Sequence alignment for CL0368

PF09988

Q8YZE9_NOSS1/2-166----PSGRTHDRITLWSLP-----LVAGLTFW...........QTRSGNVTLLVAGGFMFGGLMFGPD-LDIY.....SR
K9TIP1_9CYAN/2-166----PSGRTHDEITLWSLP-----LVAGGTYA...........QTRSSSLTLIVAGGFLFSGLMFGPD-LDIY.....SQ
B2VAC8_SULSY/2-161----AKGRTHDLINFAVLP-----PLI................YYLHPSDFISFSTGYFIGTFFLTPD-NDLYL....SK
A5UV55_ROSS1/2-173----PDTRTHDIITVATGA-----LLAPAAYVLLESGG.....RDDAAAGAAVLTGAHLISGLLFSPD-LDID.....SA
K9VXZ1_9CYAN/2-166----PSGRTHDRITLWLLP-----VVTVLTYG...........LTRSGDLTLILAGSFLFAGLMFGPD-LDIH.....SR
K9X512_9NOST/2-158----PSGRTHDSITLYALP-----VVAGVSFW...........QTRSGNLTLLVAGGFLFGGLMFGPD-LDIY.....SL
Q10Y23_TRIEI/2-165----PSGPTHDRITLWSLP-----IVIILSYV...........LVRSTHLTLFVSGGFLFSGLMFGPD-LDIN.....SR
K9R5N7_9CYAN/21-185----PSGQTHDRITIWALP-----FIAGTTFW...........QTHSSSITLLIAGGFMFGGLMFGPD-LDIY.....SI
Q7U3L4_SYNPX/2-155----ASGRAHDRATLIGGA-----PIGMAAA............VLWGADAGFIAAAGCLIGGLWLSPD-LDTH.....SN
K9UM54_9CHRO/2-166----PSGRTHDRVTLWSLP-----LIAGGTLY...........ATARADLAFWVSGGFLFSGLIFGPD-LDLY.....SF
D7CX68_TRURR/2-172----ASGRTHEAINLGVFA-----ALAGGYAYARARSLADPTNLLFAPETLWAFVLSYLIGTFFITPD-LDLAENRMRAR
K9S824_9CYAN/2-177----PSGGTHDRITLWSLP-----LVTGATIA...........CTRDGDLALLLAGGYLFGGLMFGPD-LDIR.....SR
U5QDG6_9CYAN/2-166----PSGRTHDRITWATAP-----AAVVAAWA...........LTGSLRIAATVGVSYVFAGLMFGGD-LDIH.....SI
Q9RT76_DEIRA/5-173----PSGRVHNLINLGTFA-----VLGTAALYVQRAQLWPDPTFTLTPTMALNFTWAFMAGTFLLSPD-LDLSEGRVDSK
B1XNI7_SYNP2/2-167----PSGRTHDQITFWGLP-----VVVGFGFL...........LLRRWELALILSLAYLFSGLMFGPD-LDIH.....SV
K9YHE6_CYASC/3-166----.SGKNHDRITWLCLP-----WIFIGTII...........ISKDLLTGFVVASGFLFSGLMFGPD-LDIY.....SV
K9U5M5_9CYAN/2-166----PSGQTHDRITLWSLP-----VVAGIAFG...........QTQSGNITLILSGAYLFSGLMFGPD-LDLY.....SR
K9XH03_9CHRO/2-166----PSGRTHDRITLWGLP-----VITGLTFF...........QAQSASLTLIVAAAYLFSGLMFGPD-LDLY.....SR
B7KDH5_CYAP7/2-167----PSGRTHDRITLWTLP-----WIIGLSYL...........LTRNGELTLLVAGGFLFSGLMFGPD-LDIY.....SR
D7DZB9_NOSA0/2-166----PSGQTHDRITIWSLP-----MVTGVTLV...........STRSSNVTLLVAGGFMFGGFMFGPD-LDIY.....SR
K9VNR5_9CYAN/2-166----PSGRTHDRITMWSLP-----AVAALTFG...........QTQSSNLTLLVSGSFLFGGLMFGPD-LDIY.....SC
A9B0N7_HERA2/2-170----PDGKTHDMLTVFTGI-----VGIPIIWRIV.........PNSDLLGAFVWAGSHIVSGMAFSPD-LDLA.....SE
Q8XL51_CLOPE/2-170----AAGKTHDKITVIMTP-----FIASFFLFINMIFLED...LGSSLAFTILGVSVYMFGGYMFSGD-LDIK.....SR
G2LLI8_CHLTF/2-174----PSGRTHDLVTYVLAI-----PTAVGLFF...........LTRHVGLTVLGTATMLFGGLMFGPD-LDTH.....SK
E4UAQ6_OCEP5/2-167----PRGPVHESVNLTALA-----LGVIAYHRLVPEGS.....AALPPGTLEGFVAGYLLGSLWITPD-LDLAERKNTPR
B1X0E2_CYAA5/2-167----PSGRTHDRITYLSLP-----PLAVIAYL...........LTGRGEWLLWLSGAYLFSGLMFGPD-LDIY.....SL
Q7NFX0_GLOVI/2-166----PLGRTHDRITWWSVP-----AAGAAVWL...........VSGAFEAALGAACAYLFAGLMFGGD-LDTH.....SV
K9Z9T5_CYAAP/2-167----PSGKIHDQITWFCLP-----LVIILFFI...........VTKSLLLTALGGFGFIFSGLMFGPD-LDIY.....SI
L0A273_DEIPD/2-163----PSGQSHTFINLAAYA-----VLGSVALYVHRQGI.....FFIGQEDALFFTLGFLVGTVFLSPD-LDLAEGHVNSK
K9WE31_9CYAN/2-166----PSGQTHDRITLWSLP-----VVTGLTIA...........STQSGNLALIVSGGFLFSGLMLSPD-LDLK.....SL
K9V8T7_9CYAN/2-166----PSGRTHDRITIWGLP-----MVVGMTFW...........HTRNGNLTLLLASGFMLGGLMFGPD-LDIY.....SV
Q7V3X6_PROMM/2-159----ASGEDHDKATCFWSL-----PFGFGLS............FVMGLPSGLIGGLAFVVGGLWLSPD-LDTY.....SK
B8HTG8_CYAP4/2-166----PAGRTHDRITLSCLP-----FLATATWL...........GSRNLALTGILSTSFLFSGLMFGPD-LDIH.....SC
C1CV84_DEIDV/5-166----PSGRVHNLINIAAYS-----VLAGAVLVASRQDI.....LSITPSQALYFTLAFAVGTFLLSPD-LDLAEGKVDSK
Q31N47_SYNE7/7-176----PSGRTHDRLTLWLLP-----AVAAGSWL...........ISRQSDLSLVLSGSYLFAGLMFGPD-LDVR.....SR
S0EUE8_CHTCT/2-170----PGARVHDLITVSTLA-----AFDVLYVAKV.........HPASLVPLCCFSGAYLFAGLACAGD-LDTN.....SR
E0U8U0_CYAP2/2-167----PSGRTHDRITLWCLP-----WIIGLSYL...........LTGNGELTLIAASGFLFSGLMFGPD-LDIY.....SR
D3EPX6_ATETH/2-167----PSGRTHDRITVLSVV-----PITILFYF...........IFRRKELILWFGLSYIFSGLMFGPD-LDIY.....SL
C0QT82_PERMH/2-161----ASGRTHEIINLLFLP-----GAV................YYLNPVSFEGFISGYIIGTFFLSPD-NDIYH....SK
Q2JJ24_SYNJB/2-166----PLGSTHDRITLWTAP-----GITLAAGL...........LGNSTTVALAVGSAYLFSGLMFSGD-LDTC.....SR
B7K2N6_CYAP8/2-167----PSGRTHDRITFWGLP-----PLMGLTYL...........LSGKIDLTLILVGSYLFSGLMFGPD-LDIH.....SV
K9Q2E8_9CYAN/2-167----PSGRTHDRITLWGLP-----WVVAIAYI...........LTRNGELTLIVGLAYLFSGLMFGPD-LDIH.....SV
A9WA62_CHLAA/2-176----PSARTHDLITVVSGI-----ALTPVVYHACLEYAQFS..PPTALACSLWFGGAHLVSGIMFSPD-LDID.....SA
H8GTR8_DEIGI/2-163----PSGRVHNLINLAAYA-----VLAAGALAASRQDL.....IGVTPAQAINFTLGFLAGTFLLSPD-LDLSEGRVDSK
K9XZT4_STAC7/2-167----PSGQTHDRITLWSLP-----WLAGISFC...........LTRNGELTLILAGSFLFSGLMFGPD-LDIY.....SI
B2IUE8_NOSP7/2-166----PSGRTHDRITMYALP-----LVAGITFW...........QTRSSNATLLVAGGFLFGGLMFGPD-LDIY.....SV
E8UBR4_DEIML/2-163----PSGNVHNLINTAAYA-----ALFAATALAQHAGY.....VHVTPVQGLAFTAGYAAGTFLLSPD-LDLAEGRVNSK
K9QIC8_9NOSO/2-166----PSGQTHDRITLWALP-----LVAGVSFW...........QTRSSSVTLLVASGFMFGGLMFGPD-LDIY.....SR
B0JHJ8_MICAN/2-166----PSGRTHDRITLILLP-----PIAGASFL...........VSGSGKLTLLLLASYLFSGFLFGPD-LDIH.....SV
K9RQ06_SYNP3/2-166----PSGRVHDRVTVVLSP-----LAGLGAGV...........WGQRWELATLAIVGVLVSGFFLSPD-LDIP.....SK
D7BE64_MEISD/2-161----PAGRIHEAINVGALG-----LLSASYVYEQNH.......LGLSEPAAFGFAVAYLIGTFLVTPD-LDLAEQRVRAK
A5GPK9_SYNPW/3-163----.LGRDHDRATLIGCV-----PAGLLAG............FWLGWSLGVLTAAAFAWGGLWLSPD-LDTR.....SR
Q81WY4_BACAN/2-155----PSGRTHTKINLISLP-----VVLFLLFSY..........GLTNFDFLLTFAIGFLVGTTFLTPD-LDTY.....SN
W6FU87_NODSP/2-166----PSGGTHDRITLYTLP-----VIAGVTLW...........QTRSSNLTLLVAGGFMFSGLMFGPD-LDIY.....SR
B4UA61_HYDS0/2-160----ASGNTHDFLNLATLP-----IFL................YGVPHEYFLYFGSAYVISTVLLSPD-IDLHH....SK
K9T9J7_9CYAN/2-167----PSGRTHDRITLWSLP-----PIVGLSYL...........LTRKGELTFIIAGAFLFGGLMFGPD-LDIY.....SL
F0RKU1_DEIPM/12-173----PSGRVHNYINMAVYA-----ALGAGAVWAGREGL.....VTLTQTQTLHFSLGFLAGTFLLSPD-LDLSEQGVNSK
F2NN18_MARHT/2-164----PSGRTHEAINLTALG-----LLSAGYLYGRTQG......YGPPDEWAFAFVGGYLVGTFLITPD-LDLAERRVTAK
K8GJ34_9CYAN/2-177----PSGQTHDRITLWSLP-----LVAGVTFE...........RTQNASLTLIVSGGYLFSGLMFGPD-LDIH.....SR
D3PMR5_MEIRD/2-165----PSGRVHEAINLSVLG-----LATAAYWVYRQD.......LEVPQPVAVAFMGSYLLGTFLITPD-LDLAEQQVRAK
B0CCR6_ACAM1/2-165----PSGRTHDQITLGMLP-----GIAIVALV...........LSRSASLTLSLSGAFLFSGLMFGPD-LDIY.....SI
Q8DM71_THEEB/2-162----PSGRTHDRLTWIVMP-----MVGFTVSA...........LTRDWVWGAIASSSFGIGGFLLSPD-LDTV.....SL
P72876_SYNY3/2-165----PAGKIHDRITLGATP-----AVMAITFI...........GTGSARLTLLMAIAFGFSGLMFGPD-LDIH.....SC

PF04307

Q18EP1_HALWD/1-158M...SPL.EHALVALIPVT-----IYILLRHRRLPS......-.......KTMLSVVCFG...SVFPDLVD.........
Q65F12_BACLD/1-155M...TGK.THIMGGVASCT-----AAAYFYGYDPV.......-........FMTASGVIG...ALIPD.IC........H
Q0W2I6_METAR/1-181M...DSL.TH.ALAITVVF-----TAAGRP............-........ELVPFAVLG...AVVLD.ID........V
Q1AT01_RUBXD/1-176M...NAT.THAVFGVAAFA-----GACLAAGVEPP.......-.......AYAYPAAVAA...AWLPD.VD........N
Q7MS32_WOLSU/1-175M...LAR.THLAFALGIAT-----LPLYALSLVDKATLQ...-...GVEVSLYLSGVALG...SLLPD.ID........E
Q8D1W8_WIGBR/1-169M...TSK.GHLIFGLSVAI-----FLKKIEIFNALYLG....-.....KWGHIITGSICS...CLLPD.MD........H
Q5WIF9_BACSK/1-182M...DTS.THIVMGAGLAG-----LATLDVQIASSPY.....-.....MMTAVLATTLVA...SNAPD.FD.........
Q2NV14_SODGM/1-168M...TAG.GHFIFVLASAI-----FAKKLELSPALAQG....-.....NWGHIIIGGILT...CLLPD.ID........H
A0LXF8_GRAFK/1-182M...DSL.TQIVLGAAVGE-----AVLGKKVGNK........-........AMLYGAIAG....TIPD.LD........T
Q01PN8_SOLUE/1-175M...ASAITHFVVGAGLAL-----PAMELPALRGV.......-.......MPRWALPVTTGLFAVVPD.LD.......TY
Q0W4H6_METAR/1-165M...LFF.GHIGLTLLVVF-----LVALALKIG.........-........VDYRLVIVG...SLLPDIIDK......PL
YFHP_BACSU/1-182M...DTG.THVVMGIALGG-----IATLDPVVGSDPA.....-.....MAHAVMIATLAG...SQAPD.ID.........
Q5FTT4_GLUOX/53-213V...TGR.SHLLIGGFAVL-----CAMRWHILSPE.......-.......PLSVCTGLLG...SLLPD.ID........T
Q726Y1_DESVH/1-173M...DPI.THVASGAVAMY-----ALRERPRTA.........-........WALPFGMVA...AASPD.VD.........
C1DQI7_AZOVD/1-180M...DSL.TQAVLGASVQG-----ALLGRWQGRK........-........ALLYGALLG....TLPD.LD.........
Q8ETE4_OCEIH/1-155M...TGK.THIMGGIAATT-----AYAYYSNYDPT.......-........ALIISGVIG...SIIPD.IC........H
Q5FK20_LACAC/1-175M...LTR.SHRLFSIAVVE-----LGLIATDTFLTNPV....-.....SNVVLLLATGVG...ASLPD.ID........E
A4XRV7_PSEMY/1-180M...DSI.TQAVLGASIQG-----ALLGRWQGRK........-........ALLYGAALA....TLPD.LD.........
Q2N9Y9_ERYLH/13-204I...DNL.THSLVGALLGQ-----AGLKKKTG..........-........LAMPALIIG...ANLPD.VD........A
Q023X2_SOLUE/1-190M...DNL.THTAVGLFLSR-----IGLGRWSA..........-........RGTAIVVVA...ANIPD.ID.........
A9AVQ5_HERA2/1-166M...PTIFSHVAPALIVGL-----ALGRERMSR.........-........PLLICASIA...AISPD.FD........G
Q7VVQ6_BORPE/1-180M...DSV.TQVVLGAAIQG-----SMLGRSQGRK........-........ALLYGGLLG....TLPD.LD.........
A6LWG2_CLOB8/1-169M...NYK.THINGGILVGL-----YTNCQLANMPLMS.....-......TAVLLGGAFVG...SIFPD.ID........H
A3CRK4_METMJ/1-159M...YLL.AHAMVGLLIGV-----VLAAIAGDR.........-........RVLAFAVLG...AVLPDLIDK......PL
A1TRR8_ACIAC/1-179M...DSL.TQIALGSAVSL-----AAMGRRTAAWK.......-........AVLWGAVAG....TLPD.LD.........
Q3J7C8_NITOC/1-183M...DTL.THALSGALLAR-----ATASSKQPTGQLR.....-......VGERVLLGALA...ATFPD.SD........F
Q8CV62_OCEIH/1-182M...DTG.THIVMGVALGG-----LATIDPVVQSDPT.....-.....LFHAVLVGTVVG...SHAPD.FD.........
A0JUC0_ARTS2/1-250M...MGG.HHAASGAAAWV-----AIASTGPYTLGWYP....-....LDATGILIGGMATAGTALVCD.WD........H
A1WTH1_HALHL/1-183M...DPV.THAASGALINR-----VVAPRDCGAPRFS.....-......LRERTWIGAGA...ALFPD.ID.......WF
Q5V391_HALMA/1-161M...VLPSEHFIIALLPVA-----VYALLRDRHLPS......-.......LQLVAVTFFG...SQFPDLID.........
Q97K38_CLOAB/1-212M...TGK.THISIGLMSSA-----AVLSVNNPTPEN......-......IAVGLAVGVLG...ALMPD.ID........T
Q1WSF6_LACS1/1-169M...QAK.THITTTLALGL-----PLMSLTNELTL.......-........VNVGVLAVG...SLLPD.ID........H
Q0ACJ1_ALKEH/1-184M...DTL.THAISGAVAAR-----ALPASRRAAAPS......-......LRERTWAGFVA...GASPD.ID.........
Q7N3N6_PHOLL/1-166M...TAE.GHLLFSVASII-----LAHKLEITPEIANG....-.....DWLHMLPGVLLT...ALLPD.ID........H
Q9KEC4_BACHD/1-182M...DTG.THVVMGVALGG-----LAAIDPAVTNDPM.....-.....MKSTVMIATIIG...SQAPD.FD.........
Q1D144_MYXXD/1-188M...DNL.THGLLGLAIGA-----MRKPDVRPGAPERAS...-....PTDRAVLVASVLA...AELPD.LD.........
Q2JB37_FRASC/1-225M...MGR.THALSGAVVWL-----AVAPLLSREQWLGSHA..-..VSLSSSQVIAGAVVSAGAALLPD.ID........H
Q12UG8_METBU/1-174M...FII.GHLGLTLAIFL-----VISLLVPSIRN.......-.......MIDYRFVAVG...ALLPDLIDK......PI
A8GDN5_SERP5/1-166M...TAE.GHLIFSVACAI-----FAKKAEVTPSLATG....-.....DWWHIIPAALLT...SLLPD.ID........H
Q5V568_HALMA/1-273M.....FVGHALLAFALGA-----LAAWWLGLSRE.......-........RAVQLGVIAGLFAAVPD.VD........I
Q1ATT6_RUBXD/1-170M...KVA.THIVFGECCLF-----AASAVFDFHYET......-.......PSVLAAAVCS....VLPD.AD........Y
A4J2S9_DESRM/1-180M...TGI.THAAAGSAVGA-----ALAALGG...........-........QEVTGAVVGAVAALLPD.MD........H
Q8TQH1_METAC/1-199M...VNTLSHLGIGFLIAL-----ALGLRGK...........-........KLKVVAFL....SVLPD.LDVIPYSLFLA
Q6D4I1_PECAS/1-166M...TAE.GHLLFSVACAI-----LAKKVELSPALAAG....-.....DWWHIIPGALLT...ALLPD.ID........H
Q82XH5_NITEU/1-183M...DPV.THTLSGALLMR-----AVTSSHTQYAQRL.....-.....PLRERIVAGSVA...AAFPD.SD.........
Q6YRT9_SYNY3/1-188M...LTI.THLLVGAASVG-----MAAQT.............-........TNPVPILIGAIASLLPD.ID........I
Q5HM58_STAEQ/1-158M...TGK.THASCGFLVGA-----ITTQYFHTDIFT......-......SISVIVLSVIS...SILPD.IC........H
Q8TP13_METAC/1-172M...LLF.GHLGVTLGIFF-----GLGIFIPRLRT.......-.......IIDPRYLAIG...AILPDLIDK......PI
Q0JZE4_CUPNH/1-185M...DTI.THALMGAQAAL-----AIPVAEVPGRRLS.....-......TRERLLLGAAA...GAFPD.ID.........
Q97LP7_CLOAB/1-199M...TGK.THAGIGAAVGI-----ALAGKLPGGFN.......-.......AVGMGLIIAA...SILPD.ID........H
A0PYB1_CLONN/1-199M...KGK.THAAIGMATFM-----SVYDRVPGGFN.......-.......YLGVFIVAIA...SLLPD.ID........H
Q9KE25_BACHD/1-180M...DTV.THGLLGYGVYA-----AFKKPFMETHK.......-.......KWYALASIVA...AEIPD.ID.........
Q3JF51_NITOC/1-164M...IAG.THIAFASVLYL-----GGAALFEYD.........-........TDLLGWALAAGASLLPD.VD........L
A1K1W5_AZOSB/1-183M...DTV.THALSGALLGR-----LFSSGRGGLRP.......-.......AAAIAAGATA...AAFPD.ID.........
Q6AMI9_DESPS/1-207M...ANFSTHLTAGACVGF-----AISTLSTVS..FDFS...-...ISQTATVFLLGAIG...GTLPD.LDSDSGKPLRF
Q7NV83_CHRVO/1-166M...MVA.THVAFGAFCAV-----SAALILHLPAMM......-......AVLLLAGGLAG...SLLPD.ID........H
Q47U11_THEFY/1-250M...MGF.SHATTGVLVGV-----AVAAPLAAAAGTPP....-.....TPMGLLAWALLGAGSALVPD.LD........H
Q47RB2_THEFY/1-227M...MGH.SHALSGVVGWM-----AVVPLLNKVDVLGINF..-...ELGSGEIIAGGLVCAGAALIPD.LD........H
Q1QZR4_CHRSD/1-181M...DSL.TQACLGAAIGG-----TVLGRRLGRK........-........AVIAGAALG....TLPD.LD.........
Q5P1U0_AROAE/1-192M...DTL.THALSGALAGR-----LLARRPSPGSTPAAKP..-...APSIWQPVAAGAAA...AAFPD.LD.........
Q0BSQ9_GRABC/13-169M...MAG.SHVALGAAAWL-----IVAPKLGLPPAD......-.......AAGLVLAVAG...ALLPD.VD........H
Q5L2T9_GEOKA/1-182M...DTG.THVLMGVALGS-----LASLDPAIAHDPL.....-.....LSHAVLIGALAG...SQAPD.ID.........
A5CZD2_PELTS/16-203M...TGI.THAAAGAAIGA-----AAGALGG...........-........AAAAGAAAGGLAALLPD.LD........H
Q2S300_SALRD/1-182M...DSV.TQITLGAAVGE-----ATAGREAGLK........-........APLWGAAFG....LLPD.LD........V
Q1DD75_MYXXD/1-235M...DNL.AHSLVGAWMAE-----AGLKRTTP..........-........LATATLVIG...ANLPD.VD.........
A0KFP7_AERHH/1-165M...TAQ.GHLLFSVTCTL-----LAHKLQLTPALADA....-.....SLWHTIPAALAS...ALLPD.LD........H
Q0VLL6_ALCBS/1-174M...DSL.SQAVLGASVGG-----AVLSRPLGRW........-........ALLGGALLG....TLPD.LD.........
Q3A0M8_PELCD/1-203M...AGHKTHFAAGVATAA-----LLAGTTSIVGGIPH....-....AQQPLLLACGMAA...GLAPD.LDSDTSKPLAI
Q186I4_PEPD6/1-177M...IKE.THERGGYIFAL-----LILPFINNLYLVKYDIA.-.YKIVLIIIYIYFAYLG...SLFPD.ID........M
Q2L2L1_BORA1/1-180M...DSV.TQAVLGAGIQA-----TLLGRWQGRR........-........ALLYGAALA....TLPD.LD.........
Q67R78_SYMTH/1-176M...DSL.THVLMGHAMGA-----LATAVSPEAGP.......-........AVYWAALLG...NSLPD.VD.......VP
Q97MS7_CLOAB/1-166M...IFF.GHLGLTTGAVK-----ICENTVLSKKK.......-.......DIDYRFLLVG...SILPDLIDK......PI
A6TSU9_ALKMQ/1-172M...DPL.SHGLMGLAAFS-----LKYSPSLSN.........-........PACLGAVIG...AIAPD.FD.........
A6TMK4_ALKMQ/1-249M...LGR.THVALGLMTSL-----GIAVLLGNPFMVES....-.....FNTIALLVAVGG...ALLPD.LD........M
A3CVA2_METMJ/1-183M...FVA.CHLFLGLILGL-----AIAGRLGDR.........-........RLIGFCALG...AVLPDLIDK......PV
Q9KAZ8_BACHD/1-159M...TGP.THIIGGFTAAA-----AMAYFNAISVEQ......-......PIIYYSASLFG...ALIPD.IC........H
Q0S8N5_RHOJR/1-250M...VMGPTHAMSGAAVGL-----AVADLLPLDWGGPT....-.....STAETFTFAAVCAGAALLPD.LD........T
Q1IHJ9_KORVE/1-205M...EPV.THFLTGACLGR-----AGLNRKTA..........-........LATVTLTLA...AEAAD.LD.........
Q890Y4_CLOTE/1-199M...KGK.THLGVGIVTSI-----ALYEKLSLDFN.......-.......IISLGVVAFG...SLLAD.ID........H
Q0RHF1_FRAAA/1-228MSAVMGR.THALSGAALWL-----AVVPFLGREDWLGTYA..-..LSLSSHQVIAGGVVAAGAGLLPD.ID........H
Q1MS87_LAWIP/1-199M...DPL.THALTGATIVY-----TFPKESRPW.........-........WFLVWGMLV...AMLPD.ID.........
Q11P46_CYTH3/1-219M...DIL.IHTLSGTATAA-----LISTFTKAKTK.......-........TKLSLILLGGFAGALPD.IDAIS..LWSG
A6LXK9_CLOB8/1-172M...IFF.GHLGLTTEAIK-----AYEVILHKDNKLSG....-....KEVFVDYRYVLIG...SILPDIIDK......PI
Q2VZJ9_MAGSA/1-159M...MVV.SHVVLGVSAWT-----LAQRAGLAVPLG......-.......PEGAAAAALG...ALLPD.ID........H
Q5YVJ3_NOCFA/1-233M...LGH.SHATSGALAWS-----VAAATLPLAVVTYPVMQD-VDARLGPVDVLLGVFLTAGAALLPD.AD........H
Q8FRV6_COREF/1-249M...VMGPTHAMSGAAVGL-----AVAQILPEQWGGVT....-.....TAEETFIYAGLAAGAALLPD.LD........A
A0KMD3_AERHH/1-197M...PTIITHAAVPLCLGL-----GLGSRIIPP.........-........RLLLAGVAI...AMLPD.AD........V
Q3JEV9_NITOC/1-176M...DIV.TQGLLGAVVAQ-----SAARPSQAR.........-........LAAAVGFIA...GLLAD.AD........I
Q9CNK9_PASMU/1-180M...DSV.TQFVLGAAVQG-----VGMGKYQGRK........-........ALLYGGLLG....TLPD.LD.........
A1U6Q1_MARHV/1-174M...DSI.TQAALGASIAG-----AVAGKTLGRS........-........ALLTGALLG....TLPD.LD.........
Q7NWB9_CHRVO/1-187M...PTVVTHALAGATLVG-----LACRKPLSAP........-........GVLPWLALCGAAAMLPD.LD........V
O29079_ARCFU/1-168M...MRHTTHVIFSMLFIT-----AIAEFIPSFTEFI.....-.....PYSYALTISMFS...TLLPD.ID........H
Q1MQD9_LAWIP/1-155M...KWF.THKAIAIAGAL-----ALEASP............-........PGLFATLVG...SILPDLAD.........
Q5WH30_BACSK/1-157M...TGK.THMIGGVVACQ-----AMDTIVFAGAHG......-.......WAYYAAGLVG...AILPD.IC........H
Q1GSW3_SPHAL/1-193M...DNL.THSLVGALLGQ-----MGLKKKTG..........-........LAMPTLILA...ANLPD.ID........A
A3CTE7_METMJ/1-243M...RGD.QHVSLSLATAA-----LLIAPWATAIDAA.....-.....AIAVLLFGVFVG...SLAPD.AD.......AV
YVSG_BACSU/1-155M...TGK.THIMGGIASCT-----AAAYYYGFDPV.......-........LMAASGAVG...ALIPD.IC........H
B1W5J1_STRGG/1-256M...MGP.AHSLSGAAAWL-----GVGAAAAATGHTM.....-.....PWPVLVVGALICAGAALAPD.LD........H
B2FPD0_STRMK/1-181M...DSL.TQIVLGGAVAA-----AIAPPGHRRA........-........ALLAGAALG....TLPD.LDA......LW
Q5ZZH0_LEGPH/1-172M...DPI.THGALGAACAQ-----AALGKYDKR.........-........IPWQAGALA...GMAPD.LD........V
Q6LSY8_PHOPR/1-173M...DSV.TQAALGAAVAA-----VVAGKKSSPK........-........ILLAGAALG....TIPD.LD.........
Q74JJ2_LACJO/1-173M...LTR.SHRICSIAIVE-----LSLLLTNRLLIDPV....-.....NNIIILAATAIG...ASLPD.ID........E
Q7CIV6_YERPE/1-162M...TGE.GHLIFSVACVI-----LAKKVGLTPELAHG....-.....DWWHIIPGALLT...SLLPD.ID........H
Q7CJI4_YERPE/1-166M...PTIITHAAIPLTLGL-----GLGTKIIPP.........-........RLLLAGIAI...SMLPD.AD........V
Q81YV9_BACAN/1-179M...DTA.THLVMGVTLGS-----LATLDPAIAQSDI.....-.....GPQAVMLATIAG...SNIPD.ID.........
Q8Y6J4_LISMO/1-176M...DTG.THVVMGIALGA-----LATVDPVVAGSSQ.....-.....AAIGIMTATIIG...SQIPD.ID.........
Q9HUK3_PSEAE/1-165M...TTLITHPLPVLAVGL-----ALGSRVIPP.........-........HLLLAGMLA...ACLPD.FD........V
Q9RMV6_BACAN/1-156M...KYK.THLTTSLAVAL-----PVLASTGNLTV.......-........GNVIAVSFG...ALLPD.ID........E
U5L8V8_9BACI/1-175M...DTG.THVVMGFALGG-----LATLDPVVADSTA.....-.....TATSVMIGALIG...SQAPD.ID.........

PF13803

C7QBS6_CATAD/1-242--------MPFTL.AHPAA-----VL-P.LTRRGRA------------RGGLVGSALVFG---SIAPD-V-------PYF
C0ZEY0_BREBN/1-241--------MPFTF.AHPAI-----VL-P.L....RK------------CKWFSFSALVFG---SMAPD-F-------EYF
K9WR57_9CYAN/1-241--------MPFTF.AHPIA-----AA-P.I..WLCS------------KRRLDLPSLLVG---SIIPD-I-------EYF
D3EE91_GEOS4/1-236--------MPFTF.AHPVI-----TM-P.W....WK------------KKSLPVSALIIG---CMAPD-F-------EYF
X2GTZ3_9BACI/1-237--------MPLTF.AHPAA-----VL-P.F...SRK------------SKYIHFSAMVIG---SMAPD-F-------EYF
F8A675_CELGA/1-236--------MPFTL.AHPAA-----VL-P.L.....A------------RGPLVPAALVAG---AMSPD-V-------PYF
Q1IN38_KORVE/1-247--------MPFTL.SHAAA-----VV-P.L.....R------------RTRLVWSALVIG---SFGPD-F-------QYF
D2Q1R3_KRIFD/1-251--------MPFPL.AHPAA-----VL-P.F.....V------------RRPFVASALVAG---ALAPD-L-------LYL
A6GZ02_FLAPJ/1-235--------MPFTF.SHPAI-----IL-P.L..RYLP------------RQWFSLTGLIIG---SLTPD-F-------EYF
D3V1B0_XENBS/1-240--------MPWTF.SHPAA-----VF-P.L.KSFPG------------GRLLNLPALITG---SLSPD-F-------FYS
Q899W6_CLOTE/1-232--------MPFTL.AHPAA-----VI-F......SK------------NKHFNLMGLILG---SMAPD-F-------IYF
G0FWC1_AMYMS/1-228--------MPFTF.AHPAA-----VV-P.L......------------ARWLWLPGLVAG---SLAPD-V-------AYY
C2X225_BACCE/1-236--------MPFTF.AHPAA-----VL-P.F..SKKQ------------VNYISVTALILG---SMAPD-F-------EYF
Q8XML2_CLOPE/1-242--------MPFTL.AHPAA-----VV-F.L.....K------------NKKFNFTALILG---SMAPD-F-------IYF
A0Q1Y2_CLONN/1-242--------MPFTF.AHPAI-----VI-P.C..KKKA------------PKYLDLSALVIG---SMVPD-F-------EYF
I0E062_PROSM/1-239--------MPWTF.SHPAV-----VF-P.L.KQSKL------------GRWLSLPALILG---SLSPD-L-------LYS
Q6FEH5_ACIAD/1-242--------MPFTL.SHAIL-----AP-P.I..AKLS------------GQRLPVAALAIG---CMTPD-L-------FRL
H1YCR9_9SPHI/1-235--------MPLTF.SHPAI-----VL-P.L..SYLP------------KRWVSLTGLVAG---RVAPD-F-------EYF
I4B9J2_TURPD/1-232--------MPLTI.AHPAI-----IL-P.V..LRYS------------RNAAFVTGLFIG---CLTPD-F-------EYF
K4IBC3_PSYTT/1-233--------MPFTF.SHPAI-----IL-P.L..TYFP------------RKWFSLTGLVIG---SLTPD-F-------EYF
H2JVD3_STRHJ/1-251--------MPFTL.SHAAA-----VL-PAIRRDGSG------------RGPLVPTVLVAG---SFAPD-M-------PYY
A5I0I6_CLOBH/1-248--------MPFTF.SHPAI-----VL-P.L..EEKW------------NKYFNFTALILG---SMSPD-F-------EYF
Q65Q39_MANSM/1-229--------MPFTF.AHPVT-----VL-Y.F...PRN------------SRYFHFPALVLG---TMSPD-F-------MYM
F4FE12_VERMA/1-233--------MPLTLPSHLAA-----VL-P.L..KLWR------------PRWFDGVALSAG---AVAPD-V-------AHL
C6D3J1_PAESJ/1-240--------MPYTL.AHPIF-----AY-P.L..KKIN------------RKLLSVTGLVLG---SMGPD-M-------EYF
A3HWD2_9BACT/1-236--------MPFTF.SHPAA-----IL-P.F...SKT------------SKRLSQTGLVVG---SVVPD-L-------EFY
Q7UP84_RHOBA/1-249--------MPFTP.THVAA-----AI-P.I..AWMA------------KWRLPFSALAIG---CMVPD-A-------GVF
A8L7F5_FRASN/1-232--------MPFTL.SHPVA-----VL-P.L.....R------------RLGLPMSAMVAG---SMVPD-V-------PVF
D2ARI2_STRRD/1-246--------MPFTP.SHVAA-----VL-P.LVSSARM------------RRVLDPWALALG---AMVPD-L-------PIF
Q0RF10_FRAAA/1-232--------MPFTL.SHPAA-----VL-P.L.....R------------RVGLPMSAMVAG---SMVPD-V-------PVF
C7R2G7_JONDD/1-241--------MPITF.AHPAA-----VL-P.F.....M------------GGPCVPAALVAG---ALAPD-V-------PYF

PF00882

A0A090C0Q9_ACIBA/1-206--------MPFTI.SHAVI.....AP.P.LAKLSRN............T..LPIAALAIG---SMTPD-L.......YRL
C6RSF9_ACIRA/1-206--------MPFTL.SHAVL.....AP.P.LAKLSGN............R..LPLAALAIG---CMVPD-L.......IRL
B7H911_BACC4/1-208--------MPFTF.AHPAA.....VL.P.FAKKHSK............H..ISVTALILG---SMAPD-F.......EYF
C2XYJ1_BACCE/7-214--------MPFTF.AHPAA.....VL.P.FAKKHSS............Y..ISVTALILG---SMAPD-F.......EYF
B1B9W2_CLOBO/1-214--------MPFTF.AHPAV.....VI.P.CKKKFPK............Y..LNLSALVIG---SMAPD-F.......EYF
C5VRK3_CLOBO/1-214--------MPFTF.AHPAI.....VI.P.FKKQLPK............Y..FNITALILG---SMAPD-F.......EYF
A3I5H3_9BACI/4-213--------MPLTF.AHPAA.....VL.P.FSRKS.K............Y..IHFSALVLG---SMAPD-F.......EYF
Q0SV58_CLOPS/1-213--------MPFTL.AHPAA.....VV...FFKNKK................FNLTALILG---SMAPD-F.......IYF
C6JKD9_FUSVA/1-208--------MPFTF.SHPAI.....IL.P.LKKLPKK............Y..ISMTGLIVG---SITPD-F.......EYF
A1ZM58_9BACT/1-209--------MPFTF.SHPAL.....IL.P.LTYLPKH............W..VSSSALVIG---SLAPD-F.......EYF
C0DX83_EIKCO/1-211--------MPFTL.AHPVA.....VL.P.FARCRR................VHFPAMVIG---SLAPD-F.......VYF
D4DQE9_NEIEG/58-261--------LPFTL.AHPIA.....VL.P.FSRCRY................CHFPALVIG---SLSPD-F.......VYF
C0B3N4_9ENTR/1-204--------MPWTF.SHPSI.....VF.P.IKQSRIG............KY.LNLPALIIG---STSPD-L.......LYS
D4BTR9_PRORE/1-203--------MPWTF.SHPAV.....VF.P.IKQSRFG............HF.LSLPALILG---SLSPD-L.......FYS
Q2LV15_SYNAS/6-198--------AHCLLAREAME..........RFGKSKLF.........PGVLKTKNHFVVMG---ATGPD-Y.......PYL
Q2Y883_NITMU/6-188--------AHLTMVNLVKEPDRLEKQ.G.FPPEAIV............SILDYFRFCELG---AVSPD-Y.......PYL
A7K2D4_VIBAE/6-189--------AHITAVNEASANNALMKL.N.IPQEAKK............ALAQNKRYLELG---CVSPD-Y.......PYL
A4C3L5_9GAMM/6-186--------AHITAVNIATDNNALCGM.N.IPVKAKL............ILSKNQNYLELG---CVSPD-Y.......PYL
C9YFH3_9BURK/6-183--------THITAVNKAKS....LAR.GKLSKESLY............ALGTWFPFAELG---CVSPD-Y.......PYL
Q12DA4_POLSJ/6-186--------AHIAVVNDAQKRADSAGLREDTLVS................LGLYLKYAELG---AVSPD-Y.......PYL
C4XMP3_DESMR/34-221--------AHITLASRCVNPSVLGSL.E.LDTETVG............KLMQQVGYFQLG---AISPD-M.......PYL
E6VSV5_DESAO/6-180--------IHFSIAERTAA.....LL.DGTRLAPC..............LAAERHGLLLG---AVLHD-A.........L
Q2LQI8_SYNAS/6-189--------THWILAEQTWQ.....AM.PDGLLKME..............IRENKALYYLG---AIVFD-TPYYVVTGQNR
B8FCF0_DESAA/6-187--------THWILAREAFR.....RL.KDGEARRM..............IAQNSNLYLLG---AVIPD-T.......PM.
B3E8I7_GEOLS/6-161--------THWWLATEAVK.....QLPLDRTVRQL..............LEEHQSAYLVG---AVLPD-TLLHLVRGPWS
A1AT46_PELPD/6-164--------THWILAERTAQ.....RLAGSGILADI..............IQAHHAAYLGG---AVLPD-TLLHLFRGPHS
C6Y3Y4_PEDHD/24-233--------AHIRINRLAVF.....TL.PAGLNRFY...............KANISYLSDH---AVDPD-K.......RRY
E6U8V9_ETHHY/5-158--------VHLLFARRIHA.....AV.REQIG.................VRLSWSGFLLG---NILPD-L.......SA.
Q1IVJ5_KORVE/32-215--------THQAIIDLAWDDSIRPFLLSRYPNATAE............QLQVAHAYAYGG---CAIQD-M.......GYY
C1F375_ACIC5/44-227--------THESIIDLAWDPAIKPLLLKRYPHTTAT............GLRIAHGYAYGG---STIQD-A.......GYY
Q01WM2_SOLUE/25-208--------THEAIIDSTWDSAIKPLLMKRFPLSSAG............DLTAAHAYAYGG---SIIQD-L.......GYY
Q1ISY5_KORVE/28-210--------THEEVIDLAWDHDIVPLIKARFPDATDD............DLKEAHAYAYGG---AVIQD-L.......GYY
Q025L8_SOLUE/39-222--------THEAIIDTAWDGGIKPLLLKRYPQATKD............DLLEAHAHAYGG---CIIQD-M.......GYY
Y1571_ARCFU/28-204--------THVRMSSEAGN........P.....................YTGFKMEYLSG---SIAPD-A.......GYI
Q01YQ6_SOLUE/23-198--------PHQKITRAALD.....SL.PAKFVNRL..............GPESKLLIDLY---CIYPD-RYQEMAEFGFT
Q8XI18_CLOPE/5-158--------THILIAQNILR.....DV.DVD...................FKISDKNFIYG---NVKPD-M.......VS.
R5X8W2_9CLOT/5-160--------THLTISNALIE.....NL.DSSKS.................FFISEKNFIYG---NIKPD-M.......TS.
B6FWP7_9FIRM/5-161--------THFQIAKSVLE.....NM.DEKKA.................VLISEKNFVYG---NVKPD-A.......FS.
Q18BT1_PEPD6/5-159--------THFIMAKSILD.....NI.DENKT.................FFISEKNFIYG---NIKPD-A.......FS.
D3MTQ6_9FIRM/3-156--------THIILSKSLID.....NT.DKTKQ.................FFLSENNFIYG---NIKPD-I.......VS.
A0A0C2S6D2_CLOBO/4-161--------THKLIAENILN.....NT.NSKSI.................YLINDYRFIWG---NIKPD-C.......VL.
C4IEN4_CLOBU/4-161--------THRLMGENILK.....YA.NSKSI.................YLINKKRFIWG---NIKPD-C.......TP.
A6LQ77_CLOB8/4-161--------THKIMAENIIK.....YA.NTKSI.................YLINNKRFIWG---NVKPD-C.......AP.
B1BFH6_CLOPF/5-161--------THLEIGENTLN.....TI.EGRGR.................NLIDKKSFLKG---NVLPD-I.......SP.
Q97KV3_CLOAB/5-155--------THLLISYIVYK.....NL.YNNFN.................FKLDMAAFALG---NIKPD-F.......IN.
B0P7T6_9FIRM/16-171--------SHITMGRYLYT.....YF.TEQLG.................VELDKASFVSW---NVLPD-V.......AP.
C0ECW5_9FIRM/5-161--------SHMHVSAIIRR.....QL.KSEFG.................IYLPAAVFTYA---NCRPD-F.......SV.
A8MHU0_ALKOO/5-164--------THKIISEHVHS.....NV.KEILG.................VDLNKFNLIYG---SIKPD-I.......AI.
A6TNX7_ALKMQ/5-165--------SHKLISEHIHM.....QV.KETLG.................VELNKNSLIYG---SIKPD-I.......AP.
B2A897_NATTJ/5-148--------SHIHLGRRLSN.....LI.......................EENYENYFILG---NVTPD-F.......AI.
R6RM69_9FIRM/5-161--------SHISLAGQIMD.....SL.RLE.E.................VFDYKLPFYVG---SIWPD-C.......RP.
B0NZS3_9CLOT/15-171--------SHISLAGQIMD.....SM.ELD.N.................VFDYRLPFYVG---SIWPD-C.......RP.
R7D6R4_9FIRM/20-175--------SHILLARYLAD.....QM.PANES.................LQSHRKAFCLG---NILPD-I.......QP.
C6J9X9_9FIRM/5-161--------SHILLARYLAD.....QM.QTTVS.................LQSHRKAFCLG---SILPD-I.......KP.
C6LKS6_9FIRM/5-161--------SHISLARFLVS.....QM.GAD.K.................LQQHRKAFYLG---SILPD-C.......KP.
D4KRQ8_9FIRM/5-161--------SHISLARYIVN.....SL.DDK.E.................LKKHRFSFYIG---SVLPD-I.......KP.
D9SRM2_CLOC7/5-162--------SHVVIANKINR.....DI.ENILG.................ISMNRYSFVYG---SVRPD-L.......RR.
A6LQR0_CLOB8/5-160--------LHGKIGYFLSK.....ELIERGYS.................NIIDSNFFIYG---NVLPD-L.......KL.
B0S165_FINM2/8-177--------THKRIVREINQ.....DI.KDSYG.................INLNIKKLEWG---AVSPD-I.......LP.
D1VUW6_9FIRM/8-182--------THKVIATIIHQ.....RI.KQDYN.................INLNLNKIQWG---SVCPD-V.......LP.
C4IIQ3_CLOBU/5-155--------THFHLAKLSLR.....NL.KPFYP.................KNFSINMFYFG---TILAD-C.......CW.
C4Z638_EUBE2/40-187--------GHVTVTKRLTP.....ML.......................KKRHDFALRLG---SIMPD-I.......LL.
A7VFQ0_9CLOT/5-152--------SHLFVTREIIE.....QV.......................PQNKRKWLLLG---SILPD-I.......LV.
C0EWT7_9FIRM/5-150--------GHLVMTKSLSG.....NI.......................HRAHKAALLFG---SILPD-L.......LV.
R5WI53_9FIRM/5-162--------DHMNLSRYIMD.....HM.DAGAS..................KLQKAAFIFG---SIEPD-I.......NML
D4LBU1_RUMC1/5-160--------DHRLLGSFLLR.....QQ.DIFLD..................PMRKSLFLLG---CVEPD-L.......NPV
Q315K4_DESAG/47-177--------VHMACSEWLFA.....NL.TLLPAGVAT............VISAYESVFRYG---ALSAD-IFIGKGCAVT.
B8DLU9_DESVM/18-149--------VHMVAAHWLLQ.....NA.SLLPAAVGS............ALLNHPDAFLYG---SLSAD-IFIGKGCTVT.
C7LVT1_DESBD/24-155--------VHMAIGNHVLT.....HL.HLLAPAVAA............VLTAHPEQFLYG---CLSAD-IFIGKGSTFT.
C6BUV8_DESAD/29-160--------VHMAIGNAVLS.....NT.MQLSDTVAK............LLLSNSTLFLYG---CLSAD-IFIGKGSKAK.
C8X0X8_DESRD/29-159--------IHVATGNFILE.....NL.RLILPSIAN............TVSAFPQHFLYG---CLSAD-MYVGKGKTLT.
A5G5N0_GEOUR/25-157--------IHLQLGSAVLN.....NL.QALKPAIAA............IIGEFPNDFLYG---CIAAD-ITIGKKFTHY.
E8WRC5_GEOS8/30-162--------VHLQLGMNVLA.....NL.DALKPAVAV............IISAHPYDFLYG---TIAAD-ITLGKKFTHY.
A1AK53_PELPD/24-156--------IHLQVGLHILS.....HP.ELLPAGLAA............LLAAHPLDYLYG---SIAAD-ITLGKKYTHY.
B3EBK7_GEOLS/25-157--------THLLIGLDVLS.....RL.QQLPPQLAT............LLGGYANDFLYG---CLAAD-IIVGKKHTHY.
Q3A306_PELCD/29-161--------VHLQLGSQVLG.....QL.HLLPETLRQ............LLAAHPFDFLYG---CISAD-ITLGKRFTHY.
Q1K0Z2_DESAC/27-159--------VHLQLGNRLLE.....NL.SLLSPALQH............LLTYYSADFLYG---SISAD-ITLGKKYTHY.
C1A8N1_GEMAT/19-151--------THVFLGDAVLG.....NL.SLLPSSLAA............LLSAHPADFLYG---SIAAD-TSIAKKYAEV.
B8J577_ANAD2/33-165--------AHLNFSAQALA.....NL.GVAQPSLRM............VLQDFGNEFLYG---SLAAD-IVVGKNMARY.
D6SRA3_9DELT/26-149--------THTHFAFEILR.....AA.SLLPVAVYS............LLTAYSTNFIYG---SVVAD-YFLG.KPG...
B5YG53_THEYD/20-144--------THAYLSGQIFS.....FS.GLVPAGVLT............IIKLYKEYFMYG---NIIPD-TVFGKKYLPE.
Q1H382_METFK/30-174--------THVYFAHSLLW.....AM.PLLDPRLKR............AISRFPQLVMAG---ACLPD-LAIV.SPR...
C6X6W6_METGS/30-174--------THLYFAHSLLW.....AM.PLLDPRLRQ............AIQRFPELVMAG---ACLPD-LSLV.SPT...
C6WXF1_METML/56-200--------THLYFAQSLLW.....AM.PLLDPKLQN............AIKKFPDLVMAG---ACIPD-LALV.SQP...
D5CMM4_SIDLE/28-177--------THVYFAQMLLW.....AV.PFTDPRYRR............AIKSFPRLVLAG---ACLPD-LALLSEQSWGK
B0SPX5_LEPBP/6-211--------THIEALSQVKK.....HLEHGNATQRKIAN........LLSRPDVASYANLG---AVAPD-I.......FYF
A0A022SYW6_LEPIR/6-211--------THLEVLSQICK.....HLDHGTADQRKIAV........LMRAESNRKFANIG---AIAPD-I.......FYF
C8W7P0_ATOPD/6-209--------VHIAHANRLLE.....KG.AGCLDVDI................QYPDVFLLG---NVAPD-V.......HVG
C5DV22_ZYGRC/30-228--------VHLIYLARVTS.....EL.......................DRKYEPWLKAG---AFFPD-A.......FY.
B5VL45_YEAS6/30-234--------THLFYLTRGAP....LSL.......................KENYYPWLKAG---SFFPD-A.......LY.
C5DKM1_LACTC/24-220--------VHITLLARTKVP..NN.........................LNSFSAVMKAG---VFFPD-A.......LY.
Q6FL70_CANGA/25-242--------SHLTFLLRVISDPSVFEETQLNIN.................SQYYFPWLKSG---AFFPD-A.......LY.
Q6CEF9_YARLI/23-229--------VHLTLLSRTLP.....SLLTHLP..................NQQIDQYLQPG---AFFPD-C.......FYN
C4R8D0_PICPG/19-213--------VHLIASYWTTN....Q.........................LGADLNSLAAG---SFFPD-A.......FY.
Q8R432_MOUSE/28-220--------THVEIGHRALEFLRLQDGRINYKEL................ILEHQDAYQAG---TVFPD-A.......FY.
C3ZWC6_BRAFL/5-194--------THTEIGISTLFSVLSENFQQL....................LLKHQDAFQAG---NVYPD-T.......YY.
A7SED1_NEMVE/31-226--------THIAIAHQALEWFDDQRGNTSYRKI................ILAHQDGFIAG---NPYPD-A.......MY.
D3AZT7_POLPA/38-225--------THNEVARRAFNFSDFKEYPQFQQM.................ILNNLASFQAG---AAFPD-W.......GYS
PLDG_DICDI/29-216--------THNTVARRAYNFSSFDGFEQYQKY.................VSENFDVFDAG---AAFPD-F.......GYD
Q97TF6_CLOAB/60-232--------THEFITVQAMT.....IL.GNDKGNNFK...........NLIKNYEPTLRQY---CDKPD-KDENQWAFAYH
A7B1H2_RUMGN/72-243--------THQYIVANTLK.....ILSNDKGNSAF.............NGELNSSILMEA---TDWPD-K.........L
PHLC_CLOHA/37-230--------THALIVTQAVE.....IL.....KNDVISTSPLSVKENFKILESNLKKLQRG---STYPD-Y.........D
A0PXH4_CLONN/38-231--------THSMIVTQAVK.....VL.....ENDMSKDEPEIVKQNFKILQDNMHKFQLG---STYPD-Y.........D
Q5PXE6_CLOPF/38-231--------THAMIVTQGVS.....IL.....ENDLSKNEPESVRKNLEILKENMHELQLG---STYPD-Y.........D
Q8GCY3_9CLOT/38-231--------THSVIVTQAIE.....ML.....KHDLSKDEPEAIRNDLSILEKNLHKFQLG---STFPD-Y.........D
PHLC_CLOSO/38-231--------THALIAEHGLT.....ML.....NNDLNQNEPKPIKQNIEILNKYLKDLKLG---STFPD-Y.........D
Q6R6B7_LISSE/64-245--------THLWLFNQAEK.....ILAKDVTGAQLDL.........VRELKNYNKEIAQG---IFDAD-H.........K
Q6EAE3_LISMN/64-245--------THYWLFKQAEK.....ILAKDVNHMRANL.........MNELKKFDKQIAQG---IYDAD-H.........K
Q6R6D6_LISIV/62-243--------THLWLFKQARK.....ILAKENNGAYKEL.........LEMLNKYYKEVAQG---IFDAD-H.........K
A0R9W0_BACAH/51-232--------SHLWIVNRAID.....IMSRNTTLVKQDR.........VAQLNEWRTELENG---IYAAD-Y.........E
A5D2J5_PELTS/29-178--------THIFCVQQALE.....IL.........KNDGF...FNQHALLTKHQEFLFRG---VRWAD-K.......GWK
Q896L3_CLOTE/34-205--------VHKFIMLQSLD.....IL.........KNSEH...QEAYNFFKDNLAKLNEG---TTWAD-Q.......DFK
A5N896_CLOK5/34-205--------VHKFIMIQSIA.....IL.........QNDGY...QEEYNFFRKYIKALNAG---VTWAD-Q.......DFK
Q97KA0_CLOAB/34-205--------IHKYINSLAVE.....IL.........KNKRK...AKQYKFFSDNIEAINEG---TVWAD-Q.......DFK
A6TKQ8_ALKMQ/57-228--------VHKFINIQALK.....IL.........RNDGY...AEEYNFFSSYILDINKG---AVWAD-Q.......DFK
O26214_METTH/27-173--------NHHDIAEKVYS.....EM.PEDVR.................NRMSLDEMKNG---ADDPD-T.......VFL
B8I5G2_CLOCE/32-236--------DHKTCVTDAAA.....SV.GITLSPEE..................KVALQFG---SIFPD-E......DEYN
B5HQN8_9ACTN/67-292--------LPFTL.SHAAA.....VL.PAVRTDGTG............RGRLVPAVLVAG---SFAPD-M.......TYY
Q82A31_STRAW/92-336--------LPFTL.SHAAA.....VL.PGVRGDGTG............RGRLVPTVLVAG---SFAPD-M.......TYY
C9YWP6_STRSW/1-225--------MPFTL.SHAAA.....VL.PALRGNGTG............RGPLVPSVLVAG---SFAPD-M.......TYY
B4V801_9ACTN/61-287--------MPFTL.SHAAA.....VL.PAIRRTGRA............RGPLVASALVLG---SFAPD-T.......FYF
D3D9A1_9ACTN/1-206--------MPFTA.SHPAA.....VL.P.LRRLG.................LPMSAMVVG---SMVPD-V.......PVF
A7C3K4_9GAMM/1-217--------MPLTL.SHPAA.....AV.P.LVRWG.................LVLSALVVG---SMSPD-F.......LYF
B9XK96_PEDPL/41-256--------MPLTI.AHPAI.....VI.P.IRHR..................LVLSALMIG---SMAPD-F.......SKI
D9T3L8_MICAI/1-213--------MPLTFPSHLAP.....VL.P.LKLWRPG............W..FDGVALCTG---AVAPD-V.......AYL
C1ACE2_GEMAT/1-206--------MPATILSHQAL.....VL.P.LKMRWPH............R..FSGLALCIG---SMAPD-L.......EFI
C0VQ51_9GAMM/1-206--------MPFTL.SHAVL.....AP.P.LSKLSKG............H..LPIAALAIG---CMTPD-L.......YRL
D0SL80_ACIJU/1-206--------MPFTL.SHAVL.....AP.P.LSKLTKG............H..LPIAALAIG---CMTPD-L.......YRL
D0SG75_ACIJO/1-206--------MPFTI.SHAVL.....AP.P.FAKLSGD............R..LPIAAIAIG---SMTPD-L.......YRL
D0SS47_ACILW/1-206--------MPFTL.SHAVL.....AP.P.ISYLTGN............R..LPVAALAIG---SMVPD-L.......HRL

PF02265

ENDO2_ARATH/28-290----WGKEGHEIICKIAQT-----RL.DETAAKAVKELL.PE........SA.EGDLSSL---CLWAD-R-------VKF
ENDO5_ARATH/21-288----WGKDGHYTVCKLAEG-----FF.EDDTIAAVKKLL.PE........SVDGGGLADF---CSWPD-E-------IKK
A4H6V5_LEIBR/29-297----WWDKGHMSIAEIARR-----NL.NPDVLEKVQACA.TALNE.VGPFPK.STNIVEL---GPWAD-D-------LKS
Q8F3Z8_LEPIN/21-283----WGWEGHRTIGIIAQQ-----LLINSKKFDPINDIL.GD............LTLEQI---STCPD-E-------LKA
B0T6T3_CAUSK/23-287----WGRTGHAVVAQIARG-----YL.TPKAAAAVDALL.AADT....DALT.PPDLAAR---ASWAD-A-------WRK
F2G2Z7_ALTMD/28-265----WGQTGHRVTGAIAEQ-----YL.SPLSQAALMELL.PH............GSLAEA---STHAD-E-------MRS
Q66VY6_LEIMA/29-300----WWSKGHMAVALIAQR-----HM.DPKLVKKANAAA.KVLSLAGPFPKS..PDMVQL---GPWAD-D-------LLE
Q7S8Q5_NEUCR/20-297----WGKLGHATVASVAQQ-----YL.TPNTVKQVQTIL.GD........NS.TSYMGNI---ASWAD-S-------FRY
Q5KPJ8_CRYNJ/20-279----WGAAGHEMVATIAQI-----HL.FPSTRAKLCSIL...P......EEA.NCHLAPV---AAWAD-.-------IVR
Q236I4_TETTS/18-296----WWDGGHMMTAEIAKQ-----EI.LARNATLYEQIE.KYVTILNPLCDARSQDFVQA---ASWAD-D-------IKD
Q4DEV4_TRYCC/28-293----WWCNGHMLVNEIARR-----RL.HPEVALIVEEAA.VNLSASGPFPHT..TDFVES---GCWAD-D-------IKK
Q0CD39_ASPTN/21-282----WGDVGHRTVAYVAEN-----YL.TEDGSKFLDNLL.PF........SN.NFDISDA---ATWAD-E-------QKR
Q2SFD4_HAHCH/50-295----WGELGHRVVCDVAWK-----EL.SPVARDQVQKLL.QQ........AG.KRTFAEA---CLWPD-Q-------VRS
Q585P6_TRYB2/27-292----WWDFGHMVVAEIARR-----NL.DNDVARVVETYI.QHLSESGPFPNI..PDFVQS---ACWPD-D-------LKR
Q989R8_RHILO/21-270----WGPEGHSIVAEIAQR-----RL.SSTALMEVKRIL.GG.......E....VAMASV---ASWAD-D-------VRY
ENDO1_ARATH/29-294----WSKEGHILTCRIAQN-----LL.EAGPAHVVENLL.PD........YV.KGDLSAL---CVWPD-Q-------IRH
A4CQ68_ROBBH/22-257----WGRTGHRAIGEVAEA-----HL.SRRARKAVSRLL.EG............ESLAKV---STFGD-D-------IKS
A3U8L7_CROAH/33-268----WGKTGHRAVGEIASK-----HL.NRKARKAIKDIL.DG............TSLAEV---SIYAD-E-------IRS
A7H7R9_ANADF/28-274----WSEPGHRIVAAIAEE-----RL.GPSARRLVREVL.GAT......P....MSNADV---AGWAD-A-------QRD
Q7P202_CHRVO/23-274----WGQEGHRITGYIAQQ-----LL.SSKAKAEVKKLI.PN............ADFAQL---ALYMD-Q-------HKQ
A0BML4_PARTE/16-293----WWDVGHMMTAQIAKN-----HL.RENRPDVLAWAD.SLIQDLNPLTDGKSNTFAEA---AVWLD-D-------IKE
A7EWS3_SCLS1/21-282----WGTLGHETVAYIATN-----FV.SASTKSYFQGIL.GD........ST.TDYLASV---AAWSD-S-------YRY
Q3IBZ8_PSEHT/27-268----WGQNGHRIIAKIAES-----HL.SETTKTKLLPLL.NN............ESLAQV---STWPD-E-------MRS
A7ETG5_SCLS1/21-277----WGTLGHQTVAYVATN-----FV.AESTRDYFQMLL.RN........DT.GSYLAGV---ATWAD-S-------YRL
A0M3W8_GRAFK/24-260----WGKTGHRATAEIAET-----HL.SNKAKNAIDGLL.GG............HGLAFV---ANYAD-D-------IKS
A0BLJ0_PARTE/422-699----WWEVGHMMTAQIAKN-----YL.RDNRPDVLAWAD.SLVQDFNSLTDGKSNTFAEA---AVWLD-D-------IKE
A4HJL3_LEIBR/28-299----WWSKGHMAVALIAER-----HM.EASLVEKGNLAA.KVLSLSGPYPQS..PDMVQA---APWAD-D-------LKK
Q0TYV6_PHANO/20-284----WGSLGHTTVAYIAQN-----FV.SGKTTKFAQRLL.ND........TS.GAYLANV---ATWAD-S-------YRS
ENDO3_ARATH/25-286----WGDAGHYAVCKIAQS-----YF.EEDTVVAVKKLL.PE........SA.NGELAAV---CSWPD-E-------IKK
Q0AMT2_MARMM/26-282----YGPDGHRIVCDLAWR-----YL.SDETRTEIDRLV.AQ........DPEFDHFRDV---CSWAD-D-------VRG
Q4Q7F3_LEIMA/31-295----WGCVGHMLLAEIAHR-----QL.NDENKEKLDAMA.HAFAQSGPFESS..PDMVQA---ACWAD-D-------VKR
Q5NRA3_ZYMMO/33-298----WGMEGHEAIAALAWK-----YM.TPTTRKKVNAIL.AMDHD.RLTE....PDFMSR---ATWAD-K-------WRS
A5V871_SPHWW/21-280----WWEYGHETVATIAMQ-----SV.RPDTRQAIRRLL..ARSDLLETPTCPARTIEQA---SVWAD-C-------VKT
Q5FP59_GLUOX/25-298----WGPYGHAIVADIAQE-----RL.TPQAQKAATALL.ALE.....NH....QTLDQV---ASWPD-T-------IGH
Q0UA95_PHANO/19-289----WNTDG.....FMAET-----FF.TPKTTSILSQIL.ES........QY.NESVGRA---AAWAD-G-------YAH
NUS1_ASPOR/21-284----WGNLGHETVAYIAQS-----FV.ASSTESFCQNIL.GD........DS.TSYLANV---ATWAD-T-------YKY
A4HI96_LEIBR/31-295----WGCTGHMVLAEIARR-----QL.DPSNEKKIQAMA.MKFKESGPFLLS..PDMIQA---ACWPD-D-------VKR
Q7XPN4_ORYSJ/27-283----WGKEGHYMVCKIAEG-----FL.TKEAATAVKELL.PG........WA.GGELAET---CSWAD-T-------ER.
Q01U80_SOLUE/19-261----WGPEGHSLIARLAAA-----RL.TPAAAAKVAEILGPG............NTLASI---SSWAD-S-------VRR
A2QX99_ASPNC/21-292----WGDVGHRAIAYLAEK-----YL.TVAGSNLVNELL.AN........DK.NYDISDA---ATWAD-T-------IKW
A2TWS6_9FLAO/25-260----WGKTGHRVTGKIAEK-----HL.TKKAKRKIDKLL.KG............QSLAFV---STFAD-E-------IKS
Q2UHT0_ASPOR/21-283----WGDVGHRTVAYIAEH-----HL.TKEGIGLLNDLL.PK........KH.GFDVSDA---AVWPD-H-------IKH
Q2H4S7_CHAGB/217-488----SGSFGHITVGYLASA-----FV.SPATTTYLQTLL.RN........DT.AEYLAGV---ATWAD-S-------IRY
Q15ZB2_PSEA6/20-256----WGQIGHRVTGAIAQQ-----HL.TPQAQAAISALL.PT............EDLAEA---STYPD-E-------MRS
A4I736_LEIIN/27-297----WWSKGHMSVALIAKR-----HM.GASLVEKAELAA.KVLSF.SGPYPK.SPDMVQT---APWAD-D-------IKT
B2FSF8_STRMK/27-269----WGAQGHRLVAEVADA-----RL.NPTARAEVDRLL.AT........EP.DATLASI---APWAD-Q-------LRA
G3XKQ7_SOLLC/26-290----WSKEGHVMTCRIAQG-----LL.NDEAAHAVKMLL.PE........YV.NGDLSAL---CVWPD-Q-------VRH
I1KHQ2_SOYBN/27-290----WGDDGHVIVCKIAQA-----RL.SEAAAEAVKKLL.PI........SA.GNDLSTK---CSWAD-H-------VHH
I1MEB5_SOYBN/33-297----WSKEGHVMTCQIAQA-----LL.EPEASEAVYQLL.PD........HV.KGNLSAL---CTWPD-Q-------IRH
I1PPP5_ORYGL/30-294----WSKEGHMLTCRIAQD-----LL.EPAAAHAVRNLL.TE........EA.DGDLSAL---CVWPD-Q-------VRH
M7YSG5_TRIUA/24-280----WGKEGHYMTCKIADG-----FL.TKEALAGVKALL.PS........SA.NGELAEV---CSWAD-T-------QRF
Q1K6E5_NEUCR/21-291----WGGFGHITVAYVASN-----FV.SNSTASYFQTLL.RN........DT.SDYLANV---ATWAD-S-------IRY

PF09988

Q8YZE9_NOSS1/2-166----------------------------------------------QYQRWG-VLRWIWLPYQK----------------
K9TIP1_9CYAN/2-166----------------------------------------------QFQRWG-WLRWIWLPYQQ----------------
B2VAC8_SULSY/2-161----------------------------------------------PNSRWK-ILKFIWLPYTK----------------
A5UV55_ROSS1/2-173----------------------------------------------IDNRWG-FFFWIWRPYMW----------------
K9VXZ1_9CYAN/2-166----------------------------------------------QFIRWG-WFRWIWIPYQK----------------
K9X512_9NOST/2-158----------------------------------------------QFQRWG-FLRWIWLPYQR----------------
Q10Y23_TRIEI/2-165----------------------------------------------QFQRWG-WFRWLWRPYQT----------------
K9R5N7_9CYAN/21-185----------------------------------------------QYQRWG-YFRFIWLPYQK----------------
Q7U3L4_SYNPX/2-155----------------------------------------------ALRRWG-PLRGLWWPYRR----------------
K9UM54_9CHRO/2-166----------------------------------------------HYKRWG-ILRWLWRPYQQ----------------
D7CX68_TRURR/2-172----------------------------------------------..NNWG-LLGLLWVPYGA----------------
K9S824_9CYAN/2-177----------------------------------------------QFLRWG-LLRWLWLPYQR----------------
U5QDG6_9CYAN/2-166----------------------------------------------QYRRWG-PLRWLWLPYRR----------------
Q9RT76_DEIRA/5-173----------------------------------------------..RRWG-PLGFLWVPYGR----------------
B1XNI7_SYNP2/2-167----------------------------------------------QFKRWG-IFRWIWLPYQK----------------
K9YHE6_CYASC/3-166----------------------------------------------QFKRWG-YFKFIWLPYQK----------------
K9U5M5_9CYAN/2-166----------------------------------------------QYQRWG-YARWIWIPYQK----------------
K9XH03_9CHRO/2-166----------------------------------------------QYQRWG-YLRWIWRPYQK----------------
B7KDH5_CYAP7/2-167----------------------------------------------QFQRWG-KLRCIWIPYQK----------------
D7DZB9_NOSA0/2-166----------------------------------------------QFQRWG-FLRWIWLPYQK----------------
K9VNR5_9CYAN/2-166----------------------------------------------QYQRWG-WFKPIWLPYQK----------------
A9B0N7_HERA2/2-170----------------------------------------------PYNRWG-PLRFIWWPYRE----------------
Q8XL51_CLOPE/2-170----------------------------------------------EFRRWG-YLKFIWIPYQK----------------
G2LLI8_CHLTF/2-174----------------------------------------------QYTRWG-ILRWLWYPYKK----------------
E4UAQ6_OCEP5/2-167----------------------------------------------PARLWG-WLRLLWIPYGR----------------
B1X0E2_CYAA5/2-167----------------------------------------------QYKRWG-MIRWIWLPYQS----------------
Q7NFX0_GLOVI/2-166----------------------------------------------QYRRWG-LLRWIWLPYRR----------------
K9Z9T5_CYAAP/2-167----------------------------------------------QFQRWR-FFRFIWLPYQK----------------
L0A273_DEIPD/2-163----------------------------------------------..RAWG-FLGALWVPYGL----------------
K9WE31_9CYAN/2-166----------------------------------------------PFKRWG-WLRWIWIPYQK----------------
K9V8T7_9CYAN/2-166----------------------------------------------QYQRWG-WLRWIWLPYQK----------------
Q7V3X6_PROMM/2-159----------------------------------------------PLKRWG-LLQGLWWPYRK----------------
B8HTG8_CYAP4/2-166----------------------------------------------QYRRWG-WLRWIWLPYQK----------------
C1CV84_DEIDV/5-166----------------------------------------------..RHWG-VLGVLWVPYGM----------------
Q31N47_SYNE7/7-176----------------------------------------------QSQRWG-PLRWIWTPYQR----------------
S0EUE8_CHTCT/2-170----------------------------------------------EYRRWG-PLRFIWWPYRV----------------
E0U8U0_CYAP2/2-167----------------------------------------------QFQRWG-KLSIIWLPYQK----------------
D3EPX6_ATETH/2-167----------------------------------------------QYKRWG-IGRWIWLPYQY----------------
C0QT82_PERMH/2-161----------------------------------------------PNRRWG-FLRFVWYPYTK----------------
Q2JJ24_SYNJB/2-166----------------------------------------------QYQRWL-FLCWIWLPYRK----------------
B7K2N6_CYAP8/2-167----------------------------------------------QYNRWG-IIRGIWLPYRF----------------
K9Q2E8_9CYAN/2-167----------------------------------------------QFKRWG-MFRWIWLPYQK----------------
A9WA62_CHLAA/2-176----------------------------------------------IDNRWG-IFFWIWRPYMW----------------
H8GTR8_DEIGI/2-163----------------------------------------------..RRWG-VLGFLWVPYGR----------------
K9XZT4_STAC7/2-167----------------------------------------------QFKRWG-LFRSLWLPYRY----------------
B2IUE8_NOSP7/2-166----------------------------------------------QFQRWG-FLRWIWLPYQK----------------
E8UBR4_DEIML/2-163----------------------------------------------..RYWG-ILGFLWVPYGM----------------
K9QIC8_9NOSO/2-166----------------------------------------------QYQRWG-YLRWIWLPYQK----------------
B0JHJ8_MICAN/2-166----------------------------------------------QYKRWG-YLRWLWLPYRS----------------
K9RQ06_SYNP3/2-166----------------------------------------------PYQRWG-WLRWLWWPYQR----------------
D7BE64_MEISD/2-161----------------------------------------------..GNWG-VLGWLWVPYGL----------------
A5GPK9_SYNPW/3-163----------------------------------------------ALKRWG-PLGWIWRPYRT----------------
Q81WY4_BACAN/2-155----------------------------------------------AYNKWG-FLRIFWYPYKK----------------
W6FU87_NODSP/2-166----------------------------------------------QFQRWG-FLRCIWRPYQK----------------
B4UA61_HYDS0/2-160----------------------------------------------PSKRWK-ILKWFWHPYRI----------------
K9T9J7_9CYAN/2-167----------------------------------------------QYKRWG-KLRWIWKPYQS----------------
F0RKU1_DEIPM/12-173----------------------------------------------..RNWG-FLGPLWVPYGM----------------
F2NN18_MARHT/2-164----------------------------------------------..RYWG-VLGWLWVPYGL----------------
K8GJ34_9CYAN/2-177----------------------------------------------QYRRWG-VLRWIWLPYRR----------------
D3PMR5_MEIRD/2-165----------------------------------------------..GRWG-WMGWLWVPYGW----------------
B0CCR6_ACAM1/2-165----------------------------------------------QYKRWG-WLRVIWLPYRK----------------
Q8DM71_THEEB/2-162----------------------------------------------PYYRWG-WLRIIWLPYQK----------------
P72876_SYNY3/2-165----------------------------------------------QYKRWG-WLRWVWLPYRH----------------

PF04307

Q18EP1_HALWD/1-158----------------------------------------------KPVSYANLTPW.......................
Q65F12_BACLD/1-155----------------------------------------------TKSKIGRRLPILSAVVSS................
Q0W2I6_METAR/1-181----------------------------------------------VFHRFSDRDPRLYIF...................
Q1AT01_RUBXD/1-176----------------------------------------------PRSRLGNGLSRMRSPALNLLSRPLSWA.......
Q7MS32_WOLSU/1-175----------------------------------------------PNSTLGRQLPLLSSLFHR................
Q8D1W8_WIGBR/1-169----------------------------------------------PGSFLGKKLNWISIPISK................
Q5WIF9_BACSK/1-182----------------------------------------------TVLKLKNNAIYIRH....................
Q2NV14_SODGM/1-168----------------------------------------------PKSFLGQRLKWLSIPIAK................
A0LXF8_GRAFK/1-182----------------------------------------------FIGNFFDTITSIEI....................
Q01PN8_SOLUE/1-175----------------------------------------------AMLGFGIPRGTLLS....................
Q0W4H6_METAR/1-165----------------------------------------------GEYIFHSVFNN.......................
YFHP_BACSU/1-182----------------------------------------------TVLKLKNNAVYIRN....................
Q5FTT4_GLUOX/53-213----------------------------------------------ERSMLGSRLKFLSRFLAK................
Q726Y1_DESVH/1-173----------------------------------------------.IFFGSSAIDYLTI....................
C1DQI7_AZOVD/1-180----------------------------------------------VLIDYGDAVANMTR....................
Q8ETE4_OCEIH/1-155----------------------------------------------GGSKIGRRFPILSNIINA................
Q5FK20_LACAC/1-175----------------------------------------------YNSTTSRKSPINFSLF..................
A4XRV7_PSEMY/1-180----------------------------------------------VVIDYGDAVGNMTY....................
Q2N9Y9_ERYLH/13-204----------------------------------------------ACFFWLEGAEHLGF....................
Q023X2_SOLUE/1-190----------------------------------------------LVTMAGGPLNYLHY....................
A9AVQ5_HERA2/1-166----------------------------------------------ISFWLDMPRGTLLS....................
Q7VVQ6_BORPE/1-180----------------------------------------------VLMRYPDPVSLMTY....................
A6LWG2_CLOB8/1-169----------------------------------------------GNSYIGKKTKGVSKAINK................
A3CRK4_METMJ/1-159----------------------------------------------GHIVLAGTLGY.......................
A1TRR8_ACIAC/1-179----------------------------------------------ALIDRGDPIANMVQ....................
Q3J7C8_NITOC/1-183----------------------------------------------ILRWTTDLLTYLNL....................
Q8CV62_OCEIH/1-182----------------------------------------------TVFKLKNNATYIRH....................
A0JUC0_ARTS2/1-250----------------------------------------------RHSTVANSLPPLSNVIAVRI..............
A1WTH1_HALHL/1-183----------------------------------------------LGLVIADSLVYYNL....................
Q5V391_HALMA/1-161----------------------------------------------..KPLAYELHLIPS....................
Q97K38_CLOAB/1-212----------------------------------------------SRSKVSYNLRKIVVYAALVIVGAYILMANFYPEV
Q1WSF6_LACS1/1-169----------------------------------------------PSSYLGKRHKMVSGVTNK................
Q0ACJ1_ALKEH/1-184----------------------------------------------FLLRVLDPLVYLNL....................
Q7N3N6_PHOLL/1-166----------------------------------------------PNSTLGRLFRFISIPIAK................
Q9KEC4_BACHD/1-182----------------------------------------------TILKLRNNAVYIRN....................
Q1D144_MYXXD/1-188----------------------------------------------TLLARGDAVTVALQA...................
Q2JB37_FRASC/1-225----------------------------------------------PHGRIANTFGPVTRVMCRWI..............
Q12UG8_METBU/1-174----------------------------------------------GRLFFEEIFAN.......................
A8GDN5_SERP5/1-166----------------------------------------------PKSVLGQRLRWIAIPISR................
Q5V568_HALMA/1-273----------------------------------------------VYAPFGLLVGAAENLTADGFW.............
Q1ATT6_RUBXD/1-170----------------------------------------------PKSWLGHQLGGVSEDLYR................
A4J2S9_DESRM/1-180----------------------------------------------PGSYSGRMMRPLAVWLEE................
Q8TQH1_METAC/1-199----------------------------------------------VSSSLTHESRNQLFYL..................
Q6D4I1_PECAS/1-166----------------------------------------------PKSVLGQRLKWLSAPIAR................
Q82XH5_NITEU/1-183----------------------------------------------VVLRLIDTLTYLNW....................
Q6YRT9_SYNY3/1-188----------------------------------------------STSPAGRILPFISRPLEQ................
Q5HM58_STAEQ/1-158----------------------------------------------TQSKIGRRFRLTSFFVRI................
Q8TP13_METAC/1-172----------------------------------------------GEIIFASTFSS.......................
Q0JZE4_CUPNH/1-185----------------------------------------------FLGFLVHPLRFLAQW...................
Q97LP7_CLOAB/1-199----------------------------------------------PKGMLNQYILPIKSKFIKTLFYGSFGALVVFGNY
A0PYB1_CLONN/1-199----------------------------------------------PKSIINKYILPFKNKKTKTAVYLALAVIVLYSDY
Q9KE25_BACHD/1-180----------------------------------------------.GLLFNDGEAYLRI....................
Q3JF51_NITOC/1-164----------------------------------------------PTSKLGRVLFWLSTRLEK................
A1K1W5_AZOSB/1-183----------------------------------------------YLLGYVSELTYLRG....................
Q6AMI9_DESPS/1-207----------------------------------------------LFTSISLIIPALMLSLIQQERQPTPEFLFLYFF.
Q7NV83_CHRVO/1-166----------------------------------------------PKSWLGRRIPFLSRPISY................
Q47U11_THEFY/1-250----------------------------------------------PSSTATRSQGFVTGLLSRGMRALSLAVY......
Q47RB2_THEFY/1-227----------------------------------------------KSATITKTYGVFTETLGAFF..............
Q1QZR4_CHRSD/1-181----------------------------------------------VVIDYGDAVADYTY....................
Q5P1U0_AROAE/1-192----------------------------------------------FVLGYVSDIAYLRG....................
Q0BSQ9_GRABC/13-169----------------------------------------------PKSWVGQRLGGLSIALSK................
Q5L2T9_GEOKA/1-182----------------------------------------------TIFKLRNNAQYIRN....................
A5CZD2_PELTS/16-203----------------------------------------------PGSYAGQRLRLLACWLEE................
Q2S300_SALRD/1-182----------------------------------------------LANPFLTELQALTM....................
Q1DD75_MYXXD/1-235----------------------------------------------GLVTLAGSDASLYW....................
A0KFP7_AERHH/1-165----------------------------------------------PRSVLGQRLPWISKPLSR................
Q0VLL6_ALCBS/1-174----------------------------------------------VLIDYGDAVVNFTE....................
Q3A0M8_PELCD/1-203----------------------------------------------LKSIVGVLVVGAVVADSVRRGLPMPEIAARSG..
Q186I4_PEPD6/1-177----------------------------------------------RGSYISKKFMLIYKLFGS................
Q2L2L1_BORA1/1-180----------------------------------------------VLIRYPDPVSSMTY....................
Q67R78_SYMTH/1-176----------------------------------------------LSFLLRRGIQL.......................
Q97MS7_CLOAB/1-166----------------------------------------------GAFFFRNVF.........................
A6TSU9_ALKMQ/1-172----------------------------------------------IMTRIKGDYVYLKH....................
A6TMK4_ALKMQ/1-249----------------------------------------------GTSSLAGKFGLLKAKHIKKIWIAILTTLSIGTLF
A3CVA2_METMJ/1-183----------------------------------------------GHILLAGTLNS.......................
Q9KAZ8_BACHD/1-159----------------------------------------------PRSMVGRALPVVSTVLLR................
Q0S8N5_RHOJR/1-250----------------------------------------------SQSTVARSFGPVSSVVAKGVDAVSLAFY......
Q1IHJ9_KORVE/1-205----------------------------------------------FAWLLKSRTVYFAH....................
Q890Y4_CLOTE/1-199----------------------------------------------PKSMINKYILPFKNKFTKVIMYICIGIILLWYSI
Q0RHF1_FRAAA/1-228----------------------------------------------PNGRIANTLGPVSRTICRWV..............
Q1MS87_LAWIP/1-199----------------------------------------------.ILFVSSAIDYIKV....................
Q11P46_CYTH3/1-219----------------------------------------------FDSTIGKWLHLKHTGMEIYF..............
A6LXK9_CLOB8/1-172----------------------------------------------GAGVFRSVF.........................
Q2VZJ9_MAGSA/1-159----------------------------------------------PSSWLGRRLWPISKPISM................
Q5YVJ3_NOCFA/1-233----------------------------------------------PKGTLAHVLGPLSYFACKII..............
Q8FRV6_COREF/1-249----------------------------------------------PSATVSRSFGPVTQVISRFTENIAQTFV......
A0KMD3_AERHH/1-197----------------------------------------------LAFKLGVAYGHVFG....................
Q3JEV9_NITOC/1-176----------------------------------------------FIRSPDDPLLVLEY....................
Q9CNK9_PASMU/1-180----------------------------------------------VFIRYADPISSMTY....................
A1U6Q1_MARHV/1-174----------------------------------------------VVIDYGTAVANFTQ....................
Q7NWB9_CHRVO/1-187----------------------------------------------VTFKLGIPYASPWG....................
O29079_ARCFU/1-168----------------------------------------------PHSYISKSYWGVFSGAIL................
Q1MQD9_LAWIP/1-155----------------------------------------------RTFAMGNKQQWRRI....................
Q5WH30_BACSK/1-157----------------------------------------------THSKIGRRFPVLSKTIAT................
Q1GSW3_SPHAL/1-193----------------------------------------------ACLFWLEGVQHLGF....................
A3CTE7_METMJ/1-243----------------------------------------------DAAIFNGKIAGAKGKRGQVVNGFAVVLPIFGYTI
YVSG_BACSU/1-155----------------------------------------------TQSKIGRKFPILSKVVSS................
B1W5J1_STRGG/1-256----------------------------------------------KSATISRAFGPLSKGLCEIADKLSYAVY......
B2FPD0_STRMK/1-181----------------------------------------------LGFTAADPVANMIE....................
Q5ZZH0_LEGPH/1-172----------------------------------------------FIRFSQEPL.SLEQW...................
Q6LSY8_PHOPR/1-173----------------------------------------------VLIGYGDPVSDMVK....................
Q74JJ2_LACJO/1-173----------------------------------------------YNSSASKKSVINFSLF..................
Q7CIV6_YERPE/1-162----------------------------------------------PKSILGQRLKWVSVPIAR................
Q7CJI4_YERPE/1-166----------------------------------------------LAFKFGVAYGHAFG....................
Q81YV9_BACAN/1-179----------------------------------------------TVLKLRNNAKYIRN....................
Q8Y6J4_LISMO/1-176----------------------------------------------TVLKLKNNADYIRN....................
Q9HUK3_PSEAE/1-165----------------------------------------------VAFKLGIAYHDAFG....................
Q9RMV6_BACAN/1-156----------------------------------------------QHSWIGRRTRGVSDLMNT................
U5L8V8_9BACI/1-175----------------------------------------------TVLKLRNNAVYIRN....................

PF13803

C7QBS6_CATAD/1-242.............AGAFGV--------------------GDL----AHT-WA-AVPTLDLGIAF----------------
C0ZEY0_BREBN/1-241.............FRMQPF--------------------SVY----SHT-ML-GLWVVDLPIAI----------------
K9WR57_9CYAN/1-241.............LTLQPT--------------------RTI----GHT-LL-GVLIQGLPCSI----------------
D3EE91_GEOS4/1-236.............VRFRAA--------------------GVW----GHE-GP-GILLFNLPMIL----------------
X2GTZ3_9BACI/1-237.............LRGQPK--------------------GEI----GHT-FM-GFITFNLPLVA----------------
F8A675_CELGA/1-236...VRLPRSADAWYEPFVN--------------------ATT----THA-WP-GALTVAVPSAA----------------
Q1IN38_KORVE/1-247.............FFMSYD--------------------SRS----WHH-YP-DLYRYCFPFLF----------------
D2Q1R3_KRIFD/1-251...DPLYDLATRQIHGSFT--------------------LTL----THQ-FT-SALWLNPLLAL----------------
A6GZ02_FLAPJ/1-235.............LRMRIK--------------------SNY----SHT-IG-GLFCFDLLLGL----------------
D3V1B0_XENBS/1-240.............VGLYDV--------------------ATV----AHH-LP-GWFYTAFPLCL----------------
Q899W6_CLOTE/1-232.............ILFNPS--------------------SNL----GHT-FL-GFLFLNLPLCY----------------
G0FWC1_AMYMS/1-228..............VPIPG--------------------GAL----THE-PA-GLVSVDLLLGL----------------
C2X225_BACCE/1-236.............LHFRPY--------------------GVI----GHT-WL-GFLYLNLPLVF----------------
Q8XML2_CLOPE/1-242.............LNFRPY--------------------GNL----GHQ-IL-GFFILNLPLCI----------------
A0Q1Y2_CLONN/1-242.............LRFMPK--------------------GTI----GHT-LI-GSICFDIPLVI----------------
I0E062_PROSM/1-239.............FGLYQI--------------------AAQ----AHH-VV-GWFYTGLPICL----------------
Q6FEH5_ACIAD/1-242..............FTNAS--------------------LTI----SHE-WS-GMIVPNLLVGL----------------
H1YCR9_9SPHI/1-235.............FRMKVY--------------------SIY----SHT-WL-GLLWFDVPVAM----------------
I4B9J2_TURPD/1-232.............LRAQLT--------------------STI----SHT-VL-GQFIFCLPIGI----------------
K4IBC3_PSYTT/1-233.............LRMRIR--------------------SDY----SHT-ID-GLFWFDLPLGL----------------
H2JVD3_STRHJ/1-251........AAGVLPGGMEF--------------------GSV----THA-FT-GVVTVDVLITW----------------
A5I0I6_CLOBH/1-248.............IRFKAM--------------------ATI----GHG-LI-GFFLYNLPLCF----------------
Q65Q39_MANSM/1-229.............LHWK.T--------------------DVG----GHT-LF-GSEWVNLPLCL----------------
F4FE12_VERMA/1-233MYRADGPGFPD........--------------------...----THT-WP-ALVWWCLPVAL----------------
C6D3J1_PAESJ/1-240.............VRLEPY--------------------QSI----GHT-AA-GLFLQVIPLSL----------------
A3HWD2_9BACT/1-236.............LQLKLS--------------------ENI----GHK-IT-GIFLFDLPVAF----------------
Q7UP84_RHOBA/1-249.............FPMLFD--------------------YES----FHS-IR-GLFIDCVPVGV----------------
A8L7F5_FRASN/1-232.............LGWSAM--------------------YHL----SHS-LL-GVVTFVPLLSL----------------
D2ARI2_STRRD/1-246..........LSFLPFLPD--------------------YMT----WHS-YR-GVLTIAPLAVV----------------
Q0RF10_FRAAA/1-232.............FGWPEF--------------------YRL----THS-LL-GVVTVAPVLSL----------------
C7R2G7_JONDD/1-241LRALRIPVSAQSWWEPFLN--------------------ATT----THN-WP-GALIITIPLAF----------------

PF00882

A0A090C0Q9_ACIBA/1-206-------------FT...................MQS..GML----THQ.WK-GLFYPNLALGL----------------
C6RSF9_ACIRA/1-206-------------FV...................ADA..AGY----THQ.WA-SILHPNLWIGL----------------
B7H911_BACC4/1-208-------------LH..................FRPY..GVI----GHT.WL-GFLYLNLPLVF----------------
C2XYJ1_BACCE/7-214-------------LY..................FRPY..GII----GHT.WA-GFFYLNLPLVF----------------
B1B9W2_CLOBO/1-214-------------LR..................FMPK..GTI----GHT.LL-GSIWFDIPLVI----------------
C5VRK3_CLOBO/1-214-------------LR..................FKPI..GEM----GHT.SL-GVFYFDLPIVF----------------
A3I5H3_9BACI/4-213-------------LR..................GRPI..GEI----GHT.FA-GFFLFNLPLVL----------------
Q0SV58_CLOPS/1-213-------------LN..................FRPY..GNL----GHE.IL-GFFILNLPLCI----------------
C6JKD9_FUSVA/1-208-------------L....................RMK..SKY----SHT.IS-GILWYDLPMGI----------------
A1ZM58_9BACT/1-209-------------LR..................MRIN..SQY----SHT.IQ-GLLWFDLPLGL----------------
C0DX83_EIKCO/1-211-------------LH...................GRA..VPG----GHS.LA-NLLWPNLPLCF----------------
D4DQE9_NEIEG/58-261-------------LH...................GRA..VSG----GHG.LA-DMLWPNLPLCF----------------
C0B3N4_9ENTR/1-204-------------FG..................LYQS..ATT----AHG.LL-GWFYTAFPFC.----------------
D4BTR9_PRORE/1-203-------------MM..................WYSA..ATT----AHD.LI-GWLYTGLPLC.----------------
Q2LV15_SYNAS/6-198-------------TDVMKYG.........VLHIGHNW..ANR----MHY...-...........----------------
Q2Y883_NITMU/6-188-------------DIAH..............SSAGQW..ADR----MHY...-...........----------------
A7K2D4_VIBAE/6-189-------------ALMN..............SAQNKW..ADK----MHY...-...........----------------
A4C3L5_9GAMM/6-186-------------AVGH..............SEQNKW..ADL----MHY...-...........----------------
C9YFH3_9BURK/6-183-------------GGP................GQGYW..ADQ----MHY...-...........----------------
Q12DA4_POLSJ/6-186-------------TLKQ...............GQKKW..ADA----MHY...-...........----------------
C4XMP3_DESMR/34-221-------------VGLGT............NKQAIAW..ADR----MHW...-...........----------------
E6VSV5_DESAO/6-180-------------FYATPP..........GGAPLERL..AHR----LHG...-...........----------------
Q2LQI8_SYNAS/6-189-------------SN..................LLAA..AQR----LHG...-...........----------------
B8FCF0_DESAA/6-187-------------..........................YAL----ENT...-......EEF..----------------
B3E8I7_GEOLS/6-161-------------DT..................ALQL..AQR----FHE...-...........----------------
A1AT46_PELPD/6-164-------------AT..................ALHL..ADR----FHD...-...........----------------
C6Y3Y4_PEDHD/24-233-------------ADTAEAAR.......HYLDVELYEAHIDS----IPRKWE-EAVKRYGLVRL----------------
E6U8V9_ETHHY/5-158-------------..........................KYN----VHP...-...........----------------
Q1IVJ5_KORVE/32-215-------------PFG.................HTFF..SDL----THY...-...........----------------
C1F375_ACIC5/44-227-------------PFG.................KDFF..SDL----THY...-...........----------------
Q01WM2_SOLUE/25-208-------------PFG.................SGFY..SDL----THY...-...........----------------
Q1ISY5_KORVE/28-210-------------PFG.................NRTF..SDL----VHY...-...........----------------
Q025L8_SOLUE/39-222-------------PFG.................SKFF..SDL----VHY...-...........----------------
Y1571_ARCFU/28-204-------------IS...................TEW..GTK----FHG...-...........----------------
Q01YQ6_SOLUE/23-198-------------RKSAGPQD......ASEIAVYCVRPDGEA----IHGATG-DWETDA.....----------------
Q8XI18_CLOPE/5-158-------------..........................KYK----LKK...-...........----------------
R5X8W2_9CLOT/5-160-------------..........................KYV----LHK...-...........----------------
B6FWP7_9FIRM/5-161-------------..........................KYK----LKK...-...........----------------
Q18BT1_PEPD6/5-159-------------..........................KYK----LKK...-...........----------------
D3MTQ6_9FIRM/3-156-------------..........................KYK----LKK...-...........----------------
A0A0C2S6D2_CLOBO/4-161-------------..........................KYK----MIK...-...........----------------
C4IEN4_CLOBU/4-161-------------..........................KYK----VKK...-...........----------------
A6LQ77_CLOB8/4-161-------------..........................KYK----FKK...-...........----------------
B1BFH6_CLOPF/5-161-------------..........................KYR----LKK...-...........----------------
Q97KV3_CLOAB/5-155-------------..........................KEI----KCS...-...........----------------
B0P7T6_9FIRM/16-171-------------..........................SLL----KLS...-...........----------------
C0ECW5_9FIRM/5-161-------------..........................KYK----KIP...-...........----------------
A8MHU0_ALKOO/5-164-------------..........................SLA----KLD...-...........----------------
A6TNX7_ALKMQ/5-165-------------..........................RLA----KMQ...-...........----------------
B2A897_NATTJ/5-148-------------..........................EHK----IKK...-...........----------------
R6RM69_9FIRM/5-161-------------..........................SFL----TTP...-...........----------------
B0NZS3_9CLOT/15-171-------------..........................SFV----TTP...-...........----------------
R7D6R4_9FIRM/20-175-------------..........................SFV----TKR...-...........----------------
C6J9X9_9FIRM/5-161-------------..........................SFI----TRR...-...........----------------
C6LKS6_9FIRM/5-161-------------..........................SFL----TER...-...........----------------
D4KRQ8_9FIRM/5-161-------------..........................SFI----YKR...-...........----------------
D9SRM2_CLOC7/5-162-------------..........................GKF----DTT...-...........----------------
A6LQR0_CLOB8/5-160-------------..........................KYR----MTM...-...........----------------
B0S165_FINM2/8-177-------------..........................KYK----LIR...-...........----------------
D1VUW6_9FIRM/8-182-------------..........................YYK----LIR...-...........----------------
C4IIQ3_CLOBU/5-155-------------..........................LAY----TNP...-...........----------------
C4Z638_EUBE2/40-187-------------..........................HTY----IKG...-...........----------------
A7VFQ0_9CLOT/5-152-------------..........................HTY----IKK...-...........----------------
C0EWT7_9FIRM/5-150-------------..........................YTY----LEG...-...........----------------
R5WI53_9FIRM/5-162-------------TYF.................RGSIRGEEK----LRG...-...........----------------
D4LBU1_RUMC1/5-160-------------TYT.................RGSLH.HRF----LHG...-...........----------------
Q315K4_DESAG/47-177-------------..........................PGH----SHN...-...........----------------
B8DLU9_DESVM/18-149-------------..........................PGH----SHN...-...........----------------
C7LVT1_DESBD/24-155-------------..........................PTH----SHN...-...........----------------
C6BUV8_DESAD/29-160-------------..........................RLH----SHN...-...........----------------
C8X0X8_DESRD/29-159-------------..........................DTH----CHN...-...........----------------
A5G5N0_GEOUR/25-157-------------..........................LLH----CHR...-...........----------------
E8WRC5_GEOS8/30-162-------------..........................LQH----CHR...-...........----------------
A1AK53_PELPD/24-156-------------..........................LLN----CHR...-...........----------------
B3EBK7_GEOLS/25-157-------------..........................LLN----CHR...-...........----------------
Q3A306_PELCD/29-161-------------..........................LQH----CHS...-...........----------------
Q1K0Z2_DESAC/27-159-------------..........................LKH----CHS...-...........----------------
C1A8N1_GEMAT/19-151-------------..........................GRH----CHS...-...........----------------
B8J577_ANAD2/33-165-------------..........................LYH----CHN...-...........----------------
D6SRA3_9DELT/26-149-------------..........................QKN----PHD...-...........----------------
B5YG53_THEYD/20-144-------------..........................DKN----PHS...-...........----------------
Q1H382_METFK/30-174-------------..........................FSH----SHY...-...........----------------
C6X6W6_METGS/30-174-------------..........................FRE----THQ...-...........----------------
C6WXF1_METML/56-200-------------..........................FNN----THA...-...........----------------
D5CMM4_SIDLE/28-177-------------.......................P..FST----THQ...-...........----------------
B0SPX5_LEPBP/6-211-------------Y....................HVL..QPK----RTK.KA-AFFGDL.....----------------
A0A022SYW6_LEPIR/6-211-------------Y....................HIF..SPH----KTK.KA-TRWGDM.....----------------
C8W7P0_ATOPD/6-209-------------FMVPDYSH.......KVRYGRSHQ..SYP----GSLPIP-SYRRYQRNFMG----------------
C5DV22_ZYGRC/30-228-------------..........................SCK----PSK.QW-HDFAES.....----------------
B5VL45_YEAS6/30-234-------------..........................SCA----PSNKDW-SDFAEF.....----------------
C5DKM1_LACTC/24-220-------------..........................SCN----SR.KDW-HEFAEY.....----------------
Q6FL70_CANGA/25-242-------------..........................SCS----LNNKKW-HDFAEY.....----------------
Q6CEF9_YARLI/23-229-------------C....................LGL..SEE----AEE...-...........----------------
C4R8D0_PICPG/19-213-------------..........................NCA----GTQ..L-AELSED.....----------------
Q8R432_MOUSE/28-220-------------..........................PSI----CKRGKY-HDVSER.....----------------
C3ZWC6_BRAFL/5-194-------------..........................DSL----CKKGKF-HSVSED.....----------------
A7SED1_NEMVE/31-226-------------..........................SNL----CYGGKY-HQVAED.....----------------
D3AZT7_POLPA/38-225-------------C....................GGF..AAE----SEA...-...........----------------
PLDG_DICDI/29-216-------------C....................GGL..ANE----SEA...-...........----------------
Q97TF6_CLOAB/60-232-------------FYNPYTGL.......NYLPSILPQ..SKT----TAL...-...........----------------
A7B1H2_RUMGN/72-243-------------GNETD............AGTFAGH..FYD----PDT.GK-NWLGQKS....----------------
PHLC_CLOHA/37-230-------------PKAY..............ALYQDH..FWD----PDT.DN-NFTKDSKWYLA----------------
A0PXH4_CLONN/38-231-------------PNAY..............KLFQDH..FWD----PDT.DH-NFSKDNLWYLS----------------
Q5PXE6_CLOPF/38-231-------------KNAY..............DLYQDH..FWD----PDT.DN-NFSKDNSWYLA----------------
Q8GCY3_9CLOT/38-231-------------PNAY..............SLYQDH..FWD----PDT.DH-NFTQDNKWYLS----------------
PHLC_CLOSO/38-231-------------PNAY..............DLFQDH..FFD----PDT.GN-NFTLDNKWYVA----------------
Q6R6B7_LISSE/64-245-------------NPYYD............KNTFLSH..FYN----PKTHKT-YIAGFP.....----------------
Q6EAE3_LISMN/64-245-------------NPYYD............TSTFLSH..FYN----PDRDNT-YLPGFA.....----------------
Q6R6D6_LISIV/62-243-------------NPYYD............CSTFVSH..FYN----PTKDNT-YLPGFK.....----------------
A0R9W0_BACAH/51-232-------------NPYYD............NSTFASH..FYD----PDNGKT-YIPFAK.....----------------
A5D2J5_PELTS/29-178-------------N....................FSH..YYD----PQT.GT-GIKPWP.....----------------
Q896L3_CLOTE/34-205-------------S....................SNH..FFH----FSK.GK-GLYGFS.....----------------
A5N896_CLOK5/34-205-------------S....................SNH..FYH----VNR.EK-GLYGFS.....----------------
Q97KA0_CLOAB/34-205-------------S....................TNH..FFD----FEK.GR-GLYGFS.....----------------
A6TKQ8_ALKMQ/57-228-------------S....................SNH..FYN----PYK.KK-GLYGRR.....----------------
O26214_METTH/27-173-------------D....................FKY..HVY----PYN...-...........----------------
B8I5G2_CLOCE/32-236-------------DPAGKGTLHGTLWTKDKDGYNANYIGNYI----YLTKIA-DLLGNGKAVAK----------------
B5HQN8_9ACTN/67-292-------------AASVV.............PGAMEF..GTV----THS.FP-GVFTIDVLVAW----------------
Q82A31_STRAW/92-336-------------AASVL.............SGAMEF..GDF----THS.FT-GVLTFDVLVAW----------------
C9YWP6_STRSW/1-225-------------VASVL.............PEAMEF..GDV----THS.FA-GVFTVDVLVTW----------------
B4V801_9ACTN/61-287-------------LDAVV.............EGVMGY..GEF----THS.PT-GVVTADAALTA----------------
D3D9A1_9ACTN/1-206-------------GR..................WTDL..YQL----THS.LL-GIVTVVPALTI----------------
A7C3K4_9GAMM/1-217-------------YC..................LSTR..CQF----GHT.LL-GIFLFDIPAGL----------------
B9XK96_PEDPL/41-256-------------FS..................LSPR..VTL----GHS.VP-GVFWFCVPVGL----------------
D9T3L8_MICAI/1-213-------------FTG................TAPAQ..NLR----THT.LG-GLLWWCLPVAL----------------
C1ACE2_GEMAT/1-206-------------GR..................MSHD..WLF----SHT.LS-AQIWFTVPLTM----------------
C0VQ51_9GAMM/1-206-------------FT...................PES..IAL----THQ.WA-GVLFPNLPIGL----------------
D0SL80_ACIJU/1-206-------------FT...................QAN..LPI----AHQ.WS-GVIFPNLPIGL----------------
D0SG75_ACIJO/1-206-------------FT...................QAD..SNT----THY.WT-SLIHPDLWIGL----------------
D0SS47_ACILW/1-206-------------FT...................HTN..SNI----THL.WS-SLIHPDLWIGL----------------

PF02265

ENDO2_ARATH/28-290-------------...R..Y.................HWSSP....LHYINT.PDAC.......----------------
ENDO5_ARATH/21-288-------------.LSQ..W.................QWTST....LHYVNT.PEYR......C----------------
A4H6V5_LEIBR/29-297-------------MGL.....................STMSS....WHFVDH.VY.........----------------
Q8F3Z8_LEPIN/21-283-------------FQSQ..RREMSPVCSQVFTSPAPPTNTGP....WHFIDI.PI.........----------------
B0T6T3_CAUSK/23-287-------------...D..H.................RQTTE....WHFVDV.ELDHPDLAGAC----------------
F2G2Z7_ALTMD/28-265-------------NPSEFWQ.................KTASP....WHYVTV.PE.........----------------
Q66VY6_LEIMA/29-300-------------SGL.....................KTNFN....WHFITT.PY.........----------------
Q7S8Q5_NEUCR/20-297-------------ESAA..N.................AWSAG....LHFVNG.HDGPPPE.SCH----------------
Q5KPJ8_CRYNJ/20-279-------------N..R..Y.................RGTAP....MHYINA.RND........----------------
Q236I4_TETTS/18-296-------------DAM.....................NFWYG....WHFYDK.PE.........----------------
Q4DEV4_TRYCC/28-293-------------LGL.....................FVMED....WHYIDT.PY.........----------------
Q0CD39_ASPTN/21-282-------------...R..Y.................PKTKP....WHYVDI.KDDPVHH.KCD----------------
Q2SFD4_HAHCH/50-295-------------EKE...F.................KHTGS....YHYVNV.ER.........----------------
Q585P6_TRYB2/27-292-------------YRM.....................GAMDG....WHYTAN.MY.........----------------
Q989R8_RHILO/21-270-------------AI....H.................PESYN....WHFVDI.PLAD.......----------------
ENDO1_ARATH/29-294-------------.WYK..Y.................RWTSH....LHYIDT.PDQAC.....S----------------
A4CQ68_ROBBH/22-257-------------DTT...Y.................RSFSP....WHYVNL.PPE........----------------
A3U8L7_CROAH/33-268-------------DKK...Y.................RAYGP....WHYVNV.PFD........----------------
A7H7R9_ANADF/28-274-------------........................PATRA....WHYVNI.PL.........----------------
Q7P202_CHRVO/23-274-------------EL......................KQTLPGSDQWHYNDE.PV.........----------------
A0BML4_PARTE/16-293-------------TGT.....................NFMND....WHYTNR.PM.........----------------
A7EWS3_SCLS1/21-282-------------.TTA..G.................KFSAP....FHFIDA.EDNPPD..SCG----------------
Q3IBZ8_PSEHT/27-268-------------APGEFWQ.................RKSSR....WHYINT.SAN........----------------
A7ETG5_SCLS1/21-277-------------..........................AALLRLFQRFFNT.EINAA....CG----------------
A0M3W8_GRAFK/24-260-------------DPE...Y.................REFGP....WHYVNIDPEN........----------------
A0BLJ0_PARTE/422-699-------------TGT.....................EFLFS....WHYTDR.PI.........----------------
A4HJL3_LEIBR/28-299-------------VGF.....................SALST....WHFITT.PY.........----------------
Q0TYV6_PHANO/20-284-------------.TPE..G.................AFSGV....LHYIDA.LDNPPE..SCN----------------
ENDO3_ARATH/25-286-------------.LPQ..W.................RWTSA....LHFADT.PDYKC.....N----------------
Q0AMT2_MARMM/26-282-------------STH.....................RHTAP....WHYINQ.TR.........----------------
Q4Q7F3_LEIMA/31-295-------------WGQ.....................YAMAT....WHFFDK.PY.........----------------
Q5NRA3_ZYMMO/33-298-------------AGH.....................GETEP....WHFVDI.EIDNPNLVTAC----------------
A5V871_SPHWW/21-280-------------LKDR..Y.................SYAYS....WHYQNV.DV.........----------------
Q5FP59_GLUOX/25-298-------------VPKK....................KGGAPETLKWHYVDI.DV.........----------------
Q0UA95_PHANO/19-289-------------.TAE..G.................RFSYQ....WHWIDT.HDWAPD..HCS----------------
NUS1_ASPOR/21-284-------------.TDA..G.................EFSKP....YHFIDA.QDNPPQ..SCG----------------
A4HI96_LEIBR/31-295-------------WGQ.....................DAMST....WHYYAM.QY.........----------------
Q7XPN4_ORYSJ/27-283-------------..FR..Y.................RWSSP....LHFADT.PGDC......Q----------------
Q01U80_SOLUE/19-261-------------AR......................AESGP....WHYVDI.PI.........----------------
A2QX99_ASPNC/21-292-------------...K..R.................PLTRP....LHYINP.DDEPPK..SCF----------------
A2TWS6_9FLAO/25-260-------------DRA...Y.................RAYSP....WHYVNM.GLT........----------------
Q2UHT0_ASPOR/21-283-------------...R..H.................PETAP....WHYVDV.EDDPLNN.HCK----------------
Q2H4S7_CHAGB/217-488-------------.TKW..G.................RFTSD....FHFIDA.KDDPPR..YCG----------------
Q15ZB2_PSEA6/20-256-------------SPDDFWQ.................KKAGP....FHYVTI.PKG........----------------
A4I736_LEIIN/27-297-------------IGL.....................KTLST....WHYITT.PY.........----------------
B2FSF8_STRMK/27-269-------------KDPG.LG.................RRSAG....WHYVNI.AE.........----------------
G3XKQ7_SOLLC/26-290-------------.WYK..Y.................KWTSP....LHFIDT.PDKAC.....N----------------
I1KHQ2_SOYBN/27-290-------------...I..Y.................PWASA....LHYANT.PEALC.....S----------------
I1MEB5_SOYBN/33-297-------------.WYK..Y.................RWTSP....LHFIDT.PDNAC.....S----------------
I1PPP5_ORYGL/30-294-------------.WYK..Y.................RWTSP....LHFIDT.PDKAC.....S----------------
M7YSG5_TRIUA/24-280-------------...R..Y.................RWSSP....LHFADT.PEDC......K----------------
Q1K6E5_NEUCR/21-291-------------.TKW..G.................RWTGP....LHYIDA.KDSP.......----------------

PF09988

Q8YZE9_NOSS1/2-166--------------------------------------------------------------------SLRH--RSFLSH
K9TIP1_9CYAN/2-166--------------------------------------------------------------------SLHH--RSFLSH
B2VAC8_SULSY/2-161--------------------------------------------------------------------LFSH--RG.ISH
A5UV55_ROSS1/2-173--------------------------------------------------------------------IIPH--RHFWSH
K9VXZ1_9CYAN/2-166--------------------------------------------------------------------ALNH--RSVFSH
K9X512_9NOST/2-158--------------------------------------------------------------------SLRH--RSFLSH
Q10Y23_TRIEI/2-165--------------------------------------------------------------------SLNH--RSFLSH
K9R5N7_9CYAN/21-185--------------------------------------------------------------------SLRH--RSFLSH
Q7U3L4_SYNPX/2-155--------------------------------------------------------------------LIPH--RSLWSH
K9UM54_9CHRO/2-166--------------------------------------------------------------------AIKH--RSIWSH
D7CX68_TRURR/2-172--------------------------------------------------------------------LFSH--RG.LSH
K9S824_9CYAN/2-177--------------------------------------------------------------------GLRH--RSLLSH
U5QDG6_9CYAN/2-166--------------------------------------------------------------------LGTH--RSWFTH
Q9RT76_DEIRA/5-173--------------------------------------------------------------------MFSH--RG.LSH
B1XNI7_SYNP2/2-167--------------------------------------------------------------------NLRH--RSALSH
K9YHE6_CYASC/3-166--------------------------------------------------------------------YLPH--RSFFSH
K9U5M5_9CYAN/2-166--------------------------------------------------------------------TVKH--RSILSH
K9XH03_9CHRO/2-166--------------------------------------------------------------------ALRH--RSIFSH
B7KDH5_CYAP7/2-167--------------------------------------------------------------------YLRH--RSLLSH
D7DZB9_NOSA0/2-166--------------------------------------------------------------------SLRH--RSFLSH
K9VNR5_9CYAN/2-166--------------------------------------------------------------------SLRH--RSFLSH
A9B0N7_HERA2/2-170--------------------------------------------------------------------LVPH--RAGISH
Q8XL51_CLOPE/2-170--------------------------------------------------------------------LFEH--RSVFTH
G2LLI8_CHLTF/2-174--------------------------------------------------------------------LFPH--RSHWTH
E4UAQ6_OCEP5/2-167--------------------------------------------------------------------LFRH--RG.LSH
B1X0E2_CYAA5/2-167--------------------------------------------------------------------CFKH--RSFFSH
Q7NFX0_GLOVI/2-166--------------------------------------------------------------------VAPH--RSLFSH
K9Z9T5_CYAAP/2-167--------------------------------------------------------------------TLKH--RSIFSH
L0A273_DEIPD/2-163--------------------------------------------------------------------LFSH--RG.WSH
K9WE31_9CYAN/2-166--------------------------------------------------------------------AMRH--RSIFSH
K9V8T7_9CYAN/2-166--------------------------------------------------------------------SLRH--RSFLSH
Q7V3X6_PROMM/2-159--------------------------------------------------------------------LIPH--RSLFSH
B8HTG8_CYAP4/2-166--------------------------------------------------------------------TLRH--RSFLSH
C1CV84_DEIDV/5-166--------------------------------------------------------------------LFSH--RG.LSH
Q31N47_SYNE7/7-176--------------------------------------------------------------------CLRH--RSWFSH
S0EUE8_CHTCT/2-170--------------------------------------------------------------------LVPH--RSWVSH
E0U8U0_CYAP2/2-167--------------------------------------------------------------------CLRH--RSLFSH
D3EPX6_ATETH/2-167--------------------------------------------------------------------SFKH--RSFLSH
C0QT82_PERMH/2-161--------------------------------------------------------------------IFSH--RG.ISH
Q2JJ24_SYNJB/2-166--------------------------------------------------------------------WMRH--RSFWSH
B7K2N6_CYAP8/2-167--------------------------------------------------------------------LLKH--RSFFSH
K9Q2E8_9CYAN/2-167--------------------------------------------------------------------TLSH--RSSLSH
A9WA62_CHLAA/2-176--------------------------------------------------------------------LIPH--RAFWSH
H8GTR8_DEIGI/2-163--------------------------------------------------------------------MFSH--RG.LSH
K9XZT4_STAC7/2-167--------------------------------------------------------------------LFRH--RSFFSH
B2IUE8_NOSP7/2-166--------------------------------------------------------------------SLRH--RSFLSH
E8UBR4_DEIML/2-163--------------------------------------------------------------------LFSH--RG.LSH
K9QIC8_9NOSO/2-166--------------------------------------------------------------------SLRH--RSFLSH
B0JHJ8_MICAN/2-166--------------------------------------------------------------------MIRH--RGWLSH
K9RQ06_SYNP3/2-166--------------------------------------------------------------------LIPH--RSWLSH
D7BE64_MEISD/2-161--------------------------------------------------------------------IFSH--RG.WSH
A5GPK9_SYNPW/3-163--------------------------------------------------------------------LIPH--RSLFSH
Q81WY4_BACAN/2-155--------------------------------------------------------------------VMPH--RSFFTH
W6FU87_NODSP/2-166--------------------------------------------------------------------KLRH--RSVFSH
B4UA61_HYDS0/2-160--------------------------------------------------------------------VFKH--RG.LSH
K9T9J7_9CYAN/2-167--------------------------------------------------------------------LVGH--RSQLSH
F0RKU1_DEIPM/12-173--------------------------------------------------------------------VFSH--RG.LSH
F2NN18_MARHT/2-164--------------------------------------------------------------------LFRH--RG.WSH
K8GJ34_9CYAN/2-177--------------------------------------------------------------------SMRH--RAFLSH
D3PMR5_MEIRD/2-165--------------------------------------------------------------------MFTH--RG.LSH
B0CCR6_ACAM1/2-165--------------------------------------------------------------------VLHH--RSWLSH
Q8DM71_THEEB/2-162--------------------------------------------------------------------MFCH--RSLWTH
P72876_SYNY3/2-165--------------------------------------------------------------------FIPH--RSPLSH

PF04307

Q18EP1_HALWD/1-158.......................................................................G..R.VFMH
Q65F12_BACLD/1-155....................................................................VFGH..R.TFTH
Q0W2I6_METAR/1-181......................................................................TH..G.GITH
Q1AT01_RUBXD/1-176..........................................................LRATSFVLVRTVGH..R.TLTH
Q7MS32_WOLSU/1-175....................................................................LFGH..R.GATH
Q8D1W8_WIGBR/1-169....................................................................TFGH..R.GFTH
Q5WIF9_BACSK/1-182.......................................................................H..R.GMTH
Q2NV14_SODGM/1-168....................................................................VFGH..R.GITH
A0LXF8_GRAFK/1-182.......................................................................H..R.GFSH
Q01PN8_SOLUE/1-175.......................................................................H..R.GFFH
Q0W4H6_METAR/1-165.......................................................................G..R.IFSH
YFHP_BACSU/1-182.......................................................................H..R.GFTH
Q5FTT4_GLUOX/53-213....................................................................TFGH..R.GLTH
Q726Y1_DESVH/1-173.......................................................................H..R.GITH
C1DQI7_AZOVD/1-180.......................................................................H..R.GFSH
Q8ETE4_OCEIH/1-155....................................................................IFGH..R.TITH
Q5FK20_LACAC/1-175.....................................................................LRH..R.GITH
A4XRV7_PSEMY/1-180.......................................................................H..R.GFSH
Q2N9Y9_ERYLH/13-204.......................................................................R..R.GITH
Q023X2_SOLUE/1-190.......................................................................H..R.HITH
A9AVQ5_HERA2/1-166.......................................................................H..R.GFTH
Q7VVQ6_BORPE/1-180.......................................................................H..R.GFSH
A6LWG2_CLOB8/1-169....................................................................LAGH..R.KLFH
A3CRK4_METMJ/1-159.......................................................................G..R.IYFH
A1TRR8_ACIAC/1-179.......................................................................H..R.ADTH
Q3J7C8_NITOC/1-183.......................................................................H..R.GITH
Q8CV62_OCEIH/1-182.......................................................................H..R.GASH
A0JUC0_ARTS2/1-250.................................................................ENASGGH..R.QGTH
A1WTH1_HALHL/1-183.......................................................................H..R.GETH
Q5V391_HALMA/1-161.......................................................................G..R.VFMH
Q97K38_CLOAB/1-212EKTNLFLKNMGV...........................YKLKDYIPYNLKLSNAGLLIIVGCIIFSKFTKH..R.SFSH
Q1WSF6_LACS1/1-169....................................................................AFGH..R.GITH
Q0ACJ1_ALKEH/1-184.......................................................................H..R.GVTH
Q7N3N6_PHOLL/1-166....................................................................LCGH..R.GFTH
Q9KEC4_BACHD/1-182.......................................................................H..R.GLTH
Q1D144_MYXXD/1-188.......................................................................H..R.GLSH
Q2JB37_FRASC/1-225.................................................................SRAAGGH..R.HATH
Q12UG8_METBU/1-174.......................................................................G..R.IFAH
A8GDN5_SERP5/1-166....................................................................AFGH..R.GFTH
Q5V568_HALMA/1-273.................................................................ETANVVH..R.GPTH
Q1ATT6_RUBXD/1-170....................................................................LFGH..R.SFLH
A4J2S9_DESRM/1-180....................................................................KYGH..RNSPTH
Q8TQH1_METAC/1-199.....................................................................FGH..R.EFTH
Q6D4I1_PECAS/1-166....................................................................LFGH..R.GFTH
Q82XH5_NITEU/1-183.......................................................................H..Q.GPTH
Q6YRT9_SYNY3/1-188....................................................................RFSH..R.SATH
Q5HM58_STAEQ/1-158....................................................................LFGH..R.TFTH
Q8TP13_METAC/1-172.......................................................................G..R.IIGH
Q0JZE4_CUPNH/1-185.......................................................................H..Q.GPTH
Q97LP7_CLOAB/1-199Y.................................................RFHIFMLYILGALLFLIAISSH..RNGLMH
A0PYB1_CLONN/1-199M.................................................YTKSPVSKAIGIAFIFIAVSSH..RNGLTH
Q9KE25_BACHD/1-180.......................................................................H..R.GLTH
Q3JF51_NITOC/1-164....................................................................HFGH..R.TITH
A1K1W5_AZOSB/1-183.......................................................................H..R.GVTH
Q6AMI9_DESPS/1-207....................................................CSYFFINYFLYGVVKKLTVH..R.GILH
Q7NV83_CHRVO/1-166....................................................................LFGH..R.GITH
Q47U11_THEFY/1-250..........................................................RRTRTPADRSDGEH..R.HLGH
Q47RB2_THEFY/1-227.................................................................NWAFGGH..R.NGTH
Q1QZR4_CHRSD/1-181.......................................................................H..R.GFSH
Q5P1U0_AROAE/1-192.......................................................................H..R.GVTH
Q0BSQ9_GRABC/13-169....................................................................AFGH..R.GVTH
Q5L2T9_GEOKA/1-182.......................................................................H..R.GITH
A5CZD2_PELTS/16-203....................................................................RFGH..RESPTH
Q2S300_SALRD/1-182.......................................................................H..R.SVTH
Q1DD75_MYXXD/1-235.......................................................................R..R.GWTH
A0KFP7_AERHH/1-165....................................................................LFGH..R.GFTH
Q0VLL6_ALCBS/1-174.......................................................................H..R.GFSH
Q3A0M8_PELCD/1-203.....................................................LAMGLIALMFVIFTRLTVH..R.GIMH
Q186I4_PEPD6/1-177....................................................................RFRH..R.GFTH
Q2L2L1_BORA1/1-180.......................................................................H..R.GFSH
Q67R78_SYMTH/1-176.......................................................................H..R.TYTH
Q97MS7_CLOAB/1-166.......................................................................HNSR.IFGH
A6TSU9_ALKMQ/1-172.......................................................................H..R.VESH
A6TMK4_ALKMQ/1-249FLKDTPIFYGIALILFLGFIFAKQFAQKGYYMMRNFVQSMTAITVMIGAYYYEHYPLIWIGVILMILLLVKH..R.SFSH
A3CVA2_METMJ/1-183.......................................................................G..R.IFGH
Q9KAZ8_BACHD/1-159....................................................................TFGH..R.AFTH
Q0S8N5_RHOJR/1-250.........................................................TVTKGKRDGKRRGGH..R.TLTH
Q1IHJ9_KORVE/1-205.......................................................................H..R.GFTH
Q890Y4_CLOTE/1-199A.................................................SGGMPHIKAIGILFMFIAISTH..RNGLTH
Q0RHF1_FRAAA/1-228.................................................................SRASGGH..R.HATH
Q1MS87_LAWIP/1-199.......................................................................H..R.GITH
Q11P46_CYTH3/1-219.................................................................GKFWYSH..H.GFFH
A6LXK9_CLOB8/1-172.......................................................................HNSR.IFGH
Q2VZJ9_MAGSA/1-159....................................................................VLGH..R.GLTH
Q5YVJ3_NOCFA/1-233.................................................................AKVSGGH..R.QGTH
Q8FRV6_COREF/1-249.........................................................NVTRGRKDKPCKNGH..R.TATH
A0KMD3_AERHH/1-197.......................................................................H..R.GVTH
Q3JEV9_NITOC/1-176.......................................................................H..R.QFTH
Q9CNK9_PASMU/1-180.......................................................................H..R.GFSH
A1U6Q1_MARHV/1-174.......................................................................H..R.GFSH
Q7NWB9_CHRVO/1-187.......................................................................H..R.GFSH
O29079_ARCFU/1-168...................................................................KTTHH..R.GWTH
Q1MQD9_LAWIP/1-155.......................................................................H..R.QTSH
Q5WH30_BACSK/1-157....................................................................IFGH..R.TFTH
Q1GSW3_SPHAL/1-193.......................................................................R..R.GITH
A3CTE7_METMJ/1-243R..................................................YLIYYPLSLVFMLILRKSYRHRHR.GLLH
YVSG_BACSU/1-155....................................................................VFGH..R.TFTH
B1W5J1_STRGG/1-256.........................................................KATKSKADPRRTGGH..R.TLTH
B2FPD0_STRMK/1-181.......................................................................H..R.SFSH
Q5ZZH0_LEGPH/1-172.......................................................................H..R.YLTH
Q6LSY8_PHOPR/1-173.......................................................................H..R.GFSH
Q74JJ2_LACJO/1-173.....................................................................LKH..R.GITH
Q7CIV6_YERPE/1-162....................................................................VFGH..R.GFTH
Q7CJI4_YERPE/1-166.......................................................................H..R.GFTH
Q81YV9_BACAN/1-179.......................................................................H..R.GITH
Q8Y6J4_LISMO/1-176.......................................................................H..R.GITH
Q9HUK3_PSEAE/1-165.......................................................................H..R.GFSH
Q9RMV6_BACAN/1-156....................................................................VFGH..R.GITH
U5L8V8_9BACI/1-175.......................................................................H..R.GITH

PF13803

C7QBS6_CATAD/1-242--------------------------------------------------------------------------VLAGVW
C0ZEY0_BREBN/1-241--------------------------------------------------------------------------LLAFLY
K9WR57_9CYAN/1-241--------------------------------------------------------------------------VLLLIT
D3EE91_GEOS4/1-236--------------------------------------------------------------------------LLYVVF
X2GTZ3_9BACI/1-237--------------------------------------------------------------------------FIYFIY
F8A675_CELGA/1-236--------------------------------------------------------------------------VLLAVW
Q1IN38_KORVE/1-247--------------------------------------------------------------------------AAFLLF
D2Q1R3_KRIFD/1-251--------------------------------------------------------------------------LALVVF
A6GZ02_FLAPJ/1-235--------------------------------------------------------------------------LLAFIF
D3V1B0_XENBS/1-240--------------------------------------------------------------------------LIFLIV
Q899W6_CLOTE/1-232--------------------------------------------------------------------------LLNYLI
G0FWC1_AMYMS/1-228--------------------------------------------------------------------------ALVAAG
C2X225_BACCE/1-236--------------------------------------------------------------------------LLAYIY
Q8XML2_CLOPE/1-242--------------------------------------------------------------------------LLAYIF
A0Q1Y2_CLONN/1-242--------------------------------------------------------------------------ILYLLW
I0E062_PROSM/1-239--------------------------------------------------------------------------IIYVVT
Q6FEH5_ACIAD/1-242--------------------------------------------------------------------------LFCAVW
H1YCR9_9SPHI/1-235--------------------------------------------------------------------------MLAFVY
I4B9J2_TURPD/1-232--------------------------------------------------------------------------ILTILW
K4IBC3_PSYTT/1-233--------------------------------------------------------------------------LLTFIF
H2JVD3_STRHJ/1-251--------------------------------------------------------------------------ALAGLW
A5I0I6_CLOBH/1-248--------------------------------------------------------------------------ILAYLF
Q65Q39_MANSM/1-229--------------------------------------------------------------------------LFYAVY
F4FE12_VERMA/1-233--------------------------------------------------------------------------AYARIF
C6D3J1_PAESJ/1-240--------------------------------------------------------------------------VLGLLF
A3HWD2_9BACT/1-236--------------------------------------------------------------------------AIALIF
Q7UP84_RHOBA/1-249--------------------------------------------------------------------------AAYFVY
A8L7F5_FRASN/1-232--------------------------------------------------------------------------VALGIW
D2ARI2_STRRD/1-246--------------------------------------------------------------------------MLLAVF
Q0RF10_FRAAA/1-232--------------------------------------------------------------------------VALGVW
C7R2G7_JONDD/1-241--------------------------------------------------------------------------FLYAFI

PF00882

A0A090C0Q9_ACIBA/1-206--------------------------------------------------------------------------LFSAIW
C6RSF9_ACIRA/1-206--------------------------------------------------------------------------AFTLVW
B7H911_BACC4/1-208--------------------------------------------------------------------------LIAYIY
C2XYJ1_BACCE/7-214--------------------------------------------------------------------------LLAYAY
B1B9W2_CLOBO/1-214--------------------------------------------------------------------------ILYLLW
C5VRK3_CLOBO/1-214--------------------------------------------------------------------------IMAFSW
A3I5H3_9BACI/4-213--------------------------------------------------------------------------IIYLIY
Q0SV58_CLOPS/1-213--------------------------------------------------------------------------LLAYIF
C6JKD9_FUSVA/1-208--------------------------------------------------------------------------FLAFIF
A1ZM58_9BACT/1-209--------------------------------------------------------------------------LLTVVF
C0DX83_EIKCO/1-211--------------------------------------------------------------------------TLYALY
D4DQE9_NEIEG/58-261--------------------------------------------------------------------------AVYWLY
C0B3N4_9ENTR/1-204--------------------------------------------------------------------------IFVFIL
D4BTR9_PRORE/1-203--------------------------------------------------------------------------LLITIF
Q2LV15_SYNAS/6-198--------------------------------------------------------------------------......
Q2Y883_NITMU/6-188--------------------------------------------------------------------------......
A7K2D4_VIBAE/6-189--------------------------------------------------------------------------......
A4C3L5_9GAMM/6-186--------------------------------------------------------------------------......
C9YFH3_9BURK/6-183--------------------------------------------------------------------------......
Q12DA4_POLSJ/6-186--------------------------------------------------------------------------......
C4XMP3_DESMR/34-221--------------------------------------------------------------------------......
E6VSV5_DESAO/6-180--------------------------------------------------------------------------......
Q2LQI8_SYNAS/6-189--------------------------------------------------------------------------......
B8FCF0_DESAA/6-187--------------------------------------------------------------------------..DLLA
B3E8I7_GEOLS/6-161--------------------------------------------------------------------------......
A1AT46_PELPD/6-164--------------------------------------------------------------------------......
C6Y3Y4_PEDHD/24-233--------------------------------------------------------------------------NQNGIL
E6U8V9_ETHHY/5-158--------------------------------------------------------------------------.....H
Q1IVJ5_KORVE/32-215--------------------------------------------------------------------------......
C1F375_ACIC5/44-227--------------------------------------------------------------------------......
Q01WM2_SOLUE/25-208--------------------------------------------------------------------------......
Q1ISY5_KORVE/28-210--------------------------------------------------------------------------......
Q025L8_SOLUE/39-222--------------------------------------------------------------------------......
Y1571_ARCFU/28-204--------------------------------------------------------------------------......
Q01YQ6_SOLUE/23-198--------------------------------------------------------------------------......
Q8XI18_CLOPE/5-158--------------------------------------------------------------------------.....H
R5X8W2_9CLOT/5-160--------------------------------------------------------------------------.....H
B6FWP7_9FIRM/5-161--------------------------------------------------------------------------.....H
Q18BT1_PEPD6/5-159--------------------------------------------------------------------------.....H
D3MTQ6_9FIRM/3-156--------------------------------------------------------------------------.....H
A0A0C2S6D2_CLOBO/4-161--------------------------------------------------------------------------.....H
C4IEN4_CLOBU/4-161--------------------------------------------------------------------------.....H
A6LQ77_CLOB8/4-161--------------------------------------------------------------------------.....H
B1BFH6_CLOPF/5-161--------------------------------------------------------------------------.....H
Q97KV3_CLOAB/5-155--------------------------------------------------------------------------.....H
B0P7T6_9FIRM/16-171--------------------------------------------------------------------------.....H
C0ECW5_9FIRM/5-161--------------------------------------------------------------------------.....H
A8MHU0_ALKOO/5-164--------------------------------------------------------------------------.....H
A6TNX7_ALKMQ/5-165--------------------------------------------------------------------------.....H
B2A897_NATTJ/5-148--------------------------------------------------------------------------.....H
R6RM69_9FIRM/5-161--------------------------------------------------------------------------.....H
B0NZS3_9CLOT/15-171--------------------------------------------------------------------------.....H
R7D6R4_9FIRM/20-175--------------------------------------------------------------------------.....H
C6J9X9_9FIRM/5-161--------------------------------------------------------------------------.....H
C6LKS6_9FIRM/5-161--------------------------------------------------------------------------.....H
D4KRQ8_9FIRM/5-161--------------------------------------------------------------------------.....H
D9SRM2_CLOC7/5-162--------------------------------------------------------------------------.....H
A6LQR0_CLOB8/5-160--------------------------------------------------------------------------.....H
B0S165_FINM2/8-177--------------------------------------------------------------------------.....H
D1VUW6_9FIRM/8-182--------------------------------------------------------------------------.....H
C4IIQ3_CLOBU/5-155--------------------------------------------------------------------------.....H
C4Z638_EUBE2/40-187--------------------------------------------------------------------------.....H
A7VFQ0_9CLOT/5-152--------------------------------------------------------------------------.....H
C0EWT7_9FIRM/5-150--------------------------------------------------------------------------.....H
R5WI53_9FIRM/5-162--------------------------------------------------------------------------.....H
D4LBU1_RUMC1/5-160--------------------------------------------------------------------------.....H
Q315K4_DESAG/47-177--------------------------------------------------------------------------......
B8DLU9_DESVM/18-149--------------------------------------------------------------------------......
C7LVT1_DESBD/24-155--------------------------------------------------------------------------......
C6BUV8_DESAD/29-160--------------------------------------------------------------------------......
C8X0X8_DESRD/29-159--------------------------------------------------------------------------......
A5G5N0_GEOUR/25-157--------------------------------------------------------------------------......
E8WRC5_GEOS8/30-162--------------------------------------------------------------------------......
A1AK53_PELPD/24-156--------------------------------------------------------------------------......
B3EBK7_GEOLS/25-157--------------------------------------------------------------------------......
Q3A306_PELCD/29-161--------------------------------------------------------------------------......
Q1K0Z2_DESAC/27-159--------------------------------------------------------------------------......
C1A8N1_GEMAT/19-151--------------------------------------------------------------------------......
B8J577_ANAD2/33-165--------------------------------------------------------------------------......
D6SRA3_9DELT/26-149--------------------------------------------------------------------------......
B5YG53_THEYD/20-144--------------------------------------------------------------------------......
Q1H382_METFK/30-174--------------------------------------------------------------------------......
C6X6W6_METGS/30-174--------------------------------------------------------------------------......
C6WXF1_METML/56-200--------------------------------------------------------------------------......
D5CMM4_SIDLE/28-177--------------------------------------------------------------------------......
B0SPX5_LEPBP/6-211--------------------------------------------------------------------------.....A
A0A022SYW6_LEPIR/6-211--------------------------------------------------------------------------.....S
C8W7P0_ATOPD/6-209--------------------------------------------------------------------------GLSPAE
C5DV22_ZYGRC/30-228--------------------------------------------------------------------------.....T
B5VL45_YEAS6/30-234--------------------------------------------------------------------------.....T
C5DKM1_LACTC/24-220--------------------------------------------------------------------------.....T
Q6FL70_CANGA/25-242--------------------------------------------------------------------------.....T
Q6CEF9_YARLI/23-229--------------------------------------------------------------------------.....A
C4R8D0_PICPG/19-213--------------------------------------------------------------------------.....L
Q8R432_MOUSE/28-220--------------------------------------------------------------------------.....T
C3ZWC6_BRAFL/5-194--------------------------------------------------------------------------.....T
A7SED1_NEMVE/31-226--------------------------------------------------------------------------.....T
D3AZT7_POLPA/38-225--------------------------------------------------------------------------.....A
PLDG_DICDI/29-216--------------------------------------------------------------------------.....A
Q97TF6_CLOAB/60-232--------------------------------------------------------------------------......
A7B1H2_RUMGN/72-243--------------------------------------------------------------------------....PT
PHLC_CLOHA/37-230--------------------------------------------------------------------------YGINET
A0PXH4_CLONN/38-231--------------------------------------------------------------------------YSIKDT
Q5PXE6_CLOPF/38-231--------------------------------------------------------------------------YSIPDT
Q8GCY3_9CLOT/38-231--------------------------------------------------------------------------YAVPDN
PHLC_CLOSO/38-231--------------------------------------------------------------------------SPIYDT
Q6R6B7_LISSE/64-245--------------------------------------------------------------------------.....N
Q6EAE3_LISMN/64-245--------------------------------------------------------------------------.....N
Q6R6D6_LISIV/62-243--------------------------------------------------------------------------.....N
A0R9W0_BACAH/51-232--------------------------------------------------------------------------.....Q
A5D2J5_PELTS/29-178--------------------------------------------------------------------------.....D
Q896L3_CLOTE/34-205--------------------------------------------------------------------------.....N
A5N896_CLOK5/34-205--------------------------------------------------------------------------.....D
Q97KA0_CLOAB/34-205--------------------------------------------------------------------------.....N
A6TKQ8_ALKMQ/57-228--------------------------------------------------------------------------.....S
O26214_METTH/27-173--------------------------------------------------------------------------......
B8I5G2_CLOCE/32-236--------------------------------------------------------------------------GTVSQS
B5HQN8_9ACTN/67-292--------------------------------------------------------------------------ALVGLW
Q82A31_STRAW/92-336--------------------------------------------------------------------------ALAGAW
C9YWP6_STRSW/1-225--------------------------------------------------------------------------ALVGLW
B4V801_9ACTN/61-287--------------------------------------------------------------------------ALAACW
D3D9A1_9ACTN/1-206--------------------------------------------------------------------------VVLLVW
A7C3K4_9GAMM/1-217--------------------------------------------------------------------------VILWIF
B9XK96_PEDPL/41-256--------------------------------------------------------------------------IFFILL
D9T3L8_MICAI/1-213--------------------------------------------------------------------------VYAWVV
C1ACE2_GEMAT/1-206--------------------------------------------------------------------------ALVWLL
C0VQ51_9GAMM/1-206--------------------------------------------------------------------------FFCLLW
D0SL80_ACIJU/1-206--------------------------------------------------------------------------FFCLLW
D0SG75_ACIJO/1-206--------------------------------------------------------------------------SFCVLW
D0SS47_ACILW/1-206--------------------------------------------------------------------------AFCAVW

PF02265

ENDO2_ARATH/28-290--------------------------------------------------------------------------SYQYNR
ENDO5_ARATH/21-288--------------------------------------------------------------------------NYEYCR
A4H6V5_LEIBR/29-297--------------------------------------------------------------------------...NPQ
Q8F3Z8_LEPIN/21-283--------------------------------------------------------------------------.SLTNP
B0T6T3_CAUSK/23-287--------------------------------------------------------------------------FG.FPA
F2G2Z7_ALTMD/28-265--------------------------------------------------------------------------....GT
Q66VY6_LEIMA/29-300--------------------------------------------------------------------------...YPD
Q7S8Q5_NEUCR/20-297--------------------------------------------------------------------------LV.LPE
Q5KPJ8_CRYNJ/20-279--------------------------------------------------------------------------.HPQDH
Q236I4_TETTS/18-296--------------------------------------------------------------------------...NPQ
Q4DEV4_TRYCC/28-293--------------------------------------------------------------------------...NPQ
Q0CD39_ASPTN/21-282--------------------------------------------------------------------------ISSL..
Q2SFD4_HAHCH/50-295--------------------------------------------------------------------------...AAK
Q585P6_TRYB2/27-292--------------------------------------------------------------------------...IRD
Q989R8_RHILO/21-270--------------------------------------------------------------------------SK.YDP
ENDO1_ARATH/29-294--------------------------------------------------------------------------YE.YSR
A4CQ68_ROBBH/22-257--------------------------------------------------------------------------.TPYG.
A3U8L7_CROAH/33-268--------------------------------------------------------------------------.TSYG.
A7H7R9_ANADF/28-274--------------------------------------------------------------------------....AA
Q7P202_CHRVO/23-274--------------------------------------------------------------------------......
A0BML4_PARTE/16-293--------------------------------------------------------------------------...NPD
A7EWS3_SCLS1/21-282--------------------------------------------------------------------------VD.YER
Q3IBZ8_PSEHT/27-268--------------------------------------------------------------------------.KPISL
A7ETG5_SCLS1/21-277--------------------------------------------------------------------------VK.FAR
A0M3W8_GRAFK/24-260--------------------------------------------------------------------------.KKYI.
A0BLJ0_PARTE/422-699--------------------------------------------------------------------------...NPD
A4HJL3_LEIBR/28-299--------------------------------------------------------------------------...YPD
Q0TYV6_PHANO/20-284--------------------------------------------------------------------------ID.YAR
ENDO3_ARATH/25-286--------------------------------------------------------------------------YE.YSR
Q0AMT2_MARMM/26-282--------------------------------------------------------------------------...DDP
Q4Q7F3_LEIMA/31-295--------------------------------------------------------------------------...NPE
Q5NRA3_ZYMMO/33-298--------------------------------------------------------------------------AA.ASN
A5V871_SPHWW/21-280--------------------------------------------------------------------------....CR
Q5FP59_GLUOX/25-298--------------------------------------------------------------------------...SHP
Q0UA95_PHANO/19-289--------------------------------------------------------------------------LD.YSQ
NUS1_ASPOR/21-284--------------------------------------------------------------------------VD.YDR
A4HI96_LEIBR/31-295--------------------------------------------------------------------------...NPD
Q7XPN4_ORYSJ/27-283--------------------------------------------------------------------------FN.YAR
Q01U80_SOLUE/19-261--------------------------------------------------------------------------...NKP
A2QX99_ASPNC/21-292--------------------------------------------------------------------------VS.YPH
A2TWS6_9FLAO/25-260--------------------------------------------------------------------------.ETYE.
Q2UHT0_ASPOR/21-283--------------------------------------------------------------------------ISPLPR
Q2H4S7_CHAGB/217-488--------------------------------------------------------------------------VD.FAR
Q15ZB2_PSEA6/20-256--------------------------------------------------------------------------.QTYA.
A4I736_LEIIN/27-297--------------------------------------------------------------------------.Y.TDE
B2FSF8_STRMK/27-269--------------------------------------------------------------------------...DNC
G3XKQ7_SOLLC/26-290--------------------------------------------------------------------------FD.YER
I1KHQ2_SOYBN/27-290--------------------------------------------------------------------------YK.NSR
I1MEB5_SOYBN/33-297--------------------------------------------------------------------------FQ.YSR
I1PPP5_ORYGL/30-294--------------------------------------------------------------------------FV.YSR
M7YSG5_TRIUA/24-280--------------------------------------------------------------------------FS.YAR
Q1K6E5_NEUCR/21-291--------------------------------------------------------------------------PD.SC.

PF09988

Q8YZE9_NOSS1/2-166GP------LI-GTT-LRVVY-------------LSSL----....LA---------------------------------
K9TIP1_9CYAN/2-166GP------LV-GTA-LRILY-------------LGIW----....IG---------------------------------
B2VAC8_SULSY/2-161IP------IY-GTI-TKIFY-------------LSFI----AFIFLF---------------------------------
A5UV55_ROSS1/2-173SL------VL-APL-LRLVY-------------FYLV----TLLIVV---------------------------------
K9VXZ1_9CYAN/2-166GL------II-GTI-IRVLY-------------ITNL----....VL---------------------------------
K9X512_9NOST/2-158GP------II-GTM-LRVLY-------------LGTL----....LA---------------------------------
Q10Y23_TRIEI/2-165GP------II-GTA-LRLLY-------------LLNW----....SA---------------------------------
K9R5N7_9CYAN/21-185GP------LI-GTT-VRVLY-------------LCVL----....IS---------------------------------
Q7U3L4_SYNPX/2-155GP------LI-GTA-LRLML-------------LLGW----WVVLSL---------------------------------
K9UM54_9CHRO/2-166GP------II-GTI-GRILY-------------LSLW----....LG---------------------------------
D7CX68_TRURR/2-172TW------FV-GPL-TRLLY-------------LVLL----ALALGW---------------------------------
K9S824_9CYAN/2-177GP------VL-GTL-GRLAY-------------LGLW----LGA.VW---------------------------------
U5QDG6_9CYAN/2-166GP------IA-GTL-GRLVY-------------LGIA----....LA---------------------------------
Q9RT76_DEIRA/5-173TW------IV-GPL-TRLLY-------------LGLI----AGAVWT---------------------------------
B1XNI7_SYNP2/2-167GF------LI-GTI-VRLLY-------------LGSI----....LL---------------------------------
K9YHE6_CYASC/3-166GF------II-GTV-IRSLY-------------LCFI----....LL---------------------------------
K9U5M5_9CYAN/2-166GF------AI-GTI-LRLIY-------------LAIW----....LS---------------------------------
K9XH03_9CHRO/2-166GF------LI-GTT-LRVLY-------------LGTW----....LA---------------------------------
B7KDH5_CYAP7/2-167GF------LI-GTL-LRVIY-------------LLAL----....LI---------------------------------
D7DZB9_NOSA0/2-166GP------II-GTT-LRVVY-------------LTTF----....LA---------------------------------
K9VNR5_9CYAN/2-166GP------LI-GTA-LRILY-------------LAIW----....IA---------------------------------
A9B0N7_HERA2/2-170SL------VF-GPL-FRLGY-------------FLVM----....VW---------------------------------
Q8XL51_CLOPE/2-170GF------IL-GPI-IRILY-------------VSII----PITISS---------------------------------
G2LLI8_CHLTF/2-174GL------LW-STW-LRVGY-------------FTLV----MTLALA---------------------------------
E4UAQ6_OCEP5/2-167TW------VV-GPI-TRILY-------------LVLI----LEGVLY---------------------------------
B1X0E2_CYAA5/2-167GL------IV-GTV-IRVIY-------------LFSI----....IV---------------------------------
Q7NFX0_GLOVI/2-166GP------LV-GTL-GRLLY-------------LAIV----....AV---------------------------------
K9Z9T5_CYAAP/2-167GF------LL-GTL-IRVIY-------------LSLI----....LF---------------------------------
L0A273_DEIPD/2-163SW------LI-GPL-TRLIY-------------LAVM----VAVVTG---------------------------------
K9WE31_9CYAN/2-166GP------LI-GTT-LRMLY-------------LATW----....TA---------------------------------
K9V8T7_9CYAN/2-166GP------VI-GTT-LRVLY-------------FVMI----....LL---------------------------------
Q7V3X6_PROMM/2-159GP------LI-GTG-LRLAY-------------LMSW----TGLLLM---------------------------------
B8HTG8_CYAP4/2-166GP------IM-GTA-LRLLY-------------LGSW----....LA---------------------------------
C1CV84_DEIDV/5-166TW------LV-GPL-TRLAY-------------LAAL----LALIVG---------------------------------
Q31N47_SYNE7/7-176GP------LL-GTI-GRVLY-------------LGAW----L...LL---------------------------------
S0EUE8_CHTCT/2-170GL------IV-GGI-IRALY-------------LGVM----....FF---------------------------------
E0U8U0_CYAP2/2-167GF------LL-GTV-VRLIY-------------LLTL----....IL---------------------------------
D3EPX6_ATETH/2-167GF------LI-GTI-IRLIY-------------FFVI----....VM---------------------------------
C0QT82_PERMH/2-161IP------VI-GTA-TKIVY-------------LSLV----SLILIY---------------------------------
Q2JJ24_SYNJB/2-166GP------IV-GTA-VRVLY-------------LSLW----....AG---------------------------------
B7K2N6_CYAP8/2-167GF------VI-GTL-LRLLY-------------LGSI----....LT---------------------------------
K9Q2E8_9CYAN/2-167GF------LV-GTT-LRVLY-------------FSIF----....LL---------------------------------
A9WA62_CHLAA/2-176SL------II-SPL-LRLGY-------------FAAV----VYGLLL---------------------------------
H8GTR8_DEIGI/2-163TW------LL-GPL-TRLAY-------------VAVL----LGLVAG---------------------------------
K9XZT4_STAC7/2-167GF------II-GTV-VRLIY-------------LLIF----....CL---------------------------------
B2IUE8_NOSP7/2-166GP------II-GTI-LRILY-------------LGCL----....LA---------------------------------
E8UBR4_DEIML/2-163TW------LI-GPL-TRLAY-------------LGVI----VALVVG---------------------------------
K9QIC8_9NOSO/2-166GP------II-GTT-LRVIY-------------LSVL----....LA---------------------------------
B0JHJ8_MICAN/2-166GL------LI-GTI-FRLFY-------------FGSF----....LL---------------------------------
K9RQ06_SYNP3/2-166GP------IV-GTV-LRVAY-------------LIGW----....LS---------------------------------
D7BE64_MEISD/2-161TW------IV-GPL-TRLVY-------------MVLM----GALLWF---------------------------------
A5GPK9_SYNPW/3-163GP------LI-GTG-LRLAW-------------MQTV----VMVAWF---------------------------------
Q81WY4_BACAN/2-155TI------IL-GDV-IRIAY-------------MLIV----FSPFLF---------------------------------
W6FU87_NODSP/2-166GP------II-GTI-IRVIY-------------LGCF----....LA---------------------------------
B4UA61_HYDS0/2-160FP------IV-GTL-SRLLY-------------VLIL----VVFLYF---------------------------------
K9T9J7_9CYAN/2-167GL------II-GTI-LRIIY-------------LLIS----....TI---------------------------------
F0RKU1_DEIPM/12-173TW------VI-GPL-TRLAY-------------LAIL----VFLAVG---------------------------------
F2NN18_MARHT/2-164TW------IV-GPL-SRLAY-------------LVLL----LYLLGW---------------------------------
K8GJ34_9CYAN/2-177GP------IV-GTV-VRIVY-------------LLGW----VGACLA---------------------------------
D3PMR5_MEIRD/2-165TW------VV-GPL-TRILY-------------LGAM----GVLVYW---------------------------------
B0CCR6_ACAM1/2-165GP------II-GTI-LRLVY-------------LGVW----....LG---------------------------------
Q8DM71_THEEB/2-162GP------VV-GTL-IRLLY-------------LSFW----LGLGLG---------------------------------
P72876_SYNY3/2-165GF------LI-GTI-LRLLY-------------LGSW----LLLASA---------------------------------

PF04307

Q18EP1_HALWD/1-158SL------PF.AIP-IVLVV-------------LGYA....LITNRL.................................
Q65F12_BACLD/1-155SL------LF.LLI-TAFAA-------------HLYF....ADQSIL.................................
Q0W2I6_METAR/1-181SI------AG.AVA-TSVLF-------------AVIG....LIVVTMALP..............................
Q1AT01_RUBXD/1-176SL------LG.LAL-FCAPV-------------WLLL....GGYPAF.................................
Q7MS32_WOLSU/1-175SF------LF.PFG-VALPG-------------WGIA....SSQGIA.................................
Q8D1W8_WIGBR/1-169SL------LS.LFL-LYVII-------------FSNI....FNTNYV.................................
Q5WIF9_BACSK/1-182SI------PA.LLL-WPFII-------------SGGM....MLFFQD.................................
Q2NV14_SODGM/1-168SF------LA.IVG-CSIFL-------------SSDL....LSRIIIPIPV.............................
A0LXF8_GRAFK/1-182SI------IF.AII-FAPLF-------------GWII....SKIESKS................................
Q01PN8_SOLUE/1-175SP------FF.LAL-LAGVV-------------AAIV....ARGAAF.................................
Q0W4H6_METAR/1-165TL------LF.IAV-LAIIA-------------LLVA....RKYR...................................
YFHP_BACSU/1-182SI------PA.VLF-WSVII-------------PAIL....YLFYPQ.................................
Q5FTT4_GLUOX/53-213SG------VM.LLL-AAAAL-------------NGLM....GPESLR.................................
Q726Y1_DESVH/1-173SF------AG.GAL-LALLL-------------ALLF....ALPLRRA................................
C1DQI7_AZOVD/1-180SL------FV.LTG-FSLLL-------------AWLL....RRFRPH.................................
Q8ETE4_OCEIH/1-155SL------IF.LVL-IGYIL-------------TLIT....DNQSII.................................
Q5FK20_LACAC/1-175SL------LG.WII-FSTIL-------------YFCM....NHFSPIALSMS............................
A4XRV7_PSEMY/1-180SL------FV.LSG-LALLL-------------TWLI....RRYRPH.................................
Q2N9Y9_ERYLH/13-204GP------PA.LVL-LPLIL-------------AALL....WGFDRWQASRGNR..........................
Q023X2_SOLUE/1-190SI------AA.MPV-MALAA-------------VAIV....RFAGRKH................................
A9AVQ5_HERA2/1-166SV------GF.ATI-IASMG-------------ASFA....PRLGCKR................................
Q7VVQ6_BORPE/1-180SI------LV.LTA-LAAVM-------------AWLI....RRRWSD.................................
A6LWG2_CLOB8/1-169AP------LVYLFL-YSTAI-------------GMFT....DKLM...................................
A3CRK4_METMJ/1-159GL------TV.LFL-VVVAG-------------LILY....RYRR...................................
A1TRR8_ACIAC/1-179AL------LY.LSL-LAPLL-------------GALA....ARLHGEG................................
Q3J7C8_NITOC/1-183SV------VM.LPI-WGALL-------------ATLF....WRLRGKQ................................
Q8CV62_OCEIH/1-182SL------PA.IVI-WSFLV-------------SGLI....YLFVPE.................................
A0JUC0_ARTS2/1-250SV------LG.AAF-FVLLA-------------TIAG....QLQLHTDWGLLSVGAGLLCMFMINIAAKALKF.......
A1WTH1_HALHL/1-183SL------LL.LPF-WALLL-------------GWVV....ARLWPGQ................................
Q5V391_HALMA/1-161SL------PF.AIP-LSIVV-------------IAYA....VRTDRT.................................
Q97K38_CLOAB/1-212SI------LG.LIL-FTVGV-------------KLLL....GNIFIY.................................
Q1WSF6_LACS1/1-169SL------LG.FIL-IGIIV-------------KFIQ....KQYLTD.................................
Q0ACJ1_ALKEH/1-184SL------LL.LPL-WAALL-------------AVVF....ARVAPRLGG..............................
Q7N3N6_PHOLL/1-166SL------LA.LIL-GITLF-------------WLKI....PEEWLIPTD..............................
Q9KEC4_BACHD/1-182SL------PA.LFI-WPFLV-------------AGGI....WLLFPE.................................
Q1D144_MYXXD/1-188AL------VA.APL-VALTA-------------TLAA....RALFRG.................................
Q2JB37_FRASC/1-225SI------LF.ALG-MGVVM-------------GLLA....ARFEYGWWAALFVLVGFGLRGLGLDFEKHE.........
Q12UG8_METBU/1-174TF------LF.VLV-LFAMG-------------AIIH....KYHKEN.................................
A8GDN5_SERP5/1-166SL------LA.IAG-GMALF-------------QLDV....PRSWPIPPD..............................
Q5V568_HALMA/1-273SL------LLGAAL-AAAAG-------------LWAS....NSRATRIGSLSIGAVLTVLTGAVSGPIAGL.........
Q1ATT6_RUBXD/1-170SL------LA.LLL-VTAAL-------------GPLL....WWLTGQ.................................
A4J2S9_DESRM/1-180TL------LF.CLT-VGLIL-------------GVFV....AGIMGS.................................
Q8TQH1_METAC/1-199SI------LF.IAL-VTLFI-------------WVKT....RDWIF..................................
Q6D4I1_PECAS/1-166SL------LA.IVA-GIFFI-------------QTRL....PPDWPIPTD..............................
Q82XH5_NITEU/1-183SL------VM.LPF-WAFLL-------------AHLF....SRFTGGH................................
Q6YRT9_SYNY3/1-188SL------LA.SFT-LALVS-------------YALW....FAMPVI.................................
Q5HM58_STAEQ/1-158SL------LF.IIG-ISFLL-------------YFIQ....TPMYYM.................................
Q8TP13_METAC/1-172TL------LF.SLL-LFMIG-------------LYIY....QRNR...................................
Q0JZE4_CUPNH/1-185SL------LL.LPA-WGALL-------------AGLF....CLAAHRR................................
Q97LP7_CLOAB/1-199SA------AG.MIV-CTVLV-------------GYVA....NRYNIH.................................
A0PYB1_CLONN/1-199SL------IG.LIS-FTIIA-------------SYVG....KSYAIP.................................
Q9KE25_BACHD/1-180SL------LI.SPL-MAALA-------------VGII....YLVAFKKR...............................
Q3JF51_NITOC/1-164SF------LA.LMV-LAVLI-------------SPLL....WLKPVY.................................
A1K1W5_AZOSB/1-183SV------LL.LPL-WGALL-------------AGLF....ARLARLRDR..............................
Q6AMI9_DESPS/1-207SI------PF.CLL-MGEMG-------------YLLF....INSGATF................................
Q7NV83_CHRVO/1-166SL------LA.VVG-VFYAS-------------AACL....HDWGVRL................................
Q47U11_THEFY/1-250TP------VF.AAA-VGAVI-------------GLLC....HLSWWATLVTAWFLAFLGLRALRKVAWRGLRTA......
Q47RB2_THEFY/1-227SL------LF.ALL-LGGFA-------------QLLV....LWSELAAQIFVFLLIGIAFNGLGYGMEKNRV........
Q1QZR4_CHRSD/1-181SL------LV.LAA-LALSL-------------TLLA....RAGERWRRV..............................
Q5P1U0_AROAE/1-192SL------LL.FPL-WGMLL-------------AWVF....AALAGRHHR..............................
Q0BSQ9_GRABC/13-169SL------LA.IIA-CGWAM-------------QHSR....LPRTII.................................
Q5L2T9_GEOKA/1-182SI------PA.VVL-WPLLI-------------VSVM....AAIYPK.................................
A5CZD2_PELTS/16-203TL------FF.AAL-AGLIL-------------GITA....AIVLKA.................................
Q2S300_SALRD/1-182SL------VF.IAL-VSACA-------------AYGL....RRFHRDI................................
Q1DD75_MYXXD/1-235GV------LA.LAL-WPFVL-------------TGLM....LLWDRYVRRRRH...........................
A0KFP7_AERHH/1-165SL------LA.VAA-AIWGL-------------DQSL....APALLPTGV..............................
Q0VLL6_ALCBS/1-174SL------LV.LLP-VSFLL-------------AVCL....ARWQTR.................................
Q3A0M8_PELCD/1-203SV------PF.VAL-WALLT-------------MQIT....YSLGRN.................................
Q186I4_PEPD6/1-177SL------IALLLI-YSFFK-------------SLTI....FTNNNI.................................
Q2L2L1_BORA1/1-180SI------FV.LTA-FALLL-------------MWLI....RKRWPA.................................
Q67R78_SYMTH/1-176TL------VG.AAA-LSAAS-------------AGLL....AAAFPS.................................
Q97MS7_CLOAB/1-166TL------LF.SAV-LLCIG-------------LYRQ....LRHKKNG................................
A6TSU9_ALKMQ/1-172SI------PG.ILF-STLVI-------------TAGL....SLFFSE.................................
A6TMK4_ALKMQ/1-249SI------LF.LIG-CTLVV-------------RQIS....FFYGDI.................................
A3CVA2_METMJ/1-183GL------LF.LAL-LAVAG-------------IALY....RRRE...................................
Q9KAZ8_BACHD/1-159SL------LF.LLG-IYWLL-------------NWLP....VYSTDV.................................
Q0S8N5_RHOJR/1-250TA------LF.AAG-IGAGV-------------SALV....VQFGKPAIIATLFVCLGLALRGLAGELAKEK........
Q1IHJ9_KORVE/1-205TF------LG.VPF-VAAFV-------------LALVWSIRWAFLKLRNGQTLK..........................
Q890Y4_CLOTE/1-199SL------TG.MII-FSVIV-------------GYIG....NIYNLY.................................
Q0RHF1_FRAAA/1-228SL------VF.ALA-MGVAM-------------SLLA....DHSRYGWWAALFVLVGFGLRGLGLDFEGHE.........
Q1MS87_LAWIP/1-199SL------AG.AWG-LAFIC-------------TIPL....VVLTALRPQPNE...........................
Q11P46_CYTH3/1-219SL------LA.AAL-LAAVF-------------ICLR....KLFFKEESWKKY...........................
A6LXK9_CLOB8/1-172TL------IF.SLV-LILIG-------------IYML....NRNGKKN................................
Q2VZJ9_MAGSA/1-159SL------LA.VMG-GLAVL-------------MLVE....PGRGLV.................................
Q5YVJ3_NOCFA/1-233SL------LF.VVA-AAYGT-------------WAGM....HWIGRPFTLALAFFLLALAVRALHLYPPGDD........
Q8FRV6_COREF/1-249TI------WA.ALA-AGVGA-------------TALI....GAFGKTAVIGLLFFLLGLGIRGLLPEWSKKT........
A0KMD3_AERHH/1-197SL------LF.AFA-LPTLA-------------MLFH....RQFRASTA...............................
Q3JEV9_NITOC/1-176SL------LF.VPI-GGLVA-------------TVLL....WPFLRRR................................
Q9CNK9_PASMU/1-180SL------FV.LTA-LAFFI-------------TWLT....FKRHTN.................................
A1U6Q1_MARHV/1-174SL------FI.LAP-LSLLI-------------AWGL....WRWKPL.................................
Q7NWB9_CHRVO/1-187SL------AA.AAL-LAGLL-------------AWLC....RPVWQR.................................
O29079_ARCFU/1-168SL------VG.AGI-FSFIF-------------AILL....LIFGSS.................................
Q1MQD9_LAWIP/1-155WM------GW.YLL-LMILG-------------LMNF....PLKHFALSPI.............................
Q5WH30_BACSK/1-157SL------LF.LLL-ASIVL-------------RWLF....PDNEAV.................................
Q1GSW3_SPHAL/1-193GP------IA.MLA-LPIIL-------------WALV....MSFDRWQERRGKR..........................
A3CTE7_METMJ/1-243SF------PG.VGL-TTLVL-------------CGYL....ALILTWLGS..............................
YVSG_BACSU/1-155SL------LF.MLI-MFFIT-------------STYI....PDKNIS.................................
B1W5J1_STRGG/1-256TW------FF.AVL-MGAGC-------------SFAA....VTGGRWAVLAILFVHLVLAVEGLLWRAARVSSDILVWLL
B2FPD0_STRMK/1-181SL------LV.LPW-VAALI-------------WWLF....KRFGNGRVA..............................
Q5ZZH0_LEGPH/1-172SL------MF.IPI-GGLIV-------------ALFL....LCFSQYRQ...............................
Q6LSY8_PHOPR/1-173SL------FI.MLP-FSWLL-------------AQAW....QQWRPSRF...............................
Q74JJ2_LACJO/1-173SF------LG.WAI-FSGGL-------------YYLM....NKFIPIHINNLT...........................
Q7CIV6_YERPE/1-162SL------LA.VIA-GIALF-------------QVDA....PLNGVLP................................
Q7CJI4_YERPE/1-166SL------LF.AFA-LPTLL-------------LAFY....RFFNTSL................................
Q81YV9_BACAN/1-179SI------PA.VIL-WSFLI-------------SGIS....FAFFSDAP...............................
Q8Y6J4_LISMO/1-176SL------PM.LAI-WPLLI-------------SSIL....YLLFPAAT...............................
Q9HUK3_PSEAE/1-165SL------LF.ASI-LGALA-------------ALAC....RPLHSGP................................
Q9RMV6_BACAN/1-156SL------FG.LVL-VLIPI-------------LFAV....GMTPLS.................................
U5L8V8_9BACI/1-175SI------PA.VIL-WPLAI-------------LAVI....YPFFPEAN...............................

PF13803

C7QBS6_CATAD/1-242HR------VLRAPL-VGLLPVRWAAAA......DQLT-------------------------------------------
C0ZEY0_BREBN/1-241QY------VVKKPM-LARLP.............EWMG-------------------------------------------
K9WR57_9CYAN/1-241RY------VLMRPF-LALLP.............RQLA-------------------------------------------
D3EE91_GEOS4/1-236EK------VIRPVL-HVYLP.............SWFP-------------------------------------------
X2GTZ3_9BACI/1-237HF------FIHQTF-VHYLP.............NILQ-------------------------------------------
F8A675_CELGA/1-236WF------V.RLPL-RAL...............AGTA-------------------------------------------
Q1IN38_KORVE/1-247QV------AIKKPV-AGLLP.............VALQ-------------------------------------------
D2Q1R3_KRIFD/1-251HW------VLKRPL-VALAP.............PSLA-------------------------------------------
A6GZ02_FLAPJ/1-235HN------VVRDSL-FDNLP.............KFLK-------------------------------------------
D3V1B0_XENBS/1-240R.------LLSYPL-SVLFP.............ISFA-------------------------------------------
Q899W6_CLOTE/1-232IK------FIRIPF-ILNLP.............FGLS-------------------------------------------
G0FWC1_AMYMS/1-228YA------VLA.PV-LAFGPAGWRERV......PRPA-------------------------------------------
C2X225_BACCE/1-236HY------ILKKPF-ITHLP.............KPFA-------------------------------------------
Q8XML2_CLOPE/1-242HN------FIKSPL-ISHLP.............RPLD-------------------------------------------
A0Q1Y2_CLONN/1-242EY------IIKKPF-ILSMP.............QPID-------------------------------------------
I0E062_PROSM/1-239Y.------WLRVPL-SKVVP.............FQFP-------------------------------------------
Q6FEH5_ACIAD/1-242YV------LYRPFI-YRWLSLHDPLNL......NTLD-------------------------------------------
H1YCR9_9SPHI/1-235HN------TVKAAF-IANLP.............RELY-------------------------------------------
I4B9J2_TURPD/1-232QV------VIKKPL-LANMP.............QWFR-------------------------------------------
K4IBC3_PSYTT/1-233HN------IVRNDL-FDNLP.............TFLK-------------------------------------------
H2JVD3_STRHJ/1-251.L------LVREPL-LALLP.............RARQ-------------------------------------------
A5I0I6_CLOBH/1-248HR------IIKKPL-IAHGP.............KPID-------------------------------------------
Q65Q39_MANSM/1-229RL------ILATPI-KQHLPAFCGSNV......PQVT-------------------------------------------
F4FE12_VERMA/1-233RS------SIG.TV-AAHLPQNRRFGWWVDGPPAGGG-------------------------------------------
C6D3J1_PAESJ/1-240HY------VVKSSL-ALHLP.............SLFD-------------------------------------------
A3HWD2_9BACT/1-236HC------LIKMPL-FKASP.............KWFQ-------------------------------------------
Q7UP84_RHOBA/1-249HL------LIKQPV-VELLPGPLRTKV......RPIA-------------------------------------------
A8L7F5_FRASN/1-232FC------LARDAL-LDLAPDPVRLRL......PPRA-------------------------------------------
D2ARI2_STRRD/1-246HG------LLRDPL-TALFP.............PALA-------------------------------------------
Q0RF10_FRAAA/1-232FH------LTRDAL-VDLAPGPVRLRL......AARA-------------------------------------------
C7R2G7_JONDD/1-241VA------CAR.PA-LWVLPESGST........PQTP-------------------------------------------

PF00882

A0A090C0Q9_ACIBA/1-206YL......LYRPVV-YRFFG-------------IQH.-------------------------------------------
C6RSF9_ACIRA/1-206YL......IYRPAL-YRFLG-------------IQK.-------------------------------------------
B7H911_BACC4/1-208HY......ILKKPF-ITHLP-------------KPF.-------------------------------------------
C2XYJ1_BACCE/7-214HF......ILKGPF-ITHLP-------------KPF.-------------------------------------------
B1B9W2_CLOBO/1-214EY......IIKRPF-ILSMP-------------QPI.-------------------------------------------
C5VRK3_CLOBO/1-214NY......IIKKTF-ILSLP-------------HPF.-------------------------------------------
A3I5H3_9BACI/4-213HR......FIHQPI-MSHLP-------------EFL.-------------------------------------------
Q0SV58_CLOPS/1-213HN......FIKSPL-ISHLP-------------RPL.-------------------------------------------
C6JKD9_FUSVA/1-208HN......LIKEAL-INNMP-------------LFF.-------------------------------------------
A1ZM58_9BACT/1-209HQ......IVRNVL-IDNLP-------------FFL.-------------------------------------------
C0DX83_EIKCO/1-211LA......LWHHTL-RDFLP-------------DCLN-------------------------------------------
D4DQE9_NEIEG/58-261LA......LWRDTL-SDFLP-------------NCLN-------------------------------------------
C0B3N4_9ENTR/1-204NY......LFRNPL-KCVSP-------------IPL.-------------------------------------------
D4BTR9_PRORE/1-203VQ......KSVFYL-HYAVP-------------FPL.-------------------------------------------
Q2LV15_SYNAS/6-198........ENIDGF-ILEGI-------------KKLS-------------------------------------------
Q2Y883_NITMU/6-188........QRTGDM-IKAGV-------------EWIR-------------------------------------------
A7K2D4_VIBAE/6-189........NHVGKL-IDALI-------------QQVK-------------------------------------------
A4C3L5_9GAMM/6-186........EKTGDV-IKAAV-------------HYCK-------------------------------------------
C9YFH3_9BURK/6-183........KNTATL-LRSGI-------------NAVQ-------------------------------------------
Q12DA4_POLSJ/6-186........TRNASL-LRVGV-------------AAVA-------------------------------------------
C4XMP3_DESMR/34-221........KNVSER-IGAGV-------------AAVS-------------------------------------------
E6VSV5_DESAO/6-180........ANGEDT-FALIR-------------LLTD-------------------------------------------
Q2LQI8_SYNAS/6-189........YNASRA-FNPFG-------------PLAR-------------------------------------------
B8FCF0_DESAA/6-187HFLHGKDGENTFAP-LTGLV-------------EAYQ-------------------------------------------
B3E8I7_GEOLS/6-161........PAGSSY-APLLH-------------YAEN-------------------------------------------
A1AT46_PELPD/6-164........ATGNSY-APLIR-------------VETS-------------------------------------------
C6Y3Y4_PEDHD/24-233PW.......QIQKS-YYKLV-------------HALR-------------------------------------------
E6U8V9_ETHHY/5-158FS......DVSMDF-VLGRA-------------TALY-------------------------------------------
Q1IVJ5_KORVE/32-215........VRAGDF-VASLF-------------RNAQ-------------------------------------------
C1F375_ACIC5/44-227........VRTGAF-VTALL-------------RDSR-------------------------------------------
Q01WM2_SOLUE/25-208........VRSGDF-ILNMI-------------REAQ-------------------------------------------
Q1ISY5_KORVE/28-210........VRSGDF-VVNLI-------------NESD-------------------------------------------
Q025L8_SOLUE/39-222........VRTGEF-VENLV-------------KEAQ-------------------------------------------
Y1571_ARCFU/28-204........YYVNDA-LNIAN-------------KMLS-------------------------------------------
Q01YQ6_SOLUE/23-198........GSLVYL-FERIV-------------SNLA-------------------------------------------
Q8XI18_CLOPE/5-158YL......DESFDM-IVNKI-------------KKLA-------------------------------------------
R5X8W2_9CLOT/5-160YL......KESFDM-IIGKI-------------KSLC-------------------------------------------
B6FWP7_9FIRM/5-161YM......EESFNM-IIEKI-------------KYLC-------------------------------------------
Q18BT1_PEPD6/5-159YL......DESFNM-IVSKI-------------NYLC-------------------------------------------
D3MTQ6_9FIRM/3-156YL......DESYTM-IKTKI-------------EKMS-------------------------------------------
A0A0C2S6D2_CLOBO/4-161YF......IESIDM-IIKKI-------------EKLC-------------------------------------------
C4IEN4_CLOBU/4-161YY......DESIDM-IIDKI-------------IHLS-------------------------------------------
A6LQ77_CLOB8/4-161YF......NESINM-IIEKI-------------IHLS-------------------------------------------
B1BFH6_CLOPF/5-161GR......KQFEEI-IDEKV-------------KELS-------------------------------------------
Q97KV3_CLOAB/5-155TL......NESLDS-LIEYS-------------NKLV-------------------------------------------
B0P7T6_9FIRM/16-171FK......KDIYDL-VMERA-------------ERLA-------------------------------------------
C0ECW5_9FIRM/5-161YK......PYMYDI-IKQEL-------------RDLA-------------------------------------------
A8MHU0_ALKOO/5-164FK......PQSFDF-VCNNI-------------NDLS-------------------------------------------
A6TNX7_ALKMQ/5-165FK......PQSFNY-ICEQI-------------QDLS-------------------------------------------
B2A897_NATTJ/5-148EY......LHLKKW-FLNYF-------------EKTL-------------------------------------------
R6RM69_9FIRM/5-161TF......DITYDK-IENQL-------------DDFV-------------------------------------------
B0NZS3_9CLOT/15-171KF......DITFDD-IERKI-------------SKFI-------------------------------------------
R7D6R4_9FIRM/20-175EY......FGTFDE-VQGKI-------------RRLV-------------------------------------------
C6J9X9_9FIRM/5-161EF......YGTFED-VKNRM-------------KELT-------------------------------------------
C6LKS6_9FIRM/5-161EF......YGTFDK-VSDNI-------------RSLL-------------------------------------------
D4KRQ8_9FIRM/5-161EI......NGTFPY-VKKHI-------------ARLS-------------------------------------------
D9SRM2_CLOC7/5-162YK......EEAKDY-VYKMI-------------EKVF-------------------------------------------
A6LQR0_CLOB8/5-160SK......NEDWEK-VIGII-------------DEII-------------------------------------------
B0S165_FINM2/8-177YK......EESINY-IVKEI-------------ITII-------------------------------------------
D1VUW6_9FIRM/8-182YQ......KESINF-ISKEI-------------SNLI-------------------------------------------
C4IIQ3_CLOBU/5-155FY......KKSDKY-VEEKL-------------DDLL-------------------------------------------
C4Z638_EUBE2/40-187TW......DSSYNK-VSRRL-------------QRLE-------------------------------------------
A7VFQ0_9CLOT/5-152TW......KSSFDN-TVNRI-------------QKLE-------------------------------------------
C0EWT7_9FIRM/5-150TW......EATFEQ-ITKQM-------------EALE-------------------------------------------
R5WI53_9FIRM/5-162NY......ENVMKY-MEKLT-------------KKLE-------------------------------------------
D4LBU1_RUMC1/5-160NA......ENAGKH-LARLT-------------QKLH-------------------------------------------
Q315K4_DESAG/47-177........WETAHT-LLRSA-------------DSPR-------------------------------------------
B8DLU9_DESVM/18-149........WSTGHT-LYEAA-------------DTPR-------------------------------------------
C7LVT1_DESBD/24-155........WDTGRS-LLRQA-------------EDTQ-------------------------------------------
C6BUV8_DESAD/29-160........WQTGFN-LLNES-------------TDKH-------------------------------------------
C8X0X8_DESRD/29-159........WRTGFR-LLEGN-------------RDQA-------------------------------------------
A5G5N0_GEOUR/25-157........WRIGLK-ILENA-------------EKDA-------------------------------------------
E8WRC5_GEOS8/30-162........WRIGHR-VLDKA-------------GDPA-------------------------------------------
A1AK53_PELPD/24-156........WSVGNK-VLLVA-------------GNDD-------------------------------------------
B3EBK7_GEOLS/25-157........WRVGAR-LLQSA-------------QDDP-------------------------------------------
Q3A306_PELCD/29-161........WRIGCR-ILDAA-------------KDDA-------------------------------------------
Q1K0Z2_DESAC/27-159........WNMGFK-VLDAA-------------ENDA-------------------------------------------
C1A8N1_GEMAT/19-151........WHVGLE-IHDEA-------------DSPA-------------------------------------------
B8J577_ANAD2/33-165........WRVGFN-VFKQA-------------KPGA-------------------------------------------
D6SRA3_9DELT/26-149........WETGFM-LLQAA-------------GKRT-------------------------------------------
B5YG53_THEYD/20-144........WKTGLC-LLNEA-------------KTPE-------------------------------------------
Q1H382_METFK/30-174........WENAHQ-MLANA-------------SGDE-------------------------------------------
C6X6W6_METGS/30-174........WQHAYG-LLSRA-------------RTDE-------------------------------------------
C6WXF1_METML/56-200........WKSAHQ-LLAAA-------------QSDE-------------------------------------------
D5CMM4_SIDLE/28-177........WQRARK-LLDDA-------------KSDE-------------------------------------------
B0SPX5_LEPBP/6-211HH......HKVAEL-ILSFL-------------DQVY-------------------------------------------
A0A022SYW6_LEPIR/6-211HH......NSVAEL-VLSFL-------------DLIL-------------------------------------------
C8W7P0_ATOPD/6-209YLLQHDFIQPNVTY-CSVEQ-------------RSLV-------------------------------------------
C5DV22_ZYGRC/30-228HW.........PQF-LVNAV-------------KLWH-------------------------------------------
B5VL45_YEAS6/30-234HW.........PNF-LMIAV-------------SYWQ-------------------------------------------
C5DKM1_LACTC/24-220HW.........PAF-LVQGA-------------KLWR-------------------------------------------
Q6FL70_CANGA/25-242HW.........SPF-LELAI-------------NYWR-------------------------------------------
Q6CEF9_YARLI/23-229HW.........PPF-LAAGV-------------NYWR-------------------------------------------
C4R8D0_PICPG/19-213HW.........PKL-LGAFI-------------EDYR-------------------------------------------
Q8R432_MOUSE/28-220HW.........TPF-LNASI-------------HYIR-------------------------------------------
C3ZWC6_BRAFL/5-194HW.........SEF-LNVTI-------------THIR-------------------------------------------
A7SED1_NEMVE/31-226HW.........VPF-LNATV-------------NYIR-------------------------------------------
D3AZT7_POLPA/38-225HW.........PPF-LRNAS-------------EYLL-------------------------------------------
PLDG_DICDI/29-216HW.........PPF-LRAAT-------------KYLL-------------------------------------------
Q97TF6_CLOAB/60-232........TKFEEH-AANAV-------------SSYR-------------------------------------------
A7B1H2_RUMGN/72-243AR......TRAESY-FQAAV-------------NAYR-------------------------------------------
PHLC_CLOHA/37-230GE......SQLRKL-FALAK-------------DEWK-------------------------------------------
A0PXH4_CLONN/38-231AE......SQVRKF-TALAR-------------NEWE-------------------------------------------
Q5PXE6_CLOPF/38-231GE......SQIRKF-SALAR-------------YEWQ-------------------------------------------
Q8GCY3_9CLOT/38-231AE......SQTRKF-ATLAK-------------NEWD-------------------------------------------
PHLC_CLOSO/38-231AE......TQVRKF-ATLAE-------------NEWK-------------------------------------------
Q6R6B7_LISSE/64-245AK......DTGTKY-FNISI-------------EEYQ-------------------------------------------
Q6EAE3_LISMN/64-245AK......ITGAKY-FNQSV-------------TDYR-------------------------------------------
Q6R6D6_LISIV/62-243AK......QTCGKY-FKQAL-------------QDYK-------------------------------------------
A0R9W0_BACAH/51-232AK......ETGAKY-FKLAG-------------ESYK-------------------------------------------
A5D2J5_PELTS/29-178AR......LECKAF-FKMAL-------------SNWQ-------------------------------------------
Q896L3_CLOTE/34-205AL......LECKKY-YDKSL-------------ENLE-------------------------------------------
A5N896_CLOK5/34-205AL......TECRKY-YSQSL-------------QLFN-------------------------------------------
Q97KA0_CLOAB/34-205LV......DEAQKY-YNMSL-------------NYLR-------------------------------------------
A6TKQ8_ALKMQ/57-228AM......ELGVDY-YFQAI-------------GLWR-------------------------------------------
O26214_METTH/27-173........LEKANF-WLNQG-------------KISY-------------------------------------------
B8I5G2_CLOCE/32-236YG......MYANDY-TNLNG-------------YITC-------------------------------------------
B5HQN8_9ACTN/67-292L.......LLREPL-VALLP-------------RRR.-------------------------------------------
Q82A31_STRAW/92-336L.......VLREPL-VALLP-------------RAR.-------------------------------------------
C9YWP6_STRSW/1-225L.......VLREPL-VALLP-------------KGR.-------------------------------------------
B4V801_9ACTN/61-287L.......LLREPL-VALLP-------------PAW.-------------------------------------------
D3D9A1_9ACTN/1-206CH......LVRDAL-VDLAP-------------DAV.-------------------------------------------
A7C3K4_9GAMM/1-217HR......ILKQPL-FSLFP-------------ISH.-------------------------------------------
B9XK96_PEDPL/41-256QH......LLKKPL-FLLLP-------------ANH.-------------------------------------------
D9T3L8_MICAI/1-213RR......VIAGIA-VHLPG-------------QRLF-------------------------------------------
C1ACE2_GEMAT/1-206TT......RLLPAL-VPYLR-------------DHP.-------------------------------------------
C0VQ51_9GAMM/1-206YL......LYRPVL-YRLFV-------------IRD.-------------------------------------------
D0SL80_ACIJU/1-206YL......IYRPVM-YRVLG-------------IIH.-------------------------------------------
D0SG75_ACIJO/1-206YA......LLRPCF-YRFLG-------------IQH.-------------------------------------------
D0SS47_ACILW/1-206YL......IYRPVI-YRFIG-------------IQH.-------------------------------------------

PF02265

ENDO2_ARATH/28-290DCKD.ES.GEKGRC.VAGAI-------------YNYT-------------------------------------------
ENDO5_ARATH/21-288DCHD.TH.KHKDWC.VTGAI-------------FNYT-------------------------------------------
A4H6V5_LEIBR/29-297NI.PLTI.NPVEIVNVASVI-------------PMLV-------------------------------------------
Q8F3Z8_LEPIN/21-283THDDIEK.ICKSTC.VVAEI-------------DKWS-------------------------------------------
B0T6T3_CAUSK/23-287SATPASA.GPEKDC.IVGRL-------------NAFE-------------------------------------------
F2G2Z7_ALTMD/28-265TYNE.VS.APKQGD.AVTAL-------------KQFT-------------------------------------------
Q66VY6_LEIMA/29-300SD.FTLEFSPVQTVNVASVI-------------PMLE-------------------------------------------
Q7S8Q5_NEUCR/20-297DC.P......PEGC.VVSAI-------------GNYT-------------------------------------------
Q5KPJ8_CRYNJ/20-279CEFGQHG.WQNEDVNVITAI-------------QNFT-------------------------------------------
Q236I4_TETTS/18-296GLYVILD.QDNQVYNSITGI-------------KRAI-------------------------------------------
Q4DEV4_TRYCC/28-293NINIKK..NPVNTENLKTVI-------------ESLK-------------------------------------------
Q0CD39_ASPTN/21-282DC.P......NGDC.IISAM-------------EAMT-------------------------------------------
Q2SFD4_HAHCH/50-295RVSTAEN.CESKGC.VLTAL-------------NAYA-------------------------------------------
Q585P6_TRYB2/27-292GFKPNV..TLKQKSDVVSVI-------------NGLS-------------------------------------------
Q989R8_RHILO/21-270VSQCAAN.VQ.GDC.AIAEI-------------DRAE-------------------------------------------
ENDO1_ARATH/29-294DCHD.QH.GLKDMC.VDGAI-------------QNFT-------------------------------------------
A4CQ68_ROBBH/22-257.....EI.TPNPDGDILQGI-------------EHCI-------------------------------------------
A3U8L7_CROAH/33-268.....EA.EKNPKGDIIVAI-------------NECM-------------------------------------------
A7H7R9_ANADF/28-274AFDPARD.CPREAC.VVAAL-------------ERAI-------------------------------------------
Q7P202_CHRVO/23-274CSGVTEDECPDGNC.AANQI-------------DRYR-------------------------------------------
A0BML4_PARTE/16-293GLQIKIE.DQARNINSIYAI-------------NSAT-------------------------------------------
A7EWS3_SCLS1/21-282DC.G......SSGC.VVSAI-------------QNYT-------------------------------------------
Q3IBZ8_PSEHT/27-268N.HSHTK.NKESVTNILEGI-------------HYSI-------------------------------------------
A7ETG5_SCLS1/21-277DC.G......EEGC.VVGAI-------------LNFT-------------------------------------------
A0M3W8_GRAFK/24-260.....EE.EANKSGDLVQAI-------------KKCV-------------------------------------------
A0BLJ0_PARTE/422-699GLLIKIE.DESRNINSIYAI-------------NQAV-------------------------------------------
A4HJL3_LEIBR/28-299PS.FTLDVSPVQTVNVASVI-------------PMLE-------------------------------------------
Q0TYV6_PHANO/20-284DC.P......EEGC.IISAL-------------ANYS-------------------------------------------
ENDO3_ARATH/25-286DC.......PKDWC.VTGAI-------------FNYT-------------------------------------------
Q0AMT2_MARMM/26-282HVD.AED.CAEDGC.ITSAI-------------DLHA-------------------------------------------
Q4Q7F3_LEIMA/31-295DINIT...DPVATVNAVTVS-------------RNMV-------------------------------------------
Q5NRA3_ZYMMO/33-298RSNPMKN.GGAQPC.VVSQL-------------DRFE-------------------------------------------
A5V871_SPHWW/21-280PFEIKGN.CPDGNC.VSRQV-------------ERQL-------------------------------------------
Q5FP59_GLUOX/25-298AYDQARD.CPDHVC.VVEKL-------------PEEI-------------------------------------------
Q0UA95_PHANO/19-289DC.A......KGGC.VVSAI-------------ANQT-------------------------------------------
NUS1_ASPOR/21-284DC.G......SAGC.SISAI-------------QNYT-------------------------------------------
A4HI96_LEIBR/31-295GINIT...DSVEAVNAVSVS-------------LDMI-------------------------------------------
Q7XPN4_ORYSJ/27-283DCHN.TN.GEKDMC.VVGAI-------------NNYT-------------------------------------------
Q01U80_SOLUE/19-261HLDMERD.CPKGDC.VIAKI-------------EDFE-------------------------------------------
A2QX99_ASPNC/21-292DC.P......PEGC.IISQM-------------ANMT-------------------------------------------
A2TWS6_9FLAO/25-260.....ES.AKNPKGDLVTGI-------------AKCI-------------------------------------------
Q2UHT0_ASPOR/21-283DC.E......TTGC.IISLM-------------KDMT-------------------------------------------
Q2H4S7_CHAGB/217-488DCKK......DRGC.VVSAL-------------HNYT-------------------------------------------
Q15ZB2_PSEA6/20-256.....DV.GAPEQGDGVSAL-------------KMFT-------------------------------------------
A4I736_LEIIN/27-297DF.TLDV.SPVQTVNVASVI-------------PMLQ-------------------------------------------
B2FSF8_STRMK/27-269HYEAPKH.CRNGNC.IVEAL-------------KAQS-------------------------------------------
G3XKQ7_SOLLC/26-290DCHD.QH.GVKDMC.VAGAI-------------QNFT-------------------------------------------
I1KHQ2_SOYBN/27-290DCVDYKK.GIKGRC.VVAAI-------------NNYT-------------------------------------------
I1MEB5_SOYBN/33-297DCHD.PQ.GVEDMC.VAGAV-------------KNFT-------------------------------------------
I1PPP5_ORYGL/30-294DCHG.PD.GAEDMC.VAGAI-------------ANFT-------------------------------------------
M7YSG5_TRIUA/24-280DCHD.TK.GNKNVC.VVGAI-------------NNYT-------------------------------------------
Q1K6E5_NEUCR/21-291GIIYERD.CKPEGC.VVSAI-------------QNYT-------------------------------------------

PF09988

Q8YZE9_NOSS1/2-166----------------------------------------ILTVV............ILAVV--DKLWNVTV.......T
K9TIP1_9CYAN/2-166----------------------------------------AIAFG............VVLVG--DYLGLFTW.......N
B2VAC8_SULSY/2-161----------------------------------------LLKLL............INFLI--P...............
A5UV55_ROSS1/2-173----------------------------------------WGAWI.................--..............LG
K9VXZ1_9CYAN/2-166----------------------------------------VLTLL............FLVVT--NLLLGWQW.......N
K9X512_9NOST/2-158----------------------------------------ILAV................VG--AKLGNVRF.......N
Q10Y23_TRIEI/2-165----------------------------------------VLAML............GL.IV--DKLLGLDL.......S
K9R5N7_9CYAN/21-185----------------------------------------IVTII............VLLIA--EKLLNMTL.......S
Q7U3L4_SYNPX/2-155----------------------------------------LIGWP.................--................
K9UM54_9CHRO/2-166----------------------------------------LVGLF............YVGIA--RLAGAKTY.......T
D7CX68_TRURR/2-172----------------------------------------AASEI.................--................
K9S824_9CYAN/2-177----------------------------------------SLGVF............LWAIA--QQGVGASA.......S
U5QDG6_9CYAN/2-166----------------------------------------CLGLP............LAFVL--EDWGDVPL.......H
Q9RT76_DEIRA/5-173----------------------------------------VLKFA.................--................
B1XNI7_SYNP2/2-167----------------------------------------FITII............GVAIA--QLMFDFSW.......N
K9YHE6_CYASC/3-166----------------------------------------LLGIV............LGAIA--LITFPQIW.......Q
K9U5M5_9CYAN/2-166----------------------------------------ILGLF............FLGIA--QFVWNVGW.......H
K9XH03_9CHRO/2-166----------------------------------------FLGIF............VIGVV--HLIWGVEL.......S
B7KDH5_CYAP7/2-167----------------------------------------LLAIP............LIAIA--QLILGFDW.......N
D7DZB9_NOSA0/2-166----------------------------------------VVAIL............VLVVF--AKLGNVAF.......N
K9VNR5_9CYAN/2-166----------------------------------------VFGVL............GLAIA--EKVGNLGG.......N
A9B0N7_HERA2/2-170----------------------------------------LSFYL............GMTLI--N..............S
Q8XL51_CLOPE/2-170----------------------------------------LLYSF.................--................
G2LLI8_CHLTF/2-174----------------------------------------AVLYVRAVWIDGLPADGDQAVR--T...............
E4UAQ6_OCEP5/2-167----------------------------------------GLSLLPGMGTTLEPLTTTKWLL--SPVGG...........
B1X0E2_CYAA5/2-167----------------------------------------IVAIF............VVAIA--QFIWGFPW.......N
Q7NFX0_GLOVI/2-166----------------------------------------SLGVP............GALVF--ERLAGVSI.......D
K9Z9T5_CYAAP/2-167----------------------------------------ILAIL............GVAIA--QLIFGFGW.......H
L0A273_DEIPD/2-163----------------------------------------LLHFL.................--................
K9WE31_9CYAN/2-166----------------------------------------LVGIL............ILGVV--QLFRDVPW.......S
K9V8T7_9CYAN/2-166----------------------------------------LPSLI............LLVVV--EKLGNMAL.......N
Q7V3X6_PROMM/2-159----------------------------------------LLQPL.................--................
B8HTG8_CYAP4/2-166----------------------------------------LPIGF............LLLLQ--HYFGFWNW.......N
C1CV84_DEIDV/5-166----------------------------------------LLRYV.................--................
Q31N47_SYNE7/7-176----------------------------------------LVLVI............ETAIA--IGQGG..........N
S0EUE8_CHTCT/2-170----------------------------------------LLSWV............GVWLW--N.............QC
E0U8U0_CYAP2/2-167----------------------------------------LIAIP............AVAIT--QLFLGFDW.......N
D3EPX6_ATETH/2-167----------------------------------------IFTIF............INMVI--QFFLGSTY.......N
C0QT82_PERMH/2-161----------------------------------------IFIFS............LKYAF--PDLDIQIL........
Q2JJ24_SYNJB/2-166----------------------------------------GVGLL............GAWLG--SQLGWWMWQPWVWGSD
B7K2N6_CYAP8/2-167----------------------------------------LVAIL............GVAIA--QLIWGFDW.......N
K9Q2E8_9CYAN/2-167----------------------------------------VVGII............GVAIA--QGVWGFDW.......N
A9WA62_CHLAA/2-176----------------------------------------GIGWC.................--..............LG
H8GTR8_DEIGI/2-163----------------------------------------IVRVA.................--................
K9XZT4_STAC7/2-167----------------------------------------LLAIF............VVAIL--QLIWGFEW.......N
B2IUE8_NOSP7/2-166----------------------------------------ILAIL............VLAIA--EKLWNLSF.......T
E8UBR4_DEIML/2-163----------------------------------------LVAFL.................--................
K9QIC8_9NOSO/2-166----------------------------------------ITALI............VLVII--EKLGNTTF.......N
B0JHJ8_MICAN/2-166----------------------------------------LAAII............IIPIL--QSFWGIDW.......D
K9RQ06_SYNP3/2-166----------------------------------------LIGFG............LGWVG--QETGWWTW.......R
D7BE64_MEISD/2-161----------------------------------------GGEAL.................--................
A5GPK9_SYNPW/3-163----------------------------------------TLSAL.................--................
Q81WY4_BACAN/2-155----------------------------------------LLNVI.................--................
W6FU87_NODSP/2-166----------------------------------------LVAIA............FLLVG--EVFGIVTL.......T
B4UA61_HYDS0/2-160----------------------------------------VIVGI.................--..............MS
K9T9J7_9CYAN/2-167----------------------------------------AIATP............GVAIA--QLIWGFDW.......N
F0RKU1_DEIPM/12-173----------------------------------------ALRTF.................--................
F2NN18_MARHT/2-164----------------------------------------VAGGA.................--................
K8GJ34_9CYAN/2-177----------------------------------------VIGLV............SAIAY--QLTGEFETWTQFFQQY
D3PMR5_MEIRD/2-165----------------------------------------FFTTL.................--................
B0CCR6_ACAM1/2-165----------------------------------------LGAML............AGLLL--SQVWGVPV.......N
Q8DM71_THEEB/2-162----------------------------------------LIAGV............AACTG--HLRGLQEWLHHWWRVD
P72876_SYNY3/2-165----------------------------------------GIGTV............LILLQ--KL.............N

PF04307

Q18EP1_HALWD/1-158...............................HLGTG...-FSVG.------------..YLL..HLPGDWHTRLL.NGEI
Q65F12_BACLD/1-155..................................VG...-LMAG.------------..MAS..HLLLDAGTV......N
Q0W2I6_METAR/1-181............................AYGPVSPIL.A-ILAAI------------AGGLS..HIVLDYLAY......P
Q1AT01_RUBXD/1-176.................................ALA...-LAAG.------------..YAS..HLLADALNT......R
Q7MS32_WOLSU/1-175..............................LEAVIG...-LWLG.------------..VWL..HLIGDMLTK......S
Q8D1W8_WIGBR/1-169..............................FPLDFSY.S-LLVG.------------..YFS..HILADFFTP......F
Q5WIF9_BACSK/1-182..............................AYWPTI...-LLWAA------------ISVFL..HVFVDIFNA......Y
Q2NV14_SODGM/1-168..........................DFVHA........-MIVG.------------..YIS..HVVADMLTP......A
A0LXF8_GRAFK/1-182.............................EANWKNW...-SWLMF------------WGLFT..HPLLDAHTT......W
Q01PN8_SOLUE/1-175..............................RWLAIV...-WAAA.------------..AIT..HPLLDMLTDG....GS
Q0W4H6_METAR/1-165..............................YWGVGV...-LTVS.------------..AAF..HQVEDQMWN......A
YFHP_BACSU/1-182..............................ADFLHL...-WLWTL------------LAVVL..HVFVDIFNA......Y
Q5FTT4_GLUOX/53-213...............................GPWGA...-LLLG.------------..AGT..HIAAD.LPT......G
Q726Y1_DESVH/1-173.............................PQGWGFAK.V-WGVSY------------ALVLV..HIWLDAITT......Y
C1DQI7_AZOVD/1-180..............................PGYGGGR.L-FLALW------------LVLAT..HVLLDSLTS......Y
Q8ETE4_OCEIH/1-155..................................MG...-VLVG.------------..MAS..HLVLDACTK......N
Q5FK20_LACAC/1-175..........................KSPNYWESIWL.G-LVIG.------------..YLL..HLIEDSFSR......Q
A4XRV7_PSEMY/1-180..............................PGYSDRR.L-LLTLW------------LVLIT..HPLLDAFTS......Y
Q2N9Y9_ERYLH/13-204........................PEGRRPVSFKWL...-FLLSF------------IGCLT..HPALDWLNV......Y
Q023X2_SOLUE/1-190..............................VRWTAA...-FFAAL------------IAVAS..HLLLDWTNV......Y
A9AVQ5_HERA2/1-166..............................WVAGLT...-LFLA.------------..VLS..HPLYDMLTNG....GS
Q7VVQ6_BORPE/1-180..............................APYSGRR.L-FATLL------------LVLVT..HPVLDAFTV......Y
A6LWG2_CLOB8/1-169..............................LIGING...-IFLG.------------..IFS..HLVLDSLTI......G
A3CRK4_METMJ/1-159..............................RIDLFA...-VAAG.------------..MAS..HQFFDGMWR......H
A1TRR8_ACIAC/1-179..............................FQWKRW...-WLALW------------LALAT..HPLLDWMTV......Y
Q3J7C8_NITOC/1-183..............................KPWQVY...-FGVSL------------LGISI..HIAGDVITA......Y
Q8CV62_OCEIH/1-182..............................VSYLHL...-WLWTL------------LAVVI..HVFVDLFNA......Y
A0JUC0_ARTS2/1-250....FPKSGFISNWLFALTMAGLVTWFAPDQWTWLPV.S-MLTG.------------..VAV..HIVGDMITT......G
A1WTH1_HALHL/1-183..............................RDWRDG...-ALIFA------------LGTGI..HIFGDWITN......Y
Q5V391_HALMA/1-161...............................RLGTA...-FAFA.------------..HLS..HLVADNQQLLPPNLYV
Q97K38_CLOAB/1-212.......................................-FAVG.------------..FIS..HMVADTFTN......S
Q1WSF6_LACS1/1-169..............................RIENIVF.W-LMLG.------------..YLL..HLLEDSFSQ......R
Q0ACJ1_ALKEH/1-184............................GRYGWRAW...-YAAAA------------VALLV..HILGDLITS......Y
Q7N3N6_PHOLL/1-166...........................FFHA........-MIVG.------------..YLS..HLIADMLTP......A
Q9KEC4_BACHD/1-182..............................SAFFTL...-WLWSF------------IAVFL..HVFVDIFNA......Y
Q1D144_MYXXD/1-188.................................ARLA.P-VFLTS------------LASVVFAHLLPDLWTG......W
Q2JB37_FRASC/1-225.......HWSSVMDCVTAGVAVFLMHGIDMSFAGYA...-VTLG.------------..CLA..HLAGDCLTP......R
Q12UG8_METBU/1-174..............................GTGMII...-LSIA.------------..SFM..HLLQDRMWT......V
A8GDN5_SERP5/1-166...........................VLHA........-MIIG.------------..YFS..HLLADMLTP......A
Q5V568_HALMA/1-273.......VMLVFVLAVLGVATVAQSRDVSPRTVTGL...-ALLG.------------..LLT..HPFGDLFTG......G
Q1ATT6_RUBXD/1-170..............................PATMIA...-VGVG.------------..YGS..HLFADMMTL......G
A4J2S9_DESRM/1-180..............................AFLIFS...-GTAG.------------..AIS..HLVLDGMTR......S
Q8TQH1_METAC/1-199.......................................-TYGGF------------QSIFL..HVYLDYVTT......W
Q6D4I1_PECAS/1-166...........................AYHA........-MIVG.------------..YLS..HILADMLTP......S
Q82XH5_NITEU/1-183..............................YPWRSF...-FVPAC------------LGIMI..HILGDLVTA......Y
Q6YRT9_SYNY3/1-188...............................PLVIVH.A-LNIG.------------..YFA..GWFLDCFTK......S
Q5HM58_STAEQ/1-158..................................VA...-IVIG.------------..MFS..HVILDILTP......R
Q8TP13_METAC/1-172..............................DIRGLS...-LTAG.------------..SFL..HLFEDQMWF......D
Q0JZE4_CUPNH/1-185..............................EAWREA...-FAVSC------------LGVAS..HIALDLVTV......Y
Q97LP7_CLOAB/1-199.................................VIIY.Y-FMAG.------------..YGL..HLLCDMSTS......R
A0PYB1_CLONN/1-199.................................ASAY.Y-FVIG.------------..YGM..HLFCDMATK......M
Q9KE25_BACHD/1-180............................KELSWKWI...-YFLSF------------FSVLS..HLGADWLTT......W
Q3JF51_NITOC/1-164.................................FGC...-ILGG.------------..YWS..HLWIDMLNL......R
A1K1W5_AZOSB/1-183............................RGPDWPAF...-YGLAC------------AGIAI..HIAGDLITQ......F
Q6AMI9_DESPS/1-207.............................ALIVGFS...-VFSG.------------..CLS..HLIIDELYS......I
Q7NV83_CHRVO/1-166.............................GHAMPLVL.G-LCVG.------------..YAS..HLVGDWLTP......A
Q47U11_THEFY/1-250....LGSWPGAALGALCVAALFLTAWDNYPPGWIVGA.V-VALG.------------..MIV..HSLGDALTS......S
Q47RB2_THEFY/1-227......AAEFINALATAGITLALYSSGVDYSWLGLA...-VAYG.------------..CLL..HYLGDIATQ......M
Q1QZR4_CHRSD/1-181...........................TPPIGTLRW...-GLLFG------------GCLLT..HPVLDAFTT......Y
Q5P1U0_AROAE/1-192............................ARPGWRTF...-YGIAC------------VAILI..HIAGDLITQ......F
Q0BSQ9_GRABC/13-169....................................D.P-LVTG.------------..YLS..HLAADLLTP......A
Q5L2T9_GEOKA/1-182..............................TDWLRV...-WLWTF------------VAVAL..HVFVDIFNS......Y
A5CZD2_PELTS/16-203..............................PLLALS...-GVLG.------------..GVS..HIVLDGMTR......S
Q2S300_SALRD/1-182.............................PVSVGKW...-GALVA------------LTLGT..HVGLDCLTT......Y
Q1DD75_MYXXD/1-235.........................PDLPPARFGPL...-LMLST------------LSVLS..HPALDWLNT......Y
A0KFP7_AERHH/1-165............................KDA........-LIIG.------------..YLS..HLLGDWLTP......A
Q0VLL6_ALCBS/1-174..............................ISLWRW...-WLFTG------------LCLIT..HPLLDTFTT......Y
Q3A0M8_PELCD/1-203..............................LTLAAGL.V-ALMA.------------..GLS..HLLLDELWA......I
Q186I4_PEPD6/1-177..............................VFSCLSS.G-FIIG.------------..YLS..HLCLDLITK......E
Q2L2L1_BORA1/1-180..............................AKYSAAR.L-FLTLW------------LVLVT..HPLLDAFTV......Y
Q67R78_SYMTH/1-176..............................AGAGPL...-FFWTL------------LGSLA..HLAVDGLNL......F
Q97MS7_CLOAB/1-166..............................I........-LMLG.------------..IGSAIHLILDSMWL......Y
A6TSU9_ALKMQ/1-172..............................FYFYQV...-FFWTL------------LGSLS..HIVLDIFNS......Y
A6TMK4_ALKMQ/1-249.................................DYS...-LIFG.------------..VSMGSHLLGDMLTK......A
A3CVA2_METMJ/1-183..............................SFALLA...-VATG.------------..ALS..HQVIDAMWA......M
Q9KAZ8_BACHD/1-159.................................TLG...-LLSG.------------..VVS..HFILDAMTS......Q
Q0S8N5_RHOJR/1-250......GWLAVSVVAAVLSALTWQSYPTEAGSTGLGV.A-VALG.------------..CAT..HCLGDAITK......E
Q1IHJ9_KORVE/1-205.......................SRFPRPPIRWGVL...-YLYAC------------LGALS..HILLDYTNN......Y
Q890Y4_CLOTE/1-199.................................NIIY.Y-FMIG.------------..YGS..HLLCDMATP......R
Q0RHF1_FRAAA/1-228.......FWSGLKDCVTAGIAVYLMHGLDMGFVAYP...-VVLG.------------..CLG..HLIGDCLTP......R
Q1MS87_LAWIP/1-199........................LPPPKQISWTLIE.A-WFFTY------------AILIL..HIWLDVMNS......Y
Q11P46_CYTH3/1-219........................ISMPQTKWILLL...-FFCS.------------..YVS..HLIGDLPTPAA..AWG
A6LXK9_CLOB8/1-172..............................I........-LFLG.------------..IASSIHLVLDSMWL......Y
Q2VZJ9_MAGSA/1-159.................................RLAE.P-LALG.------------..YLS..HLAADALTP......A
Q5YVJ3_NOCFA/1-233......IRSWGTVVVLAAAGTFVMDHWISDKPAWLPF.C-VGLG.------------..ALA..HLLGDCLTD......R
Q8FRV6_COREF/1-249......DWLIVTGLSAALAYAVWSYVPEESFGVFLGS.A-ITVG.------------..CLT..HMLGDLATK......Q
A0KMD3_AERHH/1-197.............................TV........-WSFLL------------ISLLS..HSLLDSLTSG....GK
Q3JEV9_NITOC/1-176..............................INFGQL...-YPLAV------------LGYLP..SGLLDACTS......Y
Q9CNK9_PASMU/1-180..............................LPFSFRR.L-FITLT------------LALIT..HPLIDAMTV......Y
A1U6Q1_MARHV/1-174..............................ISYQRW...-LALVG------------LILIT..HPLLDAFTT......Y
Q7NWB9_CHRVO/1-187..............................AGLTAAP.A-AALLF------------LAVAS..HPMLDMICDA....SF
O29079_ARCFU/1-168..............................PIYSIV...-FFLG.------------..YVA..HLISDSLNP......T
Q1MQD9_LAWIP/1-155...........................ANQLFSEIM...-LWVG.------------..FGGITHVLLDSLTP......M
Q5WH30_BACSK/1-157.................................QTG...-VLIG.------------..IAS..HYLLDALTV......R
Q1GSW3_SPHAL/1-193........................PVDRLPLHRGWL...-LALAY------------IGCLS..HPALDWLNN......Y
A3CTE7_METMJ/1-243...........................SLALLPAFGC.A-FFAG.------------..CVL..HLVEDTCTP......A
YVSG_BACSU/1-155..................................AG...-LMIG.------------..MAS..HLILDAWTV......N
B1W5J1_STRGG/1-256GATSAWILAGVLDQPGNGAGWLFDAPGQEYMWLGLP...-IVLG.------------..ALV..HDIGDALTV......S
B2FPD0_STRMK/1-181...........................QSPVRWFWA...-IQLA.------------..LVT..HPVLDAFTV......Y
Q5ZZH0_LEGPH/1-172............................YWKI...TIGA-SLVG.------------..YAT..HCLLDSLTS......Y
Q6LSY8_PHOPR/1-173............................SFTQLWLL...-IAAC.------------..LIT..HPLLDAFTS......Y
Q74JJ2_LACJO/1-173.........................SQNYWSALWFG...-LVIG.------------..YFL..HLVEDSFSK......Q
Q7CIV6_YERPE/1-162..............................PDVFHA...-MIIG.------------..YFS..HLLADMITP......A
Q7CJI4_YERPE/1-166..............................TRIWLF...-LFVS.------------..LLS..HSVLDSLTTG....GK
Q81YV9_BACAN/1-179.............................YLHLLLW...-SFIA.------------..VFL..HVFVDIFNA......Y
Q8Y6J4_LISMO/1-176.............................FIHLLLW...-TFIA.------------..VGL..HIFVDIFNA......Y
Q9HUK3_PSEAE/1-165..............................LKAGLW...-VALA.------------..TAS..HSLLDAMTNG....GL
Q9RMV6_BACAN/1-156..............................FTNGMC...-ILAG.------------..YFL..HLVEDSFSK......K
U5L8V8_9BACI/1-175.............................LLHLWIW...-TFGA.------------..VFL..HVFVDIFNS......Y

PF13803

C7QBS6_CATAD/1-242---A-------P.........RERRVRFSSV..SWFVLS.AVIG---------------TVT--HVVWDGFT--HPGRF.
C0ZEY0_BREBN/1-241---R-------G...LDYTNKGSRMPAWKMA..IVFVYS.AIIG---------------SLS--HIAWDAFT--HDGGR.
K9WR57_9CYAN/1-241---Q-------R....FPTLRSYFPLQVKHL..FNVVVS.VVMG---------------AAS--HIVWDAFT--HEGGW.
D3EE91_GEOS4/1-236---Y-------R....WQRDGKLPVSPIGWL..AVILLG..LAG---------------VGT--HLLWDQFT--HKGAW.
X2GTZ3_9BACI/1-237---D-------T........STNRVDSNKLLKLVVFIYS.ALFG---------------MLT--HVVWDSFT--HINGY.
F8A675_CELGA/1-236---S-------R......APERNRTLRAATW..TLASLA...VG---------------VAT--HVAWDAVT--HGDGA.
Q1IN38_KORVE/1-247---R-------R....IDVSRSYVPKSIGDF..LLVVLS.LAIG---------------LGS--HLLWDSFT--HPLSW.
D2Q1R3_KRIFD/1-251---G-------R......LKPSGRRPTANYL..LWAAIS.LVIG---------------GFT--HVLWDSFT--HYDGY.
A6GZ02_FLAPJ/1-235---S-------R..FSIFKQFNWNRYFKEKG..LVVMIS.ILIG---------------AAS--HIFWDSFT--HYNGY.
D3V1B0_XENBS/1-240---R-------Y...........EKPDYKDR..VAFVLS.LFIG---------------AVT--HIGWDAFT--HDKGF.
Q899W6_CLOTE/1-232---R-------Y..YTYLLNYRVNIKSIKDI..IVFGYS.SILG---------------MVT--HVFWDAFT--HSNGF.
G0FWC1_AMYMS/1-228---G-------R................VPW..LGSVVS.VLVG---------------AAT--HLLWDAFT--HTGGF.
C2X225_BACCE/1-236---G-------Y..YTYAVDERWGLHTWKDF..FVFCYS.ALFG---------------MLT--HVVWDAFT--HNTGY.
Q8XML2_CLOPE/1-242---N-------W..YGYLRTEQFGLHSWKEV..IVFIYS.ALLG---------------MIT--HVLWDGFT--HKTGF.
A0Q1Y2_CLONN/1-242---K-------KFSFLINEKKNFTIKKV.....IVFIYS.SLIG---------------IYS--HILWDSFT--HKTGF.
I0E062_PROSM/1-239---Q-------N...........WRWSAKNG..AILIFS.FFLG---------------ALT--HIIWDSFT--HDTGA.
Q6FEH5_ACIAD/1-242---R-------T...............CGFL..IGCVVS.VLIG---------------AAT--HIIWDGFT--HADFR.
H1YCR9_9SPHI/1-235---H-------R..FAGYAAFNWSRYAKQNL..PVVVLS.ILIG---------------GTS--HLLWDSFT--HVTGY.
I4B9J2_TURPD/1-232---I-------R....LGSVYSSEVKGFNQW..LFCCLG.LVFG---------------SFS--HIIWDSFT--HESGY.
K4IBC3_PSYTT/1-233---S-------R..FSVFKLFDWNRYFNRNW..LVVIIS.ILIG---------------AAS--HNFWDSFT--HDHGY.
H2JVD3_STRHJ/1-251---G-------RPAALLRCGAPRARVRTSAV..GRWYAS.AVLG---------------ALT--HVVWDAFT--HHDRW.
A5I0I6_CLOBH/1-248---S-------W..YYNTALKPWRINSLAQV..LVFSYS.AIIG---------------MIT--HVFWDSFT--HKGGK.
Q65Q39_MANSM/1-229---F-------K.............NPLAWL..IVFLYS.AWIG---------------MAT--HIALDELT--HDGGY.
F4FE12_VERMA/1-233---H-------R.....................LWVTVTSALVG---------------AAS--HLAWDWLT--HTDDW.
C6D3J1_PAESJ/1-240---L-------D.KRAYHLISGWDMRGSKAM..VVYLLS.VIIG---------------FYT--HILVDGFT--HERGY.
A3HWD2_9BACT/1-236---S-------R..TVQYLKFNWLLALKKNW..IGILLS.IMLG---------------IGT--HLVLDGMT--HYDGW.
Q7UP84_RHOBA/1-249---D-------R..........PVSVEWQSI..LLVAVC.VLVG---------------AST--HVLWDSFT--HQHRWG
A8L7F5_FRASN/1-232---R-------P..............TGHQW..LLAPVA.AVVG---------------GLT--HTGWDAFT--HEDRW.
D2ARI2_STRRD/1-246---G-------R......IASLAPAPYGLRR..LPAVVAGGAVG---------------AFT--HKLWDSFT--HHYSS.
Q0RF10_FRAAA/1-232---R-------L..............TGRQW..LLAPVA.AAVG---------------AAT--HVVWDDFT--HEGRW.
C7R2G7_JONDD/1-241---Q-------R...............AVAIRGVWVVIS.LLIG---------------ILT--HVIWDSLT--HSDGW.

PF00882

A0A090C0Q9_ACIBA/1-206---.DLKL..DSFRH..FF........SFF.--IGIIIA-LLIG---------------IAT--HLIWDGLT..HSDFR-
C6RSF9_ACIRA/1-206---.PLNI..HSPLQ..AL........IFL.--VSCSIA-ILLG---------------TAT--HILWDGLT..HADYR-
B7H911_BACC4/1-208---.AGYY..SYAIDERWGLH....TWKEF.--FVFCYS-ALFG---------------MLT--HVVWDAFT..HNTGY-
C2XYJ1_BACCE/7-214---.ASYY..KYVVDAKWGLY....TWKNF.--FVFCYS-ALFG---------------MVT--HVVWDAFT..HKTGY-
B1B9W2_CLOBO/1-214---.DKNL..YHITHRKSKNS....TIKKR.--IIFIYS-ALIG---------------IYS--HILWDSFT..HKTGF-
C5VRK3_CLOBO/1-214---.DKKL..SYFLDKKSNVI....NIKYL.--IIFIFS-ALLG---------------VYS--HILWDAFT..HKTGF-
A3I5H3_9BACI/4-213---............QDFNSYQISGTKTWKI--IVFSYS-ALLG---------------MLT--HVIWDSFT..HQNGY-
Q0SV58_CLOPS/1-213---.DNWY..GYLRTEQFGLH....SWKEV.--IVFIYS-ALLG---------------MIT--HVLWDGFT..HKTGF-
C6JKD9_FUSVA/1-208---.KSRF..INLRDFNWNSY....FKKNW.--YIVIIS-IIIG---------------ICS--HILWDGFT..HRTGH-
A1ZM58_9BACT/1-209---.KSRV..YHCKEFNWWAY....MRKRW.--WVVIIS-LLIG---------------SAS--HLLWDSFT..HEHAT-
C0DX83_EIKCO/1-211---AAYRLPESTIAAATHKRR....QTAVVL--FTFVFS-ALFG---------------MIT--HLFLDAFT..HPTGW-
D4DQE9_NEIEG/58-261---AAPY.....RPSENVDFH....KIKEV.--.AFIPS-ALFG---------------MGT--HLFLDAFT..HPTGW-
C0B3N4_9ENTR/1-204---............YDPLKF....NLRTL.--SLFVLS-LYIG---------------AIT--HIIWDSFT..HETGT-
D4BTR9_PRORE/1-203---............KNRSVG....SFRQF.--CIVVLS-FYIG---------------AAS--HIIWDAFT..HQSGA-
Q2LV15_SYNAS/6-198---S.............MNK.......TSEE--FKNCLA-WFSG---------------YVS--HVVADSYL..H....-
Q2Y883_NITMU/6-188---R.............LDG.......ASRQ--..KAFS-WLLG---------------YTS--HVVTDTTI..H....-
A7K2D4_VIBAE/6-189---A.............ADN.......EHFE--..KTFS-WLCG---------------FVA--HVATDITL..H....-
A4C3L5_9GAMM/6-186---K.............LEG.......LAQE--..KCFA-WLCG---------------YMS--HVAADITI..H....-
C9YFH3_9BURK/6-183---K.............LQG.......VERQ--..KATS-WLLG---------------VAC--HMTADMTI..H....-
Q12DA4_POLSJ/6-186---K.............LPP.......DLRP--..KATA-WLLG---------------FAA--HMVTDMTI..H....-
C4XMP3_DESMR/34-221---N.............LEG.......DVQN--..KCLA-WLLG---------------FVE--HIIFDVFM..H....-
E6VSV5_DESAO/6-180---H.............AADA.....WARQG--ATLPVA-LLVG---------------AVS--HLYADVAM..HPMV.-
Q2LQI8_SYNAS/6-189---N.............L..........ETL--PEGYRP-FLAG---------------ALT--HVAADAVF..HPFI.-
B8FCF0_DESAA/6-187---D.........................KW--SDGMWA-FVMG---------------TFS--HILADAVY..HPWVE-
B3E8I7_GEOLS/6-161---T.........................AL--SPAATA-CLLG---------------IAS--HIDADITF..H....-
A1AT46_PELPD/6-164---R.............G..........GML--PYDLLA-CLLG---------------VIS--HMQADMVF..H....-
C6Y3Y4_PEDHD/24-233---D..........................R--DSLKIL-IYSA---------------YLG--HYLADAHVPLH....-
E6U8V9_ETHHY/5-158---D.............REE.......EKSL--DSFAFA-KDIG---------------VVT--HYLSDFCCYVH....-
Q1IVJ5_KORVE/32-215---N...........................--.LNDLA-FAAG---------------ALS--HYLGDSFG..HSIAT-
C1F375_ACIC5/44-227---N...........................--.VDEFA-FALG---------------ALS--HYVGDAIG..HSYAV-
Q01WM2_SOLUE/25-208---D...........................--.LNEYA-FALG---------------ALS--HYAADNNG..HRMAT-
Q1ISY5_KORVE/28-210---S...........................--.INEYA-FALG---------------ALA--HYASDITG..HPIVN-
Q025L8_SOLUE/39-222---T...........................--.LDELA-FALG---------------ALA--HFAADTQG..HSIAV-
Y1571_ARCFU/28-204---L.........................AE--GTDEKA-FAKG---------------WLA--HLMQDRVA..HGNGD-
Q01YQ6_SOLUE/23-198---E..........................H--RPREAA-RFAG---------------VLS--HFIADSLSPPH....-
Q8XI18_CLOPE/5-158---S.............LSMY....DFKKKF--SVSRFS-QELG---------------VIC--HFICDFFCIPH....-
R5X8W2_9CLOT/5-160---K.............LSLD....FIEKYF--SISKFS-QELG---------------VIC--HFLCDFFCVPH....-
B6FWP7_9FIRM/5-161---S.............LTLE....SLSKVF--STSRLS-QELG---------------VIC--HFLCDFFCVAH....-
Q18BT1_PEPD6/5-159---S.............LNID....SLSKYF--SVSRLS-QELG---------------VIC--HFLCDFFCVAH....-
D3MTQ6_9FIRM/3-156---S.............LNLD....SLEKLY--SKSSFS-QEIG---------------VIC--HFLADFFCVAH....-
A0A0C2S6D2_CLOBO/4-161---S.............LSLQ....DVYYKM--SVNKFS-EELG---------------VIC--HFICDYFCAPH....-
C4IEN4_CLOBU/4-161---S.............LTLE....EVYFDM--KLGRFS-EELG---------------VVC--HFLCDFFCAPH....-
A6LQ77_CLOB8/4-161---S.............LSLE....EIYYDM--TIGKFS-EELG---------------VIC--HFLCDFFCAPH....-
B1BFH6_CLOPF/5-161---R.............LSSD....EIINHL--GKEKFS-IELG---------------VIC--HFLCDFFSLPH....-
Q97KV3_CLOAB/5-155---K.............Y...........NN--SIRKFS-LALG---------------IVC--HYICDYFCIYH....-
B0P7T6_9FIRM/16-171---R.............EG.........DAM--TLAEYS-KQLG---------------ILC--HFMSDFFCYAH....-
C0ECW5_9FIRM/5-161---S.............CD........KSRL--NSVVLA-DKLG---------------VIC--HFICDFFCYAH....-
A8MHU0_ALKOO/5-164---S.............YNF......QFNKE--FIKQLS-TRIG---------------VVT--HFISDFFCVPH....-
A6TNX7_ALKMQ/5-165---Q.............YSL......IENEE--LIKLIS-RQLG---------------VIT--HFVADFFCLPH....-
B2A897_NATTJ/5-148---D.............M..........NIG--NKRLAY-YRLG---------------VIT--HYLADFFCRPH....-
R6RM69_9FIRM/5-161---A.............DYD.......TLKG--MNMRRC-AKLG---------------VII--HYIADYFTFPH....-
B0NZS3_9CLOT/15-171---A.............NYD.......KDKG--MNMRRC-AGLG---------------VII--HYIADYFTFPH....-
R7D6R4_9FIRM/20-175---Q.............SG.........AGY--NDRVFW-RRSG---------------EVM--HYIADYFTFPH....-
C6J9X9_9FIRM/5-161---D.............IR........PDES--NQRVYW-RRFG---------------EVI--HYMADYFTFPH....-
C6LKS6_9FIRM/5-161---K.............MDY.......TDAQ--DGMAFW-RHLG---------------EII--HYIADYFTFPH....-
D4KRQ8_9FIRM/5-161---E.............GQK.......VMNK--KNRKYY-RDLG---------------QVS--HYLADYFTFPH....-
D9SRM2_CLOC7/5-162---E.............DY........EENW--DSREFY-VRLG---------------EVI--HFITDFFTYPH....-
A6LQR0_CLOB8/5-160---Y.............G..........EIK--RNKDIS-IKLG---------------ILS--HYLCDFFTFPH....-
B0S165_FINM2/8-177---Y.............LFQFTD.LTRLNSL--QNKILS-TKLG---------------VIS--HYLSDYVCLPH....-
D1VUW6_9FIRM/8-182---Y.............FCRYSNLQENTNPI--LINYLS-KKLG---------------IIS--HYLSDYCCYPH....-
C4IIQ3_CLOBU/5-155---E.............T...........KE--FNWYNS-LQLG---------------III--HYLCDFCCYSH....-
C4Z638_EUBE2/40-187---R.............H...........GR--MNCFSF-LSLG---------------YAL--HYIEDYFTFPH....-
A7VFQ0_9CLOT/5-152---E.............K...........GK--NSRYSF-LKLG---------------YVL--HYVEDFFTYAH....-
C0EWT7_9FIRM/5-150---A.............K...........GR--GGSFSY-LKLG---------------WIL--HYVEDYFTYPH....-
R5WI53_9FIRM/5-162---K.............G...........GM--GTVRQS-FLLG---------------KLV--HYVADSFTYPH....-
D4LBU1_RUMC1/5-160---K.............S...........DV--QSPLQW-FRFG---------------AAL--HYLADSFTFVH....-
Q315K4_DESAG/47-177---L...........................--....KA-YAYG---------------YLS--HLAADTVA..H....-
B8DLU9_DESVM/18-149---L...........................--....HA-YACG---------------YLS--HLAADTVA..H....-
C7LVT1_DESBD/24-155---A...........................--....QA-YAYG---------------YLS--HLAADVIA..H....-
C6BUV8_DESAD/29-160---L...........................--....KA-YSLG---------------YLS--HLAADIIA..H....-
C8X0X8_DESRD/29-159---L...........................--....QS-YAYG---------------YLA--HLAADTVA..H....-
A5G5N0_GEOUR/25-157---Q...........................--....KA-CAYG---------------YLS--HLAADTVA..H....-
E8WRC5_GEOS8/30-162---Q...........................--....QA-CAYG---------------YLS--HLAADCIA..H....-
A1AK53_PELPD/24-156---Q...........................--....QA-CAYG---------------YLS--HLAADVIA..H....-
B3EBK7_GEOLS/25-157---Q...........................--....RA-CAYG---------------YLC--HLAADVVA..H....-
Q3A306_PELCD/29-161---Q...........................--....RA-CAYG---------------YIA--HLAADTIA..H....-
Q1K0Z2_DESAC/27-159---Q...........................--....RA-CAYG---------------YLA--HLAADTVA..H....-
C1A8N1_GEMAT/19-151---L...........................--....QA-FALG---------------YLA--HLAADVVA..H....-
B8J577_ANAD2/33-165---E...........................--....QA-FALG---------------FLA--HLSADTVA..H....-
D6SRA3_9DELT/26-149---D...........................--....QA-FACG---------------FLS--HLAADTVA..H....-
B5YG53_THEYD/20-144---E...........................--....KS-FAYG---------------YLT--HLAADAVL..H....-
Q1H382_METFK/30-174---E...........................--....TA-IAIG---------------YAS--HLYIDVIA..H....-
C6X6W6_METGS/30-174---E...........................--....TA-MAIG---------------YAS--HLYVDVIA..H....-
C6WXF1_METML/56-200---E...........................--....IA-LAIG---------------YAS--HLYIDVIA..H....-
D5CMM4_SIDLE/28-177---E...........................--....YA-ISLG---------------FVS--HLLVDVIA..H....-
B0SPX5_LEPBP/6-211---D.............TE........MGLY--RDRFLA-FTLG---------------YIC--HCVVDIQT..HPYIF-
A0A022SYW6_LEPIR/6-211---Q.............TE........EGIH--RDRYIA-FTLG---------------YIC--HCVVDIVT..HPYIF-
C8W7P0_ATOPD/6-209---D...........................--QRQLRE-FIVG---------------IWC--HLVCDHVYNAHT...-
C5DV22_ZYGRC/30-228---G.............KYND....NPQCED--SMKLRS-FLIG---------------IFT--HQIVDSSW..HSLVN-
B5VL45_YEAS6/30-234---Q.............KYGQNY.RLRGSQG--SLALKS-FLIG---------------VFT--HQIVDVSW..HSLVT-
C5DKM1_LACTC/24-220---E.............RYSK....NQNSEK--SLRLKS-FLTG---------------VFV--HQVADAPW..HSLVD-
Q6FL70_CANGA/25-242---D.............TYGDKK.NDIMSEE--SQKLAA-FLLG---------------IFT--HQVVDVPW..HALGE-
Q6CEF9_YARLI/23-229---SRYGYL.DDYSEKTDHTKDAPSDSEFKN--SLRLRA-FLMG---------------VLT--HQIADVSW..HSLG.-
C4R8D0_PICPG/19-213---E.............NSNQ....FSEEDE--ISNYRA-FIYG---------------MFS--HQLVDINW..HSLS.-
Q8R432_MOUSE/28-220---E.............NYPL.....PWEKD--TEKLVA-FLFG---------------ITS--HMVADVSW..HSLG.-
C3ZWC6_BRAFL/5-194---Q.............KYPQ.....PWNEA--TEKLVV-FLLG---------------VVS--HQVADISW..HSLG.-
A7SED1_NEMVE/31-226---R.............KYPK.....PWDEA--TEKLVA-FTLG---------------YVS--HQMADVTW..HSLG.-
D3AZT7_POLPA/38-225---A.............TYTQ.....PWNAK--AQSLAV-FLLG---------------VMS--HQVADISW..HSIA.-
PLDG_DICDI/29-216---E.............TYPQ.....PWSLD--GIRLAV-FLLG---------------VTS--HQIADISW..HSIG.-
Q97TF6_CLOAB/60-232---T...........................--DRTYSM-QELG---------------RAC--HFLEDVNVPYH....-
A7B1H2_RUMGN/72-243---A..........................G--DVQLAM-SNLG---------------KGT--HYVSDLNEPHH....-
PHLC_CLOHA/37-230---K..........................G--NYEQAT-WLLG---------------QGL--HYFGDFHTPYH....-
A0PXH4_CLONN/38-231---K..........................G--NYEKAT-WYFG---------------QAM--HYFGDLNTPYH....-
Q5PXE6_CLOPF/38-231---R..........................G--NYKQAT-FYLG---------------EAM--HYFGDIDTPYH....-
Q8GCY3_9CLOT/38-231---K..........................G--NYEKAA-WYLG---------------QGM--HYFGDLNTPYH....-
PHLC_CLOSO/38-231---K..........................G--NYKEAT-FLLG---------------QGM--HYLGDLNTPYH....-
Q6R6B7_LISSE/64-245---D..........................G--NFEKAF-YNLG---------------LAI--HYYTDISQPMH....-
Q6EAE3_LISMN/64-245---E..........................G--KFDTAF-YKLG---------------LAI--HYYTDISQPMH....-
Q6R6D6_LISIV/62-243---E..........................D--KLNTAF-YKLG---------------LSI--HYFTDCSQPMH....-
A0R9W0_BACAH/51-232---N..........................K--DMKQAF-FYLG---------------LSL--HYLGDVNQPMH....-
A5D2J5_PELTS/29-178---N..........................S--NRNKAF-FFLG---------------ASA--HIMQDLCVPHH....-
Q896L3_CLOTE/34-205---K..........................G--DLDKAM-FFLG---------------AAC--HLIQDVTVPQH....-
A5N896_CLOK5/34-205---I..........................G--QIEKAL-FYFG---------------ASC--HLVQDVTVPHH....-
Q97KA0_CLOAB/34-205---A..........................G--DKKKSL-FYLG---------------AAC--HIIQDSTVPQH....-
A6TKQ8_ALKMQ/57-228---E..........................G--AFNESL-FYLG---------------AAL--HIIQDMTIPQH....-
O26214_METTH/27-173---D.........................AG--NYRYAS-YCYG---------------VAS--HYISDGICGPH....-
B8I5G2_CLOCE/32-236---NATMGVGTGSVGGWTWNEIFDSIGIPNN--AANRRA-FIYG---------------VAL--HVATDVFA..H....-
B5HQN8_9ACTN/67-292---.QGRAATLLRCGTPRARV....RTALA.--ARWYAS-AAVG---------------GLT--HVVWDAFT..HHDRW-
Q82A31_STRAW/92-336---.QGRVAALLRCGVPRARM....RASAV.--LWWYVS-AALG---------------ALT--HVVWDAFT..HHDRW-
C9YWP6_STRSW/1-225---.QGRVAALVRCGARARRF....GPSRA.--LWWYVS-AALG---------------SLT--HVVWDAFT..HLDRW-
B4V801_9ACTN/61-287---.RGRVYGLVRGEDWRTRR....LPSLA.--LWFYLS-AVIG---------------SLT--HIAWDSFT..HLDRW-
D3D9A1_9ACTN/1-206---.RLRL..APRARLSRRQW....MLAPA.--.....A-AMVG---------------GLT--HVGWDLFT..HRNRW-
A7C3K4_9GAMM/1-217---.QQHL..IPFVN.EFQFF....PLRRF.--LLIIIS-LLIG---------------ILT--HIIWDSFT..HYSGW-
B9XK96_PEDPL/41-256---.QKRL..VPWLN.PFPLR....TAAQW.--GLVIVS-LIIG---------------AFS--HLFWDSFT..HEHGW-
D9T3L8_MICAI/1-213---GWPWYASLARVRHP............W.--QVTVCS-VLIG---------------AFS--HVAWDRVS..DSERL-
C1ACE2_GEMAT/1-206---.EWRL..HDLLA.LRAPA....TWWDW.--VSVAWS-AWIG---------------GVS--HVVLDGIT..HGNHS-
C0VQ51_9GAMM/1-206---.DLNI..HSFDS..FI........AFS.--LMSCFA-IIIG---------------TAT--HLIWDGLT..HLDFR-
D0SL80_ACIJU/1-206---.PLNI..KSFDQ..II........TFV.--LMTCFA-IIIG---------------TAT--HLVWDGLT..HLDFR-
D0SG75_ACIJO/1-206---.ELRL..SSMLR..FF........KFS.--VAVILA-ILLG---------------TAT--HLLWDGLT..HADFR-
D0SS47_ACILW/1-206---.DLKI..HNILS..AL........KFI.--LVMCLA-VIIG---------------TAT--HLIWDGLT..HVDFR-

PF02265

ENDO2_ARATH/28-290---T------------QLLSYKTA..ASSQSQ...YNLT-EALL---------------FVS--HFMGDIHQPLH-----
ENDO5_ARATH/21-288---N------------QLMSASEN..SQNIVH...YNLT-EALL---------------FLS--HYMGDVHQPLH-----
A4H6V5_LEIBR/29-297---S------------AITSPTAT..SDTI........I-TSVA---------------NLI--HFVGDVHMPLH-----
Q8F3Z8_LEPIN/21-283---S------------VLADTTQT..KAKR........L-QALS---------------FVV--HFIGDLHQPLH-----
B0T6T3_CAUSK/23-287---A------------ELADPKTD..AAER........L-LAFK---------------FVL--HFVGDLHQPLH-----
F2G2Z7_ALTMD/28-265---E------------TLKSDTAS..VEEK........R-LALQ---------------FIV--HIIGDLHQPLH-----
Q66VY6_LEIMA/29-300---S------------AITKTTAT..TEII........T-QCLA---------------FMI--HFFGDIHQPLH-----
Q7S8Q5_NEUCR/20-297---E------------RVQMK..NITADQK........A-QALK---------------FIV--HFLGDIAQPLH-----
Q5KPJ8_CRYNJ/20-279---R------------LIMDGKGG..KDVD........I-.PLR---------------FLV--HFIGDSHQPLH-----
Q236I4_TETTS/18-296---Q------------ELSRKYYL..PLQNNLNISVQQA-IMMR---------------LLI--HIVGDMHQPLH-----
Q4DEV4_TRYCC/28-293---R------------TLMKQDLV..PYIM........S-FAIV---------------NIA--HFLGDIHQPLH-----
Q0CD39_ASPTN/21-282---S------------QVSEY..SFNRT...........-EAVL---------------FLV--HFFGDLHMPLH-----
Q2SFD4_HAHCH/50-295---E------------ALKGEPRQGYQATP........A-QALM---------------FIG--HFIGDIHQPLH-----
Q585P6_TRYB2/27-292---K------------ALRRTDTP..IYVR........S-FALA---------------HLV--HYYGDIHQPLH-----
Q989R8_RHILO/21-270---H------------EITCAT.D..PLQR........R-DSLR---------------YLI--HIVGDLHQPFH-----
ENDO1_ARATH/29-294---S------------QLQHYGE.GTSDRRY.....NMT-EALL---------------FLS--HFMGDIHQPMH-----
A4CQ68_ROBBH/22-257---R------------VLKDPASP..RDQQ........V-FYLK---------------LLV--HLVGDLHQPMH-----
A3U8L7_CROAH/33-268---T------------KVQNKTLS..KDDR........A-FYLK---------------LLV--HFIGDLHQPLH-----
A7H7R9_ANADF/28-274---A------------ELRDGEGA...ARR........A-DAFR---------------WLV--HLVADVHQPLH-----
Q7P202_CHRVO/23-274---K------------VLADRGAA..KADR........A-QALT---------------FLI--HMVGDIHQPLH-----
A0BML4_PARTE/16-293---S------------VLTSTKTA..KFRHTV....FKA-EMIR---------------VLL--HVIGDLHQPLH-----
A7EWS3_SCLS1/21-282---T------------ILQKGTAS..............A-ANLD---------------IAA--KFVGDIHQPLH-----
Q3IBZ8_PSEHT/27-268---K------------VLQDEQSS..LDAK........Q-FSLR---------------FLV--HLVGDSHQPFH-----
A7ETG5_SCLS1/21-277---S------------QLLDP..NVSRYHK........Y-IAAK---------------...--.FVGDIHQPLH-----
A0M3W8_GRAFK/24-260---E------------VLKDQNSS..RDEK........Q-FYLK---------------MLV--HFVGDLHQPFH-----
A0BLJ0_PARTE/422-699---A------------VLTNSKTS..RNRHTV....FKA-QMLR---------------VLL--HVIGDIHQPLH-----
A4HJL3_LEIBR/28-299---T------------ALQRAISN..SDII........V-HSLA---------------LLI--HFMGDIHQPLH-----
Q0TYV6_PHANO/20-284---S------------RAVES..NISVIEQ........Q-KALK---------------WVI--HFVGDVHQPLH-----
ENDO3_ARATH/25-286---N------------QLMSTSENSQSIVHY.....NLT-EALM---------------FLS--HYMGDIHQPLH-----
Q0AMT2_MARMM/26-282---G------------IFVDRSRS..DEDR........L-EALK---------------FLA--HWMGDIHQPLH-----
Q4Q7F3_LEIMA/31-295---T------------SLRRTNAP..LYLL........N-FAWV---------------NLV--HILGDLHQPLH-----
Q5NRA3_ZYMMO/33-298---R------------ELSSKQTS..DQDR........V-LALK---------------YVL--HFVGDLHQPLH-----
A5V871_SPHWW/21-280---R------------LLRDRSQP..QRVR........V-EALV---------------FLV--HFVGDLHQPLH-----
Q5FP59_GLUOX/25-298---K------------ILADTHAS..AQDR........L-TALK---------------WVV--HLVGDIHQPLH-----
Q0UA95_PHANO/19-289---G------------ILKDCITQVNSGALSGGTNLTCS-YALK---------------WVA--HFLGDIHQPLH-----
NUS1_ASPOR/21-284---N------------ILLES..PNGSEA.........L-NALK---------------FVV--HIIGDIHQPLH-----
A4HI96_LEIBR/31-295---T------------SLSNVRSP..LYML........N-FAWV---------------YLV--HLIGDLHQPLH-----
Q7XPN4_ORYSJ/27-283---N------------ALED......SSSPY.....DPT-ESLM---------------FLA--HFVGDVHQPLH-----
Q01U80_SOLUE/19-261---K------------VLVNPAAT..PVQR........K-EALM---------------FIV--HFVGDMHQPLH-----
A2QX99_ASPNC/21-292---R------------QINDR..HANMTQQ........K-EALM---------------FLI--HLFGDLHQPLH-----
A2TWS6_9FLAO/25-260---E------------VLEDDASS..EADK........N-FHLK---------------MLV--HFIGDLHQPLH-----
Q2UHT0_ASPOR/21-283---V------------QVNDH..SANQT...........-EAVM---------------YLF--HFFGDLHMPLH-----
Q2H4S7_CHAGB/217-488---T------------RLLDAEGALPAWQR........A-QAAK---------------FVV--HFVGDIHQPLH-----
Q15ZB2_PSEA6/20-256---A------------NLTSSQTS..KAEK........Q-LALR---------------FIV--HIIGDLHQPLH-----
A4I736_LEIIN/27-297---T------------AIEKPTAN..SDVI........V-QSLA---------------LLL--HFMGDIHQPLH-----
B2FSF8_STRMK/27-269---T------------ILGDRSLT..DGER........L-QALK---------------FVV--HLVGDIHQPMH-----
G3XKQ7_SOLLC/26-290---T------------QLSHYREG..TSDRRY....NMT-EALL---------------FLS--HFMGDIHQPMH-----
I1KHQ2_SOYBN/27-290---T------------QLLEYGSD..TKSRY.....NLT-QSLF---------------FLS--HFMGDIHQPLH-----
I1MEB5_SOYBN/33-297---S------------QLMHYKEG..TSDRRY....NMT-EALL---------------FLS--HFMGDIHQPMH-----
I1PPP5_ORYGL/30-294---S------------QLMHYNHG..SADRKY....NMT-EALL---------------FLS--HFMGDVHQPMH-----
M7YSG5_TRIUA/24-280---A------------ALQDS.SS..PYNR........T-ESLM---------------FLA--HFVGDVHQPLH-----
Q1K6E5_NEUCR/21-291---S------------RLLDQSLH..VVER........A-QAAK---------------FVI--HFVGDIHQPLH-----

PF09988

Q8YZE9_NOSS1/2-166.W---QDVEVTVGR---------.....------..S--L-----------------------T.SYSMEFFALFLGLE-
K9TIP1_9CYAN/2-166.P---PLASAAIAR---------.....------..T--V-----------------------K.QHPMEGIALFLGLE-
B2VAC8_SULSY/2-161..---...DNNFQV---------SRFDN------LDL--S-----------------------SFLNNVSFLSFFFGLI-
A5UV55_ROSS1/2-173RI---GVGVPDLHA---------QASAW------LFD--A-----------------------MRRNPDMVRLFIFGFI-
K9VXZ1_9CYAN/2-166.W---QRLAEDGVR---------.....------..S--L-----------------------F.QHSAEFIALFVGME-
K9X512_9NOST/2-158.L---ADL....GR---------.....------..S--L-----------------------F.LYGGEFFALFLGLE-
Q10Y23_TRIEI/2-165.V---LGLVISLWR---------.....------..S--L-----------------------S.QHYQEVVALLVGLE-
K9R5N7_9CYAN/21-185.W---QEVAKHLLD---------.....------..I--I-----------------------N.LHKTEFLALFVGLE-
Q7U3L4_SYNPX/2-155..---.......TN---------AGLPQ------LVS--W-----------------------LKQQPQQAIALGIGLE-
K9UM54_9CHRO/2-166.G---QQLVAILQH---------.....------..S--I-----------------------E.LNLPVYLALFCGLE-
D7CX68_TRURR/2-172..---....APHFG---------YRVGF------EAE--V-----------------------GESWPQLLVGSLAGYY-
K9S824_9CYAN/2-177.W---RAVAEPAWR---------STLPW------LWS--L-----------------------LQRYPQEAIALGLGLE-
U5QDG6_9CYAN/2-166.W---RAHLLAAF.---------.....------..S--W-----------------------GSAHWPVLVWGLLGLE-
Q9RT76_DEIRA/5-173..---......LPQ---------LGLGW------PRL--P-----------------------QPLPYKVLLPVAAGYY-
B1XNI7_SYNP2/2-167.W---RTAFLNVQR---------.....------..Q--W-----------------------QQHYWAESLALFVGLE-
K9YHE6_CYASC/3-166.W---QQIIDNLT.---------.....------..V--I-----------------------GEIYLKEIIALFIGLE-
K9U5M5_9CYAN/2-166.W---QTWWETVKR---------.....------..S--L-----------------------T.HHTTEWIALCLGLE-
K9XH03_9CHRO/2-166.W---QQLVAQSRR---------.....------..S--L-----------------------V.QNTAEWFYLFLGLE-
B7KDH5_CYAP7/2-167.W---RLFAQTSLN---------.....------..S--L-----------------------TGKYLSEAIAVGVGLE-
D7DZB9_NOSA0/2-166.W---GDVWRIVGR---------.....------..T--I-----------------------S.IYYGEFFALFVGFE-
K9VNR5_9CYAN/2-166.W---QDVVLSCGR---------.....------..S--I-----------------------W.EHHIEILAVYIGLE-
A9B0N7_HERA2/2-170FT---PVDTATISA---------AFIAD------LKA--L-----------------------WYSDRQLIVYALVGFV-
Q8XL51_CLOPE/2-170..---.SIINISTP---------EMLKL------VFN--F-----------------------MSKNKILFGNMALALF-
G2LLI8_CHLTF/2-174..---......LQT---------AGHHM------SRL--F-----------------------RAVDGKVWLVAFIGLW-
E4UAQ6_OCEP5/2-167..---.........---------.....------...--.-----------------------.........AGLAGYF-
B1X0E2_CYAA5/2-167.W---RNVAEYNFN---------.....------..T--L-----------------------KNQYLGEAIVTFIGLE-
Q7NFX0_GLOVI/2-166.W---QAAWQTVS.---------.....------..L--W-----------------------CGANISTLIWGLVGLE-
K9Z9T5_CYAAP/2-167.W---QKFIFNSYG---------.....------..V--L-----------------------KNNYWQEVLSLFIGLE-
L0A273_DEIPD/2-163..---......LP.---------.SVDW------PVT--S-----------------------LAFSWSLALPLLVGYY-
K9WE31_9CYAN/2-166.W---QQFGEDIKQ---------.....------..W--L-----------------------I.NYQAEWIALFVGLE-
K9V8T7_9CYAN/2-166.W---QQLTGEIMH---------.....------..S--L-----------------------L.VYNQEFLVLFLGLE-
Q7V3X6_PROMM/2-159..---...GCPAPL---------SLAKA------LNE--Q-----------------------LRLNPQPILAVLLGLE-
B8HTG8_CYAP4/2-166.W---QTGVALLQA---------.....------..S--L-----------------------Q.TYPYEWLAGLAGLE-
C1CV84_DEIDV/5-166..---......AP.---------.SVTV------PAI--P-----------------------QPISVKVVAPLIAGYY-
Q31N47_SYNE7/7-176.W---AGLGDRLSQ---------HQQWI------GTE--L-----------------------S.RRPALVLATLVGLE-
S0EUE8_CHTCT/2-170GM---HVDPASVTQ---------MEAHS------LGQ--I-----------------------MRTHPRESLAFLVGFV-
E0U8U0_CYAP2/2-167.W---HIFVQKVIY---------.....------..S--V-----------------------KGEYSQEVIALFVGLE-
D3EPX6_ATETH/2-167.W---WILFTTNYN---------.....------..K--L-----------------------RAQYLEEAVTIFLGLE-
C0QT82_PERMH/2-161..---.........---------DRFRD------VDI--Y-----------------------SFLSGSFVFSFIFGIF-
Q2JJ24_SYNJB/2-166LW---.........---------.....------..Q--L-----------------------LQVHAEMLFWIGMGLE-
B7K2N6_CYAP8/2-167.W---QQFTHRLME---------.....------..L--I-----------------------MTEYLQEAIAFTIGLE-
K9Q2E8_9CYAN/2-167.W---RSFFVVGGQ---------.....------..Q--V-----------------------QQNYWAEVLALFAGLE-
A9WA62_CHLAA/2-176QL---GFAPPAYHR---------ELATQ------VNV--L-----------------------IETYPRETWAFIIGFC-
H8GTR8_DEIGI/2-163..---......FP.---------.AWQW------PAL--P-----------------------EPVGLKFAVPLLLGYY-
K9XZT4_STAC7/2-167.W---QQVARQAIQ---------.....------..L--S-----------------------LHKYLAEIIAGVIGLE-
B2IUE8_NOSP7/2-166.W---QDLGQTVGR---------.....------..S--L-----------------------L.QYDTEYIALFLGLE-
E8UBR4_DEIML/2-163..---......VP.---------.DLRL------PGL--P-----------------------SSLDWKGLLPLLAGYY-
K9QIC8_9NOSO/2-166.W---QALGKNVAR---------.....------..S--L-----------------------V.GHSTEYLALFLGLE-
B0JHJ8_MICAN/2-166.W---RLWPQQAIA---------.....------..L--W-----------------------Q.QYPRVAIAIFLGLE-
K9RQ06_SYNP3/2-166.W---QDSLAWLEK---------.....------..S--W-----------------------R.QDDQAWIIGLISLE-
D7BE64_MEISD/2-161..---....LHYLG---------VQLDL------RGQ--V-----------------------RLPPEQVLYSGVAGYF-
A5GPK9_SYNPW/3-163..---PGWSYPTPS---------EALPL------VLA--W-----------------------LQKHPDPLLAVLLGLE-
Q81WY4_BACAN/2-155..---.........---------ALDGN------LIE--I-----------------------AKEHEVEIVTFVMGIV-
W6FU87_NODSP/2-166.W---RDLSVALGR---------.....------..S--L-----------------------V.VYTTEYLALFLGLE-
B4UA61_HYDS0/2-160FS---NYSHTFIKS---------SDTFF------QHI--K-----------------------YRIKEEDIFWFVMGAV-
K9T9J7_9CYAN/2-167.W---QRVARTAIQ---------.....------..S--I-----------------------SQDYRQEAIALVIGLE-
F0RKU1_DEIPM/12-173..---......WP.---------.GVNL------PAL--P-----------------------DPIEWKVLLPVTLGYF-
F2NN18_MARHT/2-164..---....AEALG---------VRWSL------NAE--L-----------------------ERLSPGVLWGALVGYY-
K8GJ34_9CYAN/2-177.W---LLATESIGR---------.....------..S--L-----------------------R.QHYSEWLALLIGLE-
D3PMR5_MEIRD/2-165..---....SSYLG---------LNIHL------QPH--F-----------------------KAPPQEVIWALVLGYY-
B0CCR6_ACAM1/2-165.R---QQLLQQAK.---------.....------..L--Y-----------------------SQQYLPEGLAILLGLE-
Q8DM71_THEEB/2-162.W---RW.......---------.....------...--.-----------------------.......GLAIALGLE-
P72876_SYNY3/2-165.L---QGINWLIPR---------.....------..Q--W-----------------------LEQHRWELLTIFVGLE-

PF04307

Q18EP1_HALWD/1-158PP...DL.LWPLT...........SIPA------HPG--P-----------------------AHWWGPHNI........
Q65F12_BACLD/1-155GI...KL.FFPS............AIKV------RLP--L-----------------------YIKTG............
Q0W2I6_METAR/1-181GI...PL.LYPLS...........DHKF------TLG--I-----------------------MAGPSIFLTVASIIYL.
Q1AT01_RUBXD/1-176GV...PL.LWPL............GKPF------RLL--P-----------------------RGIRS............
Q7MS32_WOLSU/1-175GI...PL.WLPWS...........ERPI------ALL--P-----------------------LSYRFKTGGII......
Q8D1W8_WIGBR/1-169GV...PL.FWPF............KFKI------CLP--I-----------------------LPSNNIKRE........
Q5WIF9_BACSK/1-182GT...QA.LWPFSN.........RWIAL------GVM--N-----------------------I.FDPVVFGAHVVGIL.
Q2NV14_SODGM/1-168GI...PL.LWPY............RRRF------CMP--I-----------------------LNPSK............
A0LXF8_GRAFK/1-182GT...QL.FWPFDL..........RLAY------KNI--F-----------------------V.IDPLYTLPFLIFLIL
Q01PN8_SOLUE/1-175GV...ML.LFPVTT.........ERLFF------PWR--P-----------------------IRVSPLSVARFFDR...
Q0W4H6_METAR/1-165AG...TW.FWPLFGWGFP.EYERGDYIL------YLL--N-----------------------NLISRPDVFL.......
YFHP_BACSU/1-182GT...QA.IRPFSK.........KWVAL------GLI--N-----------------------T.FDPFIFISHLAAIA.
Q5FTT4_GLUOX/53-213GC...QL.FAPLS...........RSRL------SLW--P-----------------------YVRTGGI..........
Q726Y1_DESVH/1-173GT...QI.LQPFSD.........WRAAL------PGV--Y-----------------------I.IDPLLTLPLLAAVA.
C1DQI7_AZOVD/1-180GT...QL.LWPLDT.........PPVAW------SSV--F-----------------------I.VDPLYTLPLLGAVLG
Q8ETE4_OCEIH/1-155GI...KL.LYPA............SVTV------RLP--I-----------------------TTRTG............
Q5FK20_LACAC/1-175GV...AW.LMPFS...........KKKR------YRK--F-----------------------LHYKV............
A4XRV7_PSEMY/1-180GT...QL.FWPLMP.........TPTAW------SSL--F-----------------------I.IDPLYTLPLIAAVVI
Q2N9Y9_ERYLH/13-204GI...RL.LEPFSS.........QWFYG------DTL--F-----------------------I.IDVWLWALMGFATWF
Q023X2_SOLUE/1-190GI...RL.FLPFSG.........QWLRA------DTT--N-----------------------V.IDLWILAVVIIGIAG
A9AVQ5_HERA2/1-166GV...AL.WWPFSS.........QRVFF------DWR--P-----------------------IAVAPISAARLF.....
Q7VVQ6_BORPE/1-180GT...QL.FWPFPL.........VPESW------SAV--F-----------------------I.IDPVYTVPMLAAVLV
A6LWG2_CLOB8/1-169GL...PW.FYPFS...........KKRF------SIC--M-----------------------IKTNSKIED........
A3CRK4_METMJ/1-159PV...EW.FWPFLGPLRH.HGYPEDYFW------ESV--L-----------------------RELAQ............
A1TRR8_ACIAC/1-179GT...QL.LRPFTD.........HPYGL------GSI--F-----------------------I.IDPLYTVPLIVGVVA
Q3J7C8_NITOC/1-183GT...QI.FAPLSN.........YKAAW------PTT--F-----------------------V.IDPWFTGIIVIGLL.
Q8CV62_OCEIH/1-182GT...QA.FRPFSK.........KWIAK------GFI--N-----------------------T.FDPYIFFLNVAGIA.
A0JUC0_ARTS2/1-250GV...PL.LWPIVIK........PPRFL------RKL--P-----------------------VLNDVWKANGAFSIP..
A1WTH1_HALHL/1-183GT...QL.LAPFSR.........ETFAF------PVT--F-----------------------I.LDPWITGALLLGLL.
Q5V391_HALMA/1-161SS...DL.LWPL............QPPV------ARS--P-----------------------VPQWVGEGA........
Q97K38_CLOAB/1-212GI...EV.FYPI............KKKI------SLK--L-----------------------VHTGS............
Q1WSF6_LACS1/1-169GV...KW.LYPFTK.........SGSSF------GGK--F-----------------------AFYKT............
Q0ACJ1_ALKEH/1-184GT...QL.LAPFSS.........HGFAW------NTT--F-----------------------I.IDPWFSGLLLGGLI.
Q7N3N6_PHOLL/1-166GV...PL.LWPI............KIRF------CLP--V-----------------------LGKQG............
Q9KEC4_BACHD/1-182GT...QA.LRPISD.........RWIAL------GVI--N-----------------------I.FDPFIFFAHVVAIF.
Q1D144_MYXXD/1-188GT...RV.LLPFSD.........SRLSL------DWT--M-----------------------V.VDPWVTLPLLAGAIL
Q2JB37_FRASC/1-225GC...PL.LWPV............TWRM------ETV--L-----------------------VPRTD............
Q12UG8_METBU/1-174PQ...TF.LWPIMGWEFP.HGTTYGGFS------HYL--S-----------------------VVTANSFAPEVSN....
A8GDN5_SERP5/1-166GV...PL.LWPC............RWRF------RLP--L-----------------------LNSQK............
Q5V568_HALMA/1-273PP...PF.FYPF............DVTL------VAE--R-----------------------VMLHPDPTTHLLAAFAI
Q1ATT6_RUBXD/1-170GV...QL.FWP.............SRAI------AVF--P-----------------------GRDEYRVVSGG......
A4J2S9_DESRM/1-180GIQPLRL.FLPMLP..........GRQW------RRV--K-----------------------EKLES....ASWTHKKW
Q8TQH1_METAC/1-199KM...RP.LYPFST..........DPSI------IGS--V-----------------------YFYDPLLNLLPLLPLFF
Q6D4I1_PECAS/1-166GV...PL.LWPC............RWRF------RLP--I-----------------------LNSQK............
Q82XH5_NITEU/1-183GL...ML.LAPFST.........WRFSL------PLV--F-----------------------V.IDPWFTAIILAGLV.
Q6YRT9_SYNY3/1-188GV...EM.FYPLGVRCV....CPGNRNL------RIS--T-----------------------GSAAEYWLMVFVVAIAV
Q5HM58_STAEQ/1-158GV...KL.LYPL............PFNI------VSP--I-----------------------HFKTG............
Q8TP13_METAC/1-172PQ...TF.LWPLFGWSFP.RESRDYIGL------EHL--L-----------------------DMFEASFHLDFLQ....
Q0JZE4_CUPNH/1-185GT...RI.FYPGSE.........RRFSL------GTS--F-----------------------L.IDPLLSGIVVSGLVL
Q97LP7_CLOAB/1-199GI...PL.LYPFKK.........KNYKF------SYT--F-----------------------RVGSA............
A0PYB1_CLONN/1-199GI...PM.FYPFIN.........KKYKL------PFT--Y-----------------------NVNSK............
Q9KE25_BACHD/1-180GT...GL.LEPFVD.........SRYSL------GFL--P-----------------------I.VDLPILLFFITGFI.
Q3JF51_NITOC/1-164GA...DL.LWPSPVRVV....MPGNRDY------RMA--V-----------------------GSKA.............
A1K1W5_AZOSB/1-183GT...MI.LAPLSD.........RRFGI------GTT--F-----------------------I.IDLVFTGIILAGLA.
Q6AMI9_DESPS/1-207SF...QHGLLPRLK..........RSSG------SAL--K-----------------------FYSKN............
Q7NV83_CHRVO/1-166GI...PL.LWPI............RIRF------RAP--L-----------------------MLLR.............
Q47U11_THEFY/1-250GV...PL.AWPFTV.........NGRRW------AML--G-----------------------VPRWMRFR.........
Q47RB2_THEFY/1-227GV...PL.LWPFW...........KYRF------GQN--I-----------------------GFKTD............
Q1QZR4_CHRSD/1-181GT...QL.WWPLTT.........PPVSW------HSI--F-----------------------I.IDPLFTLPLLVGVV.
Q5P1U0_AROAE/1-192GT...MI.FAPLSD.........RRFGL------GTT--F-----------------------I.IDLVLTGLLVAGLA.
Q0BSQ9_GRABC/13-169GL...RL.GWPL............KGTW------ALP--L-----------------------CRTG.............
Q5L2T9_GEOKA/1-182GT...QA.LRPFTK.........KWIAL------GVI--H-----------------------T.FDPVIFGLHLVGVG.
A5CZD2_PELTS/16-203GVKPYRV.YLPKLPGKLE..KWRQAEKW------NSF--A-----------------------ARAAA....HAWAGRQW
Q2S300_SALRD/1-182GT...QV.FWPFSN.........YPVVH------GAV--F-----------------------I.IDPLYTVPLAVGLLV
Q1DD75_MYXXD/1-235GV...RL.LMPFDG.........TWFYG------DAL--F-----------------------I.IDPWVWLLAGAAVIM
A0KFP7_AERHH/1-165GI...PL.LWPS............KRRY------RLP--G-----------------------WPLKS............
Q0VLL6_ALCBS/1-174GT...QL.FWPLGD..........PVAI------SSV--F-----------------------I.IDPFYTLPLLIGVL.
Q3A0M8_PELCD/1-203DF...QS