Sequence alignment for CL0368

PF09988

Q8YZE9_NOSS1/2-166----PSGRTHDRITLWSLP-----LVAGLTFW-----------QTRSGNVTLLVAGGFMFGGLMFGPD-LDIY-----SR
K9TIP1_9CYAN/2-166----PSGRTHDEITLWSLP-----LVAGGTYA-----------QTRSSSLTLIVAGGFLFSGLMFGPD-LDIY-----SQ
B2VAC8_SULSY/2-161----AKGRTHDLINFAVLP-----PLI----------------YYLHPSDFISFSTGYFIGTFFLTPD-NDLYL----SK
A5UV55_ROSS1/2-173----PDTRTHDIITVATGA-----LLAPAAYVLLESGG-----RDDAAAGAAVLTGAHLISGLLFSPD-LDID-----SA
K9VXZ1_9CYAN/2-166----PSGRTHDRITLWLLP-----VVTVLTYG-----------LTRSGDLTLILAGSFLFAGLMFGPD-LDIH-----SR
K9X512_9NOST/2-158----PSGRTHDSITLYALP-----VVAGVSFW-----------QTRSGNLTLLVAGGFLFGGLMFGPD-LDIY-----SL
Q10Y23_TRIEI/2-165----PSGPTHDRITLWSLP-----IVIILSYV-----------LVRSTHLTLFVSGGFLFSGLMFGPD-LDIN-----SR
K9R5N7_9CYAN/21-185----PSGQTHDRITIWALP-----FIAGTTFW-----------QTHSSSITLLIAGGFMFGGLMFGPD-LDIY-----SI
Q7U3L4_SYNPX/2-155----ASGRAHDRATLIGGA-----PIGMAAA------------VLWGADAGFIAAAGCLIGGLWLSPD-LDTH-----SN
K9UM54_CHAP6/2-166----PSGRTHDRVTLWSLP-----LIAGGTLY-----------ATARADLAFWVSGGFLFSGLIFGPD-LDLY-----SF
D7CX68_TRURR/2-172----ASGRTHEAINLGVFA-----ALAGGYAYARARSLADPTNLLFAPETLWAFVLSYLIGTFFITPD-LDLAENRMRAR
K9S824_9CYAN/2-177----PSGGTHDRITLWSLP-----LVTGATIA-----------CTRDGDLALLLAGGYLFGGLMFGPD-LDIR-----SR
U5QDG6_9CYAN/2-166----PSGRTHDRITWATAP-----AAVVAAWA-----------LTGSLRIAATVGVSYVFAGLMFGGD-LDIH-----SI
Q9RT76_DEIRA/5-173----PSGRVHNLINLGTFA-----VLGTAALYVQRAQLWPDPTFTLTPTMALNFTWAFMAGTFLLSPD-LDLSEGRVDSK
B1XNI7_SYNP2/2-167----PSGRTHDQITFWGLP-----VVVGFGFL-----------LLRRWELALILSLAYLFSGLMFGPD-LDIH-----SV
K9YHE6_CYASC/3-166-----SGKNHDRITWLCLP-----WIFIGTII-----------ISKDLLTGFVVASGFLFSGLMFGPD-LDIY-----SV
K9U5M5_9CYAN/2-166----PSGQTHDRITLWSLP-----VVAGIAFG-----------QTQSGNITLILSGAYLFSGLMFGPD-LDLY-----SR
K9XH03_9CHRO/2-166----PSGRTHDRITLWGLP-----VITGLTFF-----------QAQSASLTLIVAAAYLFSGLMFGPD-LDLY-----SR
B7KDH5_CYAP7/2-167----PSGRTHDRITLWTLP-----WIIGLSYL-----------LTRNGELTLLVAGGFLFSGLMFGPD-LDIY-----SR
D7DZB9_NOSA0/2-166----PSGQTHDRITIWSLP-----MVTGVTLV-----------STRSSNVTLLVAGGFMFGGFMFGPD-LDIY-----SR
K9VNR5_9CYAN/2-166----PSGRTHDRITMWSLP-----AVAALTFG-----------QTQSSNLTLLVSGSFLFGGLMFGPD-LDIY-----SC
A9B0N7_HERA2/2-170----PDGKTHDMLTVFTGI-----VGIPIIWRIV---------PNSDLLGAFVWAGSHIVSGMAFSPD-LDLA-----SE
Q8XL51_CLOPE/2-170----AAGKTHDKITVIMTP-----FIASFFLFINMIFLED---LGSSLAFTILGVSVYMFGGYMFSGD-LDIK-----SR
G2LLI8_CHLTF/2-174----PSGRTHDLVTYVLAI-----PTAVGLFF-----------LTRHVGLTVLGTATMLFGGLMFGPD-LDTH-----SK
E4UAQ6_OCEP5/2-167----PRGPVHESVNLTALA-----LGVIAYHRLVPEGS-----AALPPGTLEGFVAGYLLGSLWITPD-LDLAERKNTPR
B1X0E2_CYAA5/2-167----PSGRTHDRITYLSLP-----PLAVIAYL-----------LTGRGEWLLWLSGAYLFSGLMFGPD-LDIY-----SL
Q7NFX0_GLOVI/2-166----PLGRTHDRITWWSVP-----AAGAAVWL-----------VSGAFEAALGAACAYLFAGLMFGGD-LDTH-----SV
K9Z9T5_CYAAP/2-167----PSGKIHDQITWFCLP-----LVIILFFI-----------VTKSLLLTALGGFGFIFSGLMFGPD-LDIY-----SI
L0A273_DEIPD/2-163----PSGQSHTFINLAAYA-----VLGSVALYVHRQGI-----FFIGQEDALFFTLGFLVGTVFLSPD-LDLAEGHVNSK
K9WE31_9CYAN/2-166----PSGQTHDRITLWSLP-----VVTGLTIA-----------STQSGNLALIVSGGFLFSGLMLSPD-LDLK-----SL
K9V8T7_9CYAN/2-166----PSGRTHDRITIWGLP-----MVVGMTFW-----------HTRNGNLTLLLASGFMLGGLMFGPD-LDIY-----SV
Q7V3X6_PROMM/2-159----ASGEDHDKATCFWSL-----PFGFGLS------------FVMGLPSGLIGGLAFVVGGLWLSPD-LDTY-----SK
B8HTG8_CYAP4/2-166----PAGRTHDRITLSCLP-----FLATATWL-----------GSRNLALTGILSTSFLFSGLMFGPD-LDIH-----SC
C1CV84_DEIDV/5-166----PSGRVHNLINIAAYS-----VLAGAVLVASRQDI-----LSITPSQALYFTLAFAVGTFLLSPD-LDLAEGKVDSK
Q31N47_SYNE7/7-176----PSGRTHDRLTLWLLP-----AVAAGSWL-----------ISRQSDLSLVLSGSYLFAGLMFGPD-LDVR-----SR
S0EUE8_CHTCT/2-170----PGARVHDLITVSTLA-----AFDVLYVAKV---------HPASLVPLCCFSGAYLFAGLACAGD-LDTN-----SR
E0U8U0_CYAP2/2-167----PSGRTHDRITLWCLP-----WIIGLSYL-----------LTGNGELTLIAASGFLFSGLMFGPD-LDIY-----SR
D3EPX6_ATETH/2-167----PSGRTHDRITVLSVV-----PITILFYF-----------IFRRKELILWFGLSYIFSGLMFGPD-LDIY-----SL
C0QT82_PERMH/2-161----ASGRTHEIINLLFLP-----GAV----------------YYLNPVSFEGFISGYIIGTFFLSPD-NDIYH----SK
Q2JJ24_SYNJB/2-166----PLGSTHDRITLWTAP-----GITLAAGL-----------LGNSTTVALAVGSAYLFSGLMFSGD-LDTC-----SR
B7K2N6_CYAP8/2-167----PSGRTHDRITFWGLP-----PLMGLTYL-----------LSGKIDLTLILVGSYLFSGLMFGPD-LDIH-----SV
K9Q2E8_9CYAN/2-167----PSGRTHDRITLWGLP-----WVVAIAYI-----------LTRNGELTLIVGLAYLFSGLMFGPD-LDIH-----SV
A9WA62_CHLAA/2-176----PSARTHDLITVVSGI-----ALTPVVYHACLEYAQFS--PPTALACSLWFGGAHLVSGIMFSPD-LDID-----SA
H8GTR8_DEIGI/2-163----PSGRVHNLINLAAYA-----VLAAGALAASRQDL-----IGVTPAQAINFTLGFLAGTFLLSPD-LDLSEGRVDSK
K9XZT4_STAC7/2-167----PSGQTHDRITLWSLP-----WLAGISFC-----------LTRNGELTLILAGSFLFSGLMFGPD-LDIY-----SI
B2IUE8_NOSP7/2-166----PSGRTHDRITMYALP-----LVAGITFW-----------QTRSSNATLLVAGGFLFGGLMFGPD-LDIY-----SV
E8UBR4_DEIML/2-163----PSGNVHNLINTAAYA-----ALFAATALAQHAGY-----VHVTPVQGLAFTAGYAAGTFLLSPD-LDLAEGRVNSK
K9QIC8_9NOSO/2-166----PSGQTHDRITLWALP-----LVAGVSFW-----------QTRSSSVTLLVASGFMFGGLMFGPD-LDIY-----SR
B0JHJ8_MICAN/2-166----PSGRTHDRITLILLP-----PIAGASFL-----------VSGSGKLTLLLLASYLFSGFLFGPD-LDIH-----SV
K9RQ06_SYNP3/2-166----PSGRVHDRVTVVLSP-----LAGLGAGV-----------WGQRWELATLAIVGVLVSGFFLSPD-LDIP-----SK
D7BE64_MEISD/2-161----PAGRIHEAINVGALG-----LLSASYVYEQNH-------LGLSEPAAFGFAVAYLIGTFLVTPD-LDLAEQRVRAK
A5GPK9_SYNPW/3-163-----LGRDHDRATLIGCV-----PAGLLAG------------FWLGWSLGVLTAAAFAWGGLWLSPD-LDTR-----SR
Q81WY4_BACAN/2-155----PSGRTHTKINLISLP-----VVLFLLFSY----------GLTNFDFLLTFAIGFLVGTTFLTPD-LDTY-----SN
W6FU87_NODSP/2-166----PSGGTHDRITLYTLP-----VIAGVTLW-----------QTRSSNLTLLVAGGFMFSGLMFGPD-LDIY-----SR
B4UA61_HYDS0/2-160----ASGNTHDFLNLATLP-----IFL----------------YGVPHEYFLYFGSAYVISTVLLSPD-IDLHH----SK
K9T9J7_9CYAN/2-167----PSGRTHDRITLWSLP-----PIVGLSYL-----------LTRKGELTFIIAGAFLFGGLMFGPD-LDIY-----SL
F0RKU1_DEIPM/12-173----PSGRVHNYINMAVYA-----ALGAGAVWAGREGL-----VTLTQTQTLHFSLGFLAGTFLLSPD-LDLSEQGVNSK
F2NN18_MARHT/2-164----PSGRTHEAINLTALG-----LLSAGYLYGRTQG------YGPPDEWAFAFVGGYLVGTFLITPD-LDLAERRVTAK
K8GJ34_9CYAN/2-177----PSGQTHDRITLWSLP-----LVAGVTFE-----------RTQNASLTLIVSGGYLFSGLMFGPD-LDIH-----SR
D3PMR5_MEIRD/2-165----PSGRVHEAINLSVLG-----LATAAYWVYRQD-------LEVPQPVAVAFMGSYLLGTFLITPD-LDLAEQQVRAK
B0CCR6_ACAM1/2-165----PSGRTHDQITLGMLP-----GIAIVALV-----------LSRSASLTLSLSGAFLFSGLMFGPD-LDIY-----SI
Q8DM71_THEEB/2-162----PSGRTHDRLTWIVMP-----MVGFTVSA-----------LTRDWVWGAIASSSFGIGGFLLSPD-LDTV-----SL
P72876_SYNY3/2-165----PAGKIHDRITLGATP-----AVMAITFI-----------GTGSARLTLLMAIAFGFSGLMFGPD-LDIH-----SC

PF04307

Q18EP1_HALWD/1-158M---SPL-EHALVALIPVT-----IYILLRHRRLPS--------------KTMLSVVCFG---SVFPDLVD---------
Q65F12_BACLD/1-155M---TGK-THIMGGVASCT-----AAAYFYGYDPV----------------FMTASGVIG---ALIPD-IC--------H
Q0W2I6_METAR/1-181M---DSL-TH-ALAITVVF-----TAAGRP---------------------ELVPFAVLG---AVVLD-ID--------V
Q1AT01_RUBXD/1-176M---NAT-THAVFGVAAFA-----GACLAAGVEPP---------------AYAYPAAVAA---AWLPD-VD--------N
Q7MS32_WOLSU/1-175M---LAR-THLAFALGIAT-----LPLYALSLVDKATLQ-------GVEVSLYLSGVALG---SLLPD-ID--------E
Q8D1W8_WIGBR/1-169M---TSK-GHLIFGLSVAI-----FLKKIEIFNALYLG----------KWGHIITGSICS---CLLPD-MD--------H
Q5WIF9_BACSK/1-182M---DTS-THIVMGAGLAG-----LATLDVQIASSPY-----------MMTAVLATTLVA---SNAPD-FD---------
Q2NV14_SODGM/1-168M---TAG-GHFIFVLASAI-----FAKKLELSPALAQG----------NWGHIIIGGILT---CLLPD-ID--------H
A0LXF8_GRAFK/1-182M---DSL-TQIVLGAAVGE-----AVLGKKVGNK-----------------AMLYGAIAG----TIPD-LD--------T
Q01PN8_SOLUE/1-175M---ASAITHFVVGAGLAL-----PAMELPALRGV---------------MPRWALPVTTGLFAVVPD-LD-------TY
Q0W4H6_METAR/1-165M---LFF-GHIGLTLLVVF-----LVALALKIG------------------VDYRLVIVG---SLLPDIIDK------PL
YFHP_BACSU/1-182M---DTG-THVVMGIALGG-----IATLDPVVGSDPA-----------MAHAVMIATLAG---SQAPD-ID---------
Q5FTT4_GLUOX/53-213V---TGR-SHLLIGGFAVL-----CAMRWHILSPE---------------PLSVCTGLLG---SLLPD-ID--------T
Q726Y1_DESVH/1-173M---DPI-THVASGAVAMY-----ALRERPRTA------------------WALPFGMVA---AASPD-VD---------
C1DQI7_AZOVD/1-180M---DSL-TQAVLGASVQG-----ALLGRWQGRK-----------------ALLYGALLG----TLPD-LD---------
Q8ETE4_OCEIH/1-155M---TGK-THIMGGIAATT-----AYAYYSNYDPT----------------ALIISGVIG---SIIPD-IC--------H
Q5FK20_LACAC/1-175M---LTR-SHRLFSIAVVE-----LGLIATDTFLTNPV----------SNVVLLLATGVG---ASLPD-ID--------E
A4XRV7_PSEMY/1-180M---DSI-TQAVLGASIQG-----ALLGRWQGRK-----------------ALLYGAALA----TLPD-LD---------
Q2N9Y9_ERYLH/13-204I---DNL-THSLVGALLGQ-----AGLKKKTG-------------------LAMPALIIG---ANLPD-VD--------A
Q023X2_SOLUE/1-190M---DNL-THTAVGLFLSR-----IGLGRWSA-------------------RGTAIVVVA---ANIPD-ID---------
A9AVQ5_HERA2/1-166M---PTIFSHVAPALIVGL-----ALGRERMSR------------------PLLICASIA---AISPD-FD--------G
Q7VVQ6_BORPE/1-180M---DSV-TQVVLGAAIQG-----SMLGRSQGRK-----------------ALLYGGLLG----TLPD-LD---------
A6LWG2_CLOB8/1-169M---NYK-THINGGILVGL-----YTNCQLANMPLMS------------TAVLLGGAFVG---SIFPD-ID--------H
A3CRK4_METMJ/1-159M---YLL-AHAMVGLLIGV-----VLAAIAGDR------------------RVLAFAVLG---AVLPDLIDK------PL
A1TRR8_ACIAC/1-179M---DSL-TQIALGSAVSL-----AAMGRRTAAWK----------------AVLWGAVAG----TLPD-LD---------
Q3J7C8_NITOC/1-183M---DTL-THALSGALLAR-----ATASSKQPTGQLR------------VGERVLLGALA---ATFPD-SD--------F
Q8CV62_OCEIH/1-182M---DTG-THIVMGVALGG-----LATIDPVVQSDPT-----------LFHAVLVGTVVG---SHAPD-FD---------
A0JUC0_ARTS2/1-250M---MGG-HHAASGAAAWV-----AIASTGPYTLGWYP---------LDATGILIGGMATAGTALVCD-WD--------H
A1WTH1_HALHL/1-183M---DPV-THAASGALINR-----VVAPRDCGAPRFS------------LRERTWIGAGA---ALFPD-ID-------WF
Q5V391_HALMA/1-161M---VLPSEHFIIALLPVA-----VYALLRDRHLPS--------------LQLVAVTFFG---SQFPDLID---------
Q97K38_CLOAB/1-212M---TGK-THISIGLMSSA-----AVLSVNNPTPEN-------------IAVGLAVGVLG---ALMPD-ID--------T
Q1WSF6_LACS1/1-169M---QAK-THITTTLALGL-----PLMSLTNELTL----------------VNVGVLAVG---SLLPD-ID--------H
Q0ACJ1_ALKEH/1-184M---DTL-THAISGAVAAR-----ALPASRRAAAPS-------------LRERTWAGFVA---GASPD-ID---------
Q7N3N6_PHOLL/1-166M---TAE-GHLLFSVASII-----LAHKLEITPEIANG----------DWLHMLPGVLLT---ALLPD-ID--------H
Q9KEC4_BACHD/1-182M---DTG-THVVMGVALGG-----LAAIDPAVTNDPM-----------MKSTVMIATIIG---SQAPD-FD---------
Q1D144_MYXXD/1-188M---DNL-THGLLGLAIGA-----MRKPDVRPGAPERAS--------PTDRAVLVASVLA---AELPD-LD---------
Q2JB37_FRACC/1-225M---MGR-THALSGAVVWL-----AVAPLLSREQWLGSHA-----VSLSSSQVIAGAVVSAGAALLPD-ID--------H
Q12UG8_METBU/1-174M---FII-GHLGLTLAIFL-----VISLLVPSIRN---------------MIDYRFVAVG---ALLPDLIDK------PI
Q5V568_HALMA/1-273M-----FVGHALLAFALGA-----LAAWWLGLSRE----------------RAVQLGVIAGLFAAVPD-VD--------I
Q1ATT6_RUBXD/1-170M---KVA-THIVFGECCLF-----AASAVFDFHYET--------------PSVLAAAVCS----VLPD-AD--------Y
A4J2S9_DESRM/1-180M---TGI-THAAAGSAVGA-----ALAALGG--------------------QEVTGAVVGAVAALLPD-MD--------H
Q8TQH1_METAC/1-199M---VNTLSHLGIGFLIAL-----ALGLRGK--------------------KLKVVAFL----SVLPD-LDVIPYSLFLA
Q6D4I1_PECAS/1-166M---TAE-GHLLFSVACAI-----LAKKVELSPALAAG----------DWWHIIPGALLT---ALLPD-ID--------H
Q82XH5_NITEU/1-183M---DPV-THTLSGALLMR-----AVTSSHTQYAQRL-----------PLRERIVAGSVA---AAFPD-SD---------
Q6YRT9_SYNY3/1-188M---LTI-THLLVGAASVG-----MAAQT----------------------TNPVPILIGAIASLLPD-ID--------I
Q5HM58_STAEQ/1-158M---TGK-THASCGFLVGA-----ITTQYFHTDIFT-------------SISVIVLSVIS---SILPD-IC--------H
Q8TP13_METAC/1-172M---LLF-GHLGVTLGIFF-----GLGIFIPRLRT---------------IIDPRYLAIG---AILPDLIDK------PI
Q0JZE4_CUPNH/1-185M---DTI-THALMGAQAAL-----AIPVAEVPGRRLS------------TRERLLLGAAA---GAFPD-ID---------
Q97LP7_CLOAB/1-199M---TGK-THAGIGAAVGI-----ALAGKLPGGFN---------------AVGMGLIIAA---SILPD-ID--------H
A0PYB1_CLONN/1-199M---KGK-THAAIGMATFM-----SVYDRVPGGFN---------------YLGVFIVAIA---SLLPD-ID--------H
Q9KE25_BACHD/1-180M---DTV-THGLLGYGVYA-----AFKKPFMETHK---------------KWYALASIVA---AEIPD-ID---------
Q3JF51_NITOC/1-164M---IAG-THIAFASVLYL-----GGAALFEYD------------------TDLLGWALAAGASLLPD-VD--------L
A1K1W5_AZOSB/1-183M---DTV-THALSGALLGR-----LFSSGRGGLRP---------------AAAIAAGATA---AAFPD-ID---------
Q6AMI9_DESPS/1-207M---ANFSTHLTAGACVGF-----AISTLSTVS--FDFS-------ISQTATVFLLGAIG---GTLPD-LDSDSGKPLRF
Q7NV83_CHRVO/1-166M---MVA-THVAFGAFCAV-----SAALILHLPAMM-------------AVLLLAGGLAG---SLLPD-ID--------H
Q47U11_THEFY/1-250M---MGF-SHATTGVLVGV-----AVAAPLAAAAGTPP----------TPMGLLAWALLGAGSALVPD-LD--------H
Q47RB2_THEFY/1-227M---MGH-SHALSGVVGWM-----AVVPLLNKVDVLGINF------ELGSGEIIAGGLVCAGAALIPD-LD--------H
Q1QZR4_CHRSD/1-181M---DSL-TQACLGAAIGG-----TVLGRRLGRK-----------------AVIAGAALG----TLPD-LD---------
Q5P1U0_AROAE/1-192M---DTL-THALSGALAGR-----LLARRPSPGSTPAAKP------APSIWQPVAAGAAA---AAFPD-LD---------
Q0BSQ9_GRABC/13-169M---MAG-SHVALGAAAWL-----IVAPKLGLPPAD--------------AAGLVLAVAG---ALLPD-VD--------H
Q5L2T9_GEOKA/1-182M---DTG-THVLMGVALGS-----LASLDPAIAHDPL-----------LSHAVLIGALAG---SQAPD-ID---------
A5CZD2_PELTS/16-203M---TGI-THAAAGAAIGA-----AAGALGG--------------------AAAAGAAAGGLAALLPD-LD--------H
Q2S300_SALRD/1-182M---DSV-TQITLGAAVGE-----ATAGREAGLK-----------------APLWGAAFG----LLPD-LD--------V
Q1DD75_MYXXD/1-235M---DNL-AHSLVGAWMAE-----AGLKRTTP-------------------LATATLVIG---ANLPD-VD---------
A0KFP7_AERHH/1-165M---TAQ-GHLLFSVTCTL-----LAHKLQLTPALADA----------SLWHTIPAALAS---ALLPD-LD--------H
Q0VLL6_ALCBS/1-174M---DSL-SQAVLGASVGG-----AVLSRPLGRW-----------------ALLGGALLG----TLPD-LD---------
Q3A0M8_PELCD/1-203M---AGHKTHFAAGVATAA-----LLAGTTSIVGGIPH---------AQQPLLLACGMAA---GLAPD-LDSDTSKPLAI
Q186I4_PEPD6/1-177M---IKE-THERGGYIFAL-----LILPFINNLYLVKYDIA---YKIVLIIIYIYFAYLG---SLFPD-ID--------M
Q2L2L1_BORA1/1-180M---DSV-TQAVLGAGIQA-----TLLGRWQGRR-----------------ALLYGAALA----TLPD-LD---------
Q67R78_SYMTH/1-176M---DSL-THVLMGHAMGA-----LATAVSPEAGP----------------AVYWAALLG---NSLPD-VD-------VP
Q97MS7_CLOAB/1-166M---IFF-GHLGLTTGAVK-----ICENTVLSKKK---------------DIDYRFLLVG---SILPDLIDK------PI
A6TSU9_ALKMQ/1-172M---DPL-SHGLMGLAAFS-----LKYSPSLSN------------------PACLGAVIG---AIAPD-FD---------
A6TMK4_ALKMQ/1-249M---LGR-THVALGLMTSL-----GIAVLLGNPFMVES----------FNTIALLVAVGG---ALLPD-LD--------M
A3CVA2_METMJ/1-183M---FVA-CHLFLGLILGL-----AIAGRLGDR------------------RLIGFCALG---AVLPDLIDK------PV
Q9KAZ8_BACHD/1-159M---TGP-THIIGGFTAAA-----AMAYFNAISVEQ-------------PIIYYSASLFG---ALIPD-IC--------H
Q0S8N5_RHOJR/1-250M---VMGPTHAMSGAAVGL-----AVADLLPLDWGGPT----------STAETFTFAAVCAGAALLPD-LD--------T
Q1IHJ9_KORVE/1-205M---EPV-THFLTGACLGR-----AGLNRKTA-------------------LATVTLTLA---AEAAD-LD---------
Q890Y4_CLOTE/1-199M---KGK-THLGVGIVTSI-----ALYEKLSLDFN---------------IISLGVVAFG---SLLAD-ID--------H
Q0RHF1_FRAAA/1-228MSAVMGR-THALSGAALWL-----AVVPFLGREDWLGTYA-----LSLSSHQVIAGGVVAAGAGLLPD-ID--------H
Q1MS87_LAWIP/1-199M---DPL-THALTGATIVY-----TFPKESRPW------------------WFLVWGMLV---AMLPD-ID---------
Q11P46_CYTH3/1-219M---DIL-IHTLSGTATAA-----LISTFTKAKTK----------------TKLSLILLGGFAGALPD-IDAIS--LWSG
A6LXK9_CLOB8/1-172M---IFF-GHLGLTTEAIK-----AYEVILHKDNKLSG---------KEVFVDYRYVLIG---SILPDIIDK------PI
Q2VZJ9_MAGSA/1-159M---MVV-SHVVLGVSAWT-----LAQRAGLAVPLG--------------PEGAAAAALG---ALLPD-ID--------H
Q5YVJ3_NOCFA/1-233M---LGH-SHATSGALAWS-----VAAATLPLAVVTYPVMQD-VDARLGPVDVLLGVFLTAGAALLPD-AD--------H
Q8FRV6_COREF/1-249M---VMGPTHAMSGAAVGL-----AVAQILPEQWGGVT----------TAEETFIYAGLAAGAALLPD-LD--------A
A0KMD3_AERHH/1-197M---PTIITHAAVPLCLGL-----GLGSRIIPP------------------RLLLAGVAI---AMLPD-AD--------V
Q3JEV9_NITOC/1-176M---DIV-TQGLLGAVVAQ-----SAARPSQAR------------------LAAAVGFIA---GLLAD-AD--------I
Q9CNK9_PASMU/1-180M---DSV-TQFVLGAAVQG-----VGMGKYQGRK-----------------ALLYGGLLG----TLPD-LD---------
A1U6Q1_MARHV/1-174M---DSI-TQAALGASIAG-----AVAGKTLGRS-----------------ALLTGALLG----TLPD-LD---------
Q7NWB9_CHRVO/1-187M---PTVVTHALAGATLVG-----LACRKPLSAP-----------------GVLPWLALCGAAAMLPD-LD--------V
O29079_ARCFU/1-168M---MRHTTHVIFSMLFIT-----AIAEFIPSFTEFI-----------PYSYALTISMFS---TLLPD-ID--------H
Q1MQD9_LAWIP/1-155M---KWF-THKAIAIAGAL-----ALEASP---------------------PGLFATLVG---SILPDLAD---------
Q5WH30_BACSK/1-157M---TGK-THMIGGVVACQ-----AMDTIVFAGAHG--------------WAYYAAGLVG---AILPD-IC--------H
Q1GSW3_SPHAL/1-193M---DNL-THSLVGALLGQ-----MGLKKKTG-------------------LAMPTLILA---ANLPD-ID--------A
A3CTE7_METMJ/1-243M---RGD-QHVSLSLATAA-----LLIAPWATAIDAA-----------AIAVLLFGVFVG---SLAPD-AD-------AV
YVSG_BACSU/1-155M---TGK-THIMGGIASCT-----AAAYYYGFDPV----------------LMAASGAVG---ALIPD-IC--------H
B1W5J1_STRGG/1-256M---MGP-AHSLSGAAAWL-----GVGAAAAATGHTM-----------PWPVLVVGALICAGAALAPD-LD--------H
Q5ZZH0_LEGPH/1-172M---DPI-THGALGAACAQ-----AALGKYDKR------------------IPWQAGALA---GMAPD-LD--------V
Q6LSY8_PHOPR/1-173M---DSV-TQAALGAAVAA-----VVAGKKSSPK-----------------ILLAGAALG----TIPD-LD---------
Q74JJ2_LACJO/1-173M---LTR-SHRICSIAIVE-----LSLLLTNRLLIDPV----------NNIIILAATAIG---ASLPD-ID--------E
Q7CIV6_YERPE/1-162M---TGE-GHLIFSVACVI-----LAKKVGLTPELAHG----------DWWHIIPGALLT---SLLPD-ID--------H
Q7CJI4_YERPE/1-166M---PTIITHAAIPLTLGL-----GLGTKIIPP------------------RLLLAGIAI---SMLPD-AD--------V
Q81YV9_BACAN/1-179M---DTA-THLVMGVTLGS-----LATLDPAIAQSDI-----------GPQAVMLATIAG---SNIPD-ID---------
Q8Y6J4_LISMO/1-176M---DTG-THVVMGIALGA-----LATVDPVVAGSSQ-----------AAIGIMTATIIG---SQIPD-ID---------
Q9HUK3_PSEAE/1-165M---TTLITHPLPVLAVGL-----ALGSRVIPP------------------HLLLAGMLA---ACLPD-FD--------V
Q9RMV6_BACAN/1-156M---KYK-THLTTSLAVAL-----PVLASTGNLTV----------------GNVIAVSFG---ALLPD-ID--------E
U5L8V8_9BACI/1-175M---DTG-THVVMGFALGG-----LATLDPVVADSTA-----------TATSVMIGALIG---SQAPD-ID---------

PF13803

C7QBS6_CATAD/1-242--------MPFTL-AHPAA-----VL-P-LTRRGRA------------RGGLVGSALVFG---SIAPD-V-------PYF
C0ZEY0_BREBN/1-241--------MPFTF-AHPAI-----VL-P-L----RK------------CKWFSFSALVFG---SMAPD-F-------EYF
K9WR57_9CYAN/1-241--------MPFTF-AHPIA-----AA-P-I--WLCS------------KRRLDLPSLLVG---SIIPD-I-------EYF
D3EE91_GEOS4/1-236--------MPFTF-AHPVI-----TM-P-W----WK------------KKSLPVSALIIG---CMAPD-F-------EYF
X2GTZ3_9BACI/1-237--------MPLTF-AHPAA-----VL-P-F---SRK------------SKYIHFSAMVIG---SMAPD-F-------EYF
F8A675_CELGA/1-236--------MPFTL-AHPAA-----VL-P-L-----A------------RGPLVPAALVAG---AMSPD-V-------PYF
Q1IN38_KORVE/1-247--------MPFTL-SHAAA-----VV-P-L-----R------------RTRLVWSALVIG---SFGPD-F-------QYF
D2Q1R3_KRIFD/1-251--------MPFPL-AHPAA-----VL-P-F-----V------------RRPFVASALVAG---ALAPD-L-------LYL
A6GZ02_FLAPJ/1-235--------MPFTF-SHPAI-----IL-P-L--RYLP------------RQWFSLTGLIIG---SLTPD-F-------EYF
D3V1B0_XENBS/1-240--------MPWTF-SHPAA-----VF-P-L-KSFPG------------GRLLNLPALITG---SLSPD-F-------FYS
Q899W6_CLOTE/1-232--------MPFTL-AHPAA-----VI-F------SK------------NKHFNLMGLILG---SMAPD-F-------IYF
G0FWC1_AMYMS/1-228--------MPFTF-AHPAA-----VV-P-L------------------ARWLWLPGLVAG---SLAPD-V-------AYY
Q8XML2_CLOPE/1-242--------MPFTL-AHPAA-----VV-F-L-----K------------NKKFNFTALILG---SMAPD-F-------IYF
A0Q1Y2_CLONN/1-242--------MPFTF-AHPAI-----VI-P-C--KKKA------------PKYLDLSALVIG---SMVPD-F-------EYF
Q6FEH5_ACIAD/1-242--------MPFTL-SHAIL-----AP-P-I--AKLS------------GQRLPVAALAIG---CMTPD-L-------FRL
H1YCR9_9SPHI/1-235--------MPLTF-SHPAI-----VL-P-L--SYLP------------KRWVSLTGLVAG---RVAPD-F-------EYF
I4B9J2_TURPD/1-232--------MPLTI-AHPAI-----IL-P-V--LRYS------------RNAAFVTGLFIG---CLTPD-F-------EYF
K4IBC3_PSYTT/1-233--------MPFTF-SHPAI-----IL-P-L--TYFP------------RKWFSLTGLVIG---SLTPD-F-------EYF
H2JVD3_STRHJ/1-251--------MPFTL-SHAAA-----VL-PAIRRDGSG------------RGPLVPTVLVAG---SFAPD-M-------PYY
A5I0I6_CLOBH/1-248--------MPFTF-SHPAI-----VL-P-L--EEKW------------NKYFNFTALILG---SMSPD-F-------EYF
Q65Q39_MANSM/1-229--------MPFTF-AHPVT-----VL-Y-F---PRN------------SRYFHFPALVLG---TMSPD-F-------MYM
F4FE12_VERMA/1-233--------MPLTLPSHLAA-----VL-P-L--KLWR------------PRWFDGVALSAG---AVAPD-V-------AHL
C6D3J1_PAESJ/1-240--------MPYTL-AHPIF-----AY-P-L--KKIN------------RKLLSVTGLVLG---SMGPD-M-------EYF
A3HWD2_9BACT/1-236--------MPFTF-SHPAA-----IL-P-F---SKT------------SKRLSQTGLVVG---SVVPD-L-------EFY
Q7UP84_RHOBA/1-249--------MPFTP-THVAA-----AI-P-I--AWMA------------KWRLPFSALAIG---CMVPD-A-------GVF
A8L7F5_FRASN/1-232--------MPFTL-SHPVA-----VL-P-L-----R------------RLGLPMSAMVAG---SMVPD-V-------PVF
D2ARI2_STRRD/1-246--------MPFTP-SHVAA-----VL-P-LVSSARM------------RRVLDPWALALG---AMVPD-L-------PIF
Q0RF10_FRAAA/1-232--------MPFTL-SHPAA-----VL-P-L-----R------------RVGLPMSAMVAG---SMVPD-V-------PVF
C7R2G7_JONDD/1-241--------MPITF-AHPAA-----VL-P-F-----M------------GGPCVPAALVAG---ALAPD-V-------PYF

PF00882

A0A090C0Q9_ACIBA/1-206--------MPFTI-SHAVI-----AP-P-LAKLSRN------------T--LPIAALAIG---SMTPD-L-------YRL
C6RSF9_ACIRA/1-206--------MPFTL-SHAVL-----AP-P-LAKLSGN------------R--LPLAALAIG---CMVPD-L-------IRL
B7H911_BACC4/1-208--------MPFTF-AHPAA-----VL-P-FAKKHSK------------H--ISVTALILG---SMAPD-F-------EYF
C2XYJ1_BACCE/7-214--------MPFTF-AHPAA-----VL-P-FAKKHSS------------Y--ISVTALILG---SMAPD-F-------EYF
B1B9W2_CLOBO/1-214--------MPFTF-AHPAV-----VI-P-CKKKFPK------------Y--LNLSALVIG---SMAPD-F-------EYF
C5VRK3_CLOBO/1-214--------MPFTF-AHPAI-----VI-P-FKKQLPK------------Y--FNITALILG---SMAPD-F-------EYF
A3I5H3_9BACI/4-213--------MPLTF-AHPAA-----VL-P-FSRKS-K------------Y--IHFSALVLG---SMAPD-F-------EYF
Q0SV58_CLOPS/1-213--------MPFTL-AHPAA-----VV---FFKNKK----------------FNLTALILG---SMAPD-F-------IYF
C6JKD9_FUSVA/1-208--------MPFTF-SHPAI-----IL-P-LKKLPKK------------Y--ISMTGLIVG---SITPD-F-------EYF
A1ZM58_9BACT/1-209--------MPFTF-SHPAL-----IL-P-LTYLPKH------------W--VSSSALVIG---SLAPD-F-------EYF
C0DX83_EIKCO/1-211--------MPFTL-AHPVA-----VL-P-FARCRR----------------VHFPAMVIG---SLAPD-F-------VYF
D4DQE9_NEIEG/58-261--------LPFTL-AHPIA-----VL-P-FSRCRY----------------CHFPALVIG---SLSPD-F-------VYF
C0B3N4_9GAMM/1-204--------MPWTF-SHPSI-----VF-P-IKQSRIG------------KY-LNLPALIIG---STSPD-L-------LYS
D4BTR9_PRORE/1-203--------MPWTF-SHPAV-----VF-P-IKQSRFG------------HF-LSLPALILG---SLSPD-L-------FYS
Q2LV15_SYNAS/6-198--------AHCLLAREAME----------RFGKSKLF---------PGVLKTKNHFVVMG---ATGPD-Y-------PYL
Q2Y883_NITMU/6-188--------AHLTMVNLVKEPDRLEKQ-G-FPPEAIV------------SILDYFRFCELG---AVSPD-Y-------PYL
A7K2D4_VIBAE/6-189--------AHITAVNEASANNALMKL-N-IPQEAKK------------ALAQNKRYLELG---CVSPD-Y-------PYL
A4C3L5_9GAMM/6-186--------AHITAVNIATDNNALCGM-N-IPVKAKL------------ILSKNQNYLELG---CVSPD-Y-------PYL
C9YFH3_9BURK/6-183--------THITAVNKAKS----LAR-GKLSKESLY------------ALGTWFPFAELG---CVSPD-Y-------PYL
Q12DA4_POLSJ/6-186--------AHIAVVNDAQKRADSAGLREDTLVS----------------LGLYLKYAELG---AVSPD-Y-------PYL
C4XMP3_DESMR/34-221--------AHITLASRCVNPSVLGSL-E-LDTETVG------------KLMQQVGYFQLG---AISPD-M-------PYL
E6VSV5_PSEA9/6-180--------IHFSIAERTAA-----LL-DGTRLAPC--------------LAAERHGLLLG---AVLHD-A---------L
Q2LQI8_SYNAS/6-189--------THWILAEQTWQ-----AM-PDGLLKME--------------IRENKALYYLG---AIVFD-TPYYVVTGQNR
B8FCF0_DESAA/6-187--------THWILAREAFR-----RL-KDGEARRM--------------IAQNSNLYLLG---AVIPD-T-------PM-
B3E8I7_GEOLS/6-161--------THWWLATEAVK-----QLPLDRTVRQL--------------LEEHQSAYLVG---AVLPD-TLLHLVRGPWS
A1AT46_PELPD/6-164--------THWILAERTAQ-----RLAGSGILADI--------------IQAHHAAYLGG---AVLPD-TLLHLFRGPHS
C6Y3Y4_PEDHD/24-233--------AHIRINRLAVF-----TL-PAGLNRFY---------------KANISYLSDH---AVDPD-K-------RRY
E6U8V9_ETHHY/5-158--------VHLLFARRIHA-----AV-REQIG-----------------VRLSWSGFLLG---NILPD-L-------SA-
Q1IVJ5_KORVE/32-215--------THQAIIDLAWDDSIRPFLLSRYPNATAE------------QLQVAHAYAYGG---CAIQD-M-------GYY
C1F375_ACIC5/44-227--------THESIIDLAWDPAIKPLLLKRYPHTTAT------------GLRIAHGYAYGG---STIQD-A-------GYY
Q01WM2_SOLUE/25-208--------THEAIIDSTWDSAIKPLLMKRFPLSSAG------------DLTAAHAYAYGG---SIIQD-L-------GYY
Q1ISY5_KORVE/28-210--------THEEVIDLAWDHDIVPLIKARFPDATDD------------DLKEAHAYAYGG---AVIQD-L-------GYY
Q025L8_SOLUE/39-222--------THEAIIDTAWDGGIKPLLLKRYPQATKD------------DLLEAHAHAYGG---CIIQD-M-------GYY
Y1571_ARCFU/28-204--------THVRMSSEAGN--------P---------------------YTGFKMEYLSG---SIAPD-A-------GYI
Q01YQ6_SOLUE/23-198--------PHQKITRAALD-----SL-PAKFVNRL--------------GPESKLLIDLY---CIYPD-RYQEMAEFGFT
Q8XI18_CLOPE/5-158--------THILIAQNILR-----DV-DVD-------------------FKISDKNFIYG---NVKPD-M-------VS-
R5X8W2_9CLOT/5-160--------THLTISNALIE-----NL-DSSKS-----------------FFISEKNFIYG---NIKPD-M-------TS-
B6FWP7_9FIRM/5-161--------THFQIAKSVLE-----NM-DEKKA-----------------VLISEKNFVYG---NVKPD-A-------FS-
Q18BT1_PEPD6/5-159--------THFIMAKSILD-----NI-DENKT-----------------FFISEKNFIYG---NIKPD-A-------FS-
D3MTQ6_9FIRM/3-156--------THIILSKSLID-----NT-DKTKQ-----------------FFLSENNFIYG---NIKPD-I-------VS-
A0A0C2S6D2_CLOBO/4-161--------THKLIAENILN-----NT-NSKSI-----------------YLINDYRFIWG---NIKPD-C-------VL-
C4IEN4_CLOBU/4-161--------THRLMGENILK-----YA-NSKSI-----------------YLINKKRFIWG---NIKPD-C-------TP-
A6LQ77_CLOB8/4-161--------THKIMAENIIK-----YA-NTKSI-----------------YLINNKRFIWG---NVKPD-C-------AP-
B1BFH6_CLOPF/5-161--------THLEIGENTLN-----TI-EGRGR-----------------NLIDKKSFLKG---NVLPD-I-------SP-
Q97KV3_CLOAB/5-155--------THLLISYIVYK-----NL-YNNFN-----------------FKLDMAAFALG---NIKPD-F-------IN-
B0P7T6_9FIRM/16-171--------SHITMGRYLYT-----YF-TEQLG-----------------VELDKASFVSW---NVLPD-V-------AP-
C0ECW5_9FIRM/5-161--------SHMHVSAIIRR-----QL-KSEFG-----------------IYLPAAVFTYA---NCRPD-F-------SV-
A8MHU0_ALKOO/5-164--------THKIISEHVHS-----NV-KEILG-----------------VDLNKFNLIYG---SIKPD-I-------AI-
A6TNX7_ALKMQ/5-165--------SHKLISEHIHM-----QV-KETLG-----------------VELNKNSLIYG---SIKPD-I-------AP-
B2A897_NATTJ/5-148--------SHIHLGRRLSN-----LI-----------------------EENYENYFILG---NVTPD-F-------AI-
R6RM69_9FIRM/5-161--------SHISLAGQIMD-----SL-RLE-E-----------------VFDYKLPFYVG---SIWPD-C-------RP-
B0NZS3_9CLOT/15-171--------SHISLAGQIMD-----SM-ELD-N-----------------VFDYRLPFYVG---SIWPD-C-------RP-
R7D6R4_9FIRM/20-175--------SHILLARYLAD-----QM-PANES-----------------LQSHRKAFCLG---NILPD-I-------QP-
C6J9X9_9FIRM/5-161--------SHILLARYLAD-----QM-QTTVS-----------------LQSHRKAFCLG---SILPD-I-------KP-
C6LKS6_9FIRM/5-161--------SHISLARFLVS-----QM-GAD-K-----------------LQQHRKAFYLG---SILPD-C-------KP-
D4KRQ8_9FIRM/5-161--------SHISLARYIVN-----SL-DDK-E-----------------LKKHRFSFYIG---SVLPD-I-------KP-
D9SRM2_CLOC7/5-162--------SHVVIANKINR-----DI-ENILG-----------------ISMNRYSFVYG---SVRPD-L-------RR-
A6LQR0_CLOB8/5-160--------LHGKIGYFLSK-----ELIERGYS-----------------NIIDSNFFIYG---NVLPD-L-------KL-
B0S165_FINM2/8-177--------THKRIVREINQ-----DI-KDSYG-----------------INLNIKKLEWG---AVSPD-I-------LP-
D1VUW6_9FIRM/8-182--------THKVIATIIHQ-----RI-KQDYN-----------------INLNLNKIQWG---SVCPD-V-------LP-
C4IIQ3_CLOBU/5-155--------THFHLAKLSLR-----NL-KPFYP-----------------KNFSINMFYFG---TILAD-C-------CW-
C4Z638_EUBE2/40-187--------GHVTVTKRLTP-----ML-----------------------KKRHDFALRLG---SIMPD-I-------LL-
A7VFQ0_9CLOT/5-152--------SHLFVTREIIE-----QV-----------------------PQNKRKWLLLG---SILPD-I-------LV-
C0EWT7_9FIRM/5-150--------GHLVMTKSLSG-----NI-----------------------HRAHKAALLFG---SILPD-L-------LV-
R5WI53_9FIRM/5-162--------DHMNLSRYIMD-----HM-DAGAS------------------KLQKAAFIFG---SIEPD-I-------NML
D4LBU1_RUMC1/5-160--------DHRLLGSFLLR-----QQ-DIFLD------------------PMRKSLFLLG---CVEPD-L-------NPV
Q315K4_DESAG/47-177--------VHMACSEWLFA-----NL-TLLPAGVAT------------VISAYESVFRYG---ALSAD-IFIGKGCAVT-
B8DLU9_DESVM/18-149--------VHMVAAHWLLQ-----NA-SLLPAAVGS------------ALLNHPDAFLYG---SLSAD-IFIGKGCTVT-
C7LVT1_DESBD/24-155--------VHMAIGNHVLT-----HL-HLLAPAVAA------------VLTAHPEQFLYG---CLSAD-IFIGKGSTFT-
C6BUV8_DESAD/29-160--------VHMAIGNAVLS-----NT-MQLSDTVAK------------LLLSNSTLFLYG---CLSAD-IFIGKGSKAK-
C8X0X8_DESRD/29-159--------IHVATGNFILE-----NL-RLILPSIAN------------TVSAFPQHFLYG---CLSAD-MYVGKGKTLT-
A5G5N0_GEOUR/25-157--------IHLQLGSAVLN-----NL-QALKPAIAA------------IIGEFPNDFLYG---CIAAD-ITIGKKFTHY-
E8WRC5_GEOS8/30-162--------VHLQLGMNVLA-----NL-DALKPAVAV------------IISAHPYDFLYG---TIAAD-ITLGKKFTHY-
A1AK53_PELPD/24-156--------IHLQVGLHILS-----HP-ELLPAGLAA------------LLAAHPLDYLYG---SIAAD-ITLGKKYTHY-
B3EBK7_GEOLS/25-157--------THLLIGLDVLS-----RL-QQLPPQLAT------------LLGGYANDFLYG---CLAAD-IIVGKKHTHY-
Q3A306_PELCD/29-161--------VHLQLGSQVLG-----QL-HLLPETLRQ------------LLAAHPFDFLYG---CISAD-ITLGKRFTHY-
Q1K0Z2_DESA6/27-159--------VHLQLGNRLLE-----NL-SLLSPALQH------------LLTYYSADFLYG---SISAD-ITLGKKYTHY-
C1A8N1_GEMAT/19-151--------THVFLGDAVLG-----NL-SLLPSSLAA------------LLSAHPADFLYG---SIAAD-TSIAKKYAEV-
B8J577_ANAD2/33-165--------AHLNFSAQALA-----NL-GVAQPSLRM------------VLQDFGNEFLYG---SLAAD-IVVGKNMARY-
D6SRA3_9DELT/26-149--------THTHFAFEILR-----AA-SLLPVAVYS------------LLTAYSTNFIYG---SVVAD-YFLG-KPG---
B5YG53_THEYD/20-144--------THAYLSGQIFS-----FS-GLVPAGVLT------------IIKLYKEYFMYG---NIIPD-TVFGKKYLPE-
Q1H382_METFK/30-174--------THVYFAHSLLW-----AM-PLLDPRLKR------------AISRFPQLVMAG---ACLPD-LAIV-SPR---
C6X6W6_METGS/30-174--------THLYFAHSLLW-----AM-PLLDPRLRQ------------AIQRFPELVMAG---ACLPD-LSLV-SPT---
C6WXF1_METML/56-200--------THLYFAQSLLW-----AM-PLLDPKLQN------------AIKKFPDLVMAG---ACIPD-LALV-SQP---
D5CMM4_SIDLE/28-177--------THVYFAQMLLW-----AV-PFTDPRYRR------------AIKSFPRLVLAG---ACLPD-LALLSEQSWGK
B0SPX5_LEPBP/6-211--------THIEALSQVKK-----HLEHGNATQRKIAN--------LLSRPDVASYANLG---AVAPD-I-------FYF
A0A0C5WZU2_LEPIR/6-211--------THLEVLSQICK-----HLDHGTADQRKIAV--------LMRAESNRKFANIG---AIAPD-I-------FYF
C8W7P0_ATOPD/6-209--------VHIAHANRLLE-----KG-AGCLDVDI----------------QYPDVFLLG---NVAPD-V-------HVG
C5DV22_ZYGRC/30-228--------VHLIYLARVTS-----EL-----------------------DRKYEPWLKAG---AFFPD-A-------FY-
B5VL45_YEAS6/30-234--------THLFYLTRGAP----LSL-----------------------KENYYPWLKAG---SFFPD-A-------LY-
C5DKM1_LACTC/24-220--------VHITLLARTKVP--NN-------------------------LNSFSAVMKAG---VFFPD-A-------LY-
Q6FL70_CANGA/25-242--------SHLTFLLRVISDPSVFEETQLNIN-----------------SQYYFPWLKSG---AFFPD-A-------LY-
Q6CEF9_YARLI/23-229--------VHLTLLSRTLP-----SLLTHLP------------------NQQIDQYLQPG---AFFPD-C-------FYN
C4R8D0_KOMPG/19-213--------VHLIASYWTTN----Q-------------------------LGADLNSLAAG---SFFPD-A-------FY-
Q8R432_MOUSE/28-220--------THVEIGHRALEFLRLQDGRINYKEL----------------ILEHQDAYQAG---TVFPD-A-------FY-
C3ZWC6_BRAFL/5-194--------THTEIGISTLFSVLSENFQQL--------------------LLKHQDAFQAG---NVYPD-T-------YY-
A7SED1_NEMVE/31-226--------THIAIAHQALEWFDDQRGNTSYRKI----------------ILAHQDGFIAG---NPYPD-A-------MY-
D3AZT7_POLPP/38-225--------THNEVARRAFNFSDFKEYPQFQQM-----------------ILNNLASFQAG---AAFPD-W-------GYS
PLDG_DICDI/29-216--------THNTVARRAYNFSSFDGFEQYQKY-----------------VSENFDVFDAG---AAFPD-F-------GYD
Q97TF6_CLOAB/60-232--------THEFITVQAMT-----IL-GNDKGNNFK-----------NLIKNYEPTLRQY---CDKPD-KDENQWAFAYH
A7B1H2_RUMGV/72-243--------THQYIVANTLK-----ILSNDKGNSAF-------------NGELNSSILMEA---TDWPD-K---------L
PHLC_CLOHA/37-230--------THALIVTQAVE-----IL-----KNDVISTSPLSVKENFKILESNLKKLQRG---STYPD-Y---------D
A0PXH4_CLONN/38-231--------THSMIVTQAVK-----VL-----ENDMSKDEPEIVKQNFKILQDNMHKFQLG---STYPD-Y---------D
Q5PXE6_CLOPF/38-231--------THAMIVTQGVS-----IL-----ENDLSKNEPESVRKNLEILKENMHELQLG---STYPD-Y---------D
Q8GCY3_9CLOT/38-231--------THSVIVTQAIE-----ML-----KHDLSKDEPEAIRNDLSILEKNLHKFQLG---STFPD-Y---------D
PHLC_PAESO/38-231--------THALIAEHGLT-----ML-----NNDLNQNEPKPIKQNIEILNKYLKDLKLG---STFPD-Y---------D
Q6R6B7_LISSE/64-245--------THLWLFNQAEK-----ILAKDVTGAQLDL---------VRELKNYNKEIAQG---IFDAD-H---------K
Q6EAE3_LISMN/64-245--------THYWLFKQAEK-----ILAKDVNHMRANL---------MNELKKFDKQIAQG---IYDAD-H---------K
Q6R6D6_LISIV/62-243--------THLWLFKQARK-----ILAKENNGAYKEL---------LEMLNKYYKEVAQG---IFDAD-H---------K
A0R9W0_BACAH/51-232--------SHLWIVNRAID-----IMSRNTTLVKQDR---------VAQLNEWRTELENG---IYAAD-Y---------E
A5D2J5_PELTS/29-178--------THIFCVQQALE-----IL---------KNDGF---FNQHALLTKHQEFLFRG---VRWAD-K-------GWK
Q896L3_CLOTE/34-205--------VHKFIMLQSLD-----IL---------KNSEH---QEAYNFFKDNLAKLNEG---TTWAD-Q-------DFK
A5N896_CLOK5/34-205--------VHKFIMIQSIA-----IL---------QNDGY---QEEYNFFRKYIKALNAG---VTWAD-Q-------DFK
Q97KA0_CLOAB/34-205--------IHKYINSLAVE-----IL---------KNKRK---AKQYKFFSDNIEAINEG---TVWAD-Q-------DFK
A6TKQ8_ALKMQ/57-228--------VHKFINIQALK-----IL---------RNDGY---AEEYNFFSSYILDINKG---AVWAD-Q-------DFK
O26214_METTH/27-173--------NHHDIAEKVYS-----EM-PEDVR-----------------NRMSLDEMKNG---ADDPD-T-------VFL
B8I5G2_CLOCE/32-236--------DHKTCVTDAAA-----SV-GITLSPEE------------------KVALQFG---SIFPD-E------DEYN
B5HQN8_9ACTN/67-292--------LPFTL-SHAAA-----VL-PAVRTDGTG------------RGRLVPAVLVAG---SFAPD-M-------TYY
Q82A31_STRAW/92-336--------LPFTL-SHAAA-----VL-PGVRGDGTG------------RGRLVPTVLVAG---SFAPD-M-------TYY
C9YWP6_STRSW/1-225--------MPFTL-SHAAA-----VL-PALRGNGTG------------RGPLVPSVLVAG---SFAPD-M-------TYY
B4V801_9ACTN/61-287--------MPFTL-SHAAA-----VL-PAIRRTGRA------------RGPLVASALVLG---SFAPD-T-------FYF
D3D9A1_9ACTN/1-206--------MPFTA-SHPAA-----VL-P-LRRLG-----------------LPMSAMVVG---SMVPD-V-------PVF
A7C3K4_9GAMM/1-217--------MPLTL-SHPAA-----AV-P-LVRWG-----------------LVLSALVVG---SMSPD-F-------LYF
B9XK96_PEDPL/41-256--------MPLTI-AHPAI-----VI-P-IRHR------------------LVLSALMIG---SMAPD-F-------SKI
D9T3L8_MICAI/1-213--------MPLTFPSHLAP-----VL-P-LKLWRPG------------W--FDGVALCTG---AVAPD-V-------AYL
C1ACE2_GEMAT/1-206--------MPATILSHQAL-----VL-P-LKMRWPH------------R--FSGLALCIG---SMAPD-L-------EFI
C0VQ51_9GAMM/1-206--------MPFTL-SHAVL-----AP-P-LSKLSKG------------H--LPIAALAIG---CMTPD-L-------YRL
D0SL80_ACIJU/1-206--------MPFTL-SHAVL-----AP-P-LSKLTKG------------H--LPIAALAIG---CMTPD-L-------YRL
D0SG75_ACIJO/1-206--------MPFTI-SHAVL-----AP-P-FAKLSGD------------R--LPIAAIAIG---SMTPD-L-------YRL
D0SS47_ACILW/1-206--------MPFTL-SHAVL-----AP-P-ISYLTGN------------R--LPVAALAIG---SMVPD-L-------HRL

PF02265

ENDO2_ARATH/28-290----WGKEGHEIICKIAQT-----RL-DETAAKAVKELL-PE--------SA-EGDLSSL---CLWAD-RVKF---R--Y
ENDO5_ARATH/21-288----WGKDGHYTVCKLAEG-----FF-EDDTIAAVKKLL-PE--------SVDGGGLADF---CSWPD-EIKK-LSQ--W
A4H6V5_LEIBR/29-297----WWDKGHMSIAEIARR-----NL-NPDVLEKVQACA-TALNE-VGPFPK-STNIVEL---GPWAD-DLKSMGL----
Q8F3Z8_LEPIN/21-283----WGWEGHRTIGIIAQQ-----LLINSKKFDPINDIL-GD------------LTLEQI---STCPD-ELKAFQSQ--R
B0T6T3_CAUSK/23-287----WGRTGHAVVAQIARG-----YL-TPKAAAAVDALL-AADT----DALT-PPDLAAR---ASWAD-AWRK---D--H
Q66VY6_LEIMA/29-300----WWSKGHMAVALIAQR-----HM-DPKLVKKANAAA-KVLSLAGPFPKS--PDMVQL---GPWAD-DLLESGL----
Q7S8Q5_NEUCR/20-297----WGKLGHATVASVAQQ-----YL-TPNTVKQVQTIL-GD--------NS-TSYMGNI---ASWAD-SFRYESAA--N
Q5KPJ8_CRYNJ/20-279----WGAAGHEMVATIAQI-----HL-FPSTRAKLCSIL---P------EEA-NCHLAPV---AAWAD--IVRN--R--Y
Q236I4_TETTS/18-296----WWDGGHMMTAEIAKQ-----EI-LARNATLYEQIE-KYVTILNPLCDARSQDFVQA---ASWAD-DIKDDAM----
Q4DEV4_TRYCC/28-293----WWCNGHMLVNEIARR-----RL-HPEVALIVEEAA-VNLSASGPFPHT--TDFVES---GCWAD-DIKKLGL----
Q0CD39_ASPTN/21-282----WGDVGHRTVAYVAEN-----YL-TEDGSKFLDNLL-PF--------SN-NFDISDA---ATWAD-EQKR---R--Y
Q2SFD4_HAHCH/50-295----WGELGHRVVCDVAWK-----EL-SPVARDQVQKLL-QQ--------AG-KRTFAEA---CLWPD-QVRSEKE---F
Q585P6_TRYB2/27-292----WWDFGHMVVAEIARR-----NL-DNDVARVVETYI-QHLSESGPFPNI--PDFVQS---ACWPD-DLKRYRM----
Q989R8_RHILO/21-270----WGPEGHSIVAEIAQR-----RL-SSTALMEVKRIL-GG-------E----VAMASV---ASWAD-DVRYAI----H
ENDO1_ARATH/29-294----WSKEGHILTCRIAQN-----LL-EAGPAHVVENLL-PD--------YV-KGDLSAL---CVWPD-QIRH-WYK--Y
A4CQ68_ROBBH/22-257----WGRTGHRAIGEVAEA-----HL-SRRARKAVSRLL-EG------------ESLAKV---STFGD-DIKSDTT---Y
A3U8L7_CROAH/33-268----WGKTGHRAVGEIASK-----HL-NRKARKAIKDIL-DG------------TSLAEV---SIYAD-EIRSDKK---Y
A7H7R9_ANADF/28-274----WSEPGHRIVAAIAEE-----RL-GPSARRLVREVL-GAT------P----MSNADV---AGWAD-AQRD-------
Q7P202_CHRVO/23-274----WGQEGHRITGYIAQQ-----LL-SSKAKAEVKKLI-PN------------ADFAQL---ALYMD-QHKQEL-----
A0BML4_PARTE/16-293----WWDVGHMMTAQIAKN-----HL-RENRPDVLAWAD-SLIQDLNPLTDGKSNTFAEA---AVWLD-DIKETGT----
A7EWS3_SCLS1/21-282----WGTLGHETVAYIATN-----FV-SASTKSYFQGIL-GD--------ST-TDYLASV---AAWSD-SYRY-TTA--G
Q3IBZ8_PSEHT/27-268----WGQNGHRIIAKIAES-----HL-SETTKTKLLPLL-NN------------ESLAQV---STWPD-EMRSAPGEFWQ
A7ETG5_SCLS1/21-277----WGTLGHQTVAYVATN-----FV-AESTRDYFQMLL-RN--------DT-GSYLAGV---ATWAD-SYRL-------
A0M3W8_GRAFK/24-260----WGKTGHRATAEIAET-----HL-SNKAKNAIDGLL-GG------------HGLAFV---ANYAD-DIKSDPE---Y
A0BLJ0_PARTE/422-699----WWEVGHMMTAQIAKN-----YL-RDNRPDVLAWAD-SLVQDFNSLTDGKSNTFAEA---AVWLD-DIKETGT----
A4HJL3_LEIBR/28-299----WWSKGHMAVALIAER-----HM-EASLVEKGNLAA-KVLSLSGPYPQS--PDMVQA---APWAD-DLKKVGF----
Q0TYV6_PHANO/20-284----WGSLGHTTVAYIAQN-----FV-SGKTTKFAQRLL-ND--------TS-GAYLANV---ATWAD-SYRS-TPE--G
ENDO3_ARATH/25-286----WGDAGHYAVCKIAQS-----YF-EEDTVVAVKKLL-PE--------SA-NGELAAV---CSWPD-EIKK-LPQ--W
Q0AMT2_MARMM/26-282----YGPDGHRIVCDLAWR-----YL-SDETRTEIDRLV-AQ--------DPEFDHFRDV---CSWAD-DVRGSTH----
Q4Q7F3_LEIMA/31-295----WGCVGHMLLAEIAHR-----QL-NDENKEKLDAMA-HAFAQSGPFESS--PDMVQA---ACWAD-DVKRWGQ----
Q5NRA3_ZYMMO/33-298----WGMEGHEAIAALAWK-----YM-TPTTRKKVNAIL-AMDHD-RLTE----PDFMSR---ATWAD-KWRSAGH----
A5V871_SPHWW/21-280----WWEYGHETVATIAMQ-----SV-RPDTRQAIRRLL--ARSDLLETPTCPARTIEQA---SVWAD-CVKTLKDR--Y
Q5FP59_GLUOX/25-298----WGPYGHAIVADIAQE-----RL-TPQAQKAATALL-ALE-----NH----QTLDQV---ASWPD-TIGHVPKK---
Q0UA95_PHANO/19-289----WNTDG-----FMAET-----FF-TPKTTSILSQIL-ES--------QY-NESVGRA---AAWAD-GYAH-TAE--G
NUS1_ASPOR/21-284----WGNLGHETVAYIAQS-----FV-ASSTESFCQNIL-GD--------DS-TSYLANV---ATWAD-TYKY-TDA--G
A4HI96_LEIBR/31-295----WGCTGHMVLAEIARR-----QL-DPSNEKKIQAMA-MKFKESGPFLLS--PDMIQA---ACWPD-DVKRWGQ----
Q01U80_SOLUE/19-261----WGPEGHSLIARLAAA-----RL-TPAAAAKVAEILGPG------------NTLASI---SSWAD-SVRRAR-----
A2QX99_ASPNC/21-292----WGDVGHRAIAYLAEK-----YL-TVAGSNLVNELL-AN--------DK-NYDISDA---ATWAD-TIKW---K--R
A2TWS6_9FLAO/25-260----WGKTGHRVTGKIAEK-----HL-TKKAKRKIDKLL-KG------------QSLAFV---STFAD-EIKSDRA---Y
Q2UHT0_ASPOR/21-283----WGDVGHRTVAYIAEH-----HL-TKEGIGLLNDLL-PK--------KH-GFDVSDA---AVWPD-HIKH---R--H
Q2H4S7_CHAGB/217-488----SGSFGHITVGYLASA-----FV-SPATTTYLQTLL-RN--------DT-AEYLAGV---ATWAD-SIRY-TKW--G
Q15ZB2_PSEA6/20-256----WGQIGHRVTGAIAQQ-----HL-TPQAQAAISALL-PT------------EDLAEA---STYPD-EMRSSPDDFWQ
A4I736_LEIIN/27-297----WWSKGHMSVALIAKR-----HM-GASLVEKAELAA-KVLSF-SGPYPK-SPDMVQT---APWAD-DIKTIGL----
G3XKQ7_SOLLC/26-290----WSKEGHVMTCRIAQG-----LL-NDEAAHAVKMLL-PE--------YV-NGDLSAL---CVWPD-QVRH-WYK--Y
I1KHQ2_SOYBN/27-290----WGDDGHVIVCKIAQA-----RL-SEAAAEAVKKLL-PI--------SA-GNDLSTK---CSWAD-HVHH---I--Y
I1MEB5_SOYBN/33-297----WSKEGHVMTCQIAQA-----LL-EPEASEAVYQLL-PD--------HV-KGNLSAL---CTWPD-QIRH-WYK--Y
I1PPP5_ORYGL/30-294----WSKEGHMLTCRIAQD-----LL-EPAAAHAVRNLL-TE--------EA-DGDLSAL---CVWPD-QVRH-WYK--Y
M7YSG5_TRIUA/24-280----WGKEGHYMTCKIADG-----FL-TKEALAGVKALL-PS--------SA-NGELAEV---CSWAD-TQRF---R--Y
Q1K6E5_NEUCR/21-291----WGGFGHITVAYVASN-----FV-SNSTASYFQTLL-RN--------DT-SDYLANV---ATWAD-SIRY-TKW--G

PF09988

Q8YZE9_NOSS1/2-166---------------------------------------QYQRWG-VLRWIWLPYQK-----------------------
K9TIP1_9CYAN/2-166---------------------------------------QFQRWG-WLRWIWLPYQQ-----------------------
B2VAC8_SULSY/2-161---------------------------------------PNSRWK-ILKFIWLPYTK-----------------------
A5UV55_ROSS1/2-173---------------------------------------IDNRWG-FFFWIWRPYMW-----------------------
K9VXZ1_9CYAN/2-166---------------------------------------QFIRWG-WFRWIWIPYQK-----------------------
K9X512_9NOST/2-158---------------------------------------QFQRWG-FLRWIWLPYQR-----------------------
Q10Y23_TRIEI/2-165---------------------------------------QFQRWG-WFRWLWRPYQT-----------------------
K9R5N7_9CYAN/21-185---------------------------------------QYQRWG-YFRFIWLPYQK-----------------------
Q7U3L4_SYNPX/2-155---------------------------------------ALRRWG-PLRGLWWPYRR-----------------------
K9UM54_CHAP6/2-166---------------------------------------HYKRWG-ILRWLWRPYQQ-----------------------
D7CX68_TRURR/2-172-----------------------------------------NNWG-LLGLLWVPYGA-----------------------
K9S824_9CYAN/2-177---------------------------------------QFLRWG-LLRWLWLPYQR-----------------------
U5QDG6_9CYAN/2-166---------------------------------------QYRRWG-PLRWLWLPYRR-----------------------
Q9RT76_DEIRA/5-173-----------------------------------------RRWG-PLGFLWVPYGR-----------------------
B1XNI7_SYNP2/2-167---------------------------------------QFKRWG-IFRWIWLPYQK-----------------------
K9YHE6_CYASC/3-166---------------------------------------QFKRWG-YFKFIWLPYQK-----------------------
K9U5M5_9CYAN/2-166---------------------------------------QYQRWG-YARWIWIPYQK-----------------------
K9XH03_9CHRO/2-166---------------------------------------QYQRWG-YLRWIWRPYQK-----------------------
B7KDH5_CYAP7/2-167---------------------------------------QFQRWG-KLRCIWIPYQK-----------------------
D7DZB9_NOSA0/2-166---------------------------------------QFQRWG-FLRWIWLPYQK-----------------------
K9VNR5_9CYAN/2-166---------------------------------------QYQRWG-WFKPIWLPYQK-----------------------
A9B0N7_HERA2/2-170---------------------------------------PYNRWG-PLRFIWWPYRE-----------------------
Q8XL51_CLOPE/2-170---------------------------------------EFRRWG-YLKFIWIPYQK-----------------------
G2LLI8_CHLTF/2-174---------------------------------------QYTRWG-ILRWLWYPYKK-----------------------
E4UAQ6_OCEP5/2-167---------------------------------------PARLWG-WLRLLWIPYGR-----------------------
B1X0E2_CYAA5/2-167---------------------------------------QYKRWG-MIRWIWLPYQS-----------------------
Q7NFX0_GLOVI/2-166---------------------------------------QYRRWG-LLRWIWLPYRR-----------------------
K9Z9T5_CYAAP/2-167---------------------------------------QFQRWR-FFRFIWLPYQK-----------------------
L0A273_DEIPD/2-163-----------------------------------------RAWG-FLGALWVPYGL-----------------------
K9WE31_9CYAN/2-166---------------------------------------PFKRWG-WLRWIWIPYQK-----------------------
K9V8T7_9CYAN/2-166---------------------------------------QYQRWG-WLRWIWLPYQK-----------------------
Q7V3X6_PROMM/2-159---------------------------------------PLKRWG-LLQGLWWPYRK-----------------------
B8HTG8_CYAP4/2-166---------------------------------------QYRRWG-WLRWIWLPYQK-----------------------
C1CV84_DEIDV/5-166-----------------------------------------RHWG-VLGVLWVPYGM-----------------------
Q31N47_SYNE7/7-176---------------------------------------QSQRWG-PLRWIWTPYQR-----------------------
S0EUE8_CHTCT/2-170---------------------------------------EYRRWG-PLRFIWWPYRV-----------------------
E0U8U0_CYAP2/2-167---------------------------------------QFQRWG-KLSIIWLPYQK-----------------------
D3EPX6_ATETH/2-167---------------------------------------QYKRWG-IGRWIWLPYQY-----------------------
C0QT82_PERMH/2-161---------------------------------------PNRRWG-FLRFVWYPYTK-----------------------
Q2JJ24_SYNJB/2-166---------------------------------------QYQRWL-FLCWIWLPYRK-----------------------
B7K2N6_CYAP8/2-167---------------------------------------QYNRWG-IIRGIWLPYRF-----------------------
K9Q2E8_9CYAN/2-167---------------------------------------QFKRWG-MFRWIWLPYQK-----------------------
A9WA62_CHLAA/2-176---------------------------------------IDNRWG-IFFWIWRPYMW-----------------------
H8GTR8_DEIGI/2-163-----------------------------------------RRWG-VLGFLWVPYGR-----------------------
K9XZT4_STAC7/2-167---------------------------------------QFKRWG-LFRSLWLPYRY-----------------------
B2IUE8_NOSP7/2-166---------------------------------------QFQRWG-FLRWIWLPYQK-----------------------
E8UBR4_DEIML/2-163-----------------------------------------RYWG-ILGFLWVPYGM-----------------------
K9QIC8_9NOSO/2-166---------------------------------------QYQRWG-YLRWIWLPYQK-----------------------
B0JHJ8_MICAN/2-166---------------------------------------QYKRWG-YLRWLWLPYRS-----------------------
K9RQ06_SYNP3/2-166---------------------------------------PYQRWG-WLRWLWWPYQR-----------------------
D7BE64_MEISD/2-161-----------------------------------------GNWG-VLGWLWVPYGL-----------------------
A5GPK9_SYNPW/3-163---------------------------------------ALKRWG-PLGWIWRPYRT-----------------------
Q81WY4_BACAN/2-155---------------------------------------AYNKWG-FLRIFWYPYKK-----------------------
W6FU87_NODSP/2-166---------------------------------------QFQRWG-FLRCIWRPYQK-----------------------
B4UA61_HYDS0/2-160---------------------------------------PSKRWK-ILKWFWHPYRI-----------------------
K9T9J7_9CYAN/2-167---------------------------------------QYKRWG-KLRWIWKPYQS-----------------------
F0RKU1_DEIPM/12-173-----------------------------------------RNWG-FLGPLWVPYGM-----------------------
F2NN18_MARHT/2-164-----------------------------------------RYWG-VLGWLWVPYGL-----------------------
K8GJ34_9CYAN/2-177---------------------------------------QYRRWG-VLRWIWLPYRR-----------------------
D3PMR5_MEIRD/2-165-----------------------------------------GRWG-WMGWLWVPYGW-----------------------
B0CCR6_ACAM1/2-165---------------------------------------QYKRWG-WLRVIWLPYRK-----------------------
Q8DM71_THEEB/2-162---------------------------------------PYYRWG-WLRIIWLPYQK-----------------------
P72876_SYNY3/2-165---------------------------------------QYKRWG-WLRWVWLPYRH-----------------------

PF04307

Q18EP1_HALWD/1-158---------------------------------------KPVSYANLTPW------------------------------
Q65F12_BACLD/1-155---------------------------------------TKSKIGRRLPILSAVVSS-----------------------
Q0W2I6_METAR/1-181---------------------------------------VFHRFSDRDPRLYIF--------------------------
Q1AT01_RUBXD/1-176---------------------------------------PRSRLGNGLSRMRSPALNLLSRPLSWA--------------
Q7MS32_WOLSU/1-175---------------------------------------PNSTLGRQLPLLSSLFHR-----------------------
Q8D1W8_WIGBR/1-169---------------------------------------PGSFLGKKLNWISIPISK-----------------------
Q5WIF9_BACSK/1-182---------------------------------------TVLKLKNNAIYIRH---------------------------
Q2NV14_SODGM/1-168---------------------------------------PKSFLGQRLKWLSIPIAK-----------------------
A0LXF8_GRAFK/1-182---------------------------------------FIGNFFDTITSIEI---------------------------
Q01PN8_SOLUE/1-175---------------------------------------AMLGFGIPRGTLLS---------------------------
Q0W4H6_METAR/1-165---------------------------------------GEYIFHSVFNN------------------------------
YFHP_BACSU/1-182---------------------------------------TVLKLKNNAVYIRN---------------------------
Q5FTT4_GLUOX/53-213---------------------------------------ERSMLGSRLKFLSRFLAK-----------------------
Q726Y1_DESVH/1-173----------------------------------------IFFGSSAIDYLTI---------------------------
C1DQI7_AZOVD/1-180---------------------------------------VLIDYGDAVANMTR---------------------------
Q8ETE4_OCEIH/1-155---------------------------------------GGSKIGRRFPILSNIINA-----------------------
Q5FK20_LACAC/1-175---------------------------------------YNSTTSRKSPINFSLF-------------------------
A4XRV7_PSEMY/1-180---------------------------------------VVIDYGDAVGNMTY---------------------------
Q2N9Y9_ERYLH/13-204---------------------------------------ACFFWLEGAEHLGF---------------------------
Q023X2_SOLUE/1-190---------------------------------------LVTMAGGPLNYLHY---------------------------
A9AVQ5_HERA2/1-166---------------------------------------ISFWLDMPRGTLLS---------------------------
Q7VVQ6_BORPE/1-180---------------------------------------VLMRYPDPVSLMTY---------------------------
A6LWG2_CLOB8/1-169---------------------------------------GNSYIGKKTKGVSKAINK-----------------------
A3CRK4_METMJ/1-159---------------------------------------GHIVLAGTLGY------------------------------
A1TRR8_ACIAC/1-179---------------------------------------ALIDRGDPIANMVQ---------------------------
Q3J7C8_NITOC/1-183---------------------------------------ILRWTTDLLTYLNL---------------------------
Q8CV62_OCEIH/1-182---------------------------------------TVFKLKNNATYIRH---------------------------
A0JUC0_ARTS2/1-250---------------------------------------RHSTVANSLPPLSNVIAVRI---------------------
A1WTH1_HALHL/1-183---------------------------------------LGLVIADSLVYYNL---------------------------
Q5V391_HALMA/1-161-----------------------------------------KPLAYELHLIPS---------------------------
Q97K38_CLOAB/1-212---------------------------------------SRSKVSYNLRKIVVYAALVIVGAYILMANFYPEVEKTNLFL
Q1WSF6_LACS1/1-169---------------------------------------PSSYLGKRHKMVSGVTNK-----------------------
Q0ACJ1_ALKEH/1-184---------------------------------------FLLRVLDPLVYLNL---------------------------
Q7N3N6_PHOLL/1-166---------------------------------------PNSTLGRLFRFISIPIAK-----------------------
Q9KEC4_BACHD/1-182---------------------------------------TILKLRNNAVYIRN---------------------------
Q1D144_MYXXD/1-188---------------------------------------TLLARGDAVTVALQA--------------------------
Q2JB37_FRACC/1-225---------------------------------------PHGRIANTFGPVTRVMCRWI---------------------
Q12UG8_METBU/1-174---------------------------------------GRLFFEEIFAN------------------------------
Q5V568_HALMA/1-273---------------------------------------VYAPFGLLVGAAENLTADGFW--------------------
Q1ATT6_RUBXD/1-170---------------------------------------PKSWLGHQLGGVSEDLYR-----------------------
A4J2S9_DESRM/1-180---------------------------------------PGSYSGRMMRPLAVWLEE-----------------------
Q8TQH1_METAC/1-199---------------------------------------VSSSLTHESRNQLFYL-------------------------
Q6D4I1_PECAS/1-166---------------------------------------PKSVLGQRLKWLSAPIAR-----------------------
Q82XH5_NITEU/1-183---------------------------------------VVLRLIDTLTYLNW---------------------------
Q6YRT9_SYNY3/1-188---------------------------------------STSPAGRILPFISRPLEQ-----------------------
Q5HM58_STAEQ/1-158---------------------------------------TQSKIGRRFRLTSFFVRI-----------------------
Q8TP13_METAC/1-172---------------------------------------GEIIFASTFSS------------------------------
Q0JZE4_CUPNH/1-185---------------------------------------FLGFLVHPLRFLAQW--------------------------
Q97LP7_CLOAB/1-199---------------------------------------PKGMLNQYILPIKSKFIKTLFYGSFGALVVFGNYY------
A0PYB1_CLONN/1-199---------------------------------------PKSIINKYILPFKNKKTKTAVYLALAVIVLYSDYM------
Q9KE25_BACHD/1-180----------------------------------------GLLFNDGEAYLRI---------------------------
Q3JF51_NITOC/1-164---------------------------------------PTSKLGRVLFWLSTRLEK-----------------------
A1K1W5_AZOSB/1-183---------------------------------------YLLGYVSELTYLRG---------------------------
Q6AMI9_DESPS/1-207---------------------------------------LFTSISLIIPALMLSLIQQERQPTPEFLFLYFF--------
Q7NV83_CHRVO/1-166---------------------------------------PKSWLGRRIPFLSRPISY-----------------------
Q47U11_THEFY/1-250---------------------------------------PSSTATRSQGFVTGLLSRGMRALSLAVY-------------
Q47RB2_THEFY/1-227---------------------------------------KSATITKTYGVFTETLGAFF---------------------
Q1QZR4_CHRSD/1-181---------------------------------------VVIDYGDAVADYTY---------------------------
Q5P1U0_AROAE/1-192---------------------------------------FVLGYVSDIAYLRG---------------------------
Q0BSQ9_GRABC/13-169---------------------------------------PKSWVGQRLGGLSIALSK-----------------------
Q5L2T9_GEOKA/1-182---------------------------------------TIFKLRNNAQYIRN---------------------------
A5CZD2_PELTS/16-203---------------------------------------PGSYAGQRLRLLACWLEE-----------------------
Q2S300_SALRD/1-182---------------------------------------LANPFLTELQALTM---------------------------
Q1DD75_MYXXD/1-235---------------------------------------GLVTLAGSDASLYW---------------------------
A0KFP7_AERHH/1-165---------------------------------------PRSVLGQRLPWISKPLSR-----------------------
Q0VLL6_ALCBS/1-174---------------------------------------VLIDYGDAVVNFTE---------------------------
Q3A0M8_PELCD/1-203---------------------------------------LKSIVGVLVVGAVVADSVRRGLPMPEIAARSG---------
Q186I4_PEPD6/1-177---------------------------------------RGSYISKKFMLIYKLFGS-----------------------
Q2L2L1_BORA1/1-180---------------------------------------VLIRYPDPVSSMTY---------------------------
Q67R78_SYMTH/1-176---------------------------------------LSFLLRRGIQL------------------------------
Q97MS7_CLOAB/1-166---------------------------------------GAFFFRNVF--------------------------------
A6TSU9_ALKMQ/1-172---------------------------------------IMTRIKGDYVYLKH---------------------------
A6TMK4_ALKMQ/1-249---------------------------------------GTSSLAGKFGLLKAKHIKKIWIAILTTLSIGTLFFLKDTPI
A3CVA2_METMJ/1-183---------------------------------------GHILLAGTLNS------------------------------
Q9KAZ8_BACHD/1-159---------------------------------------PRSMVGRALPVVSTVLLR-----------------------
Q0S8N5_RHOJR/1-250---------------------------------------SQSTVARSFGPVSSVVAKGVDAVSLAFY-------------
Q1IHJ9_KORVE/1-205---------------------------------------FAWLLKSRTVYFAH---------------------------
Q890Y4_CLOTE/1-199---------------------------------------PKSMINKYILPFKNKFTKVIMYICIGIILLWYSIA------
Q0RHF1_FRAAA/1-228---------------------------------------PNGRIANTLGPVSRTICRWV---------------------
Q1MS87_LAWIP/1-199----------------------------------------ILFVSSAIDYIKV---------------------------
Q11P46_CYTH3/1-219---------------------------------------FDSTIGKWLHLKHTGMEIYF---------------------
A6LXK9_CLOB8/1-172---------------------------------------GAGVFRSVF--------------------------------
Q2VZJ9_MAGSA/1-159---------------------------------------PSSWLGRRLWPISKPISM-----------------------
Q5YVJ3_NOCFA/1-233---------------------------------------PKGTLAHVLGPLSYFACKII---------------------
Q8FRV6_COREF/1-249---------------------------------------PSATVSRSFGPVTQVISRFTENIAQTFV-------------
A0KMD3_AERHH/1-197---------------------------------------LAFKLGVAYGHVFG---------------------------
Q3JEV9_NITOC/1-176---------------------------------------FIRSPDDPLLVLEY---------------------------
Q9CNK9_PASMU/1-180---------------------------------------VFIRYADPISSMTY---------------------------
A1U6Q1_MARHV/1-174---------------------------------------VVIDYGTAVANFTQ---------------------------
Q7NWB9_CHRVO/1-187---------------------------------------VTFKLGIPYASPWG---------------------------
O29079_ARCFU/1-168---------------------------------------PHSYISKSYWGVFSGAIL-----------------------
Q1MQD9_LAWIP/1-155---------------------------------------RTFAMGNKQQWRRI---------------------------
Q5WH30_BACSK/1-157---------------------------------------THSKIGRRFPVLSKTIAT-----------------------
Q1GSW3_SPHAL/1-193---------------------------------------ACLFWLEGVQHLGF---------------------------
A3CTE7_METMJ/1-243---------------------------------------DAAIFNGKIAGAKGKRGQVVNGFAVVLPIFGYTIR------
YVSG_BACSU/1-155---------------------------------------TQSKIGRKFPILSKVVSS-----------------------
B1W5J1_STRGG/1-256---------------------------------------KSATISRAFGPLSKGLCEIADKLSYAVY-------------
Q5ZZH0_LEGPH/1-172---------------------------------------FIRFSQEPL-SLEQW--------------------------
Q6LSY8_PHOPR/1-173---------------------------------------VLIGYGDPVSDMVK---------------------------
Q74JJ2_LACJO/1-173---------------------------------------YNSSASKKSVINFSLF-------------------------
Q7CIV6_YERPE/1-162---------------------------------------PKSILGQRLKWVSVPIAR-----------------------
Q7CJI4_YERPE/1-166---------------------------------------LAFKFGVAYGHAFG---------------------------
Q81YV9_BACAN/1-179---------------------------------------TVLKLRNNAKYIRN---------------------------
Q8Y6J4_LISMO/1-176---------------------------------------TVLKLKNNADYIRN---------------------------
Q9HUK3_PSEAE/1-165---------------------------------------VAFKLGIAYHDAFG---------------------------
Q9RMV6_BACAN/1-156---------------------------------------QHSWIGRRTRGVSDLMNT-----------------------
U5L8V8_9BACI/1-175---------------------------------------TVLKLRNNAVYIRN---------------------------

PF13803

C7QBS6_CATAD/1-242-------------AGAFGV--------------------GDLAHT-WAAVPTLDLGIAFV--------------------
C0ZEY0_BREBN/1-241-------------FRMQPF--------------------SVYSHT-MLGLWVVDLPIAIL--------------------
K9WR57_9CYAN/1-241-------------LTLQPT--------------------RTIGHT-LLGVLIQGLPCSIV--------------------
D3EE91_GEOS4/1-236-------------VRFRAA--------------------GVWGHE-GPGILLFNLPMILL--------------------
X2GTZ3_9BACI/1-237-------------LRGQPK--------------------GEIGHT-FMGFITFNLPLVAF--------------------
F8A675_CELGA/1-236---VRLPRSADAWYEPFVN--------------------ATTTHA-WPGALTVAVPSAAV--------------------
Q1IN38_KORVE/1-247-------------FFMSYD--------------------SRSWHH-YPDLYRYCFPFLFA--------------------
D2Q1R3_KRIFD/1-251---DPLYDLATRQIHGSFT--------------------LTLTHQ-FTSALWLNPLLALL--------------------
A6GZ02_FLAPJ/1-235-------------LRMRIK--------------------SNYSHT-IGGLFCFDLLLGLL--------------------
D3V1B0_XENBS/1-240-------------VGLYDV--------------------ATVAHH-LPGWFYTAFPLCLL--------------------
Q899W6_CLOTE/1-232-------------ILFNPS--------------------SNLGHT-FLGFLFLNLPLCYL--------------------
G0FWC1_AMYMS/1-228--------------VPIPG--------------------GALTHE-PAGLVSVDLLLGLA--------------------
Q8XML2_CLOPE/1-242-------------LNFRPY--------------------GNLGHQ-ILGFFILNLPLCIL--------------------
A0Q1Y2_CLONN/1-242-------------LRFMPK--------------------GTIGHT-LIGSICFDIPLVII--------------------
Q6FEH5_ACIAD/1-242--------------FTNAS--------------------LTISHE-WSGMIVPNLLVGLL--------------------
H1YCR9_9SPHI/1-235-------------FRMKVY--------------------SIYSHT-WLGLLWFDVPVAMM--------------------
I4B9J2_TURPD/1-232-------------LRAQLT--------------------STISHT-VLGQFIFCLPIGII--------------------
K4IBC3_PSYTT/1-233-------------LRMRIR--------------------SDYSHT-IDGLFWFDLPLGLL--------------------
H2JVD3_STRHJ/1-251--------AAGVLPGGMEF--------------------GSVTHA-FTGVVTVDVLITWA--------------------
A5I0I6_CLOBH/1-248-------------IRFKAM--------------------ATIGHG-LIGFFLYNLPLCFI--------------------
Q65Q39_MANSM/1-229-------------LHWK-T--------------------DVGGHT-LFGSEWVNLPLCLL--------------------
F4FE12_VERMA/1-233MYRADGPGFPD-------------------------------THT-WPALVWWCLPVALA--------------------
C6D3J1_PAESJ/1-240-------------VRLEPY--------------------QSIGHT-AAGLFLQVIPLSLV--------------------
A3HWD2_9BACT/1-236-------------LQLKLS--------------------ENIGHK-ITGIFLFDLPVAFA--------------------
Q7UP84_RHOBA/1-249-------------FPMLFD--------------------YESFHS-IRGLFIDCVPVGVA--------------------
A8L7F5_FRASN/1-232-------------LGWSAM--------------------YHLSHS-LLGVVTFVPLLSLV--------------------
D2ARI2_STRRD/1-246----------LSFLPFLPD--------------------YMTWHS-YRGVLTIAPLAVVM--------------------
Q0RF10_FRAAA/1-232-------------FGWPEF--------------------YRLTHS-LLGVVTVAPVLSLV--------------------
C7R2G7_JONDD/1-241LRALRIPVSAQSWWEPFLN--------------------ATTTHN-WPGALIITIPLAFF--------------------

PF00882

A0A090C0Q9_ACIBA/1-206-------------FT-------------------MQS--GMLTHQ-WKGLFYPNLALGLL--------------------
C6RSF9_ACIRA/1-206-------------FV-------------------ADA--AGYTHQ-WASILHPNLWIGLA--------------------
B7H911_BACC4/1-208-------------LH------------------FRPY--GVIGHT-WLGFLYLNLPLVFL--------------------
C2XYJ1_BACCE/7-214-------------LY------------------FRPY--GIIGHT-WAGFFYLNLPLVFL--------------------
B1B9W2_CLOBO/1-214-------------LR------------------FMPK--GTIGHT-LLGSIWFDIPLVII--------------------
C5VRK3_CLOBO/1-214-------------LR------------------FKPI--GEMGHT-SLGVFYFDLPIVFI--------------------
A3I5H3_9BACI/4-213-------------LR------------------GRPI--GEIGHT-FAGFFLFNLPLVLI--------------------
Q0SV58_CLOPS/1-213-------------LN------------------FRPY--GNLGHE-ILGFFILNLPLCIL--------------------
C6JKD9_FUSVA/1-208-------------L--------------------RMK--SKYSHT-ISGILWYDLPMGIF--------------------
A1ZM58_9BACT/1-209-------------LR------------------MRIN--SQYSHT-IQGLLWFDLPLGLL--------------------
C0DX83_EIKCO/1-211-------------LH-------------------GRA--VPGGHS-LANLLWPNLPLCFT--------------------
D4DQE9_NEIEG/58-261-------------LH-------------------GRA--VSGGHG-LADMLWPNLPLCFA--------------------
C0B3N4_9GAMM/1-204-------------FG------------------LYQS--ATTAHG-LLGWFYTAFPFC-I--------------------
D4BTR9_PRORE/1-203-------------MM------------------WYSA--ATTAHD-LIGWLYTGLPLC-L--------------------
Q2LV15_SYNAS/6-198-------------TDVMKYG---------VLHIGHNW--ANRMHY-----------------------------------
Q2Y883_NITMU/6-188-------------DIAH--------------SSAGQW--ADRMHY-----------------------------------
A7K2D4_VIBAE/6-189-------------ALMN--------------SAQNKW--ADKMHY-----------------------------------
A4C3L5_9GAMM/6-186-------------AVGH--------------SEQNKW--ADLMHY-----------------------------------
C9YFH3_9BURK/6-183-------------GGP----------------GQGYW--ADQMHY-----------------------------------
Q12DA4_POLSJ/6-186-------------TLKQ---------------GQKKW--ADAMHY-----------------------------------
C4XMP3_DESMR/34-221-------------VGLGT------------NKQAIAW--ADRMHW-----------------------------------
E6VSV5_PSEA9/6-180-------------FYATPP----------GGAPLERL--AHRLHG-----------------------------------
Q2LQI8_SYNAS/6-189-------------SN------------------LLAA--AQRLHG-----------------------------------
B8FCF0_DESAA/6-187---------------------------------------YALENT---------EEF-----------------------
B3E8I7_GEOLS/6-161-------------DT------------------ALQL--AQRFHE-----------------------------------
A1AT46_PELPD/6-164-------------AT------------------ALHL--ADRFHD-----------------------------------
C6Y3Y4_PEDHD/24-233-------------ADTAEAAR-------HYLDVELYEAHIDSIPRKWEEAVKRYGLVRLN--------------------
E6U8V9_ETHHY/5-158---------------------------------------KYNVHP-----------------------------------
Q1IVJ5_KORVE/32-215-------------PFG-----------------HTFF--SDLTHY-----------------------------------
C1F375_ACIC5/44-227-------------PFG-----------------KDFF--SDLTHY-----------------------------------
Q01WM2_SOLUE/25-208-------------PFG-----------------SGFY--SDLTHY-----------------------------------
Q1ISY5_KORVE/28-210-------------PFG-----------------NRTF--SDLVHY-----------------------------------
Q025L8_SOLUE/39-222-------------PFG-----------------SKFF--SDLVHY-----------------------------------
Y1571_ARCFU/28-204-------------IS-------------------TEW--GTKFHG-----------------------------------
Q01YQ6_SOLUE/23-198-------------RKSAGPQD------ASEIAVYCVRPDGEAIHGATGDWETDA--------------------------
Q8XI18_CLOPE/5-158---------------------------------------KYKLKK-----------------------------------
R5X8W2_9CLOT/5-160---------------------------------------KYVLHK-----------------------------------
B6FWP7_9FIRM/5-161---------------------------------------KYKLKK-----------------------------------
Q18BT1_PEPD6/5-159---------------------------------------KYKLKK-----------------------------------
D3MTQ6_9FIRM/3-156---------------------------------------KYKLKK-----------------------------------
A0A0C2S6D2_CLOBO/4-161---------------------------------------KYKMIK-----------------------------------
C4IEN4_CLOBU/4-161---------------------------------------KYKVKK-----------------------------------
A6LQ77_CLOB8/4-161---------------------------------------KYKFKK-----------------------------------
B1BFH6_CLOPF/5-161---------------------------------------KYRLKK-----------------------------------
Q97KV3_CLOAB/5-155---------------------------------------KEIKCS-----------------------------------
B0P7T6_9FIRM/16-171---------------------------------------SLLKLS-----------------------------------
C0ECW5_9FIRM/5-161---------------------------------------KYKKIP-----------------------------------
A8MHU0_ALKOO/5-164---------------------------------------SLAKLD-----------------------------------
A6TNX7_ALKMQ/5-165---------------------------------------RLAKMQ-----------------------------------
B2A897_NATTJ/5-148---------------------------------------EHKIKK-----------------------------------
R6RM69_9FIRM/5-161---------------------------------------SFLTTP-----------------------------------
B0NZS3_9CLOT/15-171---------------------------------------SFVTTP-----------------------------------
R7D6R4_9FIRM/20-175---------------------------------------SFVTKR-----------------------------------
C6J9X9_9FIRM/5-161---------------------------------------SFITRR-----------------------------------
C6LKS6_9FIRM/5-161---------------------------------------SFLTER-----------------------------------
D4KRQ8_9FIRM/5-161---------------------------------------SFIYKR-----------------------------------
D9SRM2_CLOC7/5-162---------------------------------------GKFDTT-----------------------------------
A6LQR0_CLOB8/5-160---------------------------------------KYRMTM-----------------------------------
B0S165_FINM2/8-177---------------------------------------KYKLIR-----------------------------------
D1VUW6_9FIRM/8-182---------------------------------------YYKLIR-----------------------------------
C4IIQ3_CLOBU/5-155---------------------------------------LAYTNP-----------------------------------
C4Z638_EUBE2/40-187---------------------------------------HTYIKG-----------------------------------
A7VFQ0_9CLOT/5-152---------------------------------------HTYIKK-----------------------------------
C0EWT7_9FIRM/5-150---------------------------------------YTYLEG-----------------------------------
R5WI53_9FIRM/5-162-------------TYF-----------------RGSIRGEEKLRG-----------------------------------
D4LBU1_RUMC1/5-160-------------TYT-----------------RGSLH-HRFLHG-----------------------------------
Q315K4_DESAG/47-177---------------------------------------PGHSHN-----------------------------------
B8DLU9_DESVM/18-149---------------------------------------PGHSHN-----------------------------------
C7LVT1_DESBD/24-155---------------------------------------PTHSHN-----------------------------------
C6BUV8_DESAD/29-160---------------------------------------RLHSHN-----------------------------------
C8X0X8_DESRD/29-159---------------------------------------DTHCHN-----------------------------------
A5G5N0_GEOUR/25-157---------------------------------------LLHCHR-----------------------------------
E8WRC5_GEOS8/30-162---------------------------------------LQHCHR-----------------------------------
A1AK53_PELPD/24-156---------------------------------------LLNCHR-----------------------------------
B3EBK7_GEOLS/25-157---------------------------------------LLNCHR-----------------------------------
Q3A306_PELCD/29-161---------------------------------------LQHCHS-----------------------------------
Q1K0Z2_DESA6/27-159---------------------------------------LKHCHS-----------------------------------
C1A8N1_GEMAT/19-151---------------------------------------GRHCHS-----------------------------------
B8J577_ANAD2/33-165---------------------------------------LYHCHN-----------------------------------
D6SRA3_9DELT/26-149---------------------------------------QKNPHD-----------------------------------
B5YG53_THEYD/20-144---------------------------------------DKNPHS-----------------------------------
Q1H382_METFK/30-174---------------------------------------FSHSHY-----------------------------------
C6X6W6_METGS/30-174---------------------------------------FRETHQ-----------------------------------
C6WXF1_METML/56-200---------------------------------------FNNTHA-----------------------------------
D5CMM4_SIDLE/28-177------------------------------------P--FSTTHQ-----------------------------------
B0SPX5_LEPBP/6-211-------------Y--------------------HVL--QPKRTK-KAAFFGDL--------------------------
A0A0C5WZU2_LEPIR/6-211-------------Y--------------------HIF--SPHKTK-KATRWGDM--------------------------
C8W7P0_ATOPD/6-209-------------FMVPDYSH-------KVRYGRSHQ--SYPGSLPIPSYRRYQRNFMGG--------------------
C5DV22_ZYGRC/30-228---------------------------------------SCKPSK-QWHDFAES--------------------------
B5VL45_YEAS6/30-234---------------------------------------SCAPSNKDWSDFAEF--------------------------
C5DKM1_LACTC/24-220---------------------------------------SCNSR-KDWHEFAEY--------------------------
Q6FL70_CANGA/25-242---------------------------------------SCSLNNKKWHDFAEY--------------------------
Q6CEF9_YARLI/23-229-------------C--------------------LGL--SEEAEE-----------------------------------
C4R8D0_KOMPG/19-213---------------------------------------NCAGTQ--LAELSED--------------------------
Q8R432_MOUSE/28-220---------------------------------------PSICKRGKYHDVSER--------------------------
C3ZWC6_BRAFL/5-194---------------------------------------DSLCKKGKFHSVSED--------------------------
A7SED1_NEMVE/31-226---------------------------------------SNLCYGGKYHQVAED--------------------------
D3AZT7_POLPP/38-225-------------C--------------------GGF--AAESEA-----------------------------------
PLDG_DICDI/29-216-------------C--------------------GGL--ANESEA-----------------------------------
Q97TF6_CLOAB/60-232-------------FYNPYTGL-------NYLPSILPQ--SKTTAL-----------------------------------
A7B1H2_RUMGV/72-243-------------GNETD------------AGTFAGH--FYDPDT-GKNWLGQKS-------------------------
PHLC_CLOHA/37-230-------------PKAY--------------ALYQDH--FWDPDT-DNNFTKDSKWYLAY--------------------
A0PXH4_CLONN/38-231-------------PNAY--------------KLFQDH--FWDPDT-DHNFSKDNLWYLSY--------------------
Q5PXE6_CLOPF/38-231-------------KNAY--------------DLYQDH--FWDPDT-DNNFSKDNSWYLAY--------------------
Q8GCY3_9CLOT/38-231-------------PNAY--------------SLYQDH--FWDPDT-DHNFTQDNKWYLSY--------------------
PHLC_PAESO/38-231-------------PNAY--------------DLFQDH--FFDPDT-GNNFTLDNKWYVAS--------------------
Q6R6B7_LISSE/64-245-------------NPYYD------------KNTFLSH--FYNPKTHKTYIAGFP--------------------------
Q6EAE3_LISMN/64-245-------------NPYYD------------TSTFLSH--FYNPDRDNTYLPGFA--------------------------
Q6R6D6_LISIV/62-243-------------NPYYD------------CSTFVSH--FYNPTKDNTYLPGFK--------------------------
A0R9W0_BACAH/51-232-------------NPYYD------------NSTFASH--FYDPDNGKTYIPFAK--------------------------
A5D2J5_PELTS/29-178-------------N--------------------FSH--YYDPQT-GTGIKPWP--------------------------
Q896L3_CLOTE/34-205-------------S--------------------SNH--FFHFSK-GKGLYGFS--------------------------
A5N896_CLOK5/34-205-------------S--------------------SNH--FYHVNR-EKGLYGFS--------------------------
Q97KA0_CLOAB/34-205-------------S--------------------TNH--FFDFEK-GRGLYGFS--------------------------
A6TKQ8_ALKMQ/57-228-------------S--------------------SNH--FYNPYK-KKGLYGRR--------------------------
O26214_METTH/27-173-------------D--------------------FKY--HVYPYN-----------------------------------
B8I5G2_CLOCE/32-236-------------DPAGKGTLHGTLWTKDKDGYNANYIGNYIYLTKIADLLGNGKAVAKG--------------------
B5HQN8_9ACTN/67-292-------------AASVV-------------PGAMEF--GTVTHS-FPGVFTIDVLVAWA--------------------
Q82A31_STRAW/92-336-------------AASVL-------------SGAMEF--GDFTHS-FTGVLTFDVLVAWA--------------------
C9YWP6_STRSW/1-225-------------VASVL-------------PEAMEF--GDVTHS-FAGVFTVDVLVTWA--------------------
B4V801_9ACTN/61-287-------------LDAVV-------------EGVMGY--GEFTHS-PTGVVTADAALTAA--------------------
D3D9A1_9ACTN/1-206-------------GR------------------WTDL--YQLTHS-LLGIVTVVPALTIV--------------------
A7C3K4_9GAMM/1-217-------------YC------------------LSTR--CQFGHT-LLGIFLFDIPAGLV--------------------
B9XK96_PEDPL/41-256-------------FS------------------LSPR--VTLGHS-VPGVFWFCVPVGLI--------------------
D9T3L8_MICAI/1-213-------------FTG----------------TAPAQ--NLRTHT-LGGLLWWCLPVALV--------------------
C1ACE2_GEMAT/1-206-------------GR------------------MSHD--WLFSHT-LSAQIWFTVPLTMA--------------------
C0VQ51_9GAMM/1-206-------------FT-------------------PES--IALTHQ-WAGVLFPNLPIGLF--------------------
D0SL80_ACIJU/1-206-------------FT-------------------QAN--LPIAHQ-WSGVIFPNLPIGLF--------------------
D0SG75_ACIJO/1-206-------------FT-------------------QAD--SNTTHY-WTSLIHPDLWIGLS--------------------
D0SS47_ACILW/1-206-------------FT-------------------HTN--SNITHL-WSSLIHPDLWIGLA--------------------

PF02265

ENDO2_ARATH/28-290------------------------------HWSSP----LHYINT-PDAC-------SYQ--------------------
ENDO5_ARATH/21-288------------------------------QWTST----LHYVNT-PEYR------CNYE--------------------
A4H6V5_LEIBR/29-297------------------------------STMSS----WHFVDH-VY--------------------------------
Q8F3Z8_LEPIN/21-283-------------REMSPVCSQVFTSPAPPTNTGP----WHFIDI-PI----------SL--------------------
B0T6T3_CAUSK/23-287------------------------------RQTTE----WHFVDV-ELDHPDLAGACFG---------------------
Q66VY6_LEIMA/29-300------------------------------KTNFN----WHFITT-PY--------------------------------
Q7S8Q5_NEUCR/20-297------------------------------AWSAG----LHFVNG-HDGPPPE-SCHLV---------------------
Q5KPJ8_CRYNJ/20-279------------------------------RGTAP----MHYINA-RND---------HP--------------------
Q236I4_TETTS/18-296------------------------------NFWYG----WHFYDK-PE--------------------------------
Q4DEV4_TRYCC/28-293------------------------------FVMED----WHYIDT-PY--------------------------------
Q0CD39_ASPTN/21-282------------------------------PKTKP----WHYVDI-KDDPVHH-KCDISS--------------------
Q2SFD4_HAHCH/50-295------------------------------KHTGS----YHYVNV-ER--------------------------------
Q585P6_TRYB2/27-292------------------------------GAMDG----WHYTAN-MY--------------------------------
Q989R8_RHILO/21-270------------------------------PESYN----WHFVDI-PLAD-------SK---------------------
ENDO1_ARATH/29-294------------------------------RWTSH----LHYIDT-PDQAC-----SYE---------------------
A4CQ68_ROBBH/22-257------------------------------RSFSP----WHYVNL-PPE---------TP--------------------
A3U8L7_CROAH/33-268------------------------------RAYGP----WHYVNV-PFD---------TS--------------------
A7H7R9_ANADF/28-274------------------------------PATRA----WHYVNI-PL--------------------------------
Q7P202_CHRVO/23-274------------------------------KQTLPGSDQWHYNDE-PV--------------------------------
A0BML4_PARTE/16-293------------------------------NFMND----WHYTNR-PM--------------------------------
A7EWS3_SCLS1/21-282------------------------------KFSAP----FHFIDA-EDNPPD--SCGVD---------------------
Q3IBZ8_PSEHT/27-268------------------------------RKSSR----WHYINT-SAN---------KP--------------------
A7ETG5_SCLS1/21-277--------------------------------AALLRLFQRFFNT-EINAA----CGVK---------------------
A0M3W8_GRAFK/24-260------------------------------REFGP----WHYVNIDPEN---------KK--------------------
A0BLJ0_PARTE/422-699------------------------------EFLFS----WHYTDR-PI--------------------------------
A4HJL3_LEIBR/28-299------------------------------SALST----WHFITT-PY--------------------------------
Q0TYV6_PHANO/20-284------------------------------AFSGV----LHYIDA-LDNPPE--SCNID---------------------
ENDO3_ARATH/25-286------------------------------RWTSA----LHFADT-PDYKC-----NYE---------------------
Q0AMT2_MARMM/26-282------------------------------RHTAP----WHYINQ-TR--------------------------------
Q4Q7F3_LEIMA/31-295------------------------------YAMAT----WHFFDK-PY--------------------------------
Q5NRA3_ZYMMO/33-298------------------------------GETEP----WHFVDI-EIDNPNLVTACAA---------------------
A5V871_SPHWW/21-280------------------------------SYAYS----WHYQNV-DV--------------------------------
Q5FP59_GLUOX/25-298------------------------------KGGAPETLKWHYVDI-DV--------------------------------
Q0UA95_PHANO/19-289------------------------------RFSYQ----WHWIDT-HDWAPD--HCSLD---------------------
NUS1_ASPOR/21-284------------------------------EFSKP----YHFIDA-QDNPPQ--SCGVD---------------------
A4HI96_LEIBR/31-295------------------------------DAMST----WHYYAM-QY--------------------------------
Q01U80_SOLUE/19-261------------------------------AESGP----WHYVDI-PI--------------------------------
A2QX99_ASPNC/21-292------------------------------PLTRP----LHYINP-DDEPPK--SCFVS---------------------
A2TWS6_9FLAO/25-260------------------------------RAYSP----WHYVNM-GLT---------ET--------------------
Q2UHT0_ASPOR/21-283------------------------------PETAP----WHYVDV-EDDPLNN-HCKISP--------------------
Q2H4S7_CHAGB/217-488------------------------------RFTSD----FHFIDA-KDDPPR--YCGVD---------------------
Q15ZB2_PSEA6/20-256------------------------------KKAGP----FHYVTI-PKG---------QT--------------------
A4I736_LEIIN/27-297------------------------------KTLST----WHYITT-PY----------Y---------------------
G3XKQ7_SOLLC/26-290------------------------------KWTSP----LHFIDT-PDKAC-----NFD---------------------
I1KHQ2_SOYBN/27-290------------------------------PWASA----LHYANT-PEALC-----SYK---------------------
I1MEB5_SOYBN/33-297------------------------------RWTSP----LHFIDT-PDNAC-----SFQ---------------------
I1PPP5_ORYGL/30-294------------------------------RWTSP----LHFIDT-PDKAC-----SFV---------------------
M7YSG5_TRIUA/24-280------------------------------RWSSP----LHFADT-PEDC------KFS---------------------
Q1K6E5_NEUCR/21-291------------------------------RWTGP----LHYIDA-KDSP-------PD---------------------

PF09988

Q8YZE9_NOSS1/2-166-------------------------------------------------------------SLRH--RSFLSHGPLI-GT
K9TIP1_9CYAN/2-166-------------------------------------------------------------SLHH--RSFLSHGPLV-GT
B2VAC8_SULSY/2-161-------------------------------------------------------------LFSH--RG-ISHIPIY-GT
A5UV55_ROSS1/2-173-------------------------------------------------------------IIPH--RHFWSHSLVL-AP
K9VXZ1_9CYAN/2-166-------------------------------------------------------------ALNH--RSVFSHGLII-GT
K9X512_9NOST/2-158-------------------------------------------------------------SLRH--RSFLSHGPII-GT
Q10Y23_TRIEI/2-165-------------------------------------------------------------SLNH--RSFLSHGPII-GT
K9R5N7_9CYAN/21-185-------------------------------------------------------------SLRH--RSFLSHGPLI-GT
Q7U3L4_SYNPX/2-155-------------------------------------------------------------LIPH--RSLWSHGPLI-GT
K9UM54_CHAP6/2-166-------------------------------------------------------------AIKH--RSIWSHGPII-GT
D7CX68_TRURR/2-172-------------------------------------------------------------LFSH--RG-LSHTWFV-GP
K9S824_9CYAN/2-177-------------------------------------------------------------GLRH--RSLLSHGPVL-GT
U5QDG6_9CYAN/2-166-------------------------------------------------------------LGTH--RSWFTHGPIA-GT
Q9RT76_DEIRA/5-173-------------------------------------------------------------MFSH--RG-LSHTWIV-GP
B1XNI7_SYNP2/2-167-------------------------------------------------------------NLRH--RSALSHGFLI-GT
K9YHE6_CYASC/3-166-------------------------------------------------------------YLPH--RSFFSHGFII-GT
K9U5M5_9CYAN/2-166-------------------------------------------------------------TVKH--RSILSHGFAI-GT
K9XH03_9CHRO/2-166-------------------------------------------------------------ALRH--RSIFSHGFLI-GT
B7KDH5_CYAP7/2-167-------------------------------------------------------------YLRH--RSLLSHGFLI-GT
D7DZB9_NOSA0/2-166-------------------------------------------------------------SLRH--RSFLSHGPII-GT
K9VNR5_9CYAN/2-166-------------------------------------------------------------SLRH--RSFLSHGPLI-GT
A9B0N7_HERA2/2-170-------------------------------------------------------------LVPH--RAGISHSLVF-GP
Q8XL51_CLOPE/2-170-------------------------------------------------------------LFEH--RSVFTHGFIL-GP
G2LLI8_CHLTF/2-174-------------------------------------------------------------LFPH--RSHWTHGLLW-ST
E4UAQ6_OCEP5/2-167-------------------------------------------------------------LFRH--RG-LSHTWVV-GP
B1X0E2_CYAA5/2-167-------------------------------------------------------------CFKH--RSFFSHGLIV-GT
Q7NFX0_GLOVI/2-166-------------------------------------------------------------VAPH--RSLFSHGPLV-GT
K9Z9T5_CYAAP/2-167-------------------------------------------------------------TLKH--RSIFSHGFLL-GT
L0A273_DEIPD/2-163-------------------------------------------------------------LFSH--RG-WSHSWLI-GP
K9WE31_9CYAN/2-166-------------------------------------------------------------AMRH--RSIFSHGPLI-GT
K9V8T7_9CYAN/2-166-------------------------------------------------------------SLRH--RSFLSHGPVI-GT
Q7V3X6_PROMM/2-159-------------------------------------------------------------LIPH--RSLFSHGPLI-GT
B8HTG8_CYAP4/2-166-------------------------------------------------------------TLRH--RSFLSHGPIM-GT
C1CV84_DEIDV/5-166-------------------------------------------------------------LFSH--RG-LSHTWLV-GP
Q31N47_SYNE7/7-176-------------------------------------------------------------CLRH--RSWFSHGPLL-GT
S0EUE8_CHTCT/2-170-------------------------------------------------------------LVPH--RSWVSHGLIV-GG
E0U8U0_CYAP2/2-167-------------------------------------------------------------CLRH--RSLFSHGFLL-GT
D3EPX6_ATETH/2-167-------------------------------------------------------------SFKH--RSFLSHGFLI-GT
C0QT82_PERMH/2-161-------------------------------------------------------------IFSH--RG-ISHIPVI-GT
Q2JJ24_SYNJB/2-166-------------------------------------------------------------WMRH--RSFWSHGPIV-GT
B7K2N6_CYAP8/2-167-------------------------------------------------------------LLKH--RSFFSHGFVI-GT
K9Q2E8_9CYAN/2-167-------------------------------------------------------------TLSH--RSSLSHGFLV-GT
A9WA62_CHLAA/2-176-------------------------------------------------------------LIPH--RAFWSHSLII-SP
H8GTR8_DEIGI/2-163-------------------------------------------------------------MFSH--RG-LSHTWLL-GP
K9XZT4_STAC7/2-167-------------------------------------------------------------LFRH--RSFFSHGFII-GT
B2IUE8_NOSP7/2-166-------------------------------------------------------------SLRH--RSFLSHGPII-GT
E8UBR4_DEIML/2-163-------------------------------------------------------------LFSH--RG-LSHTWLI-GP
K9QIC8_9NOSO/2-166-------------------------------------------------------------SLRH--RSFLSHGPII-GT
B0JHJ8_MICAN/2-166-------------------------------------------------------------MIRH--RGWLSHGLLI-GT
K9RQ06_SYNP3/2-166-------------------------------------------------------------LIPH--RSWLSHGPIV-GT
D7BE64_MEISD/2-161-------------------------------------------------------------IFSH--RG-WSHTWIV-GP
A5GPK9_SYNPW/3-163-------------------------------------------------------------LIPH--RSLFSHGPLI-GT
Q81WY4_BACAN/2-155-------------------------------------------------------------VMPH--RSFFTHTIIL-GD
W6FU87_NODSP/2-166-------------------------------------------------------------KLRH--RSVFSHGPII-GT
B4UA61_HYDS0/2-160-------------------------------------------------------------VFKH--RG-LSHFPIV-GT
K9T9J7_9CYAN/2-167-------------------------------------------------------------LVGH--RSQLSHGLII-GT
F0RKU1_DEIPM/12-173-------------------------------------------------------------VFSH--RG-LSHTWVI-GP
F2NN18_MARHT/2-164-------------------------------------------------------------LFRH--RG-WSHTWIV-GP
K8GJ34_9CYAN/2-177-------------------------------------------------------------SMRH--RAFLSHGPIV-GT
D3PMR5_MEIRD/2-165-------------------------------------------------------------MFTH--RG-LSHTWVV-GP
B0CCR6_ACAM1/2-165-------------------------------------------------------------VLHH--RSWLSHGPII-GT
Q8DM71_THEEB/2-162-------------------------------------------------------------MFCH--RSLWTHGPVV-GT
P72876_SYNY3/2-165-------------------------------------------------------------FIPH--RSPLSHGFLI-GT

PF04307

Q18EP1_HALWD/1-158----------------------------------------------------------------G--R-VFMHSLPF-AI
Q65F12_BACLD/1-155-------------------------------------------------------------VFGH--R-TFTHSLLF-LL
Q0W2I6_METAR/1-181---------------------------------------------------------------TH--G-GITHSIAG-AV
Q1AT01_RUBXD/1-176---------------------------------------------------LRATSFVLVRTVGH--R-TLTHSLLG-LA
Q7MS32_WOLSU/1-175-------------------------------------------------------------LFGH--R-GATHSFLF-PF
Q8D1W8_WIGBR/1-169-------------------------------------------------------------TFGH--R-GFTHSLLS-LF
Q5WIF9_BACSK/1-182----------------------------------------------------------------H--R-GMTHSIPA-LL
Q2NV14_SODGM/1-168-------------------------------------------------------------VFGH--R-GITHSFLA-IV
A0LXF8_GRAFK/1-182----------------------------------------------------------------H--R-GFSHSIIF-AI
Q01PN8_SOLUE/1-175----------------------------------------------------------------H--R-GFFHSPFF-LA
Q0W4H6_METAR/1-165----------------------------------------------------------------G--R-IFSHTLLF-IA
YFHP_BACSU/1-182----------------------------------------------------------------H--R-GFTHSIPA-VL
Q5FTT4_GLUOX/53-213-------------------------------------------------------------TFGH--R-GLTHSGVM-LL
Q726Y1_DESVH/1-173----------------------------------------------------------------H--R-GITHSFAG-GA
C1DQI7_AZOVD/1-180----------------------------------------------------------------H--R-GFSHSLFV-LT
Q8ETE4_OCEIH/1-155-------------------------------------------------------------IFGH--R-TITHSLIF-LV
Q5FK20_LACAC/1-175--------------------------------------------------------------LRH--R-GITHSLLG-WI
A4XRV7_PSEMY/1-180----------------------------------------------------------------H--R-GFSHSLFV-LS
Q2N9Y9_ERYLH/13-204----------------------------------------------------------------R--R-GITHGPPA-LV
Q023X2_SOLUE/1-190----------------------------------------------------------------H--R-HITHSIAA-MP
A9AVQ5_HERA2/1-166----------------------------------------------------------------H--R-GFTHSVGF-AT
Q7VVQ6_BORPE/1-180----------------------------------------------------------------H--R-GFSHSILV-LT
A6LWG2_CLOB8/1-169-------------------------------------------------------------LAGH--R-KLFHAPLVYLF
A3CRK4_METMJ/1-159----------------------------------------------------------------G--R-IYFHGLTV-LF
A1TRR8_ACIAC/1-179----------------------------------------------------------------H--R-ADTHALLY-LS
Q3J7C8_NITOC/1-183----------------------------------------------------------------H--R-GITHSVVM-LP
Q8CV62_OCEIH/1-182----------------------------------------------------------------H--R-GASHSLPA-IV
A0JUC0_ARTS2/1-250----------------------------------------------------------ENASGGH--R-QGTHSVLG-AA
A1WTH1_HALHL/1-183----------------------------------------------------------------H--R-GETHSLLL-LP
Q5V391_HALMA/1-161----------------------------------------------------------------G--R-VFMHSLPF-AI
Q97K38_CLOAB/1-212KNMGV---------------------------YKLKDYIPYNLKLSNAGLLIIVGCIIFSKFTKH--R-SFSHSILG-LI
Q1WSF6_LACS1/1-169-------------------------------------------------------------AFGH--R-GITHSLLG-FI
Q0ACJ1_ALKEH/1-184----------------------------------------------------------------H--R-GVTHSLLL-LP
Q7N3N6_PHOLL/1-166-------------------------------------------------------------LCGH--R-GFTHSLLA-LI
Q9KEC4_BACHD/1-182----------------------------------------------------------------H--R-GLTHSLPA-LF
Q1D144_MYXXD/1-188----------------------------------------------------------------H--R-GLSHALVA-AP
Q2JB37_FRACC/1-225----------------------------------------------------------SRAAGGH--R-HATHSILF-AL
Q12UG8_METBU/1-174----------------------------------------------------------------G--R-IFAHTFLF-VL
Q5V568_HALMA/1-273----------------------------------------------------------ETANVVH--R-GPTHSLLLGAA
Q1ATT6_RUBXD/1-170-------------------------------------------------------------LFGH--R-SFLHSLLA-LL
A4J2S9_DESRM/1-180-------------------------------------------------------------KYGH--RNSPTHTLLF-CL
Q8TQH1_METAC/1-199--------------------------------------------------------------FGH--R-EFTHSILF-IA
Q6D4I1_PECAS/1-166-------------------------------------------------------------LFGH--R-GFTHSLLA-IV
Q82XH5_NITEU/1-183----------------------------------------------------------------H--Q-GPTHSLVM-LP
Q6YRT9_SYNY3/1-188-------------------------------------------------------------RFSH--R-SATHSLLA-SF
Q5HM58_STAEQ/1-158-------------------------------------------------------------LFGH--R-TFTHSLLF-II
Q8TP13_METAC/1-172----------------------------------------------------------------G--R-IIGHTLLF-SL
Q0JZE4_CUPNH/1-185----------------------------------------------------------------H--Q-GPTHSLLL-LP
Q97LP7_CLOAB/1-199-------------------------------------------RFHIFMLYILGALLFLIAISSH--RNGLMHSAAG-MI
A0PYB1_CLONN/1-199-------------------------------------------YTKSPVSKAIGIAFIFIAVSSH--RNGLTHSLIG-LI
Q9KE25_BACHD/1-180----------------------------------------------------------------H--R-GLTHSLLI-SP
Q3JF51_NITOC/1-164-------------------------------------------------------------HFGH--R-TITHSFLA-LM
A1K1W5_AZOSB/1-183----------------------------------------------------------------H--R-GVTHSVLL-LP
Q6AMI9_DESPS/1-207---------------------------------------------CSYFFINYFLYGVVKKLTVH--R-GILHSIPF-CL
Q7NV83_CHRVO/1-166-------------------------------------------------------------LFGH--R-GITHSLLA-VV
Q47U11_THEFY/1-250---------------------------------------------------RRTRTPADRSDGEH--R-HLGHTPVF-AA
Q47RB2_THEFY/1-227----------------------------------------------------------NWAFGGH--R-NGTHSLLF-AL
Q1QZR4_CHRSD/1-181----------------------------------------------------------------H--R-GFSHSLLV-LA
Q5P1U0_AROAE/1-192----------------------------------------------------------------H--R-GVTHSLLL-FP
Q0BSQ9_GRABC/13-169-------------------------------------------------------------AFGH--R-GVTHSLLA-II
Q5L2T9_GEOKA/1-182----------------------------------------------------------------H--R-GITHSIPA-VV
A5CZD2_PELTS/16-203-------------------------------------------------------------RFGH--RESPTHTLFF-AA
Q2S300_SALRD/1-182----------------------------------------------------------------H--R-SVTHSLVF-IA
Q1DD75_MYXXD/1-235----------------------------------------------------------------R--R-GWTHGVLA-LA
A0KFP7_AERHH/1-165-------------------------------------------------------------LFGH--R-GFTHSLLA-VA
Q0VLL6_ALCBS/1-174----------------------------------------------------------------H--R-GFSHSLLV-LL
Q3A0M8_PELCD/1-203----------------------------------------------LAMGLIALMFVIFTRLTVH--R-GIMHSVPF-VA
Q186I4_PEPD6/1-177-------------------------------------------------------------RFRH--R-GFTHSLIALLL
Q2L2L1_BORA1/1-180----------------------------------------------------------------H--R-GFSHSIFV-LT
Q67R78_SYMTH/1-176----------------------------------------------------------------H--R-TYTHTLVG-AA
Q97MS7_CLOAB/1-166----------------------------------------------------------------HNSR-IFGHTLLF-SA
A6TSU9_ALKMQ/1-172----------------------------------------------------------------H--R-VESHSIPG-IL
A6TMK4_ALKMQ/1-249FYGIALILFLGFIFAKQFAQKGYYMMRNFVQSMTAITVMIGAYYYEHYPLIWIGVILMILLLVKH--R-SFSHSILF-LI
A3CVA2_METMJ/1-183----------------------------------------------------------------G--R-IFGHGLLF-LA
Q9KAZ8_BACHD/1-159-------------------------------------------------------------TFGH--R-AFTHSLLF-LL
Q0S8N5_RHOJR/1-250--------------------------------------------------TVTKGKRDGKRRGGH--R-TLTHTALF-AA
Q1IHJ9_KORVE/1-205----------------------------------------------------------------H--R-GFTHTFLG-VP
Q890Y4_CLOTE/1-199-------------------------------------------SGGMPHIKAIGILFMFIAISTH--RNGLTHSLTG-MI
Q0RHF1_FRAAA/1-228----------------------------------------------------------SRASGGH--R-HATHSLVF-AL
Q1MS87_LAWIP/1-199----------------------------------------------------------------H--R-GITHSLAG-AW
Q11P46_CYTH3/1-219----------------------------------------------------------GKFWYSH--H-GFFHSLLA-AA
A6LXK9_CLOB8/1-172----------------------------------------------------------------HNSR-IFGHTLIF-SL
Q2VZJ9_MAGSA/1-159-------------------------------------------------------------VLGH--R-GLTHSLLA-VM
Q5YVJ3_NOCFA/1-233----------------------------------------------------------AKVSGGH--R-QGTHSLLF-VV
Q8FRV6_COREF/1-249--------------------------------------------------NVTRGRKDKPCKNGH--R-TATHTIWA-AL
A0KMD3_AERHH/1-197----------------------------------------------------------------H--R-GVTHSLLF-AF
Q3JEV9_NITOC/1-176----------------------------------------------------------------H--R-QFTHSLLF-VP
Q9CNK9_PASMU/1-180----------------------------------------------------------------H--R-GFSHSLFV-LT
A1U6Q1_MARHV/1-174----------------------------------------------------------------H--R-GFSHSLFI-LA
Q7NWB9_CHRVO/1-187----------------------------------------------------------------H--R-GFSHSLAA-AA
O29079_ARCFU/1-168------------------------------------------------------------KTTHH--R-GWTHSLVG-AG
Q1MQD9_LAWIP/1-155----------------------------------------------------------------H--R-QTSHWMGW-YL
Q5WH30_BACSK/1-157-------------------------------------------------------------IFGH--R-TFTHSLLF-LL
Q1GSW3_SPHAL/1-193----------------------------------------------------------------R--R-GITHGPIA-ML
A3CTE7_METMJ/1-243--------------------------------------------YLIYYPLSLVFMLILRKSYRHRHR-GLLHSFPG-VG
YVSG_BACSU/1-155-------------------------------------------------------------VFGH--R-TFTHSLLF-ML
B1W5J1_STRGG/1-256--------------------------------------------------KATKSKADPRRTGGH--R-TLTHTWFF-AV
Q5ZZH0_LEGPH/1-172----------------------------------------------------------------H--R-YLTHSLMF-IP
Q6LSY8_PHOPR/1-173----------------------------------------------------------------H--R-GFSHSLFI-ML
Q74JJ2_LACJO/1-173--------------------------------------------------------------LKH--R-GITHSFLG-WA
Q7CIV6_YERPE/1-162-------------------------------------------------------------VFGH--R-GFTHSLLA-VI
Q7CJI4_YERPE/1-166----------------------------------------------------------------H--R-GFTHSLLF-AF
Q81YV9_BACAN/1-179----------------------------------------------------------------H--R-GITHSIPA-VI
Q8Y6J4_LISMO/1-176----------------------------------------------------------------H--R-GITHSLPM-LA
Q9HUK3_PSEAE/1-165----------------------------------------------------------------H--R-GFSHSLLF-AS
Q9RMV6_BACAN/1-156-------------------------------------------------------------VFGH--R-GITHSLFG-LV
U5L8V8_9BACI/1-175----------------------------------------------------------------H--R-GITHSIPA-VI

PF13803

C7QBS6_CATAD/1-242-------------------------------------------------------------------LAGVWHR------
C0ZEY0_BREBN/1-241-------------------------------------------------------------------LAFLYQY------
K9WR57_9CYAN/1-241-------------------------------------------------------------------LLLITRY------
D3EE91_GEOS4/1-236-------------------------------------------------------------------LYVVFEK------
X2GTZ3_9BACI/1-237-------------------------------------------------------------------IYFIYHF------
F8A675_CELGA/1-236-------------------------------------------------------------------LLAVWWF------
Q1IN38_KORVE/1-247-------------------------------------------------------------------AFLLFQV------
D2Q1R3_KRIFD/1-251-------------------------------------------------------------------ALVVFHW------
A6GZ02_FLAPJ/1-235-------------------------------------------------------------------LAFIFHN------
D3V1B0_XENBS/1-240-------------------------------------------------------------------IFLIVR-------
Q899W6_CLOTE/1-232-------------------------------------------------------------------LNYLIIK------
G0FWC1_AMYMS/1-228-------------------------------------------------------------------LVAAGYA------
Q8XML2_CLOPE/1-242-------------------------------------------------------------------LAYIFHN------
A0Q1Y2_CLONN/1-242-------------------------------------------------------------------LYLLWEY------
Q6FEH5_ACIAD/1-242-------------------------------------------------------------------FCAVWYV------
H1YCR9_9SPHI/1-235-------------------------------------------------------------------LAFVYHN------
I4B9J2_TURPD/1-232-------------------------------------------------------------------LTILWQV------
K4IBC3_PSYTT/1-233-------------------------------------------------------------------LTFIFHN------
H2JVD3_STRHJ/1-251-------------------------------------------------------------------LAGLW-L------
A5I0I6_CLOBH/1-248-------------------------------------------------------------------LAYLFHR------
Q65Q39_MANSM/1-229-------------------------------------------------------------------FYAVYRL------
F4FE12_VERMA/1-233-------------------------------------------------------------------YARIFRS------
C6D3J1_PAESJ/1-240-------------------------------------------------------------------LGLLFHY------
A3HWD2_9BACT/1-236-------------------------------------------------------------------IALIFHC------
Q7UP84_RHOBA/1-249-------------------------------------------------------------------AYFVYHL------
A8L7F5_FRASN/1-232-------------------------------------------------------------------ALGIWFC------
D2ARI2_STRRD/1-246-------------------------------------------------------------------LLAVFHG------
Q0RF10_FRAAA/1-232-------------------------------------------------------------------ALGVWFH------
C7R2G7_JONDD/1-241-------------------------------------------------------------------LYAFIVA------

PF00882

A0A090C0Q9_ACIBA/1-206-------------------------------------------------------------------FSAIWYL------
C6RSF9_ACIRA/1-206-------------------------------------------------------------------FTLVWYL------
B7H911_BACC4/1-208-------------------------------------------------------------------IAYIYHY------
C2XYJ1_BACCE/7-214-------------------------------------------------------------------LAYAYHF------
B1B9W2_CLOBO/1-214-------------------------------------------------------------------LYLLWEY------
C5VRK3_CLOBO/1-214-------------------------------------------------------------------MAFSWNY------
A3I5H3_9BACI/4-213-------------------------------------------------------------------IYLIYHR------
Q0SV58_CLOPS/1-213-------------------------------------------------------------------LAYIFHN------
C6JKD9_FUSVA/1-208-------------------------------------------------------------------LAFIFHN------
A1ZM58_9BACT/1-209-------------------------------------------------------------------LTVVFHQ------
C0DX83_EIKCO/1-211-------------------------------------------------------------------LYALYLA------
D4DQE9_NEIEG/58-261-------------------------------------------------------------------VYWLYLA------
C0B3N4_9GAMM/1-204-------------------------------------------------------------------FVFILNY------
D4BTR9_PRORE/1-203-------------------------------------------------------------------LITIFVQ------
Q2LV15_SYNAS/6-198--------------------------------------------------------------------------------
Q2Y883_NITMU/6-188--------------------------------------------------------------------------------
A7K2D4_VIBAE/6-189--------------------------------------------------------------------------------
A4C3L5_9GAMM/6-186--------------------------------------------------------------------------------
C9YFH3_9BURK/6-183--------------------------------------------------------------------------------
Q12DA4_POLSJ/6-186--------------------------------------------------------------------------------
C4XMP3_DESMR/34-221--------------------------------------------------------------------------------
E6VSV5_PSEA9/6-180--------------------------------------------------------------------------------
Q2LQI8_SYNAS/6-189--------------------------------------------------------------------------------
B8FCF0_DESAA/6-187--------------------------------------------------------------------DLLAHFLHGKDG
B3E8I7_GEOLS/6-161--------------------------------------------------------------------------------
A1AT46_PELPD/6-164--------------------------------------------------------------------------------
C6Y3Y4_PEDHD/24-233-------------------------------------------------------------------QNGILPW------
E6U8V9_ETHHY/5-158-----------------------------------------------------------------------HFS------
Q1IVJ5_KORVE/32-215--------------------------------------------------------------------------------
C1F375_ACIC5/44-227--------------------------------------------------------------------------------
Q01WM2_SOLUE/25-208--------------------------------------------------------------------------------
Q1ISY5_KORVE/28-210--------------------------------------------------------------------------------
Q025L8_SOLUE/39-222--------------------------------------------------------------------------------
Y1571_ARCFU/28-204--------------------------------------------------------------------------------
Q01YQ6_SOLUE/23-198--------------------------------------------------------------------------------
Q8XI18_CLOPE/5-158-----------------------------------------------------------------------HYL------
R5X8W2_9CLOT/5-160-----------------------------------------------------------------------HYL------
B6FWP7_9FIRM/5-161-----------------------------------------------------------------------HYM------
Q18BT1_PEPD6/5-159-----------------------------------------------------------------------HYL------
D3MTQ6_9FIRM/3-156-----------------------------------------------------------------------HYL------
A0A0C2S6D2_CLOBO/4-161-----------------------------------------------------------------------HYF------
C4IEN4_CLOBU/4-161-----------------------------------------------------------------------HYY------
A6LQ77_CLOB8/4-161-----------------------------------------------------------------------HYF------
B1BFH6_CLOPF/5-161-----------------------------------------------------------------------HGR------
Q97KV3_CLOAB/5-155-----------------------------------------------------------------------HTL------
B0P7T6_9FIRM/16-171-----------------------------------------------------------------------HFK------
C0ECW5_9FIRM/5-161-----------------------------------------------------------------------HYK------
A8MHU0_ALKOO/5-164-----------------------------------------------------------------------HFK------
A6TNX7_ALKMQ/5-165-----------------------------------------------------------------------HFK------
B2A897_NATTJ/5-148-----------------------------------------------------------------------HEY------
R6RM69_9FIRM/5-161-----------------------------------------------------------------------HTF------
B0NZS3_9CLOT/15-171-----------------------------------------------------------------------HKF------
R7D6R4_9FIRM/20-175-----------------------------------------------------------------------HEY------
C6J9X9_9FIRM/5-161-----------------------------------------------------------------------HEF------
C6LKS6_9FIRM/5-161-----------------------------------------------------------------------HEF------
D4KRQ8_9FIRM/5-161-----------------------------------------------------------------------HEI------
D9SRM2_CLOC7/5-162-----------------------------------------------------------------------HYK------
A6LQR0_CLOB8/5-160-----------------------------------------------------------------------HSK------
B0S165_FINM2/8-177-----------------------------------------------------------------------HYK------
D1VUW6_9FIRM/8-182-----------------------------------------------------------------------HYQ------
C4IIQ3_CLOBU/5-155-----------------------------------------------------------------------HFY------
C4Z638_EUBE2/40-187-----------------------------------------------------------------------HTW------
A7VFQ0_9CLOT/5-152-----------------------------------------------------------------------HTW------
C0EWT7_9FIRM/5-150-----------------------------------------------------------------------HTW------
R5WI53_9FIRM/5-162-----------------------------------------------------------------------HNY------
D4LBU1_RUMC1/5-160-----------------------------------------------------------------------HNA------
Q315K4_DESAG/47-177--------------------------------------------------------------------------------
B8DLU9_DESVM/18-149--------------------------------------------------------------------------------
C7LVT1_DESBD/24-155--------------------------------------------------------------------------------
C6BUV8_DESAD/29-160--------------------------------------------------------------------------------
C8X0X8_DESRD/29-159--------------------------------------------------------------------------------
A5G5N0_GEOUR/25-157--------------------------------------------------------------------------------
E8WRC5_GEOS8/30-162--------------------------------------------------------------------------------
A1AK53_PELPD/24-156--------------------------------------------------------------------------------
B3EBK7_GEOLS/25-157--------------------------------------------------------------------------------
Q3A306_PELCD/29-161--------------------------------------------------------------------------------
Q1K0Z2_DESA6/27-159--------------------------------------------------------------------------------
C1A8N1_GEMAT/19-151--------------------------------------------------------------------------------
B8J577_ANAD2/33-165--------------------------------------------------------------------------------
D6SRA3_9DELT/26-149--------------------------------------------------------------------------------
B5YG53_THEYD/20-144--------------------------------------------------------------------------------
Q1H382_METFK/30-174--------------------------------------------------------------------------------
C6X6W6_METGS/30-174--------------------------------------------------------------------------------
C6WXF1_METML/56-200--------------------------------------------------------------------------------
D5CMM4_SIDLE/28-177--------------------------------------------------------------------------------
B0SPX5_LEPBP/6-211-----------------------------------------------------------------------AHH------
A0A0C5WZU2_LEPIR/6-211-----------------------------------------------------------------------SHH------
C8W7P0_ATOPD/6-209-------------------------------------------------------------------LSPAEYLLQHDFI
C5DV22_ZYGRC/30-228-----------------------------------------------------------------------THW------
B5VL45_YEAS6/30-234-----------------------------------------------------------------------THW------
C5DKM1_LACTC/24-220-----------------------------------------------------------------------THW------
Q6FL70_CANGA/25-242-----------------------------------------------------------------------THW------
Q6CEF9_YARLI/23-229-----------------------------------------------------------------------AHW------
C4R8D0_KOMPG/19-213-----------------------------------------------------------------------LHW------
Q8R432_MOUSE/28-220-----------------------------------------------------------------------THW------
C3ZWC6_BRAFL/5-194-----------------------------------------------------------------------THW------
A7SED1_NEMVE/31-226-----------------------------------------------------------------------THW------
D3AZT7_POLPP/38-225-----------------------------------------------------------------------AHW------
PLDG_DICDI/29-216-----------------------------------------------------------------------AHW------
Q97TF6_CLOAB/60-232--------------------------------------------------------------------------------
A7B1H2_RUMGV/72-243----------------------------------------------------------------------PTAR------
PHLC_CLOHA/37-230-------------------------------------------------------------------GINETGE------
A0PXH4_CLONN/38-231-------------------------------------------------------------------SIKDTAE------
Q5PXE6_CLOPF/38-231-------------------------------------------------------------------SIPDTGE------
Q8GCY3_9CLOT/38-231-------------------------------------------------------------------AVPDNAE------
PHLC_PAESO/38-231-------------------------------------------------------------------PIYDTAE------
Q6R6B7_LISSE/64-245-----------------------------------------------------------------------NAK------
Q6EAE3_LISMN/64-245-----------------------------------------------------------------------NAK------
Q6R6D6_LISIV/62-243-----------------------------------------------------------------------NAK------
A0R9W0_BACAH/51-232-----------------------------------------------------------------------QAK------
A5D2J5_PELTS/29-178-----------------------------------------------------------------------DAR------
Q896L3_CLOTE/34-205-----------------------------------------------------------------------NAL------
A5N896_CLOK5/34-205-----------------------------------------------------------------------DAL------
Q97KA0_CLOAB/34-205-----------------------------------------------------------------------NLV------
A6TKQ8_ALKMQ/57-228-----------------------------------------------------------------------SAM------
O26214_METTH/27-173--------------------------------------------------------------------------------
B8I5G2_CLOCE/32-236-------------------------------------------------------------------TVSQSYG------
B5HQN8_9ACTN/67-292-------------------------------------------------------------------LVGLWL-------
Q82A31_STRAW/92-336-------------------------------------------------------------------LAGAWL-------
C9YWP6_STRSW/1-225-------------------------------------------------------------------LVGLWL-------
B4V801_9ACTN/61-287-------------------------------------------------------------------LAACWL-------
D3D9A1_9ACTN/1-206-------------------------------------------------------------------VLLVWCH------
A7C3K4_9GAMM/1-217-------------------------------------------------------------------ILWIFHR------
B9XK96_PEDPL/41-256-------------------------------------------------------------------FFILLQH------
D9T3L8_MICAI/1-213-------------------------------------------------------------------YAWVVRR------
C1ACE2_GEMAT/1-206-------------------------------------------------------------------LVWLLTT------
C0VQ51_9GAMM/1-206-------------------------------------------------------------------FCLLWYL------
D0SL80_ACIJU/1-206-------------------------------------------------------------------FCLLWYL------
D0SG75_ACIJO/1-206-------------------------------------------------------------------FCVLWYA------
D0SS47_ACILW/1-206-------------------------------------------------------------------FCAVWYL------

PF02265

ENDO2_ARATH/28-290-------------------------------------------------------------------YNRDCKD-ES-GE
ENDO5_ARATH/21-288-------------------------------------------------------------------YCRDCHD-TH-KH
A4H6V5_LEIBR/29-297-------------------------------------------------------------------NPQNI-PLTI-NP
Q8F3Z8_LEPIN/21-283-------------------------------------------------------------------TNPTHDDIEK-IC
B0T6T3_CAUSK/23-287-------------------------------------------------------------------FPASATPASA-GP
Q66VY6_LEIMA/29-300-------------------------------------------------------------------YPDSD-FTLEFSP
Q7S8Q5_NEUCR/20-297-------------------------------------------------------------------LPEDC-P------
Q5KPJ8_CRYNJ/20-279-------------------------------------------------------------------QDHCEFGQHG-WQ
Q236I4_TETTS/18-296-------------------------------------------------------------------NPQGLYVILD-QD
Q4DEV4_TRYCC/28-293-------------------------------------------------------------------NPQNINIKK--NP
Q0CD39_ASPTN/21-282-------------------------------------------------------------------L--DC-P------
Q2SFD4_HAHCH/50-295-------------------------------------------------------------------AAKRVSTAEN-CE
Q585P6_TRYB2/27-292-------------------------------------------------------------------IRDGFKPNV--TL
Q989R8_RHILO/21-270-------------------------------------------------------------------YDPVSQCAAN-VQ
ENDO1_ARATH/29-294-------------------------------------------------------------------YSRDCHD-QH-GL
A4CQ68_ROBBH/22-257-------------------------------------------------------------------YG------EI-TP
A3U8L7_CROAH/33-268-------------------------------------------------------------------YG------EA-EK
A7H7R9_ANADF/28-274--------------------------------------------------------------------AAAFDPARD-CP
Q7P202_CHRVO/23-274----------------------------------------------------------------------CSGVTEDECP
A0BML4_PARTE/16-293-------------------------------------------------------------------NPDGLQIKIE-DQ
A7EWS3_SCLS1/21-282-------------------------------------------------------------------YERDC-G------
Q3IBZ8_PSEHT/27-268-------------------------------------------------------------------ISLN-HSHTK-NK
A7ETG5_SCLS1/21-277-------------------------------------------------------------------FARDC-G------
A0M3W8_GRAFK/24-260-------------------------------------------------------------------YI------EE-EA
A0BLJ0_PARTE/422-699-------------------------------------------------------------------NPDGLLIKIE-DE
A4HJL3_LEIBR/28-299-------------------------------------------------------------------YPDPS-FTLDVSP
Q0TYV6_PHANO/20-284-------------------------------------------------------------------YARDC-P------
ENDO3_ARATH/25-286-------------------------------------------------------------------YSRDC-------P
Q0AMT2_MARMM/26-282-------------------------------------------------------------------DDPHVD-AED-CA
Q4Q7F3_LEIMA/31-295-------------------------------------------------------------------NPEDINIT---DP
Q5NRA3_ZYMMO/33-298-------------------------------------------------------------------ASNRSNPMKN-GG
A5V871_SPHWW/21-280--------------------------------------------------------------------CRPFEIKGN-CP
Q5FP59_GLUOX/25-298-------------------------------------------------------------------SHPAYDQARD-CP
Q0UA95_PHANO/19-289-------------------------------------------------------------------YSQDC-A------
NUS1_ASPOR/21-284-------------------------------------------------------------------YDRDC-G------
A4HI96_LEIBR/31-295-------------------------------------------------------------------NPDGINIT---DS
Q01U80_SOLUE/19-261-------------------------------------------------------------------NKPHLDMERD-CP
A2QX99_ASPNC/21-292-------------------------------------------------------------------YPHDC-P------
A2TWS6_9FLAO/25-260-------------------------------------------------------------------YE------ES-AK
Q2UHT0_ASPOR/21-283-------------------------------------------------------------------LPRDC-E------
Q2H4S7_CHAGB/217-488-------------------------------------------------------------------FARDCKK------
Q15ZB2_PSEA6/20-256-------------------------------------------------------------------YA------DV-GA
A4I736_LEIIN/27-297-------------------------------------------------------------------TDEDF-TLDV-SP
G3XKQ7_SOLLC/26-290-------------------------------------------------------------------YERDCHD-QH-GV
I1KHQ2_SOYBN/27-290-------------------------------------------------------------------NSRDCVDYKK-GI
I1MEB5_SOYBN/33-297-------------------------------------------------------------------YSRDCHD-PQ-GV
I1PPP5_ORYGL/30-294-------------------------------------------------------------------YSRDCHG-PD-GA
M7YSG5_TRIUA/24-280-------------------------------------------------------------------YARDCHD-TK-GN
Q1K6E5_NEUCR/21-291-------------------------------------------------------------------SC-GIIYERD-CK

PF09988

Q8YZE9_NOSS1/2-166TLRVVYLSSL---------------------LA-----------------------------------------------
K9TIP1_9CYAN/2-166ALRILYLGIW---------------------IG-----------------------------------------------
B2VAC8_SULSY/2-161ITKIFYLSFI----A-------------FIFLF-----------------------------------------------
A5UV55_ROSS1/2-173LLRLVYFYLV----T-------------LLIVV-----------------------------------------------
K9VXZ1_9CYAN/2-166IIRVLYITNL---------------------VL-----------------------------------------------
K9X512_9NOST/2-158MLRVLYLGTL---------------------LA-----------------------------------------------
Q10Y23_TRIEI/2-165ALRLLYLLNW---------------------SA-----------------------------------------------
K9R5N7_9CYAN/21-185TVRVLYLCVL---------------------IS-----------------------------------------------
Q7U3L4_SYNPX/2-155ALRLMLLLGW----W-------------VVLSL-----------------------------------------------
K9UM54_CHAP6/2-166IGRILYLSLW---------------------LG-----------------------------------------------
D7CX68_TRURR/2-172LTRLLYLVLL----A-------------LALGW-----------------------------------------------
K9S824_9CYAN/2-177LGRLAYLGLW----L-------------GA-VW-----------------------------------------------
U5QDG6_9CYAN/2-166LGRLVYLGIA---------------------LA-----------------------------------------------
Q9RT76_DEIRA/5-173LTRLLYLGLI----A-------------GAVWT-----------------------------------------------
B1XNI7_SYNP2/2-167IVRLLYLGSI---------------------LL-----------------------------------------------
K9YHE6_CYASC/3-166VIRSLYLCFI---------------------LL-----------------------------------------------
K9U5M5_9CYAN/2-166ILRLIYLAIW---------------------LS-----------------------------------------------
K9XH03_9CHRO/2-166TLRVLYLGTW---------------------LA-----------------------------------------------
B7KDH5_CYAP7/2-167LLRVIYLLAL---------------------LI-----------------------------------------------
D7DZB9_NOSA0/2-166TLRVVYLTTF---------------------LA-----------------------------------------------
K9VNR5_9CYAN/2-166ALRILYLAIW---------------------IA-----------------------------------------------
A9B0N7_HERA2/2-170LFRLGYFLVM---------------------VW-----------------------------------------------
Q8XL51_CLOPE/2-170IIRILYVSII----P-------------ITISS-----------------------------------------------
G2LLI8_CHLTF/2-174WLRVGYFTLV----M-------------TLALA-----------------------------------------------
E4UAQ6_OCEP5/2-167ITRILYLVLI----L-------------EGVLY-----------------------------------------------
B1X0E2_CYAA5/2-167VIRVIYLFSI---------------------IV-----------------------------------------------
Q7NFX0_GLOVI/2-166LGRLLYLAIV---------------------AV-----------------------------------------------
K9Z9T5_CYAAP/2-167LIRVIYLSLI---------------------LF-----------------------------------------------
L0A273_DEIPD/2-163LTRLIYLAVM----V-------------AVVTG-----------------------------------------------
K9WE31_9CYAN/2-166TLRMLYLATW---------------------TA-----------------------------------------------
K9V8T7_9CYAN/2-166TLRVLYFVMI---------------------LL-----------------------------------------------
Q7V3X6_PROMM/2-159GLRLAYLMSW----T-------------GLLLM-----------------------------------------------
B8HTG8_CYAP4/2-166ALRLLYLGSW---------------------LA-----------------------------------------------
C1CV84_DEIDV/5-166LTRLAYLAAL----L-------------ALIVG-----------------------------------------------
Q31N47_SYNE7/7-176IGRVLYLGAW----L----------------LL-----------------------------------------------
S0EUE8_CHTCT/2-170IIRALYLGVM---------------------FF-----------------------------------------------
E0U8U0_CYAP2/2-167VVRLIYLLTL---------------------IL-----------------------------------------------
D3EPX6_ATETH/2-167IIRLIYFFVI---------------------VM-----------------------------------------------
C0QT82_PERMH/2-161ATKIVYLSLV----S-------------LILIY-----------------------------------------------
Q2JJ24_SYNJB/2-166AVRVLYLSLW---------------------AG-----------------------------------------------
B7K2N6_CYAP8/2-167LLRLLYLGSI---------------------LT-----------------------------------------------
K9Q2E8_9CYAN/2-167TLRVLYFSIF---------------------LL-----------------------------------------------
A9WA62_CHLAA/2-176LLRLGYFAAV----V-------------YGLLL-----------------------------------------------
H8GTR8_DEIGI/2-163LTRLAYVAVL----L-------------GLVAG-----------------------------------------------
K9XZT4_STAC7/2-167VVRLIYLLIF---------------------CL-----------------------------------------------
B2IUE8_NOSP7/2-166ILRILYLGCL---------------------LA-----------------------------------------------
E8UBR4_DEIML/2-163LTRLAYLGVI----V-------------ALVVG-----------------------------------------------
K9QIC8_9NOSO/2-166TLRVIYLSVL---------------------LA-----------------------------------------------
B0JHJ8_MICAN/2-166IFRLFYFGSF---------------------LL-----------------------------------------------
K9RQ06_SYNP3/2-166VLRVAYLIGW---------------------LS-----------------------------------------------
D7BE64_MEISD/2-161LTRLVYMVLM----G-------------ALLWF-----------------------------------------------
A5GPK9_SYNPW/3-163GLRLAWMQTV----V-------------MVAWF-----------------------------------------------
Q81WY4_BACAN/2-155VIRIAYMLIV----F-------------SPFLF-----------------------------------------------
W6FU87_NODSP/2-166IIRVIYLGCF---------------------LA-----------------------------------------------
B4UA61_HYDS0/2-160LSRLLYVLIL----V-------------VFLYF-----------------------------------------------
K9T9J7_9CYAN/2-167ILRIIYLLIS---------------------TI-----------------------------------------------
F0RKU1_DEIPM/12-173LTRLAYLAIL----V-------------FLAVG-----------------------------------------------
F2NN18_MARHT/2-164LSRLAYLVLL----L-------------YLLGW-----------------------------------------------
K8GJ34_9CYAN/2-177VVRIVYLLGW----V-------------GACLA-----------------------------------------------
D3PMR5_MEIRD/2-165LTRILYLGAM----G-------------VLVYW-----------------------------------------------
B0CCR6_ACAM1/2-165ILRLVYLGVW---------------------LG-----------------------------------------------
Q8DM71_THEEB/2-162LIRLLYLSFW----L-------------GLGLG-----------------------------------------------
P72876_SYNY3/2-165ILRLLYLGSW----L-------------LLASA-----------------------------------------------

PF04307

Q18EP1_HALWD/1-158PIVLVVLGYA----L-------------ITNRL-----------------------------------------------
Q65F12_BACLD/1-155ITAFAAHLYF----A-------------DQSIL-----------------------------------------------
Q0W2I6_METAR/1-181ATSVLFAVIG----L-------------IVVTMALP--------------------------------------------
Q1AT01_RUBXD/1-176LFCAPVWLLL----G-------------GYPAF-----------------------------------------------
Q7MS32_WOLSU/1-175GVALPGWGIA----S-------------SQGIA-----------------------------------------------
Q8D1W8_WIGBR/1-169LLYVIIFSNI----F-------------NTNYV-----------------------------------------------
Q5WIF9_BACSK/1-182LWPFIISGGM----M-------------LFFQD-----------------------------------------------
Q2NV14_SODGM/1-168GCSIFLSSDL----L-------------SRIIIPIPV-------------------------------------------
A0LXF8_GRAFK/1-182IFAPLFGWII----S-------------KIESKS----------------------------------------------
Q01PN8_SOLUE/1-175LLAGVVAAIV----A-------------RGAAF-----------------------------------------------
Q0W4H6_METAR/1-165VLAIIALLVA----R-------------KYR-------------------------------------------------
YFHP_BACSU/1-182FWSVIIPAIL----Y-------------LFYPQ-----------------------------------------------
Q5FTT4_GLUOX/53-213LAAAALNGLM----G-------------PESLR-----------------------------------------------
Q726Y1_DESVH/1-173LLALLLALLF----A-------------LPLRRA----------------------------------------------
C1DQI7_AZOVD/1-180GFSLLLAWLL----R-------------RFRPH-----------------------------------------------
Q8ETE4_OCEIH/1-155LIGYILTLIT----D-------------NQSII-----------------------------------------------
Q5FK20_LACAC/1-175IFSTILYFCM----N-------------HFSPIALSMS------------------------------------------
A4XRV7_PSEMY/1-180GLALLLTWLI----R-------------RYRPH-----------------------------------------------
Q2N9Y9_ERYLH/13-204LLPLILAALL----W-------------GFDRWQASRGNR----------------------------------------
Q023X2_SOLUE/1-190VMALAAVAIV----R-------------FAGRKH----------------------------------------------
A9AVQ5_HERA2/1-166IIASMGASFA----P-------------RLGCKR----------------------------------------------
Q7VVQ6_BORPE/1-180ALAAVMAWLI----R-------------RRWSD-----------------------------------------------
A6LWG2_CLOB8/1-169LYSTAIGMFT----D-------------KLM-------------------------------------------------
A3CRK4_METMJ/1-159LVVVAGLILY----R-------------YRR-------------------------------------------------
A1TRR8_ACIAC/1-179LLAPLLGALA----A-------------RLHGEG----------------------------------------------
Q3J7C8_NITOC/1-183IWGALLATLF----W-------------RLRGKQ----------------------------------------------
Q8CV62_OCEIH/1-182IWSFLVSGLI----Y-------------LFVPE-----------------------------------------------
A0JUC0_ARTS2/1-250FFVLLATIAG----Q-------------LQLHTDWGLLSVGAGLLCMFMINIAAKALKF-----------FPKSGFISNW
A1WTH1_HALHL/1-183FWALLLGWVV----A-------------RLWPGQ----------------------------------------------
Q5V391_HALMA/1-161PLSIVVIAYA----V-------------RTDRT-----------------------------------------------
Q97K38_CLOAB/1-212LFTVGVKLLL----G-------------NIFIY-----------------------------------------------
Q1WSF6_LACS1/1-169LIGIIVKFIQ----K-------------QYLTD-----------------------------------------------
Q0ACJ1_ALKEH/1-184LWAALLAVVF----A-------------RVAPRLGG--------------------------------------------
Q7N3N6_PHOLL/1-166LGITLFWLKI----P-------------EEWLIPTD--------------------------------------------
Q9KEC4_BACHD/1-182IWPFLVAGGI----W-------------LLFPE-----------------------------------------------
Q1D144_MYXXD/1-188LVALTATLAA----R-------------ALFRG-----------------------------------------------
Q2JB37_FRACC/1-225GMGVVMGLLA----A-------------RFEYGWWAALFVLVGFGLRGLGLDFEKHE----------------HWSSVMD
Q12UG8_METBU/1-174VLFAMGAIIH----K-------------YHKEN-----------------------------------------------
Q5V568_HALMA/1-273LAAAAGLWAS----N-------------SRATRIGSLSIGAVLTVLTGAVSGPIAGL----------------VMLVFVL
Q1ATT6_RUBXD/1-170LVTAALGPLL----W-------------WLTGQ-----------------------------------------------
A4J2S9_DESRM/1-180TVGLILGVFV----A-------------GIMGS-----------------------------------------------
Q8TQH1_METAC/1-199LVTLFIWVKT----R-------------DWIF------------------------------------------------
Q6D4I1_PECAS/1-166AGIFFIQTRL----P-------------PDWPIPTD--------------------------------------------
Q82XH5_NITEU/1-183FWAFLLAHLF----S-------------RFTGGH----------------------------------------------
Q6YRT9_SYNY3/1-188TLALVSYALW----F-------------AMPVI-----------------------------------------------
Q5HM58_STAEQ/1-158GISFLLYFIQ----T-------------PMYYM-----------------------------------------------
Q8TP13_METAC/1-172LLFMIGLYIY----Q-------------RNR-------------------------------------------------
Q0JZE4_CUPNH/1-185AWGALLAGLF----C-------------LAAHRR----------------------------------------------
Q97LP7_CLOAB/1-199VCTVLVGYVA----N-------------RYNIH-----------------------------------------------
A0PYB1_CLONN/1-199SFTIIASYVG----K-------------SYAIP-----------------------------------------------
Q9KE25_BACHD/1-180LMAALAVGII----Y-------------LVAFKKR---------------------------------------------
Q3JF51_NITOC/1-164VLAVLISPLL----W-------------LKPVY-----------------------------------------------
A1K1W5_AZOSB/1-183LWGALLAGLF----A-------------RLARLRDR--------------------------------------------
Q6AMI9_DESPS/1-207LMGEMGYLLF----I-------------NSGATF----------------------------------------------
Q7NV83_CHRVO/1-166GVFYASAACL----H-------------DWGVRL----------------------------------------------
Q47U11_THEFY/1-250AVGAVIGLLC----H-------------LSWWATLVTAWFLAFLGLRALRKVAWRGLRTA----------LGSWPGAALG
Q47RB2_THEFY/1-227LLGGFAQLLV----L-------------WSELAAQIFVFLLIGIAFNGLGYGMEKNRV--------------AAEFINAL
Q1QZR4_CHRSD/1-181ALALSLTLLA----R-------------AGERWRRV--------------------------------------------
Q5P1U0_AROAE/1-192LWGMLLAWVF----A-------------ALAGRHHR--------------------------------------------
Q0BSQ9_GRABC/13-169ACGWAMQHSR----L-------------PRTII-----------------------------------------------
Q5L2T9_GEOKA/1-182LWPLLIVSVM----A-------------AIYPK-----------------------------------------------
A5CZD2_PELTS/16-203LAGLILGITA----A-------------IVLKA-----------------------------------------------
Q2S300_SALRD/1-182LVSACAAYGL----R-------------RFHRDI----------------------------------------------
Q1DD75_MYXXD/1-235LWPFVLTGLM----L-------------LWDRYVRRRRH-----------------------------------------
A0KFP7_AERHH/1-165AAIWGLDQSL----A-------------PALLPTGV--------------------------------------------
Q0VLL6_ALCBS/1-174PVSFLLAVCL----A-------------RWQTR-----------------------------------------------
Q3A0M8_PELCD/1-203LWALLTMQIT----Y-------------SLGRN-----------------------------------------------
Q186I4_PEPD6/1-177IYSFFKSLTI----F-------------TNNNI-----------------------------------------------
Q2L2L1_BORA1/1-180AFALLLMWLI----R-------------KRWPA-----------------------------------------------
Q67R78_SYMTH/1-176ALSAASAGLL----A-------------AAFPS-----------------------------------------------
Q97MS7_CLOAB/1-166VLLCIGLYRQ----L-------------RHKKNG----------------------------------------------
A6TSU9_ALKMQ/1-172FSTLVITAGL----S-------------LFFSE-----------------------------------------------
A6TMK4_ALKMQ/1-249GCTLVVRQIS----F-------------FYGDI-----------------------------------------------
A3CVA2_METMJ/1-183LLAVAGIALY----R-------------RRE-------------------------------------------------
Q9KAZ8_BACHD/1-159GIYWLLNWLP----V-------------YSTDV-----------------------------------------------
Q0S8N5_RHOJR/1-250GIGAGVSALV----V-------------QFGKPAIIATLFVCLGLALRGLAGELAKEK--------------GWLAVSVV
Q1IHJ9_KORVE/1-205FVAAFVLALVWSIRW-------------AFLKLRNGQTLK----------------------------------------
Q890Y4_CLOTE/1-199IFSVIVGYIG----N-------------IYNLY-----------------------------------------------
Q0RHF1_FRAAA/1-228AMGVAMSLLA----D-------------HSRYGWWAALFVLVGFGLRGLGLDFEGHE----------------FWSGLKD
Q1MS87_LAWIP/1-199GLAFICTIPL----V-------------VLTALRPQPNE-----------------------------------------
Q11P46_CYTH3/1-219LLAAVFICLR----K-------------LFFKEESWKKY-----------------------------------------
A6LXK9_CLOB8/1-172VLILIGIYML----N-------------RNGKKN----------------------------------------------
Q2VZJ9_MAGSA/1-159GGLAVLMLVE----P-------------GRGLV-----------------------------------------------
Q5YVJ3_NOCFA/1-233AAAYGTWAGM----H-------------WIGRPFTLALAFFLLALAVRALHLYPPGDD--------------IRSWGTVV
Q8FRV6_COREF/1-249AAGVGATALI----G-------------AFGKTAVIGLLFFLLGLGIRGLLPEWSKKT--------------DWLIVTGL
A0KMD3_AERHH/1-197ALPTLAMLFH----R-------------QFRASTA---------------------------------------------
Q3JEV9_NITOC/1-176IGGLVATVLL----W-------------PFLRRR----------------------------------------------
Q9CNK9_PASMU/1-180ALAFFITWLT----F-------------KRHTN-----------------------------------------------
A1U6Q1_MARHV/1-174PLSLLIAWGL----W-------------RWKPL-----------------------------------------------
Q7NWB9_CHRVO/1-187LLAGLLAWLC----R-------------PVWQR-----------------------------------------------
O29079_ARCFU/1-168IFSFIFAILL----L-------------IFGSS-----------------------------------------------
Q1MQD9_LAWIP/1-155LLMILGLMNF----P-------------LKHFALSPI-------------------------------------------
Q5WH30_BACSK/1-157LASIVLRWLF----P-------------DNEAV-----------------------------------------------
Q1GSW3_SPHAL/1-193ALPIILWALV----M-------------SFDRWQERRGKR----------------------------------------
A3CTE7_METMJ/1-243LTTLVLCGYL----A-------------LILTWLGS--------------------------------------------
YVSG_BACSU/1-155IMFFITSTYI----P-------------DKNIS-----------------------------------------------
B1W5J1_STRGG/1-256LMGAGCSFAA----V-------------TGGRWAVLAILFVHLVLAVEGLLWRAARVSSDILVWLLGATSAWILAGVLDQ
Q5ZZH0_LEGPH/1-172IGGLIVALFL----L-------------CFSQYRQ---------------------------------------------
Q6LSY8_PHOPR/1-173PFSWLLAQAW----Q-------------QWRPSRF---------------------------------------------
Q74JJ2_LACJO/1-173IFSGGLYYLM----N-------------KFIPIHINNLT-----------------------------------------
Q7CIV6_YERPE/1-162AGIALFQVDA----P-------------LNGVLP----------------------------------------------
Q7CJI4_YERPE/1-166ALPTLLLAFY----R-------------FFNTSL----------------------------------------------
Q81YV9_BACAN/1-179LWSFLISGIS----F-------------AFFSDAP---------------------------------------------
Q8Y6J4_LISMO/1-176IWPLLISSIL----Y-------------LLFPAAT---------------------------------------------
Q9HUK3_PSEAE/1-165ILGALAALAC----R-------------PLHSGP----------------------------------------------
Q9RMV6_BACAN/1-156LVLIPILFAV----G-------------MTPLS-----------------------------------------------
U5L8V8_9BACI/1-175LWPLAILAVI----Y-------------PFFPEAN---------------------------------------------

PF13803

C7QBS6_CATAD/1-242VLRAPLVGLL----PVRWAAAA------DQLTA--------------------------------------------P--
C0ZEY0_BREBN/1-241VVKKPMLARL----P-------------EWMGR--------------------------------------------G--
K9WR57_9CYAN/1-241VLMRPFLALL----P-------------RQLAQ--------------------------------------------R--
D3EE91_GEOS4/1-236VIRPVLHVYL----P-------------SWFPY--------------------------------------------R--
X2GTZ3_9BACI/1-237FIHQTFVHYL----P-------------NILQD--------------------------------------------T--
F8A675_CELGA/1-236V-RLPLRAL-------------------AGTAS--------------------------------------------R--
Q1IN38_KORVE/1-247AIKKPVAGLL----P-------------VALQR--------------------------------------------R--
D2Q1R3_KRIFD/1-251VLKRPLVALA----P-------------PSLAG--------------------------------------------R--
A6GZ02_FLAPJ/1-235VVRDSLFDNL----P-------------KFLKS--------------------------------------------R--
D3V1B0_XENBS/1-240LLSYPLSVLF----P-------------ISFAR--------------------------------------------Y--
Q899W6_CLOTE/1-232FIRIPFILNL----P-------------FGLSR--------------------------------------------Y--
G0FWC1_AMYMS/1-228VLA-PVLAFG----PAGWRERV------PRPAG--------------------------------------------R--
Q8XML2_CLOPE/1-242FIKSPLISHL----P-------------RPLDN--------------------------------------------W--
A0Q1Y2_CLONN/1-242IIKKPFILSM----P-------------QPIDK--------------------------------------------KFS
Q6FEH5_ACIAD/1-242LYRPFIYRWL----SLHDPLNL------NTLDR--------------------------------------------T--
H1YCR9_9SPHI/1-235TVKAAFIANL----P-------------RELYH--------------------------------------------R--
I4B9J2_TURPD/1-232VIKKPLLANM----P-------------QWFRI--------------------------------------------R--
K4IBC3_PSYTT/1-233IVRNDLFDNL----P-------------TFLKS--------------------------------------------R--
H2JVD3_STRHJ/1-251LVREPLLALL----P-------------RARQG--------------------------------------------RPA
A5I0I6_CLOBH/1-248IIKKPLIAHG----P-------------KPIDS--------------------------------------------W--
Q65Q39_MANSM/1-229ILATPIKQHL----PAFCGSNV------PQVTF--------------------------------------------K--
F4FE12_VERMA/1-233SIG-TVAAHL----PQNRRFGWWVDGPPAGGGH--------------------------------------------R--
C6D3J1_PAESJ/1-240VVKSSLALHL----P-------------SLFDL--------------------------------------------D-K
A3HWD2_9BACT/1-236LIKMPLFKAS----P-------------KWFQS--------------------------------------------R--
Q7UP84_RHOBA/1-249LIKQPVVELL----PGPLRTKV------RPIAD--------------------------------------------R--
A8L7F5_FRASN/1-232LARDALLDLA----PDPVRLRL------PPRAR--------------------------------------------P--
D2ARI2_STRRD/1-246LLRDPLTALF----P-------------PALAG--------------------------------------------R--
Q0RF10_FRAAA/1-232LTRDALVDLA----PGPVRLRL------AARAR--------------------------------------------L--
C7R2G7_JONDD/1-241CAR-PALWVL----PESGST--------PQTPQ--------------------------------------------R--

PF00882

A0A090C0Q9_ACIBA/1-206LYRPVVYRFF----G-------------IQH---------------------------------------DLKL--DSFR
C6RSF9_ACIRA/1-206IYRPALYRFL----G-------------IQK---------------------------------------PLNI--HSPL
B7H911_BACC4/1-208ILKKPFITHL----P-------------KPF---------------------------------------AGYY--SYAI
C2XYJ1_BACCE/7-214ILKGPFITHL----P-------------KPF---------------------------------------ASYY--KYVV
B1B9W2_CLOBO/1-214IIKRPFILSM----P-------------QPI---------------------------------------DKNL--YHIT
C5VRK3_CLOBO/1-214IIKKTFILSL----P-------------HPF---------------------------------------DKKL--SYFL
A3I5H3_9BACI/4-213FIHQPIMSHL----P-------------EFL-------------------------------------------------
Q0SV58_CLOPS/1-213FIKSPLISHL----P-------------RPL---------------------------------------DNWY--GYLR
C6JKD9_FUSVA/1-208LIKEALINNM----P-------------LFF---------------------------------------KSRF--INLR
A1ZM58_9BACT/1-209IVRNVLIDNL----P-------------FFL---------------------------------------KSRV--YHCK
C0DX83_EIKCO/1-211LWHHTLRDFL----P-------------DCLNA-------------------------------------AYRLPESTIA
D4DQE9_NEIEG/58-261LWRDTLSDFL----P-------------NCLNA-------------------------------------APY-----RP
C0B3N4_9GAMM/1-204LFRNPLKCVS----P-------------IPL-------------------------------------------------
D4BTR9_PRORE/1-203KSVFYLHYAV----P-------------FPL-------------------------------------------------
Q2LV15_SYNAS/6-198ENIDGFILEG----I-------------KKLSS-----------------------------------------------
Q2Y883_NITMU/6-188QRTGDMIKAG----V-------------EWIRR-----------------------------------------------
A7K2D4_VIBAE/6-189NHVGKLIDAL----I-------------QQVKA-----------------------------------------------
A4C3L5_9GAMM/6-186EKTGDVIKAA----V-------------HYCKK-----------------------------------------------
C9YFH3_9BURK/6-183KNTATLLRSG----I-------------NAVQK-----------------------------------------------
Q12DA4_POLSJ/6-186TRNASLLRVG----V-------------AAVAK-----------------------------------------------
C4XMP3_DESMR/34-221KNVSERIGAG----V-------------AAVSN-----------------------------------------------
E6VSV5_PSEA9/6-180ANGEDTFALI----R-------------LLTDH-----------------------------------------------
Q2LQI8_SYNAS/6-189YNASRAFNPF----G-------------PLARN-----------------------------------------------
B8FCF0_DESAA/6-187ENTFAPLTGL----V-------------EAYQD-----------------------------------------------
B3E8I7_GEOLS/6-161PAGSSYAPLL----H-------------YAENT-----------------------------------------------
A1AT46_PELPD/6-164ATGNSYAPLI----R-------------VETSR-----------------------------------------------
C6Y3Y4_PEDHD/24-233-QIQKSYYKL----V-------------HALRD-----------------------------------------------
E6U8V9_ETHHY/5-158DVSMDFVLGR----A-------------TALYD-----------------------------------------------
Q1IVJ5_KORVE/32-215VRAGDFVASL----F-------------RNAQN-----------------------------------------------
C1F375_ACIC5/44-227VRTGAFVTAL----L-------------RDSRN-----------------------------------------------
Q01WM2_SOLUE/25-208VRSGDFILNM----I-------------REAQD-----------------------------------------------
Q1ISY5_KORVE/28-210VRSGDFVVNL----I-------------NESDS-----------------------------------------------
Q025L8_SOLUE/39-222VRTGEFVENL----V-------------KEAQT-----------------------------------------------
Y1571_ARCFU/28-204YYVNDALNIA----N-------------KMLSL-----------------------------------------------
Q01YQ6_SOLUE/23-198GSLVYLFERI----V-------------SNLAE-----------------------------------------------
Q8XI18_CLOPE/5-158DESFDMIVNK----I-------------KKLAS-----------------------------------------------
R5X8W2_9CLOT/5-160KESFDMIIGK----I-------------KSLCK-----------------------------------------------
B6FWP7_9FIRM/5-161EESFNMIIEK----I-------------KYLCS-----------------------------------------------
Q18BT1_PEPD6/5-159DESFNMIVSK----I-------------NYLCS-----------------------------------------------
D3MTQ6_9FIRM/3-156DESYTMIKTK----I-------------EKMSS-----------------------------------------------
A0A0C2S6D2_CLOBO/4-161IESIDMIIKK----I-------------EKLCS-----------------------------------------------
C4IEN4_CLOBU/4-161DESIDMIIDK----I-------------IHLSS-----------------------------------------------
A6LQ77_CLOB8/4-161NESINMIIEK----I-------------IHLSS-----------------------------------------------
B1BFH6_CLOPF/5-161KQFEEIIDEK----V-------------KELSR-----------------------------------------------
Q97KV3_CLOAB/5-155NESLDSLIEY----S-------------NKLVK-----------------------------------------------
B0P7T6_9FIRM/16-171KDIYDLVMER----A-------------ERLAR-----------------------------------------------
C0ECW5_9FIRM/5-161PYMYDIIKQE----L-------------RDLAS-----------------------------------------------
A8MHU0_ALKOO/5-164PQSFDFVCNN----I-------------NDLSS-----------------------------------------------
A6TNX7_ALKMQ/5-165PQSFNYICEQ----I-------------QDLSQ-----------------------------------------------
B2A897_NATTJ/5-148LHLKKWFLNY----F-------------EKTLD-----------------------------------------------
R6RM69_9FIRM/5-161DITYDKIENQ----L-------------DDFVA-----------------------------------------------
B0NZS3_9CLOT/15-171DITFDDIERK----I-------------SKFIA-----------------------------------------------
R7D6R4_9FIRM/20-175FGTFDEVQGK----I-------------RRLVQ-----------------------------------------------
C6J9X9_9FIRM/5-161YGTFEDVKNR----M-------------KELTD-----------------------------------------------
C6LKS6_9FIRM/5-161YGTFDKVSDN----I-------------RSLLK-----------------------------------------------
D4KRQ8_9FIRM/5-161NGTFPYVKKH----I-------------ARLSE-----------------------------------------------
D9SRM2_CLOC7/5-162EEAKDYVYKM----I-------------EKVFE-----------------------------------------------
A6LQR0_CLOB8/5-160NEDWEKVIGI----I-------------DEIIY-----------------------------------------------
B0S165_FINM2/8-177EESINYIVKE----I-------------ITIIY-----------------------------------------------
D1VUW6_9FIRM/8-182KESINFISKE----I-------------SNLIY-----------------------------------------------
C4IIQ3_CLOBU/5-155KKSDKYVEEK----L-------------DDLLE-----------------------------------------------
C4Z638_EUBE2/40-187DSSYNKVSRR----L-------------QRLER-----------------------------------------------
A7VFQ0_9CLOT/5-152KSSFDNTVNR----I-------------QKLEE-----------------------------------------------
C0EWT7_9FIRM/5-150EATFEQITKQ----M-------------EALEA-----------------------------------------------
R5WI53_9FIRM/5-162ENVMKYMEKL----T-------------KKLEK-----------------------------------------------
D4LBU1_RUMC1/5-160ENAGKHLARL----T-------------QKLHK-----------------------------------------------
Q315K4_DESAG/47-177WETAHTLLRS----A-------------DSPRL-----------------------------------------------
B8DLU9_DESVM/18-149WSTGHTLYEA----A-------------DTPRL-----------------------------------------------
C7LVT1_DESBD/24-155WDTGRSLLRQ----A-------------EDTQA-----------------------------------------------
C6BUV8_DESAD/29-160WQTGFNLLNE----S-------------TDKHL-----------------------------------------------
C8X0X8_DESRD/29-159WRTGFRLLEG----N-------------RDQAL-----------------------------------------------
A5G5N0_GEOUR/25-157WRIGLKILEN----A-------------EKDAQ-----------------------------------------------
E8WRC5_GEOS8/30-162WRIGHRVLDK----A-------------GDPAQ-----------------------------------------------
A1AK53_PELPD/24-156WSVGNKVLLV----A-------------GNDDQ-----------------------------------------------
B3EBK7_GEOLS/25-157WRVGARLLQS----A-------------QDDPQ-----------------------------------------------
Q3A306_PELCD/29-161WRIGCRILDA----A-------------KDDAQ-----------------------------------------------
Q1K0Z2_DESA6/27-159WNMGFKVLDA----A-------------ENDAQ-----------------------------------------------
C1A8N1_GEMAT/19-151WHVGLEIHDE----A-------------DSPAL-----------------------------------------------
B8J577_ANAD2/33-165WRVGFNVFKQ----A-------------KPGAE-----------------------------------------------
D6SRA3_9DELT/26-149WETGFMLLQA----A-------------GKRTD-----------------------------------------------
B5YG53_THEYD/20-144WKTGLCLLNE----A-------------KTPEE-----------------------------------------------
Q1H382_METFK/30-174WENAHQMLAN----A-------------SGDEE-----------------------------------------------
C6X6W6_METGS/30-174WQHAYGLLSR----A-------------RTDEE-----------------------------------------------
C6WXF1_METML/56-200WKSAHQLLAA----A-------------QSDEE-----------------------------------------------
D5CMM4_SIDLE/28-177WQRARKLLDD----A-------------KSDEE-----------------------------------------------
B0SPX5_LEPBP/6-211HKVAELILSF----L-------------DQVYD-----------------------------------------------
A0A0C5WZU2_LEPIR/6-211NSVAELVLSF----L-------------DLILQ-----------------------------------------------
C8W7P0_ATOPD/6-209QPNVTYCSVE----Q-------------RSLVD-----------------------------------------------
C5DV22_ZYGRC/30-228---PQFLVNA----V-------------KLWHG-----------------------------------------------
B5VL45_YEAS6/30-234---PNFLMIA----V-------------SYWQQ-----------------------------------------------
C5DKM1_LACTC/24-220---PAFLVQG----A-------------KLWRE-----------------------------------------------
Q6FL70_CANGA/25-242---SPFLELA----I-------------NYWRD-----------------------------------------------
Q6CEF9_YARLI/23-229---PPFLAAG----V-------------NYWRS-------------------------------------RYGYL-DDYS
C4R8D0_KOMPG/19-213---PKLLGAF----I-------------EDYRE-----------------------------------------------
Q8R432_MOUSE/28-220---TPFLNAS----I-------------HYIRE-----------------------------------------------
C3ZWC6_BRAFL/5-194---SEFLNVT----I-------------THIRQ-----------------------------------------------
A7SED1_NEMVE/31-226---VPFLNAT----V-------------NYIRR-----------------------------------------------
D3AZT7_POLPP/38-225---PPFLRNA----S-------------EYLLA-----------------------------------------------
PLDG_DICDI/29-216---PPFLRAA----T-------------KYLLE-----------------------------------------------
Q97TF6_CLOAB/60-232TKFEEHAANA----V-------------SSYRT-----------------------------------------------
A7B1H2_RUMGV/72-243TRAESYFQAA----V-------------NAYRA-----------------------------------------------
PHLC_CLOHA/37-230SQLRKLFALA----K-------------DEWKK-----------------------------------------------
A0PXH4_CLONN/38-231SQVRKFTALA----R-------------NEWEK-----------------------------------------------
Q5PXE6_CLOPF/38-231SQIRKFSALA----R-------------YEWQR-----------------------------------------------
Q8GCY3_9CLOT/38-231SQTRKFATLA----K-------------NEWDK-----------------------------------------------
PHLC_PAESO/38-231TQVRKFATLA----E-------------NEWKK-----------------------------------------------
Q6R6B7_LISSE/64-245DTGTKYFNIS----I-------------EEYQD-----------------------------------------------
Q6EAE3_LISMN/64-245ITGAKYFNQS----V-------------TDYRE-----------------------------------------------
Q6R6D6_LISIV/62-243QTCGKYFKQA----L-------------QDYKE-----------------------------------------------
A0R9W0_BACAH/51-232ETGAKYFKLA----G-------------ESYKN-----------------------------------------------
A5D2J5_PELTS/29-178LECKAFFKMA----L-------------SNWQN-----------------------------------------------
Q896L3_CLOTE/34-205LECKKYYDKS----L-------------ENLEK-----------------------------------------------
A5N896_CLOK5/34-205TECRKYYSQS----L-------------QLFNI-----------------------------------------------
Q97KA0_CLOAB/34-205DEAQKYYNMS----L-------------NYLRA-----------------------------------------------
A6TKQ8_ALKMQ/57-228ELGVDYYFQA----I-------------GLWRE-----------------------------------------------
O26214_METTH/27-173LEKANFWLNQ----G-------------KISYD-----------------------------------------------
B8I5G2_CLOCE/32-236MYANDYTNLN----G-------------YITCN-------------------------------------ATMGVGTGSV
B5HQN8_9ACTN/67-292LLREPLVALL----P-------------RRR---------------------------------------QGRAATLLRC
Q82A31_STRAW/92-336VLREPLVALL----P-------------RAR---------------------------------------QGRVAALLRC
C9YWP6_STRSW/1-225VLREPLVALL----P-------------KGR---------------------------------------QGRVAALVRC
B4V801_9ACTN/61-287LLREPLVALL----P-------------PAW---------------------------------------RGRVYGLVRG
D3D9A1_9ACTN/1-206LVRDALVDLA----P-------------DAV---------------------------------------RLRL--APRA
A7C3K4_9GAMM/1-217ILKQPLFSLF----P-------------ISH---------------------------------------QQHL--IPFV
B9XK96_PEDPL/41-256LLKKPLFLLL----P-------------ANH---------------------------------------QKRL--VPWL
D9T3L8_MICAI/1-213VIAGIAVHLP----G-------------QRLFG-------------------------------------WPWYASLARV
C1ACE2_GEMAT/1-206RLLPALVPYL----R-------------DHP---------------------------------------EWRL--HDLL
C0VQ51_9GAMM/1-206LYRPVLYRLF----V-------------IRD---------------------------------------DLNI--HSFD
D0SL80_ACIJU/1-206IYRPVMYRVL----G-------------IIH---------------------------------------PLNI--KSFD
D0SG75_ACIJO/1-206LLRPCFYRFL----G-------------IQH---------------------------------------ELRL--SSML
D0SS47_ACILW/1-206IYRPVIYRFI----G-------------IQH---------------------------------------DLKI--HNIL

PF02265

ENDO2_ARATH/28-290KGRC-VAGAI----Y-------------NYTTQ-----------------------------------------------
ENDO5_ARATH/21-288KDWC-VTGAI----F-------------NYTNQ-----------------------------------------------
A4H6V5_LEIBR/29-297VEIVNVASVI----P-------------MLVSA-----------------------------------------------
Q8F3Z8_LEPIN/21-283KSTC-VVAEI----D-------------KWSSV-----------------------------------------------
B0T6T3_CAUSK/23-287EKDC-IVGRL----N-------------AFEAE-----------------------------------------------
Q66VY6_LEIMA/29-300VQTVNVASVI----P-------------MLESA-----------------------------------------------
Q7S8Q5_NEUCR/20-297PEGC-VVSAI----G-------------NYTER-----------------------------------------------
Q5KPJ8_CRYNJ/20-279NEDVNVITAI----Q-------------NFTRL-----------------------------------------------
Q236I4_TETTS/18-296NQVYNSITGI----K-------------RAIQE-----------------------------------------------
Q4DEV4_TRYCC/28-293VNTENLKTVI----E-------------SLKRT-----------------------------------------------
Q0CD39_ASPTN/21-282NGDC-IISAM----E-------------AMTSQ-----------------------------------------------
Q2SFD4_HAHCH/50-295SKGC-VLTAL----N-------------AYAEA-----------------------------------------------
Q585P6_TRYB2/27-292KQKSDVVSVI----N-------------GLSKA-----------------------------------------------
Q989R8_RHILO/21-270-GDC-AIAEI----D-------------RAEHE-----------------------------------------------
ENDO1_ARATH/29-294KDMC-VDGAI----Q-------------NFTSQ-----------------------------------------------
A4CQ68_ROBBH/22-257NPDGDILQGI----E-------------HCIRV-----------------------------------------------
A3U8L7_CROAH/33-268NPKGDIIVAI----N-------------ECMTK-----------------------------------------------
A7H7R9_ANADF/28-274REAC-VVAAL----E-------------RAIAE-----------------------------------------------
Q7P202_CHRVO/23-274DGNC-AANQI----D-------------RYRKV-----------------------------------------------
A0BML4_PARTE/16-293ARNINSIYAI----N-------------SATSV-----------------------------------------------
A7EWS3_SCLS1/21-282SSGC-VVSAI----Q-------------NYTTI-----------------------------------------------
Q3IBZ8_PSEHT/27-268ESVTNILEGI----H-------------YSIKV-----------------------------------------------
A7ETG5_SCLS1/21-277EEGC-VVGAI----L-------------NFTSQ-----------------------------------------------
A0M3W8_GRAFK/24-260NKSGDLVQAI----K-------------KCVEV-----------------------------------------------
A0BLJ0_PARTE/422-699SRNINSIYAI----N-------------QAVAV-----------------------------------------------
A4HJL3_LEIBR/28-299VQTVNVASVI----P-------------MLETA-----------------------------------------------
Q0TYV6_PHANO/20-284EEGC-IISAL----A-------------NYSSR-----------------------------------------------
ENDO3_ARATH/25-286KDWC-VTGAI----F-------------NYTNQ-----------------------------------------------
Q0AMT2_MARMM/26-282EDGC-ITSAI----D-------------LHAGI-----------------------------------------------
Q4Q7F3_LEIMA/31-295VATVNAVTVS----R-------------NMVTS-----------------------------------------------
Q5NRA3_ZYMMO/33-298AQPC-VVSQL----D-------------RFERE-----------------------------------------------
A5V871_SPHWW/21-280DGNC-VSRQV----E-------------RQLRL-----------------------------------------------
Q5FP59_GLUOX/25-298DHVC-VVEKL----P-------------EEIKI-----------------------------------------------
Q0UA95_PHANO/19-289KGGC-VVSAI----A-------------NQTGI-----------------------------------------------
NUS1_ASPOR/21-284SAGC-SISAI----Q-------------NYTNI-----------------------------------------------
A4HI96_LEIBR/31-295VEAVNAVSVS----L-------------DMITS-----------------------------------------------
Q01U80_SOLUE/19-261KGDC-VIAKI----E-------------DFEKV-----------------------------------------------
A2QX99_ASPNC/21-292PEGC-IISQM----A-------------NMTRQ-----------------------------------------------
A2TWS6_9FLAO/25-260NPKGDLVTGI----A-------------KCIEV-----------------------------------------------
Q2UHT0_ASPOR/21-283TTGC-IISLM----K-------------DMTVQ-----------------------------------------------
Q2H4S7_CHAGB/217-488DRGC-VVSAL----H-------------NYTTR-----------------------------------------------
Q15ZB2_PSEA6/20-256PEQGDGVSAL----K-------------MFTAN-----------------------------------------------
A4I736_LEIIN/27-297VQTVNVASVI----P-------------MLQTA-----------------------------------------------
G3XKQ7_SOLLC/26-290KDMC-VAGAI----Q-------------NFTTQ-----------------------------------------------
I1KHQ2_SOYBN/27-290KGRC-VVAAI----N-------------NYTTQ-----------------------------------------------
I1MEB5_SOYBN/33-297EDMC-VAGAV----K-------------NFTSQ-----------------------------------------------
I1PPP5_ORYGL/30-294EDMC-VAGAI----A-------------NFTSQ-----------------------------------------------
M7YSG5_TRIUA/24-280KNVC-VVGAI----N-------------NYTAA-----------------------------------------------
Q1K6E5_NEUCR/21-291PEGC-VVSAI----Q-------------NYTSR-----------------------------------------------

PF09988

Q8YZE9_NOSS1/2-166--------------------------ILTVV------------ILAVV--DKLWNVTV-------T-W---QDVEVTVGR
K9TIP1_9CYAN/2-166--------------------------AIAFG------------VVLVG--DYLGLFTW-------N-P---PLASAAIAR
B2VAC8_SULSY/2-161--------------------------LLKLL------------INFLI--P-----------------------DNNFQV
A5UV55_ROSS1/2-173--------------------------WGAWI---------------------------------LGRI---GVGVPDLHA
K9VXZ1_9CYAN/2-166--------------------------VLTLL------------FLVVT--NLLLGWQW-------N-W---QRLAEDGVR
K9X512_9NOST/2-158--------------------------ILAV----------------VG--AKLGNVRF-------N-L---ADL----GR
Q10Y23_TRIEI/2-165--------------------------VLAML------------GL-IV--DKLLGLDL-------S-V---LGLVISLWR
K9R5N7_9CYAN/21-185--------------------------IVTII------------VLLIA--EKLLNMTL-------S-W---QEVAKHLLD
Q7U3L4_SYNPX/2-155--------------------------LIGWP-----------------------------------------------TN
K9UM54_CHAP6/2-166--------------------------LVGLF------------YVGIA--RLAGAKTY-------T-G---QQLVAILQH
D7CX68_TRURR/2-172--------------------------AASEI--------------------------------------------APHFG
K9S824_9CYAN/2-177--------------------------SLGVF------------LWAIA--QQGVGASA-------S-W---RAVAEPAWR
U5QDG6_9CYAN/2-166--------------------------CLGLP------------LAFVL--EDWGDVPL-------H-W---RAHLLAAF-
Q9RT76_DEIRA/5-173--------------------------VLKFA----------------------------------------------LPQ
B1XNI7_SYNP2/2-167--------------------------FITII------------GVAIA--QLMFDFSW-------N-W---RTAFLNVQR
K9YHE6_CYASC/3-166--------------------------LLGIV------------LGAIA--LITFPQIW-------Q-W---QQIIDNLT-
K9U5M5_9CYAN/2-166--------------------------ILGLF------------FLGIA--QFVWNVGW-------H-W---QTWWETVKR
K9XH03_9CHRO/2-166--------------------------FLGIF------------VIGVV--HLIWGVEL-------S-W---QQLVAQSRR
B7KDH5_CYAP7/2-167--------------------------LLAIP------------LIAIA--QLILGFDW-------N-W---RLFAQTSLN
D7DZB9_NOSA0/2-166--------------------------VVAIL------------VLVVF--AKLGNVAF-------N-W---GDVWRIVGR
K9VNR5_9CYAN/2-166--------------------------VFGVL------------GLAIA--EKVGNLGG-------N-W---QDVVLSCGR
A9B0N7_HERA2/2-170--------------------------LSFYL------------GMTLI--N--------------SFT---PVDTATISA
Q8XL51_CLOPE/2-170--------------------------LLYSF-----------------------------------------SIINISTP
G2LLI8_CHLTF/2-174--------------------------AVLYVRAVWIDGLPADGDQAVR--T--------------------------LQT
E4UAQ6_OCEP5/2-167--------------------------GLSLLPGMGTTLEPLTTTKWLL--SPVGG-------------------------
B1X0E2_CYAA5/2-167--------------------------IVAIF------------VVAIA--QFIWGFPW-------N-W---RNVAEYNFN
Q7NFX0_GLOVI/2-166--------------------------SLGVP------------GALVF--ERLAGVSI-------D-W---QAAWQTVS-
K9Z9T5_CYAAP/2-167--------------------------ILAIL------------GVAIA--QLIFGFGW-------H-W---QKFIFNSYG
L0A273_DEIPD/2-163--------------------------LLHFL----------------------------------------------LP-
K9WE31_9CYAN/2-166--------------------------LVGIL------------ILGVV--QLFRDVPW-------S-W---QQFGEDIKQ
K9V8T7_9CYAN/2-166--------------------------LPSLI------------LLVVV--EKLGNMAL-------N-W---QQLTGEIMH
Q7V3X6_PROMM/2-159--------------------------LLQPL-------------------------------------------GCPAPL
B8HTG8_CYAP4/2-166--------------------------LPIGF------------LLLLQ--HYFGFWNW-------N-W---QTGVALLQA
C1CV84_DEIDV/5-166--------------------------LLRYV----------------------------------------------AP-
Q31N47_SYNE7/7-176--------------------------LVLVI------------ETAIA--IGQGG----------N-W---AGLGDRLSQ
S0EUE8_CHTCT/2-170--------------------------LLSWV------------GVWLW--N-------------QCGM---HVDPASVTQ
E0U8U0_CYAP2/2-167--------------------------LIAIP------------AVAIT--QLFLGFDW-------N-W---HIFVQKVIY
D3EPX6_ATETH/2-167--------------------------IFTIF------------INMVI--QFFLGSTY-------N-W---WILFTTNYN
C0QT82_PERMH/2-161--------------------------IFIFS------------LKYAF--PDLDIQIL----------------------
Q2JJ24_SYNJB/2-166--------------------------GVGLL------------GAWLG--SQLGWWMWQPWVWGSDLW------------
B7K2N6_CYAP8/2-167--------------------------LVAIL------------GVAIA--QLIWGFDW-------N-W---QQFTHRLME
K9Q2E8_9CYAN/2-167--------------------------VVGII------------GVAIA--QGVWGFDW-------N-W---RSFFVVGGQ
A9WA62_CHLAA/2-176--------------------------GIGWC---------------------------------LGQL---GFAPPAYHR
H8GTR8_DEIGI/2-163--------------------------IVRVA----------------------------------------------FP-
K9XZT4_STAC7/2-167--------------------------LLAIF------------VVAIL--QLIWGFEW-------N-W---QQVARQAIQ
B2IUE8_NOSP7/2-166--------------------------ILAIL------------VLAIA--EKLWNLSF-------T-W---QDLGQTVGR
E8UBR4_DEIML/2-163--------------------------LVAFL----------------------------------------------VP-
K9QIC8_9NOSO/2-166--------------------------ITALI------------VLVII--EKLGNTTF-------N-W---QALGKNVAR
B0JHJ8_MICAN/2-166--------------------------LAAII------------IIPIL--QSFWGIDW-------D-W---RLWPQQAIA
K9RQ06_SYNP3/2-166--------------------------LIGFG------------LGWVG--QETGWWTW-------R-W---QDSLAWLEK
D7BE64_MEISD/2-161--------------------------GGEAL--------------------------------------------LHYLG
A5GPK9_SYNPW/3-163--------------------------TLSAL----------------------------------------PGWSYPTPS
Q81WY4_BACAN/2-155--------------------------LLNVI-------------------------------------------------
W6FU87_NODSP/2-166--------------------------LVAIA------------FLLVG--EVFGIVTL-------T-W---RDLSVALGR
B4UA61_HYDS0/2-160--------------------------VIVGI---------------------------------MSFS---NYSHTFIKS
K9T9J7_9CYAN/2-167--------------------------AIATP------------GVAIA--QLIWGFDW-------N-W---QRVARTAIQ
F0RKU1_DEIPM/12-173--------------------------ALRTF----------------------------------------------WP-
F2NN18_MARHT/2-164--------------------------VAGGA--------------------------------------------AEALG
K8GJ34_9CYAN/2-177--------------------------VIGLV------------SAIAY--QLTGEFETWTQFFQQY-W---LLATESIGR
D3PMR5_MEIRD/2-165--------------------------FFTTL--------------------------------------------SSYLG
B0CCR6_ACAM1/2-165--------------------------LGAML------------AGLLL--SQVWGVPV-------N-R---QQLLQQAK-
Q8DM71_THEEB/2-162--------------------------LIAGV------------AACTG--HLRGLQEWLHHWWRVD-W---RW-------
P72876_SYNY3/2-165--------------------------GIGTV------------LILLQ--KL-------------N-L---QGINWLIPR

PF04307

Q18EP1_HALWD/1-158-----------------HLGTG----FSVG---------------YLL--HLPGDWHTRLL-NGEIPP---DL-LWPLT-
Q65F12_BACLD/1-155--------------------VG----LMAG---------------MAS--HLLLDAGTV------NGI---KL-FFPS--
Q0W2I6_METAR/1-181--------------AYGPVSPIL-A-ILAAI------------AGGLS--HIVLDYLAY------PGI---PL-LYPLS-
Q1AT01_RUBXD/1-176-------------------ALA----LAAG---------------YAS--HLLADALNT------RGV---PL-LWPL--
Q7MS32_WOLSU/1-175----------------LEAVIG----LWLG---------------VWL--HLIGDMLTK------SGI---PL-WLPWS-
Q8D1W8_WIGBR/1-169----------------FPLDFSY-S-LLVG---------------YFS--HILADFFTP------FGV---PL-FWPF--
Q5WIF9_BACSK/1-182----------------AYWPTI----LLWAA------------ISVFL--HVFVDIFNA------YGT---QA-LWPFSN
Q2NV14_SODGM/1-168------------DFVHA---------MIVG---------------YIS--HVVADMLTP------AGI---PL-LWPY--
A0LXF8_GRAFK/1-182---------------EANWKNW----SWLMF------------WGLFT--HPLLDAHTT------WGT---QL-FWPFDL
Q01PN8_SOLUE/1-175----------------RWLAIV----WAAA---------------AIT--HPLLDMLTDG----GSGV---ML-LFPVTT
Q0W4H6_METAR/1-165----------------YWGVGV----LTVS---------------AAF--HQVEDQMWN------AAG---TW-FWPLFG
YFHP_BACSU/1-182----------------ADFLHL----WLWTL------------LAVVL--HVFVDIFNA------YGT---QA-IRPFSK
Q5FTT4_GLUOX/53-213-----------------GPWGA----LLLG---------------AGT--HIAAD-LPT------GGC---QL-FAPLS-
Q726Y1_DESVH/1-173---------------PQGWGFAK-V-WGVSY------------ALVLV--HIWLDAITT------YGT---QI-LQPFSD
C1DQI7_AZOVD/1-180----------------PGYGGGR-L-FLALW------------LVLAT--HVLLDSLTS------YGT---QL-LWPLDT
Q8ETE4_OCEIH/1-155--------------------MG----VLVG---------------MAS--HLVLDACTK------NGI---KL-LYPA--
Q5FK20_LACAC/1-175------------KSPNYWESIWL-G-LVIG---------------YLL--HLIEDSFSR------QGV---AW-LMPFS-
A4XRV7_PSEMY/1-180----------------PGYSDRR-L-LLTLW------------LVLIT--HPLLDAFTS------YGT---QL-FWPLMP
Q2N9Y9_ERYLH/13-204----------PEGRRPVSFKWL----FLLSF------------IGCLT--HPALDWLNV------YGI---RL-LEPFSS
Q023X2_SOLUE/1-190----------------VRWTAA----FFAAL------------IAVAS--HLLLDWTNV------YGI---RL-FLPFSG
A9AVQ5_HERA2/1-166----------------WVAGLT----LFLA---------------VLS--HPLYDMLTNG----GSGV---AL-WWPFSS
Q7VVQ6_BORPE/1-180----------------APYSGRR-L-FATLL------------LVLVT--HPVLDAFTV------YGT---QL-FWPFPL
A6LWG2_CLOB8/1-169----------------LIGING----IFLG---------------IFS--HLVLDSLTI------GGL---PW-FYPFS-
A3CRK4_METMJ/1-159----------------RIDLFA----VAAG---------------MAS--HQFFDGMWR------HPV---EW-FWPFLG
A1TRR8_ACIAC/1-179----------------FQWKRW----WLALW------------LALAT--HPLLDWMTV------YGT---QL-LRPFTD
Q3J7C8_NITOC/1-183----------------KPWQVY----FGVSL------------LGISI--HIAGDVITA------YGT---QI-FAPLSN
Q8CV62_OCEIH/1-182----------------VSYLHL----WLWTL------------LAVVI--HVFVDLFNA------YGT---QA-FRPFSK
A0JUC0_ARTS2/1-250LFALTMAGLVTWFAPDQWTWLPV-S-MLTG---------------VAV--HIVGDMITT------GGV---PL-LWPIVI
A1WTH1_HALHL/1-183----------------RDWRDG----ALIFA------------LGTGI--HIFGDWITN------YGT---QL-LAPFSR
Q5V391_HALMA/1-161-----------------RLGTA----FAFA---------------HLS--HLVADNQQLLPPNLYVSS---DL-LWPL--
Q97K38_CLOAB/1-212--------------------------FAVG---------------FIS--HMVADTFTN------SGI---EV-FYPI--
Q1WSF6_LACS1/1-169----------------RIENIVF-W-LMLG---------------YLL--HLLEDSFSQ------RGV---KW-LYPFTK
Q0ACJ1_ALKEH/1-184--------------GRYGWRAW----YAAAA------------VALLV--HILGDLITS------YGT---QL-LAPFSS
Q7N3N6_PHOLL/1-166-------------FFHA---------MIVG---------------YLS--HLIADMLTP------AGV---PL-LWPI--
Q9KEC4_BACHD/1-182----------------SAFFTL----WLWSF------------IAVFL--HVFVDIFNA------YGT---QA-LRPISD
Q1D144_MYXXD/1-188-------------------ARLA-P-VFLTS------------LASVVFAHLLPDLWTG------WGT---RV-LLPFSD
Q2JB37_FRACC/1-225CVTAGVAVFLMHGIDMSFAGYA----VTLG---------------CLA--HLAGDCLTP------RGC---PL-LWPV--
Q12UG8_METBU/1-174----------------GTGMII----LSIA---------------SFM--HLLQDRMWT------VPQ---TF-LWPIMG
Q5V568_HALMA/1-273AVLGVATVAQSRDVSPRTVTGL----ALLG---------------LLT--HPFGDLFTG------GPP---PF-FYPF--
Q1ATT6_RUBXD/1-170----------------PATMIA----VGVG---------------YGS--HLFADMMTL------GGV---QL-FWP---
A4J2S9_DESRM/1-180----------------AFLIFS----GTAG---------------AIS--HLVLDGMTR------SGIQPLRL-FLPMLP
Q8TQH1_METAC/1-199--------------------------TYGGF------------QSIFL--HVYLDYVTT------WKM---RP-LYPFST
Q6D4I1_PECAS/1-166-------------AYHA---------MIVG---------------YLS--HILADMLTP------SGV---PL-LWPC--
Q82XH5_NITEU/1-183----------------YPWRSF----FVPAC------------LGIMI--HILGDLVTA------YGL---ML-LAPFST
Q6YRT9_SYNY3/1-188-----------------PLVIVH-A-LNIG---------------YFA--GWFLDCFTK------SGV---EM-FYPLGV
Q5HM58_STAEQ/1-158--------------------VA----IVIG---------------MFS--HVILDILTP------RGV---KL-LYPL--
Q8TP13_METAC/1-172----------------DIRGLS----LTAG---------------SFL--HLFEDQMWF------DPQ---TF-LWPLFG
Q0JZE4_CUPNH/1-185----------------EAWREA----FAVSC------------LGVAS--HIALDLVTV------YGT---RI-FYPGSE
Q97LP7_CLOAB/1-199-------------------VIIY-Y-FMAG---------------YGL--HLLCDMSTS------RGI---PL-LYPFKK
A0PYB1_CLONN/1-199-------------------ASAY-Y-FVIG---------------YGM--HLFCDMATK------MGI---PM-FYPFIN
Q9KE25_BACHD/1-180--------------KELSWKWI----YFLSF------------FSVLS--HLGADWLTT------WGT---GL-LEPFVD
Q3JF51_NITOC/1-164-------------------FGC----ILGG---------------YWS--HLWIDMLNL------RGA---DL-LWPSPV
A1K1W5_AZOSB/1-183--------------RGPDWPAF----YGLAC------------AGIAI--HIAGDLITQ------FGT---MI-LAPLSD
Q6AMI9_DESPS/1-207---------------ALIVGFS----VFSG---------------CLS--HLIIDELYS------ISF---QHGLLPRLK
Q7NV83_CHRVO/1-166---------------GHAMPLVL-G-LCVG---------------YAS--HLVGDWLTP------AGI---PL-LWPI--
Q47U11_THEFY/1-250ALCVAALFLTAWDNYPPGWIVGA-V-VALG---------------MIV--HSLGDALTS------SGV---PL-AWPFTV
Q47RB2_THEFY/1-227ATAGITLALYSSGVDYSWLGLA----VAYG---------------CLL--HYLGDIATQ------MGV---PL-LWPFW-
Q1QZR4_CHRSD/1-181-------------TPPIGTLRW----GLLFG------------GCLLT--HPVLDAFTT------YGT---QL-WWPLTT
Q5P1U0_AROAE/1-192--------------ARPGWRTF----YGIAC------------VAILI--HIAGDLITQ------FGT---MI-FAPLSD
Q0BSQ9_GRABC/13-169----------------------D-P-LVTG---------------YLS--HLAADLLTP------AGL---RL-GWPL--
Q5L2T9_GEOKA/1-182----------------TDWLRV----WLWTF------------VAVAL--HVFVDIFNS------YGT---QA-LRPFTK
A5CZD2_PELTS/16-203----------------PLLALS----GVLG---------------GVS--HIVLDGMTR------SGVKPYRV-YLPKLP
Q2S300_SALRD/1-182---------------PVSVGKW----GALVA------------LTLGT--HVGLDCLTT------YGT---QV-FWPFSN
Q1DD75_MYXXD/1-235-----------PDLPPARFGPL----LMLST------------LSVLS--HPALDWLNT------YGV---RL-LMPFDG
A0KFP7_AERHH/1-165--------------KDA---------LIIG---------------YLS--HLLGDWLTP------AGI---PL-LWPS--
Q0VLL6_ALCBS/1-174----------------ISLWRW----WLFTG------------LCLIT--HPLLDTFTT------YGT---QL-FWPLGD
Q3A0M8_PELCD/1-203----------------LTLAAGL-V-ALMA---------------GLS--HLLLDELWA------IDF---QSGLIPRL-
Q186I4_PEPD6/1-177----------------VFSCLSS-G-FIIG---------------YLS--HLCLDLITK------EGI---EL-FYPI--
Q2L2L1_BORA1/1-180----------------AKYSAAR-L-FLTLW------------LVLVT--HPLLDAFTV------YGT---QL-FWPIPW
Q67R78_SYMTH/1-176----------------AGAGPL----FFWTL------------LGSLA--HLAVDGLNL------FGV---RP-FWPVSR
Q97MS7_CLOAB/1-166----------------I---------LMLG---------------IGSAIHLILDSMWL------YGR---IL-FWPFLG
A6TSU9_ALKMQ/1-172----------------FYFYQV----FFWTL------------LGSLS--HIVLDIFNS------YGA---SI-LYPLTR
A6TMK4_ALKMQ/1-249-------------------DYS----LIFG---------------VSMGSHLLGDMLTK------AGI---GL-FIPIT-
A3CVA2_METMJ/1-183----------------SFALLA----VATG---------------ALS--HQVIDAMWA------MPV---TW-YFPLLG
Q9KAZ8_BACHD/1-159-------------------TLG----LLSG---------------VVS--HFILDAMTS------QGI---RL-FYPL--
Q0S8N5_RHOJR/1-250AAVLSALTWQSYPTEAGSTGLGV-A-VALG---------------CAT--HCLGDAITK------EGV---PF-LAPFLT
Q1IHJ9_KORVE/1-205---------SRFPRPPIRWGVL----YLYAC------------LGALS--HILLDYTNN------YGV---RP-FAPFNP
Q890Y4_CLOTE/1-199-------------------NIIY-Y-FMIG---------------YGS--HLLCDMATP------RGV---PL-FYPFKE
Q0RHF1_FRAAA/1-228CVTAGIAVYLMHGLDMGFVAYP----VVLG---------------CLG--HLIGDCLTP------RGC---LL-LWPV--
Q1MS87_LAWIP/1-199----------LPPPKQISWTLIE-A-WFFTY------------AILIL--HIWLDVMNS------YGT---QI-FLPFSE
Q11P46_CYTH3/1-219----------ISMPQTKWILLL----FFCS---------------YVS--HLIGDLPTPAA--AWGGV---RL-FFPF--
A6LXK9_CLOB8/1-172----------------I---------LFLG---------------IASSIHLVLDSMWL------YPN---IL-FWPYFG
Q2VZJ9_MAGSA/1-159-------------------RLAE-P-LALG---------------YLS--HLAADALTP------AGV---PL-LWPW--
Q5YVJ3_NOCFA/1-233VLAAAGTFVMDHWISDKPAWLPF-C-VGLG---------------ALA--HLLGDCLTD------RGC---PL-LWPF--
Q8FRV6_COREF/1-249SAALAYAVWSYVPEESFGVFLGS-A-ITVG---------------CLT--HMLGDLATK------QGI---PA-FAPLLP
A0KMD3_AERHH/1-197---------------TV---------WSFLL------------ISLLS--HSLLDSLTSG----GKGV---GW-LWPWRD
Q3JEV9_NITOC/1-176----------------INFGQL----YPLAV------------LGYLP--SGLLDACTS------YGT---QL-FWPVSE
Q9CNK9_PASMU/1-180----------------LPFSFRR-L-FITLT------------LALIT--HPLIDAMTV------YGT---QL-FWPIPS
A1U6Q1_MARHV/1-174----------------ISYQRW----LALVG------------LILIT--HPLLDAFTT------YGT---QL-FWPIGP
Q7NWB9_CHRVO/1-187----------------AGLTAAP-A-AALLF------------LAVAS--HPMLDMICDA----SFGP---AL-FMPWSE
O29079_ARCFU/1-168----------------PIYSIV----FFLG---------------YVA--HLISDSLNP------TGV---NW-LWPKNG
Q1MQD9_LAWIP/1-155-------------ANQLFSEIM----LWVG---------------FGGITHVLLDSLTP------MGI---P--MWPFGS
Q5WH30_BACSK/1-157-------------------QTG----VLIG---------------IAS--HYLLDALTV------RGI---RF-FYPA--
Q1GSW3_SPHAL/1-193----------PVDRLPLHRGWL----LALAY------------IGCLS--HPALDWLNN------YGI---RL-LEPFSA
A3CTE7_METMJ/1-243-------------SLALLPAFGC-A-FFAG---------------CVL--HLVEDTCTP------AGV---AW-LYPFS-
YVSG_BACSU/1-155--------------------AG----LMIG---------------MAS--HLILDAWTV------NGI---KL-LFPS--
B1W5J1_STRGG/1-256PGNGAGWLFDAPGQEYMWLGLP----IVLG---------------ALV--HDIGDALTV------SGC---PI-LWPLPI
Q5ZZH0_LEGPH/1-172--------------YWKI---TIGA-SLVG---------------YAT--HCLLDSLTS------YGT---VL-FWPWSD
Q6LSY8_PHOPR/1-173--------------SFTQLWLL----IAAC---------------LIT--HPLLDAFTS------YGT---QL-LWPFDI
Q74JJ2_LACJO/1-173-----------SQNYWSALWFG----LVIG---------------YFL--HLVEDSFSK------QGV---EW-LAPFY-
Q7CIV6_YERPE/1-162----------------PDVFHA----MIIG---------------YFS--HLLADMITP------AGV---PL-LWPC--
Q7CJI4_YERPE/1-166----------------TRIWLF----LFVS---------------LLS--HSVLDSLTTG----GKGV---GW-LWPWSS
Q81YV9_BACAN/1-179---------------YLHLLLW----SFIA---------------VFL--HVFVDIFNA------YGT---QA-LRPFTK
Q8Y6J4_LISMO/1-176---------------FIHLLLW----TFIA---------------VGL--HIFVDIFNA------YGT---QA-VRPFK-
Q9HUK3_PSEAE/1-165----------------LKAGLW----VALA---------------TAS--HSLLDAMTNG----GLGV---AW-FWPWSD
Q9RMV6_BACAN/1-156----------------FTNGMC----ILAG---------------YFL--HLVEDSFSK------KGI---KW-LLPLSN
U5L8V8_9BACI/1-175---------------LLHLWIW----TFGA---------------VFL--HVFVDIFNS------YGT---QA-LRPFSS

PF13803

C7QBS6_CATAD/1-242-------RERRVRFSSV--SWFVLS-AVIG---------------TVT--HVVWDGFT--HPGRF-GV---R--LFPVLQ
C0ZEY0_BREBN/1-241-LDYTNKGSRMPAWKMA--IVFVYS-AIIG---------------SLS--HIAWDAFT--HDGGR-MV---D--HFLFLQ
K9WR57_9CYAN/1-241--FPTLRSYFPLQVKHL--FNVVVS-VVMG---------------AAS--HIVWDAFT--HEGGW-FV---A--HSKLLQ
D3EE91_GEOS4/1-236--WQRDGKLPVSPIGWL--AVILLG--LAG---------------VGT--HLLWDQFT--HKGAW-IV---N--QIPLLT
X2GTZ3_9BACI/1-237------STNRVDSNKLLKLVVFIYS-ALFG---------------MLT--HVVWDSFT--HINGY-MV---L--TFPTVF
F8A675_CELGA/1-236----APERNRTLRAATW--TLASLA---VG---------------VAT--HVAWDAVT--HGDGA-AV---Q--HIAWLR
Q1IN38_KORVE/1-247--IDVSRSYVPKSIGDF--LLVVLS-LAIG---------------LGS--HLLWDSFT--HPLSW-AW---A--HIAFLR
D2Q1R3_KRIFD/1-251----LKPSGRRPTANYL--LWAAIS-LVIG---------------GFT--HVLWDSFT--HYDGY-FV---R--QWGFLT
A6GZ02_FLAPJ/1-235FSIFKQFNWNRYFKEKG--LVVMIS-ILIG---------------AAS--HIFWDSFT--HYNGY-FV---Q--KIPALQ
D3V1B0_XENBS/1-240---------EKPDYKDR--VAFVLS-LFIG---------------AVT--HIGWDAFT--HDKGF-FV---E--LIPLLQ
Q899W6_CLOTE/1-232YTYLLNYRVNIKSIKDI--IVFGYS-SILG---------------MVT--HVFWDAFT--HSNGF-FV---L--NINFLK
G0FWC1_AMYMS/1-228--------------VPW--LGSVVS-VLVG---------------AAT--HLLWDAFT--HTGGF-AV---R--HWAWLR
Q8XML2_CLOPE/1-242YGYLRTEQFGLHSWKEV--IVFIYS-ALLG---------------MIT--HVLWDGFT--HKTGF-FV---R--HIPWLQ
A0Q1Y2_CLONN/1-242FLINEKKNFTIKKV-----IVFIYS-SLIG---------------IYS--HILWDSFT--HKTGF-FV---V--KLGLLS
Q6FEH5_ACIAD/1-242-------------CGFL--IGCVVS-VLIG---------------AAT--HIIWDGFT--HADFR-TF---V--FQDALS
H1YCR9_9SPHI/1-235FAGYAAFNWSRYAKQNL--PVVVLS-ILIG---------------GTS--HLLWDSFT--HVTGY-FV---E--YFN-MA
I4B9J2_TURPD/1-232--LGSVYSSEVKGFNQW--LFCCLG-LVFG---------------SFS--HIIWDSFT--HESGY-FV---K--LMPLLS
K4IBC3_PSYTT/1-233FSVFKLFDWNRYFNRNW--LVVIIS-ILIG---------------AAS--HNFWDSFT--HDHGY-FV---N--IIPALT
H2JVD3_STRHJ/1-251ALLRCGAPRARVRTSAV--GRWYAS-AVLG---------------ALT--HVVWDAFT--HHDRW-GT---R--LVPAIG
A5I0I6_CLOBH/1-248YYNTALKPWRINSLAQV--LVFSYS-AIIG---------------MIT--HVFWDSFT--HKGGK-FV---I--LFEGLR
Q65Q39_MANSM/1-229-----------NPLAWL--IVFLYS-AWIG---------------MAT--HIALDELT--HDGGY-FV---Q--LFPILQ
F4FE12_VERMA/1-233-------------------LWVTVTSALVG---------------AAS--HLAWDWLT--HTDDW-LA---V--VFGVRW
C6D3J1_PAESJ/1-240RAYHLISGWDMRGSKAM--VVYLLS-VIIG---------------FYT--HILVDGFT--HERGY-FV---H--HWDVLN
A3HWD2_9BACT/1-236TVQYLKFNWLLALKKNW--IGILLS-IMLG---------------IGT--HLVLDGMT--HYDGW-VV---E--LFPVFQ
Q7UP84_RHOBA/1-249--------PVSVEWQSI--LLVAVC-VLVG---------------AST--HVLWDSFT--HQHRWGSM---I--AIPFLS
A8L7F5_FRASN/1-232------------TGHQW--LLAPVA-AVVG---------------GLT--HTGWDAFT--HEDRW-GV---R--HVAWLS
D2ARI2_STRRD/1-246----IASLAPAPYGLRR--LPAVVAGGAVG---------------AFT--HKLWDSFT--HHYSS-AV---W--GWDWLD
Q0RF10_FRAAA/1-232------------TGRQW--LLAPVA-AAVG---------------AAT--HVVWDDFT--HEGRW-GV---R--QVAWLR
C7R2G7_JONDD/1-241-------------AVAIRGVWVVIS-LLIG---------------ILT--HVIWDSLT--HSDGW-VV---M--QVTALR

PF00882

A0A090C0Q9_ACIBA/1-206H--FF--------SFF---IGIIIA-LLIG---------------IAT--HLIWDGLT--HSDFR-TF---I--FQDFLS
C6RSF9_ACIRA/1-206Q--AL--------IFL---VSCSIA-ILLG---------------TAT--HILWDGLT--HADYR-TF---A--FYNFLS
B7H911_BACC4/1-208DERWGLH----TWKEF---FVFCYS-ALFG---------------MLT--HVVWDAFT--HNTGY-FV---M--KIALLQ
C2XYJ1_BACCE/7-214DAKWGLY----TWKNF---FVFCYS-ALFG---------------MVT--HVVWDAFT--HKTGY-FV---M--EMPLLQ
B1B9W2_CLOBO/1-214HRKSKNS----TIKKR---IIFIYS-ALIG---------------IYS--HILWDSFT--HKTGF-FV---V--KLSLLS
C5VRK3_CLOBO/1-214DKKSNVI----NIKYL---IIFIFS-ALLG---------------VYS--HILWDAFT--HKTGF-FV---T--RISVLA
A3I5H3_9BACI/4-213-QDFNSYQISGTKTWKI--IVFSYS-ALLG---------------MLT--HVIWDSFT--HQNGY-MV---T--NLRFLS
Q0SV58_CLOPS/1-213TEQFGLH----SWKEV---IVFIYS-ALLG---------------MIT--HVLWDGFT--HKTGF-FM---R--HITWLR
C6JKD9_FUSVA/1-208DFNWNSY----FKKNW---YIVIIS-IIIG---------------ICS--HILWDGFT--HRTGH-FV---K--IFPVLK
A1ZM58_9BACT/1-209EFNWWAY----MRKRW---WVVIIS-LLIG---------------SAS--HLLWDSFT--HEHAT-FV---D--LFPSLN
C0DX83_EIKCO/1-211AATHKRR----QTAVVL--FTFVFS-ALFG---------------MIT--HLFLDAFT--HPTGW-FV---Q--HFAPLQ
D4DQE9_NEIEG/58-261SENVDFH----KIKEV----AFIPS-ALFG---------------MGT--HLFLDAFT--HPTGW-FV---Q--HFLVLQ
C0B3N4_9GAMM/1-204-YDPLKF----NLRTL---SLFVLS-LYIG---------------AIT--HIIWDSFT--HETGT-AV---R--FFSVLQ
D4BTR9_PRORE/1-203-KNRSVG----SFRQF---CIVVLS-FYIG---------------AAS--HIIWDAFT--HQSGA-FV---R--HAEFLQ
Q2LV15_SYNAS/6-198---MNK-------TSEE--FKNCLA-WFSG---------------YVS--HVVADSYL--H-------------------
Q2Y883_NITMU/6-188---LDG-------ASRQ----KAFS-WLLG---------------YTS--HVVTDTTI--H-------------------
A7K2D4_VIBAE/6-189---ADN-------EHFE----KTFS-WLCG---------------FVA--HVATDITL--H-------------------
A4C3L5_9GAMM/6-186---LEG-------LAQE----KCFA-WLCG---------------YMS--HVAADITI--H-------------------
C9YFH3_9BURK/6-183---LQG-------VERQ----KATS-WLLG---------------VAC--HMTADMTI--H-------------------
Q12DA4_POLSJ/6-186---LPP-------DLRP----KATA-WLLG---------------FAA--HMVTDMTI--H-------------------
C4XMP3_DESMR/34-221---LEG-------DVQN----KCLA-WLLG---------------FVE--HIIFDVFM--H-------------------
E6VSV5_PSEA9/6-180---AADA-----WARQG--ATLPVA-LLVG---------------AVS--HLYADVAM--HPMV---------------W
Q2LQI8_SYNAS/6-189---L----------ETL--PEGYRP-FLAG---------------ALT--HVAADAVF--HPFI---------------Y
B8FCF0_DESAA/6-187---------------KW--SDGMWA-FVMG---------------TFS--HILADAVY--HPWVE------------YYT
B3E8I7_GEOLS/6-161---------------AL--SPAATA-CLLG---------------IAS--HIDADITF--H-------------------
A1AT46_PELPD/6-164---G----------GML--PYDLLA-CLLG---------------VIS--HMQADMVF--H-------------------
C6Y3Y4_PEDHD/24-233----------------R--DSLKIL-IYSA---------------YLG--HYLADAHVPLH-------------------
E6U8V9_ETHHY/5-158---REE-------EKSL--DSFAFA-KDIG---------------VVT--HYLSDFCCYVH-------------------
Q1IVJ5_KORVE/32-215--------------------LNDLA-FAAG---------------ALS--HYLGDSFG--HSIAT-NQ-------ATPIE
C1F375_ACIC5/44-227--------------------VDEFA-FALG---------------ALS--HYVGDAIG--HSYAV-NP-------AVAIE
Q01WM2_SOLUE/25-208--------------------LNEYA-FALG---------------ALS--HYAADNNG--HRMAT-NI-------SVPLL
Q1ISY5_KORVE/28-210--------------------INEYA-FALG---------------ALA--HYASDITG--HPIVN-QA--------VAIE
Q025L8_SOLUE/39-222--------------------LDELA-FALG---------------ALA--HFAADTQG--HSIAV-NQ-------SVPIE
Y1571_ARCFU/28-204---------------AE--GTDEKA-FAKG---------------WLA--HLMQDRVA--HGNGD------------GLP
Q01YQ6_SOLUE/23-198----------------H--RPREAA-RFAG---------------VLS--HFIADSLSPPH-------------------
Q8XI18_CLOPE/5-158---LSMY----DFKKKF--SVSRFS-QELG---------------VIC--HFICDFFCIPH-------------------
R5X8W2_9CLOT/5-160---LSLD----FIEKYF--SISKFS-QELG---------------VIC--HFLCDFFCVPH-------------------
B6FWP7_9FIRM/5-161---LTLE----SLSKVF--STSRLS-QELG---------------VIC--HFLCDFFCVAH-------------------
Q18BT1_PEPD6/5-159---LNID----SLSKYF--SVSRLS-QELG---------------VIC--HFLCDFFCVAH-------------------
D3MTQ6_9FIRM/3-156---LNLD----SLEKLY--SKSSFS-QEIG---------------VIC--HFLADFFCVAH-------------------
A0A0C2S6D2_CLOBO/4-161---LSLQ----DVYYKM--SVNKFS-EELG---------------VIC--HFICDYFCAPH-------------------
C4IEN4_CLOBU/4-161---LTLE----EVYFDM--KLGRFS-EELG---------------VVC--HFLCDFFCAPH-------------------
A6LQ77_CLOB8/4-161---LSLE----EIYYDM--TIGKFS-EELG---------------VIC--HFLCDFFCAPH-------------------
B1BFH6_CLOPF/5-161---LSSD----EIINHL--GKEKFS-IELG---------------VIC--HFLCDFFSLPH-------------------
Q97KV3_CLOAB/5-155---Y-----------NN--SIRKFS-LALG---------------IVC--HYICDYFCIYH-------------------
B0P7T6_9FIRM/16-171---EG---------DAM--TLAEYS-KQLG---------------ILC--HFMSDFFCYAH-------------------
C0ECW5_9FIRM/5-161---CD--------KSRL--NSVVLA-DKLG---------------VIC--HFICDFFCYAH-------------------
A8MHU0_ALKOO/5-164---YNF------QFNKE--FIKQLS-TRIG---------------VVT--HFISDFFCVPH-------------------
A6TNX7_ALKMQ/5-165---YSL------IENEE--LIKLIS-RQLG---------------VIT--HFVADFFCLPH-------------------
B2A897_NATTJ/5-148---M----------NIG--NKRLAY-YRLG---------------VIT--HYLADFFCRPH-------------------
R6RM69_9FIRM/5-161---DYD-------TLKG--MNMRRC-AKLG---------------VII--HYIADYFTFPH-------------------
B0NZS3_9CLOT/15-171---NYD-------KDKG--MNMRRC-AGLG---------------VII--HYIADYFTFPH-------------------
R7D6R4_9FIRM/20-175---SG---------AGY--NDRVFW-RRSG---------------EVM--HYIADYFTFPH-------------------
C6J9X9_9FIRM/5-161---IR--------PDES--NQRVYW-RRFG---------------EVI--HYMADYFTFPH-------------------
C6LKS6_9FIRM/5-161---MDY-------TDAQ--DGMAFW-RHLG---------------EII--HYIADYFTFPH-------------------
D4KRQ8_9FIRM/5-161---GQK-------VMNK--KNRKYY-RDLG---------------QVS--HYLADYFTFPH-------------------
D9SRM2_CLOC7/5-162---DY--------EENW--DSREFY-VRLG---------------EVI--HFITDFFTYPH-------------------
A6LQR0_CLOB8/5-160---G----------EIK--RNKDIS-IKLG---------------ILS--HYLCDFFTFPH-------------------
B0S165_FINM2/8-177---LFQFTD-LTRLNSL--QNKILS-TKLG---------------VIS--HYLSDYVCLPH-------------------
D1VUW6_9FIRM/8-182---FCRYSNLQENTNPI--LINYLS-KKLG---------------IIS--HYLSDYCCYPH-------------------
C4IIQ3_CLOBU/5-155---T-----------KE--FNWYNS-LQLG---------------III--HYLCDFCCYSH-------------------
C4Z638_EUBE2/40-187---H-----------GR--MNCFSF-LSLG---------------YAL--HYIEDYFTFPH-------------------
A7VFQ0_9CLOT/5-152---K-----------GK--NSRYSF-LKLG---------------YVL--HYVEDFFTYAH-------------------
C0EWT7_9FIRM/5-150---K-----------GR--GGSFSY-LKLG---------------WIL--HYVEDYFTYPH-------------------
R5WI53_9FIRM/5-162---G-----------GM--GTVRQS-FLLG---------------KLV--HYVADSFTYPH-------------------
D4LBU1_RUMC1/5-160---S-----------DV--QSPLQW-FRFG---------------AAL--HYLADSFTFVH-------------------
Q315K4_DESAG/47-177-----------------------KA-YAYG---------------YLS--HLAADTVA--H-------------------
B8DLU9_DESVM/18-149-----------------------HA-YACG---------------YLS--HLAADTVA--H-------------------
C7LVT1_DESBD/24-155-----------------------QA-YAYG---------------YLS--HLAADVIA--H-------------------
C6BUV8_DESAD/29-160-----------------------KA-YSLG---------------YLS--HLAADIIA--H-------------------
C8X0X8_DESRD/29-159-----------------------QS-YAYG---------------YLA--HLAADTVA--H-------------------
A5G5N0_GEOUR/25-157-----------------------KA-CAYG---------------YLS--HLAADTVA--H-------------------
E8WRC5_GEOS8/30-162-----------------------QA-CAYG---------------YLS--HLAADCIA--H-------------------
A1AK53_PELPD/24-156-----------------------QA-CAYG---------------YLS--HLAADVIA--H-------------------
B3EBK7_GEOLS/25-157-----------------------RA-CAYG---------------YLC--HLAADVVA--H-------------------
Q3A306_PELCD/29-161-----------------------RA-CAYG---------------YIA--HLAADTIA--H-------------------
Q1K0Z2_DESA6/27-159-----------------------RA-CAYG---------------YLA--HLAADTVA--H-------------------
C1A8N1_GEMAT/19-151-----------------------QA-FALG---------------YLA--HLAADVVA--H-------------------
B8J577_ANAD2/33-165-----------------------QA-FALG---------------FLA--HLSADTVA--H-------------------
D6SRA3_9DELT/26-149-----------------------QA-FACG---------------FLS--HLAADTVA--H-------------------
B5YG53_THEYD/20-144-----------------------KS-FAYG---------------YLT--HLAADAVL--H-------------------
Q1H382_METFK/30-174-----------------------TA-IAIG---------------YAS--HLYIDVIA--H-------------------
C6X6W6_METGS/30-174-----------------------TA-MAIG---------------YAS--HLYVDVIA--H-------------------
C6WXF1_METML/56-200-----------------------IA-LAIG---------------YAS--HLYIDVIA--H-------------------
D5CMM4_SIDLE/28-177-----------------------YA-ISLG---------------FVS--HLLVDVIA--H-------------------
B0SPX5_LEPBP/6-211---TE--------MGLY--RDRFLA-FTLG---------------YIC--HCVVDIQT--HPYIF-------------YI
A0A0C5WZU2_LEPIR/6-211---TE--------EGIH--RDRYIA-FTLG---------------YIC--HCVVDIVT--HPYIF-------------YI
C8W7P0_ATOPD/6-209-------------------QRQLRE-FIVG---------------IWC--HLVCDHVYNAHT------------------
C5DV22_ZYGRC/30-228---KYND----NPQCED--SMKLRS-FLIG---------------IFT--HQIVDSSW--HSLVN------------GYR
B5VL45_YEAS6/30-234---KYGQNY-RLRGSQG--SLALKS-FLIG---------------VFT--HQIVDVSW--HSLVT------------DYR
C5DKM1_LACTC/24-220---RYSK----NQNSEK--SLRLKS-FLTG---------------VFV--HQVADAPW--HSLVD------------GYR
Q6FL70_CANGA/25-242---TYGDKK-NDIMSEE--SQKLAA-FLLG---------------IFT--HQVVDVPW--HALGE------------GYR
Q6CEF9_YARLI/23-229EKTDHTKDAPSDSEFKN--SLRLRA-FLMG---------------VLT--HQIADVSW--HSLG---------------F
C4R8D0_KOMPG/19-213---NSNQ----FSEEDE--ISNYRA-FIYG---------------MFS--HQLVDINW--HSLS---------------W
Q8R432_MOUSE/28-220---NYPL-----PWEKD--TEKLVA-FLFG---------------ITS--HMVADVSW--HSLG---------------I
C3ZWC6_BRAFL/5-194---KYPQ-----PWNEA--TEKLVV-FLLG---------------VVS--HQVADISW--HSLG---------------I
A7SED1_NEMVE/31-226---KYPK-----PWDEA--TEKLVA-FTLG---------------YVS--HQMADVTW--HSLG---------------I
D3AZT7_POLPP/38-225---TYTQ-----PWNAK--AQSLAV-FLLG---------------VMS--HQVADISW--HSIA--------------GD
PLDG_DICDI/29-216---TYPQ-----PWSLD--GIRLAV-FLLG---------------VTS--HQIADISW--HSIG--------------GI
Q97TF6_CLOAB/60-232-------------------DRTYSM-QELG---------------RAC--HFLEDVNVPYH-------------------
A7B1H2_RUMGV/72-243----------------G--DVQLAM-SNLG---------------KGT--HYVSDLNEPHH-------------------
PHLC_CLOHA/37-230----------------G--NYEQAT-WLLG---------------QGL--HYFGDFHTPYH-------------------
A0PXH4_CLONN/38-231----------------G--NYEKAT-WYFG---------------QAM--HYFGDLNTPYH-------------------
Q5PXE6_CLOPF/38-231----------------G--NYKQAT-FYLG---------------EAM--HYFGDIDTPYH-------------------
Q8GCY3_9CLOT/38-231----------------G--NYEKAA-WYLG---------------QGM--HYFGDLNTPYH-------------------
PHLC_PAESO/38-231----------------G--NYKEAT-FLLG---------------QGM--HYLGDLNTPYH-------------------
Q6R6B7_LISSE/64-245----------------G--NFEKAF-YNLG---------------LAI--HYYTDISQPMH-------------------
Q6EAE3_LISMN/64-245----------------G--KFDTAF-YKLG---------------LAI--HYYTDISQPMH-------------------
Q6R6D6_LISIV/62-243----------------D--KLNTAF-YKLG---------------LSI--HYFTDCSQPMH-------------------
A0R9W0_BACAH/51-232----------------K--DMKQAF-FYLG---------------LSL--HYLGDVNQPMH-------------------
A5D2J5_PELTS/29-178----------------S--NRNKAF-FFLG---------------ASA--HIMQDLCVPHH-------------------
Q896L3_CLOTE/34-205----------------G--DLDKAM-FFLG---------------AAC--HLIQDVTVPQH-------------------
A5N896_CLOK5/34-205----------------G--QIEKAL-FYFG---------------ASC--HLVQDVTVPHH-------------------
Q97KA0_CLOAB/34-205----------------G--DKKKSL-FYLG---------------AAC--HIIQDSTVPQH-------------------
A6TKQ8_ALKMQ/57-228----------------G--AFNESL-FYLG---------------AAL--HIIQDMTIPQH-------------------
O26214_METTH/27-173---------------AG--NYRYAS-YCYG---------------VAS--HYISDGICGPH-------------------
B8I5G2_CLOCE/32-236GGWTWNEIFDSIGIPNN--AANRRA-FIYG---------------VAL--HVATDVFA--H-------------------
B5HQN8_9ACTN/67-292GTPRARV----RTALA---ARWYAS-AAVG---------------GLT--HVVWDAFT--HHDRW-GM---R--LFPALG
Q82A31_STRAW/92-336GVPRARM----RASAV---LWWYVS-AALG---------------ALT--HVVWDAFT--HHDRW-GI---R--LFPVLG
C9YWP6_STRSW/1-225GARARRF----GPSRA---LWWYVS-AALG---------------SLT--HVVWDAFT--HLDRW-GM---R--LFPVLG
B4V801_9ACTN/61-287EDWRTRR----LPSLA---LWFYLS-AVIG---------------SLT--HIAWDSFT--HLDRW-GT---N--AVPALG
D3D9A1_9ACTN/1-206RLSRRQW----MLAPA--------A-AMVG---------------GLT--HVGWDLFT--HRNRW-GF---R--QFVWLR
A7C3K4_9GAMM/1-217N-EFQFF----PLRRF---LLIIIS-LLIG---------------ILT--HIIWDSFT--HYSGW-VV---Q--QLPILI
B9XK96_PEDPL/41-256N-PFPLR----TAAQW---GLVIVS-LIIG---------------AFS--HLFWDSFT--HEHGW-SV---E--AFPFLQ
D9T3L8_MICAI/1-213RHP------------W---QVTVCS-VLIG---------------AFS--HVAWDRVS--DSERL-PR---LL-GIADFH
C1ACE2_GEMAT/1-206A-LRAPA----TWWDW---VSVAWS-AWIG---------------GVS--HVVLDGIT--HGNHS-GW---LVPWLPVLR
C0VQ51_9GAMM/1-206S--FI--------AFS---LMSCFA-IIIG---------------TAT--HLIWDGLT--HLDFR-TF---A--FKTVLA
D0SL80_ACIJU/1-206Q--II--------TFV---LMTCFA-IIIG---------------TAT--HLVWDGLT--HLDFR-TF---A--FRNLLA
D0SG75_ACIJO/1-206R--FF--------KFS---VAVILA-ILLG---------------TAT--HLLWDGLT--HADFR-TL---F--GHAFLS
D0SS47_ACILW/1-206S--AL--------KFI---LVMCLA-VIIG---------------TAT--HLIWDGLT--HVDFR-TF---A--FHEVLA

PF02265

ENDO2_ARATH/28-290---LLSYKTA--ASSQSQ---YNLT-EALL---------------FVS--HFMGDIHQPLH--------------VSY--
ENDO5_ARATH/21-288---LMSASEN--SQNIVH---YNLT-EALL---------------FLS--HYMGDVHQPLH--------------TGF--
A4H6V5_LEIBR/29-297---ITSPTAT--SDTI--------I-TSVA---------------NLI--HFVGDVHMPLH-------------SADLFS
Q8F3Z8_LEPIN/21-283---LADTTQT--KAKR--------L-QALS---------------FVV--HFIGDLHQPLH-------------TAER--
B0T6T3_CAUSK/23-287---LADPKTD--AAER--------L-LAFK---------------FVL--HFVGDLHQPLH--------------AAD--
Q66VY6_LEIMA/29-300---ITKTTAT--TEII--------T-QCLA---------------FMI--HFFGDIHQPLH-------------NANLFS
Q7S8Q5_NEUCR/20-297---VQMK--NITADQK--------A-QALK---------------FIV--HFLGDIAQPLH-------------TEGF--
Q5KPJ8_CRYNJ/20-279---IMDGKGG--KDVD--------I--PLR---------------FLV--HFIGDSHQPLH-------------LAGR--
Q236I4_TETTS/18-296---LSRKYYL--PLQNNLNISVQQA-IMMR---------------LLI--HIVGDMHQPLH-------------NVNMYN
Q4DEV4_TRYCC/28-293---LMKQDLV--PYIM--------S-FAIV---------------NIA--HFLGDIHQPLH-------------AVELFS
Q0CD39_ASPTN/21-282---VSEY--SFNRT------------EAVL---------------FLV--HFFGDLHMPLH-------------VEGL--
Q2SFD4_HAHCH/50-295---LKGEPRQGYQATP--------A-QALM---------------FIG--HFIGDIHQPLH--------------VSY--
Q585P6_TRYB2/27-292---LRRTDTP--IYVR--------S-FALA---------------HLV--HYYGDIHQPLH-------------TTSQVS
Q989R8_RHILO/21-270---ITCAT-D--PLQR--------R-DSLR---------------YLI--HIVGDLHQPFH-------------TVAD--
ENDO1_ARATH/29-294---LQHYGE-GTSDRRY-----NMT-EALL---------------FLS--HFMGDIHQPMH--------------VGF--
A4CQ68_ROBBH/22-257---LKDPASP--RDQQ--------V-FYLK---------------LLV--HLVGDLHQPMH--------------VGR--
A3U8L7_CROAH/33-268---VQNKTLS--KDDR--------A-FYLK---------------LLV--HFIGDLHQPLH--------------TGR--
A7H7R9_ANADF/28-274---LRDGEGA---ARR--------A-DAFR---------------WLV--HLVADVHQPLH--------------AGD--
Q7P202_CHRVO/23-274---LADRGAA--KADR--------A-QALT---------------FLI--HMVGDIHQPLH--------------AAD--
A0BML4_PARTE/16-293---LTSTKTA--KFRHTV----FKA-EMIR---------------VLL--HVIGDLHQPLH-------------DTAFWN
A7EWS3_SCLS1/21-282---LQKGTAS--------------A-ANLD---------------IAA--KFVGDIHQPLH-------------DEEL--
Q3IBZ8_PSEHT/27-268---LQDEQSS--LDAK--------Q-FSLR---------------FLV--HLVGDSHQPFH--------------AGR--
A7ETG5_SCLS1/21-277---LLDP--NVSRYHK--------Y-IAAK---------------------FVGDIHQPLH-------------AENI--
A0M3W8_GRAFK/24-260---LKDQNSS--RDEK--------Q-FYLK---------------MLV--HFVGDLHQPFH--------------TGH--
A0BLJ0_PARTE/422-699---LTNSKTS--RNRHTV----FKA-QMLR---------------VLL--HVIGDIHQPLH-------------DTSLYN
A4HJL3_LEIBR/28-299---LQRAISN--SDII--------V-HSLA---------------LLI--HFMGDIHQPLH-------------NANIFS
Q0TYV6_PHANO/20-284---AVES--NISVIEQ--------Q-KALK---------------WVI--HFVGDVHQPLH-------------VENI--
ENDO3_ARATH/25-286---LMSTSENSQSIVHY-----NLT-EALM---------------FLS--HYMGDIHQPLH--------------EGF--
Q0AMT2_MARMM/26-282---FVDRSRS--DEDR--------L-EALK---------------FLA--HWMGDIHQPLH--------------VSI--
Q4Q7F3_LEIMA/31-295---LRRTNAP--LYLL--------N-FAWV---------------NLV--HILGDLHQPLH-------------TTSRYS
Q5NRA3_ZYMMO/33-298---LSSKQTS--DQDR--------V-LALK---------------YVL--HFVGDLHQPLH--------------AAD--
A5V871_SPHWW/21-280---LRDRSQP--QRVR--------V-EALV---------------FLV--HFVGDLHQPLH--------------AGD--
Q5FP59_GLUOX/25-298---LADTHAS--AQDR--------L-TALK---------------WVV--HLVGDIHQPLH-------------AAER--
Q0UA95_PHANO/19-289---LKDCITQVNSGALSGGTNLTCS-YALK---------------WVA--HFLGDIHQPLH-------------ASGR--
NUS1_ASPOR/21-284---LLES--PNGSEA---------L-NALK---------------FVV--HIIGDIHQPLH-------------DENL--
A4HI96_LEIBR/31-295---LSNVRSP--LYML--------N-FAWV---------------YLV--HLIGDLHQPLH-------------AVSRYS
Q01U80_SOLUE/19-261---LVNPAAT--PVQR--------K-EALM---------------FIV--HFVGDMHQPLH--------------CSD--
A2QX99_ASPNC/21-292---INDR--HANMTQQ--------K-EALM---------------FLI--HLFGDLHQPLH-------------VTGV--
A2TWS6_9FLAO/25-260---LEDDASS--EADK--------N-FHLK---------------MLV--HFIGDLHQPLH--------------IGR--
Q2UHT0_ASPOR/21-283---VNDH--SANQT------------EAVM---------------YLF--HFFGDLHMPLH-------------VEGY--
Q2H4S7_CHAGB/217-488---LLDAEGALPAWQR--------A-QAAK---------------FVV--HFVGDIHQPLH-------------TENV--
Q15ZB2_PSEA6/20-256---LTSSQTS--KAEK--------Q-LALR---------------FIV--HIIGDLHQPLH--------------AGN--
A4I736_LEIIN/27-297---IEKPTAN--SDVI--------V-QSLA---------------LLL--HFMGDIHQPLH-------------NVNLFS
G3XKQ7_SOLLC/26-290---LSHYREG--TSDRRY----NMT-EALL---------------FLS--HFMGDIHQPMH--------------VGF--
I1KHQ2_SOYBN/27-290---LLEYGSD--TKSRY-----NLT-QSLF---------------FLS--HFMGDIHQPLH--------------CGF--
I1MEB5_SOYBN/33-297---LMHYKEG--TSDRRY----NMT-EALL---------------FLS--HFMGDIHQPMH--------------VGF--
I1PPP5_ORYGL/30-294---LMHYNHG--SADRKY----NMT-EALL---------------FLS--HFMGDVHQPMH--------------VGF--
M7YSG5_TRIUA/24-280---LQDS-SS--PYNR--------T-ESLM---------------FLA--HFVGDVHQPLH--------------CGH--
Q1K6E5_NEUCR/21-291---LLDQSLH--VVER--------A-QAAK---------------FVI--HFVGDIHQPLH-------------TEDV--

PF09988

Q8YZE9_NOSS1/2-166----------------------S--L-----------------------T-SYSMEFFALFLGLE---------------
K9TIP1_9CYAN/2-166----------------------T--V-----------------------K-QHPMEGIALFLGLE---------------
B2VAC8_SULSY/2-161---------SRFDN------LDL--S-----------------------SFLNNVSFLSFFFGLI---------------
A5UV55_ROSS1/2-173---------QASAW------LFD--A-----------------------MRRNPDMVRLFIFGFI---------------
K9VXZ1_9CYAN/2-166----------------------S--L-----------------------F-QHSAEFIALFVGME---------------
K9X512_9NOST/2-158----------------------S--L-----------------------F-LYGGEFFALFLGLE---------------
Q10Y23_TRIEI/2-165----------------------S--L-----------------------S-QHYQEVVALLVGLE---------------
K9R5N7_9CYAN/21-185----------------------I--I-----------------------N-LHKTEFLALFVGLE---------------
Q7U3L4_SYNPX/2-155---------AGLPQ------LVS--W-----------------------LKQQPQQAIALGIGLE---------------
K9UM54_CHAP6/2-166----------------------S--I-----------------------E-LNLPVYLALFCGLE---------------
D7CX68_TRURR/2-172---------YRVGF------EAE--V-----------------------GESWPQLLVGSLAGYY---------------
K9S824_9CYAN/2-177---------STLPW------LWS--L-----------------------LQRYPQEAIALGLGLE---------------
U5QDG6_9CYAN/2-166----------------------S--W-----------------------GSAHWPVLVWGLLGLE---------------
Q9RT76_DEIRA/5-173---------LGLGW------PRL--P-----------------------QPLPYKVLLPVAAGYY---------------
B1XNI7_SYNP2/2-167----------------------Q--W-----------------------QQHYWAESLALFVGLE---------------
K9YHE6_CYASC/3-166----------------------V--I-----------------------GEIYLKEIIALFIGLE---------------
K9U5M5_9CYAN/2-166----------------------S--L-----------------------T-HHTTEWIALCLGLE---------------
K9XH03_9CHRO/2-166----------------------S--L-----------------------V-QNTAEWFYLFLGLE---------------
B7KDH5_CYAP7/2-167----------------------S--L-----------------------TGKYLSEAIAVGVGLE---------------
D7DZB9_NOSA0/2-166----------------------T--I-----------------------S-IYYGEFFALFVGFE---------------
K9VNR5_9CYAN/2-166----------------------S--I-----------------------W-EHHIEILAVYIGLE---------------
A9B0N7_HERA2/2-170---------AFIAD------LKA--L-----------------------WYSDRQLIVYALVGFV---------------
Q8XL51_CLOPE/2-170---------EMLKL------VFN--F-----------------------MSKNKILFGNMALALF---------------
G2LLI8_CHLTF/2-174---------AGHHM------SRL--F-----------------------RAVDGKVWLVAFIGLW---------------
E4UAQ6_OCEP5/2-167----------------------------------------------------------AGLAGYF---------------
B1X0E2_CYAA5/2-167----------------------T--L-----------------------KNQYLGEAIVTFIGLE---------------
Q7NFX0_GLOVI/2-166----------------------L--W-----------------------CGANISTLIWGLVGLE---------------
K9Z9T5_CYAAP/2-167----------------------V--L-----------------------KNNYWQEVLSLFIGLE---------------
L0A273_DEIPD/2-163----------SVDW------PVT--S-----------------------LAFSWSLALPLLVGYY---------------
K9WE31_9CYAN/2-166----------------------W--L-----------------------I-NYQAEWIALFVGLE---------------
K9V8T7_9CYAN/2-166----------------------S--L-----------------------L-VYNQEFLVLFLGLE---------------
Q7V3X6_PROMM/2-159---------SLAKA------LNE--Q-----------------------LRLNPQPILAVLLGLE---------------
B8HTG8_CYAP4/2-166----------------------S--L-----------------------Q-TYPYEWLAGLAGLE---------------
C1CV84_DEIDV/5-166----------SVTV------PAI--P-----------------------QPISVKVVAPLIAGYY---------------
Q31N47_SYNE7/7-176---------HQQWI------GTE--L-----------------------S-RRPALVLATLVGLE---------------
S0EUE8_CHTCT/2-170---------MEAHS------LGQ--I-----------------------MRTHPRESLAFLVGFV---------------
E0U8U0_CYAP2/2-167----------------------S--V-----------------------KGEYSQEVIALFVGLE---------------
D3EPX6_ATETH/2-167----------------------K--L-----------------------RAQYLEEAVTIFLGLE---------------
C0QT82_PERMH/2-161---------DRFRD------VDI--Y-----------------------SFLSGSFVFSFIFGIF---------------
Q2JJ24_SYNJB/2-166----------------------Q--L-----------------------LQVHAEMLFWIGMGLE---------------
B7K2N6_CYAP8/2-167----------------------L--I-----------------------MTEYLQEAIAFTIGLE---------------
K9Q2E8_9CYAN/2-167----------------------Q--V-----------------------QQNYWAEVLALFAGLE---------------
A9WA62_CHLAA/2-176---------ELATQ------VNV--L-----------------------IETYPRETWAFIIGFC---------------
H8GTR8_DEIGI/2-163----------AWQW------PAL--P-----------------------EPVGLKFAVPLLLGYY---------------
K9XZT4_STAC7/2-167----------------------L--S-----------------------LHKYLAEIIAGVIGLE---------------
B2IUE8_NOSP7/2-166----------------------S--L-----------------------L-QYDTEYIALFLGLE---------------
E8UBR4_DEIML/2-163----------DLRL------PGL--P-----------------------SSLDWKGLLPLLAGYY---------------
K9QIC8_9NOSO/2-166----------------------S--L-----------------------V-GHSTEYLALFLGLE---------------
B0JHJ8_MICAN/2-166----------------------L--W-----------------------Q-QYPRVAIAIFLGLE---------------
K9RQ06_SYNP3/2-166----------------------S--W-----------------------R-QDDQAWIIGLISLE---------------
D7BE64_MEISD/2-161---------VQLDL------RGQ--V-----------------------RLPPEQVLYSGVAGYF---------------
A5GPK9_SYNPW/3-163---------EALPL------VLA--W-----------------------LQKHPDPLLAVLLGLE---------------
Q81WY4_BACAN/2-155---------ALDGN------LIE--I-----------------------AKEHEVEIVTFVMGIV---------------
W6FU87_NODSP/2-166----------------------S--L-----------------------V-VYTTEYLALFLGLE---------------
B4UA61_HYDS0/2-160---------SDTFF------QHI--K-----------------------YRIKEEDIFWFVMGAV---------------
K9T9J7_9CYAN/2-167----------------------S--I-----------------------SQDYRQEAIALVIGLE---------------
F0RKU1_DEIPM/12-173----------GVNL------PAL--P-----------------------DPIEWKVLLPVTLGYF---------------
F2NN18_MARHT/2-164---------VRWSL------NAE--L-----------------------ERLSPGVLWGALVGYY---------------
K8GJ34_9CYAN/2-177----------------------S--L-----------------------R-QHYSEWLALLIGLE---------------
D3PMR5_MEIRD/2-165---------LNIHL------QPH--F-----------------------KAPPQEVIWALVLGYY---------------
B0CCR6_ACAM1/2-165----------------------L--Y-----------------------SQQYLPEGLAILLGLE---------------
Q8DM71_THEEB/2-162--------------------------------------------------------GLAIALGLE---------------
P72876_SYNY3/2-165----------------------Q--W-----------------------LEQHRWELLTIFVGLE---------------

PF04307

Q18EP1_HALWD/1-158----------SIPA------HPG--P-----------------------AHWWGPHNI----------------------
Q65F12_BACLD/1-155----------AIKV------RLP--L-----------------------YIKTG--------------------------
Q0W2I6_METAR/1-181----------DHKF------TLG--I-----------------------MAGPSIFLTVASIIYL---------------
Q1AT01_RUBXD/1-176----------GKPF------RLL--P-----------------------RGIRS--------------------------
Q7MS32_WOLSU/1-175----------ERPI------ALL--P-----------------------LSYRFKTGGII--------------------
Q8D1W8_WIGBR/1-169----------KFKI------CLP--I-----------------------LPSNNIKRE----------------------
Q5WIF9_BACSK/1-182---------RWIAL------GVM--N-----------------------I-FDPVVFGAHVVGIL---------------
Q2NV14_SODGM/1-168----------RRRF------CMP--I-----------------------LNPSK--------------------------
A0LXF8_GRAFK/1-182----------RLAY------KNI--F-----------------------V-IDPLYTLPFLIFLILP-------------
Q01PN8_SOLUE/1-175---------ERLFF------PWR--P-----------------------IRVSPLSVARFFDR-----------------
Q0W4H6_METAR/1-165WGFP-EYERGDYIL------YLL--N-----------------------NLISRPDVFL---------------------
YFHP_BACSU/1-182---------KWVAL------GLI--N-----------------------T-FDPFIFISHLAAIA---------------
Q5FTT4_GLUOX/53-213----------RSRL------SLW--P-----------------------YVRTGGI------------------------
Q726Y1_DESVH/1-173---------WRAAL------PGV--Y-----------------------I-IDPLLTLPLLAAVA---------------
C1DQI7_AZOVD/1-180---------PPVAW------SSV--F-----------------------I-VDPLYTLPLLGAVLGG-------------
Q8ETE4_OCEIH/1-155----------SVTV------RLP--I-----------------------TTRTG--------------------------
Q5FK20_LACAC/1-175----------KKKR------YRK--F-----------------------LHYKV--------------------------
A4XRV7_PSEMY/1-180---------TPTAW------SSL--F-----------------------I-IDPLYTLPLIAAVVIS-------------
Q2N9Y9_ERYLH/13-204---------QWFYG------DTL--F-----------------------I-IDVWLWALMGFATWFS-------------
Q023X2_SOLUE/1-190---------QWLRA------DTT--N-----------------------V-IDLWILAVVIIGIAGPFLARLV-------
A9AVQ5_HERA2/1-166---------QRVFF------DWR--P-----------------------IAVAPISAARLF-------------------
Q7VVQ6_BORPE/1-180---------VPESW------SAV--F-----------------------I-IDPVYTVPMLAAVLVA-------------
A6LWG2_CLOB8/1-169----------KKRF------SIC--M-----------------------IKTNSKIED----------------------
A3CRK4_METMJ/1-159PLRH-HGYPEDYFW------ESV--L-----------------------RELAQ--------------------------
A1TRR8_ACIAC/1-179---------HPYGL------GSI--F-----------------------I-IDPLYTVPLIVGVVA--------------
Q3J7C8_NITOC/1-183---------YKAAW------PTT--F-----------------------V-IDPWFTGIIVIGLL---------------
Q8CV62_OCEIH/1-182---------KWIAK------GFI--N-----------------------T-FDPYIFFLNVAGIA---------------
A0JUC0_ARTS2/1-250K--------PPRFL------RKL--P-----------------------VLNDVWKANGAFSIP----------------
A1WTH1_HALHL/1-183---------ETFAF------PVT--F-----------------------I-LDPWITGALLLGLL---------------
Q5V391_HALMA/1-161----------QPPV------ARS--P-----------------------VPQWVGEGA----------------------
Q97K38_CLOAB/1-212----------KKKI------SLK--L-----------------------VHTGS--------------------------
Q1WSF6_LACS1/1-169---------SGSSF------GGK--F-----------------------AFYKT--------------------------
Q0ACJ1_ALKEH/1-184---------HGFAW------NTT--F-----------------------I-IDPWFSGLLLGGLI---------------
Q7N3N6_PHOLL/1-166----------KIRF------CLP--V-----------------------LGKQG--------------------------
Q9KEC4_BACHD/1-182---------RWIAL------GVI--N-----------------------I-FDPFIFFAHVVAIF---------------
Q1D144_MYXXD/1-188---------SRLSL------DWT--M-----------------------V-VDPWVTLPLLAGAIL--------------
Q2JB37_FRACC/1-225----------TWRM------ETV--L-----------------------VPRTD--------------------------
Q12UG8_METBU/1-174WEFP-HGTTYGGFS------HYL--S-----------------------VVTANSFAPEVSN------------------
Q5V568_HALMA/1-273----------DVTL------VAE--R-----------------------VMLHPDPTTHLLAAFAIELATVWLAVWTYVH
Q1ATT6_RUBXD/1-170----------SRAI------AVF--P-----------------------GRDEYRVVSGG--------------------
A4J2S9_DESRM/1-180----------GRQW------RRV--K-----------------------EKLES----ASWTHKKWS-------------
Q8TQH1_METAC/1-199----------DPSI------IGS--V-----------------------YFYDPLLNLLPLLPLFFIILGSLRRR-----
Q6D4I1_PECAS/1-166----------RWRF------RLP--I-----------------------LNSQK--------------------------
Q82XH5_NITEU/1-183---------WRFSL------PLV--F-----------------------V-IDPWFTAIILAGLV---------------
Q6YRT9_SYNY3/1-188RCV----CPGNRNL------RIS--T-----------------------GSAAEYWLMVFVVAIAV--------------
Q5HM58_STAEQ/1-158----------PFNI------VSP--I-----------------------HFKTG--------------------------
Q8TP13_METAC/1-172WSFP-RESRDYIGL------EHL--L-----------------------DMFEASFHLDFLQ------------------
Q0JZE4_CUPNH/1-185---------RRFSL------GTS--F-----------------------L-IDPLLSGIVVSGLVL--------------
Q97LP7_CLOAB/1-199---------KNYKF------SYT--F-----------------------RVGSA--------------------------
A0PYB1_CLONN/1-199---------KKYKL------PFT--Y-----------------------NVNSK--------------------------
Q9KE25_BACHD/1-180---------SRYSL------GFL--P-----------------------I-VDLPILLFFITGFI---------------
Q3JF51_NITOC/1-164RVV----MPGNRDY------RMA--V-----------------------GSKA---------------------------
A1K1W5_AZOSB/1-183---------RRFGI------GTT--F-----------------------I-IDLVFTGIILAGLA---------------
Q6AMI9_DESPS/1-207----------RSSG------SAL--K-----------------------FYSKN--------------------------
Q7NV83_CHRVO/1-166----------RIRF------RAP--L-----------------------MLLR---------------------------
Q47U11_THEFY/1-250---------NGRRW------AML--G-----------------------VPRWMRFR-----------------------
Q47RB2_THEFY/1-227----------KYRF------GQN--I-----------------------GFKTD--------------------------
Q1QZR4_CHRSD/1-181---------PPVSW------HSI--F-----------------------I-IDPLFTLPLLVGVV---------------
Q5P1U0_AROAE/1-192---------RRFGL------GTT--F-----------------------I-IDLVLTGLLVAGLA---------------
Q0BSQ9_GRABC/13-169----------KGTW------ALP--L-----------------------CRTG---------------------------
Q5L2T9_GEOKA/1-182---------KWIAL------GVI--H-----------------------T-FDPVIFGLHLVGVG---------------
A5CZD2_PELTS/16-203GKLE--KWRQAEKW------NSF--A-----------------------ARAAA----HAWAGRQWR-------------
Q2S300_SALRD/1-182---------YPVVH------GAV--F-----------------------I-IDPLYTVPLAVGLLVS-------------
Q1DD75_MYXXD/1-235---------TWFYG------DAL--F-----------------------I-IDPWVWLLAGAAVIMADARTRRSAAGWVV
A0KFP7_AERHH/1-165----------KRRY------RLP--G-----------------------WPLKS--------------------------
Q0VLL6_ALCBS/1-174----------PVAI------SSV--F-----------------------I-IDPFYTLPLLIGVL---------------
Q3A0M8_PELCD/1-203----------KSTF------GTA--F-----------------------KFWSS--------------------------
Q186I4_PEPD6/1-177----------TINI------SLL--P-----------------------IKTNS--------------------------
Q2L2L1_BORA1/1-180---------IPESW------SSV--F-----------------------I-IDPVYTLPLLFAVLAA-------------
Q67R78_SYMTH/1-176---------RIVEL------GVL--H-----------------------I-TDPWLLLLLGLPAV---------------
Q97MS7_CLOAB/1-166ATFPTRPEGHWLNE------GIL--R-----------------------LLSDPVYFS----------------------
A6TSU9_ALKMQ/1-172---------KKYSL------NLL--M-----------------------I-YDPVLTILNFYII----------------
A6TMK4_ALKMQ/1-249----------HKRI------KFP--F-----------------------TIKTG--------------------------
A3CVA2_METMJ/1-183PYEA--YEYTGYFG------GAI--L-----------------------AEVSSLSEWVFLAASAGIALA----------
Q9KAZ8_BACHD/1-159----------KTRV------RFP--F-----------------------TTKTG--------------------------
Q0S8N5_RHOJR/1-250LGK---ERWWEFRL------PSF--L-----------------------SIRA---------------------------
Q1IHJ9_KORVE/1-205---------KWYSL------SII--F-----------------------I-IEPILLAALTIGLVMPSLFGL--------
Q890Y4_CLOTE/1-199---------GNVKL------PIT--F-----------------------RTNSK--------------------------
Q0RHF1_FRAAA/1-228----------HWRM------EVV--L-----------------------VPRTD--------------------------
Q1MS87_LAWIP/1-199---------YRVRL------NSL--F-----------------------I-VDLLLILPLIIGL----------------
Q11P46_CYTH3/1-219----------EVYI------GGF--G-----------------------TTWWWNNYDVFLSLLTATILL----------
A6LXK9_CLOB8/1-172WKFPARPEGNWVNS------DIV--R-----------------------LITDPTYYL----------------------
Q2VZJ9_MAGSA/1-159----------KQRF------GVG--L-----------------------CST----------------------------
Q5YVJ3_NOCFA/1-233----------KPRT------CFP--I-----------------------IERTG--------------------------
Q8FRV6_COREF/1-249LKG---RRWWNLKL------PKF--L-----------------------SIRAN--------------------------
A0KMD3_AERHH/1-197---------ERFFA------PWQ--V-----------------------KRVAEGATRTCWVAYLSV-------------
Q3JEV9_NITOC/1-176---------ARIAW------NLI--A-----------------------V-VDPLFSGVLIIALG---------------
Q9CNK9_PASMU/1-180---------PPVVW------STV--F-----------------------V-IDPIYTLPLIFTCLWA-------------
A1U6Q1_MARHV/1-174----------PVAI------NSI--F-----------------------I-IDPLYTLPLLAGCL---------------
Q7NWB9_CHRVO/1-187---------HRYLS------GWR--P-----------------------IEGSPIGLKRWFGAKG---------------
O29079_ARCFU/1-168----------NFRI------NLV--K-----------------------TGSEG--------------------------
Q1MQD9_LAWIP/1-155----------KKRI------GLS--L-----------------------ISTGS--------------------------
Q5WH30_BACSK/1-157----------NIRV------RIA--R-----------------------IRTG---------------------------
Q1GSW3_SPHAL/1-193---------RWFYG------DSL--F-----------------------I-IDLWIWIALAVSLWLSF------------
A3CTE7_METMJ/1-243----------KRRV------AGR--V-----------------------RAQGLLEVRPAAFAIV---------------
YVSG_BACSU/1-155----------TIRV------RLP--L-----------------------YMKTG--------------------------
B1W5J1_STRGG/1-256---------AGKRW------YPL--G-----------------------PPKFMRFRA----------------------
Q5ZZH0_LEGPH/1-172---------SRISW------DII--S-----------------------I-IDPVFTLPLLLGTA---------------
Q6LSY8_PHOPR/1-173----------SFAV------SSI--F-----------------------I-IDPLYTIPLLVVIFA--------------
Q74JJ2_LACJO/1-173----------KKKR------K-S--P-----------------------IHYKV--------------------------
Q7CIV6_YERPE/1-162----------RWRF------SIP--L-----------------------LRPQK--------------------------
Q7CJI4_YERPE/1-166---------ERFFL------PWQ--V-----------------------IKVAPFQLAKYATPA----------------
Q81YV9_BACAN/1-179---------KWVAL------GII--N-----------------------TFDTVIF-FIHILAIAC--------------
Q8Y6J4_LISMO/1-176----------ETWV------AFG--F-----------------------INTFDWFIFGSHVVAIA--------------
Q9HUK3_PSEAE/1-165---------ARYFM------PFH--P-----------------------IAVSPIGLSRFLSERG---------------
Q9RMV6_BACAN/1-156-----------RNF------QSG--F-----------------------HVFYYSY------------------------
U5L8V8_9BACI/1-175---------KWVAL------GII--N-----------------------T-FDPFIFGIHVAGLFI--------------

PF13803

C7QBS6_CATAD/1-242NAR------VLGEP------PYV--L-----------------------LQYGCSVLGVGALGFWTVREMRRAVRSGTSA
C0ZEY0_BREBN/1-241QSI---SFAYYHVP------VYK--L-----------------------LQHSSTLFGGLAILYVIGRRARR--------
K9WR57_9CYAN/1-241AQL-------GSVP------IYK--L-----------------------LQYGSGVIGLGALFLWLSRRLNQ--------
D3EE91_GEOS4/1-236EML---HIGALQIP------VYK--L-----------------------GQHGSTLFGLVLTAWWIHRHLYV--------
X2GTZ3_9BACI/1-237TKI--YRIYGFDLP------LYK--F-----------------------LQHGSTLLGFILIFGYMYFRALS--------
F8A675_CELGA/1-236EPL------LGDMP------AAR--V-----------------------LQHASTVLGLVALAVWAGRRVAAWRAAGGRL
Q1IN38_KORVE/1-247RPM--------AVPGEPHGYGYV--A-----------------------AQMFSTLFGFFVLLVMFIVWWRR--------
D2Q1R3_KRIFD/1-251ANL------TPTWD------VNR--V-----------------------LQYLSSIGGILLIVLWLYRWWQRTTPEPVDP
A6GZ02_FLAPJ/1-235NSV---GFLGSQIP------ISK--I-----------------------LQHSSTLLGGLVVTFTIYKLPTN--------
D3V1B0_XENBS/1-240FRVFHSITNGQGIS------IYK--I-----------------------LQHLSSLLGLLYLTMKYWRYQKK--------
Q899W6_CLOTE/1-232INI---NFFNFQIP------LFK--I-----------------------IQHGSTLIGIILILIYLNKIKKE--------
G0FWC1_AMYMS/1-228VSV------AGPHR------LYN--V-----------------------IGYVSSTGGLVLLAVLVVRWYRRAPRAERAW
Q8XML2_CLOPE/1-242QKI--ILFGGEEIY------IYK--L-----------------------VQHTSTVIGIIIVLFFLYKLRDS--------
A0Q1Y2_CLONN/1-242NKI---SILNYKVP------IYK--F-----------------------LQHGSTVIGSIYIIVYLYSLMKY--------
Q6FEH5_ACIAD/1-242REI---SILGYHTH------VHM--L-----------------------MQIGTSVVTLPILIWMCLHYFKQ--------
H1YCR9_9SPHI/1-235SPV---KILFFQIP------LYK--A-----------------------VQHLSTLVGGAIIIAAICKLPLQ--------
I4B9J2_TURPD/1-232NSQ------LGSIP------LYK--F-----------------------AQHFSTAIGLVALGLYLFWLQPT--------
K4IBC3_PSYTT/1-233NSV---DFFSKQVP------ILK--I-----------------------LQHSSTLIGGLAIAFAIYKLPTR--------
H2JVD3_STRHJ/1-251RAR------PAGVP------LFT--W-----------------------LQYGSSAAGAVVIAVFAVRALRRAPDGVPAG
A5I0I6_CLOBH/1-248KNI---EILNYDIP------VYK--I-----------------------LQHGSTLLGVIFIILYIYSKRNK--------
Q65Q39_MANSM/1-229TKI--------IFH------IYD--W-----------------------LQYGIGAVGLISIILYQRRMAGK--------
F4FE12_VERMA/1-233SSV-------TDVA------WWT--V-----------------------SDLTSTALGAVVAIWCLALLGRPDARGTDIP
C6D3J1_PAESJ/1-240RIV------FLNLP------LFK--I-----------------------LQYSFSLLGLLIITLTVLIKLYQ--------
A3HWD2_9BACT/1-236TSI---LKGIYGFP------VYD--F-----------------------LQYGFSLLGLLWVIHFMIHLETQ--------
Q7UP84_RHOBA/1-249SEA--FSISGRIVR------WYA--V-----------------------AQHLSSLFLLPPMGVFALRWLWKQPEGGPEP
A8L7F5_FRASN/1-232ADH-------GALP------GYK--W-----------------------LQYCMGAAGLVVVAAAVVVHLRALPRGPRRP
D2ARI2_STRRD/1-246TRV------AGLLP------VFR--L-----------------------LQYLSTVVGLAVVARWAWLGLSRMEPQAPPE
Q0RF10_FRAAA/1-232AEH-------GALP------GYK--W-----------------------AQYGMSAAGLVVVAAAIAAHLRALPRGPRRP
C7R2G7_JONDD/1-241AEA------MGTLT------WAR--L-----------------------LQHVSSAVGLGALVAVGWVRRNSWLPSAENV

PF00882

</