Sequence alignment for CL0368

PF13803

B7IVR2_BACC2/1-238----MPFT-----F-AHPAA-----VL--PFA--------KKHSKY----------------------------..MS-V
A7FSP1_CLOB1/1-250----MPFT-----F-SHPAI-----VL--PLE--------EKWNKY----------------------------..FN-F
B1RQR4_CLOPF/1-244----MPFT-----L-AHPAA-----VI--FFK--------NKK...----------------------------..FN-I
B9XK96_9BACT/41-287----MPLT-----I-AHPAI-----VI--PIR--------HR....----------------------------..LV-L
D0T6V3_ACIRA/1-244----MPFT-----L-SHAVL-----AP--PLA--------KLSGNR----------------------------..LP-L
A8L7F5_FRASN/1-234----MPFT-----L-SHPVA-----VL--PLR--------RLG...----------------------------..LP-M
A7C3K4_9GAMM/1-251----MPLT-----L-SHPAA-----AV--PLV--------RWG...----------------------------..LV-L
B2Q274_PROST/1-240----MPWT-----F-SHPAV-----VF--PLK--------QSKLGR----------------------------W.LS-L
D2Q1R3_KRIFD/1-252----MPFP-----L-AHPAA-----VL--PFV--------RRP...----------------------------..FV-A
Q6FEH5_ACIAD/1-244----MPFT-----L-SHAIL-----AP--PIA--------KLSGQR----------------------------..LP-V
B7GWN2_ACIB3/1-244----MPFT-----I-SHAVI-----AP--PLA--------KLSRNT----------------------------..LP-I
Q65Q39_MANSM/1-231----MPFT-----F-AHPVT-----VL--YFP--------RNSRY.----------------------------..FH-F
D0SS47_ACILW/1-244----MPFT-----L-SHAVL-----AP--PIS--------YLTGNR----------------------------..LP-V
C0B3N4_9ENTR/1-241----MPWT-----F-SHPSI-----VF--PIK--------QSRIGK----------------------------Y.LN-L
D3EE91_GEOS4/1-238----MPFT-----F-AHPVI-----TM--PWW--------KKKS..----------------------------..LP-V
D3D9A1_9ACTO/1-236----MPFT-----A-SHPAA-----VL--PLR--------RLG...----------------------------..LP-M
A0Q1Y2_CLONN/1-244----MPFT-----F-AHPAI-----VI--PCK--------KKAPKY----------------------------..LD-L
Q1IN38_KORVE/1-248----MPFT-----L-SHAAA-----VV--PLR--------RTR...----------------------------..LV-W
Q0RF10_FRAAA/1-234----MPFT-----L-SHPAA-----VL--PLR--------RVG...----------------------------..LP-M
A1ZM58_9BACT/1-236----MPFT-----F-SHPAL-----IL--PLT--------YLPKHW----------------------------..VS-S
C0DX83_EIKCO/1-244----MPFT-----L-AHPVA-----VL--PFA--------RCRR..----------------------------..VH-F
A3HWD2_9BACT/1-238----MPFT-----F-SHPAA-----IL--PFS--------KTSKR.----------------------------..LS-Q
A6GZ02_FLAPJ/1-237----MPFT-----F-SHPAI-----IL--PLR--------YLPRQW----------------------------..FS-L
D3V1B0_XENBS/1-239----MPWT-----F-SHPAA-----VF--PLK--------SFPGGR----------------------------L.LN-L
C0ZEY0_BREBN/1-243----MPFT-----F-AHPAI-----VL--PLR--------KCKW..----------------------------..FS-F
D2ARI2_STRRD/1-247----MPFT-----P-SHVAA-----VL--PLV--------SSARMR----------------------------RVLD-P
B1HS87_LYSSC/4-242----LPLT-----F-AHPAA-----VL--PFS--------RKSKY.----------------------------..IH-F
D4DQE9_NEIEG/58-292----LPFT-----L-AHPIA-----VL--PFS--------RCRY..----------------------------..CH-F
C0VQ51_9GAMM/1-244----MPFT-----L-SHAVL-----AP--PLS--------KLSKGH----------------------------..LP-I
Q1VTE4_9FLAO/1-237----MPFT-----F-SHPAI-----IL--PLT--------YFPRKW----------------------------..FS-L
D4BTR9_PRORE/1-240----MPWT-----F-SHPAV-----VF--PIK--------QSRFGH----------------------------F.LS-L
Q7UP84_RHOBA/1-250----MPFT-----P-THVAA-----AI--PIA--------WMAKWR----------------------------..LP-F
Q899W6_CLOTE/1-234----MPFT-----L-AHPAA-----VI--FSK--------NKH...----------------------------..FN-L
D0SL80_ACIJU/1-244----MPFT-----L-SHAVL-----AP--PLS--------KLTKGH----------------------------..LP-I
C5VRK3_CLOBO/1-245----MPFT-----F-AHPAI-----VI--PFK--------KQLPKY----------------------------..FN-I
C6D3J1_PAESJ/1-242----MPYT-----L-AHPIF-----AY--PLK--------KINRKL----------------------------..LS-V
D0SG75_ACIJO/1-244----MPFT-----I-SHAVL-----AP--PFA--------KLSGDR----------------------------..LP-I
C6JKD9_FUSVA/1-236----MPFT-----F-SHPAI-----IL--PLK--------KLPKKY----------------------------..IS-M

PF00882

B7GWN2_ACIB3/1-206----MPFT-----I.SHAVI.....AP-.P.L--------AKLSR...NT.......---------------....LP-I
C6RSF9_ACIRA/1-206----MPFT-----L.SHAVL.....AP-.P.L--------AKLSG...NR.......---------------....LP-L
B7H911_BACC4/1-208----MPFT-----F.AHPAA.....VL-.P.F--------AKKHS...KH.......---------------....IS-V
C2XYJ1_BACCE/7-214----MPFT-----F.AHPAA.....VL-.P.F--------AKKHS...SY.......---------------....IS-V
B1B9W2_CLOBO/1-214----MPFT-----F.AHPAV.....VI-.P.C--------KKKFP...KY.......---------------....LN-L
C5VRK3_CLOBO/1-214----MPFT-----F.AHPAI.....VI-.P.F--------KKQLP...KY.......---------------....FN-I
A3I5H3_9BACI/4-213----MPLT-----F.AHPAA.....VL-.P.F--------SRKS....KY.......---------------....IH-F
A7FSP1_CLOB1/1-219----MPFT-----F.SHPAI.....VL-.P.L--------EEKWN...KY.......---------------....FN-F
Q0SV58_CLOPS/1-213----MPFT-----L.AHPAA.....VV-...F--------FKNKK............---------------....FN-L
Q899W6_CLOTE/1-207----MPFT-----L.AHPAA.....VI-...F--------SKNKH............---------------....FN-L
C0ZEY0_BREBN/1-212----MPFT-----F.AHPAI.....VL-.P.L--------RKCKW............---------------....FS-F
C6JKD9_FUSVA/1-208----MPFT-----F.SHPAI.....IL-.P.L--------KKLPK...KY.......---------------....IS-M
A6GZ02_FLAPJ/1-209----MPFT-----F.SHPAI.....IL-.P.L--------RYLPR...QW.......---------------....FS-L
Q1VTE4_9FLAO/1-209----MPFT-----F.SHPAI.....IL-.P.L--------TYFPR...KW.......---------------....FS-L
A1ZM58_9BACT/1-209----MPFT-----F.SHPAL.....IL-.P.L--------TYLPK...HW.......---------------....VS-S
D3EE91_GEOS4/1-207----MPFT-----F.AHPVI.....TM-.PWW--------KKKS.............---------------....LP-V
C6D3J1_PAESJ/1-215----MPYT-----L.AHPIF.....AY-.P.L--------KKINR...KL.......---------------....LS-V
A3HWD2_9BACT/1-210----MPFT-----F.SHPAA.....IL-.P.F--------SKTSK...R........---------------....LS-Q
C0DX83_EIKCO/1-211----MPFT-----L.AHPVA.....VL-.P.F--------ARCRR............---------------....VH-F
D4DQE9_NEIEG/58-261----LPFT-----L.AHPIA.....VL-.P.F--------SRCRY............---------------....CH-F
Q65Q39_MANSM/1-202----MPFT-----F.AHPVT.....VL-.Y.F--------PRNSR...Y........---------------....FH-F
D3V1B0_XENBS/1-204----MPWT-----F.SHPAA.....VF-.P.L--------KSFPG...GR.......---------------..L.LN-L
C0B3N4_9ENTR/1-204----MPWT-----F.SHPSI.....VF-.P.I--------KQSRI...GK.......---------------..Y.LN-L
D4BTR9_PRORE/1-203----MPWT-----F.SHPAV.....VF-.P.I--------KQSRF...GH.......---------------..F.LS-L
B2Q274_PROST/1-203----MPWT-----F.SHPAV.....VF-.P.L--------KQSKL...GR.......---------------..W.LS-L
Q2LV15_SYNAS/6-198----AHCL-----LAREAME.......-...R--------FGKSKLFPGV.......---------------..LKTK-N
Q2Y883_NITMU/6-188----AHLT-----MVNLVKEPDRLEKQ-.G.F--------PPEAI...VS.......---------------..ILDY-F
A7K2D4_VIBSE/6-189----AHIT-----AVNEASANNALMKL-.N.I--------PQEAK...KA.......---------------..LAQN-K
A4C3L5_9GAMM/6-186----AHIT-----AVNIATDNNALCGM-.N.I--------PVKAK...LI.......---------------..LSKN-Q
C9YFH3_9BURK/6-183----THIT-----AVNKAKS....LAR-.GKL--------SKESL...YA.......---------------..LGTW-F
Q12DA4_POLSJ/6-186----AHIA-----VVNDAQKRADSAGL-REDT--------LVS..............---------------..LGLY-L
C4XMP3_DESMR/34-221----AHIT-----LASRCVNPSVLGSL-.E.L--------DTETV...GK.......---------------..LMQQ-V
E6VSV5_DESAO/6-180----IHFS-----IAERTAA.....LL-.DGT--------RLAPC............---------------..LAAE-R
Q2LQI8_SYNAS/6-189----THWI-----LAEQTWQ.....AM-.PDG--------LLKME............---------------..IREN-K
B8FCF0_DESAA/6-187----THWI-----LAREAFR.....RL-.KDG--------EARRM............---------------..IAQN-S
B3E8I7_GEOLS/6-161----THWW-----LATEAVK.....QL-PLDR--------TVRQL............---------------..LEEH-Q
A1AT46_PELPD/6-164----THWI-----LAERTAQ.....RL-AGSG--------ILADI............---------------..IQAH-H
C6Y3Y4_PEDHD/24-233----AHIR-----INRLAVF.....TL-.PAG--------LNRFY............---------------...KAN-I
E6U8V9_ETHHY/5-158----VHLL-----FARRIHA.....AV-.REQ--------IG...............---------------..VRLS-W
Q1IVJ5_KORVE/32-215----THQA-----IIDLAWDDSIRPFL-LSRY--------PNATAEQ..........---------------..LQVA-H
C1F375_ACIC5/44-227----THES-----IIDLAWDPAIKPLL-LKRY--------PHTTATG..........---------------..LRIA-H
Q01WM2_SOLUE/25-208----THEA-----IIDSTWDSAIKPLL-MKRF--------PLSSAGD..........---------------..LTAA-H
Q1ISY5_KORVE/28-210----THEE-----VIDLAWDHDIVPLI-KARF--------PDATDDD..........---------------..LKEA-H
Q025L8_SOLUE/39-222----THEA-----IIDTAWDGGIKPLL-LKRY--------PQATKDD..........---------------..LLEA-H
Y1571_ARCFU/28-204----THVR-----MSSEAGN.......-.P..--------.................---------------..YTGF-K
Q01YQ6_SOLUE/23-198----PHQK-----ITRAALD.....SL-.PAK--------FVNRL............---------------..GPES-K
Q8XI18_CLOPE/5-158----THIL-----IAQNILR.....DV-.DVD--------.................---------------..FKIS-D
B0AAC8_9FIRM/5-160----THLT-----ISNALIE.....NL-.DSS--------KS...............---------------..FFIS-E
B6FWP7_9FIRM/5-161----THFQ-----IAKSVLE.....NM-.DEK--------KA...............---------------..VLIS-E
C9YL06_CLODR/5-159----THFI-----MAKSILD.....NI-.DEN--------KT...............---------------..FFIS-E
D3MTQ6_9FIRM/3-156----THII-----LSKSLID.....NT-.DKT--------KQ...............---------------..FFLS-E
C1I9N1_9CLOT/4-161----THKA-----LAQQFIS.....NV-.EED--------KV...............---------------..FIIN-D
B2UYY5_CLOBA/4-161----THKL-----IAENILN.....NT-.NSK--------SI...............---------------..YLIN-D
C4IEN4_CLOBU/4-161----THRL-----MGENILK.....YA-.NSK--------SI...............---------------..YLIN-K
A6LQ77_CLOB8/4-161----THKI-----MAENIIK.....YA-.NTK--------SI...............---------------..YLIN-N
B1BXM8_CLOPF/5-161----THLE-----IGENTLN.....TI-.EGR--------GR...............---------------..NLID-K
Q97KV3_CLOAB/5-155----THLL-----ISYIVYK.....NL-.YNN--------FN...............---------------..FKLD-M
B0P7T6_9FIRM/16-171----SHIT-----MGRYLYT.....YF-.TEQ--------LG...............---------------..VELD-K
C0ECW5_9CLOT/5-161----SHMH-----VSAIIRR.....QL-.KSE--------FG...............---------------..IYLP-A
A8MHU0_ALKOO/5-164----THKI-----ISEHVHS.....NV-.KEI--------LG...............---------------..VDLN-K
A6TNX7_ALKMQ/5-165----SHKL-----ISEHIHM.....QV-.KET--------LG...............---------------..VELN-K
B2A897_NATTJ/5-148----SHIH-----LGRRLSN.....LI-....--------.................---------------..EENY-E
B0MJ55_9FIRM/5-161----SHIS-----LAGQIMD.....SL-.RLE--------.E...............---------------..VFDY-K
B0NZS3_9CLOT/15-171----SHIS-----LAGQIMD.....SM-.ELD--------.N...............---------------..VFDY-R
A5ZUN3_9FIRM/20-175----SHIL-----LARYLAD.....QM-.PAN--------ES...............---------------..LQSH-R
C6J9X9_9FIRM/5-161----SHIL-----LARYLAD.....QM-.QTT--------VS...............---------------..LQSH-R
C6LKS6_9FIRM/5-161----SHIS-----LARFLVS.....QM-.GAD--------.K...............---------------..LQQH-R
D4KRQ8_9FIRM/5-161----SHIS-----LARYIVN.....SL-.DDK--------.E...............---------------..LKKH-R
D9SRM2_CLOC7/5-162----SHVV-----IANKINR.....DI-.ENI--------LG...............---------------..ISMN-R
A6LQR0_CLOB8/5-160----LHGK-----IGYFLSK.....EL-IERG--------YS...............---------------..NIID-S
B0S165_FINM2/8-177----THKR-----IVREINQ.....DI-.KDS--------YG...............---------------..INLN-I
D1VUW6_9FIRM/8-182----THKV-----IATIIHQ.....RI-.KQD--------YN...............---------------..INLN-L
B1QT08_CLOBU/5-155----THFH-----LAKLSLR.....NL-.KPF--------YP...............---------------..KNFS-I
C4Z638_EUBE2/40-187----GHVT-----VTKRLTP.....ML-....--------.................---------------..KKRH-D
A7VFQ0_9CLOT/5-152----SHLF-----VTREIIE.....QV-....--------.................---------------..PQNK-R
C0EWT7_9FIRM/5-150----GHLV-----MTKSLSG.....NI-....--------.................---------------..HRAH-K
A8SNU3_9FIRM/5-162----DHMN-----LSRYIMD.....HM-.DAG--------AS...............---------------...KLQ-K
D4LBU1_RUMC1/5-160----DHRL-----LGSFLLR.....QQ-.DIF--------LD...............---------------...PMR-K
Q315K4_DESDG/47-177----VHMA-----CSEWLFA.....NL-.TLL--------PAGVA...TV.......---------------..ISAY-E
B8DLU9_DESVM/18-149----VHMV-----AAHWLLQ.....NA-.SLL--------PAAVG...SA.......---------------..LLNH-P
C7LVT1_DESBD/24-155----VHMA-----IGNHVLT.....HL-.HLL--------APAVA...AV.......---------------..LTAH-P
C6BUV8_DESAD/29-160----VHMA-----IGNAVLS.....NT-.MQL--------SDTVA...KL.......---------------..LLSN-S
C8X0X8_DESRD/29-159----IHVA-----TGNFILE.....NL-.RLI--------LPSIA...NT.......---------------..VSAF-P
A5G5N0_GEOUR/25-157----IHLQ-----LGSAVLN.....NL-.QAL--------KPAIA...AI.......---------------..IGEF-P
Q39S84_GEOMG/25-157----IHLQ-----LGTAVIN.....NL-.QAV--------SPAVA...AV.......---------------..VGAF-P
E8WRC5_GEOS8/30-162----VHLQ-----LGMNVLA.....NL-.DAL--------KPAVA...VI.......---------------..ISAH-P
A1AK53_PELPD/24-156----IHLQ-----VGLHILS.....HP-.ELL--------PAGLA...AL.......---------------..LAAH-P
B3EBK7_GEOLS/25-157----THLL-----IGLDVLS.....RL-.QQL--------PPQLA...TL.......---------------..LGGY-A
Q3A306_PELCD/29-161----VHLQ-----LGSQVLG.....QL-.HLL--------PETLR...QL.......---------------..LAAH-P
Q1K0Z2_DESAC/27-159----VHLQ-----LGNRLLE.....NL-.SLL--------SPALQ...HL.......---------------..LTYY-S
C1A8N1_GEMAT/19-151----THVF-----LGDAVLG.....NL-.SLL--------PSSLA...AL.......---------------..LSAH-P
B8J577_ANAD2/33-165----AHLN-----FSAQALA.....NL-.GVA--------QPSLR...MV.......---------------..LQDF-G
D6SRA3_9DELT/26-149----THTH-----FAFEILR.....AA-.SLL--------PVAVY...SL.......---------------..LTAY-S
B5YG53_THEYD/20-144----THAY-----LSGQIFS.....FS-.GLV--------PAGVL...TI.......---------------..IKLY-K
Q1H382_METFK/30-174----THVY-----FAHSLLW.....AM-.PLL--------DPRLK...RA.......---------------..ISRF-P
C6X6W6_METSD/30-174----THLY-----FAHSLLW.....AM-.PLL--------DPRLR...QA.......---------------..IQRF-P
C6WXF1_METML/56-200----THLY-----FAQSLLW.....AM-.PLL--------DPKLQ...NA.......---------------..IKKF-P
D5CMM4_SIDLE/28-177----THVY-----FAQMLLW.....AV-.PFT--------DPRYR...RA.......---------------..IKSF-P
B0SGT0_LEPBA/6-211----THIE-----ALSQVKK.....HL-EHGN--------ATQRKIANLLS......---------------..RPDV-A
Q72P57_LEPIC/6-211----THLE-----VLSQICK.....HL-DHGT--------ADQRKIAVLMR......---------------..AESN-R
C8W7P0_ATOPD/6-209----VHIA-----HANRLLE.....KG-.AGC--------LDVDI............---------------....QY-P
C5DV22_ZYGRC/30-228----VHLI-----YLARVTS.....EL-....--------.................---------------..DRKY-E
B5VL45_YEAS6/30-234----THLF-----YLTRGAP....LSL-....--------.................---------------..KENY-Y
C5DKM1_LACTC/24-220----VHIT-----LLARTKVPNN....-....--------.................---------------..LNSF-S
Q6FL70_CANGA/25-242----SHLT-----FLLRVISDPSVFEE-TQLN--------IN...............---------------..SQYY-F
Q6CEF9_YARLI/23-229----VHLT-----LLSRTLP.....SL-LTHL--------P................---------------..NQQI-D
C4R8D0_PICPG/19-213----VHLI-----ASYWTTNQ......-....--------.................---------------..LGAD-L
Q8R432_MOUSE/28-220----THVE-----IGHRALEFLRLQDG-RINY--------KEL..............---------------..ILEH-Q
C3ZWC6_BRAFL/5-194----THTE-----IGISTLFSVLSENF-QQL.--------.................---------------..LLKH-Q
A7SED1_NEMVE/31-226----THIA-----IAHQALEWFDDQRG-NTSY--------RKI..............---------------..ILAH-Q
D3AZT7_POLPA/38-225----THNE-----VARRAFNFSDFKEY-PQFQ--------QM...............---------------..ILNN-L
PLDG_DICDI/29-216----THNT-----VARRAYNFSSFDGF-EQYQ--------KY...............---------------..VSEN-F
Q97TF6_CLOAB/60-232----THEF-----ITVQAMT.....IL-.GND--------KGNNF...........K---------------NLIKNY-E
A7B1H2_RUMGN/72-243----THQY-----IVANTLK.....IL-SNDK--------GNSAFN...........---------------..GELN-S
PHLC_CLOHA/37-230----THAL-----IVTQAVE.....IL-....--------.KNDVISTSPLSVKENF---------------KILESN-L
PHLC_CLONO/38-231----THSM-----IVTQAVK.....VL-....--------.ENDMSKDEPEIVKQNF---------------KILQDN-M
Q5PXE6_CLOPF/38-231----THAM-----IVTQGVS.....IL-....--------.ENDLSKNEPESVRKNL---------------EILKEN-M
Q8GCY3_9CLOT/38-231----THSV-----IVTQAIE.....ML-....--------.KHDLSKDEPEAIRNDL---------------SILEKN-L
PHLC_CLOSO/38-231----THAL-----IAEHGLT.....ML-....--------.NNDLNQNEPKPIKQNI---------------EILNKY-L
Q6R6B7_LISSE/64-245----THLW-----LFNQAEK.....IL-AKDV--------TGAQLDLVRE.......---------------..LKNY-N
Q6EAE3_LISMN/64-245----THYW-----LFKQAEK.....IL-AKDV--------NHMRANLMNE.......---------------..LKKF-D
Q6R6D6_LISIV/62-243----THLW-----LFKQARK.....IL-AKEN--------NGAYKELLEM.......---------------..LNKY-Y
A0R9W0_BACAH/51-232----SHLW-----IVNRAID.....IM-SRNT--------TLVKQDRVAQ.......---------------..LNEW-R
A5D2J5_PELTS/29-178----THIF-----CVQQALE.....IL-....--------........KNDGFFNQH---------------ALLTKH-Q
Q896L3_CLOTE/34-205----VHKF-----IMLQSLD.....IL-....--------........KNSEHQEAY---------------NFFKDN-L
A5N896_CLOK5/34-205----VHKF-----IMIQSIA.....IL-....--------........QNDGYQEEY---------------NFFRKY-I
Q97KA0_CLOAB/34-205----IHKY-----INSLAVE.....IL-....--------........KNKRKAKQY---------------KFFSDN-I
A6TKQ8_ALKMQ/57-228----VHKF-----INIQALK.....IL-....--------........RNDGYAEEY---------------NFFSSY-I
O26214_METTH/27-173----NHHD-----IAEKVYS.....EM-.PED--------VR...............---------------..NRMS-L
B8I5G2_CLOCE/32-236----DHKT-----CVTDAAA.....SV-.GIT--------LSPEE............---------------......-K
B5HQN8_9ACTO/67-292----LPFT-----L.SHAAA.....VL-.PAV--------RTDGT...GR.......---------------..GRLV-P
Q82A31_STRAW/92-336----LPFT-----L.SHAAA.....VL-.PGV--------RGDGT...GR.......---------------..GRLV-P
C9YWP6_STRSW/1-225----MPFT-----L.SHAAA.....VL-.PAL--------RGNGT...GR.......---------------..GPLV-P
B4V801_9ACTO/61-287----MPFT-----L.SHAAA.....VL-.PAI--------RRTGR...AR.......---------------..GPLV-A
C7QBS6_CATAD/1-214----MPFT-----L.AHPAA.....VL-.P.L--------TRRGR...AR.......---------------..GGLV-G
D3D9A1_9ACTO/1-206----MPFT-----A.SHPAA.....VL-.P.L--------RRLG.............---------------....LP-M
A8L7F5_FRASN/1-204----MPFT-----L.SHPVA.....VL-.P.L--------RRLG.............---------------....LP-M
Q0RF10_FRAAA/1-204----MPFT-----L.SHPAA.....VL-.P.L--------RRVG.............---------------....LP-M
D2ARI2_STRRD/1-214----MPFT-----P.SHVAA.....VL-.P.L--------VSSAR...MR.......---------------..RVLD-P
D2Q1R3_KRIFD/1-218----MPFP-----L.AHPAA.....VL-.P.F--------VRRP.............---------------....FV-A
C7R2G7_JONDD/1-213----MPIT-----F.AHPAA.....VL-.P.F--------MGGP.............---------------....CV-P
Q7UP84_RHOBA/1-217----MPFT-----P.THVAA.....AI-.P.I--------AWMAK...WR.......---------------....LP-F
A7C3K4_9GAMM/1-217----MPLT-----L.SHPAA.....AV-.P.L--------VRWG.............---------------....LV-L
B9XK96_9BACT/41-256----MPLT-----I.AHPAI.....VI-.P.I--------RHR..............---------------....LV-L
Q1IN38_KORVE/1-215----MPFT-----L.SHAAA.....VV-.P.L--------RRTR.............---------------....LV-W
D9T3L8_MICAI/1-213----MPLT-----FPSHLAP.....VL-.P.L--------KLWRP...GW.......---------------....FD-G
C1ACE2_GEMAT/1-206----MPAT-----ILSHQAL.....VL-.P.L--------KMRWP...HR.......---------------....FS-G
Q6FEH5_ACIAD/1-206----MPFT-----L.SHAIL.....AP-.P.I--------AKLSG...QR.......---------------....LP-V
C0VQ51_9GAMM/1-206----MPFT-----L.SHAVL.....AP-.P.L--------SKLSK...GH.......---------------....LP-I
D0SL80_ACIJU/1-206----MPFT-----L.SHAVL.....AP-.P.L--------SKLTK...GH.......---------------....LP-I
D0SG75_ACIJO/1-206----MPFT-----I.SHAVL.....AP-.P.F--------AKLSG...DR.......---------------....LP-I
D0SS47_ACILW/1-206----MPFT-----L.SHAVL.....AP-.P.I--------SYLTG...NR.......---------------....LP-V

PF04307

Q2VZJ9_MAGSA/3-159--VVSH.V.....VLGVSAW-----TL-..AQ--------RAGL......AV....................PLGPEG-A
A6LWG2_CLOB8/3-169--YKTH.I.....NGGILVG-----LY-TNCQ--------LANM......PL....................MSTAVL-L
A3CRK4_METMJ/3-159--LLAH.A.....MVGLLIG-----VV-LAAI--------................................AGDRRV-L
Q1MS87_LAWIP/3-199--PLTH.A.....LTGATIV-----YT-FPKE--------................................SRPWWF-L
Q0W649_UNCMA/3-154--RTGH.......FGGSLLL-----FY-GILS--------VVGG......GGDTA.................QTLALS-L
Q5X0H9_LEGPL/3-176--PITH.G.....VLGAACA-----QA-ALGK--------................................YDKRIP-W
Q2NZA4_XANOM/4-177--IMTH.T.....AVPLALW-----CA-SERR--------................................RIWPRL-L
Q8PZ85_METMA/4-181--PVVHVLFFLFCVGIVAVY-----AI-..TG--------PLYR......RELCF.................SDARKL-L
A4YHA8_METS5/3-210--LNSH.I.....AFALAVG-----LA-L...--------................................FHNIPL-A
A4W9L4_ENT38/3-166--AEGH.L.....LFSIACA-----VF-..AK--------NAEL......TPVLAQ................GDWWHI-V
Q468G0_METBF/3-172--LFGH........IGVTLG-----IF-FGLA--------ILIPR...........................LRTIID-P
Q6AMI9_DESPS/4-207--FSTH.L.....TAGACVG-----FA-ISTL--------STVSFDFSI.......................SQTATV-F
Q1ILA3_KORVE/3-163--PATHLL.....AAGVLAG-----FS-....--------................................RLDHRG-R
Q8TVQ4_METKA/3-158--ARTH.V.....LLTYLLT-----AP-....--------................................FLGVER-A
A8GDN5_SERP5/3-166--AEGH.L.....IFSVACA-----IF-..AK--------KAEV......TPSLAT................GDWWHI-I
A0YYL1_LYNSP/4-178--PIAH.A.....VSGYVLS-----EL-FPLK--------SNIRNQE.........................KRYHWH-S
A0YXX1_LYNSP/4-183--PIGH.S.....LAGICGY-----IL-..VQ--------PHIP......K.....................YQRLSC-L
Q1VZ04_9FLAO/3-179--SLTQ.I.....VLGAAVG-----EL-VLGR--------................................KVGNKA-M
Q0JZE4_CUPNH/3-185--TITH.A.....LMGAQAA-----LA-IPVA--------EVPG......RR....................LSTRER-L
Q2S300_SALRD/3-182--SVTQ.I.....TLGAAVG-----EA-TAGR--------................................EAGLKA-P
A5CZD2_PELTS/18-203--GITH.A.....AAGAAIG-----AA-..AG--------ALG.............................GAAAAG-A
A3CVA2_METMJ/3-183--VACH.L.....FLGLILG-----LA-IAGR--------................................LGDRRL-I
Q0BSQ9_GRABC/15-169--AGSH.V.....ALGAAAW-----LI-..VA--------PKLG......LP....................PADAAG-L
A2BN14_HYPBU/3-145--KQTH.V.....AFSLALA-----ST-..AA--------VLLS......YTV...................YEYVVA-I
Q0S8N5_RHOSR/4-250--GPTH.A.....MSGAAVG-----LA-..VA--------DLLP......LDWGGPTST.............AETFTF-A
Q1IHJ9_KORVE/3-205--PVTH.F.....LTGACLG-----RA-....--------................................GLNRKT-A
A1U6Q1_MARAV/3-174--SITQ.A.....ALGASIA-----GA-VAGK--------................................TLGRSA-L
A4J2S7_DESRM/3-150--WRTH.L.....VMGLGAG-----YM-..VA--------................................GFDPVL-L
Q28PX8_JANSC/2-152--ITAH.L.....PSGYVLG-----AS-L...--------................................GLTGTA-F
Q18EP1_HALWD/19-174--PLEHAL.....VALIPVT-----IY-ILLR--------HRR.............................LPSKTM-L
Q0VLL6_ALCBS/3-174--SLSQ.A.....VLGASVG-----GA-VLSR--------................................PLGRWA-L
Q726Y1_DESVH/3-173--PITH.V.....ASGAVAM-----YA-LRER--------................................PRTAWA-L
Q2NEC5_METST/4-226--YRNH.A.....IAGILFA-----LP-F...--------................................APSLFY-L
YFHP_BACSU/3-182--TGTH.V.....VMGIALG-----GI-ATLD--------PVVG......SDP...................AMAHAV-M
Q8TQH1_METAC/4-199--TLSH.L.....GIGFLIA-----LA-L...--------................................GLRGKK-L
A0KFP7_AERHH/3-165--AQGH.L.....LFSVTCT-----LL-..AH--------KLQL......TPALAD................ASLWHT-I
Q47U11_THEFY/3-250--GFSH.A.....TTGVLVG-----VA-..VA--------APLA......AAAGTPPTP.............MGLLAW-A
Q1C5S1_YERPA/4-178--IITH.A.....AIPLTLG-----LG-LGTK--------................................IIPPRL-L
Q465I7_METBF/4-223--TLSH.L.....GIGLLLA-----YA-L...--------................................GLKGRK-K
Q1QZR4_CHRSD/3-181--SLTQ.A.....CLGAAIG-----GT-VLGR--------................................RLGRKA-V
A6TMK4_ALKMQ/3-249--GRTH.V.....ALGLMTS-----LG-..IA--------VLLG......NPFMVE................SFNTIA-L
Q82XH5_NITEU/3-183--PVTH.T.....LSGALLM-----RA-VTSS--------HTQY......AQR...................LPLRER-I
Q6YRT9_SYNY3/3-188--TITHLL.....VGAASVG-----MA-AQ..--------................................TTNPVP-I
A6LXK9_CLOB8/3-172--FFGH........LGLTTE-----AI-KAYE--------VILHKDNKLSG.....................KEVFVD-Y
Q8D1W8_WIGBR/3-169--SKGH.L.....IFGLSVA-----IF-LKKI--------EIFNALYL........................GKWGHI-I
Q18KS6_HALWD/3-171--KDGHVLNAALLAIGLGLI-----LT-VDIA--------ISAERLFTAGVTAKPSPSDEIQTSIDFAAQLGRSVLAF-S
Q8R899_THETN/3-179--GRTH.M.....AVALAAT-----AL-..LT--------KDP.............................SQLPIN-L
A0Z1N5_9GAMM/41-214--PLSQ.A.....VLGAVVP-----QV-TMRH--------................................RNLARL-T
Q9V2B4_PYRAB/7-175--KATN.IKIERHIWKRDRG-----DF-LSLS--------S...............................NPEISP-L
Q18EE2_HALWD/4-162--LLAH.V.....FIAYSVC-----RI-LSWR--------LS..............................WLTNQY-I
Q12UG8_METBU/3-174--IIGH........LGLTLA-----IF-LVIS--------LLVPS...........................IRNMID-Y
Q3IS66_NATPD/3-169--LPTH.V.....LSGMALA-----LP-L...--------..LV......VAP...................EFAPVG-L
Q465I8_METBF/4-199--VISH.F.....GVGLLIA-----LA-L...--------................................GLKGNK-L
B4SJC5_STRM5/4-190--IITH.A.....AVPLALW-----CA-ADRG--------................................RIPPRL-L
A0PYB1_CLONN/3-199--GKTH.A.....AIGMATF-----MS-..VY--------DRVP......G.....................GFNYLG-V
Q3A0M8_PELCD/4-203--HKTH.F.....AAGVATA-----AL-LAGT--------TSIVGGIPH.......................AQQPLL-L
Q465I4_METBF/4-199--SLSH.L.....GIGLLIA-----LA-L...--------................................GFKGKK-R
Q46FT6_METBF/4-180--PVVHVLFFVFCISAVAVF-----AA-..TR--------SFFR......GELSL.................KGSTHL-I
O26450_METTH/3-144--LRTH.V.....TAAVVLF-----LL-INFL--------YPV.............................TTIIKG-A
Q1AT01_RUBXD/3-176--ATTH.A.....VFGVAAF-----AG-ACLA--------AGV.............................EPPAYA-Y
Q75TF0_GEOKU/3-155--YSSH.V.....IATLCLG-----AA-AAAH--------TKL.............................PFTAAY-T
Q1NK63_9DELT/3-180--TITH.A.....VSGAVLG-----RA-TAGV--------DGTP............................LSPRRR-M
Q1C702_YERPA/3-166--GEGH.L.....IFSVACV-----IL-..AK--------KVGL......TPELAH................GDWWHI-I
Q2RM17_MOOTA/3-158--VPGGRQ.....RPGSRPG-----..-....--------................................PPELID-Y
Q5YVJ3_NOCFA/3-233--GHSH.A.....TSGALAW-----SV-..AA--------ATLP......LAVVTYPVMQDVDARLGP....VDVLLG-V
Q8CV62_OCEIH/3-182--TGTH.I.....VMGVALG-----GL-ATID--------PVVQ......SDP...................TLFHAV-L
A0NTQ3_9RHOB/3-182--SLTQ.F.....VLGAAVS-----TA-LLGK--------K...............................LGPRKA-A
Q2NV14_SODGM/3-168--AGGH.F.....IFVLASA-----IF-..AK--------KLEL......SPALAQ................GNWGHI-I
Q2N9Y9_ERYLH/15-204--NLTH.S.....LVGALLG-----QA-GLK.--------................................KKTGLA-M
A1K1W5_AZOSB/3-183--TVTH.A.....LSGALLG-----RL-FSSG--------RGG.............................LRPAAA-I
C1DQI7_AZOVD/3-180--SLTQ.A.....VLGASVQ-----GA-LLGR--------................................WQGRKA-L
Q5FK20_LACAC/3-175--TRSH.R.....LFSIAVV-----EL-GLIA--------TDTF......LTNP..................VSNVVL-L
Q0ACJ1_ALHEH/3-184--TLTH.A.....ISGAVAA-----RA-LPAS--------RRAA......A.....................PSLRER-T
Q8FRV6_COREF/4-249--GPTH.A.....MSGAAVG-----LA-..VA--------QILP......EQWGGVTTA.............EETFIY-A
Q1V9R5_VIBAL/3-178--PLTQ.G.....LLGAALP-----LA-VSNK--------................................RNLAVV-G
Q97K38_CLOAB/3-212--GKTH.I.....SIGLMSS-----AA-..VL--------SVNN......PTP...................ENIAVG-L
Q5V827_HALMA/3-151--RNGH........YGAALL-----FV-TPIS--------AVLI......SIGFV.................RLAFVA-G
YVSG_BACSU/3-155--GKTH.I.....MGGIASC-----TA-..AA--------YYYG............................FDPVLM-A
A1WTH1_HALHL/3-183--PVTH.A.....ASGALIN-----RV-VAPR--------DCGA......PR....................FSLRER-T
Q8PSE7_METMA/3-176--LFGH........LFVTLG-----IF-FGLA--------IFIPR...........................LKTVIN-P
O29835_ARCFU/7-140--RPGH.......MGATLLA-----LS-PFIP--------................................KLGVEF-V
Q02F56_PSEAB/4-178--LITH.P.....LPVLAVG-----LA-LGSR--------................................VIPPRL-L
Q2RLP5_MOOTA/5-179--GSTH.L.....FSGLAAA-----SL-..L.--------................................STNLPG-L
Q46DH2_METBF/3-171--IFGH........IGITLG-----IF-YFLS--------RLFSK...........................NNFWVN-V
Q9EZ84_CAMJU/3-164--WKSH.L.....AIGTAIS-----L.-....--------................................PFSPFG-T
Q3YN07_BACTK/3-163--YKTH.L.....TTSLAVA-----LP-..VL--------ASTG............................NLTVGN-V
Q3JF51_NITOC/3-164--AGTH.I.....AFASVLY-----LG-GAAL--------FEY.............................DTDLLG-W
Q1MQD9_LAWIP/3-155--WFTH.K.....AIAIAGA-----LA-L...--------................................EASPPG-L
Q0AJ35_NITEC/3-176--PITH.G.....LIGATTT-----QS-FANK--------................................QNIRQI-S
Q97LP7_CLOAB/3-199--GKTH.A.....GIGAAVG-----IA-..LA--------GKLP......G.....................GFNAVG-M
A8L052_FRASN/2-224--GQTH.V.....LSGAVVW-----LA-..AV--------PVLS......REEWLGSYAVSLSP........QQVIAG-A
A9AVQ5_HERA2/4-166--IFSH.V.....APALIVG-----LA-LGRE--------................................RMSRPL-L
Q67R78_SYMTH/3-176--SLTH.V.....LMGHAMG-----AL-ATAV--------SP..............................EAGPAV-Y
Q9YAY7_AERPE/3-148--RDGH........FGMAMA-----IV-..FG--------AYSV......LDIKS.................TESLII-G
Q1ZS65_PHOAS/3-176--SITQ.A.....ALGASVA-----AV-VAGR--------................................HCKPKT-L
A4XRV7_PSEMY/3-180--SITQ.A.....VLGASIQ-----GA-LLGR--------................................WQGRKA-L
A4J2S9_DESRM/3-180--GITH.A.....AAGSAVG-----AA-..LA--------ALG.............................GQEVTG-A
Q18HI1_HALWD/3-156--RKGH........YGASLL-----AY-APVG--------CLTI......IAGFD.................VAAVLG-G
A0R9F7_BACAH/3-182--TATH.L.....VMGVTLG-----SL-ATLD--------PAIA......QSD...................IGPQAV-M
Q65F12_BACLD/3-155--GKTH.I.....MGGVASC-----TA-..AA--------YFYG............................YDPVFM-T
A0KMD3_AERHH/4-197--IITH.A.....AVPLCLG-----LG-LGSR--------................................IIPPRL-L
Q18BE8_CLOD6/3-241--GKTH.C.....AIGILTA-----IQ-TSLI--------FKI.............................PISLVD-I
Q648F5_9ARCH/3-180--LFGH........LGVTLG-----IA-FLVF--------YILKI...........................KLDRRL-Y
Q5FTT4_GLUOX/55-213--GRSHLL.....IGGFAVL-----CA-MRWH--------IL..............................SPEPLS-V
A1HQY3_9FIRM/3-173--TLSH.A.....LIGMAVA-----GL-SGHP--------L...............................SPSDPV-Y
Q3JEV9_NITOC/3-176--IVTQ.G.....LLGAVVA-----QS-AARP--------................................SQARLA-A
Q1DD75_MYXXD/3-235--NLAH.S.....LVGAWMA-----EA-GLK.--------................................RTTPLA-T
A0JUC0_ARTS2/3-250--GGHH.A.....ASGAAAW-----VA-..IA--------STGP......YTLGWYPLDA............TGILIG-G
A3CTE7_METMJ/3-243--GDQH.V.....SLSLATA-----AL-LIAP--------WATA......IDA...................AAIAVL-L
Q186I4_CLOD6/3-177--KETH.E.....RGGYIFA-----LL-ILPF--------INNLYLVKYDIAYKI.................VLIIIY-I
A0R7P4_PELPD/13-154--WRNHQM.....ITGIAIY-----SI-....--------................................TGGFLS-A
Q47RB2_THEFY/3-227--GHSH.A.....LSGVVGW-----MA-..VV--------PLLN......KVDVLGINFELGS.........GEIIAG-G
A6TSU9_ALKMQ/3-172--PLSH.G.....LMGLAAF-----SL-KYSP--------................................SLSNPA-C
Q5HM58_STAEQ/3-158--GKTH.A.....SCGFLVG-----AI-..TT--------QYFH......TDI...................FTSISV-I
Q2JB37_FRASC/3-225--GRTH.A.....LSGAVVW-----LA-..VA--------PLLS......REQWLGSHAVSLSS........SQVIAG-A
Q5V391_HALMA/4-161--PSEHFI.....IALLPVA-----VY-ALLR--------DRH.............................LPSLQL-V
Q7NV83_CHRVO/3-166--VATH.V.....AFGAFCA-----VS-..AA--------LILH......LPA...................MMAVLL-L
O27320_METTH/4-218--YRKH.A.....LLSIIMA-----IP-V...--------................................FQAVLP-V
B1J8M8_PSEPW/3-184--SITQ.A.....VLGAALQ-----GT-VLGR--------................................IQGRRS-L
Q5V568_HALMA/2-273--FVGH.A.....LLAFALG-----AL-AAWW--------LG..............................LSRERA-V
Q2L2L1_BORA1/3-180--SVTQ.A.....VLGAGIQ-----AT-LLGR--------................................WQGRRA-L
Q0W4H6_UNCMA/3-165--FFGH........IGLTLL-----VV-FLVA--------LA..............................LKIGVD-Y
Q4L847_STAHJ/3-158--GKTH.V.....SAGLLVG-----AL-..TT--------EHFQ......TDL...................FSTVTV-I
Q97MS7_CLOAB/3-166--FFGH........LGLTTG-----AV-KICE--------NTVLS...........................KKKDID-Y
B4SK06_STRM5/3-184--SLTQ.I.....VLGGAVA-----AV-IAPP--------................................GHRRAA-L
Q0SU56_CLOPS/3-177--KETH.S.....TGGVCIS-----LI-MLNT--------ILSLFLFPYDLAYKI.................LLIALF-F
Q9KE25_BACHD/3-180--TVTH.G.....LLGYGVY-----AA-FKKP--------FME.............................THKKWY-A
Q15HU4_CLOPF/3-157--YKTH.L.....STSLNVA-----IP-..AL--------YLSN............................ELSLLT-L
A0YBX0_9GAMM/3-178--PISQ.G.....LVGAALS-----QS-QGSN--------................................KQLKIA-G
Q023X2_SOLUE/3-190--NLTH.T.....AVGLFLS-----RI-GLG.--------................................RWSARG-T
Q8PXV1_METMA/3-172--IFGH........IGITLG-----IF-YLLS--------RLFPE...........................KNIPVD-I
O29079_ARCFU/4-168--HTTH.V.....IFSMLFI-----TA-IAEF--------IPSFTEF.........................IPYSYA-L
Q5P1U0_AROAE/3-192--TLTH.A.....LSGALAG-----RL-LARR--------PSPG......STPAAKPA..............PSIWQP-V
Q99S94_STAAM/3-158--GKTH.A.....SCGMLVG-----AL-..TT--------QYFQ......TDI...................FSSVTV-I
A0XYC3_9GAMM/3-181--SLTQ.V.....ALGSAVG-----YA-VLGN--------................................KIGRKA-V
Q1GSW3_SPHAL/3-193--NLTH.S.....LVGALLG-----QM-GLK.--------................................KKTGLA-M
Q46G46_METBF/3-177--LFGH........IGITLG-----IF-FVFS--------YIAPQ...........................LKTIID-K
A0LXF8_GRAFK/3-182--SLTQ.I.....VLGAAVG-----EA-VLGK--------................................KVGNKA-M
Q043R0_LACGA/3-174--TKSH.R.....ICSIAIV-----EL-SLLL--------TNRL......LIDP..................VNNIII-L
Q8TP13_METAC/3-172--LFGH........LGVTLG-----IF-FGLG--------IFIPR...........................LRTIID-P
Q6D4I1_ERWCT/3-166--AEGH.L.....LFSVACA-----IL-..AK--------KVEL......SPALAA................GDWWHI-I
Q890Y4_CLOTE/3-199--GKTH.L.....GVGIVTS-----IA-..LY--------EKLS......L.....................DFNIIS-L
A1TRR8_ACIAC/3-179--SLTQ.I.....ALGSAVS-----LA-AMGR--------R...............................TAAWKA-V
Q3J7C8_NITOC/3-183--TLTH.A.....LSGALLA-----RA-TASS--------KQPT......GQ....................LRVGER-V
Q1Z117_PHOPR/3-176--SVTQ.A.....ALGAAVA-----AV-VAGK--------................................KSTPKI-L
Q08ZS3_STIAD/3-149--PIVH.A.....ELSWLAA-----QG-....--------................................LRERRD-R
Q0RHF1_FRAAA/6-228--GRTH.A.....LSGAALW-----LA-..VV--------PFLG......REDWLGTYALSLSS........HQVIAG-G
Q0W2I6_UNCMA/3-181--SLTH.......ALAITVV-----FT-A...--------................................AGRPEL-V
Q7MS32_WOLSU/3-175--ARTH.L.....AFALGIA-----TL-PLYA--------LSLV......DKATLQG...............VEVSLY-L
Q1ATT6_RUBXD/3-170--VATH.I.....VFGECCL-----FA-ASAV--------FDF.............................HYETPS-V
Q9KAZ8_BACHD/3-159--GPTH.I.....IGGFTAA-----AA-..MA--------YFNA......ISV...................EQPIIY-Y
A8LV16_SALAI/3-256--GPSH.A.....LSGAAVW-----LA-..GS--------WALD......QFAGYEQSP.............LALAVG-T
Q8PUB3_METMA/4-199--TLSH.L.....GVGLLIA-----LA-L...--------................................GFKGKK-R
Y790_METJA/3-224--WKGH.T.....ILGIIFG-----LP-..F.--------................................ISSPEQ-I
Q01PN8_SOLUE/4-175--AITH.F.....VVGAGLA-----LP-AMEL--------PALR......GV....................MPRWAL-P
Q9CNK9_PASMU/3-180--SVTQ.F.....VLGAAVQ-----GV-GMGK--------................................YQGRKA-L
Q2B443_9BACI/45-224--TITH.T.....LFGLALY-----AS-VDKS--------RLEK............................KEKAAY-L
A0AJE4_LISW6/3-182--TGTH.V.....VMGIALG-----AL-ATVD--------PVVA......GSS...................QAAIGI-M
Q9KEC4_BACHD/3-182--TGTH.V.....VMGVALG-----GL-AAID--------PAVT......NDP...................MMKSTV-M
Q8E899_SHEON/3-158--WINHTL.....IAGSICA-----VI-....--------..................................SPIH-V
Q99T10_STAAM/3-179--TATH.I.....AIGVGLT-----AL-ATQD--------PAMA............................STFGAT-A
Q3ITN2_NATPD/3-143--KEGHVLNAVVLGVGLGFV-----LE-PAGS--------METL............................RTVVAV-T
Q11P46_CYTH3/3-219--ILIH.T.....LSGTATA-----AL-..IS--------TFTK......AKT...................KTKLSL-I
Q1D144_MYXXD/3-188--NLTH.G.....LLGLAIG-----AM-RKPD--------VRPG......APERAS................PTDRAV-L
Q50EB0_STRFL/3-259--GPAH.S.....LSGAAAW-----LG-..VG--------AAAA......AAGHTMPW..............PVLVVG-A
Q7VVQ6_BORPE/3-180--SVTQ.V.....VLGAAIQ-----GS-MLGR--------................................SQGRKA-L
Q7N3N6_PHOLL/3-166--AEGH.L.....LFSVASI-----IL-..AH--------KLEI......TPEIAN................GDWLHM-L
Q7NWB9_CHRVO/4-187--VVTH.A.....LAGATLV-----GL-ACRK--------PLSA............................PGVLPW-L
Q8ETE4_OCEIH/3-155--GKTH.I.....MGGIAAT-----TA-..YA--------YYSN............................YDPTAL-I
A6UAV6_SINMW/2-157--FIAH.L.....PAGYLLT-----RG-IVRK--------RE..............................TIWRPA-L
Q49ZB6_STAS1/3-158--GKTH.A.....SCGLLVG-----AL-..TI--------EYFH......TDL...................FTSITV-I
Q5L2T9_GEOKA/3-182--TGTH.V.....LMGVALG-----SL-ASLD--------PAIA......HDP...................LLSHAV-L
Q8PUB1_METMA/4-234--TLSH.I.....GIGLLLA-----HA-L...--------................................GLKGRK-R
Q5WIF9_BACSK/3-182--TSTH.I.....VMGAGLA-----GL-ATLD--------VQIA......SSP...................YMMTAV-L
Q2B352_9BACI/31-210--TGTH.V.....VMGFALG-----GL-ATLD--------PVVA......DST...................ATATSV-M
Q4J9X0_SULAC/3-213--LNSH.I.....LLALALG-----LA-L...--------................................FHRVDL-A
A4G067_METM5/3-224--WKGH.I.....TLGIIMG-----LP-..F.--------................................ISAPEQ-I
Q5WH30_BACSK/3-157--GKTH.M.....IGGVVAC-----QA-MDTI--------VFAG............................AHGWAY-Y
Q5I399_VIBCL/3-158--WIQSGL.....IAGAVCA-----VV-....--------..................................SPPH-V
Q04RA4_LEPBJ/4-178--IMTH.T.....AIPISFW-----IA-FGNK--------................................FIPTRL-L
Q1WSF6_LACS1/3-169--AKTH.I.....TTTLALG-----LP-..LM--------SLTN............................ELTLVN-V

PF09988

A0YPQ2_LYNSP/2-202PSGRTHDRITL..W.SLPVV-----TG-FTFG........QTRSS---------------------------HLTLII.A
Q631C1_BACCZ/2-157PSGRTHTKINL..I.SLPVV-----LF-LLFS........YGLTN---------------------------FDFLLTFA
B8GCX6_CHLAD/2-185PSARAHDLITV..LSGAAIT-----PL-AYYACLEFTPIAPDTAL---------------------------ACSLWL.G
A4CX56_SYNPV/2-164ALGRDHDRATL..MVCVPAG-----LL-SGLW........LGLG.---------------------------.MGVLT.A
A3IY70_9CHRO/2-174PSGRTHDRITY..L.SLLPL-----VI-IIYS........LTRRI---------------------------EWLFWF.S
A5GPK9_SYNPW/2-164ALGRDHDRATL..IGCVPAG-----LL-AGFW........LGWS.---------------------------.LGVLT.A
Q2JX69_SYNJA/2-169PLGSTHDRITL..W.TAPGV-----TL-AAGL........LGNSA---------------------------AVALAV.G
Q3AVT6_SYNS9/2-162AQGREHDRATA..LVSLPVG-----LG-TALL........LNWH.---------------------------.SGLIA.A
Q7U3L4_SYNPX/2-158ASGRAHDRATL..IGGAPIG-----MA-AAVL........WGAD.---------------------------.AGFIA.A
Q4C9Z4_CROWT/4-176PSGRTHDRITY..L.SLPPL-----AV-ITYI........LTRQW---------------------------EWLLWF.S
Q3M912_ANAVT/2-183PSGRTHDRITL..W.ALPLV-----AG-LTFW........QTRSG---------------------------NVTLLV.A
Q5MZ52_SYNP6/2-175PSGRTHDRLTL..W.LLPAV-----AA-GSWL........ISRQS---------------------------DLSLVL.S
A9B0N7_HERA2/2-181PDGKTHDMLTV..FTGIVGI-----PI-IWRI........VPNSD---------------------------LLGAFVWA
Q7NFX0_GLOVI/2-169PLGRTHDRITW..W.SVPAA-----GA-AVWL........VSGAF---------------------------EAALGA.A
Q1IZ50_DEIGD/5-169PSGRVHNLINIAAYSVLAAG-----VL-VAAQQNL.....LTVTP---------------------------LQALHF.T
Q05V62_9SYNE/2-168ALGRDHDRATL..VACIPFG-----LI-LTPW........LGLE.---------------------------.AGLIG.A
A3YTK7_9SYNE/2-161ASGRSHDRATW..LLSLPFG-----LL-WWPW........LGLAG---------------------------VASA...A
A7GUZ7_BACCN/2-158PSGKTHTKINL..L.SLPIV-----LL-LLIS........YGLTN---------------------------FDFLLTFA
P72876_SYNY3/2-167PAGKIHDRITL..G.ATPAV-----MA-ITFI........GTGSA---------------------------RLTLLM.A
Q0TR94_CLOP1/2-176AAGKTHDKITV..I.MTPFI-----AS-FFLFINMIFLEDLGSSL---------------------------AFTILG.V
Q10Y23_TRIEI/2-182PSGPTHDRITL..W.SLPIV-----II-LSYV........LVRST---------------------------HLTLFV.S
B1YE70_EXIS2/2-150PSGNVHDTVNT.....VALT-----GY-VAYS........VATQQ---------------------------TDWLPT.A
Q0I690_SYNS3/2-165ASGREHDRATC..VLALIYG-----VI-WWPW........LGLS.---------------------------.AAFCS.A
A3Z3L1_9SYNE/2-165TSGRDHDRATT..IASLPLA-----LL-LMPI........FGGG.---------------------------.AAALG.G
Q2JJ24_SYNJB/2-169PLGSTHDRITL..W.TAPGI-----TL-AAGL........LGNST---------------------------TVALAV.G
A5UV55_ROSS1/2-182PDTRTHDIITV..ATGALLA-----PA-AYVL...LESGGRDDAA---------------------------AGAAVL.T
Q72GM7_THET2/2-158PSGRAHEALNLAALGGLALA-----HL-AAGG.........SPED---------------------------PRAWAF.G
Q9RT76_DEIRA/5-176PSGRVHNLINLGTFAVLGTA-----AL-YVQRAQLWPDPTFTLTP---------------------------TMALNF.T

PF02265

ENDO2_ARATH/28-290WGKEGHEI-----ICKIAQT-----RL.DETA----------------------------------------AKAVKELL
ENDO5_ARATH/21-288WGKDGHYT-----VCKLAEG-----FF.EDDT----------------------------------------IAAVKKLL
A4H6V5_LEIBR/29-297WWDKGHMS-----IAEIARR-----NL.NPDV----------------------------------------LEKVQACA
Q8F3Z8_LEPIN/21-283WGWEGHRT-----IGIIAQQ-----LLINSKK----------------------------------------FDPINDIL
B0T6T3_CAUSK/23-287WGRTGHAV-----VAQIARG-----YL.TPKA----------------------------------------AAAVDALL
F2G2Z7_ALTMD/28-265WGQTGHRV-----TGAIAEQ-----YL.SPLS----------------------------------------QAALMELL
B4STV7_STRM5/27-270WGAQGHRL-----VAEVADA-----RL.NPTA----------------------------------------RAEVDRLL
Q66VY6_LEIMA/29-300WWSKGHMA-----VALIAQR-----HM.DPKL----------------------------------------VKKANAAA
Q25267_LEIDO/126-397WWSKGHMS-----VALIAKR-----HM.GASL----------------------------------------VEKAELAA
Q3BPV9_XANC5/74-316WGPQGHRL-----VARIAET-----EL.SPQA----------------------------------------RTQVAQLL
A4C4V1_9GAMM/28-270WAQNGHRV-----VGQIAEN-----HL.TDKT----------------------------------------KMAIAHLL
O68530_RHILI/22-306WGQEGHAA-----VAEIAQH-----RL.TSSA----------------------------------------SDVVQRLL
Q7S8Q5_NEUCR/20-297WGKLGHAT-----VASVAQQ-----YL.TPNT----------------------------------------VKQVQTIL
Q5KPJ8_CRYNJ/20-279WGAAGHEM-----VATIAQI-----HL.FPST----------------------------------------RAKLCSIL
Q236I4_TETTS/18-296WWDGGHMM-----TAEIAKQ-----EI.LARN----------------------------------------ATLYEQIE
Q4DEV4_TRYCC/28-293WWCNGHML-----VNEIARR-----RL.HPEV----------------------------------------ALIVEEAA
A2WK84_ORYSI/28-274WGIHGHLI-----......G-----RL.SDAA----------------------------------------AAAVRGLL
Q870T1_NEUCS/21-292WGGFGHIT-----VAYVASN-----FV.SNST----------------------------------------ASYFQTLL
A5A339_SOYBN/27-290WGDDGHVI-----VCKIAQA-----RL.SEAA----------------------------------------AEAVKKLL
Q86GJ3_LEIAM/31-295WGCVGHML-----LAEIARR-----QL.DLEN----------------------------------------EEKIELMA
Q1YUT9_9GAMM/19-260FGADGHRI-----IVSIAEK-----HL.SKKT----------------------------------------AAELTQIS
A6EB04_9SPHI/11-250WGMLGHRI-----VGQIAEA-----HL.SKKA----------------------------------------LKGVKGVL
Q0CD39_ASPTN/21-282WGDVGHRT-----VAYVAEN-----YL.TEDG----------------------------------------SKFLDNLL
Q2SFD4_HAHCH/50-295WGELGHRV-----VCDVAWK-----EL.SPVA----------------------------------------RDQVQKLL
Q585P6_TRYB2/27-292WWDFGHMV-----VAEIARR-----NL.DNDV----------------------------------------ARVVETYI
Q989R8_RHILO/21-270WGPEGHSI-----VAEIAQR-----RL.SSTA----------------------------------------LMEVKRIL
Q25A98_ORYSA/30-295WSKEGHML-----TCRIAQD-----LL.EPAA----------------------------------------AHAVRNLL
Q9NJI3_9TRYP/26-298WWSKGHMA-----VALIAQR-----HM.SPTA----------------------------------------VEKGNAAA
Q26CQ1_FLABB/21-256WGKTGHRV-----TGAIAEQ-----YL.NKKA----------------------------------------RKAIAQLL
ENDO1_ARATH/29-294WSKEGHIL-----TCRIAQN-----LL.EAGP----------------------------------------AHVVENLL
A4CQ68_ROBBH/22-257WGRTGHRA-----IGEVAEA-----HL.SRRA----------------------------------------RKAVSRLL
Q0KFV0_SOLLC/26-291WSKEGHVM-----TCRIAQG-----LL.NDEA----------------------------------------AHAVKMLL
A3U8L7_CROAH/33-268WGKTGHRA-----VGEIASK-----HL.NRKA----------------------------------------RKAIKDIL
Q9ZR88_ZINEL/19-280WGVDGHFI-----TCKIAQG-----RL.SQTA----------------------------------------VDAVNSLL
A7H7R9_ANADF/28-274WSEPGHRI-----VAAIAEE-----RL.GPSA----------------------------------------RRLVREVL
Q9LL59_APIGR/23-288WSKEGHVM-----TCQIAQD-----LL.EPEA----------------------------------------AHAVKMLL
Q7P202_CHRVO/23-274WGQEGHRI-----TGYIAQQ-----LL.SSKA----------------------------------------KAEVKKLI
A0BML4_PARTE/16-293WWDVGHMM-----TAQIAKN-----HL.RENR----------------------------------------PDVLAWAD
NUP3_PENSQ/1-265WGALGHAT-----VAYVAQH-----YV.SPEA----------------------------------------ASWAQGIL
A7EWS3_SCLS1/21-282WGTLGHET-----VAYIATN-----FV.SAST----------------------------------------KSYFQGIL
A5A338_SOYBN/33-298WSKEGHVM-----TCQIAQA-----LL.EPEA----------------------------------------SEAVYQLL
Q3IBZ8_PSEHT/27-268WGQNGHRI-----IAKIAES-----HL.SETT----------------------------------------KTKLLPLL
A7ETG5_SCLS1/21-277WGTLGHQT-----VAYVATN-----FV.AEST----------------------------------------RDYFQMLL
A0M3W8_GRAFK/24-260WGKTGHRA-----TAEIAET-----HL.SNKA----------------------------------------KNAIDGLL
A0BLJ0_PARTE/422-699WWEVGHMM-----TAQIAKN-----YL.RDNR----------------------------------------PDVLAWAD
A4HJL3_LEIBR/28-299WWSKGHMA-----VALIAER-----HM.EASL----------------------------------------VEKGNLAA
Q0TYV6_PHANO/20-284WGSLGHTT-----VAYIAQN-----FV.SGKT----------------------------------------TKFAQRLL
Q051B2_LEPBL/26-289WGHQGHKT-----IGIIAQH-----LLVNSKA----------------------------------------FEEINNIL
A4BZ60_9FLAO/25-260WGQNGHRA-----TGEIAES-----HL.NKRA----------------------------------------KRKIDKLL
A6ESW6_9BACT/22-257WGKNGHRT-----VGAIAEA-----HL.SKKA----------------------------------------QKAIDKLL
ENDO3_ARATH/25-286WGDAGHYA-----VCKIAQS-----YF.EEDT----------------------------------------VVAVKKLL
Q0AMT2_MARMM/26-282YGPDGHRI-----VCDLAWR-----YL.SDET----------------------------------------RTEIDRLV
Q8NIH8_LENED/19-292WGMKGHEA-----VGFIAMK-----FL.APEA----------------------------------------SSFVETSL
Q4Q7F3_LEIMA/31-295WGCVGHML-----LAEIAHR-----QL.NDEN----------------------------------------KEKLDAMA
A4I5I0_LEIIN/31-295WGCVGHML-----LAEIARR-----QL.DDKN----------------------------------------KEKIDAMA
Q9ZR87_ZINEL/27-293WGKEGHYA-----TCKIAQS-----FL.SEEA----------------------------------------LNAVKELL
Q5NRA3_ZYMMO/33-298WGMEGHEA-----IAALAWK-----YM.TPTT----------------------------------------RKKVNAIL
A5V871_SPHWW/21-280WWEYGHET-----VATIAMQ-----SV.RPDT----------------------------------------RQAIRRLL
A3XR21_LEEBM/28-263WGSKGHRA-----TAAIAVK-----YL.KPRT----------------------------------------KKAIEKLL
Q5FP59_GLUOX/25-298WGPYGHAI-----VADIAQE-----RL.TPQA----------------------------------------QKAATALL
A0XY62_9GAMM/27-268WGQNGHRV-----VGKIAES-----HI.TDTT----------------------------------------KSAIKPFL
Q0UA95_PHANO/19-289WNTDG...-----..FMAET-----FF.TPKT----------------------------------------TSILSQIL
NUS1_ASPOR/21-284WGNLGHET-----VAYIAQS-----FV.ASST----------------------------------------ESFCQNIL
Q9P356_LENED/21-305WGAIGHET-----VGYVAMK-----FL.SPKA----------------------------------------LSFVQSSL
A6GGE9_9DELT/20-283WHDDGHRI-----VGEIAER-----NL.SPAT----------------------------------------RAKVRALL
Q9NJY3_LEIPI/31-294WGCVGHML-----LAEIARR-----QL.DDKN----------------------------------------KEKIQKMA
O81656_HEMSP/23-288WSKEGHIV-----TCRIAQD-----LL.EPEA----------------------------------------AETVRNLL
A4HI96_LEIBR/31-295WGCTGHMV-----LAEIARR-----QL.DPSN----------------------------------------EKKIQAMA
Q7XPN4_ORYSJ/27-283WGKEGHYM-----VCKIAEG-----FL.TKEA----------------------------------------ATAVKELL
A6SS14_BOTFB/21-272WGTLGHQT-----VAYVATN-----FV.AEET----------------------------------------RHYFQTLL
Q01U80_SOLUE/19-261WGPEGHSL-----IARLAAA-----RL.TPAA----------------------------------------AAKVAEIL
A2QX99_ASPNC/21-292WGDVGHRA-----IAYLAEK-----YL.TVAG----------------------------------------SNLVNELL
A2TWS6_9FLAO/25-260WGKTGHRV-----TGKIAEK-----HL.TKKA----------------------------------------KRKIDKLL
Q2UHT0_ASPOR/21-283WGDVGHRT-----VAYIAEH-----HL.TKEG----------------------------------------IGLLNDLL
Q2H4S7_CHAGB/217-488SGSFGHIT-----VGYLASA-----FV.SPAT----------------------------------------TTYLQTLL
Q15ZB2_PSEA6/20-256WGQIGHRV-----TGAIAQQ-----HL.TPQA----------------------------------------QAAISALL
A5PCR0_9SPHN/28-287WGFFAHRT-----TAEIALE-----NV.KPET----------------------------------------RTGIARLL
Q1VUV1_9FLAO/20-255WGQNGHRS-----VGETAER-----YL.KSKV----------------------------------------KNKIDRIL
A2TPR0_9FLAO/22-257WGKTGHRT-----TGAIAEK-----YL.TKKA----------------------------------------KRAISELL
Q9ARD4_HORVU/24-280WGKEGHYM-----TCKIADG-----FL.TKEA----------------------------------------SAGVKDLL
A0MSM3_SPIOL/24-289WSKEGHMI-----TCKIAQD-----LL.EPEA----------------------------------------ADAVKKLL

PF13803

B7IVR2_BACC2/1-238---------------TALILGSMA---PD-F-------EYF.....LHF-----------------RP......Y-----
A7FSP1_CLOB1/1-250---------------TALILGSMS---PD-F-------EYF.....IRF-----------------KA......M-----
B1RQR4_CLOPF/1-244---------------TALILGSMA---PD-F-------IYF.....LNF-----------------RP......Y-----
B9XK96_9BACT/41-287---------------SALMIGSMA---PD-F-------SKI.....FSL-----------------SP......R-----
D0T6V3_ACIRA/1-244---------------AALAIGCMV---PD-L-------IRL.......F-----------------VA.....DA-----
A8L7F5_FRASN/1-234---------------SAMVAGSMV---PD-V-------PVF.....LGW-----------------SA......M-----
A7C3K4_9GAMM/1-251---------------SALVVGSMS---PD-F-------LYF.....YCL-----------------ST......R-----
B2Q274_PROST/1-240---------------PALILGSLS---PD-L-------LYS.....FGL-----------------YQ......I-----
D2Q1R3_KRIFD/1-252---------------SALVAGALA---PD-L-------LYLDPLYDLAT-----------------RQIHGSF.T-----
Q6FEH5_ACIAD/1-244---------------AALAIGCMT---PD-L-------FRL.......F-----------------TN.....AS-----
B7GWN2_ACIB3/1-244---------------AALAIGSMT---PD-L-------YRL.......F-----------------TM.....QS-----
Q65Q39_MANSM/1-231---------------PALVLGTMS---PD-F-------MYM.....LHW-----------------K.......T-----
D0SS47_ACILW/1-244---------------AALAIGSMV---PD-L-------HRL.......F-----------------TH.....TN-----
C0B3N4_9ENTR/1-241---------------PALIIGSTS---PD-L-------LYS.....FGL-----------------YQ......S-----
D3EE91_GEOS4/1-238---------------SALIIGCMA---PD-F-------EYF.....VRF-----------------RA......A-----
D3D9A1_9ACTO/1-236---------------SAMVVGSMV---PD-V-------PVF.....GRW-----------------TD......L-----
A0Q1Y2_CLONN/1-244---------------SALVIGSMV---PD-F-------EYF.....LRF-----------------MP......K-----
Q1IN38_KORVE/1-248---------------SALVIGSFG---PD-F-------QYF.....FFM-----------------SY......D-----
Q0RF10_FRAAA/1-234---------------SAMVAGSMV---PD-V-------PVF.....FGW-----------------PE......F-----
A1ZM58_9BACT/1-236---------------SALVIGSLA---PD-F-------EYF.....LRM-----------------RI......N-----
C0DX83_EIKCO/1-244---------------PAMVIGSLA---PD-F-------VYF.....LHG-----------------RA.......-----
A3HWD2_9BACT/1-238---------------TGLVVGSVV---PD-L-------EFY.....LQL-----------------KL......S-----
A6GZ02_FLAPJ/1-237---------------TGLIIGSLT---PD-F-------EYF.....LRM-----------------RI......K-----
D3V1B0_XENBS/1-239---------------PALITGSLS---PD-F-------FYS.....VGL-----------------YD......V-----
C0ZEY0_BREBN/1-243---------------SALVFGSMA---PD-F-------EYF.....FRM-----------------QP......F-----
D2ARI2_STRRD/1-247---------------WALALGAMV---PD-L-------PIF..LSFLPF-----------------LP......D-----
B1HS87_LYSSC/4-242---------------SALVLGSMA---PD-F-------EYF.....LRG-----------------RP......I-----
D4DQE9_NEIEG/58-292---------------PALVIGSLS---PD-F-------VYF.....LHG-----------------RA.......-----
C0VQ51_9GAMM/1-244---------------AALAIGCMT---PD-L-------YRL.......F-----------------TP.....ES-----
Q1VTE4_9FLAO/1-237---------------TGLVIGSLT---PD-F-------EYF.....LRM-----------------RI......R-----
D4BTR9_PRORE/1-240---------------PALILGSLS---PD-L-------FYS.....MMW-----------------YS......A-----
Q7UP84_RHOBA/1-250---------------SALAIGCMV---PD-A-------GVF.....FPM-----------------LF......D-----
Q899W6_CLOTE/1-234---------------MGLILGSMA---PD-F-------IYF.....ILF-----------------NP......S-----
D0SL80_ACIJU/1-244---------------AALAIGCMT---PD-L-------YRL.......F-----------------TQ.....AN-----
C5VRK3_CLOBO/1-245---------------TALILGSMA---PD-F-------EYF.....LRF-----------------KP......I-----
C6D3J1_PAESJ/1-242---------------TGLVLGSMG---PD-M-------EYF.....VRL-----------------EP......Y-----
D0SG75_ACIJO/1-244---------------AAIAIGSMT---PD-L-------YRL.......F-----------------TQ.....AD-----
C6JKD9_FUSVA/1-236---------------TGLIVGSIT---PD-F-------EYF.....LRM-----------------K........-----

PF00882

B7GWN2_ACIB3/1-206---------------AALAIGSMT---PD-L.......YR......L.F-----------------T.......MQS...
C6RSF9_ACIRA/1-206---------------AALAIGCMV---PD-L.......IR......L.F-----------------V.......ADA...
B7H911_BACC4/1-208---------------TALILGSMA---PD-F.......EY......F.L-----------------.....HF.RPY...
C2XYJ1_BACCE/7-214---------------TALILGSMA---PD-F.......EY......F.L-----------------.....YF.RPY...
B1B9W2_CLOBO/1-214---------------SALVIGSMA---PD-F.......EY......F.L-----------------.....RF.MPK...
C5VRK3_CLOBO/1-214---------------TALILGSMA---PD-F.......EY......F.L-----------------.....RF.KPI...
A3I5H3_9BACI/4-213---------------SALVLGSMA---PD-F.......EY......F.L-----------------.....RG.RPI...
A7FSP1_CLOB1/1-219---------------TALILGSMS---PD-F.......EY......F.I-----------------.....RF.KAM...
Q0SV58_CLOPS/1-213---------------TALILGSMA---PD-F.......IY......F.L-----------------.....NF.RPY...
Q899W6_CLOTE/1-207---------------MGLILGSMA---PD-F.......IY......F.I-----------------.....LF.NPS...
C0ZEY0_BREBN/1-212---------------SALVFGSMA---PD-F.......EY......F.F-----------------.....RM.QPF...
C6JKD9_FUSVA/1-208---------------TGLIVGSIT---PD-F.......EY......F.L-----------------........RMK...
A6GZ02_FLAPJ/1-209---------------TGLIIGSLT---PD-F.......EY......F.L-----------------.....RM.RIK...
Q1VTE4_9FLAO/1-209---------------TGLVIGSLT---PD-F.......EY......F.L-----------------.....RM.RIR...
A1ZM58_9BACT/1-209---------------SALVIGSLA---PD-F.......EY......F.L-----------------.....RM.RIN...
D3EE91_GEOS4/1-207---------------SALIIGCMA---PD-F.......EY......F.V-----------------.....RF.RAA...
C6D3J1_PAESJ/1-215---------------TGLVLGSMG---PD-M.......EY......F.V-----------------.....RL.EPY...
A3HWD2_9BACT/1-210---------------TGLVVGSVV---PD-L.......EF......Y.L-----------------.....QL.KLS...
C0DX83_EIKCO/1-211---------------PAMVIGSLA---PD-F.......VY......F.L-----------------HGRA..........
D4DQE9_NEIEG/58-261---------------PALVIGSLS---PD-F.......VY......F.L-----------------HG...RA.......
Q65Q39_MANSM/1-202---------------PALVLGTMS---PD-F.......MY......M.L-----------------.....HW.KT....
D3V1B0_XENBS/1-204---------------PALITGSLS---PD-F.......FY......S.V-----------------.....GL.YDV...
C0B3N4_9ENTR/1-204---------------PALIIGSTS---PD-L.......LY......S.F-----------------.....GL.YQS...
D4BTR9_PRORE/1-203---------------PALILGSLS---PD-L.......FY......S.M-----------------.....MW.YSA...
B2Q274_PROST/1-203---------------PALILGSLS---PD-L.......LY......S.F-----------------.....GL.YQI...
Q2LV15_SYNAS/6-198---------------HFVVMGATG---PD-Y.......PYL.TDVMKYG-----------------VLHIGHN.W.....
Q2Y883_NITMU/6-188---------------RFCELGAVS---PD-Y.......PYL.DIA....-----------------.HSSAGQ.W.....
A7K2D4_VIBSE/6-189---------------RYLELGCVS---PD-Y.......PYL.ALM....-----------------.NSAQNK.W.....
A4C3L5_9GAMM/6-186---------------NYLELGCVS---PD-Y.......PYL.AVG....-----------------.HSEQNK.W.....
C9YFH3_9BURK/6-183---------------PFAELGCVS---PD-Y.......PYL........-----------------.GGPGQGYW.....
Q12DA4_POLSJ/6-186---------------KYAELGAVS---PD-Y.......PYLT.......-----------------.LKQGQKKW.....
C4XMP3_DESMR/34-221---------------GYFQLGAIS---PD-M.......PYL.VGL...G-----------------TNKQAIA.W.....
E6VSV5_DESAO/6-180---------------HGLLLGAVL---HD-A...............LFY-----------------ATPPGGAPLERL..
Q2LQI8_SYNAS/6-189---------------ALYYLGAIV---FD-TPYYVVTGQNRSNLLAA..-----------------..............
B8FCF0_DESAA/6-187---------------NLYLLGAVI---PD-T.......PM.........-----------------..............
B3E8I7_GEOLS/6-161---------------SAYLVGAVL---PD-TLLHLVRGPWSDTALQL..-----------------..............
A1AT46_PELPD/6-164---------------AAYLGGAVL---PD-TLLHLFRGPHSATALHL..-----------------..............
C6Y3Y4_PEDHD/24-233---------------SYLSDHAVD---PD-K.......RR......Y.A-----------------DTAEAARHYLDVEL
E6U8V9_ETHHY/5-158---------------SGFLLGNIL---PD-L.......SA.........-----------------..............
Q1IVJ5_KORVE/32-215---------------AYAYGGCAI---QD-M.......GYYPFGHTFF.-----------------..............
C1F375_ACIC5/44-227---------------GYAYGGSTI---QD-A.......GYYPFGKDFF.-----------------..............
Q01WM2_SOLUE/25-208---------------AYAYGGSII---QD-L.......GYYPFGSGFY.-----------------..............
Q1ISY5_KORVE/28-210---------------AYAYGGAVI---QD-L.......GYYPFGNRTF.-----------------..............
Q025L8_SOLUE/39-222---------------AHAYGGCII---QD-M.......GYYPFGSKFF.-----------------..............
Y1571_ARCFU/28-204---------------MEYLSGSIA---PD-A.......GYIISTEW...-----------------..............
Q01YQ6_SOLUE/23-198---------------LLIDLYCIY---PD-RYQEMAEFGF......TRK-----------------SAGPQDASEIAVYC
Q8XI18_CLOPE/5-158---------------KNFIYGNVK---PD-M.......VS.........-----------------..............
B0AAC8_9FIRM/5-160---------------KNFIYGNIK---PD-M.......TS.........-----------------..............
B6FWP7_9FIRM/5-161---------------KNFVYGNVK---PD-A.......FS.........-----------------..............
C9YL06_CLODR/5-159---------------KNFIYGNIK---PD-A.......FS.........-----------------..............
D3MTQ6_9FIRM/3-156---------------NNFIYGNIK---PD-I.......VS.........-----------------..............
C1I9N1_9CLOT/4-161---------------GQFIWGNLK---PD-S.......VS.........-----------------..............
B2UYY5_CLOBA/4-161---------------YRFIWGNIK---PD-C.......VL.........-----------------..............
C4IEN4_CLOBU/4-161---------------KRFIWGNIK---PD-C.......TP.........-----------------..............
A6LQ77_CLOB8/4-161---------------KRFIWGNVK---PD-C.......AP.........-----------------..............
B1BXM8_CLOPF/5-161---------------KSFLKGNVL---PD-I.......SP.........-----------------..............
Q97KV3_CLOAB/5-155---------------AAFALGNIK---PD-F.......IN.........-----------------..............
B0P7T6_9FIRM/16-171---------------ASFVSWNVL---PD-V.......AP.........-----------------..............
C0ECW5_9CLOT/5-161---------------AVFTYANCR---PD-F.......SV.........-----------------..............
A8MHU0_ALKOO/5-164---------------FNLIYGSIK---PD-I.......AI.........-----------------..............
A6TNX7_ALKMQ/5-165---------------NSLIYGSIK---PD-I.......AP.........-----------------..............
B2A897_NATTJ/5-148---------------NYFILGNVT---PD-F.......AI.........-----------------..............
B0MJ55_9FIRM/5-161---------------LPFYVGSIW---PD-C.......RP.........-----------------..............
B0NZS3_9CLOT/15-171---------------LPFYVGSIW---PD-C.......RP.........-----------------..............
A5ZUN3_9FIRM/20-175---------------KAFCLGNIL---PD-I.......QP.........-----------------..............
C6J9X9_9FIRM/5-161---------------KAFCLGSIL---PD-I.......KP.........-----------------..............
C6LKS6_9FIRM/5-161---------------KAFYLGSIL---PD-C.......KP.........-----------------..............
D4KRQ8_9FIRM/5-161---------------FSFYIGSVL---PD-I.......KP.........-----------------..............
D9SRM2_CLOC7/5-162---------------YSFVYGSVR---PD-L.......RR.........-----------------..............
A6LQR0_CLOB8/5-160---------------NFFIYGNVL---PD-L.......KL.........-----------------..............
B0S165_FINM2/8-177---------------KKLEWGAVS---PD-I.......LP.........-----------------..............
D1VUW6_9FIRM/8-182---------------NKIQWGSVC---PD-V.......LP.........-----------------..............
B1QT08_CLOBU/5-155---------------NMFYFGTIL---AD-C.......CW.........-----------------..............
C4Z638_EUBE2/40-187---------------FALRLGSIM---PD-I.......LL.........-----------------..............
A7VFQ0_9CLOT/5-152---------------KWLLLGSIL---PD-I.......LV.........-----------------..............
C0EWT7_9FIRM/5-150---------------AALLFGSIL---PD-L.......LV.........-----------------..............
A8SNU3_9FIRM/5-162---------------AAFIFGSIE---PD-I.......NM.........-----------------........LTYFRG
D4LBU1_RUMC1/5-160---------------SLFLLGCVE---PD-L.......NP.........-----------------........VTYTRG
Q315K4_DESDG/47-177---------------SVFRYGALS---AD-IFIGKGCAVT.........-----------------..............
B8DLU9_DESVM/18-149---------------DAFLYGSLS---AD-IFIGKGCTVT.........-----------------..............
C7LVT1_DESBD/24-155---------------EQFLYGCLS---AD-IFIGKGSTFT.........-----------------..............
C6BUV8_DESAD/29-160---------------TLFLYGCLS---AD-IFIGKGSKAK.........-----------------..............
C8X0X8_DESRD/29-159---------------QHFLYGCLS---AD-MYVGKGKTLT.........-----------------..............
A5G5N0_GEOUR/25-157---------------NDFLYGCIA---AD-ITIGKKFTHY.........-----------------..............
Q39S84_GEOMG/25-157---------------HDFLYGCIA---AD-ITLGKKFTHY.........-----------------..............
E8WRC5_GEOS8/30-162---------------YDFLYGTIA---AD-ITLGKKFTHY.........-----------------..............
A1AK53_PELPD/24-156---------------LDYLYGSIA---AD-ITLGKKYTHY.........-----------------..............
B3EBK7_GEOLS/25-157---------------NDFLYGCLA---AD-IIVGKKHTHY.........-----------------..............
Q3A306_PELCD/29-161---------------FDFLYGCIS---AD-ITLGKRFTHY.........-----------------..............
Q1K0Z2_DESAC/27-159---------------ADFLYGSIS---AD-ITLGKKYTHY.........-----------------..............
C1A8N1_GEMAT/19-151---------------ADFLYGSIA---AD-TSIAKKYAEV.........-----------------..............
B8J577_ANAD2/33-165---------------NEFLYGSLA---AD-IVVGKNMARY.........-----------------..............
D6SRA3_9DELT/26-149---------------TNFIYGSVV---AD-YFLGKPG............-----------------..............
B5YG53_THEYD/20-144---------------EYFMYGNII---PD-TVFGKKYLPE.........-----------------..............
Q1H382_METFK/30-174---------------QLVMAGACL---PD-LAIVSPR............-----------------..............
C6X6W6_METSD/30-174---------------ELVMAGACL---PD-LSLVSPT............-----------------..............
C6WXF1_METML/56-200---------------DLVMAGACI---PD-LALVSQP............-----------------..............
D5CMM4_SIDLE/28-177---------------RLVLAGACL---PD-LALLSEQSWGKP.......-----------------..............
B0SGT0_LEPBA/6-211---------------SYANLGAVA---PD-I.......FY......F.Y-----------------HVL...........
Q72P57_LEPIC/6-211---------------KFANIGAIA---PD-I.......FY......F.Y-----------------HIF...........
C8W7P0_ATOPD/6-209---------------DVFLLGNVA---PD-V.......HVGFMVPDYSH-----------------KVRYGRSHQ.....
C5DV22_ZYGRC/30-228---------------PWLKAGAFF---PD-A.......FY.........-----------------..............
B5VL45_YEAS6/30-234---------------PWLKAGSFF---PD-A.......LY.........-----------------..............
C5DKM1_LACTC/24-220---------------AVMKAGVFF---PD-A.......LY.........-----------------..............
Q6FL70_CANGA/25-242---------------PWLKSGAFF---PD-A.......LY.........-----------------..............
Q6CEF9_YARLI/23-229---------------QYLQPGAFF---PD-C.......FYNCLGL....-----------------..............
C4R8D0_PICPG/19-213---------------NSLAAGSFF---PD-A.......FY.........-----------------..............
Q8R432_MOUSE/28-220---------------DAYQAGTVF---PD-A.......FY.........-----------------..............
C3ZWC6_BRAFL/5-194---------------DAFQAGNVY---PD-T.......YY.........-----------------..............
A7SED1_NEMVE/31-226---------------DGFIAGNPY---PD-A.......MY.........-----------------..............
D3AZT7_POLPA/38-225---------------ASFQAGAAF---PD-W.......GYSCGGF....-----------------..............
PLDG_DICDI/29-216---------------DVFDAGAAF---PD-F.......GYDCGGL....-----------------..............
Q97TF6_CLOAB/60-232---------------PTLRQYCDK---PD-KDENQWAFAYHFYNPYTGL-----------------NYLPSILPQ.....
A7B1H2_RUMGN/72-243---------------SILMEATDW---PD-K..............LGNE-----------------TDAGTFAGH.....
PHLC_CLOHA/37-230---------------KKLQRGSTY---PD-Y................DP-----------------KAYALYQDH.....
PHLC_CLONO/38-231---------------HKFQLGSTY---PD-Y................DP-----------------NAYKLFQDH.....
Q5PXE6_CLOPF/38-231---------------HELQLGSTY---PD-Y................DK-----------------NAYDLYQDH.....
Q8GCY3_9CLOT/38-231---------------HKFQLGSTF---PD-Y................DP-----------------NAYSLYQDH.....
PHLC_CLOSO/38-231---------------KDLKLGSTF---PD-Y................DP-----------------NAYDLFQDH.....
Q6R6B7_LISSE/64-245---------------KEIAQGIFD---AD-H..............KNPY-----------------YDKNTFLSH.....
Q6EAE3_LISMN/64-245---------------KQIAQGIYD---AD-H..............KNPY-----------------YDTSTFLSH.....
Q6R6D6_LISIV/62-243---------------KEVAQGIFD---AD-H..............KNPY-----------------YDCSTFVSH.....
A0R9W0_BACAH/51-232---------------TELENGIYA---AD-Y..............ENPY-----------------YDNSTFASH.....
A5D2J5_PELTS/29-178---------------EFLFRGVRW---AD-K.......GW.........-----------------....KNFSH.....
Q896L3_CLOTE/34-205---------------AKLNEGTTW---AD-Q.......DF.........-----------------....KSSNH.....
A5N896_CLOK5/34-205---------------KALNAGVTW---AD-Q.......DF.........-----------------....KSSNH.....
Q97KA0_CLOAB/34-205---------------EAINEGTVW---AD-Q.......DF.........-----------------....KSTNH.....
A6TKQ8_ALKMQ/57-228---------------LDINKGAVW---AD-Q.......DF.........-----------------....KSSNH.....
O26214_METTH/27-173---------------DEMKNGADD---PD-T.......VF......LDF-----------------KY............
B8I5G2_CLOCE/32-236---------------VALQFGSIF---PD-E......DEYNDPAGKGTL-----------------HGTLWTKDKDGYNA
B5HQN8_9ACTO/67-292---------------AVLVAGSFA---PD-M.......TY......Y.A-----------------ASVVPGA.MEF...
Q82A31_STRAW/92-336---------------TVLVAGSFA---PD-M.......TY......Y.A-----------------ASVLSGA.MEF...
C9YWP6_STRSW/1-225---------------SVLVAGSFA---PD-M.......TY......Y.V-----------------ASVLPEA.MEF...
B4V801_9ACTO/61-287---------------SALVLGSFA---PD-T.......FY......F.L-----------------DAVVEGV.MGY...
C7QBS6_CATAD/1-214---------------SALVFGSIA---PD-V.......PY......F.A-----------------.....GA.FGV...
D3D9A1_9ACTO/1-206---------------SAMVVGSMV---PD-V.......PV......F..-----------------.....GRWTDL...
A8L7F5_FRASN/1-204---------------SAMVAGSMV---PD-V.......PV......F.L-----------------.....GW.SAM...
Q0RF10_FRAAA/1-204---------------SAMVAGSMV---PD-V.......PV......F.F-----------------.....GW.PEF...
D2ARI2_STRRD/1-214---------------WALALGAMV---PD-L.......PI......F.L-----------------.....SF.LPFLPD
D2Q1R3_KRIFD/1-218---------------SALVAGALA---PD-L.......LY........L-----------------DPLYDLATRQIHGS
C7R2G7_JONDD/1-213---------------AALVAGALA---PD-V.......PY......F.L-----------------RALRIPVSAQSWWE
Q7UP84_RHOBA/1-217---------------SALAIGCMV---PD-A.......GV......F.F-----------------.....PM.LFD...
A7C3K4_9GAMM/1-217---------------SALVVGSMS---PD-F.......LY......F.Y-----------------.....CL.STR...
B9XK96_9BACT/41-256---------------SALMIGSMA---PD-F.......SK......I.F-----------------.....SL.SPR...
Q1IN38_KORVE/1-215---------------SALVIGSFG---PD-F.......QY......F.F-----------------.....FM.SYD...
D9T3L8_MICAI/1-213---------------VALCTGAVA---PD-V.......AY......L.F-----------------TGTAPAQ.......
C1ACE2_GEMAT/1-206---------------LALCIGSMA---PD-L.......EF......I.G-----------------.....RM.SHD...
Q6FEH5_ACIAD/1-206---------------AALAIGCMT---PD-L.......FR......L.F-----------------T.......NAS...
C0VQ51_9GAMM/1-206---------------AALAIGCMT---PD-L.......YR......L.F-----------------T.......PES...
D0SL80_ACIJU/1-206---------------AALAIGCMT---PD-L.......YR......L.F-----------------T.......QAN...
D0SG75_ACIJO/1-206---------------AAIAIGSMT---PD-L.......YR......L.F-----------------T.......QAD...
D0SS47_ACILW/1-206---------------AALAIGSMV---PD-L.......HR......L.F-----------------T.......HTN...

PF04307

Q2VZJ9_MAGSA/3-159---------------AAAALGALL...PD.I-------DHP.S......-----------------.SWL.GRRLWPI.S
A6LWG2_CLOB8/3-169---------------GGAFVGSIF...PD.I-------DHG........-----------------.NSYIGKKTKGVSK
A3CRK4_METMJ/3-159---------------AFAVLGAVL...PDLI-------DKPLG......-----------------.HIVLAGTLGY...
Q1MS87_LAWIP/3-199---------------VWGMLVAML...PD.I-------DI.........-----------------.LFV.SSAIDYIKV
Q0W649_UNCMA/3-154---------------VAGAIAAAMSVSPD.V-------DTGLG......-----------------.GIF..........
Q5X0H9_LEGPL/3-176---------------QAGALAGMA...PD.L-------DVF........-----------------.IRF.SQEPLSLEQ
Q2NZA4_XANOM/4-177---------------VAGVVAAMV...PD.A-------DVL........-----------------.AFALHIPYADAFG
Q8PZ85_METMA/4-181---------------LLAFVGGACTLFPD.I-------MVVYN......-----------------.IFI.NNTLEHC..
A4YHA8_METS5/3-210---------------VLVGIGAAL...PD.L-------DREY.......-----------------.IFTRRKIFAKYQL
A4W9L4_ENT38/3-166---------------PSAVLTCLL...PD.I-------DHP.K......-----------------.SFL.GQRLKWI.A
Q468G0_METBF/3-172---------------KYLVIGALL...PDLI-------DKPLG......-----------------.MIIFASTFAN...
Q6AMI9_DESPS/4-207---------------LLGAIGGTL...PD.L-------DSDSGKPLRFL-----------------FTSISLIIPALMLS
Q1ILA3_KORVE/3-163---------------VAVMIAGVI...PD.I-------DGL........-----------------.GVVPELFTRHSAH
Q8TVQ4_METKA/3-158---------------ITASLSAIL...PD.L-------DHP........-----------------.NSLVSSALYPLEL
A8GDN5_SERP5/3-166---------------PAALLTSLL...PD.I-------DHP.K......-----------------.SVL.GQRLRWI.A
A0YYL1_LYNSP/4-178---------------FAAVFIAIA...AD.F-------DFIP.......-----------------.QLLTGERF.....
A0YXX1_LYNSP/4-183---------------FTSVFIANA...PD.L-------DFLPG......-----------------.IFL.QADPGMF..
Q1VZ04_9FLAO/3-179---------------IYGAVAGTI...PD.L-------DVF........-----------------.IGNFYDTVTALEI
Q0JZE4_CUPNH/3-185---------------LLGAAAGAF...PD.I-------DFL........-----------------.GFL.VHPLRFLAQ
Q2S300_SALRD/3-182---------------LWGAAFGLL...PD.L-------DVL........-----------------.ANPFLTELQALTM
A5CZD2_PELTS/18-203---------------AAGGLAALL...PD.L-------DHP.G......-----------------.SYA.GQRLRLL.A
A3CVA2_METMJ/3-183---------------GFCALGAVL...PDLI-------DKPVG......-----------------.HILLAGTLNS...
Q0BSQ9_GRABC/15-169---------------VLAVAGALL...PD.V-------DHP.K......-----------------.SWV.GQRLGGL.S
A2BN14_HYPBU/3-145---------------VAAIVSSVL...PD.L-------DLYFR......-----------------..............
Q0S8N5_RHOSR/4-250---------------AVCAGAALL...PD.L-------DTS.Q......-----------------.STV.ARSFGPV.S
Q1IHJ9_KORVE/3-205---------------LATVTLTLAAEAAD.L-------DFA........-----------------.WLLKSRTVYFAH.
A1U6Q1_MARAV/3-174---------------LTGALLGTL...PD.L-------DVV........-----------------..IDYGTAVANFTQ
A4J2S7_DESRM/3-150---------------AVAGVGSLL...PD.L-------DHP.N......-----------------.SWI.GNKIPVL.P
Q28PX8_JANSC/2-152---------------AAALIGAVF...PD.L-------DLLMF......-----------------.YVIDDRAIHH...
Q18EP1_HALWD/19-174---------------SVVCFGSVF...PDLV-------DKPVSYANLT.-----------------..PW..........
Q0VLL6_ALCBS/3-174---------------LGGALLGTL...PD.L-------DVL........-----------------..IDYGDAVVNFTE
Q726Y1_DESVH/3-173---------------PFGMVAAAS...PD.V-------DIFFG......-----------------.....SSAIDYLTI
Q2NEC5_METST/4-226---------------FFALLGASI...PD.M-------DHV........-----------------.NNKNKVVVMFIIG
YFHP_BACSU/3-182---------------IATLAGSQA...PD.I-------DTV........-----------------.LKL.KNNAVYIRN
Q8TQH1_METAC/4-199---------------KVVAFLSVL...PD.L-------DVIPYSLFLAV-----------------SSSLTHESRNQLFY
A0KFP7_AERHH/3-165---------------PAALASALL...PD.L-------DHP.R......-----------------.SVL.GQRLPWI.S
Q47U11_THEFY/3-250---------------LLGAGSALV...PD.L-------DHP.S......-----------------.STA.TRSQGFV.T
Q1C5S1_YERPA/4-178---------------LAGIAISML...PD.A-------DVL........-----------------.AFKFGVAYGHAFG
Q465I7_METBF/4-223---------------LILLFLSIL...PD.L-------DYFTYSIFTLI-----------------SGSVSHEARNQLFY
Q1QZR4_CHRSD/3-181---------------IAGAALGTL...PD.L-------DVV........-----------------..IDYGDAVADYTY
A6TMK4_ALKMQ/3-249---------------LVAVGGALL...PD.L-------DMGTS......-----------------.SLA.GKFGLLKAK
Q82XH5_NITEU/3-183---------------VAGSVAAAF...PD.S-------DVV........-----------------.LRL.IDTLTYLNW
Q6YRT9_SYNY3/3-188---------------LIGAIASLL...PD.I-------DIS........-----------------.TSPAGRILPFISR
A6LXK9_CLOB8/3-172---------------RYVLIGSIL...PDII-------DKPIG......-----------------.AGVFRSVFHN...
Q8D1W8_WIGBR/3-169---------------TGSICSCLL...PD.M-------DHP........-----------------.GSFLGKKLNWISI
Q18KS6_HALWD/3-171---------------LPIILGALF...PD.V-------DTA........-----------------.FGR..........
Q8R899_THETN/3-179---------------AVAAASSLL...PD.I-------DTP.G......-----------------.SML.RHKLNKYTG
A0Z1N5_9GAMM/41-214---------------LIGALAGMA...PD.L-------DVL........-----------------.IRS.DTDPLLFLE
Q9V2B4_PYRAB/7-175---------------ILLVIGSIF...PD.L-------DVF........-----------------.TFFSFESLALHGG
Q18EE2_HALWD/4-162---------------TLGMVGAFI...PDLV-------KIK........-----------------.LVIPDWRVEQLLG
Q12UG8_METBU/3-174---------------RFVAVGALL...PDLI-------DKPIG......-----------------.RLFFEEIFAN...
Q3IS66_NATPD/3-169---------------VAGFLGGLA...PD.L-------DMYFG......-----------------..............
Q465I8_METBF/4-199---------------KVVALLSVL...PD.L-------DFILYSIFIYA-----------------NNGLSPAVRNQLFY
B4SJC5_STRM5/4-190---------------VAGVIAAML...PD.A-------DVL........-----------------.AFALHIPYADAFG
A0PYB1_CLONN/3-199---------------FIVAIASLL...PD.I-------DHP.K......-----------------.SII.NKYILPFKN
Q3A0M8_PELCD/4-203---------------ACGMAAGLA...PD.L-------DSDTSKPLAIL-----------------KSIVGVLVVGAVVA
Q465I4_METBF/4-199---------------NALGFLAIL...PD.L-------DFIPYILFALI-----------------SGSVSHEVRNQLFY
Q46FT6_METBF/4-180---------------FLLFIGSICSLFPD.I-------VIIHS......-----------------.LFV.SGTMEHC..
O26450_METTH/3-144---------------LLAGAAGTV...PDLL-------DYL........-----------------.TGR..........
Q1AT01_RUBXD/3-176---------------PAAVAAAWL...PD.V-------DNP........-----------------.RSRLGNGLSRMRS
Q75TF0_GEOKU/3-155---------------AGLVIGSLL...PD.I-------DEP........-----------------.SSYVGRRSFGVAG
Q1NK63_9DELT/3-180---------------VAGFLAAAF...PD.S-------DFI........-----------------.LRLFVDPLTFLAL
Q1C702_YERPA/3-166---------------PGALLTSLL...PD.I-------DHP.K......-----------------.SIL.GQRLKWV.S
Q2RM17_MOOTA/3-158---------------RLVLIGSML...PDII-------DKPLG......-----------------.GVIFKETLGN...
Q5YVJ3_NOCFA/3-233---------------FLTAGAALL...PD.A-------DHP.K......-----------------.GTL.AHVLGPL.S
Q8CV62_OCEIH/3-182---------------VGTVVGSHA...PD.F-------DTV........-----------------.FKL.KNNATYIRH
A0NTQ3_9RHOB/3-182---------------LVGGVLGTL...PD.L-------DVL........-----------------..IPYDDPVDSFVF
Q2NV14_SODGM/3-168---------------IGGILTCLL...PD.I-------DHP.K......-----------------.SFL.GQRLKWL.S
Q2N9Y9_ERYLH/15-204---------------PALIIGANL...PD.V-------DAA........-----------------.CFF.WLEGAEHLG
A1K1W5_AZOSB/3-183---------------AAGATAAAF...PD.I-------DYL........-----------------.LGY.VSELTYLRG
C1DQI7_AZOVD/3-180---------------LYGALLGTL...PD.L-------DVL........-----------------..IDYGDAVANMTR
Q5FK20_LACAC/3-175---------------LATGVGASL...PD.I-------DEY.N......-----------------.STT.SRKSPINFS
Q0ACJ1_ALHEH/3-184---------------WAGFVAGAS...PD.I-------DFL........-----------------.LRV.LDPLVYLNL
Q8FRV6_COREF/4-249---------------GLAAGAALL...PD.L-------DAP.S......-----------------.ATV.SRSFGPV.T
Q1V9R5_VIBAL/3-178---------------VLGVVSGMA...PD.L-------DVL........-----------------.IRS.STDPLLYLE
Q97K38_CLOAB/3-212---------------AVGVLGALM...PD.I-------DTS.R......-----------------.SKV.SYNLRKIVV
Q5V827_HALMA/3-151---------------ITAVGFAMV...PD.L-------DQRLP......-----------------.GVT..........
YVSG_BACSU/3-155---------------ASGAVGALI...PD.I-------CHT.Q......-----------------.SKI.GRKFPIL.S
A1WTH1_HALHL/3-183---------------WIGAGAALF...PD.I-------DWFLG......-----------------.LVI.ADSLVYYNL
Q8PSE7_METMA/3-176---------------RYLAIGAIL...PDLI-------DKPIG......-----------------.EVIFASTFGN...
O29835_ARCFU/7-140---------------ALAAIFSML...PD.V-------DLV........-----------------.LKIR.........
Q02F56_PSEAB/4-178---------------LAGMLAACL...PD.F-------DVV........-----------------.AFKLGIAYHDAFG
Q2RLP5_MOOTA/5-179---------------GMAALGALL...PD.I-------DQP.G......-----------------.SMI.SREVAGVPF
Q46DH2_METBF/3-171---------------PWIAFGALL...PDFI-------DKPLG......-----------------.RIILAETIGS...
Q9EZ84_CAMJU/3-164---------------PLAMLGSTA...PDWI-------EWI........-----------------.LKFFGIHVK....
Q3YN07_BACTK/3-163---------------IAVSFGALL...PD.I-------DEQ.H......-----------------.SWI.GRRTRGV.S
Q3JF51_NITOC/3-164---------------ALAAGASLL...PD.V-------DLP........-----------------.TSKLGRVLFWLST
Q1MQD9_LAWIP/3-155---------------FATLVGSIL...PDLA-------DRTFAMGNKQQ-----------------WRRI..........
Q0AJ35_NITEC/3-176---------------LVGFFGALL...PD.L-------DVF........-----------------.INS.AADPLLTVE
Q97LP7_CLOAB/3-199---------------GLIIAASIL...PD.I-------DHP.K......-----------------.GML.NQYILPIKS
A8L052_FRASN/2-224---------------VVAAGAGLL...PD.I-------DHP.S......-----------------.GRI.ANTLGPV.T
A9AVQ5_HERA2/4-166---------------ICASIAAIS...PD.F-------DGI........-----------------.SFWLDMPRGTLLS
Q67R78_SYMTH/3-176---------------WAALLGNSL...PD.V-------DVP........-----------------.LSFLLRRGIQL..
Q9YAY7_AERPE/3-148---------------FLIVGLSTL...PD.V-------DLA.L......-----------------.EIA..........
Q1ZS65_PHOAS/3-176---------------LAGAALGTL...PD.L-------DVF........-----------------..ISYGDPISDTVK
A4XRV7_PSEMY/3-180---------------LYGAALATL...PD.L-------DVV........-----------------..IDYGDAVGNMTY
A4J2S9_DESRM/3-180---------------VVGAVAALL...PD.M-------DHP.G......-----------------.SYS.GRMMRPL.A
Q18HI1_HALWD/3-156---------------VLTLAIAPL...PD.Y-------DTQID......-----------------.TLT..........
A0R9F7_BACAH/3-182---------------LATIAGSNI...PD.I-------DTV........-----------------.LKL.RNNAKYIRN
Q65F12_BACLD/3-155---------------ASGVIGALI...PD.I-------CHT.K......-----------------.SKI.GRRLPIL.S
A0KMD3_AERHH/4-197---------------LAGVAIAML...PD.A-------DVL........-----------------.AFKLGVAYGHVFG
Q18BE8_CLOD6/3-241---------------LVSATFAVL...PD.L-------DKS........-----------------.NSM.VSNFILKNN
Q648F5_9ARCH/3-180---------------LFVLIGAIL...PDLI-------DKPVG......-----------------.EILLANSISN...
Q5FTT4_GLUOX/55-213---------------CTGLLGSLL...PD.I-------DTE........-----------------.RSMLGSRLKFLSR
A1HQY3_9FIRM/3-173---------------IAAVLGAQA...PD.L-------DII........-----------------.AGL.RGGMAYLRQ
Q3JEV9_NITOC/3-176---------------AVGFIAGLL...AD.A-------DIF........-----------------.IRS.PDDPLLVLE
Q1DD75_MYXXD/3-235---------------ATLVIGANL...PD.V-------DGL........-----------------.VTL.AGSDASLYW
A0JUC0_ARTS2/3-250---------------MATAGTALV...CD.W-------DHR.H......-----------------.STV.ANSLPPL.S
A3CTE7_METMJ/3-243---------------FGVFVGSLA...PD.A-------DAVDAAIFNGK-----------------IAGAKGKRGQVVNG
Q186I4_CLOD6/3-177---------------YFAYLGSLF...PD.I-------DMR........-----------------.GSYISKKFMLIYK
A0R7P4_PELPD/13-154---------------WLAAAGSVL...PDVL-------ELN........-----------------.GLI.K........
Q47RB2_THEFY/3-227---------------LVCAGAALI...PD.L-------DHK.S......-----------------.ATI.TKTYGVF.T
A6TSU9_ALKMQ/3-172---------------LGAVIGAIA...PD.F-------DIM........-----------------.TRI.KGDYVYLKH
Q5HM58_STAEQ/3-158---------------VLSVISSIL...PD.I-------CHT.Q......-----------------.SKI.GRRFRLT.S
Q2JB37_FRASC/3-225---------------VVSAGAALL...PD.I-------DHP.H......-----------------.GRI.ANTFGPV.T
Q5V391_HALMA/4-161---------------AVTFFGSQF...PDLI-------DKPLAYELHLI-----------------PS............
Q7NV83_CHRVO/3-166---------------AGGLAGSLL...PD.I-------DHP.K......-----------------.SWL.GRRIPFL.S
O27320_METTH/4-218---------------ALALIGAMI...PD.M-------DHE........-----------------.VNSGSVSTIFLLG
B1J8M8_PSEPW/3-184---------------IYGAALGTV...PD.L-------DVV........-----------------..IRYADPVSQMTY
Q5V568_HALMA/2-273---------------QLGVIAGLFAAVPD.V-------DIVYAPF....-----------------.GLLVGAAENLTAD
Q2L2L1_BORA1/3-180---------------LYGAALATL...PD.L-------DVL........-----------------..IRYPDPVSSMTY
Q0W4H6_UNCMA/3-165---------------RLVIVGSLL...PDII-------DKPLG......-----------------.EYIFHSVFNN...
Q4L847_STAHJ/3-158---------------CLSVVSSLL...PD.I-------CHT.G......-----------------.SKI.GRKLKLL.S
Q97MS7_CLOAB/3-166---------------RFLLVGSIL...PDLI-------DKPIG......-----------------.AFFFRNVFHN...
B4SK06_STRM5/3-184---------------LAGAALGTL...PD.L-------DALWL......-----------------.GFTAADPVANMIE
Q0SU56_CLOPS/3-177---------------HFSYIGSLF...PD.I-------DQR........-----------------.KSSISQMYPFLSK
Q9KE25_BACHD/3-180---------------LASIVAAEI...PD.I-------DGL........-----------------.LFNDGEAYLRI..
Q15HU4_CLOPF/3-157---------------TGVGLGSLL...PD.L-------DTP.N......-----------------.SFI.GRRLKII.S
A0YBX0_9GAMM/3-178---------------ILGFLSGMA...AD.L-------DVF........-----------------.IRS.SEDPLLFLV
Q023X2_SOLUE/3-190---------------AIVVVAANI...PD.I-------DLV........-----------------.TMA.GGPLNYLHY
Q8PXV1_METMA/3-172---------------KWIAFGALL...PDFI-------DKPLG......-----------------.RIVLAETIGS...
O29079_ARCFU/4-168---------------TISMFSTLL...PD.I-------DHP........-----------------.HSYISKSYWGVFS
Q5P1U0_AROAE/3-192---------------AAGAAAAAF...PD.L-------DFV........-----------------.LGY.VSDIAYLRG
Q99S94_STAAM/3-158---------------ILATLASLL...PD.I-------CHT.Q......-----------------.SKI.GRRFKVI.S
A0XYC3_9GAMM/3-181---------------FWGAALGTL...PD.L-------DVF........-----------------..LPYGGPVESFTY
Q1GSW3_SPHAL/3-193---------------PTLILAANL...PD.I-------DAA........-----------------.CLF.WLEGVQHLG
Q46G46_METBF/3-177---------------RYLAIGALL...PDLI-------DKPLG......-----------------.LIVFASTISN...
A0LXF8_GRAFK/3-182---------------LYGAIAGTI...PD.L-------DTF........-----------------.IGNFFDTITSIEI
Q043R0_LACGA/3-174---------------AATAIGASL...PD.I-------DEY.N......-----------------.SSA.SKKSVINFS
Q8TP13_METAC/3-172---------------RYLAIGAIL...PDLI-------DKPIG......-----------------.EIIFASTFSS...
Q6D4I1_ERWCT/3-166---------------PGALLTALL...PD.I-------DHP.K......-----------------.SVL.GQRLKWL.S
Q890Y4_CLOTE/3-199---------------GVVAFGSLL...AD.I-------DHP.K......-----------------.SMI.NKYILPFKN
A1TRR8_ACIAC/3-179---------------LWGAVAGTL...PD.L-------DAL........-----------------..IDRGDPIANMVQ
Q3J7C8_NITOC/3-183---------------LLGALAATF...PD.S-------DFI........-----------------.LRWTTDLLTYLNL
Q1Z117_PHOPR/3-176---------------LAGAALGTI...PD.L-------DVL........-----------------..IGYGDPVSDMVK
Q08ZS3_STIAD/3-149---------------VLVTCAGLA...PD.L-------DGL........-----------------.SLLGGEAFYARY.
Q0RHF1_FRAAA/6-228---------------VVAAGAGLL...PD.I-------DHP.N......-----------------.GRI.ANTLGPV.S
Q0W2I6_UNCMA/3-181---------------PFAVLGAVV...LD.I-------DVVFH......-----------------.RFSDRDPRLYIFT
Q7MS32_WOLSU/3-175---------------SGVALGSLL...PD.I-------DEP.N......-----------------.STL.GRQLPLL.S
Q1ATT6_RUBXD/3-170---------------LAAAVCSVL...PD.A-------DYP.K......-----------------.SWL.GHQLGGVSE
Q9KAZ8_BACHD/3-159---------------SASLFGALI...PD.I-------CHP.R......-----------------.SMV.GRALPVV.S
A8LV16_SALAI/3-256---------------AVCAGAALL...PD.L-------DLSGKVTRNQG-----------------GATV.ARTFGVF.S
Q8PUB3_METMA/4-199---------------NVVAFLSIL...PD.L-------DFIPYTLFFLL-----------------SSSVSHETRTHLFY
Y790_METJA/3-224---------------FLALAGALY...PD.L-------DHDVK......-----------------.EDI.VKRGLLISG
Q01PN8_SOLUE/4-175---------------VTTGLFAVV...PD.L-------DTY........-----------------.AMLGFGIPRGTLL
Q9CNK9_PASMU/3-180---------------LYGGLLGTL...PD.L-------DVF........-----------------..IRYADPISSMTY
Q2B443_9BACI/45-224---------------TAAVAASQI...PD.I-------DVI........-----------------.SQLWDTQGLYQMW
A0AJE4_LISW6/3-182---------------TATIIGSQI...PD.I-------DTV........-----------------.LKL.KNNADYIRN
Q9KEC4_BACHD/3-182---------------IATIIGSQA...PD.F-------DTI........-----------------.LKL.RNNAVYIRN
Q8E899_SHEON/3-158---------------APVVIGATA...PDWM-------EWV........-----------------.VKLTGRHIK....
Q99T10_STAAM/3-179---------------TTLIVGSLI...PD.G-------DTV........-----------------.LKL.KDNATYISH
Q3ITN2_NATPD/3-143---------------VPVVLGALF...PD.V-------DTA........-----------------.FGK..........
Q11P46_CYTH3/3-219---------------LLGGFAGAL...PD.I-------DAI........-----------------.SLW.SGFDSTIGK
Q1D144_MYXXD/3-188---------------VASVLAAEL...PD.L-------DTL........-----------------.LAR.GDAVTVALQ
Q50EB0_STRFL/3-259---------------LICAGAALA...PD.L-------DHK.S......-----------------.ATI.SRAFGPV.S
Q7VVQ6_BORPE/3-180---------------LYGGLLGTL...PD.L-------DVL........-----------------..MRYPDPVSLMTY
Q7N3N6_PHOLL/3-166---------------PGVLLTALL...PD.I-------DHP.N......-----------------.STL.GRLFRFI.S
Q7NWB9_CHRVO/4-187---------------ALCGAAAML...PD.L-------DVV........-----------------.TFKLGIPYASPWG
Q8ETE4_OCEIH/3-155---------------ISGVIGSII...PD.I-------CHG.G......-----------------.SKI.GRRFPIL.S
A6UAV6_SINMW/2-157---------------AVGLIFSLA...PD.L-------DLFYF......-----------------.YLVDGRRTP....
Q49ZB6_STAS1/3-158---------------TLAVISSLL...PD.I-------CHP.Q......-----------------.SKI.GRRFKLI.S
Q5L2T9_GEOKA/3-182---------------IGALAGSQA...PD.I-------DTI........-----------------.FKL.RNNAQYIRN
Q8PUB1_METMA/4-234---------------LGLVLLSIV...PD.I-------DYFSYSLFTLI-----------------SGSVSHEARNQLFY
Q5WIF9_BACSK/3-182---------------ATTLVASNA...PD.F-------DTV........-----------------.LKL.KNNAIYIRH
Q2B352_9BACI/31-210---------------IGALIGSQA...PD.I-------DTV........-----------------.LKL.RNNAVYIRN
Q4J9X0_SULAC/3-213---------------VLVGIGAAI...PD.L-------DREY.......-----------------.TLLKRDIFRRMQL
A4G067_METM5/3-224---------------FLLVAGALY...PD.L-------DHDVK......-----------------.SEI.VQRGLYISG
Q5WH30_BACSK/3-157---------------AAGLVGAIL...PD.I-------CHT.H......-----------------.SKI.GRRFPVL.S
Q5I399_VIBCL/3-158---------------PICIAGATA...PDWI-------EYV........-----------------.VKVFGHNIK....
Q04RA4_LEPBJ/4-178---------------IIGILFSIL...PD.V-------DVI........-----------------.AFQFGIPYESDWG
Q1WSF6_LACS1/3-169---------------GVLAVGSLL...PD.I-------DHP.S......-----------------.SYL.GKRHKMV.S

PF09988

A0YPQ2_LYNSP/2-202---------------SCFLFSGLM-FGPD-L-------DIHRS..YHFQ-----------------RWGWLRWLWLPYQK
Q631C1_BACCZ/2-157---------------IGFLVGTTF-LTPD-L-------DTY.S..NAYN-----------------KWGFLRIFWYPYKK
B8GCX6_CHLAD/2-185---------------GAHLLSGIM-FSPD-L-------DID.S..AIDN-----------------RWGIFFWIWRPYMW
A4CX56_SYNPV/2-164---------------AAFAWGGLW-LSPD-L-------DTR.S..RALK-----------------RWGPLGWIWRPYRT
A3IY70_9CHRO/2-174---------------GAYLFSGLM-FGPD-L-------DIY.S..VQYK-----------------RWGIIRWIWLPYQS
A5GPK9_SYNPW/2-164---------------AAFAWGGLW-LSPD-L-------DTR.S..RALK-----------------RWGPLGWIWRPYRT
Q2JX69_SYNJA/2-169---------------SAYLFSGLM-FSGD-L-------DTD.S..RQYR-----------------RWLFLRWIWLPYRR
Q3AVT6_SYNS9/2-162---------------AAFSFGGLW-LSPD-L-------DTR.C..RALQ-----------------RWGPLQFIWWPYRR
Q7U3L4_SYNPX/2-158---------------AGCLIGGLW-LSPD-L-------DTH.S..NALR-----------------RWGPLRGLWWPYRR
Q4C9Z4_CROWT/4-176---------------AAYLFSGLM-FGPD-L-------DIY.S..IQYK-----------------RWGMIRWVWFPYQS
Q3M912_ANAVT/2-183---------------GGFMFGGLM-FGPD-L-------DIY.S..RQYQ-----------------RWGFLRWIWLPYQK
Q5MZ52_SYNP6/2-175---------------GSYLFAGLM-FGPD-L-------DVR.S..RQSQ-----------------RWGPLRWIWTPYQR
A9B0N7_HERA2/2-181---------------GSHIVSGMA-FSPD-L-------DLA.S..EPYN-----------------RWGPLRFIWWPYRE
Q7NFX0_GLOVI/2-169---------------CAYLFAGLM-FGGD-L-------DTH.S..VQYR-----------------RWGLLRWIWLPYRR
Q1IZ50_DEIGD/5-169---------------VGFFVGTFL-LSPD-L-------DLAEGQVDSKR-----------------RWGWLGFLWVPYGM
Q05V62_9SYNE/2-168---------------GSFVVGGLW-LSPD-L-------DTL.S..RPLQ-----------------RWGPLRWIWWPYRQ
A3YTK7_9SYNE/2-161---------------GGFLAGGLW-LSPD-L-------DTR.S..NPSR-----------------RWGPLALLWWPYRR
A7GUZ7_BACCN/2-158---------------IGFLVGTFF-LTPD-L-------DIH.S..SAYN-----------------KWGLLRIFWYPYQC
P72876_SYNY3/2-167---------------IAFGFSGLM-FGPD-L-------DIH.S..CQYK-----------------RWGWLRWVWLPYRH
Q0TR94_CLOP1/2-176---------------SIYMFGGYM-FSGD-L-------DIK.S..REFR-----------------RWGYLKFIWIPYQK
Q10Y23_TRIEI/2-182---------------GGFLFSGLM-FGPD-L-------DIN.S..RQFQ-----------------RWGWFRWLWRPYQT
B1YE70_EXIS2/2-150---------------VGIAVGTLW-LSPD-L-------DLK.S..EPYY-----------------RHGPLRVLWMPYVK
Q0I690_SYNS3/2-165---------------LAFLFGGLF-LSPD-L-------DIN.S..RPYQ-----------------RWGVLRWIWWPYLR
A3Z3L1_9SYNE/2-165---------------LTFLIGGLW-LSPD-L-------DTH.S..RAFQ-----------------RWGPLRPLWWPYQR
Q2JJ24_SYNJB/2-169---------------SAYLFSGLM-FSGD-L-------DTC.S..RQYQ-----------------RWLFLCWIWLPYRK
A5UV55_ROSS1/2-182---------------GAHLISGLL-FSPD-L-------DID.S..AIDN-----------------RWGFFFWIWRPYMW
Q72GM7_THET2/2-158---------------LAYLAGTYL-LSPD-L-------DLAERGVRASR-----------------RWGILAAFWRPYGW
Q9RT76_DEIRA/5-176---------------WAFMAGTFL-LSPD-L-------DLSEGRVDSKR-----------------RWGPLGFLWVPYGR

PF02265

ENDO2_ARATH/28-290.PE........SA.EGDLSSLCLW---AD---------RVKF...R..Y.................HWSSP....LH---
ENDO5_ARATH/21-288.PE........SVDGGGLADFCSW---PD---------EIKK.LSQ..W.................QWTST....LH---
A4H6V5_LEIBR/29-297.TALNE.VGPFPK.STNIVELGPW---AD---------DLKSMGL.....................STMSS....WH---
Q8F3Z8_LEPIN/21-283.GD............LTLEQISTC---PD---------ELKAFQSQ..RREMSPVCSQVFTSPAPPTNTGP....WH---
B0T6T3_CAUSK/23-287.AADT....DALT.PPDLAARASW---AD---------AWRK...D..H.................RQTTE....WH---
F2G2Z7_ALTMD/28-265.PH............GSLAEASTH---AD---------EMRSNPSEFWQ.................KTASP....WH---
B4STV7_STRM5/27-270.AT........EP.DATLASIAPW---AD---------QLRAKDPG.LG.................RRSAG....WH---
Q66VY6_LEIMA/29-300.KVLSLAGPFPKS..PDMVQLGPW---AD---------DLLESGL.....................KTNFN....WH---
Q25267_LEIDO/126-397.KVLSFSGPYPKS..PDMVQTAPW---AD---------DIKTIGL.....................KTLST....WH---
Q3BPV9_XANC5/74-316.AGE.....PD....PTLHGVATW---AD---------ELREHDPDLG..................KRSGP....WH---
A4C4V1_9GAMM/28-270.EG............DKLPEVTTW---AD---------EMRSDPSKFWK.................KESVI....WH---
O68530_RHILI/22-306.RAHLGLTGQQV...VSMASIASW---AD---------DYRADG....H.................KDTSN....WH---
Q7S8Q5_NEUCR/20-297.GD........NS.TSYMGNIASW---AD---------SFRYESAA..N.................AWSAG....LH---
Q5KPJ8_CRYNJ/20-279...P......EEA.NCHLAPVAAW---AD---------.IVRN..R..Y.................RGTAP....MH---
Q236I4_TETTS/18-296.KYVTILNPLCDARSQDFVQAASW---AD---------DIKDDAM.....................NFWYG....WH---
Q4DEV4_TRYCC/28-293.VNLSASGPFPHT..TDFVESGCW---AD---------DIKKLGL.....................FVMED....WH---
A2WK84_ORYSI/28-274.PS........YA.GGNLSSLCSW---AD---------GVK...LR..Y.................PWSAP....LH---
Q870T1_NEUCS/21-292.RN........DT.SDYLANVATW---AD---------SIRY.TKW..G.................RWTGP....LH---
A5A339_SOYBN/27-290.PI........SA.GNDLSTKCSW---AD---------HVH...HI..Y.................PWASA....LH---
Q86GJ3_LEIAM/31-295.AVFSGSGPFPMS..PSMVQAACW---AD---------DVKLWRQ.....................YAMST....WH---
Q1YUT9_9GAMM/19-260.GG............TALTELALW---PD---------QIRGQQK...W.................SHTKS....WH---
A6EB04_9SPHI/11-250.GN............ETLAMASNW---GD---------FIKSDTS...Y.................NYLYN....WH---
Q0CD39_ASPTN/21-282.PF........SN.NFDISDAATW---AD---------EQKR...R..Y.................PKTKP....WH---
Q2SFD4_HAHCH/50-295.QQ........AG.KRTFAEACLW---PD---------QVRSEKE...F.................KHTGS....YH---
Q585P6_TRYB2/27-292.QHLSESGPFPNI..PDFVQSACW---PD---------DLKRYRM.....................GAMDG....WH---
Q989R8_RHILO/21-270.GG.......E....VAMASVASW---AD---------DVRYAI....H.................PESYN....WH---
Q25A98_ORYSA/30-295.TE........EA.DGDLSALCVW---PD---------QVRH.WYK..Y.................RWTSP....LH---
Q9NJI3_9TRYP/26-298.NVLCKTGPYPLS..PDMVQTASW---AD---------DIKTIGL.....................DTMSS....WH---
Q26CQ1_FLABB/21-256.DG............ESLALVSTY---AD---------DIKSDTL...Y.................RAYGP....QH---
ENDO1_ARATH/29-294.PD........YV.KGDLSALCVW---PD---------QIRH.WYK..Y.................RWTSH....LH---
A4CQ68_ROBBH/22-257.EG............ESLAKVSTF---GD---------DIKSDTT...Y.................RSFSP....WH---
Q0KFV0_SOLLC/26-291.PE........YV.NGDLSALCVW---PD---------QVRH.WYK..Y.................KWTSP....LH---
A3U8L7_CROAH/33-268.DG............TSLAEVSIY---AD---------EIRSDKK...Y.................RAYGP....WH---
Q9ZR88_ZINEL/19-280.PE........YA.EGDLASLCSW---AD---------HVK...FR..Y.................HWSSA....LH---
A7H7R9_ANADF/28-274.GAT......P....MSNADVAGW---AD---------AQRD........................PATRA....WH---
Q9LL59_APIGR/23-288.PD........YA.NGNLSSLCVW---PD---------QIRH.WYK..Y.................RWTSS....LH---
Q7P202_CHRVO/23-274.PN............ADFAQLALY---MD---------QHKQEL......................KQTLPGSDQWH---
A0BML4_PARTE/16-293.SLIQDLNPLTDGKSNTFAEAAVW---LD---------DIKETGT.....................NFMND....WH---
NUP3_PENSQ/1-265.GS........SS.SSYLASIASW---AD---------EYRL.TSA..G.................KWSAS....LH---
A7EWS3_SCLS1/21-282.GD........ST.TDYLASVAAW---SD---------SYRY.TTA..G.................KFSAP....FH---
A5A338_SOYBN/33-298.PD........HV.KGNLSALCTW---PD---------QIRH.WYK..Y.................RWTSP....LH---
Q3IBZ8_PSEHT/27-268.NN............ESLAQVSTW---PD---------EMRSAPGEFWQ.................RKSSR....WH---
A7ETG5_SCLS1/21-277.RN........DT.GSYLAGVATW---AD---------SYRL..........................AALLRLFQR---
A0M3W8_GRAFK/24-260.GG............HGLAFVANY---AD---------DIKSDPE...Y.................REFGP....WH---
A0BLJ0_PARTE/422-699.SLVQDFNSLTDGKSNTFAEAAVW---LD---------DIKETGT.....................EFLFS....WH---
A4HJL3_LEIBR/28-299.KVLSLSGPYPQS..PDMVQAAPW---AD---------DLKKVGF.....................SALST....WH---
Q0TYV6_PHANO/20-284.ND........TS.GAYLANVATW---AD---------SYRS.TPE..G.................AFSGV....LH---
Q051B2_LEPBL/26-289.GG............LTLEEISTC---PD---------ELRVFQSEKKPMSSVCNQ..IFTNPEPPTNTGS....WH---
A4BZ60_9FLAO/25-260.NG............QSLAFVSTY---AD---------EIKSDKA...Y.................SEYAS....WH---
A6ESW6_9BACT/22-257.NG............KSLALVSTF---GD---------EIRSDKK...Y.................RSFAP....WH---
ENDO3_ARATH/25-286.PE........SA.NGELAAVCSW---PD---------EIKK.LPQ..W.................RWTSA....LH---
Q0AMT2_MARMM/26-282.AQ........DPEFDHFRDVCSW---AD---------DVRGSTH.....................RHTAP....WH---
Q8NIH8_LENED/19-292SGP........QY.HSSLGLAAPW---AD---------EVRR.QKG..Y.................AWSAP....LH---
Q4Q7F3_LEIMA/31-295.HAFAQSGPFESS..PDMVQAACW---AD---------DVKRWGQ.....................YAMAT....WH---
A4I5I0_LEIIN/31-295.EVFAQSGPFPSS..PDMVQAACW---AD---------DVKLWRQ.....................RAMGS....WH---
Q9ZR87_ZINEL/27-293.PE........TA.EGDLASVCSW---PD---------EIKW.MHK..W.................HWTSE....LH---
Q5NRA3_ZYMMO/33-298.AMDHD.RLTE....PDFMSRATW---AD---------KWRSAGH.....................GETEP....WH---
A5V871_SPHWW/21-280..ARSDLLETPTCPARTIEQASVW---AD---------CVKTLKDR..Y.................SYAYS....WH---
A3XR21_LEEBM/28-263.GD............ETLVTVSTY---GD---------EIKSYEE...Y.................RKYSS....WH---
Q5FP59_GLUOX/25-298.ALE.....NH....QTLDQVASW---PD---------TIGHVPKK....................KGGAPETLKWH---
A0XY62_9GAMM/27-268.AG............ESLAQVSTW---PD---------EMRSNPGKFWQ.................KQSSR....WH---
Q0UA95_PHANO/19-289.ES........QY.NESVGRAAAW---AD---------GYAH.TAE..G.................RFSYQ....WH---
NUS1_ASPOR/21-284.GD........DS.TSYLANVATW---AD---------TYKY.TDA..G.................EFSKP....YH---
Q9P356_LENED/21-305.GS........EY.SESLGPAAPW---AD---------DVRF.EAA..F.................SWSAP....FH---
A6GGE9_9DELT/20-283...QG...SDGKG.DGSLATASIW---AD---------HEARESPE..F.................AFAAS....SH---
Q9NJY3_LEIPI/31-294.AVFSDSGPFPTS..PDMVQAACW---AD---------DVKLWRQ.....................RGMST....WH---
O81656_HEMSP/23-288.PH........YV.DGDLSALCTW---PD---------QIRH.WYK..Y.................RWSSP....LH---
A4HI96_LEIBR/31-295.MKFKESGPFLLS..PDMIQAACW---PD---------DVKRWGQ.....................DAMST....WH---
Q7XPN4_ORYSJ/27-283.PG........WA.GGELAETCSW---AD---------TER...FR..Y.................RWSSP....LH---
A6SS14_BOTFB/21-272.KN........TT.ESYLAGVATA---GK---------H.............................TGV....WH---
Q01U80_SOLUE/19-261GPG............NTLASISSW---AD---------SVRRAR......................AESGP....WH---
A2QX99_ASPNC/21-292.AN........DK.NYDISDAATW---AD---------TIKW...K..R.................PLTRP....LH---
A2TWS6_9FLAO/25-260.KG............QSLAFVSTF---AD---------EIKSDRA...Y.................RAYSP....WH---
Q2UHT0_ASPOR/21-283.PK........KH.GFDVSDAAVW---PD---------HIKH...R..H.................PETAP....WH---
Q2H4S7_CHAGB/217-488.RN........DT.AEYLAGVATW---AD---------SIRY.TKW..G.................RFTSD....FH---
Q15ZB2_PSEA6/20-256.PT............EDLAEASTY---PD---------EMRSSPDDFWQ.................KKAGP....FH---
A5PCR0_9SPHN/28-287..KAAPELGVPDCDLASLEDASVW---PD---------CLRKDYWR..W.................GYTFA....WH---
Q1VUV1_9FLAO/20-255.NG............QSLADASTY---AD---------EIKSDDE...Y.................DKYKP....WH---
A2TPR0_9FLAO/22-257.DG............ESLALVSTY---AD---------EIKSDEK...Y.................RSFGP....WH---
Q9ARD4_HORVU/24-280.PS........SA.NGELAEVCSW---AD---------SQR...FR..Y.................RWSSP....LH---
A0MSM3_SPIOL/24-289.PE........DL.NGNLSALCVW---PD---------QVRH.WYK..Y.................RWTSP....LH---

PF13803

B7IVR2_BACC2/1-238--------------------------------------------------------------------------------
A7FSP1_CLOB1/1-250--------------------------------------------------------------------------------
B1RQR4_CLOPF/1-244--------------------------------------------------------------------------------
B9XK96_9BACT/41-287--------------------------------------------------------------------------------
D0T6V3_ACIRA/1-244--------------------------------------------------------------------------------
A8L7F5_FRASN/1-234--------------------------------------------------------------------------------
A7C3K4_9GAMM/1-251--------------------------------------------------------------------------------
B2Q274_PROST/1-240--------------------------------------------------------------------------------
D2Q1R3_KRIFD/1-252--------------------------------------------------------------------------------
Q6FEH5_ACIAD/1-244--------------------------------------------------------------------------------
B7GWN2_ACIB3/1-244--------------------------------------------------------------------------------
Q65Q39_MANSM/1-231--------------------------------------------------------------------------------
D0SS47_ACILW/1-244--------------------------------------------------------------------------------
C0B3N4_9ENTR/1-241--------------------------------------------------------------------------------
D3EE91_GEOS4/1-238--------------------------------------------------------------------------------
D3D9A1_9ACTO/1-236--------------------------------------------------------------------------------
A0Q1Y2_CLONN/1-244--------------------------------------------------------------------------------
Q1IN38_KORVE/1-248--------------------------------------------------------------------------------
Q0RF10_FRAAA/1-234--------------------------------------------------------------------------------
A1ZM58_9BACT/1-236--------------------------------------------------------------------------------
C0DX83_EIKCO/1-244--------------------------------------------------------------------------------
A3HWD2_9BACT/1-238--------------------------------------------------------------------------------
A6GZ02_FLAPJ/1-237--------------------------------------------------------------------------------
D3V1B0_XENBS/1-239--------------------------------------------------------------------------------
C0ZEY0_BREBN/1-243--------------------------------------------------------------------------------
D2ARI2_STRRD/1-247--------------------------------------------------------------------------------
B1HS87_LYSSC/4-242--------------------------------------------------------------------------------
D4DQE9_NEIEG/58-292--------------------------------------------------------------------------------
C0VQ51_9GAMM/1-244--------------------------------------------------------------------------------
Q1VTE4_9FLAO/1-237--------------------------------------------------------------------------------
D4BTR9_PRORE/1-240--------------------------------------------------------------------------------
Q7UP84_RHOBA/1-250--------------------------------------------------------------------------------
Q899W6_CLOTE/1-234--------------------------------------------------------------------------------
D0SL80_ACIJU/1-244--------------------------------------------------------------------------------
C5VRK3_CLOBO/1-245--------------------------------------------------------------------------------
C6D3J1_PAESJ/1-242--------------------------------------------------------------------------------
D0SG75_ACIJO/1-244--------------------------------------------------------------------------------
C6JKD9_FUSVA/1-236--------------------------------------------------------------------------------

PF00882

B7GWN2_ACIB3/1-206....----------------------------------------------------------------------------
C6RSF9_ACIRA/1-206....----------------------------------------------------------------------------
B7H911_BACC4/1-208....----------------------------------------------------------------------------
C2XYJ1_BACCE/7-214....----------------------------------------------------------------------------
B1B9W2_CLOBO/1-214....----------------------------------------------------------------------------
C5VRK3_CLOBO/1-214....----------------------------------------------------------------------------
A3I5H3_9BACI/4-213....----------------------------------------------------------------------------
A7FSP1_CLOB1/1-219....----------------------------------------------------------------------------
Q0SV58_CLOPS/1-213....----------------------------------------------------------------------------
Q899W6_CLOTE/1-207....----------------------------------------------------------------------------
C0ZEY0_BREBN/1-212....----------------------------------------------------------------------------
C6JKD9_FUSVA/1-208....----------------------------------------------------------------------------
A6GZ02_FLAPJ/1-209....----------------------------------------------------------------------------
Q1VTE4_9FLAO/1-209....----------------------------------------------------------------------------
A1ZM58_9BACT/1-209....----------------------------------------------------------------------------
D3EE91_GEOS4/1-207....----------------------------------------------------------------------------
C6D3J1_PAESJ/1-215....----------------------------------------------------------------------------
A3HWD2_9BACT/1-210....----------------------------------------------------------------------------
C0DX83_EIKCO/1-211....----------------------------------------------------------------------------
D4DQE9_NEIEG/58-261....----------------------------------------------------------------------------
Q65Q39_MANSM/1-202....----------------------------------------------------------------------------
D3V1B0_XENBS/1-204....----------------------------------------------------------------------------
C0B3N4_9ENTR/1-204....----------------------------------------------------------------------------
D4BTR9_PRORE/1-203....----------------------------------------------------------------------------
B2Q274_PROST/1-203....----------------------------------------------------------------------------
Q2LV15_SYNAS/6-198....----------------------------------------------------------------------------
Q2Y883_NITMU/6-188....----------------------------------------------------------------------------
A7K2D4_VIBSE/6-189....----------------------------------------------------------------------------
A4C3L5_9GAMM/6-186....----------------------------------------------------------------------------
C9YFH3_9BURK/6-183....----------------------------------------------------------------------------
Q12DA4_POLSJ/6-186....----------------------------------------------------------------------------
C4XMP3_DESMR/34-221....----------------------------------------------------------------------------
E6VSV5_DESAO/6-180....----------------------------------------------------------------------------
Q2LQI8_SYNAS/6-189....----------------------------------------------------------------------------
B8FCF0_DESAA/6-187....----------------------------------------------------------------------------
B3E8I7_GEOLS/6-161....----------------------------------------------------------------------------
A1AT46_PELPD/6-164....----------------------------------------------------------------------------
C6Y3Y4_PEDHD/24-233YEAH----------------------------------------------------------------------------
E6U8V9_ETHHY/5-158....----------------------------------------------------------------------------
Q1IVJ5_KORVE/32-215....----------------------------------------------------------------------------
C1F375_ACIC5/44-227....----------------------------------------------------------------------------
Q01WM2_SOLUE/25-208....----------------------------------------------------------------------------
Q1ISY5_KORVE/28-210....----------------------------------------------------------------------------
Q025L8_SOLUE/39-222....----------------------------------------------------------------------------
Y1571_ARCFU/28-204....----------------------------------------------------------------------------
Q01YQ6_SOLUE/23-198VRPD----------------------------------------------------------------------------
Q8XI18_CLOPE/5-158....----------------------------------------------------------------------------
B0AAC8_9FIRM/5-160....----------------------------------------------------------------------------
B6FWP7_9FIRM/5-161....----------------------------------------------------------------------------
C9YL06_CLODR/5-159....----------------------------------------------------------------------------
D3MTQ6_9FIRM/3-156....----------------------------------------------------------------------------
C1I9N1_9CLOT/4-161....----------------------------------------------------------------------------
B2UYY5_CLOBA/4-161....----------------------------------------------------------------------------
C4IEN4_CLOBU/4-161....----------------------------------------------------------------------------
A6LQ77_CLOB8/4-161....----------------------------------------------------------------------------
B1BXM8_CLOPF/5-161....----------------------------------------------------------------------------
Q97KV3_CLOAB/5-155....----------------------------------------------------------------------------
B0P7T6_9FIRM/16-171....----------------------------------------------------------------------------
C0ECW5_9CLOT/5-161....----------------------------------------------------------------------------
A8MHU0_ALKOO/5-164....----------------------------------------------------------------------------
A6TNX7_ALKMQ/5-165....----------------------------------------------------------------------------
B2A897_NATTJ/5-148....----------------------------------------------------------------------------
B0MJ55_9FIRM/5-161....----------------------------------------------------------------------------
B0NZS3_9CLOT/15-171....----------------------------------------------------------------------------
A5ZUN3_9FIRM/20-175....----------------------------------------------------------------------------
C6J9X9_9FIRM/5-161....----------------------------------------------------------------------------
C6LKS6_9FIRM/5-161....----------------------------------------------------------------------------
D4KRQ8_9FIRM/5-161....----------------------------------------------------------------------------
D9SRM2_CLOC7/5-162....----------------------------------------------------------------------------
A6LQR0_CLOB8/5-160....----------------------------------------------------------------------------
B0S165_FINM2/8-177....----------------------------------------------------------------------------
D1VUW6_9FIRM/8-182....----------------------------------------------------------------------------
B1QT08_CLOBU/5-155....----------------------------------------------------------------------------
C4Z638_EUBE2/40-187....----------------------------------------------------------------------------
A7VFQ0_9CLOT/5-152....----------------------------------------------------------------------------
C0EWT7_9FIRM/5-150....----------------------------------------------------------------------------
A8SNU3_9FIRM/5-162SIRG----------------------------------------------------------------------------
D4LBU1_RUMC1/5-160SLH.----------------------------------------------------------------------------
Q315K4_DESDG/47-177....----------------------------------------------------------------------------
B8DLU9_DESVM/18-149....----------------------------------------------------------------------------
C7LVT1_DESBD/24-155....----------------------------------------------------------------------------
C6BUV8_DESAD/29-160....----------------------------------------------------------------------------
C8X0X8_DESRD/29-159....----------------------------------------------------------------------------
A5G5N0_GEOUR/25-157....----------------------------------------------------------------------------
Q39S84_GEOMG/25-157....----------------------------------------------------------------------------
E8WRC5_GEOS8/30-162....----------------------------------------------------------------------------
A1AK53_PELPD/24-156....----------------------------------------------------------------------------
B3EBK7_GEOLS/25-157....----------------------------------------------------------------------------
Q3A306_PELCD/29-161....----------------------------------------------------------------------------
Q1K0Z2_DESAC/27-159....----------------------------------------------------------------------------
C1A8N1_GEMAT/19-151....----------------------------------------------------------------------------
B8J577_ANAD2/33-165....----------------------------------------------------------------------------
D6SRA3_9DELT/26-149....----------------------------------------------------------------------------
B5YG53_THEYD/20-144....----------------------------------------------------------------------------
Q1H382_METFK/30-174....----------------------------------------------------------------------------
C6X6W6_METSD/30-174....----------------------------------------------------------------------------
C6WXF1_METML/56-200....----------------------------------------------------------------------------
D5CMM4_SIDLE/28-177....----------------------------------------------------------------------------
B0SGT0_LEPBA/6-211....----------------------------------------------------------------------------
Q72P57_LEPIC/6-211....----------------------------------------------------------------------------
C8W7P0_ATOPD/6-209....----------------------------------------------------------------------------
C5DV22_ZYGRC/30-228....----------------------------------------------------------------------------
B5VL45_YEAS6/30-234....----------------------------------------------------------------------------
C5DKM1_LACTC/24-220....----------------------------------------------------------------------------
Q6FL70_CANGA/25-242....----------------------------------------------------------------------------
Q6CEF9_YARLI/23-229....----------------------------------------------------------------------------
C4R8D0_PICPG/19-213....----------------------------------------------------------------------------
Q8R432_MOUSE/28-220....----------------------------------------------------------------------------
C3ZWC6_BRAFL/5-194....----------------------------------------------------------------------------
A7SED1_NEMVE/31-226....----------------------------------------------------------------------------
D3AZT7_POLPA/38-225....----------------------------------------------------------------------------
PLDG_DICDI/29-216....----------------------------------------------------------------------------
Q97TF6_CLOAB/60-232....----------------------------------------------------------------------------
A7B1H2_RUMGN/72-243....----------------------------------------------------------------------------
PHLC_CLOHA/37-230....----------------------------------------------------------------------------
PHLC_CLONO/38-231....----------------------------------------------------------------------------
Q5PXE6_CLOPF/38-231....----------------------------------------------------------------------------
Q8GCY3_9CLOT/38-231....----------------------------------------------------------------------------
PHLC_CLOSO/38-231....----------------------------------------------------------------------------
Q6R6B7_LISSE/64-245....----------------------------------------------------------------------------
Q6EAE3_LISMN/64-245....----------------------------------------------------------------------------
Q6R6D6_LISIV/62-243....----------------------------------------------------------------------------
A0R9W0_BACAH/51-232....----------------------------------------------------------------------------
A5D2J5_PELTS/29-178....----------------------------------------------------------------------------
Q896L3_CLOTE/34-205....----------------------------------------------------------------------------
A5N896_CLOK5/34-205....----------------------------------------------------------------------------
Q97KA0_CLOAB/34-205....----------------------------------------------------------------------------
A6TKQ8_ALKMQ/57-228....----------------------------------------------------------------------------
O26214_METTH/27-173....----------------------------------------------------------------------------
B8I5G2_CLOCE/32-236NYIG----------------------------------------------------------------------------
B5HQN8_9ACTO/67-292....----------------------------------------------------------------------------
Q82A31_STRAW/92-336....----------------------------------------------------------------------------
C9YWP6_STRSW/1-225....----------------------------------------------------------------------------
B4V801_9ACTO/61-287....----------------------------------------------------------------------------
C7QBS6_CATAD/1-214....----------------------------------------------------------------------------
D3D9A1_9ACTO/1-206....----------------------------------------------------------------------------
A8L7F5_FRASN/1-204....----------------------------------------------------------------------------
Q0RF10_FRAAA/1-204....----------------------------------------------------------------------------
D2ARI2_STRRD/1-214....----------------------------------------------------------------------------
D2Q1R3_KRIFD/1-218FT..----------------------------------------------------------------------------
C7R2G7_JONDD/1-213PFLN----------------------------------------------------------------------------
Q7UP84_RHOBA/1-217....----------------------------------------------------------------------------
A7C3K4_9GAMM/1-217....----------------------------------------------------------------------------
B9XK96_9BACT/41-256....----------------------------------------------------------------------------
Q1IN38_KORVE/1-215....----------------------------------------------------------------------------
D9T3L8_MICAI/1-213....----------------------------------------------------------------------------
C1ACE2_GEMAT/1-206....----------------------------------------------------------------------------
Q6FEH5_ACIAD/1-206....----------------------------------------------------------------------------
C0VQ51_9GAMM/1-206....----------------------------------------------------------------------------
D0SL80_ACIJU/1-206....----------------------------------------------------------------------------
D0SG75_ACIJO/1-206....----------------------------------------------------------------------------
D0SS47_ACILW/1-206....----------------------------------------------------------------------------

PF04307

Q2VZJ9_MAGSA/3-159KPISMVL.........................................................................
A6LWG2_CLOB8/3-169AINKLAG.........................................................................
A3CRK4_METMJ/3-159................................................................................
Q1MS87_LAWIP/3-199................................................................................
Q0W649_UNCMA/3-154................................................................................
Q5X0H9_LEGPL/3-176W...............................................................................
Q2NZA4_XANOM/4-177................................................................................
Q8PZ85_METMA/4-181................................................................................
A4YHA8_METS5/3-210................................................................................
A4W9L4_ENT38/3-166KPIARAF.........................................................................
Q468G0_METBF/3-172................................................................................
Q6AMI9_DESPS/4-207LIQQERQPTPEFLFLYFFCSYFFINYFLYGVVKKLTV...........................................
Q1ILA3_KORVE/3-163PLLWFSEFH.......................................................................
Q8TVQ4_METKA/3-158LTGRDLRLALSRRLR.................................................................
A8GDN5_SERP5/3-166IPISRAF.........................................................................
A0YYL1_LYNSP/4-178................................................................................
A0YXX1_LYNSP/4-183................................................................................
Q1VZ04_9FLAO/3-179................................................................................
Q0JZE4_CUPNH/3-185W...............................................................................
Q2S300_SALRD/3-182................................................................................
A5CZD2_PELTS/18-203CWLEERF.........................................................................
A3CVA2_METMJ/3-183................................................................................
Q0BSQ9_GRABC/15-169IALSKAF.........................................................................
A2BN14_HYPBU/3-145................................................................................
Q0S8N5_RHOSR/4-250SVVAKGVDAVSLA.............................................................FYTVTK
Q1IHJ9_KORVE/3-205................................................................................
A1U6Q1_MARAV/3-174................................................................................
A4J2S7_DESRM/3-150TITRGIL.........................................................................
Q28PX8_JANSC/2-152................................................................................
Q18EP1_HALWD/19-174................................................................................
Q0VLL6_ALCBS/3-174................................................................................
Q726Y1_DESVH/3-173................................................................................
Q2NEC5_METST/4-226VILAVALSVYDKL...........................................................PLSAMIII
YFHP_BACSU/3-182................................................................................
Q8TQH1_METAC/4-199LFG.............................................................................
A0KFP7_AERHH/3-165KPLSRLF.........................................................................
Q47U11_THEFY/3-250GLLSRGMRALSLA..............................................................VYRRT
Q1C5S1_YERPA/4-178................................................................................
Q465I7_METBF/4-223LLG.............................................................................
Q1QZR4_CHRSD/3-181................................................................................
A6TMK4_ALKMQ/3-249HIKKIWIAILTTLSIGTLFFLKDTPIFYGIALILFLGFIFAKQFAQKGYYMMRNFVQSMTAITVMIGAYYYEHYPLIWIG
Q82XH5_NITEU/3-183................................................................................
Q6YRT9_SYNY3/3-188PLEQRFS.........................................................................
A6LXK9_CLOB8/3-172................................................................................
Q8D1W8_WIGBR/3-169PISKTFG.........................................................................
Q18KS6_HALWD/3-171................................................................................
Q8R899_THETN/3-179ALTFPALIAAGYF...................................................LFKYKYFLLLSLILYL
A0Z1N5_9GAMM/41-214Y...............................................................................
Q9V2B4_PYRAB/7-175EDIRKE..........................................................................
Q18EE2_HALWD/4-162VPF.............................................................................
Q12UG8_METBU/3-174................................................................................
Q3IS66_NATPD/3-169................................................................................
Q465I8_METBF/4-199LIG.............................................................................
B4SJC5_STRM5/4-190................................................................................
A0PYB1_CLONN/3-199KKTKTAVYLALAV................................................IVLYSDYMYTKSPVSKAIG
Q3A0M8_PELCD/4-203DSVRRGLPMPEIAARSGLAMGLIALMFVIFTRLTV.............................................
Q465I4_METBF/4-199LLG.............................................................................
Q46FT6_METBF/4-180................................................................................
O26450_METTH/3-144................................................................................
Q1AT01_RUBXD/3-176PALNLLSRPLSWALRATSFVLVRTVG......................................................
Q75TF0_GEOKU/3-155KVKEAFG.........................................................................
Q1NK63_9DELT/3-180................................................................................
Q1C702_YERPA/3-166VPIARVF.........................................................................
Q2RM17_MOOTA/3-158................................................................................
Q5YVJ3_NOCFA/3-233YFACKIIAKVSG....................................................................
Q8CV62_OCEIH/3-182................................................................................
A0NTQ3_9RHOB/3-182................................................................................
Q2NV14_SODGM/3-168IPIAKVF.........................................................................
Q2N9Y9_ERYLH/15-204F...............................................................................
A1K1W5_AZOSB/3-183................................................................................
C1DQI7_AZOVD/3-180................................................................................
Q5FK20_LACAC/3-175LFL.............................................................................
Q0ACJ1_ALHEH/3-184................................................................................
Q8FRV6_COREF/4-249QVISRFTENIAQT.............................................................FVNVTR
Q1V9R5_VIBAL/3-178Y...............................................................................
Q97K38_CLOAB/3-212YAALVIVGAYILM..........................ANFYPEVEKTNLFLKNMGVYKLKDYIPYNLKLSNAGLLIIV
Q5V827_HALMA/3-151................................................................................
YVSG_BACSU/3-155KVVSSVF.........................................................................
A1WTH1_HALHL/3-183................................................................................
Q8PSE7_METMA/3-176................................................................................
O29835_ARCFU/7-140................................................................................
Q02F56_PSEAB/4-178................................................................................
Q2RLP5_MOOTA/5-179GRIGRGIVGIAIL....................................................GAWHQTRLPLLLPAG
Q46DH2_METBF/3-171................................................................................
Q9EZ84_CAMJU/3-164................................................................................
Q3YN07_BACTK/3-163DLMNMVF.........................................................................
Q3JF51_NITOC/3-164RLEKHFG.........................................................................
Q1MQD9_LAWIP/3-155................................................................................
Q0AJ35_NITEC/3-176F...............................................................................
Q97LP7_CLOAB/3-199KFIKTLFYGSFGA................................................LVVFGNYYRFHIFMLYILG
A8L052_FRASN/2-224RTLCRWVGRASG....................................................................
A9AVQ5_HERA2/4-166................................................................................
Q67R78_SYMTH/3-176................................................................................
Q9YAY7_AERPE/3-148................................................................................
Q1ZS65_PHOAS/3-176................................................................................
A4XRV7_PSEMY/3-180................................................................................
A4J2S9_DESRM/3-180VWLEEKY.........................................................................
Q18HI1_HALWD/3-156................................................................................
A0R9F7_BACAH/3-182................................................................................
Q65F12_BACLD/3-155AVVSSVF.........................................................................
A0KMD3_AERHH/4-197................................................................................
Q18BE8_CLOD6/3-241VSKYIYRIFIYAVNIIIFFISININDNFYLSAIITFVAIIIIEAKLTHTFLRKVFLSLIFILLAICLYIIEVEIYFTIFC
Q648F5_9ARCH/3-180................................................................................
Q5FTT4_GLUOX/55-213FLAKTFG.........................................................................
A1HQY3_9FIRM/3-173................................................................................
Q3JEV9_NITOC/3-176Y...............................................................................
Q1DD75_MYXXD/3-235................................................................................
A0JUC0_ARTS2/3-250NVIAVRIENASG....................................................................
A3CTE7_METMJ/3-243FAVVLPIFGYTIRYLIYYPLSLVFMLILRKSYRHR.............................................
Q186I4_CLOD6/3-177LFGSRFR.........................................................................
A0R7P4_PELPD/13-154................................................................................
Q47RB2_THEFY/3-227ETLGAFFNWAFG....................................................................
A6TSU9_ALKMQ/3-172................................................................................
Q5HM58_STAEQ/3-158FFVRILF.........................................................................
Q2JB37_FRASC/3-225RVMCRWISRAAG....................................................................
Q5V391_HALMA/4-161................................................................................
Q7NV83_CHRVO/3-166RPISYLF.........................................................................
O27320_METTH/4-218LVIFLVFYILGLP...........................................................YLAGIALM
B1J8M8_PSEPW/3-184................................................................................
Q5V568_HALMA/2-273GFWETANVV.......................................................................
Q2L2L1_BORA1/3-180................................................................................
Q0W4H6_UNCMA/3-165................................................................................
Q4L847_STAHJ/3-158LIIRLLF.........................................................................
Q97MS7_CLOAB/3-166................................................................................
B4SK06_STRM5/3-184................................................................................
Q0SU56_CLOPS/3-177HIGSKCR.........................................................................
Q9KE25_BACHD/3-180................................................................................
Q15HU4_CLOPF/3-157YPLSTIF.........................................................................
A0YBX0_9GAMM/3-178Y...............................................................................
Q023X2_SOLUE/3-190................................................................................
Q8PXV1_METMA/3-172................................................................................
O29079_ARCFU/4-168GAILKTTH........................................................................
Q5P1U0_AROAE/3-192................................................................................
Q99S94_STAAM/3-158FFVRLIF.........................................................................
A0XYC3_9GAMM/3-181................................................................................
Q1GSW3_SPHAL/3-193F...............................................................................
Q46G46_METBF/3-177................................................................................
A0LXF8_GRAFK/3-182................................................................................
Q043R0_LACGA/3-174LFL.............................................................................
Q8TP13_METAC/3-172................................................................................
Q6D4I1_ERWCT/3-166APIARLF.........................................................................
Q890Y4_CLOTE/3-199KFTKVIMYICIGI................................................ILLWYSIASGGMPHIKAIG
A1TRR8_ACIAC/3-179................................................................................
Q3J7C8_NITOC/3-183................................................................................
Q1Z117_PHOPR/3-176................................................................................
Q08ZS3_STIAD/3-149................................................................................
Q0RHF1_FRAAA/6-228RTICRWVSRASG....................................................................
Q0W2I6_UNCMA/3-181................................................................................
Q7MS32_WOLSU/3-175SLFHRLF.........................................................................
Q1ATT6_RUBXD/3-170DLYRLFG.........................................................................
Q9KAZ8_BACHD/3-159TVLLRTF.........................................................................
A8LV16_SALAI/3-256LFVAEVTEKVSLG.............................................................VYYATK
Q8PUB3_METMA/4-199FLG.............................................................................
Y790_METJA/3-224GIVFINILLYFFD...................................................KHLFNVDLFILGVLIL
Q01PN8_SOLUE/4-175S...............................................................................
Q9CNK9_PASMU/3-180................................................................................
Q2B443_9BACI/45-224................................................................................
A0AJE4_LISW6/3-182................................................................................
Q9KEC4_BACHD/3-182................................................................................
Q8E899_SHEON/3-158................................................................................
Q99T10_STAAM/3-179................................................................................
Q3ITN2_NATPD/3-143................................................................................
Q11P46_CYTH3/3-219WLHLKHTGMEIYFGKFWYS.............................................................
Q1D144_MYXXD/3-188A...............................................................................
Q50EB0_STRFL/3-259KALCEIVDKLSYA.............................................................VYKATK
Q7VVQ6_BORPE/3-180................................................................................
Q7N3N6_PHOLL/3-166IPIAKLC.........................................................................
Q7NWB9_CHRVO/4-187................................................................................
Q8ETE4_OCEIH/3-155NIINAIF.........................................................................
A6UAV6_SINMW/2-157................................................................................
Q49ZB6_STAS1/3-158FFIRMIF.........................................................................
Q5L2T9_GEOKA/3-182................................................................................
Q8PUB1_METMA/4-234LLG.............................................................................
Q5WIF9_BACSK/3-182................................................................................
Q2B352_9BACI/31-210................................................................................
Q4J9X0_SULAC/3-213................................................................................
A4G067_METM5/3-224GLILVSILAYLFR...................................................PEYFNTGFFIAAVLSG
Q5WH30_BACSK/3-157KTIATIF.........................................................................
Q5I399_VIBCL/3-158................................................................................
Q04RA4_LEPBJ/4-178................................................................................
Q1WSF6_LACS1/3-169GVTNKAF.........................................................................

PF09988

A0YPQ2_LYNSP/2-202SVR-----------------------------------------------------------------------------
Q631C1_BACCZ/2-157VMP-----------------------------------------------------------------------------
B8GCX6_CHLAD/2-185LIP-----------------------------------------------------------------------------
A4CX56_SYNPV/2-164LIP-----------------------------------------------------------------------------
A3IY70_9CHRO/2-174CFK-----------------------------------------------------------------------------
A5GPK9_SYNPW/2-164LIP-----------------------------------------------------------------------------
Q2JX69_SYNJA/2-169CLQ-----------------------------------------------------------------------------
Q3AVT6_SYNS9/2-162LIP-----------------------------------------------------------------------------
Q7U3L4_SYNPX/2-158LIP-----------------------------------------------------------------------------
Q4C9Z4_CROWT/4-176CLK-----------------------------------------------------------------------------
Q3M912_ANAVT/2-183SLR-----------------------------------------------------------------------------
Q5MZ52_SYNP6/2-175CLR-----------------------------------------------------------------------------
A9B0N7_HERA2/2-181LVP-----------------------------------------------------------------------------
Q7NFX0_GLOVI/2-169VAP-----------------------------------------------------------------------------
Q1IZ50_DEIGD/5-169LCR-----------------------------------------------------------------------------
Q05V62_9SYNE/2-168LVP-----------------------------------------------------------------------------
A3YTK7_9SYNE/2-161GLR-----------------------------------------------------------------------------
A7GUZ7_BACCN/2-158IMP-----------------------------------------------------------------------------
P72876_SYNY3/2-167FIP-----------------------------------------------------------------------------
Q0TR94_CLOP1/2-176LFE-----------------------------------------------------------------------------
Q10Y23_TRIEI/2-182SLN-----------------------------------------------------------------------------
B1YE70_EXIS2/2-150IMP-----------------------------------------------------------------------------
Q0I690_SYNS3/2-165LIP-----------------------------------------------------------------------------
A3Z3L1_9SYNE/2-165LLR-----------------------------------------------------------------------------
Q2JJ24_SYNJB/2-169WMR-----------------------------------------------------------------------------
A5UV55_ROSS1/2-182IIP-----------------------------------------------------------------------------
Q72GM7_THET2/2-158LFR-----------------------------------------------------------------------------
Q9RT76_DEIRA/5-176MFS-----------------------------------------------------------------------------

PF02265

ENDO2_ARATH/28-290--------------------------------------------------------------------------------
ENDO5_ARATH/21-288--------------------------------------------------------------------------------
A4H6V5_LEIBR/29-297--------------------------------------------------------------------------------
Q8F3Z8_LEPIN/21-283--------------------------------------------------------------------------------
B0T6T3_CAUSK/23-287--------------------------------------------------------------------------------
F2G2Z7_ALTMD/28-265--------------------------------------------------------------------------------
B4STV7_STRM5/27-270--------------------------------------------------------------------------------
Q66VY6_LEIMA/29-300--------------------------------------------------------------------------------
Q25267_LEIDO/126-397--------------------------------------------------------------------------------
Q3BPV9_XANC5/74-316--------------------------------------------------------------------------------
A4C4V1_9GAMM/28-270--------------------------------------------------------------------------------
O68530_RHILI/22-306--------------------------------------------------------------------------------
Q7S8Q5_NEUCR/20-297--------------------------------------------------------------------------------
Q5KPJ8_CRYNJ/20-279--------------------------------------------------------------------------------
Q236I4_TETTS/18-296--------------------------------------------------------------------------------
Q4DEV4_TRYCC/28-293--------------------------------------------------------------------------------
A2WK84_ORYSI/28-274--------------------------------------------------------------------------------
Q870T1_NEUCS/21-292--------------------------------------------------------------------------------
A5A339_SOYBN/27-290--------------------------------------------------------------------------------
Q86GJ3_LEIAM/31-295--------------------------------------------------------------------------------
Q1YUT9_9GAMM/19-260--------------------------------------------------------------------------------
A6EB04_9SPHI/11-250--------------------------------------------------------------------------------
Q0CD39_ASPTN/21-282--------------------------------------------------------------------------------
Q2SFD4_HAHCH/50-295--------------------------------------------------------------------------------
Q585P6_TRYB2/27-292--------------------------------------------------------------------------------
Q989R8_RHILO/21-270--------------------------------------------------------------------------------
Q25A98_ORYSA/30-295--------------------------------------------------------------------------------
Q9NJI3_9TRYP/26-298--------------------------------------------------------------------------------
Q26CQ1_FLABB/21-256--------------------------------------------------------------------------------
ENDO1_ARATH/29-294--------------------------------------------------------------------------------
A4CQ68_ROBBH/22-257--------------------------------------------------------------------------------
Q0KFV0_SOLLC/26-291--------------------------------------------------------------------------------
A3U8L7_CROAH/33-268--------------------------------------------------------------------------------
Q9ZR88_ZINEL/19-280--------------------------------------------------------------------------------
A7H7R9_ANADF/28-274--------------------------------------------------------------------------------
Q9LL59_APIGR/23-288--------------------------------------------------------------------------------
Q7P202_CHRVO/23-274--------------------------------------------------------------------------------
A0BML4_PARTE/16-293--------------------------------------------------------------------------------
NUP3_PENSQ/1-265--------------------------------------------------------------------------------
A7EWS3_SCLS1/21-282--------------------------------------------------------------------------------
A5A338_SOYBN/33-298--------------------------------------------------------------------------------
Q3IBZ8_PSEHT/27-268--------------------------------------------------------------------------------
A7ETG5_SCLS1/21-277--------------------------------------------------------------------------------
A0M3W8_GRAFK/24-260--------------------------------------------------------------------------------
A0BLJ0_PARTE/422-699--------------------------------------------------------------------------------
A4HJL3_LEIBR/28-299--------------------------------------------------------------------------------
Q0TYV6_PHANO/20-284--------------------------------------------------------------------------------
Q051B2_LEPBL/26-289--------------------------------------------------------------------------------
A4BZ60_9FLAO/25-260--------------------------------------------------------------------------------
A6ESW6_9BACT/22-257--------------------------------------------------------------------------------
ENDO3_ARATH/25-286--------------------------------------------------------------------------------
Q0AMT2_MARMM/26-282--------------------------------------------------------------------------------
Q8NIH8_LENED/19-292--------------------------------------------------------------------------------
Q4Q7F3_LEIMA/31-295--------------------------------------------------------------------------------
A4I5I0_LEIIN/31-295--------------------------------------------------------------------------------
Q9ZR87_ZINEL/27-293--------------------------------------------------------------------------------
Q5NRA3_ZYMMO/33-298--------------------------------------------------------------------------------
A5V871_SPHWW/21-280--------------------------------------------------------------------------------
A3XR21_LEEBM/28-263--------------------------------------------------------------------------------
Q5FP59_GLUOX/25-298--------------------------------------------------------------------------------
A0XY62_9GAMM/27-268--------------------------------------------------------------------------------
Q0UA95_PHANO/19-289--------------------------------------------------------------------------------
NUS1_ASPOR/21-284--------------------------------------------------------------------------------
Q9P356_LENED/21-305--------------------------------------------------------------------------------
A6GGE9_9DELT/20-283--------------------------------------------------------------------------------
Q9NJY3_LEIPI/31-294--------------------------------------------------------------------------------
O81656_HEMSP/23-288--------------------------------------------------------------------------------
A4HI96_LEIBR/31-295--------------------------------------------------------------------------------
Q7XPN4_ORYSJ/27-283--------------------------------------------------------------------------------
A6SS14_BOTFB/21-272--------------------------------------------------------------------------------
Q01U80_SOLUE/19-261--------------------------------------------------------------------------------
A2QX99_ASPNC/21-292--------------------------------------------------------------------------------
A2TWS6_9FLAO/25-260--------------------------------------------------------------------------------
Q2UHT0_ASPOR/21-283--------------------------------------------------------------------------------
Q2H4S7_CHAGB/217-488--------------------------------------------------------------------------------
Q15ZB2_PSEA6/20-256--------------------------------------------------------------------------------
A5PCR0_9SPHN/28-287--------------------------------------------------------------------------------
Q1VUV1_9FLAO/20-255--------------------------------------------------------------------------------
A2TPR0_9FLAO/22-257--------------------------------------------------------------------------------
Q9ARD4_HORVU/24-280--------------------------------------------------------------------------------
A0MSM3_SPIOL/24-289--------------------------------------------------------------------------------

PF13803

B7IVR2_BACC2/1-238-------------GVIG-HT-WLGFLYLNLPLVFLLAYIYHY------ILKKSFITH-----------------------
A7FSP1_CLOB1/1-250-------------ATIG-HG-LIGFFLYNLPLCFILAYLFHR------IIKKPLIAH-----------------------
B1RQR4_CLOPF/1-244-------------GNLG-HQ-ILGFFILNLPLCILLAYIFHN------FIKSPLISH-----------------------
B9XK96_9BACT/41-287-------------VTLG-HS-VPGVFWFCVPVGLIFFILLQH------LLKKPLFLL-----------------------
D0T6V3_ACIRA/1-244-------------AGYT-HQ-WASILHPNLWIGLAFTLVWYL------IYRPALYRF-----------------------
A8L7F5_FRASN/1-234-------------YHLS-HS-LLGVVTFVPLLSLVALGIWFC------LARDALLDL-----------------------
A7C3K4_9GAMM/1-251-------------CQFG-HT-LLGIFLFDIPAGLVILWIFHR------ILKQPLFSL-----------------------
B2Q274_PROST/1-240-------------AAQA-HH-VVGWFYTGLPICLII.YVVTY------WLRVPLSKV-----------------------
D2Q1R3_KRIFD/1-252-------------LTLT-HQ-FTSALWLNPLLALLALVVFHW------VLKRPLVAL-----------------------
Q6FEH5_ACIAD/1-244-------------LTIS-HE-WSGMIVPNLLVGLLFCAVWYV------LYRPFIYRW-----------------------
B7GWN2_ACIB3/1-244-------------GMLT-HQ-WKGLFYPNLALGLLFSAIWYL------LYRPVVYRF-----------------------
Q65Q39_MANSM/1-231-------------DVGG-HT-LFGSEWVNLPLCLLFYAVYRL------ILATPIKQH-----------------------
D0SS47_ACILW/1-244-------------SNIT-HL-WSSLIHPDLWIGLAFCAVWYL------IYRPVIYRF-----------------------
C0B3N4_9ENTR/1-241-------------ATTA-HG-LLGWFYTAFPFCIFV.FILNY------LFRNPLKCV-----------------------
D3EE91_GEOS4/1-238-------------GVWG-HE-GPGILLFNLPMILLLYVVFEK------VIRPVLHVY-----------------------
D3D9A1_9ACTO/1-236-------------YQLT-HS-LLGIVTVVPALTIVVLLVWCH------LVRDALVDL-----------------------
A0Q1Y2_CLONN/1-244-------------GTIG-HT-LIGSICFDIPLVIILYLLWEY------IIKKPFILS-----------------------
Q1IN38_KORVE/1-248-------------SRSW-HH-YPDLYRYCFPFLFAAFLLFQV------AIKKPVAGL-----------------------
Q0RF10_FRAAA/1-234-------------YRLT-HS-LLGVVTVAPVLSLVALGVWFH------LTRDALVDL-----------------------
A1ZM58_9BACT/1-236-------------SQYS-HT-IQGLLWFDLPLGLLLTVVFHQ------IVRNVLIDN-----------------------
C0DX83_EIKCO/1-244-------------VPGG-HS-LANLLWPNLPLCFTLYALYLA------LWHHTLRDF-----------------------
A3HWD2_9BACT/1-238-------------ENIG-HK-ITGIFLFDLPVAFAIALIFHC------LIKMPLFKA-----------------------
A6GZ02_FLAPJ/1-237-------------SNYS-HT-IGGLFCFDLLLGLLLAFIFHN------VVRDSLFDN-----------------------
D3V1B0_XENBS/1-239-------------ATVA-HH-LPGWFYTAFPLCLLI.FLIVR------LLSYPLSVL-----------------------
C0ZEY0_BREBN/1-243-------------SVYS-HT-MLGLWVVDLPIAILLAFLYQY------VVKKPMLAR-----------------------
D2ARI2_STRRD/1-247-------------YMTW-HS-YRGVLTIAPLAVVMLLAVFHG------LLRDPLTAL-----------------------
B1HS87_LYSSC/4-242-------------GEIG-HT-FTGFFLFNLPLVLVIYLIYQR------FIHQPIMSH-----------------------
D4DQE9_NEIEG/58-292-------------VSGG-HG-LADMLWPNLPLCFAVYWLYLA------LWRDTLSDF-----------------------
C0VQ51_9GAMM/1-244-------------IALT-HQ-WAGVLFPNLPIGLFFCLLWYL------LYRPVLYRL-----------------------
Q1VTE4_9FLAO/1-237-------------SDYS-HT-IDGLFWFDLPLGLLLTFIFHN------IVRNDLFDN-----------------------
D4BTR9_PRORE/1-240-------------ATTA-HD-LIGWLYTGLPLCLLI.TIFVQ------KSVFYLHYA-----------------------
Q7UP84_RHOBA/1-250-------------YESF-HS-IRGLFIDCVPVGVAAYFVYHL------LIKQPVVEL-----------------------
Q899W6_CLOTE/1-234-------------SNLG-HT-FLGFLFLNLPLCYLLNYLIIK------FIRIPFILN-----------------------
D0SL80_ACIJU/1-244-------------LPIA-HQ-WSGVIFPNLPIGLFFCLLWYL------IYRPVMYRV-----------------------
C5VRK3_CLOBO/1-245-------------GEMG-HT-SLGVFYFDLPIVFIMAFSWNY------IIKKTFILS-----------------------
C6D3J1_PAESJ/1-242-------------QSIG-HT-AAGLFLQVIPLSLVLGLLFHY------VVKSSLALH-----------------------
D0SG75_ACIJO/1-244-------------SNTT-HY-WTSLIHPDLWIGLSFCVLWYA------LLRPCFYRF-----------------------
C6JKD9_FUSVA/1-236-------------SKYS-HT-ISGILWYDLPMGIFLAFIFHN------LIKEALINN-----------------------

PF00882

B7GWN2_ACIB3/1-206-------------GMLT-HQ.WKGLFYPNLALGLLFSAIWYL......LYRPVVYRF-----------------------
C6RSF9_ACIRA/1-206-------------AGYT-HQ.WASILHPNLWIGLAFTLVWYL......IYRPALYRF-----------------------
B7H911_BACC4/1-208-------------GVIG-HT.WLGFLYLNLPLVFLIAYIYHY......ILKKPFITH-----------------------
C2XYJ1_BACCE/7-214-------------GIIG-HT.WAGFFYLNLPLVFLLAYAYHF......ILKGPFITH-----------------------
B1B9W2_CLOBO/1-214-------------GTIG-HT.LLGSIWFDIPLVIILYLLWEY......IIKRPFILS-----------------------
C5VRK3_CLOBO/1-214-------------GEMG-HT.SLGVFYFDLPIVFIMAFSWNY......IIKKTFILS-----------------------
A3I5H3_9BACI/4-213-------------GEIG-HT.FAGFFLFNLPLVLIIYLIYHR......FIHQPIMSH-----------------------
A7FSP1_CLOB1/1-219-------------ATIG-HG.LIGFFLYNLPLCFILAYLFHR......IIKKPLIAH-----------------------
Q0SV58_CLOPS/1-213-------------GNLG-HE.ILGFFILNLPLCILLAYIFHN......FIKSPLISH-----------------------
Q899W6_CLOTE/1-207-------------SNLG-HT.FLGFLFLNLPLCYLLNYLIIK......FIRIPFILN-----------------------
C0ZEY0_BREBN/1-212-------------SVYS-HT.MLGLWVVDLPIAILLAFLYQY......VVKKPMLAR-----------------------
C6JKD9_FUSVA/1-208-------------SKYS-HT.ISGILWYDLPMGIFLAFIFHN......LIKEALINN-----------------------
A6GZ02_FLAPJ/1-209-------------SNYS-HT.IGGLFCFDLLLGLLLAFIFHN......VVRDSLFDN-----------------------
Q1VTE4_9FLAO/1-209-------------SDYS-HT.IDGLFWFDLPLGLLLTFIFHN......IVRNDLFDN-----------------------
A1ZM58_9BACT/1-209-------------SQYS-HT.IQGLLWFDLPLGLLLTVVFHQ......IVRNVLIDN-----------------------
D3EE91_GEOS4/1-207-------------GVWG-HE.GPGILLFNLPMILLLYVVFEK......VIRPVLHVY-----------------------
C6D3J1_PAESJ/1-215-------------QSIG-HT.AAGLFLQVIPLSLVLGLLFHY......VVKSSLALH-----------------------
A3HWD2_9BACT/1-210-------------ENIG-HK.ITGIFLFDLPVAFAIALIFHC......LIKMPLFKA-----------------------
C0DX83_EIKCO/1-211-------------VPGG-HS.LANLLWPNLPLCFTLYALYLA......LWHHTLRDF-----------------------
D4DQE9_NEIEG/58-261-------------VSGG-HG.LADMLWPNLPLCFAVYWLYLA......LWRDTLSDF-----------------------
Q65Q39_MANSM/1-202-------------DVGG-HT.LFGSEWVNLPLCLLFYAVYRL......ILATPIKQH-----------------------
D3V1B0_XENBS/1-204-------------ATVA-HH.LPGWFYTAFPLCLLI.FLIVR......LLSYPLSVL-----------------------
C0B3N4_9ENTR/1-204-------------ATTA-HG.LLGWFYTAFPFCIFV.FILNY......LFRNPLKCV-----------------------
D4BTR9_PRORE/1-203-------------ATTA-HD.LIGWLYTGLPLCLLI.TIFVQ......KSVFYLHYA-----------------------
B2Q274_PROST/1-203-------------AAQA-HH.VVGWFYTGLPICLII.YVVTY......WLRVPLSKV-----------------------
Q2LV15_SYNAS/6-198-------------ANRM-HY............................ENIDGFILE-----------------------
Q2Y883_NITMU/6-188-------------ADRM-HY............................QRTGDMIKA-----------------------
A7K2D4_VIBSE/6-189-------------ADKM-HY............................NHVGKLIDA-----------------------
A4C3L5_9GAMM/6-186-------------ADLM-HY............................EKTGDVIKA-----------------------
C9YFH3_9BURK/6-183-------------ADQM-HY............................KNTATLLRS-----------------------
Q12DA4_POLSJ/6-186-------------ADAM-HY............................TRNASLLRV-----------------------
C4XMP3_DESMR/34-221-------------ADRM-HW............................KNVSERIGA-----------------------
E6VSV5_DESAO/6-180-------------AHRL-HG............................ANGEDTFAL-----------------------
Q2LQI8_SYNAS/6-189-------------AQRL-HG............................YNASRAFNP-----------------------
B8FCF0_DESAA/6-187-------------YALE-NT.............EEFDLLAHFLHGKDGENTFAPLTG-----------------------
B3E8I7_GEOLS/6-161-------------AQRF-HE............................PAGSSYAPL-----------------------
A1AT46_PELPD/6-164-------------ADRF-HD............................ATGNSYAPL-----------------------
C6Y3Y4_PEDHD/24-233-------------IDSI-PRKWEEAVKRYGLVRLNQNGILPW.......QIQKSYYK-----------------------
E6U8V9_ETHHY/5-158-------------KYNV-HP...................HFS......DVSMDFVLG-----------------------
Q1IVJ5_KORVE/32-215-------------SDLT-HY............................VRAGDFVAS-----------------------
C1F375_ACIC5/44-227-------------SDLT-HY............................VRTGAFVTA-----------------------
Q01WM2_SOLUE/25-208-------------SDLT-HY............................VRSGDFILN-----------------------
Q1ISY5_KORVE/28-210-------------SDLV-HY............................VRSGDFVVN-----------------------
Q025L8_SOLUE/39-222-------------SDLV-HY............................VRTGEFVEN-----------------------
Y1571_ARCFU/28-204-------------GTKF-HG............................YYVNDALNI-----------------------
Q01YQ6_SOLUE/23-198-------------GEAI-HGATGDWETDA...................GSLVYLFER-----------------------
Q8XI18_CLOPE/5-158-------------KYKL-KK...................HYL......DESFDMIVN-----------------------
B0AAC8_9FIRM/5-160-------------KYVL-HK...................HYL......KESFDMIIG-----------------------
B6FWP7_9FIRM/5-161-------------KYKL-KK...................HYM......EESFNMIIE-----------------------
C9YL06_CLODR/5-159-------------KYKL-KK...................HYL......DESFNMIVS-----------------------
D3MTQ6_9FIRM/3-156-------------KYKL-KK...................HYL......DESYTMIKT-----------------------
C1I9N1_9CLOT/4-161-------------KYKF-KK...................HYI......DESFGMIVK-----------------------
B2UYY5_CLOBA/4-161-------------KYKM-IK...................HYF......IESIDMIIK-----------------------
C4IEN4_CLOBU/4-161-------------KYKV-KK...................HYY......DESIDMIID-----------------------
A6LQ77_CLOB8/4-161-------------KYKF-KK...................HYF......NESINMIIE-----------------------
B1BXM8_CLOPF/5-161-------------KYRL-KK...................HGR......KQFEEIIDE-----------------------
Q97KV3_CLOAB/5-155-------------KEIK-CS...................HTL......NESLDSLIE-----------------------
B0P7T6_9FIRM/16-171-------------SLLK-LS...................HFK......KDIYDLVME-----------------------
C0ECW5_9CLOT/5-161-------------KYKK-IP...................HYK......PYMYDIIKQ-----------------------
A8MHU0_ALKOO/5-164-------------SLAK-LD...................HFK......PQSFDFVCN-----------------------
A6TNX7_ALKMQ/5-165-------------RLAK-MQ...................HFK......PQSFNYICE-----------------------
B2A897_NATTJ/5-148-------------EHKI-KK...................HEY......LHLKKWFLN-----------------------
B0MJ55_9FIRM/5-161-------------SFLT-TP...................HTF......DITYDKIEN-----------------------
B0NZS3_9CLOT/15-171-------------SFVT-TP...................HKF......DITFDDIER-----------------------
A5ZUN3_9FIRM/20-175-------------SFVT-KR...................HEY......FGTFDEVQG-----------------------
C6J9X9_9FIRM/5-161-------------SFIT-RR...................HEF......YGTFEDVKN-----------------------
C6LKS6_9FIRM/5-161-------------SFLT-ER...................HEF......YGTFDKVSD-----------------------
D4KRQ8_9FIRM/5-161-------------SFIY-KR...................HEI......NGTFPYVKK-----------------------
D9SRM2_CLOC7/5-162-------------GKFD-TT...................HYK......EEAKDYVYK-----------------------
A6LQR0_CLOB8/5-160-------------KYRM-TM...................HSK......NEDWEKVIG-----------------------
B0S165_FINM2/8-177-------------KYKL-IR...................HYK......EESINYIVK-----------------------
D1VUW6_9FIRM/8-182-------------YYKL-IR...................HYQ......KESINFISK-----------------------
B1QT08_CLOBU/5-155-------------LAYT-NP...................HFY......KKSDKYVEE-----------------------
C4Z638_EUBE2/40-187-------------HTYI-KG...................HTW......DSSYNKVSR-----------------------
A7VFQ0_9CLOT/5-152-------------HTYI-KK...................HTW......KSSFDNTVN-----------------------
C0EWT7_9FIRM/5-150-------------YTYL-EG...................HTW......EATFEQITK-----------------------
A8SNU3_9FIRM/5-162-------------EEKL-RG...................HNY......ENVMKYMEK-----------------------
D4LBU1_RUMC1/5-160-------------HRFL-HG...................HNA......ENAGKHLAR-----------------------
Q315K4_DESDG/47-177-------------PGHS-HN............................WETAHTLLR-----------------------
B8DLU9_DESVM/18-149-------------PGHS-HN............................WSTGHTLYE-----------------------
C7LVT1_DESBD/24-155-------------PTHS-HN............................WDTGRSLLR-----------------------
C6BUV8_DESAD/29-160-------------RLHS-HN............................WQTGFNLLN-----------------------
C8X0X8_DESRD/29-159-------------DTHC-HN............................WRTGFRLLE-----------------------
A5G5N0_GEOUR/25-157-------------LLHC-HR............................WRIGLKILE-----------------------
Q39S84_GEOMG/25-157-------------LQHC-HR............................WRIGMKVLE-----------------------
E8WRC5_GEOS8/30-162-------------LQHC-HR............................WRIGHRVLD-----------------------
A1AK53_PELPD/24-156-------------LLNC-HR............................WSVGNKVLL-----------------------
B3EBK7_GEOLS/25-157-------------LLNC-HR............................WRVGARLLQ-----------------------
Q3A306_PELCD/29-161-------------LQHC-HS............................WRIGCRILD-----------------------
Q1K0Z2_DESAC/27-159-------------LKHC-HS............................WNMGFKVLD-----------------------
C1A8N1_GEMAT/19-151-------------GRHC-HS............................WHVGLEIHD-----------------------
B8J577_ANAD2/33-165-------------LYHC-HN............................WRVGFNVFK-----------------------
D6SRA3_9DELT/26-149-------------QKNP-HD............................WETGFMLLQ-----------------------
B5YG53_THEYD/20-144-------------DKNP-HS............................WKTGLCLLN-----------------------
Q1H382_METFK/30-174-------------FSHS-HY............................WENAHQMLA-----------------------
C6X6W6_METSD/30-174-------------FRET-HQ............................WQHAYGLLS-----------------------
C6WXF1_METML/56-200-------------FNNT-HA............................WKSAHQLLA-----------------------
D5CMM4_SIDLE/28-177-------------FSTT-HQ............................WQRARKLLD-----------------------
B0SGT0_LEPBA/6-211-------------QPKR-TK.KAAFFGDL..........AHH......HKVAELILS-----------------------
Q72P57_LEPIC/6-211-------------SPHK-TK.KATRWGDM..........SHH......NSVAELVLS-----------------------
C8W7P0_ATOPD/6-209-------------SYPG-SLPIPSYRRYQRNFMGGLSPAEYLLQHDFIQPNVTYCSV-----------------------
C5DV22_ZYGRC/30-228-------------SCKP-SK.QWHDFAES..........THW.........PQFLVN-----------------------
B5VL45_YEAS6/30-234-------------SCAP-SNKDWSDFAEF..........THW.........PNFLMI-----------------------
C5DKM1_LACTC/24-220-------------SCNS-R.KDWHEFAEY..........THW.........PAFLVQ-----------------------
Q6FL70_CANGA/25-242-------------SCSL-NNKKWHDFAEY..........THW.........SPFLEL-----------------------
Q6CEF9_YARLI/23-229-------------SEEA-EE...................AHW.........PPFLAA-----------------------
C4R8D0_PICPG/19-213-------------NCAG-TQ..LAELSED..........LHW.........PKLLGA-----------------------
Q8R432_MOUSE/28-220-------------PSIC-KRGKYHDVSER..........THW.........TPFLNA-----------------------
C3ZWC6_BRAFL/5-194-------------DSLC-KKGKFHSVSED..........THW.........SEFLNV-----------------------
A7SED1_NEMVE/31-226-------------SNLC-YGGKYHQVAED..........THW.........VPFLNA-----------------------
D3AZT7_POLPA/38-225-------------AAES-EA...................AHW.........PPFLRN-----------------------
PLDG_DICDI/29-216-------------ANES-EA...................AHW.........PPFLRA-----------------------
Q97TF6_CLOAB/60-232-------------SKTT-AL............................TKFEEHAAN-----------------------
A7B1H2_RUMGN/72-243-------------FYDP-DT.GKNWLGQKSP........TAR......TRAESYFQA-----------------------
PHLC_CLOHA/37-230-------------FWDP-DT.DNNFTKDSKWYLAYGINETGE......SQLRKLFAL-----------------------
PHLC_CLONO/38-231-------------FWDP-DT.DHNFSKDNLWYLSYSIKDTAE......SQVRKFTAL-----------------------
Q5PXE6_CLOPF/38-231-------------FWDP-DT.DNNFSKDNSWYLAYSIPDTGE......SQIRKFSAL-----------------------
Q8GCY3_9CLOT/38-231-------------FWDP-DT.DHNFTQDNKWYLSYAVPDNAE......SQTRKFATL-----------------------
PHLC_CLOSO/38-231-------------FFDP-DT.GNNFTLDNKWYVASPIYDTAE......TQVRKFATL-----------------------
Q6R6B7_LISSE/64-245-------------FYNP-KTHKTYIAGFP..........NAK......DTGTKYFNI-----------------------
Q6EAE3_LISMN/64-245-------------FYNP-DRDNTYLPGFA..........NAK......ITGAKYFNQ-----------------------
Q6R6D6_LISIV/62-243-------------FYNP-TKDNTYLPGFK..........NAK......QTCGKYFKQ-----------------------
A0R9W0_BACAH/51-232-------------FYDP-DNGKTYIPFAK..........QAK......ETGAKYFKL-----------------------
A5D2J5_PELTS/29-178-------------YYDP-QT.GTGIKPWP..........DAR......LECKAFFKM-----------------------
Q896L3_CLOTE/34-205-------------FFHF-SK.GKGLYGFS..........NAL......LECKKYYDK-----------------------
A5N896_CLOK5/34-205-------------FYHV-NR.EKGLYGFS..........DAL......TECRKYYSQ-----------------------
Q97KA0_CLOAB/34-205-------------FFDF-EK.GRGLYGFS..........NLV......DEAQKYYNM-----------------------
A6TKQ8_ALKMQ/57-228-------------FYNP-YK.KKGLYGRR..........SAM......ELGVDYYFQ-----------------------
O26214_METTH/27-173-------------HVYP-YN............................LEKANFWLN-----------------------
B8I5G2_CLOCE/32-236-------------NYIY-LTKIADLLGNGKAVAKGTVSQSYG......MYANDYTNL-----------------------
B5HQN8_9ACTO/67-292-------------GTVT-HS.FPGVFTIDVLVAWALVGLWL.......LLREPLVAL-----------------------
Q82A31_STRAW/92-336-------------GDFT-HS.FTGVLTFDVLVAWALAGAWL.......VLREPLVAL-----------------------
C9YWP6_STRSW/1-225-------------GDVT-HS.FAGVFTVDVLVTWALVGLWL.......VLREPLVAL-----------------------
B4V801_9ACTO/61-287-------------GEFT-HS.PTGVVTADAALTAALAACWL.......LLREPLVAL-----------------------
C7QBS6_CATAD/1-214-------------GDLA-HT.WAAVPTLDLGIAFVLAGVWHR......VLRAPLVGL-----------------------
D3D9A1_9ACTO/1-206-------------YQLT-HS.LLGIVTVVPALTIVVLLVWCH......LVRDALVDL-----------------------
A8L7F5_FRASN/1-204-------------YHLS-HS.LLGVVTFVPLLSLVALGIWFC......LARDALLDL-----------------------
Q0RF10_FRAAA/1-204-------------YRLT-HS.LLGVVTVAPVLSLVALGVWFH......LTRDALVDL-----------------------
D2ARI2_STRRD/1-214-------------YMTW-HS.YRGVLTIAPLAVVMLLAVFHG......LLRDPLTAL-----------------------
D2Q1R3_KRIFD/1-218-------------LTLT-HQ.FTSALWLNPLLALLALVVFHW......VLKRPLVAL-----------------------
C7R2G7_JONDD/1-213-------------ATTT-HN.WPGALIITIPLAFFLYAFIVA......CARPALWVL-----------------------
Q7UP84_RHOBA/1-217-------------YESF-HS.IRGLFIDCVPVGVAAYFVYHL......LIKQPVVEL-----------------------
A7C3K4_9GAMM/1-217-------------CQFG-HT.LLGIFLFDIPAGLVILWIFHR......ILKQPLFSL-----------------------
B9XK96_9BACT/41-256-------------VTLG-HS.VPGVFWFCVPVGLIFFILLQH......LLKKPLFLL-----------------------
Q1IN38_KORVE/1-215-------------SRSW-HH.YPDLYRYCFPFLFAAFLLFQV......AIKKPVAGL-----------------------
D9T3L8_MICAI/1-213-------------NLRT-HT.LGGLLWWCLPVALVYAWVVRR......VIAGIAVHL-----------------------
C1ACE2_GEMAT/1-206-------------WLFS-HT.LSAQIWFTVPLTMALVWLLTT......RLLPALVPY-----------------------
Q6FEH5_ACIAD/1-206-------------LTIS-HE.WSGMIVPNLLVGLLFCAVWYV......LYRPFIYRW-----------------------
C0VQ51_9GAMM/1-206-------------IALT-HQ.WAGVLFPNLPIGLFFCLLWYL......LYRPVLYRL-----------------------
D0SL80_ACIJU/1-206-------------LPIA-HQ.WSGVIFPNLPIGLFFCLLWYL......IYRPVMYRV-----------------------
D0SG75_ACIJO/1-206-------------SNTT-HY.WTSLIHPDLWIGLSFCVLWYA......LLRPCFYRF-----------------------
D0SS47_ACILW/1-206-------------SNIT-HL.WSSLIHPDLWIGLAFCAVWYL......IYRPVIYRF-----------------------

PF04307

Q2VZJ9_MAGSA/3-159.........GHR.GL.T-HS----------------------------LLAVMGGLA.......................
A6LWG2_CLOB8/3-169..........HR.KL.F-HA----------------------------PLVYLFLYS.......................
A3CRK4_METMJ/3-159..........GR.IY.F-HG----------------------------LTVLFLVVV.......................
Q1MS87_LAWIP/3-199..........HR.GI.T-HS----------------------------LAGAWGLAF.......................
Q0W649_UNCMA/3-154..........HR.TWIT-HS----------------------------LTTVFIATG.......................
Q5X0H9_LEGPL/3-176..........HR.YL.T-HS----------------------------LMFIPIGGL.......................
Q2NZA4_XANOM/4-177..........HR.GA.S-HL----------------------------LLFAALMAL.......................
Q8PZ85_METMA/4-181..........SIGSIPT-HS----------------------------LLFSFTAIL.......................
A4YHA8_METS5/3-210..........HR.AL.F-HN----------------------------VFIGLAVMY.......................
A4W9L4_ENT38/3-166.........GHR.GF.T-HS----------------------------LLAVFILLT.......................
Q468G0_METBF/3-172..........GR.II.C-HT----------------------------LLSVLSLFL.......................
Q6AMI9_DESPS/4-207..........HR.GI.L-HS----------------------------IPFCLLMGE.......................
Q1ILA3_KORVE/3-163..........HQ....L-HT----------------------------LLFAIIVTL.......................
Q8TVQ4_METKA/3-158..........HR.GI.L-HC----------------------------PWPWGALAY.......................
A8GDN5_SERP5/3-166.........GHR.GF.T-HS----------------------------LLAIAGGMA.......................
A0YYL1_LYNSP/4-178..........HR.GL.T-HT----------------------------LIFAVGLSL.......................
A0YXX1_LYNSP/4-183..........HR.QA.T-HS----------------------------LIVAIIVGV.......................
Q1VZ04_9FLAO/3-179..........HR.GF.S-HS----------------------------IVFSVLMAP.......................
Q0JZE4_CUPNH/3-185..........HQ.GP.T-HS----------------------------LLLLPAWGA.......................
Q2S300_SALRD/3-182..........HR.SV.T-HS----------------------------LVFIALVSA.......................
A5CZD2_PELTS/18-203.........GHRESP.T-HT----------------------------LFFAALAGL.......................
A3CVA2_METMJ/3-183..........GR.IF.G-HG----------------------------LLFLALLAV.......................
Q0BSQ9_GRABC/15-169.........GHR.GV.T-HS----------------------------LLAIIACGW.......................
A2BN14_HYPBU/3-145..........HR.MA.L-HN----------------------------VNVFLVLAL.......................
Q0S8N5_RHOSR/4-250GKRDGKRRGGHR.TL.T-HT----------------------------ALFAAGIGA...........GVSALVVQFGKP
Q1IHJ9_KORVE/3-205..........HR.GF.T-HT----------------------------FLGVPFVAA.......................
A1U6Q1_MARAV/3-174..........HR.GF.S-HS----------------------------LFILAPLSL.......................
A4J2S7_DESRM/3-150.........GHR.GA.L-HS----------------------------LAATLALGL.......................
Q28PX8_JANSC/2-152..........HR.YW.V-HA----------------------------PAFAACVGG.......................
Q18EP1_HALWD/19-174..........GR.VF.M-HS----------------------------LPFAIPIVL.......................
Q0VLL6_ALCBS/3-174..........HR.GF.S-HS----------------------------LLVLLPVSF.......................
Q726Y1_DESVH/3-173..........HR.GI.T-HS----------------------------FAGGALLAL.......................
Q2NEC5_METST/4-226LVAGIFYVSKHR.GF.T-HT----------------------------LLGVSVLSFLFTLIVMGFIPFINKLLIVSNIA
YFHP_BACSU/3-182..........HR.GF.T-HS----------------------------IPAVLFWSV.......................
Q8TQH1_METAC/4-199..........HR.EF.T-HS----------------------------ILFIALVTL.......................
A0KFP7_AERHH/3-165.........GHR.GF.T-HS----------------------------LLAVAAAIW.......................
Q47U11_THEFY/3-250RTPADRSDGEHR.HL.G-HT----------------------------PVFAAAVGA.......VIGLLCHLSWWATLVT
Q1C5S1_YERPA/4-178..........HR.GF.T-HS----------------------------LLFAFALPT.......................
Q465I7_METBF/4-223..........HR.EL.T-HS----------------------------IFFAFLVAL.......................
Q1QZR4_CHRSD/3-181..........HR.GF.S-HS----------------------------LLVLAALAL.......................
A6TMK4_ALKMQ/3-249VILMILLLVKHR.SF.S-HS----------------------------ILFLIGCTL.......................
Q82XH5_NITEU/3-183..........HQ.GP.T-HS----------------------------LVMLPFWAF.......................
Q6YRT9_SYNY3/3-188..........HR.SA.T-HS----------------------------LLASFTLAL.......................
A6LXK9_CLOB8/3-172..........SR.IF.G-HT----------------------------LIFSLVLIL.......................
Q8D1W8_WIGBR/3-169..........HR.GF.T-HS----------------------------LLSLFLLYV.......................
Q18KS6_HALWD/3-171..........HR.KT.L-HN----------------------------LPVLLLFIL.......................
Q8R899_THETN/3-179TYIGLAFIGPHR.GF.T-HS----------------------------LAGFLFFTF.......................
A0Z1N5_9GAMM/41-214..........HR.QF.T-HS----------------------------LIFIPIGSL.......................
Q9V2B4_PYRAB/7-175..........HR.SY.L-HS----------------------------LLFLAPLVL.......................
Q18EE2_HALWD/4-162.............SWES-FT----------------------------TGGGVLLST.......................
Q12UG8_METBU/3-174..........GR.IF.A-HT----------------------------FLFVLVLFA.......................
Q3IS66_NATPD/3-169..........HR.KT.L-HY----------------------------PVYYSVLAA.......................
Q465I8_METBF/4-199..........HR.EF.M-HS----------------------------ILFIVLITC.......................
B4SJC5_STRM5/4-190..........HR.GA.S-HS----------------------------LLFACVLAT.......................
A0PYB1_CLONN/3-199IAFIFIAVSSHRNGL.T-HS----------------------------LIGLISFTI.......................
Q3A0M8_PELCD/4-203..........HR.GI.M-HS----------------------------VPFVALWAL.......................
Q465I4_METBF/4-199..........HR.EF.L-HS----------------------------ILFILLVTL.......................
Q46FT6_METBF/4-180..........WAGPIPT-HS----------------------------LLFSLLAVL.......................
O26450_METTH/3-144..........HR.GI.G-HT----------------------------LLILPPLLL.......................
Q1AT01_RUBXD/3-176..........HR.TL.T-HS----------------------------LLGLALFCA.......................
Q75TF0_GEOKU/3-155..........HR.GM.T-HS----------------------------LIVWGVLAA.......................
Q1NK63_9DELT/3-180..........HR.GV.T-HS----------------------------LIMLPLWAI.......................
Q1C702_YERPA/3-166.........GHR.GF.T-HS----------------------------LLAVIAGIA.......................
Q2RM17_MOOTA/3-158..........GR.IY.A-HT----------------------------LVFLLFAWA.......................
Q5YVJ3_NOCFA/3-233.........GHR.QG.T-HS----------------------------LLFVVAAAY.........GTWAGMHWIGRPFT
Q8CV62_OCEIH/3-182..........HR.GA.S-HS----------------------------LPAIVIWSF.......................
A0NTQ3_9RHOB/3-182..........HR.GW.T-HS----------------------------VFVHAFAAP.......................
Q2NV14_SODGM/3-168.........GHR.GI.T-HS----------------------------FLAIVGCSI.......................
Q2N9Y9_ERYLH/15-204..........RR.GI.T-HG----------------------------PPALVLLPL.......................
A1K1W5_AZOSB/3-183..........HR.GV.T-HS----------------------------VLLLPLWGA.......................
C1DQI7_AZOVD/3-180..........HR.GF.S-HS----------------------------LFVLTGFSL.......................
Q5FK20_LACAC/3-175.........RHR.GI.T-HS----------------------------LLGWIIFST.......................
Q0ACJ1_ALHEH/3-184..........HR.GV.T-HS----------------------------LLLLPLWAA.......................
Q8FRV6_COREF/4-249GRKDKPCKNGHR.TA.T-HT----------------------------IWAALAAGV...........GATALIGAFGKT
Q1V9R5_VIBAL/3-178..........HR.QF.T-HS----------------------------LLFIPFGSF.......................
Q97K38_CLOAB/3-212GCIIFSKFTKHR.SF.S-HS----------------------------ILGLILFTV.......................
Q5V827_HALMA/3-151..........HR.GL.T-HT----------------------------VWFALVVGF.......................
YVSG_BACSU/3-155.........GHR.TF.T-HS----------------------------LLFMLIMFF.......................
A1WTH1_HALHL/3-183..........HR.GE.T-HS----------------------------LLLLPFWAL.......................
Q8PSE7_METMA/3-176..........GR.IV.G-HT----------------------------LLFSLLLFL.......................
O29835_ARCFU/7-140..........HR.EY.T-HN----------------------------FTFAAISTL.......................
Q02F56_PSEAB/4-178..........HR.GF.S-HS----------------------------LLFAAILGA.......................
Q2RLP5_MOOTA/5-179VAFVALAFLPHR.GI.T-HS----------------------------ALGLVLAWL.......................
Q46DH2_METBF/3-171..........GR.IF.A-HT----------------------------LLFGLLLVL.......................
Q9EZ84_CAMJU/3-164..........HR.GE.T-HF----------------------------LIIPLSIII.......................
Q3YN07_BACTK/3-163.........GHR.GI.T-HS----------------------------LFGLVLVLI.......................
Q3JF51_NITOC/3-164..........HR.TI.T-HS----------------------------FLALMVLAV.......................
Q1MQD9_LAWIP/3-155..........HR.QT.S-HW----------------------------MGWYLLLMI.......................
Q0AJ35_NITEC/3-176..........HR.QF.S-HS----------------------------LFFTPVGAL.......................
Q97LP7_CLOAB/3-199ALLFLIAISSHRNGL.M-HS----------------------------AAGMIVCTV.......................
A8L052_FRASN/2-224.........GHR.HA.T-HS----------------------------LLFAVAMGA..........VMGLLATHFQYGW
A9AVQ5_HERA2/4-166..........HR.GF.T-HS----------------------------VGFATIIAS.......................
Q67R78_SYMTH/3-176..........HR.TY.T-HT----------------------------LVGAAALSA.......................
Q9YAY7_AERPE/3-148..........HR.KY.T-HN----------------------------LAASIVAGL.......................
Q1ZS65_PHOAS/3-176..........HR.GF.S-HS----------------------------LFVLLPFSL.......................
A4XRV7_PSEMY/3-180..........HR.GF.S-HS----------------------------LFVLSGLAL.......................
A4J2S9_DESRM/3-180.........GHRNSP.T-HT----------------------------LLFCLTVGL.......................
Q18HI1_HALWD/3-156..........HR.GV.T-HT----------------------------ISFAVLTGC.......................
A0R9F7_BACAH/3-182..........HR.GI.T-HS----------------------------IPAVILWSF.......................
Q65F12_BACLD/3-155.........GHR.TF.T-HS----------------------------LLFLLITAF.......................
A0KMD3_AERHH/4-197..........HR.GV.T-HS----------------------------LLFAFALPT.......................
Q18BE8_CLOD6/3-241LMLSIFPWLKHR.SF.S-HS----------------------------IFATIIVYF.......................
Q648F5_9ARCH/3-180..........GR.LF.A-HT----------------------------LLFVVILLL.......................
Q5FTT4_GLUOX/55-213..........HR.GL.T-HS----------------------------GVMLLLAAA.......................
A1HQY3_9FIRM/3-173..........HR.AM.S-HS----------------------------VPGVTVWSA.......................
Q3JEV9_NITOC/3-176..........HR.QF.T-HS----------------------------LLFVPIGGL.......................
Q1DD75_MYXXD/3-235..........RR.GW.T-HG----------------------------VLALALWPF.......................
A0JUC0_ARTS2/3-250.........GHR.QG.T-HS----------------------------VLGAAFFVL......LATIAGQLQLHTDWGLL
A3CTE7_METMJ/3-243..........HR.GL.L-HS----------------------------FPGVGLTTL.......................
Q186I4_CLOD6/3-177..........HR.GF.T-HS----------------------------LIALLLIYS.......................
A0R7P4_PELPD/13-154..........HR.TV.T-HW----------------------------PYPYLVMAA.......................
Q47RB2_THEFY/3-227.........GHR.NG.T-HS----------------------------LLFALLLGG..........FAQLLVLWSELAA
A6TSU9_ALKMQ/3-172..........HR.VE.S-HS----------------------------IPGILFSTL.......................
Q5HM58_STAEQ/3-158.........GHR.TF.T-HS----------------------------LLFIIGISF.......................
Q2JB37_FRASC/3-225.........GHR.HA.T-HS----------------------------ILFALGMGV..........VMGLLAARFEYGW
Q5V391_HALMA/4-161..........GR.VF.M-HS----------------------------LPFAIPLSI.......................
Q7NV83_CHRVO/3-166.........GHR.GI.T-HS----------------------------LLAVVGVFY.......................
O27320_METTH/4-218DLAMIFYLSRHR.GF.T-HS----------------------------LIGAFILSA......CLTVFVLASFFLLRSLG
B1J8M8_PSEPW/3-184..........HR.GF.S-HS----------------------------IFVLTGLAL.......................
Q5V568_HALMA/2-273..........HR.GP.T-HS----------------------------LLLGAALAA................AAGLWAS
Q2L2L1_BORA1/3-180..........HR.GF.S-HS----------------------------IFVLTAFAL.......................
Q0W4H6_UNCMA/3-165..........GR.IF.S-HT----------------------------LLFIAVLAI.......................
Q4L847_STAHJ/3-158.........GHR.TF.T-HS----------------------------LLFIGIIVF.......................
Q97MS7_CLOAB/3-166..........SR.IF.G-HT----------------------------LLFSAVLLC.......................
B4SK06_STRM5/3-184..........HR.SF.S-HS----------------------------LLVLPWVAA.......................
Q0SU56_CLOPS/3-177..........HR.GF.T-HS----------------------------LLCLSLTIL.......................
Q9KE25_BACHD/3-180..........HR.GL.T-HS----------------------------LLISPLMAA.......................
Q15HU4_CLOPF/3-157.........KHR.GF.L-HS----------------------------ITPVILIFT.......................
A0YBX0_9GAMM/3-178..........HR.QF.T-HS----------------------------LIFIPFGGL.......................
Q023X2_SOLUE/3-190..........HR.HI.T-HS----------------------------IAAMPVMAL.......................
Q8PXV1_METMA/3-172..........GR.IF.A-HT----------------------------LIFAILLGL.......................
O29079_ARCFU/4-168..........HR.GW.T-HS----------------------------LVGAGIFSF.......................
Q5P1U0_AROAE/3-192..........HR.GV.T-HS----------------------------LLLFPLWGM.......................
Q99S94_STAAM/3-158.........GHR.TF.T-HS----------------------------ILFIAIIAF.......................
A0XYC3_9GAMM/3-181..........HR.GF.S-HS----------------------------FFIHLLISP.......................
Q1GSW3_SPHAL/3-193..........RR.GI.T-HG----------------------------PIAMLALPI.......................
Q46G46_METBF/3-177..........GR.MI.S-HT----------------------------LLFSITLFL.......................
A0LXF8_GRAFK/3-182..........HR.GF.S-HS----------------------------IIFAIIFAP.......................
Q043R0_LACGA/3-174.........RHR.GI.T-HS----------------------------FLGWAFFSG.......................
Q8TP13_METAC/3-172..........GR.II.G-HT----------------------------LLFSLLLFM.......................
Q6D4I1_ERWCT/3-166.........GHR.GF.T-HS----------------------------LLAIVAGIF.......................
Q890Y4_CLOTE/3-199ILFMFIAISTHRNGL.T-HS----------------------------LTGMIIFSV.......................
A1TRR8_ACIAC/3-179..........HR.AD.T-HA----------------------------LLYLSLLAP.......................
Q3J7C8_NITOC/3-183..........HR.GI.T-HS----------------------------VVMLPIWGA.......................
Q1Z117_PHOPR/3-176..........HR.GF.S-HS----------------------------LFILLPFSW.......................
Q08ZS3_STIAD/3-149..........HH.VL.F-HG----------------------------YVGALITVA.......................
Q0RHF1_FRAAA/6-228.........GHR.HA.T-HS----------------------------LVFALAMGV..........AMSLLADHSRYGW
Q0W2I6_UNCMA/3-181..........HG.GI.T-HS----------------------------IAGAVATSV.......................
Q7MS32_WOLSU/3-175.........GHR.GA.T-HS----------------------------FLFPFGVAL.......................
Q1ATT6_RUBXD/3-170..........HR.SF.L-HS----------------------------LLALLLVTA.......................
Q9KAZ8_BACHD/3-159.........GHR.AF.T-HS----------------------------LLFLLGIYW.......................
A8LV16_SALAI/3-256LSRDPRRSNGHR.TL.T-HT----------------------------IPFTVLVGW...........GTTTLCAAYGKW
Q8PUB3_METMA/4-199..........HR.EF.M-HS----------------------------ILFIFLVTL.......................
Y790_METJA/3-224LIYLIPYFSDHR.GL.T-HT----------------------------FWSLLFVSSILGYLAYKLSFISSVFAGLISLL
Q01PN8_SOLUE/4-175..........HR.GF.F-HS----------------------------PFFLALLAG.......................
Q9CNK9_PASMU/3-180..........HR.GF.S-HS----------------------------LFVLTALAF.......................
Q2B443_9BACI/45-224..........HR.GI.T-HS----------------------------VFLTPLWAL.......................
A0AJE4_LISW6/3-182..........HR.GI.T-HS----------------------------LPMLAIWPL.......................
Q9KEC4_BACHD/3-182..........HR.GL.T-HS----------------------------LPALFIWPF.......................
Q8E899_SHEON/3-158..........HR.GV.T-HI----------------------------LTHWLIAAL.......................
Q99T10_STAAM/3-179..........HR.GI.T-HS----------------------------IPFTILWPI.......................
Q3ITN2_NATPD/3-143..........HR.KT.L-HN----------------------------LPILGLFVA.......................
Q11P46_CYTH3/3-219..........HH.GF.F-HS----------------------------LLAAALLAA.......................
Q1D144_MYXXD/3-188..........HR.GL.S-HA----------------------------LVAAPLVAL.......................
Q50EB0_STRFL/3-259SAGDPRRTGGHR.TL.T-HT----------------------------WLWAVLIGG...........GCSVAAITGGRW
Q7VVQ6_BORPE/3-180..........HR.GF.S-HS----------------------------ILVLTALAA.......................
Q7N3N6_PHOLL/3-166.........GHR.GF.T-HS----------------------------LLALILGIT.......................
Q7NWB9_CHRVO/4-187..........HR.GF.S-HS----------------------------LAAAALLAG.......................
Q8ETE4_OCEIH/3-155.........GHR.TI.T-HS----------------------------LIFLVLIGY.......................
A6UAV6_SINMW/2-157..........HH.DYWT-HA----------------------------PLFWLAAAA.......................
Q49ZB6_STAS1/3-158.........GHR.TF.T-HS----------------------------LLFIAIIVC.......................
Q5L2T9_GEOKA/3-182..........HR.GI.T-HS----------------------------IPAVVLWPL.......................
Q8PUB1_METMA/4-234..........HR.EL.T-HS----------------------------VFFAVILAV.......................
Q5WIF9_BACSK/3-182..........HR.GM.T-HS----------------------------IPALLLWPF.......................
Q2B352_9BACI/31-210..........HR.GI.T-HS----------------------------IPAVILWPL.......................
Q4J9X0_SULAC/3-213..........HR.AL.F-HN----------------------------IFFIIALFL.......................
A4G067_METM5/3-224LIYVIPYYAEHR.GI.T-HT----------------------------FFSLGIMSVILGYLTFKLSIISPIMASLIALI
Q5WH30_BACSK/3-157.........GHR.TF.T-HS----------------------------LLFLLLASI.......................
Q5I399_VIBCL/3-158..........HR.GT.T-HI----------------------------FTHWLIVAL.......................
Q04RA4_LEPBJ/4-178..........HR.GF.S-HS----------------------------ILFSFSLSV.......................
Q1WSF6_LACS1/3-169.........GHR.GI.T-HS----------------------------LLGFILIGI.......................

PF09988

A0YPQ2_LYNSP/2-202----------HR-SFLS-HG----------------------------PVIGTAVRL-----------------------
Q631C1_BACCZ/2-157----------HR-SFFT-HT----------------------------IILGDVIRI-----------------------
B8GCX6_CHLAD/2-185----------HR-GFWS-HS----------------------------LVISPLLRL-----------------------
A4CX56_SYNPV/2-164----------HR-SLFS-HG----------------------------PLIGTGLRL-----------------------
A3IY70_9CHRO/2-174----------HR-SFFS-HG----------------------------FILGTAIRV-----------------------
A5GPK9_SYNPW/2-164----------HR-SLFS-HG----------------------------PLIGTGLRL-----------------------
Q2JX69_SYNJA/2-169----------HR-SFWS-HG----------------------------PIVGTALRV-----------------------
Q3AVT6_SYNS9/2-162----------HR-SLLS-HG----------------------------PLIGTSLRL-----------------------
Q7U3L4_SYNPX/2-158----------HR-SLWS-HG----------------------------PLIGTALRL-----------------------
Q4C9Z4_CROWT/4-176----------HR-SFFS-HG----------------------------LIVGTVIRI-----------------------
Q3M912_ANAVT/2-183----------HR-SFLS-HG----------------------------PLIGTTLRV-----------------------
Q5MZ52_SYNP6/2-175----------HR-SWFS-HG----------------------------PLLGTIGRV-----------------------
A9B0N7_HERA2/2-181----------HR-AGIS-HS----------------------------LVFGPLFRL-----------------------
Q7NFX0_GLOVI/2-169----------HR-SLFS-HG----------------------------PLVGTLGRL-----------------------
Q1IZ50_DEIGD/5-169----------HR-G.LS-HT----------------------------WLVGPLTRL-----------------------
Q05V62_9SYNE/2-168----------HR-SLFS-HG----------------------------PLIGMALRL-----------------------
A3YTK7_9SYNE/2-161----------HR-SLLS-HS----------------------------PLLGSAFRL-----------------------
A7GUZ7_BACCN/2-158----------HR-SFLT-HT----------------------------IIIGDLIRI-----------------------
P72876_SYNY3/2-167----------HR-SPLS-HG----------------------------FLIGTILRL-----------------------
Q0TR94_CLOP1/2-176----------HR-SVFT-HG----------------------------FILGPIIRI-----------------------
Q10Y23_TRIEI/2-182----------HR-SFLS-HG----------------------------PIIGTALRL-----------------------
B1YE70_EXIS2/2-150----------HR-SIWS-HG----------------------------LIIGDLIRL-----------------------
Q0I690_SYNS3/2-165----------HR-SVLS-HS----------------------------PVIGTAIRI-----------------------
A3Z3L1_9SYNE/2-165----------HR-SLIS-HS----------------------------PVLGSAGRL-----------------------
Q2JJ24_SYNJB/2-169----------HR-SFWS-HG----------------------------PIVGTAVRV-----------------------
A5UV55_ROSS1/2-182----------HR-HFWS-HS----------------------------LVLAPLLRL-----------------------
Q72GM7_THET2/2-158----------HR-G.LS-HT----------------------------WLLGPLTRL-----------------------
Q9RT76_DEIRA/5-176----------HR-G.LS-HT----------------------------WIVGPLTRL-----------------------

PF02265

ENDO2_ARATH/28-290-------------YINT.PDAC........SYQ..YNRDCKD.ES.GEKGRC.VAGA-----------------------
ENDO5_ARATH/21-288-------------YVNT.PEYRC.......NYE..YCRDCHD.TH.KHKDWC.VTGA-----------------------
A4H6V5_LEIBR/29-297-------------FVDH.VY...............NPQNI.PLTI.NPVEIVNVASV-----------------------
Q8F3Z8_LEPIN/21-283-------------FIDI.PI...........SL..TNPTHDDIEK.ICKSTC.VVAE-----------------------
B0T6T3_CAUSK/23-287-------------FVDV.ELDHPDLA.GACFG...FPASATPASA.GPEKDC.IVGR-----------------------
F2G2Z7_ALTMD/28-265-------------YVTV.PE................GTTYNE.VS.APKQGD.AVTA-----------------------
B4STV7_STRM5/27-270-------------YVNI.AE...............DNCHYEAPKH.CKNGNC.IVEA-----------------------
Q66VY6_LEIMA/29-300-------------FITT.PY...............YPDSD.FTLEFSPVQTVNVASV-----------------------
Q25267_LEIDO/126-397-------------YITT.PY...............YTDED.FTLDVSPVQTVNVASV-----------------------
Q3BPV9_XANC5/74-316-------------YVNL.GE...............HDCTYSPPRD.CPDGNC.VIAA-----------------------
A4C4V1_9GAMM/28-270-------------YINI.NEA..........E..DFKPNRYRITA.TKGEVTDAYSA-----------------------
O68530_RHILI/22-306-------------FVDI.PLASLPGGSSATTD...YDAIRDCADD.ATYGSC.LLKA-----------------------
Q7S8Q5_NEUCR/20-297-------------FVNG.HDGPPPE..SCHLV...LPEDC.P......PEGC.VVSA-----------------------
Q5KPJ8_CRYNJ/20-279-------------YINA.RND..........H..PQDHCEFGQHG.WQNEDVNVITA-----------------------
Q236I4_TETTS/18-296-------------FYDK.PE...............NPQGLYVILD.QDNQVYNSITG-----------------------
Q4DEV4_TRYCC/28-293-------------YIDT.PY...............NPQNINIKK..NPVNTENLKTV-----------------------
A2WK84_ORYSI/28-274-------------YIDT.PDHLC......SYT...YDRDCKD.ED.SFRGES.QA..-----------------------
Q870T1_NEUCS/21-292-------------YIDA.KDSPPDS...CGII...YERDC.K......PEGC.VVSA-----------------------
A5A339_SOYBN/27-290-------------YANT.PEALC......SYK...NSRDCVDYKK.GIKGRC.VVAA-----------------------
Q86GJ3_LEIAM/31-295-------------FYAM.PY...............NPGNINIT...DPVNTVNAVTV-----------------------
Q1YUT9_9GAMM/19-260-------------YINI.KDH..........E..RFS......GL.RRSPKGDVLSA-----------------------
A6EB04_9SPHI/11-250-------------FVNL.PAGL........DKQGVFN......VL.DKVQEPNVYNK-----------------------
Q0CD39_ASPTN/21-282-------------YVDI.KDDPVHH..KCDIS..SL..DC.P......NGDC.IISA-----------------------
Q2SFD4_HAHCH/50-295-------------YVNV.ER...............AAKRVSTAEN.CESKGC.VLTA-----------------------
Q585P6_TRYB2/27-292-------------YTAN.MY...............IRDGFKPNV..TLKQKSDVVSV-----------------------
Q989R8_RHILO/21-270-------------FVDI.PLAD........SK...YDPVSQCAAN.VQ.GDC.AIAE-----------------------
Q25A98_ORYSA/30-295-------------FIDT.PDKAC......SFV...YSRDCHG.AD.GAEDMC.VAGA-----------------------
Q9NJI3_9TRYP/26-298-------------FITT.PY...............YPEGDTFRLSVSPVQAVNVASV-----------------------
Q26CQ1_FLABB/21-256-------------YVNI.PFD..........K..TYD......TH.PHSEKGDIIQA-----------------------
ENDO1_ARATH/29-294-------------YIDT.PDQAC......SYE...YSRDCHD.QH.GLKDMC.VDGA-----------------------
A4CQ68_ROBBH/22-257-------------YVNL.PPE..........T..PYG......EI.TPNPDGDILQG-----------------------
Q0KFV0_SOLLC/26-291-------------FIDT.PDKAC......NFD...YERDCHD.QH.GVKDMC.VAGA-----------------------
A3U8L7_CROAH/33-268-------------YVNV.PFD..........T..SYG......EA.EKNPKGDIIVA-----------------------
Q9ZR88_ZINEL/19-280-------------YIDT.PDNLC......TYQ...YRRDCKD.ED.GVMGRC.VAGA-----------------------
A7H7R9_ANADF/28-274-------------YVNI.PL................AAAFDPARD.CPREAC.VVAA-----------------------
Q9LL59_APIGR/23-288-------------FIDT.PDQAC......SFD...YQRDCHD.PH.GGKDMC.VAGA-----------------------
Q7P202_CHRVO/23-274-------------YNDE.PV..................CSGVTEDECPDGNC.AANQ-----------------------
A0BML4_PARTE/16-293-------------YTNR.PM...............NPDGLQIKIE.DQARNINSIYA-----------------------
NUP3_PENSQ/1-265-------------FIDA.EDNPPTN...CNVD...YERDC.G......SSGC.SISA-----------------------
A7EWS3_SCLS1/21-282-------------FIDA.EDNPPDS...CGVD...YERDC.G......SSGC.VVSA-----------------------
A5A338_SOYBN/33-298-------------FIDT.PDNAC......SFQ...YSRDCHD.PQ.GVEDMC.VAGA-----------------------
Q3IBZ8_PSEHT/27-268-------------YINT.SAN..........K..PISLN.HSHTK.NKESVTNILEG-----------------------
A7ETG5_SCLS1/21-277-------------FFNT.EINAAC.....GVK...FARDC.G......EEGC.VVGA-----------------------
A0M3W8_GRAFK/24-260-------------YVNIDPEN..........K..KYI......EE.EANKSGDLVQA-----------------------
A0BLJ0_PARTE/422-699-------------YTDR.PI...............NPDGLLIKIE.DESRNINSIYA-----------------------
A4HJL3_LEIBR/28-299-------------FITT.PY...............YPDPS.FTLDVSPVQTVNVASV-----------------------
Q0TYV6_PHANO/20-284-------------YIDA.LDNPPES...CNID...YARDC.P......EEGC.IISA-----------------------
Q051B2_LEPBL/26-289-------------FIDT.PIS..........Q...FNPTHEDIVK.ACKSSC.VLTE-----------------------
A4BZ60_9FLAO/25-260-------------YVNM.NLD..........E..TYA......TA.AKNTKGDLITG-----------------------
A6ESW6_9BACT/22-257-------------YVSF.PFE..........A..TYD......TH.PKSEKGDVITG-----------------------
ENDO3_ARATH/25-286-------------FADT.PDYKC......NYE...YSRDC.......PKDWC.VTGA-----------------------
Q0AMT2_MARMM/26-282-------------YINQ.TR...............DDPHVD.AED.CAEDGC.ITSA-----------------------
Q8NIH8_LENED/19-292-------------FVDA.EDQPPTE...CSVN...QKRDC.A......GNGC.ILTA-----------------------
Q4Q7F3_LEIMA/31-295-------------FFDK.PY...............NPEDINIT...DPVATVNAVTV-----------------------
A4I5I0_LEIIN/31-295-------------YFDA.PY...............NPENINIT...DAIATVNAVTV-----------------------
Q9ZR87_ZINEL/27-293-------------YVDT.PDFRC......NYD...YCRDCHD.SS.GVKDRC.VTGA-----------------------
Q5NRA3_ZYMMO/33-298-------------FVDI.EIDNPNLV.TACAA...ASNRSNPMKN.GGAQPC.VVSQ-----------------------
A5V871_SPHWW/21-280-------------YQNV.DV................CRPFEIKGN.CPDGNC.VSRQ-----------------------
A3XR21_LEEBM/28-263-------------YVNI.APG..........L..SYA......EA.DKNEYGDLVQG-----------------------
Q5FP59_GLUOX/25-298-------------YVDI.DV...............SHPAYDQARD.CPDHVC.VVEK-----------------------
A0XY62_9GAMM/27-268-------------YINA.SPN..........K..SFTIN.HDHTN.NKESVSNILEG-----------------------
Q0UA95_PHANO/19-289-------------WIDT.HDWAPDH...CSLD...YSQDC.A......KGGC.VVSA-----------------------
NUS1_ASPOR/21-284-------------FIDA.QDNPPQS...CGVD...YDRDC.G......SAGC.SISA-----------------------
Q9P356_LENED/21-305-------------FVDA.EDNPPTS...CSVE...QMRDC.S......SGTC.ILSA-----------------------
A6GGE9_9DELT/20-283-------------YVNL...D..........G..PTSPRELHAQC.LERAGC.LATA-----------------------
Q9NJY3_LEIPI/31-294-------------YYDK.VY...............NPENINIT...DPVNTVNALTA-----------------------
O81656_HEMSP/23-288-------------FIDT.PDDAC......SFD...YSRDCHD.PK.GAEDMC.VAGA-----------------------
A4HI96_LEIBR/31-295-------------YYAM.QY...............NPDGINIT...DSVEAVNAVSV-----------------------
Q7XPN4_ORYSJ/27-283-------------FADT.PGDCQ.......FN...YARDCHN.TN.GEKDMC.VVGA-----------------------
A6SS14_BOTFB/21-272-------------FIDA.LDDVPRS...CGVK...FARDC.G......EEGC.VVGA-----------------------
Q01U80_SOLUE/19-261-------------YVDI.PI...............NKPHLDMERD.CPKGDC.VIAK-----------------------
A2QX99_ASPNC/21-292-------------YINP.DDEPPKS...CFVS...YPHDC.P......PEGC.IISQ-----------------------
A2TWS6_9FLAO/25-260-------------YVNM.GLT..........E..TYE......ES.AKNPKGDLVTG-----------------------
Q2UHT0_ASPOR/21-283-------------YVDV.EDDPLNN..HCKIS..PLPRDC.E......TTGC.IISL-----------------------
Q2H4S7_CHAGB/217-488-------------FIDA.KDDPPRY...CGVD...FARDCKK......DRGC.VVSA-----------------------
Q15ZB2_PSEA6/20-256-------------YVTI.PKG..........Q..TYA......DV.GAPEQGDGVSA-----------------------
A5PCR0_9SPHN/28-287-------------YRTT.PV................CEAYEPRRN.CSGQNC.ILAQ-----------------------
Q1VUV1_9FLAO/20-255-------------YANI.PFD..........K..TYA......ET.EKNPEGDIVFG-----------------------
A2TPR0_9FLAO/22-257-------------YVNV.PFD..........S..SFE......QH.PRSEKGDIISG-----------------------
Q9ARD4_HORVU/24-280-------------FADT.PKDCK.......FS...YARDCHD.TK.GNKDAC.VVGA-----------------------
A0MSM3_SPIOL/24-289-------------FIDT.PDDSC......SFD...YKRDCHD.EH.GVEDMC.VAGA-----------------------

PF13803

B7IVR2_BACC2/1-238-------------------------------LPKPFA.---GYYTYAVDKGWGLHTWKDL.F....VFCY--------SA
A7FSP1_CLOB1/1-250-------------------------------GPKPID.---SWYYNTALKPWRINSLAQV.L....VFSY--------SA
B1RQR4_CLOPF/1-244-------------------------------LPRPLD.---NWYGYLRTEQFGLHSWKEV.I....VFIY--------SA
B9XK96_9BACT/41-287-------------------------------LPANHQ.---KRLVPWLNP.FPLRTAAQW.G....LVIV--------SL
D0T6V3_ACIRA/1-244-------------------------------LGIQKPL---NIHSPLQAL........IFLV....SCSI--------AI
A8L7F5_FRASN/1-234-------------------------------APDPVR.---.....LRLPPRARPTGHQW.L....LAPV--------AA
A7C3K4_9GAMM/1-251-------------------------------FPISHQQ---HLIPFVN..EFQFFPLRRF.L....LIII--------SL
B2Q274_PROST/1-240-------------------------------VPFQFP.---.........QNWRWSAKNG.A....ILIF--------SF
D2Q1R3_KRIFD/1-252-------------------------------APPSLA.---GRLKPSGRRPTANYL.....L....WAAI--------SL
Q6FEH5_ACIAD/1-244-------------------------------LSLHDPL---NLNTLDRTC........GFLI....GCVV--------SV
B7GWN2_ACIB3/1-244-------------------------------FGIQHDL---KLDSFRHFF........SFFI....GIII--------AL
Q65Q39_MANSM/1-231-------------------------------LPAFCG.---SNVPQVTFKNPLAWL.....I....VFLY--------SA
D0SS47_ACILW/1-244-------------------------------IGIQHDL---KIHNILSAL........KFIL....VMCL--------AV
C0B3N4_9ENTR/1-241-------------------------------SPIPLY.---.........DPLKFNLRTL.S....LFVL--------SL
D3EE91_GEOS4/1-238-------------------------------LPSWFPY---RWQRDGKLP....VSPIGW.L....AVIL--------LG
D3D9A1_9ACTO/1-236-------------------------------APDAVR.---.....LRLAPRARLSRRQW.M....LAPA--------AA
A0Q1Y2_CLONN/1-244-------------------------------MPQPID.---KKFSFLINEK.KNFTIKKV.I....VFIY--------SS
Q1IN38_KORVE/1-248-------------------------------LPVALQ.---RRIDVSR..SYVPKSIGDF.L....LVVL--------SL
Q0RF10_FRAAA/1-234-------------------------------APGPVR.---.....LRLAARARLTGRQW.L....LAPV--------AA
A1ZM58_9BACT/1-236-------------------------------LPFFLK.---SRVYHCKEFNWWAYMRKRW.W....VVII--------SL
C0DX83_EIKCO/1-244-------------------------------LPDCLNA---AYRLPESTIAAATHKRRQT.AVVLFTFVF--------SA
A3HWD2_9BACT/1-238-------------------------------SPKWFQ.---SRTVQYLKFNWLLALKKNW.I....GILL--------SI
A6GZ02_FLAPJ/1-237-------------------------------LPKFLK.---SRFSIFKQFNWNRYFKEKG.L....VVMI--------SI
D3V1B0_XENBS/1-239-------------------------------FPISFA.---.........RYEKPDYKDR.V....AFVL--------SL
C0ZEY0_BREBN/1-243-------------------------------LPEWMG.---RGLDYTNK.GSRMPAWKMA.I....VFVY--------SA
D2ARI2_STRRD/1-247-------------------------------FPPALAG---RIASLAPAP.........YGLRRLPAVVA--------GG
B1HS87_LYSSC/4-242-------------------------------LPEFLQ.---DFNSY...QKAGTKTWKI..I....VFSY--------SA
D4DQE9_NEIEG/58-292-------------------------------LPNCLNA---APYRPSENV..DFHKIKEV......AFIP--------SA
C0VQ51_9GAMM/1-244-------------------------------FVIRDDL---NIHSFDSFI........AFSL....MSCF--------AI
Q1VTE4_9FLAO/1-237-------------------------------LPTFLK.---SRFSVFKLFDWNRYFNRNW.L....VVII--------SI
D4BTR9_PRORE/1-240-------------------------------VPFPLK.---.........NRSVGSFRQF.C....IVVL--------SF
Q7UP84_RHOBA/1-250-------------------------------LPGPLRT---KVRPIADRP..VSVEWQSI.L....LVAV--------CV
Q899W6_CLOTE/1-234-------------------------------LPFGLS.---RYYTYLLNYRVNIKSIKDI.I....VFGY--------SS
D0SL80_ACIJU/1-244-------------------------------LGIIHPL---NIKSFDQII........TFVL....MTCF--------AI
C5VRK3_CLOBO/1-245-------------------------------LPHPFD.---KKLSYFLDKKSNVINIKYL.I....IFIF--------SA
C6D3J1_PAESJ/1-242-------------------------------LPSLFDL---DKRAYHLISGWDMRGSKAM.V....VYLL--------SV
D0SG75_ACIJO/1-244-------------------------------LGIQHEL---RLSSMLRFF........KFSV....AVIL--------AI
C6JKD9_FUSVA/1-236-------------------------------MPLFFK.---SRFINLRDFNWNSYFKKNW.Y....IVII--------SI

PF00882

B7GWN2_ACIB3/1-206-------------------------------FGIQH..DLKLDSFRH........FFSFF.....IGIII--------AL
C6RSF9_ACIRA/1-206-------------------------------LGIQK..PLNIHSPLQ........ALIFL.....VSCSI--------AI
B7H911_BACC4/1-208-------------------------------LPKPF..AGYYSYAID..ERWGLHTWKEF.....FVFCY--------SA
C2XYJ1_BACCE/7-214-------------------------------LPKPF..ASYYKYVVD..AKWGLYTWKNF.....FVFCY--------SA
B1B9W2_CLOBO/1-214-------------------------------MPQPI..DKNLYHITH..RKSKNSTIKKR.....IIFIY--------SA
C5VRK3_CLOBO/1-214-------------------------------LPHPF..DKKLSYFLD..KKSNVINIKYL.....IIFIF--------SA
A3I5H3_9BACI/4-213-------------------------------LPEFL.............QDFNSYQISGTKTWKIIVFSY--------SA
A7FSP1_CLOB1/1-219-------------------------------GPKPI..DSWYYNTAL..KPWRINSLAQV.....LVFSY--------SA
Q0SV58_CLOPS/1-213-------------------------------LPRPL..DNWYGYLRT..EQFGLHSWKEV.....IVFIY--------SA
Q899W6_CLOTE/1-207-------------------------------LPFGL..SRYYTYLLN..YRVNIKSIKDI.....IVFGY--------SS
C0ZEY0_BREBN/1-212-------------------------------LPEWM..GRGLDYTNK...GSRMPAWKMA.....IVFVY--------SA
C6JKD9_FUSVA/1-208-------------------------------MPLFF..KSRFINLRD..FNWNSYFKKNW.....YIVII--------SI
A6GZ02_FLAPJ/1-209-------------------------------LPKFL..KSRFSIFKQ..FNWNRYFKEKG.....LVVMI--------SI
Q1VTE4_9FLAO/1-209-------------------------------LPTFL..KSRFSVFKL..FDWNRYFNRNW.....LVVII--------SI
A1ZM58_9BACT/1-209-------------------------------LPFFL..KSRVYHCKE..FNWWAYMRKRW.....WVVII--------SL
D3EE91_GEOS4/1-207-------------------------------LPSWF..P..........YRWQRDGKLPVSPIGWLAVIL--------LG
C6D3J1_PAESJ/1-215-------------------------------LPSLFDLDKRAYHLIS...GWDMRGSKAM.....VVYLL--------SV
A3HWD2_9BACT/1-210-------------------------------SPKWF..QSRTVQYLK..FNWLLALKKNW.....IGILL--------SI
C0DX83_EIKCO/1-211-------------------------------LPDCLNAAYRLPESTIAAATHKRRQTAVV....LFTFVF--------SA
D4DQE9_NEIEG/58-261-------------------------------LPNCLNAAPYRPS.....ENVDFHKIKEV......AFIP--------SA
Q65Q39_MANSM/1-202-------------------------------LPAFC..GSNVPQVTF......KNPLAWL.....IVFLY--------SA
D3V1B0_XENBS/1-204-------------------------------FPISF.............ARYEKPDYKDR.....VAFVL--------SL
C0B3N4_9ENTR/1-204-------------------------------SPIPL.............YDPLKFNLRTL.....SLFVL--------SL
D4BTR9_PRORE/1-203-------------------------------VPFPL.............KNRSVGSFRQF.....CIVVL--------SF
B2Q274_PROST/1-203-------------------------------VPFQF.............PQNWRWSAKNG.....AILIF--------SF
Q2LV15_SYNAS/6-198-------------------------------GIKKLSS....................MNKTSEEFKNCL--------AW
Q2Y883_NITMU/6-188-------------------------------GVEWIRR....................LDGASRQ..KAF--------SW
A7K2D4_VIBSE/6-189-------------------------------LIQQVKA....................ADNEHFE..KTF--------SW
A4C3L5_9GAMM/6-186-------------------------------AVHYCKK....................LEGLAQE..KCF--------AW
C9YFH3_9BURK/6-183-------------------------------GINAVQK....................LQGVERQ..KAT--------SW
Q12DA4_POLSJ/6-186-------------------------------GVAAVAK....................LPPDLRP..KAT--------AW
C4XMP3_DESMR/34-221-------------------------------GVAAVSN....................LEGDVQN..KCL--------AW
E6VSV5_DESAO/6-180-------------------------------IRLLTDH..................AADAWARQGATLPV--------AL
Q2LQI8_SYNAS/6-189-------------------------------FGPLARN.......................LETLPEGYR--------PF
B8FCF0_DESAA/6-187-------------------------------LVEAYQD.........................KWSDGMW--------AF
B3E8I7_GEOLS/6-161-------------------------------LHYAENT.........................ALSPAAT--------AC
A1AT46_PELPD/6-164-------------------------------IRVETSR.......................GGMLPYDLL--------AC
C6Y3Y4_PEDHD/24-233-------------------------------LVHALRD..........................RDSLKI--------LI
E6U8V9_ETHHY/5-158-------------------------------RATALYD....................REEEKSLDSFAF--------AK
Q1IVJ5_KORVE/32-215-------------------------------LFRNAQN............................LNDL--------AF
C1F375_ACIC5/44-227-------------------------------LLRDSRN............................VDEF--------AF
Q01WM2_SOLUE/25-208-------------------------------MIREAQD............................LNEY--------AF
Q1ISY5_KORVE/28-210-------------------------------LINESDS............................INEY--------AF
Q025L8_SOLUE/39-222-------------------------------LVKEAQT............................LDEL--------AF
Y1571_ARCFU/28-204-------------------------------ANKMLSL.........................AEGTDEK--------AF
Q01YQ6_SOLUE/23-198-------------------------------IVSNLAE..........................HRPREA--------AR
Q8XI18_CLOPE/5-158-------------------------------KIKKLAS.................LSMYDFKKKFSVSRF--------SQ
B0AAC8_9FIRM/5-160-------------------------------KIKSLCK.................LSLDFIEKYFSISKF--------SQ
B6FWP7_9FIRM/5-161-------------------------------KIKYLCS.................LTLESLSKVFSTSRL--------SQ
C9YL06_CLODR/5-159-------------------------------KINYLCS.................LNIDSLSKYFSVSRL--------SQ
D3MTQ6_9FIRM/3-156-------------------------------KIEKMSS.................LNLDSLEKLYSKSSF--------SQ
C1I9N1_9CLOT/4-161-------------------------------KIEFLSS.................LTLDDIYTRYSSKKF--------NQ
B2UYY5_CLOBA/4-161-------------------------------KIEKLCS.................LSLQDVYYKMSVNKF--------SE
C4IEN4_CLOBU/4-161-------------------------------KIIHLSS.................LTLEEVYFDMKLGRF--------SE
A6LQ77_CLOB8/4-161-------------------------------KIIHLSS.................LSLEEIYYDMTIGKF--------SE
B1BXM8_CLOPF/5-161-------------------------------KVKELSR.................LSSDEIINHLGKEKF--------SI
Q97KV3_CLOAB/5-155-------------------------------YSNKLVK........................YNNSIRKF--------SL
B0P7T6_9FIRM/16-171-------------------------------RAERLAR......................EGDAMTLAEY--------SK
C0ECW5_9CLOT/5-161-------------------------------ELRDLAS.....................CDKSRLNSVVL--------AD
A8MHU0_ALKOO/5-164-------------------------------NINDLSS...................YNFQFNKEFIKQL--------ST
A6TNX7_ALKMQ/5-165-------------------------------QIQDLSQ...................YSLIENEELIKLI--------SR
B2A897_NATTJ/5-148-------------------------------YFEKTLD.......................MNIGNKRLA--------YY
B0MJ55_9FIRM/5-161-------------------------------QLDDFVA....................DYDTLKGMNMRR--------CA
B0NZS3_9CLOT/15-171-------------------------------KISKFIA....................NYDKDKGMNMRR--------CA
A5ZUN3_9FIRM/20-175-------------------------------KIRRLVQ......................SGAGYNDRVF--------WR
C6J9X9_9FIRM/5-161-------------------------------RMKELTD.....................IRPDESNQRVY--------WR
C6LKS6_9FIRM/5-161-------------------------------NIRSLLK....................MDYTDAQDGMAF--------WR
D4KRQ8_9FIRM/5-161-------------------------------HIARLSE....................GQKVMNKKNRKY--------YR
D9SRM2_CLOC7/5-162-------------------------------MIEKVFE.....................DYEENWDSREF--------YV
A6LQR0_CLOB8/5-160-------------------------------IIDEIIY.......................GEIKRNKDI--------SI
B0S165_FINM2/8-177-------------------------------EIITIIY..............LFQFTDLTRLNSLQNKIL--------ST
D1VUW6_9FIRM/8-182-------------------------------EISNLIY.............FCRYSNLQENTNPILINYL--------SK
B1QT08_CLOBU/5-155-------------------------------KLDDLLE........................TKEFNWYN--------SL
C4Z638_EUBE2/40-187-------------------------------RLQRLER........................HGRMNCFS--------FL
A7VFQ0_9CLOT/5-152-------------------------------RIQKLEE........................KGKNSRYS--------FL
C0EWT7_9FIRM/5-150-------------------------------QMEALEA........................KGRGGSFS--------YL
A8SNU3_9FIRM/5-162-------------------------------LTKKLEK........................GGMGTVRQ--------SF
D4LBU1_RUMC1/5-160-------------------------------LTQKLHK........................SDVQSPLQ--------WF
Q315K4_DESDG/47-177-------------------------------SADSPRL...............................K--------AY
B8DLU9_DESVM/18-149-------------------------------AADTPRL...............................H--------AY
C7LVT1_DESBD/24-155-------------------------------QAEDTQA...............................Q--------AY
C6BUV8_DESAD/29-160-------------------------------ESTDKHL...............................K--------AY
C8X0X8_DESRD/29-159-------------------------------GNRDQAL...............................Q--------SY
A5G5N0_GEOUR/25-157-------------------------------NAEKDAQ...............................K--------AC
Q39S84_GEOMG/25-157-------------------------------YAWNPPQ...............................K--------AC
E8WRC5_GEOS8/30-162-------------------------------KAGDPAQ...............................Q--------AC
A1AK53_PELPD/24-156-------------------------------VAGNDDQ...............................Q--------AC
B3EBK7_GEOLS/25-157-------------------------------SAQDDPQ...............................R--------AC
Q3A306_PELCD/29-161-------------------------------AAKDDAQ...............................R--------AC
Q1K0Z2_DESAC/27-159-------------------------------AAENDAQ...............................R--------AC
C1A8N1_GEMAT/19-151-------------------------------EADSPAL...............................Q--------AF
B8J577_ANAD2/33-165-------------------------------QAKPGAE...............................Q--------AF
D6SRA3_9DELT/26-149-------------------------------AAGKRTD...............................Q--------AF
B5YG53_THEYD/20-144-------------------------------EAKTPEE...............................K--------SF
Q1H382_METFK/30-174-------------------------------NASGDEE...............................T--------AI
C6X6W6_METSD/30-174-------------------------------RARTDEE...............................T--------AM
C6WXF1_METML/56-200-------------------------------AAQSDEE...............................I--------AL
D5CMM4_SIDLE/28-177-------------------------------DAKSDEE...............................Y--------AI
B0SGT0_LEPBA/6-211-------------------------------FLDQVYD.....................TEMGLYRDRFL--------AF
Q72P57_LEPIC/6-211-------------------------------FLDLILQ.....................TEEGIHRDRYI--------AF
C8W7P0_ATOPD/6-209-------------------------------EQRSLVD...........................QRQLR--------EF
C5DV22_ZYGRC/30-228-------------------------------AVKLWHG.................KYNDNPQCEDSMKLR--------SF
B5VL45_YEAS6/30-234-------------------------------AVSYWQQ..............KYGQNYRLRGSQGSLALK--------SF
C5DKM1_LACTC/24-220-------------------------------GAKLWRE..............RYSKNQN...SEKSLRLK--------SF
Q6FL70_CANGA/25-242-------------------------------AINYWRD..............TYGDKKNDIMSEESQKLA--------AF
Q6CEF9_YARLI/23-229-------------------------------GVNYWRS.RYGYLDDYSEKTDHTKDAPSDSEFKNSLRLR--------AF
C4R8D0_PICPG/19-213-------------------------------FIEDYRE.................NSNQFSEEDEISNYR--------AF
Q8R432_MOUSE/28-220-------------------------------SIHYIRE..................NYPLPWEKDTEKLV--------AF
C3ZWC6_BRAFL/5-194-------------------------------TITHIRQ..................KYPQPWNEATEKLV--------VF
A7SED1_NEMVE/31-226-------------------------------TVNYIRR..................KYPKPWDEATEKLV--------AF
D3AZT7_POLPA/38-225-------------------------------ASEYLLA..................TYTQPWNAKAQSLA--------VF
PLDG_DICDI/29-216-------------------------------ATKYLLE..................TYPQPWSLDGIRLA--------VF
Q97TF6_CLOAB/60-232-------------------------------AVSSYRT...........................DRTYS--------MQ
A7B1H2_RUMGN/72-243-------------------------------AVNAYRA..........................GDVQLA--------MS
PHLC_CLOHA/37-230-------------------------------AKDEWKK..........................GNYEQA--------TW
PHLC_CLONO/38-231-------------------------------ARNEWEK..........................GNYEKA--------TW
Q5PXE6_CLOPF/38-231-------------------------------ARYEWQR..........................GNYKQA--------TF
Q8GCY3_9CLOT/38-231-------------------------------AKNEWDK..........................GNYEKA--------AW
PHLC_CLOSO/38-231-------------------------------AENEWKK..........................GNYKEA--------TF
Q6R6B7_LISSE/64-245-------------------------------SIEEYQD..........................GNFEKA--------FY
Q6EAE3_LISMN/64-245-------------------------------SVTDYRE..........................GKFDTA--------FY
Q6R6D6_LISIV/62-243-------------------------------ALQDYKE..........................DKLNTA--------FY
A0R9W0_BACAH/51-232-------------------------------AGESYKN..........................KDMKQA--------FF
A5D2J5_PELTS/29-178-------------------------------ALSNWQN..........................SNRNKA--------FF
Q896L3_CLOTE/34-205-------------------------------SLENLEK..........................GDLDKA--------MF
A5N896_CLOK5/34-205-------------------------------SLQLFNI..........................GQIEKA--------LF
Q97KA0_CLOAB/34-205-------------------------------SLNYLRA..........................GDKKKS--------LF
A6TKQ8_ALKMQ/57-228-------------------------------AIGLWRE..........................GAFNES--------LF
O26214_METTH/27-173-------------------------------QGKISYD.........................AGNYRYA--------SY
B8I5G2_CLOCE/32-236-------------------------------NGYITCNATMGVGTGSVGGWTWNEIFDSIGIPNNAANRR--------AF
B5HQN8_9ACTO/67-292-------------------------------LPRRR..QGRAATLLRCGTPRARVRTALA.....ARWYA--------SA
Q82A31_STRAW/92-336-------------------------------LPRAR..QGRVAALLRCGVPRARMRASAV.....LWWYV--------SA
C9YWP6_STRSW/1-225-------------------------------LPKGR..QGRVAALVRCGARARRFGPSRA.....LWWYV--------SA
B4V801_9ACTO/61-287-------------------------------LPPAW..RGRVYGLVRGEDWRTRRLPSLA.....LWFYL--------SA
C7QBS6_CATAD/1-214-------------------------------LPVRW..AAAADQLTA..PRERRVRFSSV.....SWFVL--------SA
D3D9A1_9ACTO/1-206-------------------------------APDAV..RLRLAPRAR..LSRRQWMLAPA..........--------AA
A8L7F5_FRASN/1-204-------------------------------APDPV..RLRLPPRAR..PTGHQWLLAPV..........--------AA
Q0RF10_FRAAA/1-204-------------------------------APGPV..RLRLAARAR..LTGRQWLLAPV..........--------AA
D2ARI2_STRRD/1-214-------------------------------FPPAL..AGRIASLAP.....APYGLRRL.....PAVVA--------GG
D2Q1R3_KRIFD/1-218-------------------------------APPSL..AGRLK......PSGRRPTANYL.....LWAAI--------SL
C7R2G7_JONDD/1-213-------------------------------PESGS................TPQTPQRAVAIRGVWVVI--------SL
Q7UP84_RHOBA/1-217-------------------------------LPGPL..RTKVRPIAD...RPVSVEWQSI.....LLVAV--------CV
A7C3K4_9GAMM/1-217-------------------------------FPISH..QQHLIPFVN...EFQFFPLRRF.....LLIII--------SL
B9XK96_9BACT/41-256-------------------------------LPANH..QKRLVPWLN...PFPLRTAAQW.....GLVIV--------SL
Q1IN38_KORVE/1-215-------------------------------LPVAL..QRRIDVS....RSYVPKSIGDF.....LLVVL--------SL
D9T3L8_MICAI/1-213-------------------------------PGQRLFGWPWYASLARVRHPW.............QVTVC--------SV
C1ACE2_GEMAT/1-206-------------------------------LRDHP..EWRLHDLLA...LRAPATWWDW.....VSVAW--------SA
Q6FEH5_ACIAD/1-206-------------------------------LSLHD..PLNLNTLDR........TCGFL.....IGCVV--------SV
C0VQ51_9GAMM/1-206-------------------------------FVIRD..DLNIHSFDS........FIAFS.....LMSCF--------AI
D0SL80_ACIJU/1-206-------------------------------LGIIH..PLNIKSFDQ........IITFV.....LMTCF--------AI
D0SG75_ACIJO/1-206-------------------------------LGIQH..ELRLSSMLR........FFKFS.....VAVIL--------AI
D0SS47_ACILW/1-206-------------------------------IGIQH..DLKIHNILS........ALKFI.....LVMCL--------AV

PF04307

Q2VZJ9_MAGSA/3-159...............................VLMLVEPGR.......................GLVRLAE--------PL
A6LWG2_CLOB8/3-169...............................TAIGMFTDK.......................LMLIGIN--------GI
A3CRK4_METMJ/3-159...............................AGLILYRYR........................RRIDLF--------AV
Q1MS87_LAWIP/3-199...............................ICTIPLVVL.....TALRPQPNELPPPKQISWTLIEAWF--------FT
Q0W649_UNCMA/3-154...............................ATYILFDDI..................FHAGPLSGYVTL--------AV
Q5X0H9_LEGPL/3-176...............................IVALFLLCF..................SQYRQSWKVTIG--------AS
Q2NZA4_XANOM/4-177...............................FGAAAHRLL.....................RADAVQAAV--------LL
Q8PZ85_METMA/4-181...............................FGGIVGYGA................FRE..FSKAVYMAI--------FA
A4YHA8_METS5/3-210...................................................................FNF--------YL
A4W9L4_ENT38/3-166...............................CFYLKIPET.....................WIVPADAIQ--------GM
Q468G0_METBF/3-172...............................VGLYIYKKK........................KDVKVL--------SL
Q6AMI9_DESPS/4-207...............................MGYLLFINS....................GATFALIVGF--------SV
Q1ILA3_KORVE/3-163...............................VAVAFCGER.........................LKTAL--------FV
Q8TVQ4_METKA/3-158...............................LLWATGHPN............................AA--------LV
A8GDN5_SERP5/3-166...............................LFQLDVPRS.....................WPIPPDVLH--------AM
A0YYL1_LYNSP/4-178...............................IIGLLGRWL....................GKFSVQKLMG--------WT
A0YXX1_LYNSP/4-183...............................LTALIARYL.....................KFKHWNWFG--------LW
Q1VZ04_9FLAO/3-179...............................VLGYLLSRI...................HKQASWKNWSS--------LV
Q0JZE4_CUPNH/3-185...............................LLAGLFCLA..................AHRREAWREAFA--------VS
Q2S300_SALRD/3-182...............................CAAYGLRRF.................HRDIPVSVGKWGA--------LV
A5CZD2_PELTS/18-203...............................ILGITAAIV......................LKAPLLAL--------SG
A3CVA2_METMJ/3-183...............................AGIALYRRR........................ESFALL--------AV
Q0BSQ9_GRABC/15-169...............................AMQHSRLPR..........................TIID--------PL
A2BN14_HYPBU/3-145...............................TAYTILSPF......................GHTEPVIV--------GL
Q0S8N5_RHOSR/4-250AIIATLFVCLGLALRGLAGELAKEKGWLAVSVVAAVLSAL............TWQSYPT..EAGSTGLGV--------AV
Q1IHJ9_KORVE/3-205...............................FVLALVWSI.RWAFLKLRNGQTLKSRFPRPPIRWGVLYL--------YA
A1U6Q1_MARAV/3-174...............................LIAWGLWRW...................KPLISYQRWLA--------LV
A4J2S7_DESRM/3-150...............................LLGLFWGKN...........................LGI--------AV
Q28PX8_JANSC/2-152...............................ALIVCASLW.....................APVWRWPAI--------AF
Q18EP1_HALWD/19-174...............................VVLGYALIT.......................NRLHLGT--------GF
Q0VLL6_ALCBS/3-174...............................LLAVCLARW...................QTRISLWRWWL--------FT
Q726Y1_DESVH/3-173...............................LLALLFALP...............LRRAPQGWGFAKVWG--------VS
Q2NEC5_METST/4-226WPSSILLFVVMILVGYFIVSRKYLLWYVLLVGIYLFLFPV..................DYGNIGSSNVFL--------MF
YFHP_BACSU/3-182...............................IIPAILYLF...................YPQADFLHLWL--------WT
Q8TQH1_METAC/4-199...............................FIWVKTRDW..........................IFTY--------GG
A0KFP7_AERHH/3-165...............................GLDQSLAPA......................LLPTGVKD--------AL
Q47U11_THEFY/3-250AWFLAFLGLRALRKVAWRGLRTALGSWPGAALGALCVAAL............FLTAWDN..YPPGWIVGA--------VV
Q1C5S1_YERPA/4-178...............................LLLAFYRFF.....................NTSLTRIWL--------FL
Q465I7_METBF/4-223...............................FIWVKTKDR..........................RFTL--------GG
Q1QZR4_CHRSD/3-181...............................SLTLLARAG.............ERWRRVTPPIGTLRWGL--------LF
A6TMK4_ALKMQ/3-249...............................VVRQISFFY.....................GDIDYSLIF--------GV
Q82XH5_NITEU/3-183...............................LLAHLFSRF..................TGGHYPWRSFFV--------PA
Q6YRT9_SYNY3/3-188...............................VSYALWFAM.....................PVIPLVIVH--------AL
A6LXK9_CLOB8/3-172...............................IGIYMLNRN........................GKKNIL--------FL
Q8D1W8_WIGBR/3-169...............................IIFSNIFNT....................NYVFPLDFSY--------SL
Q18KS6_HALWD/3-171...............................FPPVFGNLQ..............................--------FV
Q8R899_THETN/3-179...............................ILFMSDRTI............................LP--------PA
A0Z1N5_9GAMM/41-214...............................LCALVFWKT..................IGRGLSLWTVWV--------AA
Q9V2B4_PYRAB/7-175...............................VSLAFKSLF..............................--------MF
Q18EE2_HALWD/4-162...............................LIGVVLLSA......................TERRKGGT--------VL
Q12UG8_METBU/3-174...............................MGAIIHKYH......................KENGTGMI--------IL
Q3IS66_NATPD/3-169...............................VAVPVTLAA.....................PSTVTIAMA--------LF
Q465I8_METBF/4-199...............................ILWFKTKDW..........................LFTV--------GG
B4SJC5_STRM5/4-190...............................LAAVLAFFG........SSRPWSAVPCQPRLAPTLQAAT--------LV
A0PYB1_CLONN/3-199...............................IASYVGKSY.......................AIPASAY--------YF
Q3A0M8_PELCD/4-203...............................LTMQITYSL....................GRNLTLAAGL--------VA
Q465I4_METBF/4-199...............................FIWIKTKDR..........................LFTA--------AG
Q46FT6_METBF/4-180...............................FGIVAGYAK................YRE..PGRAMYLGL--------FA
O26450_METTH/3-144............................................................YSLKSPENGV--------PL
Q1AT01_RUBXD/3-176...............................PVWLLLGGY.........................PAFAL--------AL
Q75TF0_GEOKU/3-155...............................LVWRDSASP...........................FTA--------GL
Q1NK63_9DELT/3-180...............................LLAWIFSRL...................FADHRWQDYLP--------LT
Q1C702_YERPA/3-166...............................LFQVDAPLN.....................GVLPPDVFH--------AM
Q2RM17_MOOTA/3-158...............................AGLLWWRRY........................RRPGGL--------VL
Q5YVJ3_NOCFA/3-233LALAFFLLALAVRALHLYPPGDDIRSWGTVVVLAAAGTFV..............MDHWI..SDKPAWLPF--------CV
Q8CV62_OCEIH/3-182...............................LVSGLIYLF...................VPEVSYLHLWL--------WT
A0NTQ3_9RHOB/3-182...............................LLGEGLVRL.................FKGLRDCRWLTWL--------TV
Q2NV14_SODGM/3-168...............................FLSSDLLSR.................II..IPIPVDFVH--------AM
Q2N9Y9_ERYLH/15-204...............................ILAALLWGF......DRWQASRGNRPEGRRPVSFKWLFL--------LS
A1K1W5_AZOSB/3-183...............................LLAGLFARL..............ARLRDRRGPDWPAFYG--------LA
C1DQI7_AZOVD/3-180...............................LLAWLLRRF.................RPHPGYGGGRLFL--------AL
Q5FK20_LACAC/3-175...............................ILYFCMNHF.........SPIALSMSKS..PNYWESIWL--------GL
Q0ACJ1_ALHEH/3-184...............................LLAVVFARV..............APRLGGGRYGWRAWYA--------AA
Q8FRV6_COREF/4-249AVIGLLFFLLGLGIRGLLPEWSKKTDWLIVTGLSAALAYA............VWSYVPE..ESFGVFLGS--------AI
Q1V9R5_VIBAL/3-178...............................ICALVLYPL................FAKKRGLSFRQSWF--------YC
Q97K38_CLOAB/3-212...............................GVKLLLGNI............................FI--------YF
Q5V827_HALMA/3-151...............................LLAGAGTVV...................TIAPSLIGTVT--------GF
YVSG_BACSU/3-155...............................ITSTYIPDK..........................NISA--------GL
A1WTH1_HALHL/3-183...............................LLGWVVARL..................WPGQRDWRDGAL--------IF
Q8PSE7_METMA/3-176...............................AGLYLYDKR........................RDIRAL--------SL
O29835_ARCFU/7-140...............................LFFFLFRYA......................GIPEMLAL--------SV
Q02F56_PSEAB/4-178...............................LAALACRPL.....................HSGPLKAGL--------WV
Q2RLP5_MOOTA/5-179...............................AIKTLGWPQ.............................V--------PF
Q46DH2_METBF/3-171...............................AGYYLYIQG.........................KPELL--------II
Q9EZ84_CAMJU/3-164...............................ISFVIDFNN...........................FLF--------WF
Q3YN07_BACTK/3-163...............................PILFAVGMT......................PLSFTNGM--------CI
Q3JF51_NITOC/3-164...............................LISPLLWLK.........................PVYFG--------CI
Q1MQD9_LAWIP/3-155...............................LGLMNFPLK.............HFALSPIANQLFSEIML--------WV
Q0AJ35_NITEC/3-176...............................IATVIIWWL..................VRKKLSFKETYF--------YS
Q97LP7_CLOAB/3-199...............................LVGYVANRY.......................NIHVIIY--------YF
A8L052_FRASN/2-224WAALYILVGFGLRGLGLDFEGHPFWSGLKDCAAAGVAIYL.................MH..GLDMSFAGY--------AV
A9AVQ5_HERA2/4-166...............................MGASFAPRL.....................GCKRWVAGL--------TL
Q67R78_SYMTH/3-176...............................ASAGLLAAA...................FPSAGAGPLFF--------WT
Q9YAY7_AERPE/3-148...............................LLGAVLEMG.....................GFKGLGFIE--------GF
Q1ZS65_PHOAS/3-176...............................LLTALWSRF..................RPNVLSFNRLWL--------LI
A4XRV7_PSEMY/3-180...............................LLTWLIRRY.................RPHPGYSDRRLLL--------TL
A4J2S9_DESRM/3-180...............................ILGVFVAGI......................MGSAFLIF--------SG
Q18HI1_HALWD/3-156...............................LVAVLTTIA.............VVFADARIVSILISIPF--------GF
A0R9F7_BACAH/3-182...............................LISGISFAF...................FSDAPYLHLLL--------WS
Q65F12_BACLD/3-155...............................AAHLYFADQ..........................SILV--------GL
A0KMD3_AERHH/4-197...............................LAMLFHRQF.....................RASTATVWS--------FL
Q18BE8_CLOD6/3-241...............................LLKQIELIT.......................NINNLSF--------YG
Q648F5_9ARCH/3-180...............................IGTYIYTRN......................GNGEKAII--------LL
Q5FTT4_GLUOX/55-213...............................ALNGLMGPE.......................SLRGPWG--------AL
A1HQY3_9FIRM/3-173...............................LIAAGLYFF...................MPGVSFTTVCG--------WA
Q3JEV9_NITOC/3-176...............................VATVLLWPF..................LRRRINFGQLYP--------LA
Q1DD75_MYXXD/3-235...............................VLTGLMLLW........DRYVRRRRHPDLPPARFGPLLM--------LS
A0JUC0_ARTS2/3-250SVGAGLLCMFMINIAAKALKFFPKSGFISNWLFALTMAGL..............VTWFA..PDQWTWLPV--------SM
A3CTE7_METMJ/3-243...............................VLCGYLALI..............LTWLGSSLALLPAFGC--------AF
Q186I4_CLOD6/3-177...............................FFKSLTIFT...................NNNIVFSCLSS--------GF
A0R7P4_PELPD/13-154...............................VLYALEYRT.....................PSIVLYLIF--------FM
Q47RB2_THEFY/3-227QIFVFLLIGIAFNGLGYGMEKNRVAAEFINALATAGITLA...............LYSS..GVDYSWLGL--------AV
A6TSU9_ALKMQ/3-172...............................VITAGLSLF...................FSEFYFYQVFF--------WT
Q5HM58_STAEQ/3-158...............................LLYFIQTPM..........................YYMV--------AI
Q2JB37_FRASC/3-225WAALFVLVGFGLRGLGLDFEKHEHWSSVMDCVTAGVAVFL.................MH..GIDMSFAGY--------AV
Q5V391_HALMA/4-161...............................VVIAYAVRT.......................DRTRLGT--------AF
Q7NV83_CHRVO/3-166...............................ASAACLHDW................GVR..LGHAMPLVL--------GL
O27320_METTH/4-218LDGKASLVVILTVLGFIILNRVLVLPFVLLTLLGVFLTDF....................PVMNLYTIMG--------PL
B1J8M8_PSEPW/3-184...............................LLAWLVNRL.............GRTRWPDKGYTLPRLFL--------AF
Q5V568_HALMA/2-273NSRATRIGSLSIGAVLTVLTGAVSGPIAGLVMLVFVLAVL............GVATVAQSRDVSPRTVTG--------LA
Q2L2L1_BORA1/3-180...............................LLMWLIRKR.................WPAAKYSAARLFL--------TL
Q0W4H6_UNCMA/3-165...............................IALLVARKY........................RYWGVG--------VL
Q4L847_STAHJ/3-158...............................LLNLIQTPT..........................YYLV--------SI
Q97MS7_CLOAB/3-166...............................IGLYRQLRH........................KKNGIL--------ML
B4SK06_STRM5/3-184...............................LIWWLFKRF................GNGRVAQSPVRWFW--------AI
Q0SU56_CLOPS/3-177...............................TLYIVLNIS...................NFNIILLIISI--------GF
Q9KE25_BACHD/3-180...............................LAVGIIYLV...............AFKKRKELSWKWIYF--------LS
Q15HU4_CLOPF/3-157...............................LGIFLRSLF............................IK--------SI
A0YBX0_9GAMM/3-178...............................ICALVLHKL................FSRQHGISLKETWL--------FC
Q023X2_SOLUE/3-190...............................AAVAIVRFA..................GRKHVRWTAAFF--------AA
Q8PXV1_METMA/3-172...............................AAYYIFYHK........................GWTAPL--------II
O29079_ARCFU/4-168...............................IFAILLLIF......................GSSPIYSI--------VF
Q5P1U0_AROAE/3-192...............................LLAWVFAAL..............AGRHHRARPGWRTFYG--------IA
Q99S94_STAAM/3-158...............................LLQIIQTPN..........................YYMA--------AI
A0XYC3_9GAMM/3-181...............................LIVWLILKL.................HSGMQTYKVRWFW--------LV
Q1GSW3_SPHAL/3-193...............................ILWALVMSF......DRWQERRGKRPVDRLPLHRGWLLA--------LA
Q46G46_METBF/3-177...............................IGLYVYNKR........................NDIVII--------TL
A0LXF8_GRAFK/3-182...............................LFGWIISKI.................ESKSEANWKNWSW--------LM
Q043R0_LACGA/3-174...............................GLYYLMNKF.........IPIRINNLTS..QNYWSALWF--------GL
Q8TP13_METAC/3-172...............................IGLYIYQRN........................RDIRGL--------SL
Q6D4I1_ERWCT/3-166...............................FIQTRLPPD.....................WPIPTDAYH--------AM
Q890Y4_CLOTE/3-199...............................IVGYIGNIY.......................NLYNIIY--------YF
A1TRR8_ACIAC/3-179...............................LLGALAARL..................HGEGFQWKRWWL--------AL
Q3J7C8_NITOC/3-183...............................LLATLFWRL..................RGKQKPWQVYFG--------VS
Q1Z117_PHOPR/3-176...............................LLAQGWHQW..................RPSHFSFTQLWL--------LI
Q08ZS3_STIAD/3-149...............................VCAALARQR.........................KAVAL--------LS
Q0RHF1_FRAAA/6-228WAALFVLVGFGLRGLGLDFEGHEFWSGLKDCVTAGIAVYL.................MH..GLDMGFVAY--------PV
Q0W2I6_UNCMA/3-181...............................LFAVIGLIV............VTMALPAYGPVSPILAIL--------AA
Q7MS32_WOLSU/3-175...............................PGWGIASSQ......................GIALEAVI--------GL
Q1ATT6_RUBXD/3-170...............................ALGPLLWWL......................TGQPATMI--------AV
Q9KAZ8_BACHD/3-159...............................LLNWLPVYS.........................TDVTL--------GL
A8LV16_SALAI/3-256AVIGILFFMFGLALRGLFDEWAERAGWLVVTLASLAAAWF............TFATLPG..DRGYPMIGL--------AV
Q8PUB3_METMA/4-199...............................FIWLRTKDR..........................LFTA--------AG
Y790_METJA/3-224MVTNEVLLGRVM...................IFAVFAWAV.........LDI.LNPNIN..VNGALYYIL--------PV
Q01PN8_SOLUE/4-175...............................VVAAIVARG......................AAFRWLAI--------VW
Q9CNK9_PASMU/3-180...............................FITWLTFKR.................HTNLPFSFRRLFI--------TL
Q2B443_9BACI/45-224...............................LIYMACRWI....................FKVKDPKLFF--------LS
A0AJE4_LISW6/3-182...............................LISSILYFI...................FPAATFIHLLL--------WT
Q9KEC4_BACHD/3-182...............................LVAGGIWLL...................FPESAFFTLWL--------WS
Q8E899_SHEON/3-158...............................ATTFLFDYQ..........................GMLT--------AF
Q99T10_STAAM/3-179...............................LITFLIFTF...................FSGTNPFHVWM--------WA
Q3ITN2_NATPD/3-143...............................FPFVFGNLS..............................--------YV
Q11P46_CYTH3/3-219...............................VFICLRKLF........FKEESWKKYIS..MPQTKWILL--------LF
Q1D144_MYXXD/3-188...............................TATLAARAL...................FRGARLAPVFL--------TS
Q50EB0_STRFL/3-259AVLVILFVHLVLAVEGLLWRAARVSSDVLVWLLGATSAWILAGVLDKPGYGADWLFDAP..GQEYMWLGL--------PI
Q7VVQ6_BORPE/3-180...............................VMAWLIRRR.................WSDAPYSGRRLFA--------TL
Q7N3N6_PHOLL/3-166...............................LFWLKIPEE.....................WLIPTDFFH--------AM
Q7NWB9_CHRVO/4-187...............................LLAWLCRPV.................WQRAGLTAAPAAA--------LL
Q8ETE4_OCEIH/3-155...............................ILTLITDNQ..........................SIIM--------GV
A6UAV6_SINMW/2-157...............................LTVLALSLA....................GKRQYLIFVG--------IA
Q49ZB6_STAS1/3-158...............................LLYVIQTSS..........................YYLV--------TI
Q5L2T9_GEOKA/3-182...............................LIVSVMAAI...................YPKTDWLRVWL--------WT
Q8PUB1_METMA/4-234...............................LIWIKTRDR..........................TYTF--------GG
Q5WIF9_BACSK/3-182...............................IISGGMMLF...................FQDAYWPTILL--------WA
Q2B352_9BACI/31-210...............................AILAVIYPF...................FPEANLLHLWI--------WT
Q4J9X0_SULAC/3-213...................................................................FNK--------YI
A4G067_METM5/3-224MVTNNNLLGKSI...................AISVFAWVL.........YNIISTSFTT..FQGLEFYII--------PI
Q5WH30_BACSK/3-157...............................VLRWLFPDN.........................EAVQT--------GV
Q5I399_VIBCL/3-158...............................VFTFVWDYQ..........................GVGM--------AF
Q04RA4_LEPBJ/4-178...............................LACVLVRWL.....................RARIEAVFF--------FL
Q1WSF6_LACS1/3-169...............................IVKFIQKQY..................L..TDRIENIVF--------WL

PF09988

A0YPQ2_LYNSP/2-202----------------------------------------------------------------LYLSIW--------VI
Q631C1_BACCZ/2-157----------------------------------------------------------------AYMLIV--------FS
B8GCX6_CHLAD/2-185----------------------------------------------------------------GYFAAV--------GY
A4CX56_SYNPV/2-164----------------------------------------------------------------TWLMTI--------AM
A3IY70_9CHRO/2-174----------------------------------------------------------------IYLLTI--------IL
A5GPK9_SYNPW/2-164----------------------------------------------------------------AWMQTV--------VM
Q2JX69_SYNJA/2-169----------------------------------------------------------------LYLGLW--------VA
Q3AVT6_SYNS9/2-162----------------------------------------------------------------MLLFLW--------AS
Q7U3L4_SYNPX/2-158----------------------------------------------------------------MLLLGW--------WV
Q4C9Z4_CROWT/4-176----------------------------------------------------------------IYIFII--------VL
Q3M912_ANAVT/2-183----------------------------------------------------------------VYLSSL--------LA
Q5MZ52_SYNP6/2-175----------------------------------------------------------------LYLGA