_STRAW/5-122-----------------------------------------------------TQAL--V---------DQI--V---AH
A1SG89_NOCSJ/5-128-----------------------------------------------------ARAT--Y---------DAI--V---AH
Q1AY15_RUBXD/6-127-----------------------------------------------------GRGD--V---------EHI--H---RH
Q02B10_SOLUE/5-125-----------------------------------------------------ESAA--W---------AAM--V---KH
Q5Z0V7_NOCFA/5-122-----------------------------------------------------KSDL--V---------AAM--V---AH
A8L770_FRASN/19-136-----------------------------------------------------DRTH--Y---------EAI--V---AH
Q47MB9_THEFY/5-122-----------------------------------------------------DRSI--Y---------DKI--V---AH
Q2JEP2_FRASC/5-122-----------------------------------------------------DRAC--Y---------EAI--V---AH
Q7MRV8_WOLSU/6-118-----------------------------------------------------.KAL--F---------DSI--I---EH
Q39VC3_GEOMG/6-119-----------------------------------------------------.RAI--H---------AEL--I---AH
B3EN74_CHLPB/4-118-----------------------------------------------------CKSV--Y---------EKI--I---EH
A3DIG3_CLOTH/5-123-----------------------------------------------------TKQQ--Y---------QEI--L---EH
A6TTW0_ALKMQ/7-124-----------------------------------------------------.KEN--Y---------NQI--V---KQ
A4XJZ1_CALS8/5-124-----------------------------------------------------PKTL--Y---------EEM--L---NH
Q7U4L3_SYNPX/10-140-----------------------------------------------------RCGC--L---------TIL--E---RT
Q7V9V1_PROMA/10-154-----------------------------------------------------HKDS--E---------RIL--S---SS
Q46IP8_PROMT/10-154-----------------------------------------------------HNRT--N---------SVL--S---RF
B2J4Y6_NOSP7/5-138-----------------------------------------------------SPEH--L---------QTI--R---AH
Q2JJY1_SYNJB/6-136-----------------------------------------------------SADH--L---------HSI--R---QH
A9W9Z2_CHLAA/6-141-----------------------------------------------------PDQA--A---------AAI--A---AH
Q2IF99_ANADE/8-141-----------------------------------------------------GAPL--L---------ARI--S---AL
TIPK_BPN15/2-106-----------------------------------------------------RQKT--I---------DAI--M---AH
Q8XYR3_RALSO/2-105-----------------------------------------------------QETT--L---------DAA--R---RH
Q6XQC1_BPT1/3-111-----------------------------------------------------SAKI--K---------LEI--M---TH
Q7WX35_CUPNH/81-188-----------------------------------------------------PAQL--I---------GEF--A---AM
A1VVA1_POLNA/80-189-----------------------------------------------------PASL--W---------REF--A---VL
A0R7L0_PELPD/81-188-----------------------------------------------------PVDM--I---------TRF--M---VE
Q8XYU8_RALSO/133-242-----------------------------------------------------TFPM--V---------RAF--I---EA
Q21Q53_RHOFT/82-191-----------------------------------------------------PENL--L---------VEF--L---HQ
Q120V3_POLSJ/78-187-----------------------------------------------------PTEL--R---------SKF--V---QD
Q8ZSF0_NOSS1/58-173-----------------------------------------------------LEPY--F---------RLK--V---PK
Q5NXB5_AROAE/80-200-----------------------------------------------------PLSL--F---------ERF--A---GI
Q11ZD2_POLSJ/78-182-----------------------------------------------------PKAL--L---------DRF--V---LQ
Q47D11_DECAR/80-200-----------------------------------------------------PIRV--I---------EAF--I---EA
A1U033_MARHV/627-755-----------------------------------------------------DVSI--E---------GCM--S---SL
A1VVG1_POLNA/619-747-----------------------------------------------------DASV--E---------LQL--R---DL
Q5HY19_GLUOX/596-724-----------------------------------------------------SVGV--I---------KAM--R---TY
Q3J4T5_RHOS4/19-143-----------------------------------------------------TARA--F---------AKM--A---EF
A9BTW4_DELAS/624-751-----------------------------------------------------LSPV--A---------QAI--H---AD
A1U5J0_MARHV/600-724-----------------------------------------------------LDSV--V---------SLM--K---EC
Q2LTW5_SYNAS/612-744-----------------------------------------------------SQAA--L---------SEM--H---TW
Q21PA7_SACD2/610-735-----------------------------------------------------EIRV--L---------GNI--R---DQ
Q3SNL7_NITWN/223-347-----------------------------------------------------SSRV--M---------TKI--A---EE
Q4FRY9_PSYA2/20-141-----------------------------------------------------IGVA--N---------ILT--S---YR
Y4QB_RHISN/8-136-----------------------------------------------------PESV--V---------EAM--L---KD
A0AW82_ARTS2/13-145-----------------------------------------------------PVPV--L---------SDL--V---EQ
A5G3M8_GEOUR/23-151-----------------------------------------------------VEVI--A---------SIH--G---YI
Q2NDB2_ERYLH/5-124-----------------------------------------------------EASV--M---------DAL--L---AE
Q2K8Q5_RHIEC/6-134-----------------------------------------------------SPSE--L---------ATL--T---TA
Q2K2A8_RHIEC/65-199-----------------------------------------------------AAVN--D---------VHE--H---LA
C5ATD4_METEA/9-143-----------------------------------------------------AILA--E---------TLD--R---LR
Q6YRV1_SYNY3/11-152-----------------------------------------------------.ESH--L---------QEL--R---KS
A1VQ27_POLNA/13-152-----------------------------------------------------.ESH--E---------AAL--R---AL
Q1QNK4_NITHX/10-142-----------------------------------------------------PVGV--H---------TAL--R---AH
Q2IDP5_ANADE/4-131-----------------------------------------------------VADW--V---------LRA--L---DA
Q9I5S7_PSEAE/5-101-----------------------------------------------------.RSL--Q---------RAI--A---AH
Q9KVG5_VIBCH/24-139-----------------------------------------------------...V--T---------RLL--S---YR

PF03665

S2JVY4_MUCC1/7-196-------------------------------------------------...VDLHA--Y---------AIP--L---LH
H3A1H6_LATCH/3-193-------------------------------------------------VIKLTTQA--Y---------CKM--V---LH
E1ZPZ1_CHLVA/4-226-------------------------------------------------NCSVEPAA--L---------YKI--L---LH
A8PXT4_MALGO/8-186-------------------------------------------------SVDVSPLA--Y---------RKI--V---YH
K7IXZ7_NASVI/3-194-------------------------------------------------DISFSGRA--Y---------AKI--I---LH
B6ABX0_CRYMR/2-193-------------------------------------------------EVSLSEKA--F---------GKM--A---MH
F8PZP6_SERL3/3-194-------------------------------------------------SYCISHQA--Y---------LKI--F---FH
D7UAL1_VITVI/6-204-------------------------------------------------KYEIAQNA--Y---------IKL--V---LH
K3X3W2_PYTUL/3-194-------------------------------------------------DYHVEASA--Y---------VKL--L---LH
E9H1Y4_DAPPU/4-193-------------------------------------------------TCELSKLA--Y---------SKI--I---LH
W1NI66_AMBTC/6-203-------------------------------------------------RYELKQNA--Y---------MKV--V---LH
U9UHY5_RHIID/3-195-------------------------------------------------EYIINKEA--Y---------LKI--I---LH
Q8IHW7_PLAF7/5-193-------------------------------------------------EITIDDGA--Y---------AKI--F---MH
G6CKX7_DANPL/3-196-------------------------------------------------EVTLDTVA--Y---------AKI--M---LH
A7RMN9_NEMVE/2-189-------------------------------------------------KYRISARA--Y---------AKM--L---LH
E7F7R8_DANRE/8-194-------------------------------------------------......ES--Y---------CKM--L---LH
K5XVE6_AGABU/4-197-------------------------------------------------KYTITGPA--Y---------IKL--F---FH
A9SC67_PHYPA/3-200-------------------------------------------------TYDLRQTA--Y---------VKL--V---LH
J3LWC9_ORYBR/6-208-------------------------------------------------QYEVAQAA--Y---------VKL--A---LH
T1KNA2_TETUR/2-199-------------------------------------------------ECQISIRC--F---------SKI--M---MH
EMC89_DICDI/4-190-------------------------------------------------NISITTEA--L---------SKA--H---LH
Q580G6_TRYB2/15-270-------------------------------------------------...SSVQA--Y---------VKA--L---LH
H2ZYC6_LATCH/3-193-------------------------------------------------EVEISAQA--Y---------VKM--R---LH
A9UQH6_MONBE/4-204-------------------------------------------------...ITSDA--Y---------FKL--L---AH
V2WXJ1_MONRO/3-193-------------------------------------------------SYTIHPTA--Y---------FKI--F---FH
U5H1I2_USTV1/19-212-------------------------------------------------SYTLSPLA--Y---------LKL--V---LH
C6T3E5_SOYBN/8-202-------------------------------------------------.YEIEQNA--Y---------IKL--V---LH
E2C953_HARSA/3-193-------------------------------------------------NVFFSPRA--Y---------CKI--I---LH
T1J291_STRMM/3-192-------------------------------------------------DIIVSMQA--Y---------CKV--F---LH
M7WJF6_RHOT1/3-188-------------------------------------------------DYSIASLA--Y---------LKL--V---LH
I1F3D0_AMPQE/3-193-------------------------------------------------HFQLSARA--Y---------AKL--I---CH
D8RDW5_SELML/2-207-------------------------------------------------KYQISQTA--Y---------VKL--A---LH
F6SMK1_XENTR/3-190-------------------------------------------------EVELTTRV--Y---------VKM--L---LH
H3FWQ9_PRIPA/653-834-------------------------------------------------TIEVDSLP--Y---------ATI--V---LH
H2XJW9_CIOIN/3-199-------------------------------------------------.VEVSCKA--F---------TKL--Q---LH
E0VL46_PEDHC/3-196-------------------------------------------------DVSFSSRA--Y---------AKM--I---LH
D8PXF6_SCHCM/3-192-------------------------------------------------SYTFSDDA--Y---------LKL--F---FH
D8LMA2_ECTSI/5-188-------------------------------------------------NVNVEEAA--Y---------LKL--M---LH
D8U3A0_VOLCA/3-209-------------------------------------------------ACTVDQVA--F---------LKV--L---AH
Q17EH7_AEDAE/3-187-------------------------------------------------EVNFSARA--Y---------CKM--M---LH
H0X2J2_OTOGA/3-202-------------------------------------------------GVKLTTQA--Y---------CKM--V---LH
D6WHD0_TRICA/3-190-------------------------------------------------DITFSAKA--Y---------CKI--I---LH
G3PTY1_GASAC/4-197-------------------------------------------------.IQLTSQA--Y---------CKM--V---LH
A4HT47_LEIIN/7-247-------------------------------------------------SVVASPEA--Y---------TKA--L---LH
F2U324_SALR5/2-194-------------------------------------------------..RIHAAA--Y---------VKA--V---CH
E6ZZH1_SPORE/6-197-------------------------------------------------AVSVSPLA--Y---------KKL--I---LH
M9LL18_PSEA3/6-197-------------------------------------------------SVRVSPLA--Y---------KKL--V---LH
D3BSK2_POLPA/3-189-------------------------------------------------EITISLQS--F---------LKI--H---SH
M1AGM8_SOLTU/6-202-------------------------------------------------TYEIHQNA--Y---------IKL--I---LH
K4DMB1_TRYCR/8-213-------------------------------------------------SVVSSVEA--H---------AKA--L---LH
H9GAA6_ANOCA/2-194-------------------------------------------------..KLSTQA--Y---------CKL--V---LD
L8WT82_THACA/184-364-------------------------------------------------EFQLSHKA--Y---------TKL--I---VH
Q8L439_CHLRE/4-200-------------------------------------------------SCSADQTA--L---------LKI--L---AH
Q93568_CAEEL/4-184-------------------------------------------------QVETQALP--Y---------STI--I---LH
C4WXC3_ACYPI/3-189-------------------------------------------------KVSFSTLA--Y---------CKM--V---AH
F1LEA9_ASCSU/7-187-------------------------------------------------....NSLC--Y---------AKI--I---LH
R9AN22_WALI9/6-184-------------------------------------------------.SSINTRV--H---------SKI--I---AH
A0A068X284_HYMMI/3-184-------------------------------------------------TLHLESLA--F---------AKI--L---LH
F4PPA7_DICFS/6-190-------------------------------------------------NIEVTIEA--F---------KKI--H---SH
G4TEZ9_PIRID/281-458-------------------------------------------------KLVLSHQA--Y---------LSM--L---LH
A8NSL7_COPC7/7-197-------------------------------------------------.LTVASKA--Y---------LKI--Y---FH
I7LUF5_TETTS/9-204-------------------------------------------------..AIELLA--Y---------KKA--Y---LH
M4BIS6_HYAAE/6-193-------------------------------------------------.YTVQTQS--Y---------VKL--M---LH
E1FPI7_LOALO/3-186-------------------------------------------------SSAFTLRG--Y---------AKM--I---LH
H9JQS8_BOMMO/3-195-------------------------------------------------EVSIETGA--Y---------AKI--I---LH
EMC89_DROME/3-192-------------------------------------------------DYKVSERA--Y---------AKL--I---FH
I2FZ76_USTH4/6-200-------------------------------------------------SVRVSPLA--Y---------KKL--I---LH
H3CTG5_TETNG/3-190-------------------------------------------------EMELSCRA--Y---------VKM--Y---LH
W5KBR5_ASTMX/3-190-------------------------------------------------EVELSCLA--Y---------VKM--F---LH
M4EJI7_BRARP/8-204-------------------------------------------------KYEISQNA--Y---------IKL--V---LH
C1N8U7_MICPC/4-205-------------------------------------------------EYRLADKA--Y---------VKM--L---LH
Q8AWD7_DANRE/3-190-------------------------------------------------EVELSCLA--Y---------AKM--Y---LH
D2VG68_NAEGR/7-193-------------------------------------------------...SESSP--Y---------FKS--L---FH
Q6P4M9_XENTR/3-194-------------------------------------------------AFKLTTQA--F---------CKM--M---LH
T1ELZ1_HELRO/3-187-------------------------------------------------NICMNARS--F---------VKP--L---LH
F4P6T5_BATDJ/6-192-------------------------------------------------SYHISNKA--Y---------AKI--L---LH
B4LMW8_DROVI/3-191-------------------------------------------------EYEFSETA--Y---------TKI--I---FH
L5KIQ8_PTEAL/3-191-------------------------------------------------EVEISARA--Y---------VKM--C---LH
B9S9X3_RICCO/8-202-------------------------------------------------KYEISQNA--Y---------IKL--V---LH
B0CX14_LACBS/4-198-------------------------------------------------SYTISAQA--Y---------YKI--F---FH
Q5TPN5_ANOGA/3-186-------------------------------------------------EIMFDPRA--F---------CKI--M---LH
B7P0N7_IXOSC/7-201-------------------------------------------------DVNLGVRA--F---------SKM--L---LH
E4XDZ8_OIKDI/3-184-------------------------------------------------DIVFSSLA--L---------TKM--M---LH
W5LY47_LEPOC/2-192-------------------------------------------------AVKLTTQA--Y---------CKM--L---LH
B3S6U6_TRIAD/5-192-------------------------------------------------KITVKSRS--Y---------AKI--L---LH
C1E2I6_MICSR/2-195-------------------------------------------------KYTLSDRA--Y---------CKL--I---LH
C3ZBN0_BRAFL/3-191-------------------------------------------------EIEISVRS--Y---------VKL--V---LH
A5K556_PLAVS/5-194-------------------------------------------------EISIENAA--Y---------AKM--F---MH
D0NP92_PHYIT/2-190-------------------------------------------------DYSVSTQT--Y---------VKL--V---LH

PF04002

Y5284_PSEPK/103-223-----------------------------------------M.D--SP....AAVRR..Y.--.L....KAM..L...RH
E4RNA6_HALHG/25-148-----------------------------------------I.S--NP....LAARD..L.--.F....IEV..L...EL
F3ZWY8_MAHA5/23-143-----------------------------------------V.L--YD....TDAAE..I.--.....AQEY..F...VG
Q28VQ9_JANSC/136-256-----------------------------------------L.S--SW....DALLA..Y.--.C....QTA..M...AH
E3PVU0_CLOSD/38-158-----------------------------------------I.S--CP....ADGLM..M.--.A....KMF..L...ED
B2URH1_AKKM8/106-233-----------------------------------------I.Q--TP....EDVYD..Y.--.L....TTA..M...RW
Y2075_CLOTE/107-227-----------------------------------------I.T--NP....KDAAY..L.--.V....MEE..M...RW
G2Z3M4_FLABF/108-228-----------------------------------------I.T--CS....RDAFL..L.--.M....QPL..I...GD
I2F2Z1_9BACT/99-218-----------------------------------------L.D--EP....EGVYH..L.--.C....HD...M...AF
R5BCM7_9CLOT/99-219-----------------------------------------L.N--NP....ERAAE..Y.--.C....MQL..L.....
D3RWG0_ALLVD/46-166-----------------------------------------L.T--SP....DATRD..Y.--.L....KLR..L...YG
D5BC92_ZUNPS/22-146-----------------------------------------I.T--CC....QDAAN..I.--.Y....Y.S..N...WD
W8L1Z3_HALHR/103-222-----------------------------------------I.T--SP....EHTRR..Y.--.L....AAR..L...RD
R5R1B6_9FIRM/110-230-----------------------------------------I.E--HP....ETIAA..Y.--.Y....MEQ..M...RH
I1ER86_AMPQE/103-223-----------------------------------------F.N--SP....EDTCL..Y.--.L....HAR..L...RS
C7RTF0_ACCPU/103-224-----------------------------------------F.A--SP....GAVRD..Y.--.L....RLH..L...AG
T0U3M9_9STRE/104-224-----------------------------------------I.M--SS....QKLAH..K.--.I....QQE..I...GH
R6V2L8_9FIRM/110-230-----------------------------------------F.D--CP....ASIAK..Y.--.Y....MEQ..L...RH
U5NAV3_9BURK/110-230-----------------------------------------L.N--TP....SLVKD..Y.--.V....RLH..L...GE
D4M5Z8_9FIRM/112-232-----------------------------------------F.S--SP....DSIAR..Y.--.Y....MED..L...RH
R7HL71_9BACT/112-232-----------------------------------------I.N--MP....SKAYD..L.--.M....LDK..L...TG
Y1522_COPPD/112-234-----------------------------------------...--TP....EDAIE..Y.--.AARYFSSM..L...MN
K9V4F0_9CYAN/114-235-----------------------------------------I.D--SP....ASAAA..A.--.L....SQD..L...MW
R6JMU8_9CLOT/103-226-----------------------------------------L.T--DA....AQSCA..Y.--.F....ANL..L...RD
Y1979_METAC/107-227-----------------------------------------I.C--SP....KDVYA..L.--.M....YPR..M...RE
R5AEJ0_9CLOT/106-227-----------------------------------------L.N--TP....AASAR..F.--.V....NEL..L...LA
K9VXG9_9CYAN/114-235-----------------------------------------I.D--SP....GAGAA..A.--.L....SHD..L...MW
K9YJM8_CYASC/114-235-----------------------------------------I.D--SP....QAAAS..A.--.F....SHE..L...MW
D4MYV8_9FIRM/121-241-----------------------------------------F.H--SP....ASIAD..Y.--.Y....MER..M...RH
Y065_PELCD/106-226-----------------------------------------Y.T--SP....QAVFA..H.--.F....HER..L...RD
R6NJL1_9FIRM/98-227-----------------------------------------Y.N--TDVFVLNSETSENY.--.................
R5US02_9PORP/117-237-----------------------------------------I.H--SS....VDAYR..Y.--.I....API..L...KD
C5APV7_METEA/127-247-----------------------------------------L.S--SW....SALIE..Y.--.L....RAT..M...AF
D4KXI5_9FIRM/120-240-----------------------------------------M.T--NP....RTIAD..Y.--.Y....MEH..L...RH
Q30YK7_DESAG/104-224-----------------------------------------L.V--SS....RAVAD..M.--.A....RTR..L...AG
R7MM84_9FIRM/100-219-----------------------------------------L.D--TS....NSAKK..F.--.F....EHY..F.....
R6WGP4_9FIRM/109-229-----------------------------------------F.S--SS....QSVAE..Y.--.Y....MED..L...RH
Y3678_SACD2/103-223-----------------------------------------L.T--ST....TAVKQ..F.--.V....SAQ..L...RH
C5B9D5_EDWI9/107-227-----------------------------------------I.T--SP....DLTAL..Y.--.L....QNL..F...VS
E6U843_ETHHY/108-231-----------------------------------------V.R--DS....EDAAK..Y.--.L....LPF..F.....
A5VIV5_LACRD/84-210-----------------------------------------A.Y--SS....IELGR..K.--.M....VDH..F...QS
Q8PA70_XANCP/38-158-----------------------------------------I.H--SP....DQAGD..Y.--.L....VAR..C...AH
R5LD03_9FIRM/107-227-----------------------------------------Y.D--SP....KKIAG..Y.--.Y....MER..L...RH
R7CLP4_9FIRM/107-227-----------------------------------------F.N--SP....QKVSR..Y.--.....FMEK..L...RH
W0A464_9SPHN/116-236-----------------------------------------L.S--NW....QALLD..Y.--.L....HVD..M...AH
B2V8J4_SULSY/109-228-----------------------------------------I.T--SV....SDAFN..Y.--...........L.....
G8R4W9_OWEHD/111-231-----------------------------------------I.T--SS....AQAFE..V.--.L....QPL..I...GD
R5ACA2_9FIRM/103-224-----------------------------------------L.T--SI....TRCVE..Y.--.................
R6CUA2_9CLOT/108-228-----------------------------------------C.N--SA....EKIYR..H.--.F....RSL..L...MD
D6S4C3_9LACO/86-206-----------------------------------------F.V--SS....HEVGK..Y.--.....LIDR..F...LG
R5VDS3_9BACE/108-228-----------------------------------------I.T--SS....QDVYA..F.--.F....HPL..M...CD
R6Q8T0_9FIRM/106-226-----------------------------------------L.R--TT....EQLAE..F.--.L....KSK..F.....
Q3Z6I4_DEHM1/117-237-----------------------------------------C.N--TA....QQVFD..Y.--.L....YCA..M.....
F4LNQ7_TREBD/95-214-----------------------------------------I.Q--TP....ADLVP..F.--.L.....QH..Y...SM
E3FL00_STIAD/112-232-----------------------------------------L.R--TP....KEIHL..Y.--.L....SPT..L...NA
W8EWR6_9BACT/132-252-----------------------------------------I.T--CS....RDIYR..V.--.V....RPY..L...QD
R6C1S4_9CLOT/112-232-----------------------------------------F.D--RS....GTVAS..Y.--.Y....MES..M...RH
Q73P26_TREDE/101-221-----------------------------------------I.S--HP....TDVVP..L.--.L.....QH..Y...AD
R6TRA0_9CLOT/117-237-----------------------------------------F.T--NA....KEIYL..D.--.N....KYL..F...VD
R6FT99_9BACT/117-237-----------------------------------------M.G--SA....QAVYE..Y.--.M....HPK..M...QD
Y2073_CYAP7/114-235-----------------------------------------I.N--DP....VSAVA..A.--.L....SHD..L...MW
W0IZP3_9BACT/129-256-----------------------------------------M.S--DS....AAVAA..F.--.................
R7QWB5_9FIRM/108-228-----------------------------------------L.T--DA....ASVAG..Y.--.Y....MEQ..L...RH
A4AMB7_MARSH/111-231-----------------------------------------I.S--SS....RDVFE..L.--.L....QPS..M...GE
C9R8K7_AMMDK/111-231-----------------------------------------I.N--SP....AAAAQ..L.--.V....VPT..M...AH
Y2138_NITMU/103-223-----------------------------------------M.D--SP....GPVRA..F.--.L....RLS..L...EG
A7HJG0_FERNB/100-219-----------------------------------------L.T--SP....ENVFQ..Y.--.C....ID...M...QS
R5RS63_9BACE/104-224-----------------------------------------I.T--HS....RQIYE..M.--.M....IPL..L...KG
R7N750_9FIRM/109-229-----------------------------------------F.K--TP....SSIAD..Y.--.Y....MEQ..M...RH
K9SG97_9CYAN/114-235-----------------------------------------I.T--DP....SIAAA..A.--.L....SQE..L...MW
Y3860_XANCP/103-223-----------------------------------------L.S--DP....SSVGR..Y.--.F....SQR..L...RA
Y413_FLAJ1/108-228-----------------------------------------I.T--SS....KDAFT..I.--.M....QPI..I...GE
F9Z8P0_ODOSD/41-163-----------------------------------------I.R--CS....RDAFL..Y.--.I....KEF..F...KS
F9ZAH9_ODOSD/110-230-----------------------------------------I.R--FS....REAYR..Y.--.I....RSF..I...ED
K7SYG7_GLUOY/113-231-----------------------------------------VLG--NW....PQLTS..Y.--.................
D3PBS2_DEFDS/111-231-----------------------------------------L.N--SP....TAVFK..F.--.L....KFE..V...GF
L0FXZ1_ECHVK/29-152-----------------------------------------I.G--SS....KDAYK..L.--.L....L.K..N...WD
U5T1X5_9GAMM/103-223-----------------------------------------M.T--GP....EETRQ..Y.--.L....VAR..L...RH
R6WPE8_9BACT/116-236-----------------------------------------M.D--SA....EAIYE..Y.--.M....RPK..M...QD
I3Z0D0_BELBD/110-230-----------------------------------------I.N--SS....KEAYD..L.--.M....KPD..L...MD
R5ZMY8_9CLOT/106-226-----------------------------------------I.K--NT....DDIAK..I.--.L....IEE..L...KY
Q5LI37_BACFN/109-229-----------------------------------------I.R--CS....EDIYK..L.--.F....HPL..M...CD
F6IKU2_9SPHN/12-140-----------------------------------------RPL--SG....ATLES....--.................
X2H7P0_9NEIS/103-223-----------------------------------------F.T--QP....AAVAD..F.--.L....RLH..I...GH
R4ZYW4_9CLOT/111-232-----------------------------------------L.N--NS....KVIFD..Y.--.F....KHV..F...QD
L0G541_ECHVK/30-153-----------------------------------------V.V--SS....QGAAK..V.--.L....R.A..N...WD
C7JGI6_ACEP3/140-274-----------------------------------------FLG--NW....DSILE..Y.--.................
Q5FNC5_GLUOX/112-229-----------------------------------------TLS--NW....EQLMA..Y.--.................
R6XQS6_9CLOT/100-220-----------------------------------------I.A--TR....GDLVR..Y.--.L....SPF..F.....
Y3126_ACIAD/121-236-----------------------------------------L.N--SS....RLVLD..Y.--.L....RYE..L.....
Q5NML0_ZYMMO/23-141-----------------------------------------L..--......EDAID..L.--.................
R7DMH4_9FIRM/102-223-----------------------------------------M.R--SA....SDVVL..K.--.Y....LPL..Y...AN
R5C3D7_9BACE/112-232-----------------------------------------I.K--AS....TDIYN..L.--.F....HPL..L...CD
E8RF98_DESPD/37-156-----------------------------------------I.L--SP....TAAKE..A.--.I....GLK..L...TG
G2T1I1_ROSHA/109-229-----------------------------------------L.G--DP....GSIAS..Y.--.Y....MED..M...RH
R5QDV9_9FIRM/110-230-----------------------------------------F.S--SP....RTIAD..Y.--.Y....MED..M...RH
Y1038_NEIMB/103-223-----------------------------------------L.S--DP....DTVAD..Y.--.L....RFH..L...GQ
B4E8Y6_BURCJ/88-208-----------------------------------------I.D--SP....GAVED..C.--.L....RLK..I...GT
Y3773_ACIAC/116-236-----------------------------------------F.H--SP....RAVRD..Y.--.L....QLH..L...GG
R6R369_9FIRM/74-199-----------------------------------------I.N--TI....QEAAL..F.--.L....YHQ..I...TN
Y1020_HAHCH/103-223-----------------------------------------L.T--SP....ELTRE..Y.--.L....SAH..L...RH
E1SW46_FERBD/106-226-----------------------------------------L.T--SP....QAVRD..Y.--.L....RHR..L...QG
X4ZZJ0_9BACL/79-200-----------------------------------------I.R--SP....QDAYE..L.--.L....YSE..L...SY
R6GRW5_9FIRM/103-225-----------------------------------------L.S--NK....EKIHE..V.--.....FKKF..F...IN
R6XGE5_9FIRM/101-228-----------------------------------------L.K--ES....HAIYR..F.--.................
E8UCD0_TAYEM/104-224-----------------------------------------L.Q--QA....STVKR..Y.--.C....IHA..I...GN
Y2444_RALSO/103-223-----------------------------------------L.E--SP....QSVKD..F.--.L....RLT..L...GH
K9TSS9_9CYAN/114-235-----------------------------------------I.E--SP....AVAAA..V.--.L....SQD..L...MW
W8KH20_HALHR/39-161-----------------------------------------F.T--SP....ALVRQ..F.--.L....HLK..L...GA
Y214_ALCBS/103-223-----------------------------------------L.D--NP....DKAGQ..L.--.L....TAQ..L...RG
Q03R16_LACBA/85-205-----------------------------------------V.L--AS....SQLGQ..V.--.....LMDD..L...RY
R6PL39_9FIRM/104-228-----------------------------------------L.D--SV....SKAGV..F.--.................
R7FQ02_9CLOT/101-224-----------------------------------------IKD--SN....DLFLR....--.................
W0EUJ6_9SPHI/108-228-----------------------------------------T.A--GS....KQIGA..Y.--.L....RTI..L...QD
R7H4T7_9FIRM/53-180-----------------------------------------I.T--SY....EQIKE..Y.--.L....QIQ..F.....
R6MT67_9FIRM/102-222-----------------------------------------V.I--EL....EHLGE..M.--.F....INK..F.....
B2IKI6_BEII9/120-240-----------------------------------------L.S--SF....SAVID..Y.--.C....RIA..M...GF
B8CY05_HALOH/107-227-----------------------------------------V.K--SP....GDVAE..L.--.V....MPD..M...RY
R5XLN2_9CLOT/108-228-----------------------------------------I.K--SG....QDVAN..M.--.F....MEE..L...RY
Y611_CHLTE/101-221-----------------------------------------V.K--GA....RDVFE..Y.--.M....KGR..I...PD
D8MKD6_ERWBE/101-221-----------------------------------------A.G--GT....ADMLT..F.--.F....ISQ..L...AH
C8X2R8_DESRD/107-227-----------------------------------------L.S--SP....ERVAR..M.--.A....RER..F...GR
F8HZR3_WEIKK/1-125-----------------------------------------M.G--KT....NKLIQ..Q.--.Y....QIK..L...GS
R5KN13_9CLOT/103-223-----------------------------------------L.S--SS....DLAAE..Y.--.F....ENL..L.....
R5K0Z2_9CLOT/108-228-----------------------------------------L.K--HP....AALAE..Y.--.F....MKE..L...QY
R6Z4N0_9CLOT/109-229-----------------------------------------Y.E--SP....EEIAA..F.--.Y....MED..M...RH
R6EN47_9FIRM/111-231-----------------------------------------F.T--RA....DMVAE..Y.--.F....MEK..L...RH
C6BYC2_DESAD/104-224-----------------------------------------I.S--SP....DVVYK..A.--.A....MAR..I...GN
R6H979_9FIRM/30-150-----------------------------------------L.N--TV....ERCGA..Y.--.L....TPR..F.....
R7FIG1_9CLOT/110-230-----------------------------------------V.H--NS....SHLAG..M.--.L....MQE..L...RF
R5PY27_9PROT/128-248-----------------------------------------L.S--NW....DRMIS..Y.--.C....KAA........
E6SUA0_BACT6/75-195-----------------------------------------I.R--CS....LDIHA..L.--.M....QPF..L...WD
I0I0Q8_CALAS/102-222-----------------------------------------V.R--GP....ADVAN..L.--.V....MLE..M...GL
D5B9K5_ZUNPS/24-148-----------------------------------------I.K--SS....ATAAD..V.--.L....Y.S..N...WD
Y148_XYLFA/103-223-----------------------------------------I.H--DP....ISAGR..Y.--.F....AQR..L...RA
Q2N869_ERYLH/28-147-----------------------------------------L.A--DP.....GFLQ..Y.--.I....HSRFAM.....
G0A5I7_METMM/103-223-----------------------------------------L.T--SP....EITRA..Y.--.L....SAQ..L...RG
A9KR89_CLOPH/33-155-----------------------------------------L.E--SP....SEIQK..L.--.M....KEQ..F...QI
A8F4C4_PSELT/95-214-----------------------------------------L.D--KP....ESVYE..Y.--.C....HE...M...RF
Q1GAU6_LACDA/83-203-----------------------------------------W.A--GS....SKIGN..Y.--.....LANK..L...LG
Y442_AROAE/103-224-----------------------------------------F.E--SP....LAVRN..W.--.L....RLR..I...GS
Q74JZ5_LACJO/82-202-----------------------------------------F.Y--SS....SQVGC..Y.--.....IADK..L...CG
Y3142_DECAR/104-225-----------------------------------------F.T--SP....GKVRD..W.--.L....RLK..L...AS
D6DG41_CLOSC/43-164-----------------------------------------I.G--DS....STAAE..I.--.A....RPL..L...ER
Y013_ACTSZ/99-219-----------------------------------------F.T--NP....LTVRL..Y.--.L....QTE..L...EH
Q5LEH2_BACFN/24-146-----------------------------------------I.R--SS....KESYD..I.--.L......K..T...FY
W5X2J0_BDEBC/4-123-----------------------------------------V.N--SS....SEAFH..L.--.L....KSK..F....N
C8WYB3_ALIAD/25-146-----------------------------------------I.R--CA....EDAAN..I.--.L....RGY..I...GN
B7JUA9_CYAP8/114-235-----------------------------------------I.E--NP....DTAAA..A.--.L....SHD..L...MW
R5HU73_9MOLU/106-225-----------------------------------------I.I--NP....LNIYN..Y.--.Y....KDK..L...KN
R5LID6_9MOLU/107-228-----------------------------------------L.N--NP....EVIFQ..E.--.M....RYL..F...ID
D3V2K1_XENBS/36-155-----------------------------------------F.T--ST....SVTKT..W.--.L....QLQ..M...AG
R5V674_9FIRM/104-232-----------------------------------------I.T--SA....KEVYM..R.--.Y....HLQ..V...TN
F2KUB1_PREDF/111-231-----------------------------------------L.T--NA....AKIYH..F.--.M....HTT..I...QD
Y2301_HALHL/103-223-----------------------------------------L.S--SP....AQTRT..Y.--.L....AAL..L...RD
D3R1Z5_MAGIU/112-235-----------------------------------------V.N--RP....DLVAK..Y.--.L....YQE..M...SY
D3RRI0_ALLVD/103-223-----------------------------------------L.T--SP....EATRD..Y.--.L....KLR..L...YG
D9SEL4_GALCS/84-204-----------------------------------------L.N--NP....VEVKK..Y.--.L....KLL..L...GG
D1CCM1_THET1/111-231-----------------------------------------I.T--SP....EDIAD..L.--.L....MLE..M...GH
Y1610_AQUAE/111-230-----------------------------------------I.R--NP....QEAFE..F.--...........L.....
H8L280_FRAAD/102-222-----------------------------------------L.S--NP....ADSGR..F.--.L....RAR..L...GH
F2NW47_TRES6/103-222-----------------------------------------I.N--AP....KDVIP..F.--......LQHYTL.....
H8KNS2_SOLCM/32-155-----------------------------------------V.T--CS....ADAYK..L.--.L....D.S..L...WD
C7M9C6_CAPOD/104-224-----------------------------------------I.E--VA....HNVFV..L.--.M....QPL..I...GE
R6GJ39_9FIRM/101-221-----------------------------------------V.A--SV....DQAGA..Y.--.F....LRL..L.....
R6LNS1_9FIRM/12-132-----------------------------------------F.S--RP....DTIAA..Y.--.Y....MED..M...RY
L0FUI1_ECHVK/32-155-----------------------------------------I.T--SS....KEAYD..V.--.L....L.E..N...WD
E6X308_NITSE/99-218-----------------------------------------I.H--SA....AEVYE..L.--.L.....EP..F...AN
K8E3A4_CARML/107-227-----------------------------------------I.T--SS....QMVGD..L.--.L....FTE..M...KD
Y1904_DELAS/105-225-----------------------------------------L.A--SP....EAVAR..Y.--.L....QLH..L...AA
Q2RWF9_RHORT/122-242-----------------------------------------L.G--AW....DRVLD..Y.--.C....HAT..M...DH
Y4435_MICAN/114-235-----------------------------------------I.D--SP....DTAAA..I.--.L....GHE..L...MY
F8KZT6_PARAV/110-230-----------------------------------------I.R--TP....LHAYH..L.--.V....KDD..L...EK
R5I961_9BACT/97-217-----------------------------------------I.T--AS....STVSR..I.--.F....SPL..L...RN
Y935_PELPB/101-221-----------------------------------------I.Q--AA....RDVFE..Y.--.M....AGR..V...PD
D5CP50_SIDLE/103-223-----------------------------------------L.N--SP....RAVRE..Y.--.L....QLL..L...RS
R6P491_9FIRM/116-239-----------------------------------------F..--......ARASA..Y.--.................
D7DLS6_METV0/103-223-----------------------------------------L.S--SP....KQVRD..Y.--.L....CLK..L...GN
K0P606_9BACT/123-243-----------------------------------------V.N--SS....SKAYK..L.--.L....QPD..L...TD
Y2405_BORA1/104-224-----------------------------------------M.K--HP....EEVRR..Y.--.C....LTA..L...AH
Y3578_BURXL/132-252-----------------------------------------I.N--SP....EAVEN..Y.--.L....RLR..I...GG
Y624_MARMS/103-223-----------------------------------------F.A--SA....EHVRT..Y.--.L....SSQ..L...RH
A6L365_BACV8/27-149-----------------------------------------I.L--SS....ETSYS..Y.--.L......K..P...FY
R5C6J2_9FIRM/111-231-----------------------------------------C.R--SA....AQVAD..C.--.Y....MES..L...RH
R6NVH9_9FIRM/104-224-----------------------------------------M.Q--NA....FSVAD..Y.--.Y....MEQ..L...RH
B9KJ96_ANAMF/109-229-----------------------------------------V.N--EW....QKLLD..Y.--.L....RVK..I...GN
R6THG6_9FIRM/105-225-----------------------------------------I.R--NI....SAALS..F.--.VNNCFRNE........
Q2GEH3_NEOSM/115-235-----------------------------------------L.K--SW....KSVVD..Y.--.L....RLS..I...GN
B2GB03_LACF3/81-207-----------------------------------------A.A--SS....TSVGT..A.--.L....IDE..F...AG
R6YH91_9FIRM/88-208-----------------------------------------V.Y--DA....DSAIA..L.--.F....RPK..F.....
E8N4R5_ANATU/112-232-----------------------------------------I.T--CP....ADAAE..L.--.V....RYE..M...SA
D6ZAJ2_SEGRD/99-216-----------------------------------------L.V--QS....SDIAR..V.--.................
D1BNF1_VEIPT/110-230-----------------------------------------F.S--QP....FVIAQ..Y.--.....VMER..L...RH
Q1GU85_SPHAL/151-271-----------------------------------------L.S--SW....DALLD..W.--.L....RAD..M...GP
K7SLE3_GLUOY/136-256-----------------------------------------L.D--SE....QKLLD..Y.--.L....TAR..L...AR
R5TQH5_9CLOT/80-200-----------------------------------------I.K--TS....KDVYN..L.--.M....KYD..L...SL
R5DVG9_9FIRM/95-215-----------------------------------------F.S--SP....ETIAG..Y.--.Y....MQD..L...RG
B8GNP3_THISH/45-165-----------------------------------------L.T--SP....ASVRE..Y.--.L....WLK..L...AS
Y046_PSEA6/103-223-----------------------------------------F.N--SA....QQTKH..F.--.L....IAQ..L...RD
K0CD70_ALCDB/47-167-----------------------------------------L.T--SS....LAVRE..Y.--.L....RLQ..L...AS
D4ZI11_SHEVD/38-157-----------------------------------------Y.T--DP....QTTKD..F.--.L....TYK..L...GG
R7FVV9_9PROT/101-232-----------------------------------------N.N--LKFYNYAEVKN..Y.--.................
E8RT73_ASTEC/123-243-----------------------------------------I.S--SW....QALLS..Y.--.L....RVT..L...AH
R6X9C8_9CLOT/107-227-----------------------------------------I.K--SP....QDVAD..L.--.L....INE..L...KY
B4RG10_PHEZH/134-254-----------------------------------------D.A--NA....KRTHD..Y.--.L....RAL..L...EF
F8EX90_TRECH/113-237-----------------------------------------I.R--EP....ADAYQ..L.--.L.....RH..Y...AD
B7VP91_VIBTL/36-155-----------------------------------------F.T--NP....QATRD..Y.--.L....RFK..I...GG
R6YGF9_9FIRM/111-231-----------------------------------------F.D--SP....EFIAN..Y.--.F....MEE..M...RT
M1PMK6_DESSD/108-227-----------------------------------------L.T--SS....ADVRD..Y.--.L....LHA..L...RG
V5UBJ0_9BURK/103-223-----------------------------------------L.D--SP....TRVRD..Y.--.L....RLT..L...QD
D0LGP2_HALO1/104-225-----------------------------------------V.R--NP....RDLYE..R.--.L....RLR..L...RG
M4NFQ4_9GAMM/41-160-----------------------------------------I.G--NP....MDAAD..F.--.L....RMR..M...GA
R5D036_9FIRM/103-223-----------------------------------------F.S--SP....TSIAD..Y.--.Y....MED..L...RH
K4KY92_9FIRM/73-197-----------------------------------------I.N--SP....ESASD..F.--.F....HSV..M.....
R5GYG8_9FIRM/105-227-----------------------------------------L.S--TS....DSMRDYCYK--LL....KET..I.....
D5EQU3_CORAD/111-238-----------------------------------------L.D--SP....ELVAR..R.--.................
R7DAT5_9FIRM/110-230-----------------------------------------F.N--SP....DSIAA..Y.--.Y....MEQ..L...RH
Y357_FINM2/102-223-----------------------------------------L.N--DP....DSVAE..I.--.F....CNE..I...GS
G4QEU4_GLANF/103-223-----------------------------------------F.T--QA....DAASN..Y.--.L....LAE..L...RD
Q8F655_LEPIN/106-224-----------------------------------------..Y--SS....EQLLN..F.--.................
R6M7S0_9CLOT/104-224-----------------------------------------L.T--NP....ESIIN..Y.--.F....HNL..F...DG
D5WUP2_KYRT2/107-227-----------------------------------------I.H--SP....NDVAS..R.--.L....MER..L...QF
Y2926_ENTFA/108-228-----------------------------------------V.T--SS....QQVAQ..R.--.L....LQE..M...KG
F0JFH1_DESDE/108-228-----------------------------------------V.S--GP....DSLAR..A.--.A....MAR..L...GH
R5G321_9FIRM/104-225-----------------------------------------I.K--TP....DDLYE..Y.--.................
Q47CZ3_DECAR/72-192-----------------------------------------M.A--SP....QVLRD..W.--.L....RLH..C...AG
B8IPF4_METNO/121-241-----------------------------------------L.S--SW....SAVID..Y.--.C....RAA..M...AF
R5YE69_9FIRM/107-227-----------------------------------------L.N--NP....ASIAD..Y.--.Y....MEE..L...RH
A9IEU5_BORPD/53-173-----------------------------------------L.S--NP....DKAKA..F.--.L....QLR..L...AG
F4GWW4_PUSST/104-224-----------------------------------------L.D--QP....QRVKH..Y.--.C....TAK..L...GH
R6R974_9FIRM/105-225-----------------------------------------F.T--DS....GTVAG..Y.--.Y....MEQ..L...RH
Y2468_HERAR/103-223-----------------------------------------L.N--SP....QAVKQ..Y.--.L....QLL..L...SG
Q0BRK0_GRABC/150-270-----------------------------------------L.N--NW....ERLIA..Y.--.L....NAS..L...AR
F8ACC7_THEID/107-227-----------------------------------------L.H--SA....KEVYE..Y.--.L....AHS..M...ID
G8PR76_PSEUV/154-274-----------------------------------------L.S--SW....SKVLE..Y.--.V....RAA..M...AH
D9R177_CLOSW/110-230-----------------------------------------F.C--RP....LDIVN..Y.--.F....VED..M...RH
I2BEI5_SHIBC/102-222-----------------------------------------L.T--SP....ETTRE..F.--.L....CAE..L...AG
H5WPE3_9BURK/51-171-----------------------------------------M.S--SP....EAVKD..Y.--.L....RVT..L...GV
H8MHI6_CORCM/115-235-----------------------------------------L.R--NP....KEVHA..Y.--.L....APT..L...GA
R7K7U4_9FIRM/102-222-----------------------------------------F.A--NR....GEAVR..Y.--.L....KTF..F.....
R6GGK3_9FIRM/110-230-----------------------------------------F.H--SP....DTIAA..Y.--.Y....MER..M...RH
F8EA06_FLESM/100-220-----------------------------------------V.D--SP....EKVYE..F.--.....LKYH..I...GY
E8RAS7_DESPD/108-229-----------------------------------------V.H--SS....REVAD..Y.--.L....IHS..M...RG
F6CJ84_DESK7/25-145-----------------------------------------I.T--GP....EDVAD..L.--.V....CDF..L...ED
T0U7K4_9ENTE/103-223-----------------------------------------V.H--SS....VDIAN..Q.--.M....MEE..L...KD
D6GSK0_FILAD/106-226-----------------------------------------I.D--SA....VSVAN..L.--.F....MEE..L...RY
Y2495_CYAA5/114-235-----------------------------------------I.D--SP....EAAVA..A.--.L....SHD..L...MW
V4IZ13_9DELT/108-227-----------------------------------------L.K--SS....HDVIN..Y.--.L....RHS..L...QG
C4XRP2_DESMR/107-227-----------------------------------------L.G--SP....DVVAE..M.--.A....RAR..I...GV
A3DJW5_CLOTH/99-218-----------------------------------------I.T--SA....CDILP..L.--.I.....SY..L...AN
Y2489_LEGPH/103-224-----------------------------------------L.S--NT....QQTYA..F.--.L....KKR..L...RD
H9UKS1_SPIAZ/105-224-----------------------------------------I.R--IP....QDALP..V.--.L.....SH..Y...AD
F9UQM7_LACPL/84-204-----------------------------------------V.Y--GS....EQLGA..V.--.....LARD..F...AN
B4S9N8_PROA2/46-164-----------------------------------------C.D--IA....YDFFC..K.--.I....G....L...QD
A9B8G6_HERA2/80-204-----------------------------------------I.T--TP....MQVVA..L.--.L....QAE..M...SH
H8XNJ9_FLAIG/20-143-----------------------------------------V.T--NS....QKIFE..V.--.I....MKH......WD
R5I5Z2_9PORP/111-231-----------------------------------------I.L--SS....RDVYD..L.--.F....YPQ..L...AD
D9S278_THEOJ/116-236-----------------------------------------I.S--SP....ADVKK..L.--.L....MEE..M...RF
E3PRL1_CLOSD/107-227-----------------------------------------I.S--SP....QDIGN..V.--.Y....MEE..L...RY
Q03YZ9_LEUMM/77-197-----------------------------------------A.K--YS....AEIGR..F.--.A....QQQ..I...GN
E0WTW2_9ENTR/60-180-----------------------------------------L.C--NP....KITRE..F.--.I....YNI..L...SH
A6GZB2_FLAPJ/110-230-----------------------------------------I.T--SS....KAVFE..I.--.M....QPI..I...GE
A4G2Z6_HERAR/53-173-----------------------------------------L.A--SP....QDVKD..Y.--.L....RLQ..L...IN
E6SKE0_THEM7/227-347-----------------------------------------V.R--CP....EDVGR..L.--.L....MAG..M...KD
Y3079_CHRVO/103-223-----------------------------------------L.S--SP....QQVRD..Y.--.L....RLS..I...GR
Y2739_METHJ/103-224-----------------------------------------I.T--EP....DHILK..IS--EV.....TD..L...SG
R5Q908_9CLOT/107-227-----------------------------------------I.S--RA....YDVYQ..L.--.L....TNE..M...RY
R7HGR0_9FIRM/120-240-----------------------------------------F.T--EP....EAIAA..Y.--.Y....MQD..L...RL
G8M5A7_9BURK/123-243-----------------------------------------L.N--SP....GAVED..Y.--.L....RLL..I...GT
Q11VY8_CYTH3/112-232-----------------------------------------V.K--SS....EDVYN..Y.--.M....QSN..L...AD
R5CX07_9FIRM/101-221-----------------------------------------L.N--SV....ERCGA..Y.--.F....MDL..L.....
V5XTZ7_ENTMU/25-145-----------------------------------------T.T--SS....YTIAT..W.--.L....QNE..I...GL
F4L1Z8_HALH1/113-233-----------------------------------------I.S--SS....KDAYL..A.--.L....APL..V...LD
J9ZCU4_LEPFM/110-230-----------------------------------------I.R--SA....RDVYD..I.--.L....GAR..L...RD
A5FBM2_FLAJ1/32-155-----------------------------------------I.T--SS....RDAYR..I.--.L....L.D..S...WD
H1XT56_9BACT/115-235-----------------------------------------F.R--EP....AKVAR..A.--.Y....QPI..L...GH
K0C7F6_ALCDB/103-223-----------------------------------------L.S--EP....EPAAR..M.--.F....MSE..L...RG
Y1763_STAA8/93-213-----------------------------------------I.T--QP....SDVAD..Y.--.M....IPT..M...KD
G0IV22_CYCMS/96-216-----------------------------------------I.N--CS....QDVYN..C.--.M....KPF..L...YD
F5XW39_RAMTT/108-228-----------------------------------------F.S--SP....GAVKH..Y.--.L....QLH..L...AH
B1HVC4_LYSSC/102-222-----------------------------------------I.R--SP....QDAAA..Y.--.L....MPD..M...TS
Y562_CLOBB/108-228-----------------------------------------I.M--SP....NDLAM..L.--.I....NGE..M...SL
X2H0Y8_9GAMM/101-221-----------------------------------------L.S--SP....SLTHH..Y.--.L....ASR..L...AN
R5NX86_9CLOT/108-228-----------------------------------------F.H--TP....DTIGA..Y.--.Y....REKCRF.....
V6EZR7_9PROT/115-235-----------------------------------------I.T--KW....DQLLD..Y.--.C....TIA..M...GR
A6LF44_PARD8/112-232-----------------------------------------I.R--SS....KDSYL..L.--.F....RTQ..L...CD
R5VKW4_9CLOT/96-216-----------------------------------------L.Q--TP....EDAAR..Y.--.F....MQE..M...RM
D4KF16_9FIRM/107-227-----------------------------------------I.K--RP....LDVVN..Y.--.V....MPR..L...RY
A4CJS6_ROBBH/121-241-----------------------------------------I.R--ES....ADAFR..M.--.L....QPV..L...AR
A1WDH8_ACISJ/43-163-----------------------------------------I.S--AP....ADASA..F.--.F....SLR..L...GN
Y1761_CHLPD/101-221-----------------------------------------V.L--SA....RDVFE..Y.--.M....AGR..V...PD
R7LA59_9BACT/110-232-----------------------------------------L.P--TI....SKLIK..F.--.F....RSK..I.....
I3YI41_ALIFI/82-202-----------------------------------------V.S--SS....DDVVR..L.--.F....RPQ..L...ET
Q2LSS5_SYNAS/185-305-----------------------------------------I.S--CT....GELLD..F.--.C....KTA..L...GG
Y1834_PSYA2/103-218-----------------------------------------L.G--RS....QMVKD..Y.--.I....STH..L.....
K0C5Y9_CYCSP/103-223-----------------------------------------L.N--TP....DDTKQ..F.--.L....KSK..L...AH
A4XJG8_CALS8/37-159-----------------------------------------L.K--NV....NSAVE..F.--.L....KKH..LLLHCE
L0KBI1_HALHC/106-226-----------------------------------------I.S--SP....AEVAE..I.--.L....IPN..L...RY
R5IST5_9CLOT/106-225-----------------------------------------L.T--TS....KAVYE..Y.--.F....KDLKDL.....
E6W163_DESIS/96-215-----------------------------------------V.R--SY....RDVIH..L.--.L.....EE..F...RH
E3DRU8_HALPG/25-148-----------------------------------------I.R--NL....ENVKD..V.--.F....IEV..L...DL
A9GNT0_SORC5/122-243-----------------------------------------V.R--TS....ASIAA..W.--.C....AAQ..L...GP
J0SBZ3_9EURY/113-232-----------------------------------------I.S--AP....TDVLP..L.--.V.....RH..L...AD
D4JZA0_9FIRM/106-226-----------------------------------------L.T--TT....ERLAA..Y.--.L....KPR..F.....
R6QJN9_9FIRM/111-231-----------------------------------------F.H--TP....KSIAD..Y.--.Y....MEK..M...RH
F2J502_POLGS/115-235-----------------------------------------L.S--SW....SKLND..Y.--.I....HAA..M...AY
H8KP10_SOLCM/113-233-----------------------------------------I.S--CS....KDAYT..I.--.I....NPY..L...AD
T2GBM1_DESGI/104-224-----------------------------------------L.S--HP....SVVAN..M.--.A....MSR..L...GA
R5QP40_9FIRM/101-221-----------------------------------------I.K--EP....QDGYE..Y.--.I....KHK..L...MF
V5XMX8_ENTMU/106-226-----------------------------------------V.H--AS....YELAK..E.--.L....ILE..L...KD
G0GBR5_SPITZ/98-217-----------------------------------------I.T--TP....EIAYQ..F.--.L.....RP..Y...AD
B0T9F0_CAUSK/102-222-----------------------------------------L.T--SF....SQVAD..Y.--.L....RAL..M...AG
K9Y7H2_HALP7/116-237-----------------------------------------I.D--SP....GAAAA..A.--.L....SQD..L...MW
D1AWS8_STRM9/90-210-----------------------------------------I.S--CF....EDLVK..Y.--.L....KFQ..Y...VD
R6CNC8_9BACE/108-228-----------------------------------------I.K--SS....QDIYE..V.--.F....HPV..M...CD
I0IIA0_PHYMF/129-253-----------------------------------------I.T--GT....ASAVN..F.--.CRRRFARL..A...AD
K4L506_9FIRM/106-226-----------------------------------------I.N--TP....SDAAD..L.--.V....MEE..M...RK
Y382_METBU/107-227-----------------------------------------I.R--SA....NDVYS..L.--.L....YPR..H...RE
C9LXS1_SELS3/107-227-----------------------------------------V.H--GP....ADAAS..Y.--.V....MPR..F...RF
B9E733_MACCJ/102-222-----------------------------------------V.K--SP....ACAAN..L.--.L....MER..L...RY
A5FYL9_ACICJ/134-254-----------------------------------------L.N--HW....DRLIE..Y.--.L....TAV..L...AR
Y2695_METPP/101-221-----------------------------------------F.D--SP....QAVKD..Y.--.L....QLQ..L...AS
Y2588_THIDA/103-223-----------------------------------------L.S--SP....AAVRD..Y.--.L....RLI..L...RD
C4K7F9_HAMD5/101-221-----------------------------------------M.L--NS....KITQK..F.--.L....QNL..L...SH
F5Z611_ALTSS/103-223-----------------------------------------F.N--NV....DDTKR..Y.--.L....QAK..L...RD
A5CF20_ORITB/105-225-----------------------------------------L.S--SW....SALLE..Y.--.L....KIT..M...GK
Y1917_THICR/103-224-----------------------------------------L.T--QP....EKVAR..L.--.L....QHH..I...GH
Q039T4_LACC3/99-219-----------------------------------------I.K--NS....EQLGK..T.--.....MISR..F...AG
A0R7V6_PELPD/48-167-----------------------------------------F.T--SP....KQVFE..L.--.F....KD...L...IY
Q3Z8Y4_DEHM1/101-221-----------------------------------------I.K--TP....EDVFQ..I.--.I....YPL..V...CD
C8WXL6_ALIAD/108-228-----------------------------------------I.R--TA....EDAAK..Y.--.V....MDR..L...RY
F2K091_MARM1/103-223-----------------------------------------F.H--NA....DHVKS..Y.--.L....SSQ..L...RH
R5A777_9CLOT/94-214-----------------------------------------V.Y--DT....NSAVD..L.--.F....RPK..F.....
R6KCE4_9BACE/24-146-----------------------------------------V.N--SS....RVSYD..I.--.F......K..E...AY
A3U7J3_CROAH/110-230-----------------------------------------I.T--SS....ASVFE..L.--.M....QPI..I...GD
A6QCM4_SULNB/99-218-----------------------------------------I.C--SA....GDVYD..E.--.L.....KQ..F...ST
H6LC26_ACEWD/114-234-----------------------------------------V.S--SP....SDVVD..L.--.L....MDE..M...QY
B8GJN0_METPE/105-224-----------------------------------------I.Q--RP....EDVLP..L.--.L.....PD..L...RE
A9KL05_CLOPH/110-230-----------------------------------------Y.T--DP....SSVAE..Y.--.Y....MQD..M...RS
Q1MS20_LAWIP/105-225-----------------------------------------L.C--TP....KIVAE..I.--.A....KAR..F...TG
W8UBM6_YEREN/101-221-----------------------------------------L.L--NA....DITQK..F.--.L....QNI..L...SH
G8TLK8_NIAKG/109-229-----------------------------------------V.K--SS....RDIAN..Y.--.L....QAL..L...RD
R5NQ10_9CLOT/104-224-----------------------------------------I.K--TP....KDVYE..L.--.L....MPE..Y...KL
E1RFR5_METP4/99-218-----------------------------------------I.E--KP....GDVLP..L.--.V.....DH..L...RS
R7D095_9BACE/109-229-----------------------------------------I.T--SS....KDIYA..Y.--.F....HPL..L...CD
K9ULX2_9CHRO/114-235-----------------------------------------I.E--SP....DTAAA..A.--.L....SQE..L...MW
R5E2F5_9FIRM/106-226-----------------------------------------I.I--DY....ENLGK..I.--.F....KAK..F.....
Y536_MOOTA/108-228-----------------------------------------I.R--NP....RDVAG..L.--.L....LDE..M...RY
Y1101_STRA5/104-224-----------------------------------------I.L--SS....EQLAR..K.--.M....MLE..L...GD
R7F9D7_9CLOT/108-231-----------------------------------------I.K--GS....EDVAT..L.--.F....MKE..L...KN
R6AS63_9FIRM/106-226-----------------------------------------F.S--TP....EKVSA..F.--.....FMER..L...RH
R5IXJ0_9FIRM/106-225-----------------------------------------L.N--TP....LKIFE..F.--.Y....KSK..I...ND
R5QX53_9PROT/110-230-----------------------------------------I.R--SP....DTLLE..Y.--.C....RTA..M...CH
B4F0W8_PROMH/102-222-----------------------------------------L.S--SS....AETKS..Y.--.L....QKR..L...NW
R5T7A8_9FIRM/106-226-----------------------------------------F.S--FP....EAVAS..Y.--.....FMEK..L...RH
D2QFB0_SPILD/110-230-----------------------------------------V.T--CS....RDAYN..E.--.M....IPH..L...ID
Y2144_CLOPE/106-226-----------------------------------------I.S--KP....SDVAK..L.--.V....LDE..L...RM
F6B8L9_DESCC/106-226-----------------------------------------I.R--CP....EDVAA..L.--.L....MED..L...RD
K0NJJ4_DESTT/106-226-----------------------------------------V.Q--NP....RDLME..Y.--.L....NQT..I...GH
R6VTN0_9BACT/109-229-----------------------------------------M.D--SA....NAIYR..E.--.M....HPR..M...QD
E8T627_THEA1/101-221-----------------------------------------I.T--SP....EEAFS..V.--.L....KPL..F...GH
Y1397_RHISN/142-262-----------------------------------------L.S--SW....SAVID..Y.--.C....HAA..M...AH
H6LJ70_ACEWD/104-224-----------------------------------------L.N--ST....TKAGK..Y.--.V....MSL..F...TG
Y523_GEOLS/109-229-----------------------------------------F.T--SP....AQVFD..F.--.F....HHE..L...RD
M9RE36_9RHOB/145-265-----------------------------------------I.S--SW....DAMLD..Y.--.C....HTV..M...AH
A4J365_DESRM/110-230-----------------------------------------I.R--CP....EDIFY..L.--.M....KNE..A...KL
K0CIP9_ALCDB/44-164-----------------------------------------L.S--DP....EEAVA..F.--.L....KLT..L...AQ
L0H3Z3_9GAMM/51-171-----------------------------------------L.T--SP....EATRS..Y.--.L....RLE..I...GE
X5DDS0_9BACT/110-230-----------------------------------------I.T--GS....KDAAE..Y.--.F....QPM..L...GD
Q5P8G7_AROAE/75-195-----------------------------------------L.D--AP....DVVKP..F.--.L....RTF..F...AG
F8L772_SIMNZ/104-230-----------------------------------------V.K--CP....KDAYY..L.--.IAPYLEDE........
Q2SPA2_HAHCH/25-145-----------------------------------------I.T--SP....ELAYD..F.--.L....KLK..L...AE
H1Y0F4_9SPHI/111-231-----------------------------------------I.G--SS....RDAYQ..L.--.F....YPL..L...AD
R6DC48_9FIRM/101-221-----------------------------------------L.N--SP....DRTGA..Y.--.F....MEL..L.....
I1YW52_PREI7/109-229-----------------------------------------L.N--SA....AAIYS..Y.--.M....RPK..L...QD
R5B0N0_9FIRM/102-222-----------------------------------------L.R--SS....EDAGN..Y.--.L....VPL..Y.....
R6CK30_9BACT/108-228-----------------------------------------L.G--SS....LAIYN..Y.--.M....LPK..M...QD
R6LX37_9CLOT/109-229-----------------------------------------C.D--NP....EKIAL..R.--.F....MHE..M...RF
C4ZA49_EUBR3/108-228-----------------------------------------M.N--NP....QTIAD..Y.--.....YMEQ..M...RH
V4JDL2_9GAMM/102-222-----------------------------------------L.G--TR....EDLIR..F.--.A....VDE..L...ST
E8SIR6_STAPH/105-225-----------------------------------------I.H--SP....SQIAE..R.--.Y....YAK..F...KD
R6T3Q7_9FIRM/33-153-----------------------------------------L.N--SS....ERAGA..Y.--.L....LER..F.....
Y1557_THEMA/102-221-----------------------------------------L.D--SS....VKVYK..Y.--.C....QE...M...VY
R6FKR1_9FIRM/30-152-----------------------------------------L.D--SP....TKIAE..F.--.L....NASVGL...NR
A3QCC9_SHELP/37-156-----------------------------------------F.C--NP....DATRD..F.--.L....RFK..L...HQ
Y2667_TRIEI/114-235-----------------------------------------V.E--SP....QAAAD..A.--.L....SQD..L...MW
Y4094_CROS8/109-229-----------------------------------------L.L--SP....TITRD..F.--.L....ESQ..L...AE
A2U3E5_9FLAO/107-227-----------------------------------------I.T--SS....KAVFN..L.--.M....QPI..I...GD
I6ZU37_MELRP/105-226-----------------------------------------I.V--SP....SDIAE..Y.--.M....IPM..L...RD
Y897_CALS4/109-229-----------------------------------------V.T--SP....EDVIN..L.--.L....MEE..M...RY
C8W5S1_DESAS/112-232-----------------------------------------I.K--SP....EDVAG..L.--.V....MED..M...RY
I0K5N5_9BACT/111-231-----------------------------------------I.T--CS....RDAYE..E.--.I....RPY..L...LD
F0P159_WEEVC/112-232-----------------------------------------I.T--CS....QDAYQ..L.--.L....QLQ..M...AD
M9WY89_MANHA/107-227-----------------------------------------I.Q--AP....YMAIM..Y.--.F....QTE..L...EE
B9ECC3_MACCJ/29-150-----------------------------------------V.K--SP....DNVAD..F.--.................
Y4033_VARPS/104-224-----------------------------------------F.D--SP....GTVKQ..Y.--.L....QLH..I...GS
K9S3X0_9CYAN/114-235-----------------------------------------I.E--SP....ADAAL..Y.--.L....SHD..L...MW
F6CP98_DESK7/110-230-----------------------------------------I.R--SP....EDAAR..L.--.V....MEE..M...RH
D3SDI2_THISK/122-241-----------------------------------------L.T--SP....TATRQ..F.--.L....AAR..L...RD
R7MCB3_9CLOT/101-222-----------------------------------------F.K--ST....NDMFN..Y.--.V....KGD..F...LN
R5BQ20_9BACE/105-225-----------------------------------------I.V--SS....RMIFD..I.--.M....SPR..M...KG
A8ZTW3_DESOH/103-222-----------------------------------------I.K--FP....ADVLP..L.--.I.....HH..Y...AD
D9QV39_ACEAZ/107-227-----------------------------------------I.T--SP....QDVAN..L.--.L....LAR..L...SF
R5FEV0_9BACT/140-262-----------------------------------------L.L--SP....GDIYD..Y.--.L....ARKTGM...TH
Y2615_BACSK/105-225-----------------------------------------I.S--SP....EDAAE..L.--.V....SED..M...RG
D3V735_XENBS/109-229-----------------------------------------M.S--SP....VATQN..Y.--.L....QDL..L...SW
D9S7T5_FIBSS/100-222-----------------------------------------V.A--VPEDVLSRVAYMKY.--.................
Y767_ROSS1/108-228-----------------------------------------I.R--SP....TDAAQ..L.--.M....QIE..M...SH
R5AYE4_9BACE/23-148-----------------------------------------I.Y--GA....KDIHQ..L.--.L....INR..V...FD
R7JCD2_9PORP/108-228-----------------------------------------I.T--CS....RDVYD..L.--.F....FPL..L...AD
R7IS48_9FIRM/109-229-----------------------------------------F.R--EP....QTVAS..Y.--.Y....MES..L...RH
F7XLN3_METZD/107-227-----------------------------------------I.Q--SP....LDVYS..L.--.F....YPK..M...RE
B8J197_DESDA/108-228-----------------------------------------L.A--TP....QAVAR..M.--.A....QSR..L...AG
R6E180_9FIRM/104-222-----------------------------------------I.H--HS....DDVAN..L.--.F....MKE..L...RH
W6S2Y9_9CLOT/105-225-----------------------------------------V.S--SA....IDCVN..I.--.I....NNE..M...CL
Y1465_STRT2/104-224-----------------------------------------I.M--SS....QQVAR..R.--.M....MLD..I...GD
B4EWQ7_PROMH/44-164-----------------------------------------I.E--QP....SSAFS..Y.--.L....QTL..M...HE
S5Y2D9_PARAH/43-162-----------------------------------------L.T--SW....QAVLD..Y.--.C....AIA..V....R
Q7UL21_RHOBA/197-319-----------------------------------------I.T--ST....TEATE..Y.--.CAQKFAYL..A...GD
R6E3R8_9BACE/26-150-----------------------------------------I.N--SS....QDAYE..L.--.L....I.K..C...FP
R5V4V4_9FIRM/25-145-----------------------------------------L.D--RV....SFMAT..H.--.L....QHL..Y.....
B8FHA4_DESAA/128-249-----------------------------------------V.S--SS....EELYN..L.--.L....NFQ..F...EN
M1FJ00_9ALTE/80-200-----------------------------------------L.K--SP....EDTRR..F.--.L....ASR..L...GT
R4K0Q2_CLOPA/23-144-----------------------------------------I.S--RV....PQSAE..L.--.V....RKV..I...GD
F5Y709_TREAZ/105-224-----------------------------------------I.K--TP....QDIYS..L.--.I.....RH..Y...AD
G0AJD2_COLFT/103-223-----------------------------------------F.D--AP....AAVKQ..Y.--.L....QLL..L...TN
C8VVH2_DESAS/106-226-----------------------------------------V.K--TP....DDAVN..Y.--.V....MEE..M...RY
E3EC59_PAEPS/78-198-----------------------------------------I.S--HP....RDVYN..L.--.L....EPE..F...RF
G8PCK3_PEDCP/110-220-----------------------------------------M.I--N..............--........R..F...QK
E7FJ82_9BURK/47-167-----------------------------------------F.T--SP....EAVKD..Y.--.L....RAK..L...AG
Q6D9M1_PECAS/16-136-----------------------------------------M.T--SP....EDVKA..Y.--.L....RFK..L...EH
V5SD55_9RHIZ/143-263-----------------------------------------L.S--SW....AQVLD..Y.--.L....RAA..Q...GF
B2A699_NATTJ/120-240-----------------------------------------I.T--SP....EDIFR..L.--.M....NFR..L...KT
U5MLE0_CLOSA/108-228-----------------------------------------V.T--SP....KDLAD..L.--.L....SGE..M...ND
R6E7I0_9BACE/124-244-----------------------------------------I.T--TS....KQVYE..L.--.M....API..L...KG
I2EWH8_EMTOG/106-226-----------------------------------------V.G--SS....SDAYE..A.--.I....RPY..L...MD
S6A4W6_9SPIO/102-222-----------------------------------------I.E--HP....SDVVP..L.--.L.....QH..Y...AG
R6N0B1_9CLOT/105-225-----------------------------------------I.K--QP....HDLAK..I.--.L....MSE..L...KF
A8GCN6_SERP5/39-159-----------------------------------------F.T--SP....DAVRH..W.--.L....CLQ..M...AG
E0SMR5_DICD3/82-202-----------------------------------------F.T--SA....SQTQA..Y.--.L....CAK..L...AG
A9NF52_ACHLI/94-214-----------------------------------------I.T--ES....SEVYH..L.--.L....KED..M...SY
E1V938_HALED/103-223-----------------------------------------L.T--SP....GLVRD..Y.--.L....TSR..L...RH
E1VH15_9GAMM/103-223-----------------------------------------F.T--SP....ERVGR..Y.--.L....QAQ..L...RS
F4C4D8_SPHS2/112-232-----------------------------------------I.E--SS....EDAYQ..V.--.L....QSV..Y...AD
B8ERG4_METSB/117-237-----------------------------------------M.S--SL....PAVID..Y.--.C....RTA..M...AF
R7PNW9_9FIRM/106-226-----------------------------------------F.N--SP....HKVAN..Y.--.....FMEM..L...RH
G4L6X4_TETHN/103-223-----------------------------------------V.V--TS....FDLAH..Q.--.L....MSE..M...KD
L7VSK5_CLOSH/104-224-----------------------------------------L.D--SS....SKAGE..Y.--.I....TKL..F...IG
D0J5R5_COMT2/109-229-----------------------------------------F.S--SP....EAVKH..Y.--.L....QLH..L...AA
L0EG89_THECK/108-228-----------------------------------------I.R--KP....EDAAK..L.--.V....MED..L...RS
C7NDB9_LEPBD/119-239-----------------------------------------I.T--SN....IKLLN..Y.--.L....KCS..L...LK
C0ZAK0_BREBN/111-231-----------------------------------------I.R--LP....RDVAD..L.--.M....SPE..L...AH
G0J386_CYCMS/30-153-----------------------------------------V.T--CS....DDVET..F.--......LRQ..I...WD
R5UB53_9FIRM/25-147-----------------------------------------L.S--SP....DQVVQ..F.--.M....RKE..L...SE
Q6D389_PECAS/36-156-----------------------------------------F.K--TS....EDTKS..W.--.L....LLE..L...SS
R6YDU6_9CLOT/106-225-----------------------------------------M.D--SP....DKIYE..Y.--.I....KGE..V...EG
R5IZM0_9FIRM/102-222-----------------------------------------L.D--TT....SKCGQ..Y.--.L....LPY..F.....
Q2GHA0_EHRCR/109-229-----------------------------------------I.N--QW....QKLIE..Y.--.L....RIK..I...GN
D4ZWK2_ARTPN/114-235-----------------------------------------I.D--SP....QAAAN..A.--.L....SHN..L...MW
J7J4Y9_DESMD/106-226-----------------------------------------V.N--SP....QDVAH..I.--.V....MEE..M...RY
R5T718_9CLOT/43-163-----------------------------------------F.R--ES....REAAE..M.--.V....RPI..F...EY
F4GMP0_PUSST/56-176-----------------------------------------M.G--NP....NAVKR..Y.--.F....QAK..L...SG
F3ZZK6_MAHA5/110-230-----------------------------------------I.K--TP....QDISA..L.--.L....MDQ..M...RY
G0J3F5_CYCMS/110-230-----------------------------------------I.T--SS....ADVYT..L.--.M....RPE..L...LD
R5XVB7_9FIRM/103-223-----------------------------------------L.G--NA....DDAEE..Y.--.F....MNL..L.....
R5AK34_9BACT/110-230-----------------------------------------I.T--GS....EDAYK..L.--.L....RDS..M...AL
E4TK19_CALNY/101-221-----------------------------------------I.K--SP....RDVYD..Y.--.....IKNS..I...GY
D8K312_DEHLB/128-248-----------------------------------------C.A--TP....QVVYD..Y.--.L....YSS..M.....
W0PBT4_9BURK/56-176-----------------------------------------F.N--AP....GRVKA..F.--.F....QAK..L...CG
C7LSH0_DESBD/105-225-----------------------------------------F.S--SP....DQVRD..M.--.V....CSR..L...GH
A6Q5Q5_NITSB/100-219-----------------------------------------V.I--SA....NDVYE..E.--.L.....KE..Y...FD
D3DGY6_HYDTT/104-223-----------------------------------------I.N--SP....EDVYN..L.--...........L.....
R6PCV1_9CLOT/111-231-----------------------------------------F.T--SP....STIAD..Y.--.Y....MED..L...RH
Q2G8R8_NOVAD/124-244-----------------------------------------L.S--NW....QALLD..Y.--.L....HID..M...AH
E3GG12_EUBLK/113-233-----------------------------------------I.G--SP....KDVAT..L.--.L....TDE..L...RY
R4K5S2_CLOPA/107-227-----------------------------------------I.S--KP....KDAAD..L.--.V....MRE..M...RS
A4G669_HERAR/45-165-----------------------------------------L.T--SP....GDVKE..H.--.L....RAL..L...QD
R6D5P6_9FIRM/108-220-----------------------------------------F.D--DL....NTLTD..Y.--.L....KALYSL.....
Y1241_CLOAB/108-228-----------------------------------------I.T--SP....KEAAN..L.--.V....MEQ..L...RS
D5MFK1_9BACT/111-231-----------------------------------------V.T--SS....KEVYE..W.--.L....RPQ..M...QG
C9A565_ENTCA/104-224-----------------------------------------V.N--SS....MAIAH..Q.--.L....IQE..L...KD
Q2SAN5_HAHCH/50-170-----------------------------------------M.D--DP....GKVKE..Y.--.L....MMH..L.....
R7HLG7_9FIRM/104-224-----------------------------------------L.T--SP....KTIIE..Y.--.F....NTE..Y...KN
I3ZYV8_ORNRL/116-236-----------------------------------------I.K--SS....QSAYE..Y.--.L....RHE..L...ED
A1ARB4_PELPD/47-165-----------------------------------------Y.S--SP....EQVFE..TF--NF.........L...RH
G4Q820_ACIIR/102-222-----------------------------------------I.R--CP....GDAAR..M.--.V....MER..L...RY
H5WPS0_9BURK/51-171-----------------------------------------M.S--SP....ADVKD..Y.--.L....RVQ..L...GA
X2HBM7_9NEIS/13-138-----------------------------------------I.E--GS....DDVFS..I.--.M....QRV..L.....
B9L1S0_THERP/136-256-----------------------------------------I.R--TP....EDVYA..I.--.A....GAE..M...AT
R5D4X0_9FIRM/102-222-----------------------------------------V.E--SA....EQLGR..Y.--.F....IAK..F.....
R6GSB3_9CLOT/107-227-----------------------------------------V.T--RP....SEIAE..L.--.L....MNE..M...NV
F4L5Q5_HALH1/21-159-----------------------------------------IER--KPVRDTEEIIE..FL--MA...............
I0DUI5_PROSM/100-220-----------------------------------------I.S--DP....NLLKM..R.--.L....VEL..F...SG
R7JSN1_9FIRM/109-229-----------------------------------------F.H--DP....ASIAD..Y.--.Y....MER..L...RH
F0S737_PSESL/113-233-----------------------------------------I.T--SS....FDVYK..L.--.L....SSH..F...FD
G0VQV0_MEGEL/108-228-----------------------------------------F.S--TP....QAIAG..Y.--.V....MED..L...RF
G2PRV3_MURRD/111-231-----------------------------------------I.Q--SS....HDAYE..L.--.L....YPL..I...GE
Y1642_SYNWW/110-234-----------------------------------------I.K--SP....EDVQE..A.--.VRELAMEE..M...RH
R5SQL1_9CLOT/95-216-----------------------------------------I.T--SP....SDAFN..F.--.V....HDS..Y...IG
Q2IG79_ANADE/113-235-----------------------------------------C.L--DP....RTVHE..L.--.L....RHA......AH
A0KH71_AERHH/55-175-----------------------------------------I.T--DK....HVAHQ..A.--.L....QGL..L...QT
K9RSV4_SYNP3/114-235-----------------------------------------I.S--EP....SQAAA..V.--.L....SQE..M...MW
X5A2F7_9BACL/108-228-----------------------------------------I.R--SP....HDAAD..I.--.L....TEQ..L...RY
Y766_SYNY3/114-235-----------------------------------------V.D--SP....EAAAI..A.--.L....SQD..L...MW
R5T4E8_9CLOT/4-124-----------------------------------------F.T--NP....EDIVN..Y.--.Y....VED..M...RH
G8X7Y5_FLACA/20-143-----------------------------------------L.T--TC....HEVYK..F.--.I....LSK......WD
C0QRE1_PERMH/109-228-----------------------------------------F.E--KP....SDVFK..H.--...........I.....
R6NRC8_9BACE/108-228-----------------------------------------V.R--CS....KDIYE..V.--.F....YPL..M...CD
E0SLL9_DICD3/111-231-----------------------------------------M.L--NP....EVTQQ..Y.--.L....QLL..L...AH
W0L5P7_9ENTR/38-157-----------------------------------------F.T--AT....SFAKS..W.--.V....QLQ..L...AR
R5QJC7_9FIRM/108-228-----------------------------------------F.R--NP....QVVAQ..A.--.Y....MER..L...RH
B6IWS5_RHOCS/138-258-----------------------------------------L.S--SW....QKLLD..Y.--.C....AGA..M...AN
B5YL92_THEYD/99-218-----------------------------------------I.K--NV....DDVLK....--.I....TEE..L...KD
Y1144_PEPD6/114-234-----------------------------------------I.M--NP....WDIQR..Y.--.Y....MDS..L...RY
R7API3_9CLOT/125-245-----------------------------------------F.T--AP....EAIAA..F.--.Y....MEE..M...RH
F7V2K9_CLOSS/27-148-----------------------------------------V.A--NP....DDAVR..L.--.M....AEM..L...KG
R6ZYQ7_9FIRM/106-226-----------------------------------------F.D--RP....STIAD..Y.--.Y....MEK..L...RH
R5LXQ1_9FIRM/106-226-----------------------------------------F.N--TS....KDAAD..Y.--.C....MEE..L...RH
Y4865_PHOLL/109-229-----------------------------------------M.S--SP....SVTQE..Y.--.L....QNL..L...SG
J7TDS0_MORMO/103-223-----------------------------------------L.S--SA....CTVKA..Y.--.....LNQR..M...AG
Y399_STRMK/103-224-----------------------------------------VGN--NP....AAVGR..Y.--.L....QHR..L...RG
A1K759_AZOSB/75-195-----------------------------------------L.D--SP....GVVRQ..F.--.L....RTF..F...EG
H8XSF2_FLAIG/106-226-----------------------------------------I.T--SS....KAVFE..I.--.M....QPI..I...GE
T2KIK0_9FLAO/111-231-----------------------------------------I.T--SS....ASVFE..I.--.M....QPI..L...GE
Y184_TERTT/103-223-----------------------------------------F.A--NS....QSVKD..F.--.L....NSQ..L...RH
A3DDG3_CLOTH/100-220-----------------------------------------L.N--SS....AKAGQ..Y.--.A....ISL..F...AG
K4KKQ5_SIMAS/103-223-----------------------------------------L.T--SP....AAVRH..Y.--.L....QSQ..L...RH
R6GVC1_9FIRM/105-225-----------------------------------------V.S--RL....SDAVN..V.--.L....RPY..F.....
R7L305_9CLOT/109-229-----------------------------------------I.T--CP....QDVAN..L.--.L....IDE..L...KN
I0IM21_LEPFC/90-210-----------------------------------------I.N--SA....EDAYR..I.--.F....SGQ..T...KD
R6BZG0_9FIRM/144-264-----------------------------------------F.K--DA....ASIAD..Y.--.F....MEE..M...RH
R5YBM9_9PROT/123-243-----------------------------------------L.S--NK....KLIVD..Y.--.C....RSC..I...GY
C6XNR3_HIRBI/151-271-----------------------------------------I.S--NW....GALLS..H.--.V....RIA..L...QH
H1YBW9_9SPHI/32-155-----------------------------------------V.G--HA....HDAYK..I.--.L....K.Q..C...WD
I0GTM6_SELRL/107-227-----------------------------------------I.H--GP....EDVAH..Y.--.A....MPR..Y...RF
L7W6C5_NONDD/111-231-----------------------------------------I.T--SS....NDAFR..I.--.M....QPI..L...GE
L0EJP0_THECK/103-222-----------------------------------------I.R--SP....EDVKS..L.--.L.....WD..L...QH
R5ZX42_9FIRM/102-222-----------------------------------------I.E--TA....EDVVT..W.--.F....EME..Y...GY
R6SQJ0_9BACE/104-224-----------------------------------------I.T--NA....SQIFS..I.--.M....FPV..L...KG
E8RHZ2_DESPD/37-156-----------------------------------------I.T--SP....LAARE..A.--.I....GLK..L...AG
Y2664_ALKEH/103-223-----------------------------------------L.T--SP....EQVAR..Y.--.L....TAR..L...RH
Y3522_CELJU/103-223-----------------------------------------L.S--SP....HLVRD..Y.--.L....RAQ..L...RH
B2VF83_ERWT9/102-222-----------------------------------------V.G--GV....QQMLD..Y.--.L....NSS..L...AH
Y1007_LACLA/104-224-----------------------------------------V.L--SS....REYGL..S.--.L....AFE..M...QN
W8TUM0_YEREN/36-156-----------------------------------------F.L--DT....SCTKS..W.--.L....QLH..L...GR
C4Z083_EUBE2/108-228-----------------------------------------F.S--NA....ETIAG..Y.--.Y....MED..M...RH
R7C9P8_9CLOT/111-231-----------------------------------------F.S--RP....EQLAA..Y.--.F....MDE..M...RN
R6TVR0_9CLOT/106-226-----------------------------------------Y.R--SM....KAVIA..Y.--.L....RDL..F.....
D4LC35_RUMC1/108-228-----------------------------------------L.N--TF....DATCA..Y.--.F....KDI..Y.....
A5G1T0_ACICJ/120-240-----------------------------------------L.N--NW....ERLID..H.--.L....TIA..M...AR
R6DBH8_9CLOT/111-231-----------------------------------------C.N--DP....AVVAG..Y.--.Y....MPS..M...RF
Q2N9N7_ERYLH/115-235-----------------------------------------L.G--SW....QALLD..Y.--.L....TVD..M...AH
C6X8W8_METGS/103-223-----------------------------------------M.N--SP....QQVRD..F.--.L....SLK..L...GG
Q5FKW2_LACAC/86-206-----------------------------------------L.T--SS....VELGT..Y.--.....LADK..L...AG
Y894_PORGI/105-226-----------------------------------------I.T--DS....RMAYR..T.--.I....SPF..L...TD
C0QZR3_BRAHW/99-223-----------------------------------------I.A--SPHIKKKDLIN..Y.--.L....IIK..L...GK
F8ENC4_RUNSL/113-233-----------------------------------------I.T--SS....QDGYE..Q.--.M....RPY..L...LD
R5PA02_9BACT/110-230-----------------------------------------M.G--SA....TAIYE..Y.--.M....HPK..M...QD
Y1907_LARHH/103-223-----------------------------------------L.T--SP....QAVHD..Y.--.L....RLA..Y...GM
R6FVI3_9FIRM/111-231-----------------------------------------F.S--SP....EYIAS..Y.--.Y....MEE..M...RH
E0RWC6_BUTPB/114-234-----------------------------------------C.N--NP....SDVAD..Y.--.F....MEK..L...RH
R5NEA8_9BACT/126-246-----------------------------------------I.R--SS....VDLYH..Y.--.F....LPQ..M...QD
Y1118_STRP1/104-224-----------------------------------------V.L--TS....VQVAE..K.--.M....MAA..L...GD
Q5QX21_IDILO/38-157-----------------------------------------P.Y--NP....NVIKD..F.--.L....TYK..L...AH
I3U468_ENTFC/106-226-----------------------------------------V.R--TS....YELAQ..Q.--.L....ILE..M...KD
F0P2W1_WEEVC/27-153-----------------------------------------VIV--SSHEDAATVFH..T.--.................
R5XQY2_9FIRM/110-230-----------------------------------------F.H--HP....DSIAS..Y.--.Y....MER..L...RH
H2IY88_RAHAC/105-225-----------------------------------------M.L--SP....AVIRE..Y.--.L....QNL..L...VF
R5JFK9_9FIRM/109-229-----------------------------------------F.D--SP....ATIAD..Y.--.....FMES..T...RY
F8JD62_HYPSM/132-252-----------------------------------------L.T--SW....SGVID..Y.--.L....RLA..Q...GF
D2UBD2_XANAP/103-223-----------------------------------------L.N--DP....SVVGR..Y.--.F....SQR..L...RA
R6QCX3_9FIRM/92-208-----------------------------------------L.N--CS....SEAIA..Y.--.C....SNL..F.....
F8I7U4_SULAT/98-216-----------------------------------------I.S--GP....EDAVR..L.--......LWD..M...QH
E4RUB9_LEAB4/104-224-----------------------------------------I.K--TA....QDAYE..H.--.F....KPY..L...SD
Q1LKU4_RALME/43-163-----------------------------------------L.L--DP....TAVRD..Y.--.L....RVK..L...VA
F4GVT8_PUSST/58-179-----------------------------------------L.N--VP....RLVKE..F.--.F....ALK..L...NH
U6B4R7_9RHIZ/114-234-----------------------------------------L.D--SW....PTLID..Y.--.C....KVT..L...AH
Y843_STRU0/104-224-----------------------------------------I.L--SS....YQVAK..R.--.M....MHE..L...GD
R6UQZ0_9FIRM/103-223-----------------------------------------I.H--HP....QDILE..W.--.V....NQQ..I...GF
D4JTU4_9FIRM/100-220-----------------------------------------L.G--AS....GAVKD..Y.--.C....MGLFRF.....
Y4685_BACAN/104-224-----------------------------------------I.R--SP....EDCAT..Y.--.M....MEE..M...RF
K4LDG8_THEPS/110-230-----------------------------------------I.R--SP....QEASN..L.--.V....MEE..M...CY
R6AN32_9BACT/106-226-----------------------------------------V.N--SA....NDIYA..Y.--.M....RPI..M...CD
R5MQN4_9FIRM/105-225-----------------------------------------F.N--SP....DIIFE..Y.--.F....KDK..F...SL
W0DSG3_9GAMM/31-152-----------------------------------------F.N--SP....ELSAE..L.--.F....KTR..L...VG
I0GI86_CALEA/39-161-----------------------------------------...--......RDGAQ..Y.--.VIAEFSPY..L...RD
Y1549_LISMO/103-223-----------------------------------------V.R--CP....EDAVK..L.--.V....MPE..L...AF
F5YK51_TREPZ/138-257-----------------------------------------I.K--HP....SDIFN..T.--.V.....RH..Y...AD
E1R3G0_SPISS/7-126-----------------------------------------I.N--NP....VDAYD..L.--.L.....SR..Y...AS
V5RS28_9BACT/102-222-----------------------------------------I.S--TP....GDAYD..Y.--.....IKPS..L...LG
R5J116_9BACE/110-230-----------------------------------------I.S--CS....KDIYE..L.--.F....HPL..M...CD
Q8DU89_STRMU/87-207-----------------------------------------I.L--SS....ERLAK..I.--.M....MSE..L...GD
X5HLC2_9RICK/36-156-----------------------------------------L.K--SW....KSVVD..Y.--.L....RIS..I...GN
Y852_LACSS/101-221-----------------------------------------V.A--SS....QMVGQ..R.--.....MIES..L...AG
R7NNV2_9BACE/108-228-----------------------------------------I.L--SS....CDVYQ..Y.--.F....YPL..M...CD
Y732_HAEDU/99-219-----------------------------------------I.N--TP....HLAIM..Y.--.F....QTE..L...EF
D5XBF5_THEPJ/110-230-----------------------------------------I.R--TP....EDVAG..I.--.L....MEK..M...RH
J9R8N2_RIEAN/104-224-----------------------------------------I.T--QS....TDIFE..M.--.L....SPH..L...SD
R6K0T4_9FIRM/110-230-----------------------------------------F.S--SP....SAIAE..Y.--.Y....MED..M...RH
R6T7W5_9STAP/100-221-----------------------------------------FYT--NP....QQVFD..A.--.F....YPKVHL.....
C6XXT7_PEDHD/28-151-----------------------------------------I.T--NA....SLAYK....--.LFLAQWSMDKI.....
G2SPW9_LACRR/102-222-----------------------------------------F.C--SS....SVVGK..Y.--.M....IDV..L...GD
F6AAS6_PSEF1/47-167-----------------------------------------F.T--SP....ELVKE..Y.--.L....ITK..L...AG
Y2338_SALRD/111-231-----------------------------------------V.T--CP....ADVAD..V.--.Y....GPL..L...RD
B2JE00_BURP8/121-241-----------------------------------------I.D--SP....EAVED..Y.--.L....RLL..I...GS
F7YN80_VIBA7/37-156-----------------------------------------L.T--NP....DATKE..Y.--.V....RCK..L...GS
K9T4N4_9CYAN/114-235-----------------------------------------I.D--SP....DAAAA..A.--.I....SLD..L...MW
M5DYQ5_9GAMM/107-227-----------------------------------------L.T--SP....EHTRQ..Y.--.L....QAQ..L...RD
R5TM68_9FIRM/108-228-----------------------------------------L.Q--SP....ESIAS..Y.--.F....MEK..M...RH
Q3A6E7_PELCD/47-165-----------------------------------------F.T--SP....RKVAE..M.--.L....AF...L...KA
R6DL41_9FIRM/108-228-----------------------------------------L.A--SS....ERLYD..F.--.I....RMK..Y.....
Q72CU0_DESVH/104-224-----------------------------------------L.C--TP....QSVAE..M.--.A....RMR..L...GN
H1YZL9_9EURY/99-218-----------------------------------------I.S--KP....HDVLP..L.--.V.....DY..L...KG
Y341_CARHZ/105-226-----------------------------------------F.L--NP....DDVYN..Y.--.L....RYK..I...GH
Y315_METFK/103-223-----------------------------------------L.T--SP....QAVRQ..Y.--.L....SLR..I...GA
B3EUD0_AMOA5/121-242-----------------------------------------I.T--SS....LEAYE..L.--.M....RME..L...SD
Y1766_ALKOO/111-231-----------------------------------------I.K--GP....DDVSN..L.--.L....MEE..M...RY
L0G6Z3_ECHVK/32-155-----------------------------------------I.T--SS....KEAYE..L.--.L....I.G..N...WD
R5H014_9FIRM/122-244-----------------------------------------F.P--DP....ATAAD..Y.--.CRPMFEED..G...GM
G2PPT1_MURRD/24-148-----------------------------------------I.T--GS....QAVAQ..L.--.L....F.K..N...WN
Y3033_CUPNH/103-228-----------------------------------------F.D--GP....AAVRN..Y.--.L....RLT..L...AP
R5HG36_9FIRM/102-222-----------------------------------------I.S--DS....ASLRT..L.--.F....LPY..F.....
Q6AQC9_DESPS/112-231-----------------------------------------L.H--SS....TEVVE..Y.--.L....SYR..M...RG
K4IG28_PSYTT/111-231-----------------------------------------I.S--TS....KDVFT..I.--.M....HPF..L...GD
D6Z510_DESAT/109-230-----------------------------------------L.R--SS....REVGD..Y.--.L....LHA..M...RG
R6Z0T4_9CLOT/109-229-----------------------------------------I.L--RP....KDIAE..I.--.L....MER..T...RF
E1VKM0_9GAMM/45-165-----------------------------------------LIE--SP....SAATR....--...........L.....
C4L4M1_EXISA/86-206-----------------------------------------I.R--SP....QDAYE..L.--.L....RDE..L...RL
R5MMG2_9FIRM/108-228-----------------------------------------L.D--SA....EAAGK..Y.--.F....MSR..F.....
R6I308_9FIRM/102-222-----------------------------------------I.R--RS....EDAGA..Y.--.F....VAK..F.....
G2T4X7_ROSHA/28-150-----------------------------------------F.N--KP....EEVAA..V.--.M....GEC..M...CQ
R6EGF0_9BACT/108-228-----------------------------------------L.T--SA....QDIYR..Y.--.M....LPK..M...QD
A1TJG0_ACIAC/46-166-----------------------------------------I.S--TP....RELYD..Y.--.L....RLK..L...AG
Y2289_ALKMQ/111-231-----------------------------------------I.K--SP....DDVSN..L.--.L....MEE..M...RY
Y386_GEOSL/108-228-----------------------------------------F.T--SP....EQVYN..H.--.Y....HYA..F...RD
E4TU46_MARTH/113-233-----------------------------------------I.V--AS....QDAFD..L.--.L....KSV..L...LD
R5VDA7_9FIRM/118-238-----------------------------------------M.N--CP....SSIAD..Y.--.Y....MEE..L...RH
R5Q2K3_9BACT/108-228-----------------------------------------L.D--SA....DAIYA..H.--.M....LTR..M...QD
D2QCL1_SPILD/31-154-----------------------------------------I.R--SS....ATAYE..I.--.L....L.A..S...WD
Q5NPS3_ZYMMO/106-226-----------------------------------------L.S--GW....QALID..Y.--.L....HAD..M...AF
W0HQQ2_9ENTR/38-158-----------------------------------------F.T--SS....HTVRN..W.--.L....RLQ..L...AT
F3YXV8_DESAF/104-224-----------------------------------------L.S--GP....EQVAA..L.--.A....KAR..L...GP
D7GW82_9FIRM/112-232-----------------------------------------F.D--AP....SKVAA..F.--.Y....MEE..M...RH
D4LHD9_9FIRM/110-230-----------------------------------------F.H--HP....VTIAK..Y.--.Y....MER..L...RH
D1C725_SPHTD/113-233-----------------------------------------V.Q--TP....EDIYA..V.--.A....GSD..M...GA
R5HTE9_9FIRM/108-228-----------------------------------------M.R--SA....ATVAE..Y.--.Y....MEQ..L...RH
E1R2L7_SPISS/105-227-----------------------------------------I.T--SP....ADVLP..L.--.V.....RH..L...AD
G2II48_9SPHN/114-234-----------------------------------------L.S--SW....QALLD..Y.--.L....RAD..M...AF
L0H8U8_METFS/97-216-----------------------------------------V.T--RP....DDILP..L.--.V.....AH..L...RD
B5EEJ0_GEOBB/110-230-----------------------------------------F.T--SA....SQVFE..H.--.L....NPE..F...RD
K0EI52_9NOCA/97-217-----------------------------------------L.T--AA....SDVAA..A.--.................
A4XRI0_PSEMY/44-164-----------------------------------------L.T--DP....HKVRE..H.--.L....QVL..L...QD
Y3149_BORPD/104-224-----------------------------------------M.S--EP....GSVKR..Y.--.F....KTA..L...AN
R5YL78_9FIRM/106-226-----------------------------------------F.S--RP....DTIAR..Y.--.Y....MES..M...RH
D9SS19_CLOC7/107-227-----------------------------------------I.T--CP....KDAAN..L.--.M....IKD..M...SL
W0DQ20_9GAMM/103-224-----------------------------------------M.N--AP....ELSAQ..Y.--.F....MQQ..I...GH
I0AHR8_IGNAJ/67-187-----------------------------------------I.T--SP....ADVAE..I.--.Y....IPL..L...KN
U5Q2Z8_9BACT/108-228-----------------------------------------I.Q--SS....SSAAG..L.--.I....SPI..L...RD
A2SPN1_METLZ/128-247-----------------------------------------I.H--KA....EDVLP..F.--...........VHQYRY
F7YY90_9THEM/95-214-----------------------------------------F.T--NP....ESIYQ..F.--.C....HD...M...RF
I3YWJ7_AEQSU/110-230-----------------------------------------I.T--SS....NSVFE..Y.--.V....QPI..I...GE
R6RLI6_9FIRM/29-152-----------------------------------------L.D--NP....KKCFD..F.--.I....NAVYDA...NH
B1H050_UNCTG/108-228-----------------------------------------L.S--SP....KNVKD..Y.--.L....IST..L...SG
V5WF60_9SPIO/104-223-----------------------------------------I.Q--SP....EDAWN..C.--.V.....RH..Y...GD
R4KH33_9FIRM/81-201-----------------------------------------I.K--SP....ENAAA..L.--.V....MEE..M...RH
E6WPR1_PSEUU/103-223-----------------------------------------L.T--DP....ATAGR..Y.--.F....ARR..L...RP
R6FKP8_9BACE/107-227-----------------------------------------I.R--CS....TDIYE..L.--.F....YPL..M...CD
C6Y249_PEDHD/111-231-----------------------------------------V.F--SS....KDAFE..A.--.L....IPV..F...AD
Y1765_PARUW/108-228-----------------------------------------I.E--HS....SHAYQ..L.--.V....KDE..L...EN
B4R7U6_PHEZH/122-242-----------------------------------------I.S--SW....SALLA..Y.--.V....KTA..L...AH
B5YIR9_THEYD/103-223-----------------------------------------F.N--SA....EIVYN..Y.--.F....FPK..L...NG
M4R7Z0_BIBTR/101-221-----------------------------------------I.T--DP....MLAVM..Y.--.S....QAE..L...EN
R5FKY9_9FIRM/100-220-----------------------------------------I.I--NT....ADAIK..Y.--.L....RCL..F.....
Y1264_STACT/103-223-----------------------------------------I.T--SP....QDAAD..Y.--.F....LSR..M...MH
F9VDS8_LACGL/104-224-----------------------------------------V.I--GS....RQFGL..S.--.L....ADE..M...SD
A9F436_SORC5/93-211-----------------------------------------L.T--DA....ARVAR..Y.--.................
A7I4E4_METB6/100-219-----------------------------------------I.R--TP....EDVLP..L.--.V.....GQ..Y...RD
Y1464_NITEU/103-223-----------------------------------------M.D--SP....QSVRN..Y.--.L....CLS..L...KG
Q2S840_HAHCH/2-122-----------------------------------------I.A--SP....RFAYD..Y.--.L....KLN..L...AE
D4Z4D1_SPHJU/158-274-----------------------------------------LGL--IP...........Y.--.F....EAR..M...AA
R5CR58_9BACT/109-229-----------------------------------------L.D--SA....AAIYE..F.--.M....HPK..M...QD
R6L424_9BACE/118-238-----------------------------------------I.H--SS....NDIYE..I.--.F....HPL..L...CD
R7JIG4_9BACT/92-212-----------------------------------------I.G--SS....NDVVR..I.--.F....RPL..L...TE
Q2GL92_ANAPZ/111-231-----------------------------------------L.D--KW....PKLID..Y.--.L....KVK..I...GN
G2PQ86_MURRD/24-148-----------------------------------------V.T--NS....AEVAQ..L.--.L....Y.Q..N...WD
R5I764_9FIRM/113-233-----------------------------------------F.N--DP....VTIAR..Y.--.Y....MEH..L...RH
A0M5B9_GRAFK/111-231-----------------------------------------I.T--SS....NSVFE..I.--.M....QPV..I...GE
R6HRP6_9PROT/116-236-----------------------------------------I.S--NW....DAMID..Y.--.C....RTA..I...GH
R5TI06_9CLOT/107-227-----------------------------------------I.K--NP....IDIIS..Y.--.F....NEL..L...KD
H2FY66_OCESG/103-223-----------------------------------------L.T--SP....DLTRA..F.--.L....QLR..L...RD
R7IE80_9FIRM/83-203-----------------------------------------L.E--SR....QVTLD..Y.--.C....RTM..M.....
R7FAU4_9FIRM/113-239-----------------------------------------..S--DVMDTLPKLCN..Y.--.................
Y4138_GEOUR/107-227-----------------------------------------F.T--SP....SQVFE..H.--.F....HHE..F...RD
W0LA12_9ENTR/29-149-----------------------------------------L.T--KP....DAVRS..Y.--.L....RLQ..L...ER
Q03EP2_PEDPA/108-218-----------------------------------------M.V--S..............--........R..F...QK
Q47ZW8_COLP3/38-157-----------------------------------------F.T--SS....QATKD..F.--.L....RFK..L...AN
B8I6Q0_CLOCE/108-228-----------------------------------------V.N--SP....GDVSN..L.--.M....MEE..M...RY
R7I149_9CLOT/109-229-----------------------------------------F.S--SP....DIISD..Y.--.Y....MQD..M...RH
C6X609_FLAB3/104-224-----------------------------------------I.T--CS....RDTYN..V.--.L....SPY..L...SD
D8PG85_9BACT/110-230-----------------------------------------I.S--SS....ADLFK..H.--.Y....HAR..L...RD
I4WGW7_9GAMM/102-222-----------------------------------------L.G--NP....RDSGD..Y.--.L....RAR..L...RH
A0LNF4_SYNFM/103-223-----------------------------------------F.N--ST....RGAVS..Y.--.L....SAL..L...CT
D0KW68_HALNC/103-222-----------------------------------------I.D--SP....EATRR..Y.--.L....QAQ..L...RD
F4HF54_GALAU/97-217-----------------------------------------F.N--NI....EFAKL..Y.--.M....QTE..L...SH
R6S5G1_9BACE/109-229-----------------------------------------V.R--CS....QDIFL..Y.--.F....HPL..M...CD
A4SZN2_POLSQ/114-234-----------------------------------------F.S--SP....GHVKE..Y.--.L....QSK..I...GR
A2SGD1_METPP/48-168-----------------------------------------M.S--SP....QAVKD..H.--.L....RLE..I...GM
Q1WT78_LACS1/112-222-----------------------------------------M.I--D..............--........K..I...GD
D7CL85_SYNLT/108-228-----------------------------------------I.R--SP....EDVKN..K.--.L....MEE..M...RY
A9HJP0_GLUDA/115-244-----------------------------------------LTR--TPMRDWDAVLA..Y.--.................
Y2618_GEOKA/105-225-----------------------------------------I.R--CP....EDGAK..Y.--.V....MED..M...RF
A7HYP6_PARL1/43-163-----------------------------------------L.D--RP....AAVRD..Y.--.L....RLK..L...VA
L0ESE5_LIBCB/113-233-----------------------------------------L.D--SW....SKVLD..Y.--.C....NAT..M...AH
M4U7F3_9GAMM/37-156-----------------------------------------F.T--DV....KTTKE..Y.--.L....TFK..L...AH
C0Q9Z9_DESAH/146-266-----------------------------------------L.K--NS....HDLCA..F.--.L....GHA..I...GH
B1YJT0_EXIS2/96-216-----------------------------------------V.R--SP....DDAAE..L.--.L....MEE..M...RL
F8GGA8_NITSI/103-223-----------------------------------------M.N--SP....ELVRD..F.--.L....RLS..L...AN
M4RZ11_9SPHN/113-233-----------------------------------------L.A--SW....QALLD..Y.--.L....RAD..M...AH
Y1235_BORPE/104-224-----------------------------------------L.A--NP....DLVRR..Y.--.C....QAA..L...GH
Q3IYM9_RHOS4/133-253-----------------------------------------L.T--SW....AALLD..Y.--.C....HTT..M...AH
A4YL64_BRASO/116-236-----------------------------------------L.A--SW....QEVIS..Y.--.C....RTS..M...AF
R5MTC5_9MOLU/104-222-----------------------------------------L.I--SS....KSVYD..C.--.....FKYL..F...IG
G8UKP0_TANFA/108-228-----------------------------------------I.R--SS....QDAFR..L.--.F....YPV..L...CD
YICR_SHIDS/101-221-----------------------------------------L.L--SP....EMTRE..F.--.L....QSQ..L...TG
G4KTG5_OSCVS/101-221-----------------------------------------L.N--ST....EKAGD..Y.--.L....LCR..F.....
D5EDV3_AMICL/99-222-----------------------------------------I.E--SERDEWRKTLS..Y.--.................
C7RDS9_ANAPD/107-227-----------------------------------------I.T--SS....KDVYD..I.--.M....SPR..L...SN
R5BYJ8_9FIRM/106-226-----------------------------------------F.T--RP....ETVAR..Y.--.Y....MER..F...RH
F8C480_THEGP/114-234-----------------------------------------L.R--SP....EEVYN..Y.--.L....KYE..M...QN
G0L606_ZOBGA/111-231-----------------------------------------I.S--SS....RDVFH..L.--.L....HPR..I...GE
G2TLY3_BACCO/106-226-----------------------------------------I.R--TP....QDGAN..Y.--.V....MND..M...RF
R7EY42_9BACI/103-223-----------------------------------------Y.T--NP....KDIFE..S.--.V....RYL..F...AG
L0H3Y4_9GAMM/46-165-----------------------------------------L.T--SP....VDSQE..F.--.L....AVR..L...AH
R6GG04_9CLOT/100-220-----------------------------------------R.L--KK....EQIEK..I.--.I....LNK..F.....
D4JA77_9FIRM/24-145-----------------------------------------M.N--NP....DVAIR..V.--.M....NEF..L...SQ
D7CPX9_SYNLT/43-165-----------------------------------------I.T--GP....DAVVS..L.--.VNE..HLN..L...EN
D3IDD4_9BACT/108-228-----------------------------------------L.S--SA....EAIYR..Y.--.A....HCI..I...GE
G8X752_FLACA/104-224-----------------------------------------I.T--SS....AQVYS..L.--.M....QPI..V...GE
E4T6J8_PALPW/112-232-----------------------------------------I.T--SS....LDLFD..L.--.F....EPQ..L...VD
F2F3X1_SOLSS/33-153-----------------------------------------V.R--SP....EDAAN..I.--.I....RDF..I...GD
C9R212_AGGAD/98-218-----------------------------------------F.T--ST....DIVKM..Y.--.L....QTE..L...AN
R6JKI4_9CLOT/110-230-----------------------------------------F.G--HP....EEISD..Y.--.Y....MED..M...RH
I0JPE2_HALH3/108-228-----------------------------------------I.R--SP....EDGAD..F.--.V....MEE..M...RD
R7R7R1_9FIRM/108-228-----------------------------------------F.H--RP....DTVAE..Y.--.Y....MER..L...RH
H1XUR5_9BACT/106-226-----------------------------------------T.Q--SR....EELIK..F.--.C....INK..L.....
K9SZY0_9SYNE/115-236-----------------------------------------I.T--DP....TIAVA..A.--.L....SAE..L...MW
W0I3D4_9ENTR/106-226-----------------------------------------M.T--SP....DMARR..Y.--.L....QQI..L...VC
Y1707_THEEB/118-239-----------------------------------------I.D--SP....ALAAA..V.--.L....AAD..L...MW
Y371_SYMTH/111-231-----------------------------------------L.C--NP....RAVFE..F.--.L....APR..M...AH
B8E079_DICTD/107-227-----------------------------------------I.L--NP....HDAFL..I.--.F....KED..M...FD
Y3003_CLOBH/107-227-----------------------------------------I.S--TP....LDVSN..L.--.V....MED..M...KY
E3F0B3_KETVY/131-251-----------------------------------------L.S--GW....DALLD..Y.--.C....HTV..M...AH
R5B616_9BACE/122-242-----------------------------------------V.R--GS....ADAYQ..Y.--.I....RPY..M...EH
I0HV36_RUBGI/104-224-----------------------------------------F.D--SP....DKVKD..Y.--.V....ALR..L...AG
C4LDH2_TOLAT/44-164-----------------------------------------I.E--RP....SSAFI..Y.--.L....QAL..M...GN
Y056_PSYIN/104-224-----------------------------------------L.T--SA....AQTKA..F.--.................
S6AXP4_PSERE/103-223-----------------------------------------L.E--SP....QAVRD..F.--.L....KAQ..L...RH
W0A9L5_9SPHN/53-173-----------------------------------------F.A--NF....DALLD..Y.--.L....QAD..M...GR
H6L397_SAPGL/118-239-----------------------------------------I.R--SS....AEAYR..L.--.A....APL..L...MD
A5FDW5_FLAJ1/32-155-----------------------------------------I.T--SS....RRAYE..L.--.A....L.Q..N...WD
Q28UH5_JANSC/152-272-----------------------------------------V.S--SW....DDLVA..Y.--.C....RTV..M...AH
D0MFA0_RHOM4/123-243-----------------------------------------V.R--TP....ADVAA..C.--.Y....GPL..L...RD
Y865_CLOK5/107-227-----------------------------------------I.C--SP....QDAAV..L.--.V....MEE..M...RG
D5QD62_KOMHA/104-224-----------------------------------------L.S--GH....GRIVD..Y.--.L....QAV..M.....
F4GI24_SPHCD/108-227-----------------------------------------I.Q--SP....PDVYP..L.--.I.....RH..Y...AD
R5J4N2_9FIRM/106-226-----------------------------------------I.K--NP....WDIYS..F.--.Y....MEE..M...RY
E4RMM6_HALHG/110-230-----------------------------------------V.S--NP....VQAAE..L.--.L....ASE..M...RF
K0N1Z4_DESTT/100-219-----------------------------------------I.N--TP....EDILP..H.--.I.....KH..Y...AD
Y240_IDILO/103-223-----------------------------------------F.T--EP....TMVKD..Y.--.L....TSQ..L...RH
A8HSP7_AZOC5/113-233-----------------------------------------L.S--SW....SAVLD..Y.--.C....RSA..M...AF
D6YWS9_WADCW/103-223-----------------------------------------V.Q--TP....EHAYA..Y.--.....VKDF..L...LQ
D1ANH5_SEBTE/106-226-----------------------------------------L.S--NN....KKLIQ..Y.--.L....KYN..L...GS
R5PKC0_9PORP/110-230-----------------------------------------L.C--SS....IEVFN..Y.--.I....SPV..L...KD
Y2933_BACLD/103-223-----------------------------------------I.R--FP....EDAAN..F.--.L....MGD..M...RF
Y1909_OCHA4/128-248-----------------------------------------L.G--SW....NKVIE..Y.--.C....TAA..M...AY
R5W419_9DELT/101-231-----------------------------------------...--.SLAGIASVIK..Y.--.................
R6FN60_9FIRM/104-224-----------------------------------------I.Q--DD....EDVAE..L.--.F....MEE..M...RR
R5WTV6_9BACT/101-221-----------------------------------------I.R--TK....DDVTA..L.--.F....APL..L...AR
X4Z9N8_9BORD/80-200-----------------------------------------M.N--HP....EEVKR..Y.--.C....RTA..L...SH
D8PG30_9BACT/100-219-----------------------------------------I.Q--TP....ADLLP..H.--.V.....RH..Y...AD
R7BSV8_9FIRM/106-226-----------------------------------------L.S--GR....GKARN..F.--.................
I1XEZ6_METNJ/103-223-----------------------------------------F.T--DA....ATTRL..Y.--.L....QRQ..L...RH
R7FUJ0_9FIRM/100-216-----------------------------------------L.S--SI....EDIGK..Y.--.L....VAR..Y.....
R6WD84_9FIRM/103-213-----------------------------------------F.H--NE....QELKK..F.--.................
R7L4R8_9FIRM/143-267-----------------------------------------..T--NS....DMLAE..L.--.F....KPM..F.....
I0GV74_SELRL/24-144-----------------------------------------I.N--SP....QTAVD..T.--.I....NDALNL...KD
Y236_NITOC/103-223-----------------------------------------L.T--DP....QTTQR..Y.--.L....VAR..L...RA
V5UGD1_9BURK/48-168-----------------------------------------F.T--SP....ATVKE..Y.--.L....RTK..L...AG
Y735_PROA2/101-221-----------------------------------------I.R--SA....RDVFD..Y.--.M....QGR..L...PD
R5KTK3_9FIRM/28-150-----------------------------------------I.S--NP....EVAVQ..V.--.I....GKY..L...CK
D4K5B3_9FIRM/105-225-----------------------------------------I.K--TT....EQMGS..Y.--.L....MAK..F.....
F0S368_DESTD/105-225-----------------------------------------I.T--SP....EDVVN..L.--.I....WPK..V...NN
R6AMD6_9CLOT/107-226-----------------------------------------L.K--NT....DDAMD..FC--SA.........L.....
A9C308_DELAS/43-163-----------------------------------------L.E--RP....AAVRD..Y.--.L....RLK..L...VA
Y086_PSESM/103-223-----------------------------------------L.E--NP....AQVRN..Y.--.L....KAQ..L...RH
E5AN07_BURRH/118-238-----------------------------------------L.D--HP....EIVED..Y.--.L....RLM..I...GT
I1YGQ5_METFJ/47-167-----------------------------------------F.T--SP....ALVKD..Y.--.L....RTK..L...AN
Y831_CHLPB/101-221-----------------------------------------V.R--SA....RDVFD..Y.--.M....YGR..V...PD
M1WKR1_DESPC/106-226-----------------------------------------L.S--DP....ADVAK..A.--.A....MAR..I...GN
R6ISZ4_9PROT/112-232-----------------------------------------I.S--DF....DAMVD..Y.--.C....RSA..M...AY
R6CTM9_9CLOT/108-228-----------------------------------------L.N--TS....AKAGS..Y.--.L....SAR..F.....
YKFG_ECOLI/37-157-----------------------------------------F.T--ST....HAVRE..W.--.L....RLH..M...AA
Y491_PSYWF/103-218-----------------------------------------L.N--RS....QVVKD..Y.--.I....TTQ..I.....
Y220_SYNP2/114-235-----------------------------------------V.D--SP....EAAAI..A.--.L....SND..L...MW
A0A068NWT8_9BACT/84-204-----------------------------------------I.D--SP....DDVFE....--.L....LSY..L...QG
R7K9V0_9FIRM/108-233-----------------------------------------V..--......DRLPQ..I.--.................
A5FDD8_FLAJ1/31-154-----------------------------------------V.T--SS....QYAYS..L.--.I....K.D..C...WD
R5GDH1_9BACT/107-227-----------------------------------------M.A--TS....RDIYN..Y.--.F....LPL..M...QD
Q0AUQ1_SYNWW/85-205-----------------------------------------I.K--GP....MDVSD..L.--.V....QAQ..M...RY
D9QPF6_BRESC/128-248-----------------------------------------I.S--SW....TALLA..Y.--.I....RLA..L...QH
R6XU52_9CLOT/109-229-----------------------------------------I.S--NT....KDVAE..L.--.V....MSE..L...RY
Y3603_CHLAA/106-226-----------------------------------------I.R--SP....ADVAT..L.--.L....LVE..M...SH
R6RDQ3_9CLOT/91-211-----------------------------------------I.I--TD....ENIGK..K.--.M....VHL..F.....
F4KLC9_PORAD/128-263-----------------------------------------L.R--TPITCSLDAYR..V.--.L....RRQ..L...ES
Y948_POLSJ/103-223-----------------------------------------F.S--TP....QAVRD..Y.--.L....QLQ..L...GG
R7DNC7_9PORP/105-225-----------------------------------------I.T--CS....RDVYD..L.--.M....YAS..M...VD
Y183_TOLAT/103-223-----------------------------------------L.T--SP....QLVRR..Y.--.L....QAQ..L...RD
Y909_FUSNN/111-231-----------------------------------------I.S--NK....DILLK..Y.--.L....RNK..I...GY
R6MZM4_9CLOT/103-225-----------------------------------------P.T--SM....EEVID..I.--.I....LSK..F.....
F3ZRZ4_9BACE/110-230-----------------------------------------Y.R--CS....TDIYQ..L.--.F....HPI..L...CD
U5NA38_9BURK/110-230-----------------------------------------L.S--DS....HAVER..Y.--.L....VPL..M...AG
Q6MR78_BDEBA/36-155-----------------------------------------V.S--TS....LQAYE..I.--.L....RNE..I....N
F5Z6Y4_ALTSS/43-163-----------------------------------------F.T--SP....GAVRD..Y.--.L....CLH..L...AE
D5BAB1_ZUNPS/24-148-----------------------------------------I.T--CS....QSAAD..L.--.A....Y.S..H...WN
D5EAP3_METMS/107-227-----------------------------------------I.R--SP....DDVYK..L.--.L....HPQ..L...RC
R5IJ61_9CLOT/110-230-----------------------------------------F.T--HP....EQIAD..Y.--.Y....MED..M...RH
Y3032_BACHD/108-228-----------------------------------------I.R--TP....EDVSR..F.--.V....MEE..M...RF
R5E933_9FIRM/36-158-----------------------------------------L.T--SP....EAVVR..A.--.L....ADE..M...SW
D4J877_9FIRM/113-233-----------------------------------------F.T--TP....QSIAD..Y.--.Y....MAY..M...CR
Y2643_PSEHT/103-223-----------------------------------------F.N--SP....NAVYD..Y.--.L....TLQ..M...RG
Q5QX33_IDILO/37-152-----------------------------------------F.T--EP....SMVKE..F.--.................
R7M883_9CLOT/104-224-----------------------------------------C.T--NA....LSIYK..Y.--.F....NSM..F...KD
R6BBF6_9CLOT/102-222-----------------------------------------L.N--NS....TLIFD..T.--.F....KDL..F...IN
H2J3A1_MARPK/96-216-----------------------------------------L.D--SP....DKVYD..L.--.I....YDR..F...IF
G0A564_METMM/37-156-----------------------------------------I.T--EP....AKAAD..Y.--.L....KLQ..L...AQ
R5KL45_9CLOT/110-230-----------------------------------------F.G--NP....QSIAD..Y.--.....FMER..T...KY
U5RWB8_9CLOT/107-227-----------------------------------------I.C--NP....GDAAM..L.--.V....MEE..M...KG
R5BFG9_9FIRM/111-231-----------------------------------------F.S--SP....KAVAS..Y.--.I....MER..L...RY
E6XD68_CELAD/111-231-----------------------------------------I.T--SS....KSVFE..L.--.L....QPK..M...GD
R6U2T9_9CLOT/91-212-----------------------------------------V.N--SP....RDIFE..V.--.L....HKS..F...IG
Y1530_RUBXD/107-226-----------------------------------------I.S--SP....ADVDG..L.--.L....RGR..I...AN
E3HWS2_ACHXA/104-224-----------------------------------------L.A--HP....LQVKE..Y.--.C....KMA..L...GH
Y1467_DESAP/109-229-----------------------------------------V.R--TP....EEAAG..L.--.V....MEE..M...RY
S0EYD6_CHTCT/109-229-----------------------------------------I.T--CP....RDVAN..L.--.L....MPE..L...RY
B8CX04_HALOH/119-239-----------------------------------------I.V--QP....LDVYN..L.--.F....CEL........
G8AJ12_AZOBR/138-258-----------------------------------------L.A--NW....QSLLD..Y.--.C....TAA..M...AH
Q5E054_VIBF1/37-156-----------------------------------------F.S--NP....TATQN..Y.--.L....RYK..L...GH
A4XMN4_CALS8/40-162-----------------------------------------L.A--NV....RLAVD..F.--.L....KKH..LKLHLE
B0T9R6_CAUSK/132-252-----------------------------------------V.S--SW....TALID..Y.--.L....KLT..M...AH
G2PLV8_MURRD/13-138-----------------------------------------V.L--NS....ADIYA..I.--.M....QQV..L.....
S6CEQ7_9GAMM/103-223-----------------------------------------I.D--AP....EKCVD..Y.--.L....QAR..L...GD
C7R7U8_KANKD/103-223-----------------------------------------F.S--NP....NDVKL..Y.--.....LKSL..L...SH
F9D3V0_PREDD/107-227-----------------------------------------I.G--SA....TAVYN..F.--.M....HPI..L...QD
Q93MC6_CLOPE/24-144-----------------------------------------I.K--KP....EQVFE..V.--.V....KNF..L...GE
C5AC38_BURGB/145-265-----------------------------------------V.D--SP....GAVED..Y.--.L....RLT..I...GT
R7A5M2_9FIRM/97-217-----------------------------------------I.K--NS....QDVIQ..W.--.F....KVE..Y...GY
A6L552_BACV8/29-152-----------------------------------------I.Y--SS....EDAYK..Y.--.L....L.P..T...YK
F2IKK1_FLUTR/109-229-----------------------------------------I.D--SV....QKAYE..E.--.L....KGY..F...TD
A3HWS3_9BACT/110-230-----------------------------------------I.T--SS....QDVYN..L.--.M....KAE..L...AD
K7I0N5_CAEJA/44-164-----------------------------------------F.T--DP....KLVRG..Y.--.....LSLK..L...RG
R6SSK7_9FIRM/109-229-----------------------------------------F.E--NP....DSIAR..Y.--.Y....MED..L...RH
A5CZE2_PELTS/18-139-----------------------------------------I.S--SP....DDAAG..F.--.V....RDF..I...ED
F0R980_BACSH/22-145-----------------------------------------I.R--SS....IDAAS..F.--......AKQ..I...YG
Y1687_CLONN/107-227-----------------------------------------I.K--SP....GDVAG..L.--.V....MEE..M...KY
Y202_PHOPR/103-223-----------------------------------------L.T--SP....QHTRH..Y.--.L....SQL..L...RD
A1B298_PARDP/42-161-----------------------------------------L.T--SW....QAVLD..Y.--.C....ALT..I....R
D5BRL2_PUNMI/126-246-----------------------------------------L.T--NW....VQVQE..Y.--.C....INR..L...AH
Q31NW2_SYNE7/115-236-----------------------------------------I.T--SP....EAAAK..A.--.L....SAD..L...MW
E3I6Z7_RHOVT/132-252-----------------------------------------F.A--AM....STVLD..Y.--.L....RSA..M...AF
A5FDP1_FLAJ1/30-153-----------------------------------------I.K--SS....KDAYL..L.--.L....K.S..S...WD
F3Y852_MELPT/109-229-----------------------------------------I.S--SS....HQIAQ..V.--.L....IHE..L...RG
C4L9T8_TOLAT/47-167-----------------------------------------L.K--KP....NDACD..F.--.L....RLM..L...VG
F5YI93_TREPZ/17-136-----------------------------------------I.K--NP....DDMYK..L.--.V.....KR..Y...AQ
R6SU20_9CLOT/112-232-----------------------------------------F.D--HP....AVIAD..Y.--.F....MEE..M...RH
R7KF20_9CLOT/103-223-----------------------------------------L.V--TA....EDVFS..Y.--.S....KYL..F...YG
K9TJT1_9CYAN/114-235-----------------------------------------I.D--SP....EAAAA..A.--.L....SHE..L...MW
Q2JK53_SYNJB/110-231-----------------------------------------I.E--SP....EQAAM..A.--.L....SGD..L...MW
C6VSA9_DYAFD/113-233-----------------------------------------I.N--GS....QPVYE..A.--.M....RPY..L...MD
D5EV64_PRER2/108-228-----------------------------------------L.G--TA....TRIYN..H.--.M....HPV..M...QD
R7IUZ4_9CLOT/110-230-----------------------------------------I.N--KS....SDVVD..I.--.L....FEE..M...RF
Y1152_PASMU/103-223-----------------------------------------F.K--NS....ENVRF..Y.--.L....QAT..L...EN
Q74B73_GEOSL/43-162-----------------------------------------F.T--KP....EQVYE..M.--.F....RD...L...RR
F4B2W6_DOKS4/116-236-----------------------------------------I.S--SS....KDAYQ..I.--.L....QPI..I...GE
D5X1M3_THIK1/105-225-----------------------------------------L.D--SP....AAVRD..Y.--.L....RLW..L...GP
A8ZUS2_DESOH/107-227-----------------------------------------L.A--NS....TDLLN..Y.--.L....NHT..L...RD
G7Z8F8_AZOL4/173-294-----------------------------------------L.A--SW....QALID..Y.--.C....SAA..M...SH
Y2304_PARDP/142-262-----------------------------------------L.T--SW....DALLD..Y.--.C....HTA..M...AH
R7NPE7_9FIRM/105-225-----------------------------------------I.I--DL....EHLGD..Y.--.F....LPK..Y.....
W8WVA9_CASDE/104-224-----------------------------------------L.S--QP....EQVKR..F.--.C....ALR..L...AH
U5QKW2_9CYAN/112-233-----------------------------------------V.D--SP....QAVAA..V.--.L....RAE..M...AF
R6YXM2_9FIRM/28-151-----------------------------------------I.N--EP....QDAIR..A.--.M....KNL..L.....
A5EYF9_DICNV/277-401-----------------------------------------F.S--SA....DDVRN..F.--.................
Q8A1G6_BACTN/110-230-----------------------------------------I.S--CS....RDIYD..I.--.F....QPV..M...CD
C5D8D2_GEOSW/48-168-----------------------------------------I.K--SP....EDAYK..L.--.L....KPF..L...VE
Q162D1_ROSDO/179-299-----------------------------------------L.S--SW....DDLIE..Y.--.C....RTT..M...AH
R5X7H1_9CLOT/114-234-----------------------------------------I.K--VP....WDIYK..Y.--.Y....MEE..L...RY
Y182_VIBTL/103-223-----------------------------------------L.T--SP....SHTKL..Y.--.L....SSI..L...RD
A8ZYJ4_DESOH/29-149-----------------------------------------I.S--SA....QEVYN..I.--.M....KPV..F...AE
E6WAK0_PANSA/97-217-----------------------------------------M.E--NP....QVTRH..Y.--.L....QSV..L...AH
Y4248_SHEON/103-223-----------------------------------------L.T--NP....DLTRD..Y.--.L....MRQ..L...AD
A1VUW6_POLNA/47-167-----------------------------------------L.T--SP....QAVRD..F.--.L....RVK..L...GG
R6UEU9_9CLOT/103-223-----------------------------------------I.I--DI....DNIGE..K.--.I....KHK..F.....
A9B2B0_HERA2/108-228-----------------------------------------I.T--SP....ADVVG..L.--.L....QVE..M...SH
F2JQE5_CELLD/113-233-----------------------------------------I.T--SP....AILSC..Y.--.F....MEE..L...RH
R6BBW9_9CLOT/86-206-----------------------------------------L.N--SS....LKAGE..Y.--.L....CSL..L.....
R6PK66_9FIRM/110-230-----------------------------------------F.R--HP....ASIAD..Y.--.Y....MEQ..L...RH
A3CRJ6_METMJ/103-222-----------------------------------------I.A--RP....EDVLP..L.--.V.....TE..W...RD
F5WTJ4_ERYRF/99-224-----------------------------------------L.S--SC....DRIVR..W.--.L....NLE..I...GF
A6LJI8_THEM4/94-212-----------------------------------------L.N--SP....ELIYE..F.--.C....KDMKQF.....
D6XT27_BACIE/107-227-----------------------------------------I.R--SP....KDASD..F.--.V....MED..M...RT
Q3JDF2_NITOC/50-170-----------------------------------------L.P--SP....NHTRD..F.--.L....RML..L...AE
I5B471_9DELT/107-227-----------------------------------------V.S--NP....ESLIA..Y.--.L....NQT..I...GY
C1A4H3_GEMAT/123-243-----------------------------------------L.R--GP....RDVAA..A.--.F....APR..L...QD
F0S7A0_PSESL/28-151-----------------------------------------V.Y--DA....KSAYE..V.--.L....L.K..S...WD
D8J1T0_HERSS/103-223-----------------------------------------L.N--ST....RAVGD..Y.--.L....KLM..L...AH
Y126_VIBF1/103-223-----------------------------------------L.T--SP....EHTKR..Y.--.L....TRM..L...RD
S6B1P0_9PROT/103-223-----------------------------------------L.S--SP....QAVRD..Y.--.L....RLR..L...QG
R7CMI7_9FIRM/113-233-----------------------------------------M.N--KP....SSIAA..Y.--.Y....MEE..L...RH
R7EZ53_9BACT/126-247-----------------------------------------I.A--CS....EDAYK..I.--.................
R6H769_9CLOT/110-230-----------------------------------------I.K--ST....EQLAS..L.--.V....MQD..L...RY
C4ZN65_THASP/43-163-----------------------------------------L.G--SP....AAVRD..Y.--.L....RLK..L...VA
B0TBY8_HELMI/102-222-----------------------------------------I.R--SP....EDASR..L.--.V....MED..M...RF
R5ETG6_9FIRM/102-222-----------------------------------------L.P--TV....QACGE..Y.--.L....VPF..F.....
R6YP13_9BACT/108-228-----------------------------------------L.G--SS....IAIYN..Y.--.M....LPR..M...QD
R7GFK2_9CLOT/110-230-----------------------------------------I.K--SP....ADIAK..I.--.L....MNE..L...RY
R7K2K0_9CLOT/122-242-----------------------------------------C.N--EP....EQVAA..Y.--.Y....IQQ..M...RF
K8GK29_9CYAN/114-235-----------------------------------------I.D--DP....AIAAA..A.--.L....SHD..L...MW
C6D864_PAESJ/107-227-----------------------------------------V.R--KP....QDAAN..Y.--.V....MEE..M...RY
C7PSZ0_CHIPD/115-235-----------------------------------------I.R--QG....RDAAL..Y.--.F....KPL..L...GD
Q7UT53_RHOBA/84-208-----------------------------------------L.T--ST....HKAVA..F.--.CRSHFSRL..I...AE
R5R0P5_9FIRM/102-222-----------------------------------------I.K--EP....RDGYE..L.--.L....KNQ..L...MF
W0PC12_9BURK/120-240-----------------------------------------L.D--RP....TVVRD..F.--.C....ISL..L...SH
G8QTS4_SPHPG/107-230-----------------------------------------I.S--QP....GDIYP..L.--.I.....RH..Y...AD
D2RM81_ACIFV/99-219-----------------------------------------I.H--CP....EDGAM..L.--.V....MPR..L...RY
R5G402_9PORP/125-250-----------------------------------------L.T--NS....QMIYD..Y.--.................
E1QKP1_DESB2/107-226-----------------------------------------L.A--A.....EQAAE..Y.--.L....RMG..M.....
G8QP73_AZOSU/103-224-----------------------------------------F.N--SP....GAVRD..Y.--.L....RAR..L...GG
A8MGD7_ALKOO/26-153-----------------------------------------V.Y--SA....DEAGP..I.--.................
R7BLV7_9FIRM/108-228-----------------------------------------L.C--SA....QAVVD..Y.--.L....MED..M...RH
D3HM28_LEGLN/60-181-----------------------------------------I.T--NS....KQTYV..Y.--.L....KKR..L...RD
Q1DAY3_MYXXD/102-222-----------------------------------------L.R--TP....KEIAA..Y.--.L....APV..L...GA
I5AQT4_EUBCE/111-231-----------------------------------------F.S--AP....SGVAE..Y.--.Y....VES..L...RY
R5VMV8_9FIRM/105-225-----------------------------------------M.I--NS....KTIYE..L.--.....FKYK..F...VG
Q2IEL9_ANADE/82-203-----------------------------------------C.L--DP....GRVYE..L.--.M....RPL......AH
A7HWC4_PARL1/109-229-----------------------------------------L.G--SW....AALLD..Y.--.C....SAS..M...AH
R6B608_9CLOT/107-227-----------------------------------------I.R--SS....ASVAN..L.--.L....MNE..M...KY
D5V5W3_ARCNC/100-219-----------------------------------------I.N--FA....SDVYE..E.--.L.....KP..Y...KN
R6XJC6_9FIRM/100-221-----------------------------------------FYT--SP....EAVFE..Y.--.F....YPKLRL.....
E0TDI4_PARBH/124-244-----------------------------------------L.S--SW....DKLLA..Y.--.V....RAQ..I...AY
Y1513_CHLCH/101-221-----------------------------------------I.M--AA....GDVFE..Y.--.M....SGR..I...PD
K0C1Z8_CYCSP/42-162-----------------------------------------F.S--SP....HEVRD..Y.--.L....RLQ..L...AG
A9BIK5_PETMO/99-218-----------------------------------------V.T--SP....EEAYH..V.--.C....ED...M...IY
R6XQD6_9BACT/105-225-----------------------------------------L.T--DA....EIVYR..M.--.M....LPR..L...KG
R6IAE0_9FIRM/101-226-----------------------------------------Y.D--GP....ESVKE..L.--.................
R7G579_9FIRM/103-223-----------------------------------------I.S--SP....QKLSE..W.--.L....MQQ..I...GF
Q0AQV1_MARMM/105-225-----------------------------------------I.T--SW....SALVA..Y.--.C....RTA..M...QH
G4RE53_PELHB/106-226-----------------------------------------L.G--SW....AEVID..Y.--.C....KAS..M...SY
K6ZUW9_9ALTE/103-223-----------------------------------------F.N--SV....EQTQA..Y.--.L....IAK..L...RD
R6NN99_9CLOT/107-230-----------------------------------------L.A--EP....EDVMK..Y.--.................
G2KSU9_MICAA/115-235-----------------------------------------L.N--SW....SRLMD..Y.--.L....AAS..M...AH
F2NFN8_DESAR/112-229-----------------------------------------L.P--V.......LID..Y.--.C....RTS..M...GG
R7LJJ8_9BACT/104-224-----------------------------------------F.S--SS....KHIYD..Y.--.F....KTK..V...SD
Y1229_STRGC/104-224-----------------------------------------I.L--SS....QKLAK..K.--.M....QQE..L...SH
Q7VMM9_HAEDU/36-156-----------------------------------------F.G--DE....KEASE..Y.--.C....QMQ..L...GF
R6X5H3_9PORP/105-225-----------------------------------------I.H--SS....SDVYR..I.--.F....YPL..L...CD
C0QCU0_DESAH/53-178-----------------------------------------L.S--GP....KQAQK..I.--.M....KSL..IEMQGQ
R6YU81_9BACE/108-228-----------------------------------------I.R--CS....KDIYA..F.--.F....HPL..M...CD
R7MKG1_9FIRM/104-227-----------------------------------------L.N--SS....EKIKN..Y.--.F....SDY..FKSCTN
A4XHM1_CALS8/104-224-----------------------------------------L.K--NV....EVAAE..Y.--.I....KSL..F...VG
Y054_RUEPO/103-223-----------------------------------------I.S--SW....DALLD..Y.--.C....HTT..M...AH
E6UJ92_RUMA7/101-229-----------------------------------------V.S--VHADDFDSLSR..Y.--.................
F0SVI5_SYNGF/109-229-----------------------------------------V.S--SP....GDASA..L.--.V....MEE..M...RF
Q7MJB1_VIBVY/64-183-----------------------------------------F.T--RT....QNTAD..Y.--.L....RCK..L...AG
R7GDT2_9CLOT/106-227-----------------------------------------F.D--SV....K......I.--.C....YPR..L...AH
Q5DY97_VIBF1/44-164-----------------------------------------L.T--SP....DLAAE..L.--.C....VNR..L...VH
D4H3V4_DENA2/100-220-----------------------------------------I.D--KP....EKAAQ..F.--.....LKYK..I...AY
R7J2I5_9BACT/122-242-----------------------------------------I.C--TS....ELAFR..K.--.M....APV..F...LG
R5NLB5_9FIRM/119-239-----------------------------------------F.I--SP....EIIAN..Y.--.Y....MED..L...RH
R6LL38_9FIRM/102-222-----------------------------------------L.D--TT....YKCAQ..Y.--.L....APR..F.....
W0BCD9_9GAMM/103-224-----------------------------------------L.T--DS....YQTYA..F.--.L....KRC..L...RD
E3H613_ILYPC/104-224-----------------------------------------I.S--GT....RDLLA..F.--.L....RND..I...GF
F9ZRH5_ACICS/103-223-----------------------------------------L.D--SP....RRVAE..Y.--.L....RLI..L...RD
R5Y3P6_9BACE/122-242-----------------------------------------I.T--TS....RDAYE..W.--.I....YPQ..L...AD
Q2S8K4_HAHCH/83-204-----------------------------------------F.C--DP....DATKY..Y.--.L....VLQ..L...AE
F0RUU5_SPHGB/107-226-----------------------------------------I.S--TP....SEIYP..L.--.I.....QH..Y...AS
Y009_HISS2/101-221-----------------------------------------F.T--SP....DTVRM..Y.--.L....QTE..L...EN
D3SNH3_THEAH/104-223-----------------------------------------I.S--SP....EDVYQ..F.--...........V.....
R5S153_9FIRM/102-222-----------------------------------------F.N--TR....ENIGA..Y.--.F....IEL..F.....
A1AQ75_PELPD/46-165-----------------------------------------F.T--SP....LQVFE..M.--.F....RD...L...VI
B2KEG6_ELUMP/107-227-----------------------------------------I.R--TP....EDVAN..Y.--.C....RAS..L...AE
R5QF23_9FIRM/100-221-----------------------------------------L.K--TK....EDIGA..Y.--.L....AAR..Y.....
Y3582_PELPD/108-228-----------------------------------------F.T--SP....RQVFD..Y.--.F....HYE..L...RD
R7GKY6_9FIRM/100-221-----------------------------------------IYD--NP....AKVFY..H.--.L....ENK..M...SH
J7QP12_METSZ/120-240-----------------------------------------L.S--SF....MEVLD..Y.--.C....RTA..M...AF
R6GHR2_9FIRM/104-224-----------------------------------------F.E--TP....ELISN..Y.--.Y....MER..L...RH
W8T6D1_EUBAC/120-240-----------------------------------------I.T--HP....EDISR..I.--.Y....MEE..M...RY
B8DJE6_DESVM/104-224-----------------------------------------L.G--SP....QAVAE..M.--.A....RMR..L...AA
I0DVS5_PROSM/39-159-----------------------------------------F.T--ST....QNVRD..W.--.L....RLK..M...SA
A0L491_MAGMM/114-234-----------------------------------------L.N--RA....DNVRD..Y.--.L....VPL..M...AG
Y952_HAEIN/100-220-----------------------------------------I.N--DP....ETVKL..F.--.L....LTE..L...QH

PF15659

E4RXN7_LEAB4/136-223-----------------------------------------GTT--TNATDARNLYN--F--------------------
R7IZD2_9BACT/1-90-----------------------------------------MKV--EGDENGRIIHE--F--------------------
Q89ZT9_BACTN/85-156-----------------------------------------GTS--...EQNRDIYS--F--------------------
R6S6W4_9BACE/193-277-----------------------------------------GST--QDLETAAAVFK--F--------------------
Q8A2V0_BACTN/107-192-----------------------------------------GST--QDLETAATVFK--F--------------------
R5PFE2_9PORP/254-344-----------------------------------------YRI--RGDGNGTKLFE--F--------------------
R7DCI7_9PORP/81-171-----------------------------------------YKI--RGDTNGKSLFE--F--------------------
I3YN54_ALIFI/106-189-----------------------------------------FTG--GNPTELASVFL--F--------------------
R7IYP6_9BACT/147-233-----------------------------------------MQI--RGDENGTEAFE--Y--------------------
R5JRJ4_9BACE/240-330-----------------------------------------YAI--TNSHEVGDVYI--F--------------------
Q8A3M7_BACTN/941-1029-----------------------------------------TTT--NSVYNAANVFL--F--------------------
R7J1U0_9BACT/141-227-----------------------------------------FKV--RGDENAEKAFE--T--------------------
E4RWK7_LEAB4/398-485-----------------------------------------GTT--TNATDARNLYN--F--------------------
E4RWK9_LEAB4/277-362-----------------------------------------FVT--GNNSEAHKLFE--F--------------------

PF05021

Q380R2_ANOGA/286-599RIGFLFGKYEIHPDVPLGIRARVAAIYEPPQESNRDSIRL.LDD..PHDADVDELAR--QL..GLQRVGWIFTDLLSENL
NPL4_CRYNJ/281-610RIAFLIGREDKYEKVPMGIKVIVEAVWEPKQEGELDGLTVETPW..SDESRVQEIAK--WCDKGLSVVGMIYTDLTPSPD
NPL4_MAGO7/285-589RYGIMYGKYSEYEEVPLGIKAVVQAIYEPPQVDEVDGVSL.NSW..DNEKDVNQVAR--LC..GLEPVGAIWTDLLDAGA
NPL4_PICST/268-574RFGVMYGRYEPFDKVPLGIKAVVEAIYEPPQSGELDGITM.LPW..ENEAEVDAIAS--EL..GIYKVGVVFTDLTDSGQ
NPL4_DEBHA/260-563RFGILYGRYEQFDKVPLGIKAVVEAIYEPPQSGELDGLTL.LPW..ENERQVDEIAA--SL..GLYKVGMTFTDLTDSGA
NPL4_DROME/282-593RMGYLYGTYEQHTDVPLGIRAKVAAIYEPPQESTRDSINI.QPD..EFADDVDAVAS--AL..GLKKIGWIFTDLITDDA
NPL4_CANAL/286-595RFGYLYGRYAKSEKTPLGIKAIVETIIEPPQHDELDGITL.LDWDQQEEKMVDQVAN--KF..GLYKVGIIFTDLTDAGT
NPL4_PICGU/288-564RFGFMFGRYEVFDKVPLGIKAVVEAIYEPPQAGETDGITL.LPW..ENQELVLKVAE--KL..NLYPVGIAFTDLTDSGA
A8X418_CAEBR/151-470RVGYLIGQYQPHPEVPLGIKATVAAIYEPPQHCREDGIEF.LED..KNEKIVDKLLE--ML..GLQRVGWIFTDCWTAAR
NPL4_COCIM/290-605RLGFLYGTYEEYSEVPLGVKAVVQAIYEPPQVDEVDGITL.REW..ENERDVDEVAK--LC..GLEKVGVIFTDLLDSGL
NPL4_ASPOR/287-599RLGFLYGTYEEYTEVPLGVKAVVQAIYEPPQVDEIDGVTL.HEW..HNEKEVDEVAR--LC..GLEKVGVIFTDLLDAGQ
NPL4_SCLS1/289-608RFGYLYGRYEEYTEVPLGVKAVVEAIYEPPQVDELDGITL.NKW..ESEKDVDEMAR--LC..GMERVGVIWTDLLDSGA
NPL4_KLULA/265-593RFGYLYGYYKRYDNVPLGIKAVVEAIWEPPQHDEQDGLTMDMDQVVKEVEDTDKLAR--EM..GLERIGMIFTDLTDTGL
NPL4_AJECN/292-589RLGFLYGTYEEYTEVPLGIKAVVQAIYEPPQVGEVDGVTL.HEW..GNEKDVDEVAK--FC..GLEKIGVIFTDLLDAGA
A7SZA1_NEMVE/172-484RLGFLYGRYEEHKDVPLGIRAVVAAIYEPPQEGTPDSLEL.LPN..TNLDTVNKLAA--DL..GLRIVGWIFSDLVPDDV
NPL4_VANPO/248-566RFGYLYGSYEKYDSTPLGVKAVVHAIYEPPQHDEQDGLTMDLEQVEEEMQKVDQIAM--SM..GLLRVGLIFSDLTDTGN
NPL4_CANGA/260-578RFAYLYGKYEKYDATPLGIKACVHAIYEPPQHDEQDGITMDMEQVTQELNTIDLLAK--EM..GLLRVGMIFSDLTDAGN
Q2HAC4_CHAGB/250-562RLGILYGKYMEYDVVPLGIKAVVEAIYEPPQVDEVDGVSL.NPW..ENQEEINTIAR--YC..GLEQVGVIWTDLVDAGM
NPL4_YEAST/259-577RFGYMYGSYSKYDNTPLGIKAVVEAIYEPPQHDEQDGLTMDVEQVKNEMLQIDRQAQ--EM..GLSRIGLIFTDLSDAGA
NPL4_ASHGO/241-560RFGYLYGRYARYDNTPLGIKAVVEAIWEPEQHDEQDGLTMDTVAVRVSVAAVDAIAA--DM..GLMRLGMIFTDLTDSGS
NPL4_PHANO/275-593RLGFLYGRYEEYTEVPLGTKAVVETIYEPPQVNELDGISL.GDW..DNEKEIDEIAA--QC..GLQRVGVIFTDLLDADK
NPL4_LODEL/287-597RFGYLYGRYEKFDKVPMGIKAVVEAIYEPPQHDELDGLTL.LDW..EDEPIVDAIAA--KL..GLQKVGIVFTDLTDSGN
F7C8S1_XENTR/250-558RIGYLYGRYTEHKDIPLGLRAEVAAIYEPPQIGTQNSLQL.LDD..PKAKVVDEIAA--KL..GLRKVGWIFTDLVSEDT

PF01398

D1039_DICDI/532-641AENN-----TKRS.......................IETCGILSGTL---------------S---ND............
PSDE_DICDI/26-139ARAG-----VPL.........................EVMGLMLGEL---------------I---DEY...........
CSN5_YEAST/66-190AVRG-----GNI.........................EIMGILMGFT---------------L---KD............
PSMD7_DROME/6-121FNRM-----GKIGN.....................QKRVVGVLLGCW---------------R---SKG...........
RPN8_YEAST/3-116YERT-----QTKE......................NKRCVGVILGDA---------------N---SS............
RPN11_SCHPO/25-138GRHG-----TPM.........................EVMGLMLGEF---------------V---DDF...........
CSN5_CAEEL/51-165AKRG-----GNL.........................EIMGLLQGRI---------------D---ANS...........
EIF3F_ARATH/23-133FVRR-----PDSA.......................ERVIGTLLGSI---------------L---PDG...........
EIF3F_HUMAN/87-196YERR-----NEGA.......................ARVIGTLLGTV---------------D---KH............
BRCC3_HUMAN/7-148ALST-----EKE.........................EVMGLCIGEL---------------N---DDT...........
O61792_CAEEL/36-151FNRV-----SKTQS.....................VKRVVGVLLGSM---------------K---KDK...........
EIF3H_HUMAN/34-146YQEE-----GQGT.......................EVVQGVLLGLV---------------V---ED............
EIF3F_CAEEL/2-117HMRR-----TKSSAKN.................TGQEKCMGTLMGYY---------------E---KG............
YPT5_CAEEL/24-137ARSG-----IPL.........................EVMGLMLGDF---------------V---DDY...........
RPN8_SCHPO/12-125YNRS-----AKGT......................KRRVVGILLGQN---------------N---GD............
EIF3F_SCHPO/18-129STRK-----SENN.......................QRVIGTLLGTR---------------S---EDG...........
CSN6_HUMAN/36-148WIRM-----RSQEG....................RPVQVIGALIGKQ---------------E---GR............
EIF3H_CAEEL/10-139VDSE-----LHAGISE.................VSGDACAGVLTGLV---------------F---LED...........
STABP_HUMAN/252-361ASAN-----TARG.......................VETCGILCGKL---------------M---RNE...........
BRCC3_MOUSE/7-148ALST-----EKE.........................EVMGLCIGEL---------------N---DDIRSDSKFTYTGT
PSD7A_ARATH/12-125YNRV-----AKDS......................SKRVVGVLLGSS---------------S---RG............
CSN6B_ARATH/6-136FTRV-----KTQLNPPAASCATGNGSNNADAMLLQNPRVYGCVIGLQ---------------R---GR............
CSN5B_ARATH/54-168ARSG-----GTI.........................EIMGLMQGKT---------------E---GD............
PRP8_HUMAN/2099-2205SDLR-----AQI...........................AGYLYGVS---------------P---PDNP..........
CSN5_SCHPO/30-144VSQG-----MPL.........................EVMGYVQGKV---------------E---GA............
G0RSA9_HYPJQ/14-125YNRT-----VTSKT.....................KRRVVGVLLGQN---------------D---GK............

PF14464

Q8TYS8_METKA/10-115SDKN.....HPD-------------------------EFFAMLGGSI................---DAE-----------
Q8TQ16_METAC/27-138DTLD.....FIL-------------------------EASKSMAPEEFA...........GLL---QEQ-----------
O27052_METTH/16-131EVMD.....EVL-------------------------EIARRSHPHEFAAL.......LEGRQ---EGE-----------
Q9I213_PSEAE/7-137ACRT.....YPR-------------------------ECCGFVLADA...............K---VKE-----------
Q8ZW14_PYRAE/1-111KCA......PEA-------------------------ECVALIFGISD..............T---.AL-----------
Q9YE90_AERPE/3-117LMAL.....AHN-------------------------EEAGLVIGAR...............R---GDT-----------
P73582_SYNY3/7-143GERC.....YPE-------------------------ECCGLLLGKILIG.........ENGH---..R-----------
Q9S2G8_STRCO/5-111ARED.....HPD-------------------------EACGVVAGPA...............G---EGR-----------
Q9RXB3_DEIRA/6-119VRRE.....LPR-------------------------ECVGALGGW................V---RGE-----------
O67597_AQUAE/5-125AERD.....YPY-------------------------ETCGLLIGK.................---SEG-----------
Q216W0_RHOPB/11-140AEQA.....YPK-------------------------ECCGFVYADGEV...........RAC---VNI-----------
Q0A9H9_ALKEH/13-128GLAR.....WPE-------------------------EACGLMLGCD................---...-----------
Q82SH4_NITEU/5-122SLKD.....HPI-------------------------ETCGIIAGLA................---..G-----------
Q2YAE7_NITMU/14-131AHKD.....HPF-------------------------EICGVIAGPE................---..K-----------
Q2SI97_HAHCH/5-122AQAE.....HPI-------------------------ETCGVIAGRE................---..G-----------
Q82D25_STRAW/5-122ARQD.....HPD-------------------------EACGVVAGPE................---..G-----------
A1SG89_NOCSJ/5-128ARRD.....HPD-------------------------EACGIVAGPE................---..G-----------
Q1AY15_RUBXD/6-127AREA.....YPE-------------------------ECAGALVGMDVG............GG---TKI-----------
Q02B10_SOLUE/5-125AQAS.....YPN-------------------------ECCGAMLGDT................---..D-----------
Q5Z0V7_NOCFA/5-122ARAD.....HPD-------------------------EACGVIAGPE................---..G-----------
A8L770_FRASN/19-136ARRD.....HPD-------------------------EACGVIAGPE................---..G-----------
Q47MB9_THEFY/5-122ARRD.....HPD-------------------------EACGIVAGPE................---..G-----------
Q2JEP2_FRASC/5-122ARRD.....HPD-------------------------EACGIVAGSL................---..G-----------
Q7MRV8_WOLSU/6-118AQRE.....LPL-------------------------EACGYVAG..................---..V-----------
Q39VC3_GEOMG/6-119AQAD.....API-------------------------EACGILGG..................---..I-----------
B3EN74_CHLPB/4-118ARRE.....TPL-------------------------EACGYLGGK.................---...-----------
A3DIG3_CLOTH/5-123SRNA.....LPN-------------------------EACGLLGGRI................---ENG-----------
A6TTW0_ALKMQ/7-124AKEE.....FPL-------------------------ECCGLLAGVK................---TDD-----------
A4XJZ1_CALS8/5-124CLNS.....LPI-------------------------EACGLLGGVI................---EDE-----------
Q7U4L3_SYNPX/10-140LLAS.....WPE-------------------------EGCALLIGSQGE............GS---SLR-----------
Q7V9V1_PROMA/10-154LLTV.....KPE-------------------------EGCALLLGKSIKAEN......LEGRN---IFQ-----------
Q46IP8_PROMT/10-154LKAA.....EPE-------------------------EGCCILIGKTNSLTK......DHKRN---IWE-----------
B2J4Y6_NOSP7/5-138AEST.....YPE-------------------------ECCGIILGYMA.............AE---DKI-----------
Q2JJY1_SYNJB/6-136GEQA.....FPH-------------------------ESCGILIGEIR.............GS---DKI-----------
A9W9Z2_CHLAA/6-141AEAT.....YPD-------------------------ECVGLLVGTLN.............GE---KKT-----------
Q2IF99_ANADE/8-141CEAD.....PER-------------------------EVCGFVVRRRGL............LE---VEP-----------
TIPK_BPN15/2-106AAAE.....YPR-------------------------ECCGVVAQKS................---RVE-----------
Q8XYR3_RALSO/2-105AARE.....HPR-------------------------EACGLVVVVR................---GRE-----------
Q6XQC1_BPT1/3-111AQEE.....YPR-------------------------ECCGVVTQKG................---RVQ-----------
Q7WX35_CUPNH/81-188ARAA.....HPK-------------------------ETGGWVVWNA................---DSA-----------
A1VVA1_POLNA/80-189AKST.....LPN-------------------------EVAAAMVWNA................---EQD-----------
A0R7L0_PELPD/81-188AKER.....FPL-------------------------ECAAWFTWDT................---YLK-----------
Q8XYU8_RALSO/133-242ARKA.....APN-------------------------EHAAWVVWDS................---RTG-----------
Q21Q53_RHOFT/82-191ARAA.....APN-------------------------ETAAWIVFNE................---GDR-----------
Q120V3_POLSJ/78-187AKAA.....MPN-------------------------EMAAAVIWNS................---NDH-----------
Q8ZSF0_NOSS1/58-173VPCQ.....AIA-------------------------EIINAASINP................---.QQ-----------
Q5NXB5_AROAE/80-200ARES.....CPL-------------------------EAAGWITWNE................---VSN-----------
Q11ZD2_POLSJ/78-182ARAA.....TPM-------------------------ETAAWIVWEA................---ETC-----------
Q47D11_DECAR/80-200ARRG.....LPN-------------------------EVAGALIYSR................---RNQ-----------
A1U033_MARHV/627-755RENE.....LPN-------------------------ETGGVLVGFI...............D---RKI-----------
A1VVG1_POLNA/619-747RTKG.....FPN-------------------------ETGGVLIGYY...............D---FNV-----------
Q5HY19_GLUOX/596-724RQKA.....APN-------------------------ETGGILIGTF...............D---LVR-----------
Q3J4T5_RHOS4/19-143AAKR.....SQR-------------------------ETGGILIGHY...............S---EDL-----------
A9BTW4_DELAS/624-751ALRW.....GAL-------------------------ETGGALIGRI...............S---FEN-----------
A1U5J0_MARHV/600-724RASA.....GKN-------------------------ETGGAIIGRY...............D---PLL-----------
Q2LTW5_SYNAS/612-744VRRSALIYGEKA-------------------------ETGGILFGGR...............D---NAC-----------
Q21PA7_SACD2/610-735IERES..KGSSV-------------------------EQGGVLAGMV...............C---HLS-----------
Q3SNL7_NITWN/223-347VARH.....PAV-------------------------ETGGVLVGTC...............S---ARL-----------
Q4FRY9_PSYA2/20-141QLSD.....SSP-------------------------ESAGVLIGER...............R---DVH-----------
Y4QB_RHISN/8-136ASRW.....HDL-------------------------ETGGTFMGYW...............S---DAN-----------
A0AW82_ARTS2/13-145ARLY.....APA-------------------------ETGGILVGHYTVT..........KPN---GQR-----------
A5G3M8_GEOUR/23-151QNDR.....HKP-------------------------EGGGVMLGRYI..............I---DSQ-----------
Q2NDB2_ERYLH/5-124TSLA.....HPL-------------------------ECCGILLGEH................---.NH-----------
Q2K8Q5_RHIEC/6-134LRSA.....GDK-------------------------EIGGQLFGEQI..............E---PSH-----------
Q2K2A8_RHIEC/65-199EVGR.....SGY-------------------------EGLGLWVGTVAA............EI---ATV-----------
C5ATD4_METEA/9-143VGGR.....RGE-------------------------ERAVLWLARSAS............AA---PTP-----------
Q6YRV1_SYNY3/11-152LWHS.....DGK-------------------------EKAAYLICGEVSIQADPWTSMPRKKY---LSV-----------
A1VQ27_POLNA/13-152LHRE.....NGS-------------------------EAAAYVLFGKAEIAADPWSKQPRIRL---ISH-----------
Q1QNK4_NITHX/10-142LFPG.....DGN-------------------------ESAAILLCAAGPGR........RLKL---LAR-----------
Q2IDP5_ANADE/4-131ELGG.....HPP-------------------------ERGGALLGPPGR...........PLL---TRF-----------
Q9I5S7_PSEAE/5-101AARE.....HPR-------------------------ECCGLIVRGV................---RQR-----------
Q9KVG5_VIBCH/24-139QLHH.....LTP-------------------------ESAGVLIGER................---RGQ-----------

PF03665

S2JVY4_MUCC1/7-196AAKY-----PSS-------------------------DVCGVLLGQN---------------T---TDG-----------
H3A1H6_LATCH/3-193AAKY-----PHC-------------------------AVNGILVAEK---------------Q---KRK-----------
E1ZPZ1_CHLVA/4-226SLKH-----.TA-------------------------GVNGVLLGTV---------------S---VGT-----------
A8PXT4_MALGO/8-186SAKY-----LSS-------------------------TVVGVLVGTK---------------S---QSN-----------
K7IXZ7_NASVI/3-194AAKY-----PHC-------------------------AINGLLLG..---------------.---KQP-----------
B6ABX0_CRYMR/2-193SLKY-----PKC-------------------------PVDGILLGYE---------------E---DQV-----------
F8PZP6_SERL3/3-194AAKY-----PHQ-------------------------PVNGVLLGKP---------------S---SSQ-----------
D7UAL1_VITVI/6-204ALKH-----KTA-------------------------AVNAVLLGRL---------------V---T..-----------
K3X3W2_PYTUL/3-194AAKY-----PTS-------------------------ACNGLLVGEE---------------Q---GQG-----------
E9H1Y4_DAPPU/4-193AFKY-----PHT-------------------------AINGVLLANE---------------G---SNS-----------
W1NI66_AMBTC/6-203ALKY-----NTT-------------------------SVNGILVGRE---------------.---P..-----------
U9UHY5_RHIID/3-195ACKY-----PSS-------------------------TVNGVLLAQE---------------E---VGN-----------
Q8IHW7_PLAF7/5-193SIKY-----SCD-------------------------DVCGILIGKY---------------L---SSN-----------
G6CKX7_DANPL/3-196AASY-----PHC-------------------------AVTGVLLADG---------------S---KIR-----------
A7RMN9_NEMVE/2-189ASKY-----PHK-------------------------AVNGVLLGEE---------------V---THD-----------
E7F7R8_DANRE/8-194AAKY-----PHC-------------------------AVNGLLVAEK---------------H---KKK-----------
K5XVE6_AGABU/4-197LAKH-----PHQ-------------------------RVNGVLIGKE---------------L---SEG-----------
A9SC67_PHYPA/3-200ALKH-----TSC-------------------------AVNGVLIGRI---------------G---KGD-----------
J3LWC9_ORYBR/6-208ALKH-----PAA-------------------------AVNGLLIGRL---------------L---DAG-----------
T1KNA2_TETUR/2-199SLKY-----PYY-------------------------TINGVLLAEK---------------R---TSK-----------
EMC89_DICDI/4-190SFKH-----HAS-------------------------SVNGILLGKA---------------D---KNS-----------
Q580G6_TRYB2/15-270CHKY-----PTQ-------------------------AVSGFLIGKR---------------I---SAT-----------
H2ZYC6_LATCH/3-193AARY-----PHC-------------------------AVNGILLSER---------------R---KEG-----------
A9UQH6_MONBE/4-204ACKY-----PFD-------------------------TCLGLLVGQR---------------G---ADG-----------
V2WXJ1_MONRO/3-193AAKH-----PHR-------------------------QVNGVLLGVG---------------T---GNA-----------
U5H1I2_USTV1/19-212ASKY-----TSC-------------------------SVCGLLVGST---------------S---SSS-----------
C6T3E5_SOYBN/8-202SLKH-----PTS-------------------------AVNGVLIGRI---------------.---...-----------
E2C953_HARSA/3-193AAKY-----PHC-------------------------AINGLLLG..---------------.---KQK-----------
T1J291_STRMM/3-192AVKY-----PEC-------------------------AVNGLLLVEK---------------P---KNK-----------
M7WJF6_RHOT1/3-188AAKF-----PSS-------------------------TCVGLLIGTV---------------A---GSS-----------
I1F3D0_AMPQE/3-193SAKY-----PDR-------------------------EINGALIGTI---------------S---KKD-----------
D8RDW5_SELML/2-207ALKH-----RSA-------------------------AVNGILVGRV---------------S---GGG-----------
F6SMK1_XENTR/3-190AARY-----PHS-------------------------TVCGALLGHK---------------S---HG.-----------
H3FWQ9_PRIPA/653-834ALKY-----PSK-------------------------AVYGLLLGEA---------------K---GSK-----------
H2XJW9_CIOIN/3-199AAKY-----PHC-------------------------AINGLLVACK---------------Q---TLK-----------
E0VL46_PEDHC/3-196CAKY-----PHC-------------------------AVNGVLLAES---------------L---KTK-----------
D8PXF6_SCHCM/3-192CAKY-----PHR-------------------------AVNGVLLGTE---------------A---GDE-----------
D8LMA2_ECTSI/5-188AAKY-----PWA-------------------------AVNGFLLGEE---------------G---LTG-----------
D8U3A0_VOLCA/3-209AAKF-----PSN-------------------------SINGILLGN.---------------.---...-----------
Q17EH7_AEDAE/3-187AAKY-----PHL-------------------------AVNGLLLGAK---------------G---DQQ-----------
H0X2J2_OTOGA/3-202GAKY-----PHC-------------------------AVNGLLVAEK---------------Q---KPR-----------
D6WHD0_TRICA/3-190AAKY-----PHC-------------------------SVNGVLLSKS---------------S---AAK-----------
G3PTY1_GASAC/4-197AAKY-----PHC-------------------------AVNGLLVAEK---------------M---KEK-----------
A4HT47_LEIIN/7-247CYKY-----PAQ-------------------------PVMGMLVGKR---------------L---SDD-----------
F2U324_SALR5/2-194ASKH-----SFG-------------------------AVNGVLLGLV---------------H---EEG-----------
E6ZZH1_SPORE/6-197TAKY-----PTA-------------------------RVFGFLLADA---------------T---SSP-----------
M9LL18_PSEA3/6-197AAKY-----PTS-------------------------RVLGLLLADS---------------S---SSS-----------
D3BSK2_POLPA/3-189SFKY-----CTN-------------------------AVNGILLGYV---------------E---KSV-----------
M1AGM8_SOLTU/6-202ASKH-----KTS-------------------------AVNGVLLGRI---------------.---...-----------
K4DMB1_TRYCR/8-213CQKY-----PTQ-------------------------AVSGFLIGKR---------------L---TES-----------
H9GAA6_ANOCA/2-194GAKY-----PHC-------------------------AVNGLPGGPR---------------S---PRR-----------
L8WT82_THACA/184-364AAKY-----PHA-------------------------PVNGVLLGKA---------------S---GDP-----------
Q8L439_CHLRE/4-200AAKY-----PSN-------------------------SVNGVLVGT.---------------.---...-----------
Q93568_CAEEL/4-184CLKY-----PAK-------------------------GVFGLLIGNK---------------K---GDK-----------
C4WXC3_ACYPI/3-189AAKY-----PHC-------------------------EVNGLLVAEN---------------S---TKG-----------
F1LEA9_ASCSU/7-187ALKY-----PHC-------------------------AVVGLLIGEA---------------E---EEG-----------
R9AN22_WALI9/6-184AAKY-----PEA-------------------------AINGVLIGRI---------------E---ANE-----------
A0A068X284_HYMMI/3-184ASKY-----PHL-------------------------AINGVLLGEY---------------D---QGK-----------
F4PPA7_DICFS/6-190SFKY-----LES-------------------------AVNGILLGTV---------------Q---KDS-----------
G4TEZ9_PIRID/281-458ASKH-----PHR-------------------------AVNGVLLGPT---------------S---GGS-----------
A8NSL7_COPC7/7-197AAKH-----LHQ-------------------------TINGVLLGNQ---------------T---GGK-----------
I7LUF5_TETTS/9-204ALKY-----VKD-------------------------DVIGVLTGKI---------------E---NGQ-----------
M4BIS6_HYAAE/6-193AAKR-----PAN-------------------------SMCGLLLGQK---------------K---GQG-----------
E1FPI7_LOALO/3-186AYKY-----PHR-------------------------PVVGFLIGKT---------------R---NNS-----------
H9JQS8_BOMMO/3-195AAKY-----PHC-------------------------AVNGVLLADA---------------G---KTK-----------
EMC89_DROME/3-192AAKY-----PHQ-------------------------AVNGLLLAEK---------------T---SKG-----------
I2FZ76_USTH4/6-200TAKY-----PTA-------------------------RVLGLLLADT---------------T---SSS-----------
H3CTG5_TETNG/3-190CCLF-----PRC-------------------------SINGLLLSSG---------------P---ADG-----------
W5KBR5_ASTMX/3-190ASLF-----PHC-------------------------SVNGLLLSSS---------------S---SEG-----------
M4EJI7_BRARP/8-204TLRH-----KTA-------------------------AVNGVLVGRI---------------S---SKD-----------
C1N8U7_MICPC/4-205ALKH-----PTR-------------------------AVCGVLLGSP---------------A---EDG-----------
Q8AWD7_DANRE/3-190ASQF-----PRC-------------------------SVNGLLLSSS---------------T---AGG-----------
D2VG68_NAEGR/7-193SFKF-----PFA-------------------------PINGVFIGKR---------------K---DDK-----------
Q6P4M9_XENTR/3-194SAKY-----PYC-------------------------TVNGILVAQK---------------Q---KRK-----------
T1ELZ1_HELRO/3-187AAKY-----PHC-------------------------YINGVFLAEC---------------P---KQK-----------
F4P6T5_BATDJ/6-192SAKY-----SMD-------------------------PVYGVLLGSL---------------N---TDG-----------
B4LMW8_DROVI/3-191AAKY-----PHQ-------------------------AVNGLLLAEK---------------K---PKG-----------
L5KIQ8_PTEAL/3-191AARY-----PHA-------------------------AVNGLLLARA---------------P---QSG-----------
B9S9X3_RICCO/8-202ALKH-----KST-------------------------SVNGVLLGR.---------------.---...-----------
B0CX14_LACBS/4-198AAKH-----PHR-------------------------AVNGVLVGKQ---------------T---SSG-----------
Q5TPN5_ANOGA/3-186AAKY-----PHL-------------------------AVNGILLAEN---------------G---KTS-----------
B7P0N7_IXOSC/7-201CLKY-----PQH-------------------------AVNGVLLADD---------------R---RKQ-----------
E4XDZ8_OIKDI/3-184SYKY-----PHM-------------------------PVNGVFLMDC---------------D---VEK-----------
W5LY47_LEPOC/2-192AAKY-----PHC-------------------------SVNGLLVAEK---------------Q---KRR-----------
B3S6U6_TRIAD/5-192AAKY-----PHC-------------------------KVDGLLIGKL---------------T---NNG-----------
C1E2I6_MICSR/2-195ALKH-----PLR-------------------------SVCGALVGRC---------------D---GDV-----------
C3ZBN0_BRAFL/3-191AAKY-----PHC-------------------------AVNGVLLADR---------------K---RYK-----------
A5K556_PLAVS/5-194GLKN-----SYD-------------------------DVCGILIGKY---------------S---DVE-----------
D0NP92_PHYIT/2-190AAKR-----PAN-------------------------SVCGLLLGTE---------------Q---GQG-----------

PF04002

Y5284_PSEPK/103-223.E.A....S..E-------------------------VFGCLFLDTK---------------------------------
E4RNA6_HALHG/25-148DK.R....T.EE-------------------------VFAMATLDAK---------------------------------
F3ZWY8_MAHA5/23-143.A.D....R..E-------------------------MFAVLFLDVK---------------------------------
Q28VQ9_JANSC/136-256.R.D....L..E-------------------------QFRVLYLDRK---------------------------------
E3PVU0_CLOSD/38-158.K.D....R..E-------------------------EFIVITLDTK---------------------------------
B2URH1_AKKM8/106-233.K.E....K..E-------------------------TVLVLLLDTK---------------------------------
Y2075_CLOTE/107-227.L.K....Q..E-------------------------YLKVILLNTK---------------------------------
G2Z3M4_FLABF/108-228.L.L....H..E-------------------------EFWVMYLNNA---------------------------------
I2F2Z1_9BACT/99-218.M.D....R..E-------------------------TVRVISLDSK---------------------------------
R5BCM7_9CLOT/99-219.RPH....R.YE-------------------------VMYLVSLDSG---------------------------------
D3RWG0_ALLVD/46-166.L.T....Y..E-------------------------VFAVLLLDNR---------------------------------
D5BC92_ZUNPS/22-146.K.NEIQLQ..E-------------------------SFKVMLLNNS---------------------------------
W8L1Z3_HALHR/103-222.Y.P....F..E-------------------------VFACVFLDNR---------------------------------
R5R1B6_9FIRM/110-230.Q.E....Q..E-------------------------RMLCMMLNGK---------------------------------
I1ER86_AMPQE/103-223.R.P....H..E-------------------------VFACLFMDNR---------------------------------
C7RTF0_ACCPU/103-224.L.Q....H..E-------------------------VFFALWLDAQ---------------------------------
T0U3M9_9STRE/104-224.K.K....Q..E-------------------------HLVALYLNTQ---------------------------------
R6V2L8_9FIRM/110-230.E.E....Q..E-------------------------HLLCMMLDCK---------------------------------
U5NAV3_9BURK/110-230.R.T....Q..E-------------------------VFAVLFLDAQ---------------------------------
D4M5Z8_9FIRM/112-232.K.K....R..E-------------------------VMKLLLLNTR---------------------------------
R7HL71_9BACT/112-232.L.D....H..E-------------------------EFWAIYLNTA---------------------------------
Y1522_COPPD/112-234.E.G....K..E-------------------------HFWILLLDRK---------------------------------
K9V4F0_9CYAN/114-235.Q.T....K..E-------------------------LFAVLLLDVK---------------------------------
R6JMU8_9CLOT/103-226........KTTE-------------------------QVYLVTLDGS---------------------------------
Y1979_METAC/107-227.Q.K....K..E-------------------------KFITLYLDTK---------------------------------
R5AEJ0_9CLOT/106-227........EPNE-------------------------TALLLCLNTQ---------------------------------
K9VXG9_9CYAN/114-235.Q.A....Q..E-------------------------RFAVLLLDVK---------------------------------
K9YJM8_CYASC/114-235.Q.C....Q..E-------------------------RFAVLLLDSK---------------------------------
D4MYV8_9FIRM/121-241.L.S....R..E-------------------------EMILIFFNGK---------------------------------
Y065_PELCD/106-226.H.K....R..E-------------------------RFIALLLDSK---------------------------------
R6NJL1_9FIRM/98-227.LCNLFDGKSRE-------------------------CCYMICLDPK---------------------------------
R5US02_9PORP/117-237.L.D....H..E-------------------------EFWVIYLNRS---------------------------------
C5APV7_METEA/127-247.S.G....R..E-------------------------EFRVLFLDRR---------------------------------
D4KXI5_9FIRM/120-240.E.N....K..E-------------------------HLIVCMFDNK---------------------------------
Q30YK7_DESAG/104-224.C.P....H..E-------------------------EVWVAYMDRQ---------------------------------
R7MM84_9FIRM/100-219.TGV....L.SE-------------------------NFAVVCVDNN---------------------------------
R6WGP4_9FIRM/109-229.R.N....Q..E-------------------------VMKLLLLNSK---------------------------------
Y3678_SACD2/103-223.R.Q....S..E-------------------------VFALILLNTQ---------------------------------
C5B9D5_EDWI9/107-227.L.E....R..E-------------------------IFVVLFLDNQ---------------------------------
E6U843_ETHHY/108-231.MGR....T.AE-------------------------IVALMCIDGK---------------------------------
A5VIV5_LACRD/84-210EE......Q..E-------------------------SVCIACTDIH---------------------------------
Q8PA70_XANCP/38-158.L.P....H..E-------------------------VFGVVFLDTK---------------------------------
R5LD03_9FIRM/107-227.L.E....Q..E-------------------------TLHVMFLDTK---------------------------------
R7CLP4_9FIRM/107-227.E.T....Q..E-------------------------KFIVSFLNVK---------------------------------
W0A464_9SPHN/116-236.S.A....I..E-------------------------RVRVLHLNAK---------------------------------
B2V8J4_SULSY/109-228...KFLSKETQE-------------------------HMVALYLNSS---------------------------------
G8R4W9_OWEHD/111-231.L.S....H..E-------------------------EFWVVYLSAS---------------------------------
R5ACA2_9FIRM/103-224.CRQLLSHYSTE-------------------------RFYIICMDSR---------------------------------
R6CUA2_9CLOT/108-228.S.N....Q..E-------------------------YFYCLYLNQQ---------------------------------
D6S4C3_9LACO/86-206.V.E....Q..E-------------------------QLVVIYLDNK---------------------------------
R5VDS3_9BACE/108-228.L.P....V..E-------------------------ECWVMLLNQA---------------------------------
R6Q8T0_9FIRM/106-226.LGA....D.RE-------------------------RALLMALDSR---------------------------------
Q3Z6I4_DEHM1/117-237.RGL....K.KE-------------------------VFKVIYLDSQ---------------------------------
F4LNQ7_TREBD/95-214.Q.T....K..E-------------------------HFVCVTLNGA---------------------------------
E3FL00_STIAD/112-232.L.R....R..E-------------------------VFHVLCFNPR---------------------------------
W8EWR6_9BACT/132-252.L.P....H..E-------------------------EFWVVLLNRA---------------------------------
R6C1S4_9CLOT/112-232.R.T....R..E-------------------------CVLLLCLDAK---------------------------------
Q73P26_TREDE/101-221.R.D....R..E-------------------------HFICVSLNGA---------------------------------
R6TRA0_9CLOT/117-237.K.K....Q..E-------------------------YFYCFYFNTK---------------------------------
R6FT99_9BACT/117-237.L.D....T..E-------------------------EAWVLLMNQR---------------------------------
Y2073_CYAP7/114-235.Q.N....Q..E-------------------------RFAIVLLNVK---------------------------------
W0IZP3_9BACT/129-256.MQARVQGLAVE-------------------------KCWTLCLNVR---------------------------------
R7QWB5_9FIRM/108-228.E.Q....K..E-------------------------KLMVCMFDSK---------------------------------
A4AMB7_MARSH/111-231.L.P....H..E-------------------------EFWIVYLNNS---------------------------------
C9R8K7_AMMDK/111-231.L.E....Q..E-------------------------EFRVILLDTK---------------------------------
Y2138_NITMU/103-223.K.E....H..E-------------------------VFVSIFLDAR---------------------------------
A7HJG0_FERNB/100-219.Y.P....Q..E-------------------------IVRVIFLDTK---------------------------------
R5RS63_9BACE/104-224.L.D....H..E-------------------------ECWIIFLNRS---------------------------------
R7N750_9FIRM/109-229.E.E....V..E-------------------------KVLLLLLDTK---------------------------------
K9SG97_9CYAN/114-235.Q.E....Q..E-------------------------KLAILMLDGR---------------------------------
Y3860_XANCP/103-223.R.N....Y..E-------------------------VFAALFLDSR---------------------------------
Y413_FLAJ1/108-228.L.P....H..E-------------------------EFWVLFLNNS---------------------------------
F9Z8P0_ODOSD/41-163.F.M..SHH..E-------------------------EVWMILLNSC---------------------------------
F9ZAH9_ODOSD/110-230.L.D....H..E-------------------------EFWVIYLTHS---------------------------------
K7SYG7_GLUOY/113-231.LETTLQGAVPG-------------------------QLRILYLDNR---------------------------------
D3PBS2_DEFDS/111-231.D.D....V..E-------------------------KLIAVFLDSK---------------------------------
L0FXZ1_ECHVK/29-152.K.DQIEFV..E-------------------------EFKVILLNSA---------------------------------
U5T1X5_9GAMM/103-223.L.P....H..E-------------------------IFACLFLDNR---------------------------------
R6WPE8_9BACT/116-236.L.A....T..E-------------------------QAWVLLLNQN---------------------------------
I3Z0D0_BELBD/110-230.E.S....V..E-------------------------SFYIIMLNRN---------------------------------
R5ZMY8_9CLOT/106-226EK.R.......E-------------------------IVKLVLLNTK---------------------------------
Q5LI37_BACFN/109-229.L.P....Q..E-------------------------EFWILLLNQA---------------------------------
F6IKU2_9SPHN/12-140.LVSQIGGLRHE-------------------------VVVALLFDVR---------------------------------
X2H7P0_9NEIS/103-223.E.K....V..E-------------------------VCVALLLNQR---------------------------------
R4ZYW4_9CLOT/111-232.E.K....Q..E-------------------------YFYAIYLDSK---------------------------------
L0G541_ECHVK/30-153.A.SKLEFI..E-------------------------EFKVILLNRA---------------------------------
C7JGI6_ACEP3/140-274.ADVYLAKATRG-------------------------QVRALFLDSR---------------------------------
Q5FNC5_GLUOX/112-229.LDQALEGGIPG-------------------------QFRLLYLDNR---------------------------------
R6XQS6_9CLOT/100-220.YGE....K.TE-------------------------MFYMLCLDAK---------------------------------
Y3126_ACIAD/121-236.LGE....K.QE-------------------------VFAVLCLDSE---------------------------------
Q5NML0_ZYMMO/23-141.FKWRFVGLDIE-------------------------QIYIAYLTAE---------------------------------
R7DMH4_9FIRM/102-223.K.E....Q..E-------------------------YMVLIMLNSR---------------------------------
R5C3D7_9BACE/112-232.L.P....T..E-------------------------EFWVLLLNQA---------------------------------
E8RF98_DESPD/37-156.L.E....Y..E-------------------------VFGCLFLDSR---------------------------------
G2T1I1_ROSHA/109-229.E.S....R..E-------------------------RTMVLLFDAK---------------------------------
R5QDV9_9FIRM/110-230.R.T....R..E-------------------------ILKLIFLNTR---------------------------------
Y1038_NEIMB/103-223.E.K....V..E-------------------------VSVALLLNRQ---------------------------------
B4E8Y6_BURCJ/88-208.R.Q....Y..E-------------------------VFIAVYLDAR---------------------------------
Y3773_ACIAC/116-236.K.P....H..E-------------------------VFSVLFLDSQ---------------------------------
R6R369_9FIRM/74-199YQ......Q..E-------------------------HLLLLMLDDK---------------------------------
Y1020_HAHCH/103-223.Y.P....Y..E-------------------------VFAALFLDNQ---------------------------------
E1SW46_FERBD/106-226.L.E....E..E-------------------------RFMLLLLDSQ---------------------------------
X4ZZJ0_9BACL/79-200.L.T....K..E-------------------------HFICLFLNTK---------------------------------
R6GRW5_9FIRM/103-225.E.N....Q..E-------------------------KFLAIFLDNK---------------------------------
R6XGE5_9FIRM/101-228.CFPKYYGLQKE-------------------------KISLIILDKN---------------------------------
E8UCD0_TAYEM/104-224.K.S....E..E-------------------------NCLLLYLNYS---------------------------------
Y2444_RALSO/103-223.R.P....Q..E-------------------------VFACLFLDVR---------------------------------
K9TSS9_9CYAN/114-235.Q.P....Q..E-------------------------RFAVLLLDVK---------------------------------
W8KH20_HALHR/39-161.L.E....H..E-------------------------MFAVLFLDNK---------------------------------
Y214_ALCBS/103-223.L.P....F..E-------------------------VFACLFLDNK---------------------------------
Q03R16_LACBA/85-205.L.L....Q..E-------------------------QLEVLALDAQ---------------------------------
R6PL39_9FIRM/104-228.AVDLLSHYHYE-------------------------RFYVLCLDNR---------------------------------
R7FQ02_9CLOT/101-224.FKNLFINEPKE-------------------------KAYVISLDNK---------------------------------
W0EUJ6_9SPHI/108-228.H.S....H..E-------------------------VFVVLYLNQN---------------------------------
R7H4T7_9FIRM/53-180.L.D....TTKE-------------------------KIIFVCFDDN---------------------------------
R6MT67_9FIRM/102-222.IGR....T.NE-------------------------AVALMLGDAK---------------------------------
B2IKI6_BEII9/120-240.L.D....R..E-------------------------EFRILFLDRK---------------------------------
B8CY05_HALOH/107-227.L.K....Q..E-------------------------VFKIILFDIK---------------------------------
R5XLN2_9CLOT/108-228EK.R.......E-------------------------IVKIIILNTK---------------------------------
Y611_CHLTE/101-221.E.T....K..E-------------------------HLFVLFLSTK---------------------------------
D8MKD6_ERWBE/101-221.R.E....R..E-------------------------IFMVAFLDNQ---------------------------------
C8X2R8_DESRD/107-227.L.S....H..E-------------------------EFWVALVDNK---------------------------------
F8HZR3_WEIKK/1-125EP......Q..E-------------------------ECWAVYLNTQ---------------------------------
R5KN13_9CLOT/103-223.ADQ....S.KE-------------------------KFLLVSLDNS---------------------------------
R5K0Z2_9CLOT/108-228.E.G....Q..E-------------------------CVYAVFLDQK---------------------------------
R6Z4N0_9CLOT/109-229.M.E....Q..E-------------------------ELHLMMFNTK---------------------------------
R6EN47_9FIRM/111-231.K.D....T..E-------------------------CVYLLCLDAK---------------------------------
C6BYC2_DESAD/104-224.L.S....K..E-------------------------EFWIALVNNR---------------------------------
R6H979_9FIRM/30-150.FGL....R.DE-------------------------AVCALCLDAK---------------------------------
R7FIG1_9CLOT/110-230EK.K.......E-------------------------HILLILLNNK---------------------------------
R5PY27_9PROT/128-248.QGH....KKIE-------------------------VFRVLFLDTG---------------------------------
E6SUA0_BACT6/75-195.L.P....N..E-------------------------ELWVLALNNA---------------------------------
I0I0Q8_CALAS/102-222.L.E....Q..E-------------------------HLRVVLLDTK---------------------------------
D5B9K5_ZUNPS/24-148.K.DEIEVS..E-------------------------SFKLLLLNNN---------------------------------
Y148_XYLFA/103-223.N.P....N..E-------------------------VFAVLFLDNR---------------------------------
Q2N869_ERYLH/28-147.ANE.......E-------------------------RLHVVYCDDR---------------------------------
G0A5I7_METMM/103-223.Y.S....Y..E-------------------------VFACLFLDNQ---------------------------------
A9KR89_CLOPH/33-155HK.K....A.EE-------------------------YVYLVSLDMK---------------------------------
A8F4C4_PSELT/95-214.F.E....K..E-------------------------VLRVILLDSK---------------------------------
Q1GAU6_LACDA/83-203.Q.K....Q..E-------------------------QFWVLYFDQQ---------------------------------
Y442_AROAE/103-224.L.P....H..E-------------------------VFHVLLLDAR---------------------------------
Q74JZ5_LACJO/82-202.R.P....Q..E-------------------------ELYGIYLDSK---------------------------------
Y3142_DECAR/104-225.R.G....H..E-------------------------VFMALWLDAQ---------------------------------
D6DG41_CLOSC/43-164.A.D....R..E-------------------------MLLVLSLDSK---------------------------------
Y013_ACTSZ/99-219.Y.E....R..E-------------------------VFSVLFLDNQ---------------------------------
Q5LEH2_BACFN/24-146.E.DCMQHH..E-------------------------ECWAMYLNGA---------------------------------
W5X2J0_BDEBC/4-123PF......S..E-------------------------EVWVISLDTQ---------------------------------
C8WYB3_ALIAD/25-146.A.D....R..E-------------------------MFVVMVLSAK---------------------------------
B7JUA9_CYAP8/114-235.Q.T....Q..E-------------------------RFAVVFLDVK---------------------------------
R5HU73_9MOLU/106-225.K.K....Q..E-------------------------CFYCIYLNSK---------------------------------
R5LID6_9MOLU/107-228.K.K....Q..E-------------------------LFYCLYLNEK---------------------------------
D3V2K1_XENBS/36-155.L.E....R..E-------------------------IFIVLYLDNQ---------------------------------
R5V674_9FIRM/104-232YC......Q..E-------------------------VFYVLFLNVK---------------------------------
F2KUB1_PREDF/111-231.L.D....I..E-------------------------EGWMLMMKQN---------------------------------
Y2301_HALHL/103-223.H.P....S..E-------------------------VFGGLFLDNR---------------------------------
D3R1Z5_MAGIU/112-235.L.D....H..E-------------------------EIYGVFLNTA---------------------------------
D3RRI0_ALLVD/103-223.S.P....H..E-------------------------IFACLFLDNR---------------------------------
D9SEL4_GALCS/84-204.R.Q....Q..E-------------------------VFVVLFLDTQ---------------------------------
D1CCM1_THET1/111-231.L.E....Q..E-------------------------HLRVVQLNTK---------------------------------
Y1610_AQUAE/111-230.KDKFDERR..E-------------------------SLIALYLDLS---------------------------------
H8L280_FRAAD/102-222.L.P....Y..E-------------------------VFACLYLDNR---------------------------------
F2NW47_TRES6/103-222.M.P....T..E-------------------------HFITVTVNGA---------------------------------
H8KNS2_SOLCM/32-155.K.TKIDLL..E-------------------------EFKVMLLNKA---------------------------------
C7M9C6_CAPOD/104-224.L.P....H..E-------------------------EFWVLYLNST---------------------------------
R6GJ39_9FIRM/101-221.DGQ....R.TE-------------------------QLYQLCVDAK---------------------------------
R6LNS1_9FIRM/12-132.Y.R....Q..E-------------------------HLKLLMLNTR---------------------------------
L0FUI1_ECHVK/32-155.K.SKLQFV..E-------------------------QFKVMLLNRS---------------------------------
E6X308_NITSE/99-218.K.S....R..E-------------------------HFLSVTLDGA---------------------------------
K8E3A4_CARML/107-227.L.P....Q..E-------------------------HVVALYLNTK---------------------------------
Y1904_DELAS/105-225.R.Q....H..E-------------------------VFAVLFLDGQ---------------------------------
Q2RWF9_RHORT/122-242.R.P....I..E-------------------------QFRVLFLDNR---------------------------------
Y4435_MICAN/114-235.Q.S....Q..E-------------------------RFAVILLDVK---------------------------------
F8KZT6_PARAV/110-230.A.M....Q..E-------------------------HFLTILQDVK---------------------------------
R5I961_9BACT/97-217.L.Q....H..E-------------------------ECWVLFLNKA---------------------------------
Y935_PELPB/101-221.E.T....K..E-------------------------HLFVLHLNTK---------------------------------
D5CP50_SIDLE/103-223.R.Q....Q..E-------------------------VFVAIFVDAQ---------------------------------
R6P491_9FIRM/116-239.LTTLLSARPFE-------------------------SFVLLCLDIN---------------------------------
D7DLS6_METV0/103-223.L.T....R..E-------------------------VFFVLFLDAQ---------------------------------
K0P606_9BACT/123-243.K.S....I..E-------------------------EFWILLLNRA---------------------------------
Y2405_BORA1/104-224.Q.P....V..E-------------------------HCIALYLDQQ---------------------------------
Y3578_BURXL/132-252.R.P....Q..E-------------------------IFVSLFLDAR---------------------------------
Y624_MARMS/103-223.S.P....R..E-------------------------VFAVLFLDTQ---------------------------------
A6L365_BACV8/27-149.I.ECMEHH..E-------------------------ESYVMFLNRA---------------------------------
R5C6J2_9FIRM/111-231.E.K....Q..E-------------------------KVLLLLLNSK---------------------------------
R6NVH9_9FIRM/104-224.E.E....K..E-------------------------HLMLCMFDTK---------------------------------
B9KJ96_ANAMF/109-229.S.S....V..E-------------------------NLCVLYLNKK---------------------------------
R6THG6_9FIRM/105-225...K....Q..E-------------------------KFKVICIDSG---------------------------------
Q2GEH3_NEOSM/115-235.K.P....V..E-------------------------TIRVLFLNKK---------------------------------
B2GB03_LACF3/81-207EE......Q..E-------------------------MVVAMCTDVH---------------------------------
R6YH91_9FIRM/88-208.LGR....S.TE-------------------------AVCLMLLDSR---------------------------------
E8N4R5_ANATU/112-232.L.L....Q..E-------------------------HLRVILLDTR---------------------------------
D6ZAJ2_SEGRD/99-216.ASRVLGASRTE-------------------------QVAVLVADAR---------------------------------
D1BNF1_VEIPT/110-230.E.D....V..E-------------------------HVWAAMLTSR---------------------------------
Q1GU85_SPHAL/151-271.I.D....V..E-------------------------RVRILYLNSR---------------------------------
K7SLE3_GLUOY/136-256.E.N....I..E-------------------------QFRILFLNDR---------------------------------
R5TQH5_9CLOT/80-200.K.Q....Q..E-------------------------YFYCLYLNNK---------------------------------
R5DVG9_9FIRM/95-215.L.D....K..E-------------------------HLILVLLDNK---------------------------------
B8GNP3_THISH/45-165.E.A....L..E-------------------------VFAVVFLDSQ---------------------------------
Y046_PSEA6/103-223.E.P....N..E-------------------------VFGMLLLDSQ---------------------------------
K0CD70_ALCDB/47-167.E.P....L..E-------------------------VFAIVFLDNH---------------------------------
D4ZI11_SHEVD/38-157.Y.E....R..E-------------------------VFGVMMLNSQ---------------------------------
R7FVV9_9PROT/101-232.VVKHYSYYQSE-------------------------VFTVFLLDSK---------------------------------
E8RT73_ASTEC/123-243.E.P....R..E-------------------------QFRLLFLDKK---------------------------------
R6X9C8_9CLOT/107-227EK.R.......E-------------------------IVKVLMLNVK---------------------------------
B4RG10_PHEZH/134-254.E.T....R..E-------------------------SFRVIFLDAS---------------------------------
F8EX90_TRECH/113-237.R.K....Q..E-------------------------HFICISLNGA---------------------------------
B7VP91_VIBTL/36-155.S.E....R..E-------------------------VFAVMLLDNQ---------------------------------
R6YGF9_9FIRM/111-231.L.E....T..E-------------------------QTRVLYLDNR---------------------------------
M1PMK6_DESSD/108-227.L.K....K..E-------------------------VLCVIYLDSS---------------------------------
V5UBJ0_9BURK/103-223.R.S....R..E-------------------------RFACLFLDAS---------------------------------
D0LGP2_HALO1/104-225.L.S....Q..E-------------------------VFLVIALDPR---------------------------------
M4NFQ4_9GAMM/41-160.L.P....H..E-------------------------EFHVLWLDNR---------------------------------
R5D036_9FIRM/103-223.E.S....Q..E-------------------------VMKLLMLNTK---------------------------------
K4KY92_9FIRM/73-197...DKIYDK..E-------------------------AFVVAFLNTK---------------------------------
R5GYG8_9FIRM/105-227..........TE-------------------------QSRAIFLDQT---------------------------------
D5EQU3_CORAD/111-238.LRSRSAGLDVE-------------------------KFWVLCLDRK---------------------------------
R7DAT5_9FIRM/110-230.Q.E....Q..E-------------------------IMICMMLDNQ---------------------------------
Y357_FINM2/102-223.C.D....V..E-------------------------NFYALLLDTK---------------------------------
G4QEU4_GLANF/103-223.K.P....H..E-------------------------VFSMLLLDSQ---------------------------------
Q8F655_LEPIN/106-224.LATSLIPKNRE-------------------------CFVLITLSPE---------------------------------
R6M7S0_9CLOT/104-224.I.K....Q..E-------------------------LFYVIYLDNQ---------------------------------
D5WUP2_KYRT2/107-227.L.S....K..E-------------------------HFVVLHLDTK---------------------------------
Y2926_ENTFA/108-228.L.Q....Q..E-------------------------HLICIYLNTK---------------------------------
F0JFH1_DESDE/108-228.K.D....T..E-------------------------EFWAVFLDTK---------------------------------
R5G321_9FIRM/104-225.LRFEMENLLVE-------------------------EMRCVYLNAK---------------------------------
Q47CZ3_DECAR/72-192.L.Q....H..E-------------------------VFLVIYLDAH---------------------------------
B8IPF4_METNO/121-241.A.P....R..E-------------------------EFRILFLDKR---------------------------------
R5YE69_9FIRM/107-227.R.R....E..E-------------------------VFMGAFFDAK---------------------------------
A9IEU5_BORPD/53-173.L.E....H..E-------------------------VCALMLLDVQ---------------------------------
F4GWW4_PUSST/104-224.L.S....V..E-------------------------HCIALYLDSQ---------------------------------
R6R974_9FIRM/105-225.L.E....S..E-------------------------RFILMLLDNK---------------------------------
Y2468_HERAR/103-223.R.A....Y..E-------------------------SFVILFLDVK---------------------------------
Q0BRK0_GRABC/150-270.E.K....N..E-------------------------QFRVLFLDNR---------------------------------
F8ACC7_THEID/107-227.L.K....K..E-------------------------VFKAIYLDAR---------------------------------
G8PR76_PSEUV/154-274.N.D....K..E-------------------------EFRILFLDKK---------------------------------
D9R177_CLOSW/110-230.K.E....Q..E-------------------------LVYIALLNTK---------------------------------
I2BEI5_SHIBC/102-222.E.Q....R..E-------------------------IFIVIFLDNQ---------------------------------
H5WPE3_9BURK/51-171.L.E....Y..E-------------------------VFAVLFLDAQ---------------------------------
H8MHI6_CORCM/115-235.L.R....R..E-------------------------VFHVLCFNPR---------------------------------
R7K7U4_9FIRM/102-222.SCR....T.KE-------------------------AVYAIALDKR---------------------------------
R6GGK3_9FIRM/110-230.E.E....Q..E-------------------------QMICTMLNTK---------------------------------
F8EA06_FLESM/100-220.S.E....R..E-------------------------VFVVLLLDSA---------------------------------
E8RAS7_DESPD/108-229.L.Q....H..E-------------------------VLTVVFLDAA---------------------------------
F6CJ84_DESK7/25-145.A.D....R..E-------------------------IFLVICLNAK---------------------------------
T0U7K4_9ENTE/103-223.Y.Q....Q..E-------------------------HLLCLYLNTK---------------------------------
D6GSK0_FILAD/106-226.L.K....R..E-------------------------VFKVLFLDTK---------------------------------
Y2495_CYAA5/114-235.E.R....R..E-------------------------HFAAVFLDSK---------------------------------
V4IZ13_9DELT/108-227.R.R....I..E-------------------------CFTAIFLDAS---------------------------------
C4XRP2_DESMR/107-227.K.E....H..E-------------------------EFWMALVDTK---------------------------------
A3DJW5_CLOTH/99-218.R.K....Q..E-------------------------HFVCVSLNGA---------------------------------
Y2489_LEGPH/103-224.Y.K....N..E-------------------------TFAALFLDNQ---------------------------------
H9UKS1_SPIAZ/105-224.R.Q....Q..E-------------------------LFLCTTLNGA---------------------------------
F9UQM7_LACPL/84-204.L.E....Q..E-------------------------QLQLLCLDTK---------------------------------
B4S9N8_PROA2/46-164.K.A....S..E-------------------------EFYALYLDTK---------------------------------
A9B8G6_HERA2/80-204.L.E....Q..E-------------------------ELRVISLSTQ---------------------------------
H8XNJ9_FLAIG/20-143.L.DILEYQ..E-------------------------QMKVILLNRA---------------------------------
R5I5Z2_9PORP/111-231.L.P....H..E-------------------------EFWVAFLNSS---------------------------------
D9S278_THEOJ/116-236.L.E....K..E-------------------------HFKVILLNVK---------------------------------
E3PRL1_CLOSD/107-227.K.K....K..E-------------------------IFRVVLLNTK---------------------------------
Q03YZ9_LEUMM/77-197LM......Q..E-------------------------QLSVALLDTQ---------------------------------
E0WTW2_9ENTR/60-180.R.E....R..E-------------------------VFLVLFLDNQ---------------------------------
A6GZB2_FLAPJ/110-230.L.V....H..E-------------------------EFWVLFLNNA---------------------------------
A4G2Z6_HERAR/53-173.E.Q....R..E-------------------------VFAVVFMDTQ---------------------------------
E6SKE0_THEM7/227-347.L.D....R..E-------------------------HLYVVLLNTK---------------------------------
Y3079_CHRVO/103-223.R.E....V..E-------------------------TFVVIFLSAQ---------------------------------
Y2739_METHJ/103-224.K.S....Q..E-------------------------HFLVTTLNGA---------------------------------
R5Q908_9CLOT/107-227EK.R.......E-------------------------KLKVLALNTR---------------------------------
R7HGR0_9FIRM/120-240.L.E....K..E-------------------------HMILVLLDSK---------------------------------
G8M5A7_9BURK/123-243.R.P....Y..E-------------------------VFVCLYLDAR---------------------------------
Q11VY8_CYTH3/112-232.L.P....Y..E-------------------------EFWILLLNRA---------------------------------
R5CX07_9FIRM/101-221.DGQ....R.RE-------------------------LLYQVCLDGK---------------------------------
V5XTZ7_ENTMU/25-145.D.T....Q..E-------------------------NLVLLCLDVR---------------------------------
F4L1Z8_HALH1/113-233.L.S....T..E-------------------------EFWILLLNQA---------------------------------
J9ZCU4_LEPFM/110-230.E.K....K..E-------------------------SFWVLLLDQR---------------------------------
A5FBM2_FLAJ1/32-155.P.GKIEFF..E-------------------------QFKVLLLSQS---------------------------------
H1XT56_9BACT/115-235.L.K....Q..E-------------------------VFYVILLNNN---------------------------------
K0C7F6_ALCDB/103-223.E.P....S..E-------------------------VFAVLFMDNK---------------------------------
Y1763_STAA8/93-213.L.T....Q..E-------------------------HFVILLLNSK---------------------------------
G0IV22_CYCMS/96-216.E.V....V..E-------------------------HFYIVLLNRN---------------------------------
F5XW39_RAMTT/108-228.K.G....H..E-------------------------VFAVLFLDAQ---------------------------------
B1HVC4_LYSSC/102-222.L.N....Q..E-------------------------HFVVLFLNIK---------------------------------
Y562_CLOBB/108-228.L.K....Q..E-------------------------ILKVIFLNTK---------------------------------
X2H0Y8_9GAMM/101-221.K.D....R..E-------------------------IFMVVFLNNQ---------------------------------
R5NX86_9CLOT/108-228........LSVE-------------------------KTFLLLLTNA---------------------------------
V6EZR7_9PROT/115-235.L.P....T..E-------------------------QFRLLFLDRK---------------------------------
A6LF44_PARD8/112-232.L.P....Y..E-------------------------ELWIALTNPL---------------------------------
R5VKW4_9CLOT/96-216.L.D....K..E-------------------------HLYAAYLDAS---------------------------------
D4KF16_9FIRM/107-227.E.K....K..E-------------------------HFAILLLDTK---------------------------------
A4CJS6_ROBBH/121-241.L.D....H..E-------------------------EFWVLYLNNA---------------------------------
A1WDH8_ACISJ/43-163.L.E....H..E-------------------------VFAAIFLDAQ---------------------------------
Y1761_CHLPD/101-221.I.T....K..E-------------------------HLFVLHLNTK---------------------------------
R7LA59_9BACT/110-232.ASE....K.HE-------------------------VLEMVCLDAK---------------------------------
I3YI41_ALIFI/82-202.L.S....H..E-------------------------ECWAVYLTSS---------------------------------
Q2LSS5_SYNAS/185-305.L.K....D..E-------------------------NFCVLYLDTQ---------------------------------
Y1834_PSYA2/103-218.RGE....P.RE-------------------------VFAVLCLDNA---------------------------------
K0C5Y9_CYCSP/103-223.Q.Q....R..E-------------------------VFACLYLDTK---------------------------------
A4XJG8_CALS8/37-159PE.........E-------------------------VFTVICLDLQ---------------------------------
L0KBI1_HALHC/106-226.K.M....Q..E-------------------------CFMTVLLDTK---------------------------------
R5IST5_9CLOT/106-225...K....Q..E-------------------------HFYAVYLDSK---------------------------------
E6W163_DESIS/96-215.K.K....Q..E-------------------------YFLSITLDGA---------------------------------
E3DRU8_HALPG/25-148DK.R....A.EE-------------------------VFAIITLDSK---------------------------------
A9GNT0_SORC5/122-243.L.D....H..E-------------------------QMWVISLDGR---------------------------------
J0SBZ3_9EURY/113-232.R.K....Q..E-------------------------YFICISLNGA---------------------------------
D4JZA0_9FIRM/106-226.AGA....K.QE-------------------------KALLLSLDSR---------------------------------
R6QJN9_9FIRM/111-231.L.N....R..E-------------------------EMILILFNGK---------------------------------
F2J502_POLGS/115-235.S.E....R..E-------------------------EFRILFLDKR---------------------------------
H8KP10_SOLCM/113-233.I.Q....H..E-------------------------EFWVILLGRS---------------------------------
T2GBM1_DESGI/104-224LK.A.......E-------------------------EFWVALVDAK---------------------------------
R5QP40_9FIRM/101-221.E.K....Q..E-------------------------KVILLCLNSR---------------------------------
V5XMX8_ENTMU/106-226.Q.K....Q..E-------------------------HLVCIYLDTK---------------------------------
G0GBR5_SPITZ/98-217.K.K....Q..E-------------------------HFLCLSLNGA---------------------------------
B0T9F0_CAUSK/102-222.L.P....R..E-------------------------EFWVLFLDRR---------------------------------
K9Y7H2_HALP7/116-237.Q.T....Q..E-------------------------RFAVLLLDVK---------------------------------
D1AWS8_STRM9/90-210.M.E....R..E-------------------------VFKVLYFNTK---------------------------------
R6CNC8_9BACE/108-228.L.P....I..E-------------------------EFWIMLLNQS---------------------------------
I0IIA0_PHYMF/129-253.G.V....Q..E-------------------------EFHLVTLDTR---------------------------------
K4L506_9FIRM/106-226.L.D....R..E-------------------------HFRIIHLSTR---------------------------------
Y382_METBU/107-227.L.K....K..E-------------------------HLTALYLDTK---------------------------------
C9LXS1_SELS3/107-227.E.R....R..E-------------------------HFAVLLLNAK---------------------------------
B9E733_MACCJ/102-222.M.T....Q..E-------------------------HFIVLSLNTK---------------------------------
A5FYL9_ACICJ/134-254.E.R....V..E-------------------------QARALFLDQR---------------------------------
Y2695_METPP/101-221.K.P....H..E-------------------------VFAVLFLDTQ---------------------------------
Y2588_THIDA/103-223.K.E....Y..E-------------------------VFCCVFLNAQ---------------------------------
C4K7F9_HAMD5/101-221.R.D....R..E-------------------------VFLVLFLNNK---------------------------------
F5Z611_ALTSS/103-223.C.Q....Q..E-------------------------KFLLLMLDSQ---------------------------------
A5CF20_ORITB/105-225.A.K....T..E-------------------------QFRVLFLNKK---------------------------------
Y1917_THICR/103-224.Q.S....R..E-------------------------IFGLVLLDQQ---------------------------------
Q039T4_LACC3/99-219.V.N....Q..E-------------------------SMLILFLDVK---------------------------------
A0R7V6_PELPD/48-167.E.T....K..E-------------------------HFITLHLDGK---------------------------------
Q3Z8Y4_DEHM1/101-221.E.K....K..E-------------------------HFFCLMLDVK---------------------------------
C8WXL6_ALIAD/108-228.L.K....K..E-------------------------HFVTLLLDTK---------------------------------
F2K091_MARM1/103-223.S.P....R..E-------------------------KFVALFLDSQ---------------------------------
R5A777_9CLOT/94-214.LGR....T.TE-------------------------AVCLMLLDGR---------------------------------
R6KCE4_9BACE/24-146.D.ECMQHH..E-------------------------ECWVMFLNQA---------------------------------
A3U7J3_CROAH/110-230.L.D....H..E-------------------------EFWVVYLNNS---------------------------------
A6QCM4_SULNB/99-218.K.T....Q..E-------------------------HFLTITLDGA---------------------------------
H6LC26_ACEWD/114-234.L.K....Q..E-------------------------SFKIIILDTK---------------------------------
B8GJN0_METPE/105-224.E.K....Q..E-------------------------HFISITMNGA---------------------------------
A9KL05_CLOPH/110-230.L.K....T..E-------------------------QSRLLMFDTK---------------------------------
Q1MS20_LAWIP/105-225.C.P....H..E-------------------------EVWIATVDTQ---------------------------------
W8UBM6_YEREN/101-221.R.E....R..E-------------------------VFLVMFLDNQ---------------------------------
G8TLK8_NIAKG/109-229.L.P....N..E-------------------------VFAVAYLNQG---------------------------------
R5NQ10_9CLOT/104-224.E.K....V..E-------------------------VIKLIILNSK---------------------------------
E1RFR5_METP4/99-218.K.K....Q..E-------------------------YFICMTLNGA---------------------------------
R7D095_9BACE/109-229.L.S....V..E-------------------------ECWVLLLNQA---------------------------------
K9ULX2_9CHRO/114-235.S.T....Q..E-------------------------RFAILLLDTK---------------------------------
R5E2F5_9FIRM/106-226.IGR....T.NE-------------------------CVALMLGDAK---------------------------------
Y536_MOOTA/108-228.L.D....R..E-------------------------NFRTVSLNTK---------------------------------
Y1101_STRA5/104-224.K.K....Q..E-------------------------HLVAIYMDTQ---------------------------------
R7F9D7_9CLOT/108-231.S.K....R..E-------------------------IAKLLILNNK---------------------------------
R6AS63_9FIRM/106-226.E.T....Q..E-------------------------HFLVAFVNVK---------------------------------
R5IXJ0_9FIRM/106-225...D....Q..E-------------------------QFYCIYLDAS---------------------------------
R5QX53_9PROT/110-230.S.D....V..E-------------------------ELRIIFMDAK---------------------------------
B4F0W8_PROMH/102-222.R.D....R..E-------------------------VFVVLFLDNQ---------------------------------
R5T7A8_9FIRM/106-226.E.D....Q..E-------------------------HFIVCFLNTK---------------------------------
D2QFB0_SPILD/110-230.K.P....H..E-------------------------EFWILLMNRA---------------------------------
Y2144_CLOPE/106-226.L.R....Q..E-------------------------VLILINLDTK---------------------------------
F6B8L9_DESCC/106-226.L.D....R..E-------------------------HFLALLLNTK---------------------------------
K0NJJ4_DESTT/106-226.K.T....K..E-------------------------VFAGIFLDAK---------------------------------
R6VTN0_9BACT/109-229.L.D....V..E-------------------------EAWVVLANQS---------------------------------
E8T627_THEA1/101-221.K.E....V..E-------------------------HFGVVTLAGN---------------------------------
Y1397_RHISN/142-262.E.T....K..E-------------------------QFRILFLDKR---------------------------------
H6LJ70_ACEWD/104-224.R.L....N..E-------------------------AFYVICLDSQ---------------------------------
Y523_GEOLS/109-229.N.R....K..E-------------------------LFLTLLLDGK---------------------------------
M9RE36_9RHOB/145-265.R.D....T..E-------------------------QFRVLFLDRK---------------------------------
A4J365_DESRM/110-230.L.D....K..E-------------------------YFSALLLNTK---------------------------------
K0CIP9_ALCDB/44-164.H.P....T..E-------------------------HFGVLFLTNK---------------------------------
L0H3Z3_9GAMM/51-171.R.H....H..E-------------------------LFGCLFLDNR---------------------------------
X5DDS0_9BACT/110-230.L.N....H..E-------------------------EFWILLLNRG---------------------------------
Q5P8G7_AROAE/75-195.R.P....Y..E-------------------------VFVALYLNAR---------------------------------
F8L772_SIMNZ/104-230...K....Q..E-------------------------KVALLFRNVK---------------------------------
Q2SPA2_HAHCH/25-145.L.Q....Y..E-------------------------VFGVMFLDNQ---------------------------------
H1Y0F4_9SPHI/111-231.L.N....H..E-------------------------EFWIMLMNKG---------------------------------
R6DC48_9FIRM/101-221.AGE....K.KE-------------------------MLYQVCLDAK---------------------------------
I1YW52_PREI7/109-229.K.D....V..E-------------------------EAWILLMSQK---------------------------------
R5B0N0_9FIRM/102-222.LYE....R.TE-------------------------VVYLLCLDAK---------------------------------
R6CK30_9BACT/108-228.L.D....T..E-------------------------EAWLLMMNQN---------------------------------
R6LX37_9CLOT/109-229.E.E....T..E-------------------------QVRVLLLNGR---------------------------------
C4ZA49_EUBR3/108-228.L.T....N..E-------------------------VVICAYFDVK---------------------------------
V4JDL2_9GAMM/102-222.A.N....N..E-------------------------VFLLILLTHE---------------------------------
E8SIR6_STAPH/105-225.Y.D....Q..E-------------------------HFVLLILNTK---------------------------------
R6T3Q7_9FIRM/33-153.SGE....S.RE-------------------------VIYELCLDRK---------------------------------
Y1557_THEMA/102-221.L.E....R..E-------------------------IVKVICLDTK---------------------------------
R6FKR1_9FIRM/30-152.KAE.......E-------------------------YVYMLAFDTK---------------------------------
A3QCC9_SHELP/37-156.H.Q....R..E-------------------------VFGVMMLDSQ---------------------------------
Y2667_TRIEI/114-235.Q.T....Q..E-------------------------KFAVLLLDVK---------------------------------
Y4094_CROS8/109-229.Q.E....R..E-------------------------VFLVIFLDSQ---------------------------------
A2U3E5_9FLAO/107-227.L.E....H..E-------------------------EFWVLFLNNS---------------------------------
I6ZU37_MELRP/105-226.E.V....K..E-------------------------KFYVVCLSSS---------------------------------
Y897_CALS4/109-229.L.S....K..E-------------------------HFKVVMLNVK---------------------------------
C8W5S1_DESAS/112-232.L.D....R..E-------------------------YFRAMLLNTK---------------------------------
I0K5N5_9BACT/111-231.K.Q....H..E-------------------------EFWVLLLNRA---------------------------------
F0P159_WEEVC/112-232.L.P....I..E-------------------------EFWVMYLNQG---------------------------------
M9WY89_MANHA/107-227.E.E....R..E-------------------------VFMVLFLDNQ---------------------------------
B9ECC3_MACCJ/29-150.CKKLIGNSVRE-------------------------KFLLVGLNTK---------------------------------
Y4033_VARPS/104-224.R.P....Y..E-------------------------VFAVLFLDAQ---------------------------------
K9S3X0_9CYAN/114-235.Q.S....Q..E-------------------------HFAVLLLDIK---------------------------------
F6CP98_DESK7/110-230.L.D....R..E-------------------------HFRALLLNTK---------------------------------
D3SDI2_THISK/122-241.Y.P....F..E-------------------------VFAVLFLDNR---------------------------------
R7MCB3_9CLOT/101-222.A.R....Q..E-------------------------KFLILLFDNK---------------------------------
R5BQ20_9BACE/105-225.M.Q....H..E-------------------------ECWGLFLDSG---------------------------------
A8ZTW3_DESOH/103-222.R.K....Q..E-------------------------HFLCVSINGA---------------------------------
D9QV39_ACEAZ/107-227.L.E....K..E-------------------------HFVTLLLNTK---------------------------------
R5FEV0_9BACT/140-262.L.D....V..E-------------------------EFWVLLLKQN---------------------------------
Y2615_BACSK/105-225.L.Q....Q..E-------------------------HFVALYLNTK---------------------------------
D3V735_XENBS/109-229.Q.D....R..E-------------------------VFVVLFLTNQ---------------------------------
D9S7T5_FIBSS/100-222........ESQE-------------------------HLVVISLNSA---------------------------------
Y767_ROSS1/108-228.L.D....Q..E-------------------------QLRAICLDTK---------------------------------
R5AYE4_9BACE/23-148.A.DTIGYK..E-------------------------TFKVLLLNNA---------------------------------
R7JCD2_9PORP/108-228.L.P....H..E-------------------------EFWVAYLNRS---------------------------------
R7IS48_9FIRM/109-229.K.E....K..E-------------------------ELWLLMLDSK---------------------------------
F7XLN3_METZD/107-227.K.K....K..E-------------------------EMYALYLDTK---------------------------------
B8J197_DESDA/108-228.C.P....H..E-------------------------ECWLALVDQR---------------------------------
R6E180_9FIRM/104-222.E.K....K..E-------------------------AFKAVLLNAK---------------------------------
W6S2Y9_9CLOT/105-225.L.N....K..E-------------------------VLKIIMLNVK---------------------------------
Y1465_STRT2/104-224.K.P....Q..E-------------------------HLVAIYLDTQ---------------------------------
B4EWQ7_PROMH/44-164.Y.E....H..E-------------------------VFGVLFLDTK---------------------------------
S5Y2D9_PARAH/43-162.G.E....V..E-------------------------CFHVLYLDRK---------------------------------
Q7UL21_RHOBA/197-319.A.V....Q..E-------------------------EFHIVTLDTK---------------------------------
R6E3R8_9BACE/26-150.D.DTIEYK..E-------------------------SFKVVLLNQS---------------------------------
R5V4V4_9FIRM/25-145.TGV....Q.RE-------------------------QVAVLLLDNS---------------------------------
B8FHA4_DESAA/128-249.K.K....N..E-------------------------CFFIVYLDVQ---------------------------------
M1FJ00_9ALTE/80-200.Y.S....H..E-------------------------VFAALFLDNR---------------------------------
R4K0Q2_CLOPA/23-144.M.D....R..E-------------------------AFVVITLDTK---------------------------------
F5Y709_TREAZ/105-224.R.R....Q..E-------------------------RFICISLNGA---------------------------------
G0AJD2_COLFT/103-223.K.P....H..E-------------------------SFLVLFLDVK---------------------------------
C8VVH2_DESAS/106-226.M.D....R..E-------------------------HFKALLLNTK---------------------------------
E3EC59_PAEPS/78-198.S.T....K..E-------------------------HFICLLLNTK---------------------------------
G8PCK3_PEDCP/110-220.K.N....Q..E-------------------------ELYLLCLDTK---------------------------------
E7FJ82_9BURK/47-167.F.E....H..E-------------------------VFAVLFLDTR---------------------------------
Q6D9M1_PECAS/16-136.I.E....R..E-------------------------VFVAMFLNNQ---------------------------------
V5SD55_9RHIZ/143-263.E.E....R..E-------------------------QFRILFLDKK---------------------------------
B2A699_NATTJ/120-240.E.T....R..E-------------------------HFLAVMLNTK---------------------------------
U5MLE0_CLOSA/108-228.L.N....Q..E-------------------------VLKVVLLNTK---------------------------------
R6E7I0_9BACE/124-244.L.D....H..E-------------------------ECWILYLNRS---------------------------------
I2EWH8_EMTOG/106-226.L.Q....H..E-------------------------QFWVLLLNRA---------------------------------
S6A4W6_9SPIO/102-222.R.S....Q..E-------------------------HFICVSLNGA---------------------------------
R6N0B1_9CLOT/105-225EK.S.......E-------------------------KVKIIVLNNK---------------------------------
A8GCN6_SERP5/39-159.L.E....R..E-------------------------VFMVLYLDNQ---------------------------------
E0SMR5_DICD3/82-202.F.E....R..E-------------------------VFAVLFLTTR---------------------------------
A9NF52_ACHLI/94-214.L.R....K..E-------------------------HLIVLCLDIK---------------------------------
E1V938_HALED/103-223.L.G....H..E-------------------------EFAALFLDSQ---------------------------------
E1VH15_9GAMM/103-223.H.Q....R..E-------------------------VFAALFLDSQ---------------------------------
F4C4D8_SPHS2/112-232.L.S....H..E-------------------------EFWILLLNTN---------------------------------
B8ERG4_METSB/117-237.L.D....R..E-------------------------EFRILFLDKK---------------------------------
R7PNW9_9FIRM/106-226.E.S....Q..E-------------------------HLYACYLNTK---------------------------------
G4L6X4_TETHN/103-223.F.S....Q..E-------------------------HLICLYLNTK---------------------------------
L7VSK5_CLOSH/104-224.R.N....Y..E-------------------------AFYVCCLNSQ---------------------------------
D0J5R5_COMT2/109-229.R.P....H..E-------------------------VFAVLFLDSQ---------------------------------
L0EG89_THECK/108-228.E.L....K..E-------------------------HFVCLFLNTK---------------------------------
C7NDB9_LEPBD/119-239.R.D....I..E-------------------------VFKVLFLNTQ---------------------------------
C0ZAK0_BREBN/111-231.L.T....Q..E-------------------------HFVCLFLNTK---------------------------------
G0J386_CYCMS/30-153.I.DTLEYC..E-------------------------SFCVMTLNRA---------------------------------
R5UB53_9FIRM/25-147.Y.D....R..E-------------------------VFCILNCTTK---------------------------------
Q6D389_PECAS/36-156.L.E....R..E-------------------------VFMVLYLDNQ---------------------------------
R6YDU6_9CLOT/106-225.L.E....Q..E-------------------------HFYALYLDSK---------------------------------
R5IZM0_9FIRM/102-222.HGE....S.EE-------------------------VVYLLCLDAK---------------------------------
Q2GHA0_EHRCR/109-229.G.S....V..E-------------------------NFHILYLNTK---------------------------------
D4ZWK2_ARTPN/114-235.Q.T....Q..E-------------------------RFAILLMDVK---------------------------------
J7J4Y9_DESMD/106-226.L.D....R..E-------------------------HFRVVSLSTK---------------------------------
R5T718_9CLOT/43-163.A.D....R..E-------------------------MLVVMSLDTA---------------------------------
F4GMP0_PUSST/56-176.M.G....H..E-------------------------VAAVLYLNSQ---------------------------------
F3ZZK6_MAHA5/110-230.L.K....K..E-------------------------HFKLVQLDTK---------------------------------
G0J3F5_CYCMS/110-230.E.T....I..E-------------------------YFYVLFLNRS---------------------------------
R5XVB7_9FIRM/103-223.GSE....E.LE-------------------------KFVMVTLDNS---------------------------------
R5AK34_9BACT/110-230.L.P....Y..E-------------------------EFRIILLSRS---------------------------------
E4TK19_CALNY/101-221.Q.D....K..E-------------------------SFMVILLNSA---------------------------------
D8K312_DEHLB/128-248.SGL....R.KE-------------------------VFKVLYLNSQ---------------------------------
W0PBT4_9BURK/56-176.L.G....H..E-------------------------CLAVVYLNAQ---------------------------------
C7LSH0_DESBD/105-225.L.T....K..E-------------------------EFWVILVDNQ---------------------------------
A6Q5Q5_NITSB/100-219.K.K....Q..E-------------------------YFIAFYLDGA---------------------------------
D3DGY6_HYDTT/104-223.KDKMDNRR..E-------------------------HLWALYLTPS---------------------------------
R6PCV1_9CLOT/111-231.R.K....Q..E-------------------------HMKLLMLNTK---------------------------------
Q2G8R8_NOVAD/124-244.L.T....V..E-------------------------RVRVLYLNSQ---------------------------------
E3GG12_EUBLK/113-233.L.K....Q..E-------------------------HFMILLLDNK---------------------------------
R4K5S2_CLOPA/107-227.L.N....K..E-------------------------VLKVILLNTK---------------------------------
A4G669_HERAR/45-165.H.P....H..E-------------------------VFAILLLDTQ---------------------------------
R6D5P6_9FIRM/108-220........ECRE-------------------------KLYMFSVDKK---------------------------------
Y1241_CLOAB/108-228.F.N....K..E-------------------------HLYVIMLNTK---------------------------------
D5MFK1_9BACT/111-231.L.A....K..E-------------------------VFKVLLLNGN---------------------------------
C9A565_ENTCA/104-224.C.R....Q..E-------------------------HLLGLYLNTK---------------------------------
Q2SAN5_HAHCH/50-170.APE....P.RE-------------------------TFVGLFLDTQ---------------------------------
R7HLG7_9FIRM/104-224.Q.K....Q..E-------------------------LFYVVYLDNQ---------------------------------
I3ZYV8_ORNRL/116-236.L.H....V..E-------------------------EFWVLFLNQS---------------------------------
A1ARB4_PELPD/47-165.E.T....K..E-------------------------YFFAIHLDGK---------------------------------
G4Q820_ACIIR/102-222.E.V....K..E-------------------------HVLTLLLSAK---------------------------------
H5WPS0_9BURK/51-171.L.E....H..E-------------------------VFMVIFLDHQ---------------------------------
X2HBM7_9NEIS/13-138.LRENKIDKEKE-------------------------HFWIIGMNEA---------------------------------
B9L1S0_THERP/136-256.L.E....Q..E-------------------------QLRVVLLDTR---------------------------------
R5D4X0_9FIRM/102-222.MYF....Q.DE-------------------------VCYALLLDNA---------------------------------
R6GSB3_9CLOT/107-227.L.K....Q..E-------------------------TLKLILLDTK---------------------------------
F4L5Q5_HALH1/21-159.FFDKDDFQIQE-------------------------KIVVLFLDES---------------------------------
I0DUI5_PROSM/100-220.Q.E....R..E-------------------------VFTVLFLNNQ---------------------------------
R7JSN1_9FIRM/109-229.E.D....Q..E-------------------------VLLCMMLDTK---------------------------------
F0S737_PSESL/113-233.L.L....H..E-------------------------EFWIVLLNRT---------------------------------
G0VQV0_MEGEL/108-228.L.P....Q..E-------------------------QFGAVYLSTK---------------------------------
G2PRV3_MURRD/111-231.L.P....H..E-------------------------EFWIVYLNNS---------------------------------
Y1642_SYNWW/110-234.Y.D....R..E-------------------------HFRVLYLDRK---------------------------------
R5SQL1_9CLOT/95-216.A.R....Q..E-------------------------ILKIIILNKQ---------------------------------
Q2IG79_ANADE/113-235........AERE-------------------------GFHVVLLDVR---------------------------------
A0KH71_AERHH/55-175.R.D....R..E-------------------------VFAALFLDNQ---------------------------------
K9RSV4_SYNP3/114-235.E.T....T..E-------------------------RFGVLLLDVR---------------------------------
X5A2F7_9BACL/108-228.L.Q....K..E-------------------------HFVCLFLNTK---------------------------------
Y766_SYNY3/114-235.Q.T....Q..E-------------------------HFAIVMLDVK---------------------------------
R5T4E8_9CLOT/4-124.M.E....Q..E-------------------------QIRIMLLNTK---------------------------------
G8X7Y5_FLACA/20-143.I.DLIEFQ..E-------------------------ECKVILLNRA---------------------------------
C0QRE1_PERMH/109-228...KWLSKEKQE-------------------------KMLVLYTNTM---------------------------------
R6NRC8_9BACE/108-228.L.S....V..E-------------------------ECWVLLLNQS---------------------------------
E0SLL9_DICD3/111-231.H.E....R..E-------------------------VFLVMFLDNQ---------------------------------
W0L5P7_9ENTR/38-157.Q.E....R..E-------------------------VFLVMYFDNQ---------------------------------
R5QJC7_9FIRM/108-228.L.E....K..E-------------------------YCIALYLDTK---------------------------------
B6IWS5_RHOCS/138-258.E.P....V..E-------------------------QFRILFLDRK---------------------------------
B5YL92_THEYD/99-218.K.K....Q..E-------------------------YFLSLTLDGA---------------------------------
Y1144_PEPD6/114-234.L.K....K..E-------------------------VFKAVLLNTK---------------------------------
R7API3_9CLOT/125-245.K.E....Q..E-------------------------EMHLMILNTK---------------------------------
F7V2K9_CLOSS/27-148.Y.D....R..E-------------------------VFCIVNFRND---------------------------------
R6ZYQ7_9FIRM/106-226.Q.E....K..E-------------------------NVLLLLLDNK---------------------------------
R5LXQ1_9FIRM/106-226.L.E....Y..E-------------------------CFMVLLLNTK---------------------------------
Y4865_PHOLL/109-229.R.D....R..E-------------------------IFVVLFLNNQ---------------------------------
J7TDS0_MORMO/103-223.Q.E....R..E-------------------------VFAVLFLNNQ---------------------------------
Y399_STRMK/103-224.Q.A....R..E-------------------------VFMALFLDNR---------------------------------
A1K759_AZOSB/75-195.K.P....Y..E-------------------------IFVVLYLDAQ---------------------------------
H8XSF2_FLAIG/106-226.L.P....H..E-------------------------EFWVLYLNNS---------------------------------
T2KIK0_9FLAO/111-231.L.A....H..E-------------------------EFWIIYLNNS---------------------------------
Y184_TERTT/103-223.R.R....S..E-------------------------VFAALFLDSQ---------------------------------
A3DDG3_CLOTH/100-220.R.N....Y..E-------------------------VFYVICLDAQ---------------------------------
K4KKQ5_SIMAS/103-223.K.P....R..E-------------------------VFALLLLDNQ---------------------------------
R6GVC1_9FIRM/105-225.YGR....N.SE-------------------------FIYCLALDLN---------------------------------
R7L305_9CLOT/109-229EK.R.......E-------------------------IVKVLILNTK---------------------------------
I0IM21_LEPFC/90-210.A.K....K..E-------------------------CFYAISMDQK---------------------------------
R6BZG0_9FIRM/144-264.L.E....Q..E-------------------------QMILLMLDTK---------------------------------
R5YBM9_9PROT/123-243.S.G....Q..E-------------------------HLLIIYLNKH---------------------------------
C6XNR3_HIRBI/151-271.E.T....E..E-------------------------QFRVLFLDHK---------------------------------
H1YBW9_9SPHI/32-155.A.DKIDFI..E-------------------------EFKILLLDTN---------------------------------
I0GTM6_SELRL/107-227.E.Q....K..E-------------------------HFAVLLLNTK---------------------------------
L7W6C5_NONDD/111-231.L.P....H..E-------------------------EFWVMLLDNS---------------------------------
L0EJP0_THECK/103-222.L.D....R..E-------------------------HFVCIFLNTK---------------------------------
R5ZX42_9FIRM/102-222.Q.K....Q..E-------------------------HFIVLYLDSK---------------------------------
R6SQJ0_9BACE/104-224.I.D....H..E-------------------------ECWILYLNRA---------------------------------
E8RHZ2_DESPD/37-156.L.E....H..E-------------------------SFACLFLDGR---------------------------------
Y2664_ALKEH/103-223.Q.S....R..E-------------------------IFACLFLDNR---------------------------------
Y3522_CELJU/103-223.H.A....R..E-------------------------VFAVLFLDNQ---------------------------------
B2VF83_ERWT9/102-222.R.E....R..E-------------------------IFQVIFFDNQ---------------------------------
Y1007_LACLA/104-224.F.E....Q..E-------------------------HLVATYLDGQ---------------------------------
W8TUM0_YEREN/36-156.Q.E....R..E-------------------------VFVVLYLDNQ---------------------------------
C4Z083_EUBE2/108-228.L.E....K..E-------------------------HLVLVMLDNR---------------------------------
R7C9P8_9CLOT/111-231.L.E....T..E-------------------------HLYLAALDAS---------------------------------
R6TVR0_9CLOT/106-226.IGV....R.NE-------------------------RVYMLLFDNG---------------------------------
D4LC35_RUMC1/108-228.LGE....P.EE-------------------------QLRLACLDDR---------------------------------
A5G1T0_ACICJ/120-240.E.P....V..E-------------------------QFRVIYLDNR---------------------------------
R6DBH8_9CLOT/111-231.L.E....T..E-------------------------QVRLLILDGK---------------------------------
Q2N9N7_ERYLH/115-235.L.T....V..E-------------------------RVRVLYLNAQ---------------------------------
C6X8W8_METGS/103-223.L.P....R..E-------------------------VFLVIFLDAQ---------------------------------
Q5FKW2_LACAC/86-206.H.K....Q..E-------------------------ELWALYIDNS---------------------------------
Y894_PORGI/105-226.L.P....Q..E-------------------------EMWVLLLNQS---------------------------------
C0QZR3_BRAHW/99-223.L......K.FE-------------------------TFSIICLDVN---------------------------------
F8ENC4_RUNSL/113-233.L.P....H..E-------------------------EFWVLLLNRA---------------------------------
R5PA02_9BACT/110-230.L.D....M..E-------------------------EAWVLLMNQN---------------------------------
Y1907_LARHH/103-223.R.V....Q..E-------------------------VVLLLCLDAR---------------------------------
R6FVI3_9FIRM/111-231.L.C....V..E-------------------------KVMLLLLDGR---------------------------------
E0RWC6_BUTPB/114-234.E.E....Q..E-------------------------KTILLCLDNK---------------------------------
R5NEA8_9BACT/126-246.L.F....H..E-------------------------ECYVLLMNQA---------------------------------
Y1118_STRP1/104-224.K.K....Q..E-------------------------HLVVLYLDNQ---------------------------------
Q5QX21_IDILO/38-157.Y.E....R..E-------------------------VFSIIFLDEK---------------------------------
I3U468_ENTFC/106-226.H.K....Q..E-------------------------HLVCIYLDTK---------------------------------
F0P2W1_WEEVC/27-153.MWDDSLINIQE-------------------------QFCVIFLNQA---------------------------------
R5XQY2_9FIRM/110-230.Q.E....Q..E-------------------------LLICMMLDNR---------------------------------
H2IY88_RAHAC/105-225.R.E....R..E-------------------------VFLVLFLDNQ---------------------------------
R5JFK9_9FIRM/109-229.L.E....K..E-------------------------YVYLLLFDSK---------------------------------
F8JD62_HYPSM/132-252.E.T....R..E-------------------------QFRILFLDKK---------------------------------
D2UBD2_XANAP/103-223.R.P....Y..E-------------------------VFAVLFLDTR---------------------------------
R6QCX3_9FIRM/92-208.KYE....K.VE-------------------------KLYMITLNND---------------------------------
F8I7U4_SULAT/98-216.L.D....Q..E-------------------------EFRVICLNTK---------------------------------
E4RUB9_LEAB4/104-224.L.Y....R..E-------------------------EFWMLCLNRQ---------------------------------
Q1LKU4_RALME/43-163.E.P....N..E-------------------------IFVAVFLDSM---------------------------------
F4GVT8_PUSST/58-179TL.E....H..E-------------------------VFAMAMLNAQ---------------------------------
U6B4R7_9RHIZ/114-234.E.E....R..E-------------------------QFRILFLNKR---------------------------------
Y843_STRU0/104-224.K.K....Q..E-------------------------HLIAIYLDTQ---------------------------------
R6UQZ0_9FIRM/103-223.E.Q....Q..E-------------------------HFLVLFLNQK---------------------------------
D4JTU4_9FIRM/100-220........VDTE-------------------------QLRMIFLDSE---------------------------------
Y4685_BACAN/104-224.L.Q....Q..E-------------------------HFVCLYLNTK---------------------------------
K4LDG8_THEPS/110-230.L.D....R..E-------------------------HFRVILLNTK---------------------------------
R6AN32_9BACT/106-226.L.P....H..E-------------------------ESHILLLNQR---------------------------------
R5MQN4_9FIRM/105-225.E.M....Q..E-------------------------NFYCVYLDSK---------------------------------
W0DSG3_9GAMM/31-152.E.E....R..E-------------------------HFEVLFLNQQ---------------------------------
I0GI86_CALEA/39-161.K.K....Q..E-------------------------FFLIVLLDKK---------------------------------
Y1549_LISMO/103-223.L.F....Q..E-------------------------HFHCLFLNTK---------------------------------
F5YK51_TREPZ/138-257RR......Q..E-------------------------RFICLSLNGA---------------------------------
E1R3G0_SPISS/7-126.E.R....Q..D-------------------------HFIVLTLDGA---------------------------------
V5RS28_9BACT/102-222.K.E....T..E-------------------------HLYLITLNAR---------------------------------
R5J116_9BACE/110-230.L.E....L..E-------------------------EFWVLLMNQA---------------------------------
Q8DU89_STRMU/87-207.K.R....Q..E-------------------------HLIAIYLDTQ---------------------------------
X5HLC2_9RICK/36-156.R.P....I..E-------------------------AICVLLLNKK---------------------------------
Y852_LACSS/101-221.E.T....Q..E-------------------------QLLAVYLDVK---------------------------------
R7NNV2_9BACE/108-228.L.P....T..E-------------------------ECWVLLLNQA---------------------------------
Y732_HAEDU/99-219.E.E....R..E-------------------------VFMVLFLDNQ---------------------------------
D5XBF5_THEPJ/110-230.Y.D....R..E-------------------------HFLAIMLNTK---------------------------------
J9R8N2_RIEAN/104-224.L.P....N..E-------------------------EFWVIFLNQS---------------------------------
R6K0T4_9FIRM/110-230.L.S....K..E-------------------------RLVLIMLDSR---------------------------------
R6T7W5_9STAP/100-221.L.K....K..E-------------------------HLYAIFLNTK---------------------------------
C6XXT7_PEDHD/28-151........EYLE-------------------------EFKMMLLSRS---------------------------------
G2SPW9_LACRR/102-222.E.K....Q..E-------------------------ALVCFFLDTK---------------------------------
F6AAS6_PSEF1/47-167.F.E....H..E-------------------------VFAALFLDAK---------------------------------
Y2338_SALRD/111-231.L.D....K..E-------------------------VFKVVHLNTA---------------------------------
B2JE00_BURP8/121-241.R.P....Y..E-------------------------VFICLFLDTR---------------------------------
F7YN80_VIBA7/37-156.H.E....R..E-------------------------VFALLLLDNK---------------------------------
K9T4N4_9CYAN/114-235.Q.Q....Q..E-------------------------RFAVILLDVK---------------------------------
M5DYQ5_9GAMM/107-227.L.D....Y..E-------------------------VFACLFLDNQ---------------------------------
R5TM68_9FIRM/108-228.E.R....K..E-------------------------QLMLAMFDSK---------------------------------
Q3A6E7_PELCD/47-165.E.S....K..E-------------------------YFMALHLDNK---------------------------------
R6DL41_9FIRM/108-228.LGE....T.RE-------------------------IVYLLSLDAH---------------------------------
Q72CU0_DESVH/104-224.C.P....H..E-------------------------EVWVALLDNQ---------------------------------
H1YZL9_9EURY/99-218.K.K....Q..E-------------------------YFICVTLNGA---------------------------------
Y341_CARHZ/105-226.K.K....Q..E-------------------------QVVVLYLNTK---------------------------------
Y315_METFK/103-223.L.P....R..E-------------------------VFIGIFLDAQ---------------------------------
B3EUD0_AMOA5/121-242........KVIE-------------------------EFWIVTLTRA---------------------------------
Y1766_ALKOO/111-231.L.N....K..E-------------------------IFNILLLTTK---------------------------------
L0G6Z3_ECHVK/32-155.Q.SKLRFI..E-------------------------QFKVMLLNRA---------------------------------
R5H014_9FIRM/122-244.L.........E-------------------------RTILLLLDGK---------------------------------
G2PPT1_MURRD/24-148.K.KTIGMH..E-------------------------TFKVLLLNNA---------------------------------
Y3033_CUPNH/103-228.L.P....H..E-------------------------VFLCLFLDPR---------------------------------
R5HG36_9FIRM/102-222.FGA....R.NE-------------------------MSFLACFDGK---------------------------------
Q6AQC9_DESPS/112-231.L.K....K..E-------------------------VFCVVFLDSS---------------------------------
K4IG28_PSYTT/111-231.L.D....H..E-------------------------QFWILMLNNS---------------------------------
D6Z510_DESAT/109-230.L.S....R..E-------------------------TLVAILLDAS---------------------------------
R6Z0T4_9CLOT/109-229EK.Q.......E-------------------------ILKVAMLNNK---------------------------------
E1VKM0_9GAMM/45-165.AKTWLGLEPNE-------------------------VFGVIYLDAG---------------------------------
C4L4M1_EXISA/86-206.L.N....Q..E-------------------------HFVCLYLNTK---------------------------------
R5MMG2_9FIRM/108-228.IGA....N.TE-------------------------KLYAVCLDNN---------------------------------
R6I308_9FIRM/102-222.MYE....V.NE-------------------------ICYALLLNSS---------------------------------
G2T4X7_ROSHA/28-150.F.D....R..E-------------------------VVCVVNLSSD---------------------------------
R6EGF0_9BACT/108-228.L.S....V..E-------------------------EAWIVLMNQS---------------------------------
A1TJG0_ACIAC/46-166.E.L....H..E-------------------------VFGVVFLDCQ---------------------------------
Y2289_ALKMQ/111-231.L.K....K..E-------------------------YFNIALLNTK---------------------------------
Y386_GEOSL/108-228.R.R....K..E-------------------------YFMALLLDGK---------------------------------
E4TU46_MARTH/113-233.L.H....H..E-------------------------EFWVIMMNRA---------------------------------
R5VDA7_9FIRM/118-238.R.R....E..E-------------------------AFMAAFFDSK---------------------------------
R5Q2K3_9BACT/108-228.L.D....V..E-------------------------EAWVLLMNQN---------------------------------
D2QCL1_SPILD/31-154.Q.NRLDMV..E-------------------------QFKILLLDQQ---------------------------------
Q5NPS3_ZYMMO/106-226.R.L....T..E-------------------------RCRLLHLDNH---------------------------------
W0HQQ2_9ENTR/38-158.L.D....R..E-------------------------AFIVFFLDNQ---------------------------------
F3YXV8_DESAF/104-224.S.R....T..E-------------------------EFWLALVDSK---------------------------------
D7GW82_9FIRM/112-232.L.E....Q..E-------------------------NLKLLLLNTK---------------------------------
D4LHD9_9FIRM/110-230.E.E....Q..E-------------------------LLYCMMLDGH---------------------------------
D1C725_SPHTD/113-233.L.D....Q..E-------------------------QLRVVVLDTK---------------------------------
R5HTE9_9FIRM/108-228.E.Q....Q..E-------------------------KLIVCMFDSK---------------------------------
E1R2L7_SPISS/105-227.R.P....Q..E-------------------------QFLALSLNGA---------------------------------
G2II48_9SPHN/114-234.M.S....V..E-------------------------RVRVLHLNSR---------------------------------
L0H8U8_METFS/97-216.K.R....Q..E-------------------------HFCCITLNGA---------------------------------
B5EEJ0_GEOBB/110-230RH......K..E-------------------------QFMALLLDGK---------------------------------
K0EI52_9NOCA/97-217.ARPLFTGARVE-------------------------RLLVLVCDAQ---------------------------------
A4XRI0_PSEMY/44-164.L.P....H..E-------------------------IFAVLLLDSK---------------------------------
Y3149_BORPD/104-224.C.A....V..E-------------------------HCLALYLDSQ---------------------------------
R5YL78_9FIRM/106-226.K.E....K..E-------------------------ELVVAYLDTK---------------------------------
D9SS19_CLOC7/107-227.L.S....K..E-------------------------VLRIIMLNVK---------------------------------
W0DQ20_9GAMM/103-224.S.Q....R..E-------------------------QFGLMLLDQQ---------------------------------
I0AHR8_IGNAJ/67-187.E.V....K..E-------------------------QFWVLCLNNS---------------------------------
U5Q2Z8_9BACT/108-228.L.S....H..E-------------------------ECWVLYLNRA---------------------------------
A2SPN1_METLZ/128-247DT......Q..E-------------------------NVISVTLSGA---------------------------------
F7YY90_9THEM/95-214.Y.E....K..E-------------------------VLRVICLDSK---------------------------------
I3YWJ7_AEQSU/110-230.L.P....H..E-------------------------EFWILYLNNS---------------------------------
R6RLI6_9FIRM/29-152.LSE.......E-------------------------HFYVIATDMK---------------------------------
B1H050_UNCTG/108-228.E.N....I..E-------------------------KFYAILLNSG---------------------------------
V5WF60_9SPIO/104-223.R.L....Q..E-------------------------HFFVLCLNGA---------------------------------
R4KH33_9FIRM/81-201.L.D....R..E-------------------------HFCALLLNTK---------------------------------
E6WPR1_PSEUU/103-223.R.P....H..E-------------------------VFAALFLDNR---------------------------------
R6FKP8_9BACE/107-227.L.P....T..E-------------------------EFWILLLNQA---------------------------------
C6Y249_PEDHD/111-231.L.N....H..E-------------------------EFWILILNQA---------------------------------
Y1765_PARUW/108-228.E.N....R..E-------------------------IFMAIFQDTK---------------------------------
B4R7U6_PHEZH/122-242.E.S....R..E-------------------------QFRVLFLDKK---------------------------------
B5YIR9_THEYD/103-223.L.K....K..E-------------------------VFITLLLDTK---------------------------------
M4R7Z0_BIBTR/101-221.D.E....R..E-------------------------VFMVLFLDNQ---------------------------------
R5FKY9_9FIRM/100-220.AGE....R.VE-------------------------KCYVVCLDSS---------------------------------
Y1264_STACT/103-223.L.T....H..E-------------------------QFEVLFLNSK---------------------------------
F9VDS8_LACGL/104-224.F.E....Q..E-------------------------NLVAIYLDAQ---------------------------------
A9F436_SORC5/93-211.FGPRLASLVHE-------------------------ELWIAALDTH---------------------------------
A7I4E4_METB6/100-219.K.P....Q..E-------------------------HFICISLSGA---------------------------------
Y1464_NITEU/103-223.K.P....Y..E-------------------------VFVGIFLDAR---------------------------------
Q2S840_HAHCH/2-122.L.Q....H..E-------------------------AFGVLFLDNQ---------------------------------
D4Z4D1_SPHJU/158-274.LAE.......E-------------------------QVRVLFFNDA---------------------------------
R5CR58_9BACT/109-229.L.S....E..E-------------------------EAWILLMNQN---------------------------------
R6L424_9BACE/118-238.L.T....I..E-------------------------EFWVLLLNQA---------------------------------
R7JIG4_9BACT/92-212.M.K....H..E-------------------------ECWCLYLNTG---------------------------------
Q2GL92_ANAPZ/111-231.S.T....I..E-------------------------NFLVLYLNKR---------------------------------
G2PQ86_MURRD/24-148.A.DTIGLH..E-------------------------TFMIVLLNQA---------------------------------
R5I764_9FIRM/113-233.E.E....Q..E-------------------------MLIVMLLDGR---------------------------------
A0M5B9_GRAFK/111-231.L.P....H..E-------------------------EFWIIYLNNS---------------------------------
R6HRP6_9PROT/116-236.R.D....V..E-------------------------EFRIIFLDTK---------------------------------
R5TI06_9CLOT/107-227.K.K....Q..E-------------------------EFYVLYLDNK---------------------------------
H2FY66_OCESG/103-223.Q.P....R..E-------------------------VFALLLLDNQ---------------------------------
R7IE80_9FIRM/83-203.AGY....R.RE-------------------------QFYVICLTAD---------------------------------
R7FAU4_9FIRM/113-239.LKAWFSGVISE-------------------------QVVLLCLNES---------------------------------
Y4138_GEOUR/107-227.H.R....K..E-------------------------YFLTLLLDGK---------------------------------
W0LA12_9ENTR/29-149.Q.D....R..E-------------------------LFMVMYLDSQ---------------------------------
Q03EP2_PEDPA/108-218.E.P....Q..E-------------------------HLLVLCLDTK---------------------------------
Q47ZW8_COLP3/38-157.K.E....H..E-------------------------IFAVMLLDNQ---------------------------------
B8I6Q0_CLOCE/108-228.L.K....K..E-------------------------MFKAILLDTK---------------------------------
R7I149_9CLOT/109-229.L.E....Y..E-------------------------QVILVLLDTK---------------------------------
C6X609_FLAB3/104-224.L.N....T..E-------------------------EFWAIYLNQN---------------------------------
D8PG85_9BACT/110-230.L.R....H..E-------------------------IFAVVLLDAK---------------------------------
I4WGW7_9GAMM/102-222.L.P....Y..E-------------------------VFGCLYLDNR---------------------------------
A0LNF4_SYNFM/103-223.E.R....S..E-------------------------KFCILALNST---------------------------------
D0KW68_HALNC/103-222.A.A....Q..E-------------------------VFAVLFLDQR---------------------------------
F4HF54_GALAU/97-217.Q.Q....R..E-------------------------LFVVLFLNNQ---------------------------------
R6S5G1_9BACE/109-229.L.P....V..E-------------------------ECWVMLLNQA---------------------------------
A4SZN2_POLSQ/114-234.L.P....H..E-------------------------VFLCLYLDPR---------------------------------
A2SGD1_METPP/48-168.L.E....H..E-------------------------VFCVLFLDAQ---------------------------------
Q1WT78_LACS1/112-222.S.K....Q..E-------------------------LLVCVCLDTK---------------------------------
D7CL85_SYNLT/108-228.L.D....R..E-------------------------HFRAVYLDRK---------------------------------
A9HJP0_GLUDA/115-244.CDTVLTGAPPG-------------------------QLRILFLDSS---------------------------------
Y2618_GEOKA/105-225.L.S....Q..E-------------------------HFVAIYLNTK---------------------------------
A7HYP6_PARL1/43-163.E.P....N..E-------------------------VFVVVFMDSL---------------------------------
L0ESE5_LIBCB/113-233.E.E....R..E-------------------------QFRILFLNKR---------------------------------
M4U7F3_9GAMM/37-156.H.K....R..E-------------------------VFAVMFLNSR---------------------------------
C0Q9Z9_DESAH/146-266.R.P....R..E-------------------------VFVGIFLDAK---------------------------------
B1YJT0_EXIS2/96-216.Y.Q....Q..E-------------------------HFICLYLNTK---------------------------------
F8GGA8_NITSI/103-223.K.Q....H..E-------------------------VFLGIFLDAK---------------------------------
M4RZ11_9SPHN/113-233.R.T....I..E-------------------------RVRVLHLNSK---------------------------------
Y1235_BORPE/104-224.R.K....V..E-------------------------HCIALYLDAR---------------------------------
Q3IYM9_RHOS4/133-253.R.A....T..E-------------------------QFRVLYLDRK---------------------------------
A4YL64_BRASO/116-236.A.D....K..E-------------------------QFRLLFLDKR---------------------------------
R5MTC5_9MOLU/104-222.L.K....Q..E-------------------------KVIGIYLDNS---------------------------------
G8UKP0_TANFA/108-228.L.P....H..E-------------------------ELRAAFISRS---------------------------------
YICR_SHIDS/101-221.E.E....R..E-------------------------IFMVIFLDSQ---------------------------------
G4KTG5_OSCVS/101-221.DGK....K.NE-------------------------LVYELCLDRK---------------------------------
D5EDV3_AMICL/99-222.LCRLLSEEERE-------------------------IIVSLFLDGK---------------------------------
C7RDS9_ANAPD/107-227.L.K....K..E-------------------------YFYAILLDSK---------------------------------
R5BYJ8_9FIRM/106-226.E.E....Q..E-------------------------NLLCVMLNTK---------------------------------
F8C480_THEGP/114-234.L.S....R..E-------------------------TLKTIFLDAK---------------------------------
G0L606_ZOBGA/111-231.L.Q....H..E-------------------------EFWILYLSNA---------------------------------
G2TLY3_BACCO/106-226.L.S....Q..E-------------------------HFVCLYLNIK---------------------------------
R7EY42_9BACI/103-223.K.K....Q..E-------------------------CFYALYFNQK---------------------------------
L0H3Y4_9GAMM/46-165.L.E....H..E-------------------------VFAVLWLDNR---------------------------------
R6GG04_9CLOT/100-220.IGR....I.KE-------------------------HVVLALFDAK---------------------------------
D4JA77_9FIRM/24-145.M.D....R..E-------------------------LFCIVNLQAD---------------------------------
D7CPX9_SYNLT/43-165.A.D....R..E-------------------------HFVVLYLNSG---------------------------------
D3IDD4_9BACT/108-228.Q.S....V..E-------------------------HGLVLYLNQG---------------------------------
G8X752_FLACA/104-224.L.P....H..E-------------------------EFWVLFLNNS---------------------------------
E4T6J8_PALPW/112-232.L.P....H..E-------------------------EFWVGLLNGA---------------------------------
F2F3X1_SOLSS/33-153.S.D....R..E-------------------------RFVVLGMSTK---------------------------------
C9R212_AGGAD/98-218.I.E....R..E-------------------------IFMVLFLDNQ---------------------------------
R6JKI4_9CLOT/110-230.L.E....Q..E-------------------------EIRVMFLNTK---------------------------------
I0JPE2_HALH3/108-228.L.K....Q..E-------------------------HFICLFLNTK---------------------------------
R7R7R1_9FIRM/108-228.K.N....T..E-------------------------QVILILLDSK---------------------------------
H1XUR5_9BACT/106-226.GFK....K.EE-------------------------EFWMISLDSK---------------------------------
K9SZY0_9SYNE/115-236.Q.P....Q..E-------------------------RLAVLMLDSK---------------------------------
W0I3D4_9ENTR/106-226.R.E....R..E-------------------------VFVVMFLDNR---------------------------------
Y1707_THEEB/118-239.Q.A....T..E-------------------------RFAVLLLDVR---------------------------------
Y371_SYMTH/111-231.L.S....I..E-------------------------QFHVILLNAK---------------------------------
B8E079_DICTD/107-227.L.K....E..E-------------------------HLFCIYMDVK---------------------------------
Y3003_CLOBH/107-227.L.K....Q..E-------------------------KLKILILNTK---------------------------------
E3F0B3_KETVY/131-251.R.E....I..E-------------------------QFRILFLDRK---------------------------------
R5B616_9BACE/122-242.L.D....A..E-------------------------EFWIIVLSRS---------------------------------
I0HV36_RUBGI/104-224.R.E....Q..E-------------------------VFAVLFLDSQ---------------------------------
C4LDH2_TOLAT/44-164.Y.E....N..E-------------------------VFGSLFLDNQ---------------------------------
Y056_PSYIN/104-224.LIAKMHNLPYE-------------------------VFAAILLDTQ---------------------------------
S6AXP4_PSERE/103-223.S.E....H..E-------------------------QFACLFLDAK---------------------------------
W0A9L5_9SPHN/53-173.Q.R....E..E-------------------------CLRALYLNAR---------------------------------
H6L397_SAPGL/118-239.L.P....H..E-------------------------EFWVLLLNRA---------------------------------
A5FDW5_FLAJ1/32-155.E.NKIEFI..E-------------------------QCKIMLLSQS---------------------------------
Q28UH5_JANSC/152-272.R.E....T..E-------------------------QFRILYLNRR---------------------------------
D0MFA0_RHOM4/123-243.L.K....R..E-------------------------VFKIVLLNTA---------------------------------
Y865_CLOK5/107-227.M.K....Q..E-------------------------HLKVILLNTK---------------------------------
D5QD62_KOMHA/104-224.AHD....C.TE-------------------------QFRVLFLDAE---------------------------------
F4GI24_SPHCD/108-227.R.T....R..E-------------------------HFICVALNGA---------------------------------
R5J4N2_9FIRM/106-226.L.K....K..E-------------------------VFKVVLLNTK---------------------------------
E4RMM6_HALHG/110-230.L.K....Q..E-------------------------VLRTILLDVK---------------------------------
K0N1Z4_DESTT/100-219.R.K....Q..E-------------------------HFLCASINGA---------------------------------
Y240_IDILO/103-223.Q.G....R..E-------------------------VFAILLLDSQ---------------------------------
A8HSP7_AZOC5/113-233.A.D....K..E-------------------------QVRVLFLDKR---------------------------------
D6YWS9_WADCW/103-223.E.T....K..E-------------------------VLISLLLDTK---------------------------------
D1ANH5_SEBTE/106-226.K.K....I..E-------------------------IFKVLFLNTQ---------------------------------
R5PKC0_9PORP/110-230.L.D....H..E-------------------------EFWVIYLNRS---------------------------------
Y2933_BACLD/103-223.L.S....Q..E-------------------------HFVCVYLNTK---------------------------------
Y1909_OCHA4/128-248.E.T....R..E-------------------------QFRILFLDKK---------------------------------
R5W419_9DELT/101-231.SQKIIADSYVE-------------------------KTVVVYVDGA---------------------------------
R6FN60_9FIRM/104-224.L.K....K..E-------------------------MFKAVLLDSK---------------------------------
R5WTV6_9BACT/101-221.L.P....H..E-------------------------EMWALYLSSA---------------------------------
X4Z9N8_9BORD/80-200.R.P....I..E-------------------------HCIALYLDQQ---------------------------------
D8PG30_9BACT/100-219.R.K....Q..E-------------------------HFLCATINGA---------------------------------
R7BSV8_9FIRM/106-226.MCARLFGLNQE-------------------------HVCVAALDAH---------------------------------
I1XEZ6_METNJ/103-223.F.P....H..E-------------------------VFACLFLDTR---------------------------------
R7FUJ0_9FIRM/100-216.LGV....T.EE-------------------------TVLLLLLDNK---------------------------------
R6WD84_9FIRM/103-213.ILDMFDDSVVE-------------------------KIAVICLSRD---------------------------------
R7L4R8_9FIRM/143-267.VGE....S.TE-------------------------KFMLACFDSR---------------------------------
I0GV74_SELRL/24-144.E.A....Q..E-------------------------VLACIYMNVK---------------------------------
Y236_NITOC/103-223.Y.P....F..E-------------------------VFSCLFLDNR---------------------------------
V5UGD1_9BURK/48-168.F.E....H..E-------------------------VFAVLFLDTR---------------------------------
Y735_PROA2/101-221.E.M....R..E-------------------------HLFLLNLNTK---------------------------------
R5KTK3_9FIRM/28-150.M.D....R..E-------------------------VLCVVNLKSD---------------------------------
D4K5B3_9FIRM/105-225.AWS....D.YE-------------------------RAMLVSLDSR---------------------------------
F0S368_DESTD/105-225.L.P....V..E-------------------------IFGIVTLNTK---------------------------------
R6AMD6_9CLOT/107-226.IAE....EREE-------------------------VCLAVCLNAK---------------------------------
A9C308_DELAS/43-163.E.P....N..E-------------------------IFVVVFMNSM---------------------------------
Y086_PSESM/103-223.E.P....H..E-------------------------VFACLFLDNK---------------------------------
E5AN07_BURRH/118-238.R.P....Y..E-------------------------VFVCLFLDTR---------------------------------
I1YGQ5_METFJ/47-167.F.E....H..E-------------------------VFATLFLDSQ---------------------------------
Y831_CHLPB/101-221.E.S....K..E-------------------------HLFVLHLNTK---------------------------------
M1WKR1_DESPC/106-226.K.G....V..E-------------------------EFWAAYLDSK---------------------------------
R6ISZ4_9PROT/112-232.Q.T....V..E-------------------------EFRIIFLNSK---------------------------------
R6CTM9_9CLOT/108-228.RGR....T.KE-------------------------TLIILCMTPD---------------------------------
YKFG_ECOLI/37-157.L.E....R..E-------------------------EFRVLYLDNQ---------------------------------
Y491_PSYWF/103-218.RRE....S.KE-------------------------VFAVLCLDNG---------------------------------
Y220_SYNP2/114-235.Q.D....Q..E-------------------------RFAVLCLDVK---------------------------------
A0A068NWT8_9BACT/84-204.E.K....R..E-------------------------HFVAILLDAK---------------------------------
R7K9V0_9FIRM/108-233.ASALLKGSVTE-------------------------EMHVLCLDVK---------------------------------
A5FDD8_FLAJ1/31-154.P.GKIEFL..E-------------------------QFKVLLLNQS---------------------------------
R5GDH1_9BACT/107-227.L.P....T..E-------------------------ECHVMLLNQQ---------------------------------
Q0AUQ1_SYNWW/85-205.L.D....R..E-------------------------HFKAILLNRK---------------------------------
D9QPF6_BRESC/128-248.E.P....R..E-------------------------QFRVLYLDNR---------------------------------
R6XU52_9CLOT/109-229EK.R.......E-------------------------IAKVIILNNK---------------------------------
Y3603_CHLAA/106-226.L.D....Q..E-------------------------HLRTILLDTK---------------------------------
R6RDQ3_9CLOT/91-211.AGK....N.EE-------------------------CVYAFFLDAK---------------------------------
F4KLC9_PORAD/128-263.L.D....H..E-------------------------ELRCLYLDAS---------------------------------
Y948_POLSJ/103-223.R.P....H..E-------------------------IFAVLFLDSQ---------------------------------
R7DNC7_9PORP/105-225.L.P....Q..E-------------------------EFWIVLLNVA---------------------------------
Y183_TOLAT/103-223.R.P....R..E-------------------------VFAMLLLDNQ---------------------------------
Y909_FUSNN/111-231.E.E....I..E-------------------------KFYVIYLSSS---------------------------------
R6MZM4_9CLOT/103-225.TGR....S.NE-------------------------AVVLTLLDGK---------------------------------
F3ZRZ4_9BACE/110-230.A.V....Q..E-------------------------EFWILLLNQA---------------------------------
U5NA38_9BURK/110-230.R.P....E..E-------------------------VFYVLCLDSR---------------------------------
Q6MR78_BDEBA/36-155PH......A..E-------------------------ELWVIALDSQ---------------------------------
F5Z6Y4_ALTSS/43-163.R.K....Y..E-------------------------IFYCLFLDSQ---------------------------------
D5BAB1_ZUNPS/24-148.K.ETIELH..E-------------------------TFKILLLNNA---------------------------------
D5EAP3_METMS/107-227.Q.K....K..E-------------------------HLTTLHLDTK---------------------------------
R5IJ61_9CLOT/110-230.L.E....Q..E-------------------------EIRVMFLNTK---------------------------------
Y3032_BACHD/108-228.L.S....Q..E-------------------------NFVCLYLNTK---------------------------------
R5E933_9FIRM/36-158.Y.D....R..E-------------------------VVGVINFDNK---------------------------------
D4J877_9FIRM/113-233.L.G....H..E-------------------------EVHVMMLDTK---------------------------------
Y2643_PSEHT/103-223.L.Q....Q..E-------------------------VFMVLYLDSQ---------------------------------
Q5QX33_IDILO/37-152.VQGSYQQCSTE-------------------------VAGLLLLDSQ---------------------------------
R7M883_9CLOT/104-224.I.K....Q..E-------------------------EFYCLYLDTK---------------------------------
R6BBF6_9CLOT/102-222.E.T....Q..E-------------------------NFYALYLNPK---------------------------------
H2J3A1_MARPK/96-216.E.D....R..E-------------------------NVLCISLNSK---------------------------------
G0A564_METMM/37-156.Y.E....H..E-------------------------VFVCVFLNSQ---------------------------------
R5KL45_9CLOT/110-230.L.D....K..E-------------------------RVYSLLFDSR---------------------------------
U5RWB8_9CLOT/107-227.L.K....Q..E-------------------------YFKVIMLNTK---------------------------------
R5BFG9_9FIRM/111-231.E.K....E..E-------------------------HFCAAFLTCK---------------------------------
E6XD68_CELAD/111-231.L.P....H..E-------------------------EFWVVYLNNS---------------------------------
R6U2T9_9CLOT/91-212.K.K....Q..E-------------------------ELKTVILDKS---------------------------------
Y1530_RUBXD/107-226.L.D....R..E-------------------------HFVVVLLNTK---------------------------------
E3HWS2_ACHXA/104-224.R.Q....V..E-------------------------HCIALYLDNR---------------------------------
Y1467_DESAP/109-229.F.D....R..E-------------------------HFWALVLNTK---------------------------------
S0EYD6_CHTCT/109-229.E.T....K..E-------------------------HFKSILLDTK---------------------------------
B8CX04_HALOH/119-239......NTTNDK-------------------------RLMILTLDED---------------------------------
G8AJ12_AZOBR/138-258.Q.P....M..E-------------------------QFRLLFLDRK---------------------------------
Q5E054_VIBF1/37-156.Y.E....R..E-------------------------VFAVLLLDNQ---------------------------------
A4XMN4_CALS8/40-162PE.........E-------------------------VLVVLCLDVQ---------------------------------
B0T9R6_CAUSK/132-252.C.E....R..E-------------------------AFRVLFLDKK---------------------------------
G2PLV8_MURRD/13-138.LRENKIRRNQE-------------------------HFWVVGLNHN---------------------------------
S6CEQ7_9GAMM/103-223.S.P....S..E-------------------------CFAVLFLDNR---------------------------------
C7R7U8_KANKD/103-223.H.K....R..E-------------------------QFVALFLNNQ---------------------------------
F9D3V0_PREDD/107-227.L.D....V..E-------------------------EFHILLINQA---------------------------------
Q93MC6_CLOPE/24-144.V.D....R..E-------------------------YLIVIVLDVK---------------------------------
C5AC38_BURGB/145-265.R.A....H..E-------------------------VFVCLYLDAQ---------------------------------
R7A5M2_9FIRM/97-217.L.T....Q..E-------------------------NFVCVYLDTK---------------------------------
A6L552_BACV8/29-152.E.GTICYK..E-------------------------YFKVLFLNQS---------------------------------
F2IKK1_FLUTR/109-229.L.T....H..E-------------------------EFYILYLNNS---------------------------------
A3HWS3_9BACT/110-230.E.S....V..E-------------------------YFYLVLLSRS---------------------------------
K7I0N5_CAEJA/44-164.R.P....N..E-------------------------VFMGLFLNSQ---------------------------------
R6SSK7_9FIRM/109-229.E.K....Q..E-------------------------IMKLLMLNSK---------------------------------
A5CZE2_PELTS/18-139.A.D....R..E-------------------------KFLIICLNTR---------------------------------
F0R980_BACSH/22-145.N.DILIY...E-------------------------SAYIILINSA---------------------------------
Y1687_CLONN/107-227.F.K....E..E-------------------------HLRVIMLNTK---------------------------------
Y202_PHOPR/103-223.R.Q....R..E-------------------------VFYVLFLDNQ---------------------------------
A1B298_PARDP/42-161.G.D....V..E-------------------------RFHVLYLDRR---------------------------------
D5BRL2_PUNMI/126-246.Q.P....I..E-------------------------HFLILCLDNQ---------------------------------
Q31NW2_SYNE7/115-236.A.E....Q..E-------------------------RFALLLLDVR---------------------------------
E3I6Z7_RHOVT/132-252.E.D....R..E-------------------------QFRILFLDRR---------------------------------
A5FDP1_FLAJ1/30-153.Q.GKIDYF..E-------------------------QFKILFLNHS---------------------------------
F3Y852_MELPT/109-229.M.Q....Q..E-------------------------HLICMYLNTK---------------------------------
C4L9T8_TOLAT/47-167.E.P....N..E-------------------------IFAALFLDTR---------------------------------
F5YI93_TREPZ/17-136.A.K....K..E-------------------------QFIVVTLNTA---------------------------------
R6SU20_9CLOT/112-232.M.E....Q..E-------------------------HVKLLVLNTK---------------------------------
R7KF20_9CLOT/103-223.K.K....Q..E-------------------------CFYCLYVDKL---------------------------------
K9TJT1_9CYAN/114-235.Q.T....Q..E-------------------------RFALLLLDVK---------------------------------
Q2JK53_SYNJB/110-231.E.S....Q..E-------------------------HFAVLHLDVK---------------------------------
C6VSA9_DYAFD/113-233.K.T....H..E-------------------------EFWILLLNRG---------------------------------
D5EV64_PRER2/108-228.L.D....V..E-------------------------EFWVLLLNQQ---------------------------------
R7IUZ4_9CLOT/110-230EK.Q.......E-------------------------ILKVVILGNK---------------------------------
Y1152_PASMU/103-223.K.E....R..E-------------------------IFQVLFLDNQ---------------------------------
Q74B73_GEOSL/43-162.E.T....K..E-------------------------HFVVLHLDGK---------------------------------
F4B2W6_DOKS4/116-236.L.G....H..E-------------------------EFWVLFLNNS---------------------------------
D5X1M3_THIK1/105-225.Q.P....V..E-------------------------IFAVLFLDNQ---------------------------------
A8ZUS2_DESOH/107-227.R.H....R..E-------------------------TFAAIFMDAK---------------------------------
G7Z8F8_AZOL4/173-294.E.P....T..E-------------------------QFRLLFLDRK---------------------------------
Y2304_PARDP/142-262.G.E....I..E-------------------------QFRVLYLDRK---------------------------------
R7NPE7_9FIRM/105-225.IGK....D.SE-------------------------EVYLLLMDSK---------------------------------
W8WVA9_CASDE/104-224.L.R....V..E-------------------------HCIALFLDSQ---------------------------------
U5QKW2_9CYAN/112-233.A.R....Q..E-------------------------QFAVLLLDIK---------------------------------
R6YXM2_9FIRM/28-151......SDLDRE-------------------------YVMVLNLNTR---------------------------------
A5EYF9_DICNV/277-401.LLMHYKGLGFE-------------------------EVAILLLNQK---------------------------------
Q8A1G6_BACTN/110-230.L.E....Q..E-------------------------EFWVLLLNQA---------------------------------
C5D8D2_GEOSW/48-168.A.D....R..E-------------------------KFVVVCLDTK---------------------------------
Q162D1_ROSDO/179-299.R.E....T..E-------------------------QFRVLFLDRK---------------------------------
R5X7H1_9CLOT/114-234.A.P....K..E-------------------------IFKIVLLNTK---------------------------------
Y182_VIBTL/103-223.R.Q....R..E-------------------------AFYILFLDNQ---------------------------------
A8ZYJ4_DESOH/29-149.T.D....D.VE-------------------------TLYCLYLDTK---------------------------------
E6WAK0_PANSA/97-217.Q.E....R..E-------------------------IFMALFLDNQ---------------------------------
Y4248_SHEON/103-223.R.S....Y..E-------------------------VFAILLLDSQ---------------------------------
A1VUW6_POLNA/47-167.L.E....H..E-------------------------VFAVLMLDAQ---------------------------------
R6UEU9_9CLOT/103-223.VGR....E.YE-------------------------AVVLLLLDSK---------------------------------
A9B2B0_HERA2/108-228.L.D....K..E-------------------------HLRVVILNTK---------------------------------
F2JQE5_CELLD/113-233.S.R....E..E-------------------------RFIITLLDAK---------------------------------
R6BBW9_9CLOT/86-206.QGR....E.TE-------------------------ALLLVCLDAG---------------------------------
R6PK66_9FIRM/110-230.E.E....Q..E-------------------------LLICMMLDTK---------------------------------
A3CRJ6_METMJ/103-222.K.K....Q..E-------------------------YFFCITLNGA---------------------------------
F5WTJ4_ERYRF/99-224EE......Q..E-------------------------LFRVLFLSTQ---------------------------------
A6LJI8_THEM4/94-212...D....Q..E-------------------------VVRVIMLNSK---------------------------------
D6XT27_BACIE/107-227.L.T....Q..E-------------------------HFVCLFLSTK---------------------------------
Q3JDF2_NITOC/50-170.R.K....A..E-------------------------VFGCLYLDNR---------------------------------
I5B471_9DELT/107-227.K.N....K..E-------------------------HFLGIFLDAK---------------------------------
C1A4H3_GEMAT/123-243.A.P....V..E-------------------------EFHVAILDAQ---------------------------------
F0S7A0_PSESL/28-151.M.DSIEIV..E-------------------------QFKIMLLNKS---------------------------------
D8J1T0_HERSS/103-223.R.E....Q..E-------------------------CFVALFLDVR---------------------------------
Y126_VIBF1/103-223.R.H....R..E-------------------------AFYVLFLDNQ---------------------------------
S6B1P0_9PROT/103-223.L.P....H..E-------------------------VFMALFLDAQ---------------------------------
R7CMI7_9FIRM/113-233.E.E....Q..E-------------------------LVICMMSDVK---------------------------------
R7EZ53_9BACT/126-247.LRPEIAHLGHE-------------------------EMWIMMLNRA---------------------------------
R6H769_9CLOT/110-230EK.Q.......E-------------------------IVKLFLLNNK---------------------------------
C4ZN65_THASP/43-163.E.P....N..E-------------------------IFAVVFLDNQ---------------------------------
B0TBY8_HELMI/102-222.L.D....R..E-------------------------VFRAIALNTK---------------------------------
R5ETG6_9FIRM/102-222.FGR....N.VE-------------------------TVFLLCLDAK---------------------------------
R6YP13_9BACT/108-228.L.D....V..E-------------------------EGWILMMNQN---------------------------------
R7GFK2_9CLOT/110-230EK.K.......E-------------------------IVKLIILNNK---------------------------------
R7K2K0_9CLOT/122-242.L.E....T..E-------------------------QVRLLVLDGK---------------------------------
K8GK29_9CYAN/114-235.Q.A....Q..E-------------------------RFAVLLLDVK---------------------------------
C6D864_PAESJ/107-227.L.K....K..E-------------------------HFVCLFLNTK---------------------------------
C7PSZ0_CHIPD/115-235.A.A....L..E-------------------------SFHVLYLNHA---------------------------------
Q7UT53_RHOBA/84-208.G.L....Q..E-------------------------EFHIVTLDTK---------------------------------
R5R0P5_9FIRM/102-222.E.Q....Q..E-------------------------KVIVLCLNSR---------------------------------
W0PC12_9BURK/120-240.E.V....V..E-------------------------KCLLLLVNTR---------------------------------
G8QTS4_SPHPG/107-230.R.Q....Q..E-------------------------HFIVTSLNGA---------------------------------
D2RM81_ACIFV/99-219.E.N....H..E-------------------------HFLVVLLNSK---------------------------------
R5G402_9PORP/125-250.IYTDLYNLSHE-------------------------ELWIVLFNQR---------------------------------
E1QKP1_DESB2/107-226.QSL....E.RE-------------------------VFRVMLLDGR---------------------------------
G8QP73_AZOSU/103-224.E.P....R..E-------------------------VFLALWLDAQ---------------------------------
A8MGD7_ALKOO/26-153.FEDFIGGATLE-------------------------RLALLCIDSS---------------------------------
R7BLV7_9FIRM/108-228.L.E....Q..E-------------------------QLRLLLLDTK---------------------------------
D3HM28_LEGLN/60-181.Y.K....N..E-------------------------TFVALFLDNQ---------------------------------
Q1DAY3_MYXXD/102-222.L.R....R..E-------------------------VFHVLCFNAR---------------------------------
I5AQT4_EUBCE/111-231.E.E....Q..E-------------------------VVCAVMLDTK---------------------------------
R5VMV8_9FIRM/105-225.V.M....Q..E-------------------------MLVAVFLDVK---------------------------------
Q2IEL9_ANADE/82-203........APVE-------------------------EFHVVLLDVR---------------------------------
A7HWC4_PARL1/109-229.N.P....T..E-------------------------QFRILFLDRK---------------------------------
R6B608_9CLOT/107-227EK.R.......E-------------------------KVKVLVLNTK---------------------------------
D5V5W3_ARCNC/100-219.K.R....Q..E-------------------------YFLTLYLDGA---------------------------------
R6XJC6_9FIRM/100-221.K.N....K..E-------------------------CLYAMYLDVK---------------------------------
E0TDI4_PARBH/124-244.E.T....V..E-------------------------QFRVLYLNAK---------------------------------
Y1513_CHLCH/101-221.E.S....K..E-------------------------HLFVLHLNTK---------------------------------
K0C1Z8_CYCSP/42-162.Q.Q....R..E-------------------------VFSCLFVDSQ---------------------------------
A9BIK5_PETMO/99-218.L.S....T..E-------------------------TVRAIFLDSK---------------------------------
R6XQD6_9BACT/105-225.L.D....H..E-------------------------EFWVILLNRA---------------------------------
R6IAE0_9FIRM/101-226.LMSKYLGAREE-------------------------MVYMLSLDFD---------------------------------
R7G579_9FIRM/103-223.Q.Q....Q..E-------------------------HFLVVFLNQR---------------------------------
Q0AQV1_MARMM/105-225.A.T....T..E-------------------------QFRVLFLDRK---------------------------------
G4RE53_PELHB/106-226.E.T....V..E-------------------------QFRILFLDKK---------------------------------
K6ZUW9_9ALTE/103-223.Q.P....H..E-------------------------VFAMLLLDSQ---------------------------------
R6NN99_9CLOT/107-230.AVAKFYGCKSE-------------------------VFYLICLDAA---------------------------------
G2KSU9_MICAA/115-235.E.R....K..E-------------------------HFRILFLNRK---------------------------------
F2NFN8_DESAR/112-229.L.K....D..E-------------------------QFRVIFLNSQ---------------------------------
R7LJJ8_9BACT/104-224.L.A....F..E-------------------------ESHVMLLNNN---------------------------------
Y1229_STRGC/104-224.K.K....Q..E-------------------------HLVALYLNTQ---------------------------------
Q7VMM9_HAEDU/36-156.E.E....R..E-------------------------VFGVLFWDTQ---------------------------------
R6X5H3_9PORP/105-225.L.P....H..E-------------------------ELWIALTNRS---------------------------------
C0QCU0_DESAH/53-178.P.D....R..E-------------------------QFCILMLNAK---------------------------------
R6YU81_9BACE/108-228.L.A....V..E-------------------------ECWVLLLNQA---------------------------------
R7MKG1_9FIRM/104-227...........E-------------------------IYLFVTADNE---------------------------------
A4XHM1_CALS8/104-224.R.K....N..E-------------------------VFYVICLDTQ---------------------------------
Y054_RUEPO/103-223.R.E....T..E-------------------------QFRVFYLDRK---------------------------------
E6UJ92_RUMA7/101-229.LLNFFKGDTTE-------------------------RLCAFSINKA---------------------------------
F0SVI5_SYNGF/109-229.L.D....R..E-------------------------HFRVMHLNTK---------------------------------
Q7MJB1_VIBVY/64-183.Y.E....H..E-------------------------VFAVLLLDNQ---------------------------------
R7GDT2_9CLOT/106-227LK......Q..E-------------------------KLLVLFVDAK---------------------------------
Q5DY97_VIBF1/44-164.Q.E....R..E-------------------------VFAILMLDNQ---------------------------------
D4H3V4_DENA2/100-220.D.K....K..E-------------------------HFVALFLDVN---------------------------------
R7J2I5_9BACT/122-242.L.D....H..E-------------------------EFWLLLLNRA---------------------------------
R5NLB5_9FIRM/119-239.L.E....T..E-------------------------RLLVVMLNTK---------------------------------
R6LL38_9FIRM/102-222.IGE....P.EE-------------------------VVYLLCLDAK---------------------------------
W0BCD9_9GAMM/103-224.K.K....N..E-------------------------TFSAIFLDSQ---------------------------------
E3H613_ILYPC/104-224.S.P....I..E-------------------------EFKVIFLDTA---------------------------------
F9ZRH5_ACICS/103-223.R.S....R..E-------------------------VFLVLFLDNR---------------------------------
R5Y3P6_9BACE/122-242.L.P....Q..E-------------------------EFWVVLLNAS---------------------------------
Q2S8K4_HAHCH/83-204.H.E....Q..E-------------------------VFACMFLDNQ---------------------------------
F0RUU5_SPHGB/107-226.R.M....Q..E-------------------------HFLSICLNGA---------------------------------
Y009_HISS2/101-221.K.D....R..E-------------------------IFMVLFLDNQ---------------------------------
D3SNH3_THEAH/104-223.KDKVDDRR..E-------------------------HLVAVYLGPN---------------------------------
R5S153_9FIRM/102-222.LGE....R.RE-------------------------VFYEACLDAK---------------------------------
A1AQ75_PELPD/46-165.E.T....K..E-------------------------HFLCLHLDGK---------------------------------
B2KEG6_ELUMP/107-227.H.K....D..E-------------------------VFEVIYLTVR---------------------------------
R5QF23_9FIRM/100-221.VGI....T.SE-------------------------VVYMLLLDNK---------------------------------
Y3582_PELPD/108-228.C.R....R..E-------------------------YFLVLLLDGK---------------------------------
R7GKY6_9FIRM/100-221.L.S....Q..E-------------------------HFLIMILDNH---------------------------------
J7QP12_METSZ/120-240.A.E....R..E-------------------------EFRILFLDKR---------------------------------
R6GHR2_9FIRM/104-224.L.E....Q..E-------------------------QMHVMFLDTK---------------------------------
W8T6D1_EUBAC/120-240.L.K....K..E-------------------------IFKVVMLNTK---------------------------------
B8DJE6_DESVM/104-224.S.P....H..E-------------------------EVWVALLDTQ---------------------------------
I0DVS5_PROSM/39-159.L.E....R..E-------------------------AFIVLYLNQQ---------------------------------
A0L491_MAGMM/114-234.R.T....E..E-------------------------VFYVLCLDAQ---------------------------------
Y952_HAEIN/100-220.E.E....R..E-------------------------VFMVLFLDNQ---------------------------------

PF15659

E4RXN7_LEAB4/136-223-MDAN...STRG-------------------------IEFSLTGSME---------------------------------
R7IZD2_9BACT/1-90-LASH.....TK-------------------------VEWGRTLVG.---------------------------------
Q89ZT9_BACTN/85-156-LTQN.....TS-------------------------VEWSMCV..D---------------------------------
R6S6W4_9BACE/193-277-AADN.....TS-------------------------VEWKLDVYDD---------------------------------
Q8A2V0_BACTN/107-192-AADH.....TT-------------------------VEWKLDVYDD---------------------------------
R5PFE2_9PORP/254-344-MSNNVSGSGTG-------------------------VEISQAMTGV---------------------------------
R7DCI7_9PORP/81-171-LSFNVTGSSSQ-------------------------VEIGLAQTGI---------------------------------
I3YN54_ALIFI/106-189-GADN.....SN-------------------------AEWRFSRYDE---------------------------------
R7IYP6_9BACT/147-233-LARN.....TK-------------------------VEWSQLMLGQ---------------------------------
R5JRJ4_9BACE/240-330-AANN.....TK-------------------------VEWGLSGYQG---------------------------------
Q8A3M7_BACTN/941-1029-VADN.....TS-------------------------VEWTLKGGYM---------------------------------
R7J1U0_9BACT/141-227-LADQ.....TC-------------------------KEWPLFQTGK---------------------------------
E4RWK7_LEAB4/398-485-MDAN...TTRG-------------------------TEFSLAGSME---------------------------------
E4RWK9_LEAB4/277-362-AAEN.....SD-------------------------VEFLLTTVES---------------------------------

PF05021

Q380R2_ANOGA/286-599ASGTVKHVRNIK-------------------------THFLTAQECILAGHLQNKYPNRCKDS...SNGYFG--------
NPL4_CRYNJ/281-610DITKTLYKRHAQ-------------------------SYTASSLEMLLSAAYQLSHPLSTRMS...PTGHYS--------
NPL4_MAGO7/285-589GDGSVVCKRHAD-------------------------SYFLSSLEVCFAARLQAQHPKPSKWS...DTGRFG--------
NPL4_PICST/268-574KNGTVLCKRHKD-------------------------SYFLSNLEILMAARNQIQHANITKFS...SSGQFS--------
NPL4_DEBHA/260-563KNGTVLCKRHKN-------------------------SYFLSCLEVIMAAKYQVSNPNITKHS...NSGRFS--------
NPL4_DROME/282-593SIGTVKQIRGIE-------------------------SHFITAQECITAGELQNRHPNPCKYA...SNGVFG--------
NPL4_CANAL/286-595KNGKVLCKRHKD-------------------------SYFLTNLEIIMAAKFQLKYPNISKYSTAKNNGQFS--------
NPL4_PICGU/288-564RNGTVLCKRHKD-------------------------TYFLSCLEVLMAARFQIEHPNITKHS...NSGRFS--------
A8X418_CAEBR/151-470AEGTVHYTRHKD-------------------------SFFLSAEECITAGMLQNAHPNVTDYS...MDRRYG--------
NPL4_COCIM/290-605GDGTVICRRHID-------------------------SYYLSSLEVAFAARLQARYPKPSKWS...ETGRFG--------
NPL4_ASPOR/287-599GDGSVICKRHID-------------------------SYFLSSLEITFAARLQAQYPKATKWS...RTGRFG--------
NPL4_SCLS1/289-608GDGTVICKRHID-------------------------SYYLSSLEIAFAARLQAKHPKPTKWS...DTGKFG--------
NPL4_KLULA/265-593GDGSVYCKRHKD-------------------------SFFLSSLEVIMAAKHQLRHPNVSKFS...ETGLFS--------
NPL4_AJECN/292-589GD..........-------------------------.......EIVFAAQLQARYPKATKWS...ETGRFG--------
A7SZA1_NEMVE/172-484KKGTVKHLRDIN-------------------------THFLTAEECIMAGDFQNQYVSPCRYA...SSGKFG--------
NPL4_VANPO/248-566GNGTVFCKRHKD-------------------------SFFLSSLEIIMAAKHQLAFPNASRFS...EQGKFS--------
NPL4_CANGA/260-578GDGTVLCKRHKD-------------------------SFFLSSLETIMAAQHQTRHPNVSKFS...EQGIFS--------
Q2HAC4_CHAGB/250-562GDGTAVCKRHAD-------------------------SYFLASQEVVFAARMQAQHPKPSKWS...DTGRFG--------
NPL4_YEAST/259-577GDGSVFCKRHKD-------------------------SFFLSSLEVIMAARHQTRHPNVSKYS...EQGFFS--------
NPL4_ASHGO/241-560GDGSVFCKRHKD-------------------------SFFLSSLEVITAARHQLHHRNACRFS...DQGFYS--------
NPL4_PHANO/275-593GDGSVICKRHID-------------------------SYYLSSLEIAFAARYQAKYPRPTKWS...ETGKFG--------
NPL4_LODEL/287-597RDGTVLCKRHKD-------------------------SYFLTNLEIIMAAKFQIKNPNITKYA...NLGEFS--------
F7C8S1_XENTR/250-558RKGTVRYSRNKD-------------------------TYFLSAEECITSGFFQNKHPNLCRLS...PDGHFG--------

PF01398

D1039_DICDI/532-641.............V--------------------------------------------------------FRITTI-II-
PSDE_DICDI/26-139.............T--------------------------------------------------------IRVIDV-FA-
CSN5_YEAST/66-190.............N--------------------------------------------------------IVVMDC-FN-
PSMD7_DROME/6-121.............V--------------------------------------------------------LDVSNS-FA-
RPN8_YEAST/3-116.............T--------------------------------------------------------IRVTNS-FA-
RPN11_SCHPO/25-138.............T--------------------------------------------------------VRVVDV-FA-
CSN5_CAEEL/51-165.............F--------------------------------------------------------I.ILDV-FA-
EIF3F_ARATH/23-133.............T--------------------------------------------------------VDIRNS-YA-
EIF3F_HUMAN/87-196.............S--------------------------------------------------------VEVTNC-FS-
BRCC3_HUMAN/7-148............RS--------------------------------------------------------DSKFAY-TG-
O61792_CAEEL/36-151.............T--------------------------------------------------------LDIGNS-FA-
EIF3H_HUMAN/34-146.............R--------------------------------------------------------LEITNC-FP-
EIF3F_CAEEL/2-117.............S--------------------------------------------------------IQVTNC-FA-
YPT5_CAEEL/24-137.............T--------------------------------------------------------INVTDV-FA-
RPN8_SCHPO/12-125.............V--------------------------------------------------------VNVANS-YA-
EIF3F_SCHPO/18-129............RE--------------------------------------------------------IEIKSC-FA-
CSN6_HUMAN/36-148.............N--------------------------------------------------------IEVMNS-FE-
EIF3H_CAEEL/10-139............SR--------------------------------------------------------LEITNC-FP-
STABP_HUMAN/252-361.............F--------------------------------------------------------T.ITHV-LI-
BRCC3_MOUSE/7-148EMRTVQEKMDTIRI--------------------------------------------------------VHIHSV-II-
PSD7A_ARATH/12-125.............V--------------------------------------------------------VDVTNS-YA-
CSN6B_ARATH/6-136.............T--------------------------------------------------------VEIFNS-FE-
CSN5B_ARATH/54-168.............T--------------------------------------------------------IIVMDA-FA-
PRP8_HUMAN/2099-2205............QV--------------------------------------------------------KEIRCI-VM-
CSN5_SCHPO/30-144.............S--------------------------------------------------------LIILDS-FA-
G0RSA9_HYPJQ/14-125.............N--------------------------------------------------------VRVSNS-FA-

PF14464

Q8TYS8_METKA/10-115-------------T--------------------------------------------------------ITIDSL-IVV
Q8TQ16_METAC/27-138-------------D--------------------------------------------------------GIITEV-LIL
O27052_METTH/16-131-------------V--------------------------------------------------------LHVTGL-IFL
Q9I213_PSEAE/7-137-------------G--------------------------------------------------------TNIQDE-LHM
Q8ZW14_PYRAE/1-111-------------S--------------------------------------------------------WRWMKN-VAA
Q9YE90_AERPE/3-117-------------V--------------------------------------------------------YAYILY-RTD
P73582_SYNY3/7-143-------------H--------------------------------------------------------WQVVEV-QPT
Q9S2G8_STRCO/5-111-------------P--------------------------------------------------------ERFIPM-LNA
Q9RXB3_DEIRA/6-119-------------Q--------------------------------------------------------VQAHAL-YPL
O67597_AQUAE/5-125-------------G--------------------------------------------------------IRIAYE-AFE
Q216W0_RHOPB/11-140-------------Q--------------------------------------------------------DDLKSI-D.P
Q0A9H9_ALKEH/13-128-------------G--------------------------------------------------------RVRRLV-L.C
Q82SH4_NITEU/5-122-------------S--------------------------------------------------------NLPLRL-I.P
Q2YAE7_NITMU/14-131-------------S--------------------------------------------------------NLPLRL-I.P
Q2SI97_HAHCH/5-122-------------S--------------------------------------------------------DRPLRL-I.P
Q82D25_STRAW/5-122-------------S--------------------------------------------------------GRPERF-I.P
A1SG89_NOCSJ/5-128-------------S--------------------------------------------------------DRPERL-V.E
Q1AY15_RUBXD/6-127-------------V--------------------------------------------------------VDVWRA-..E
Q02B10_SOLUE/5-125-------------G--------------------------------------------------------ETKLVR-..E
Q5Z0V7_NOCFA/5-122-------------S--------------------------------------------------------DRPERF-I.A
A8L770_FRASN/19-136-------------S--------------------------------------------------------DRPERH-I.P
Q47MB9_THEFY/5-122-------------S--------------------------------------------------------DRPERF-I.E
Q2JEP2_FRASC/5-122-------------S--------------------------------------------------------DRPKRF-I.P
Q7MRV8_WOLSU/6-118-------------E--------------------------------------------------------GEVKRL-F.P
Q39VC3_GEOMG/6-119-------------D--------------------------------------------------------GAVSAI-F.R
B3EN74_CHLPB/4-118-------------G--------------------------------------------------------KTVIEA-Y.C
A3DIG3_CLOTH/5-123-------------V--------------------------------------------------------KYVEKV-Y.L
A6TTW0_ALKMQ/7-124-------------E--------------------------------------------------------ILIKKV-Y.A
A4XJZ1_CALS8/5-124-------------K--------------------------------------------------------RIVKKV-Y.L
Q7U4L3_SYNPX/10-140-------------L--------------------------------------------------------DHVWPG-CNR
Q7V9V1_PROMA/10-154-------------I--------------------------------------------------------ELVWPC-CNI
Q46IP8_PROMT/10-154-------------V--------------------------------------------------------THVWNC-QNI
B2J4Y6_NOSP7/5-138-------------V--------------------------------------------------------VEVMPT-ENA
Q2JJY1_SYNJB/6-136-------------I--------------------------------------------------------HELWSV-TNT
A9W9Z2_CHLAA/6-141-------------V--------------------------------------------------------LQVVTL-ENR
Q2IF99_ANADE/8-141-------------I--------------------------------------------------------PNAADR-YHA
TIPK_BPN15/2-106-------------R--------------------------------------------------------YFPCRN-LS.
Q8XYR3_RALSO/2-105-------------R--------------------------------------------------------YMACRN-VA.
Q6XQC1_BPT1/3-111-------------K--------------------------------------------------------YHRIDN-VH.
Q7WX35_CUPNH/81-188-------------S--------------------------------------------------------FRLVPV-Q..
A1VVA1_POLNA/80-189-------------T--------------------------------------------------------WRLAAR-Q..
A0R7L0_PELPD/81-188-------------R--------------------------------------------------------FNYYSL-H..
Q8XYU8_RALSO/133-242-------------D--------------------------------------------------------LAYREL-Q..
Q21Q53_RHOFT/82-191-------------S--------------------------------------------------------LRLLPM-E..
Q120V3_POLSJ/78-187-------------S--------------------------------------------------------WRYEMR-E..
Q8ZSF0_NOSS1/58-173-------------E--------------------------------------------------------ILFYLG-VTN
Q5NXB5_AROAE/80-200-------------Q--------------------------------------------------------FAFREV-G..
Q11ZD2_POLSJ/78-182-------------Q--------------------------------------------------------FRYLPL-A..
Q47D11_DECAR/80-200-------------S--------------------------------------------------------LRLALC-E..
A1U033_MARHV/627-755-------------K--------------------------------------------------------TISVVL-AR.
A1VVG1_POLNA/619-747-------------S--------------------------------------------------------AVIVVA-AL.
Q5HY19_GLUOX/596-724-------------N--------------------------------------------------------ILHIVA-AL.
Q3J4T5_RHOS4/19-143-------------T--------------------------------------------------------IARIEA-AS.
A9BTW4_DELAS/624-751-------------R--------------------------------------------------------TITIAG-LV.
A1U5J0_MARHV/600-724-------------Q--------------------------------------------------------TVHVTG-LV.
Q2LTW5_SYNAS/612-744-------------R--------------------------------------------------------VIWVSE-VI.
Q21PA7_SACD2/610-735-------------K--------------------------------------------------------TIYVTL-VV.
Q3SNL7_NITWN/223-347-------------R--------------------------------------------------------TIIVVD-LI.
Q4FRY9_PSYA2/20-141-------------I--------------------------------------------------------VIKTVS-EP.
Y4QB_RHISN/8-136-------------V--------------------------------------------------------AVITKM-ID.
A0AW82_ARTS2/13-145-------------D--------------------------------------------------------AVVTDV-IG.
A5G3M8_GEOUR/23-151-------------D--------------------------------------------------------VVIDKI-SF.
Q2NDB2_ERYLH/5-124-------------I--------------------------------------------------------TAIQP.-...
Q2K8Q5_RHIEC/6-134-------------F--------------------------------------------------------RVSTMT-IQ.
Q2K2A8_RHIEC/65-199-------------E--------------------------------------------------------RALIPQ-QRL
C5ATD4_METEA/9-143-------------V--------------------------------------------------------QEVYEP-EQA
Q6YRV1_SYNY3/11-152-------------E--------------------------------------------------------VIPIP.-DNE
A1VQ27_POLNA/13-152-------------E--------------------------------------------------------VVPIT.-SDE
Q1QNK4_NITHX/10-142-------------E--------------------------------------------------------LIPVP.-HEA
Q2IDP5_ANADE/4-131-------------E--------------------------------------------------------PDPGA.-..R
Q9I5S7_PSEAE/5-101-------------R--------------------------------------------------------YVACRN-AA.
Q9KVG5_VIBCH/24-139-------------H--------------------------------------------------------LVVCDI-SE.

PF03665

S2JVY4_MUCC1/7-196-------------.........................................................LLVKTA-IP-
H3A1H6_LATCH/3-193-------------EG...........QQ..........................................VLLVDC-IP-
E1ZPZ1_CHLVA/4-226-------------ATG......AGPATA..........................................VRVVDA-VP-
A8PXT4_MALGO/8-186-------------KPN......................................................TTVTDI-IP-
K7IXZ7_NASVI/3-194-------------KSSS........GTE..........................................LQIVDA-VP-
B6ABX0_CRYMR/2-193-------------.........................................................IKVTDV-IP-
F8PZP6_SERL3/3-194-------------.........................................................ILIEDT-IP-
D7UAL1_VITVI/6-204-------------S........TDGSHT..........................................LQISDA-VP-
K3X3W2_PYTUL/3-194-------------.........................................................FVVTDA-VP-
E9H1Y4_DAPPU/4-193-------------.............QS..........................................VKYVDA-IP-
W1NI66_AMBTC/6-203-------------S........SSSSSM..........................................VEIVDA-IP-
U9UHY5_RHIID/3-195-------------DDSNK....................................................IIIADA-IP-
Q8IHW7_PLAF7/5-193-------------EKKKK....................................................CLITNY-IP-
G6CKX7_DANPL/3-196-------------DGAK........SQD..........................................LDIVDA-IP-
A7RMN9_NEMVE/2-189-------------GE.......................................................LYVLDA-VP-
E7F7R8_DANRE/8-194-------------DNPR.........DS..........................................VLCVDC-VP-
K5XVE6_AGABU/4-197-------------V........................................................VEATDA-I