Sequence alignment for CL0372

PF08124

HYSA_PROAC/46-376--WIDII......TGRRAARTSDPRARAIIAKT---------------------DRKVAEILTDLVSGSSRQTVL-ISAD
Q8DZB2_STRA5/347-671--WNDVT......IGNHVYDTNDSNMQKLNQKL---------------------DETNAKNIEAIKL..DSNRTF-LWKD
Q034G7_LACC3/85-397--WRDRL......IATK.PDMSDPNVKAYLTDL---------------------AAQSQTLWATMDR..SANRSR-LWLK
Q82ZM8_ENTFA/271-596--WKMRL......LGTTQYD.NDADVQQYRAQI---------------------ATESLALWQTLNQ..AADREY-LWER
Q7MP30_VIBVY/51-385--WASYF......LGDQ.TMAFDQQLTNEITKI---------------------NHQAKQWLDQL....TIDENG-LWAD
Q8A3J0_BACTN/19-332--WDLVLPCPSICTSALQNDDFDILMKKIRDGV---------------------AENPN..........IDKALE-LYDD
Q837L8_ENTFA/241-573--WRNQL......VSKE.YDSTNQALVDYVQKI---------------------SNEATELDQTMNK..EPNRSY-LWPL
Q82JQ0_STRAW/45-368--WLVLA......LGAG.YDPTAEPYASRLRRT---------------------GELARGYRATM....APAAAS-LWPG
A1R957_ARTAT/40-374--RRRLV......LTGGRSAADIPELAAQLEGM---------------------GKTAEKWWTSMDK..TTARTS-LWSD
Q5DYT2_VIBF1/47-382--WAENY......LGDP.AITFDQTLKNMVTST---------------------NSSAQKHWDSMTP..QPNASG-IWDD
A0JVM2_ARTS2/50-371--WVDQI......TGRKVLVAGDNDFVTALAAL---------------------DKKARTAIDLLER..SAGRLT-VFSD
CSLA_PEDHD/26-332--G..........TAELIMKRVMLDLKKPLRNM---------------------DKVAEKNLNTLQP......DG-SWKD
Q7MP31_VIBVY/73-381--WM...................QQFQSSRTNV---------------------N..................AG-LWLD
Q8CWU3_STRR6/310-632--WNGII......AGNQYYDSKNEQMAKLNQEL---------------------EGKVADSLSSISS..QADRIY-LWEK
Q99ZX4_STRP1/77-422--WNSII......AGNDAYDKTNPDMVTFHNKA---------------------EKDAQNIIKSYQGPDHENRTY-LWEH

PF09093

C6Y213_PEDHD/219-572--.TLAE------GVTRQELLDLELISSRYIDMIMPVK.GTL...VKNM.....LEEIEKGFAYWNI--RRE..GSRISG
R5VIM9_9BACE/215-567--..LKP------.VSEKELQDMHLMEKRYRDLIYT.P.GKL...SQKQ.....IDKIRRKYDAYKI--VYKN.G.KVSG
R6L6G0_9BACE/214-569--IALTP------.VSDVQKQEMRVIEKRFRDMLYT.P.GKL...SDKE.....MAAIRKQYDFYKI--TYRN.G.KVSG
E6SWL0_BACT6/213-564--IALTP------.VTEAQRRDIRIIEERFRNMLYT.P.SVL...SEKE.....MEAIRKKYDFYKI--TDKN.G.KVSG
R6L598_9BACE/204-548--IPRPA------KLTEQQRRDLKTIEERLNEALTPPA.ASA...VTAA.....VKKAVATYAKADI--YPS..GSGFTG
D4IKB3_9BACT/216-561--..PLR------DVTPAEKAQLDAVKSRIESIVAANM.SSANYINGTI.....IPRARATFEKAAI--RRTDDG.GIIG
B4F1D7_PROMH/243-604--VQPQL------PVTPENLAAIDLIRQRLINEFVGGE.KETNLALEEN.....ISKLKTDFEALNI--RPLSDG.GMQG
Q0WIL0_YERPE/254-620--PAKLP------APTAGEIAAADDIRGALIRVFTEGQGGENGLVVVDN.....REKLRAHFAALKI--QRDADG.QLSG
Q8A2F5_BACTN/203-547--VPLLS------KLTTRQKKDLKTIEQRLTEFL..DV.KKA...PQGQ.....INAARKTFERAAI--APSAAGTGFTG
R5MQB1_9BACE/206-547--.PLPS------TLTQAEKEELRTVEQRLTTAL..DI.QKA...PKEA.....VSKAYDVFQKTNI--QRS..GTGFTG
R6CX81_9BACE/213-568--.ALTP------.VTEAEKADVRKLEERFKSIIFN.P.GKV...TEKT.....LASIRKKFAFYQI--TYNEKG.EISG
R6CKP2_9BACE/202-544--LPLSN------SLTADEKNELNTVESRLTAAL..DI.KKA...PKKE.....VAKAYNTFKAANI--RPS..GNGFTG
R5IB67_9PORP/214-568--ITLEA------TVTPQQKKEIALLESRLREIIYQ.P.SQL...IDKT.....MQSIRKAYARYGI--TYNNRG.EVKG
R5J7L6_9BACE/215-571--IPLEA------TVSNTQKQEIEIIEKRLREIICP.P.GEV...TSQT.....IANLRKAYEHYGI--VYKD.G.KVAG
CABC2_BACTN/204-560--IELTP------.VSDRQRQEMKLLEKRFRDMIYT.K.GKV...TEKE.....AETIRKKYDLYQI--TYKD.G.QVSG
C5B905_EDWI9/243-604--ATPTL------AMTPASQAGVELIRQRLIDEFVNGP.QDSTLKAEAD.....LGKLRAAFDALQI--RQAADG.TLSG
F9D2N7_PREDD/212-567--IALTP------.LTAQERQEMKAIEGRYRDLIFA.P.GKL...YNKV.....KQELHSDFAKYDI--KEKG.G.NVTG
R5I8R5_9PORP/196-548--LNYSY------PASSEQKEALSTIKERIDNWFLNTNHTSTIFNKRKNSINNWIKRAQNNFTSINL--IVQNDG.SVLG

PF04850

Q8B9K4_NPVR1/314-700EVINTVGLTRAIENVGSPEGVVVPGVMSRNGTLYSNVIGNFITYPLAVH-----SADYSKVLTKLSKTYYGSVVG-VTNR
Q91F16_GVCPM/302-683DVLNDEGLTRSIQNVASPEGIVNPAVMSRNGTLFSNVIGAFVQYPITVH-----SADHSKVLTKLSNMYYGCVVG-TTPR

PF08124

HYSA_PROAC/46-376LR.........-------------KEQSPFI..TKT-ARAIESMAC-AWATPGSSYHKDPEILSACIEGLRDFCRLRYNP
Q8DZB2_STRA5/347-671LD........N-------------LNNSAQL..TAT-YRRLEDLAK-QITNPHSTIYKNEKAIRTVKESLAWLHQNFYNV
Q034G7_LACC3/85-397KS........S-------------DTTSADY..TSM-FTNIKMLTL-GYYNPVSQQHQNPEVYQAIIDAIDFMETAKKYN
Q82ZM8_ENTFA/271-596KP........S-------------DTVSADY..TTQ-FTNIKKLAL-GYYEPSSELFEKPEVYDAIVKGIEFMIDTKKYN
Q7MP30_VIBVY/51-385LPLQTDNAEQK-------------RKLGIQL..YAT-YQRIFTLAR-AYKLPGGELENDPQLLAMLVESLAFLHDNFYHV
Q8A3J0_BACTN/19-332VQGCFIDIDYA-------------RRDRTNWMPLIH-VDRLYDFVF-AYTHPKNSYYQNEDLYHKIVKGLEYWHHRNPHC
Q837L8_ENTFA/241-573EP........G-------------NTPSADL..TTQ-FTKLQKLAL-AYGTKGSTLYQDDKLAATIIDGLDFMVTQKGYD
Q82JQ0_STRAW/45-368HP.........-------------FDPPSGI..TQS-YSRLWTMTQ-AYVQEGTGSTGDAGLLADIVRGLDHVSATVYNP
A1R957_ARTAT/40-374IPLTG..IGQS-------------TAATGNM..GLH-FNRLYDMAL-GYAVPGNPFAGNPALAADIVAGLQLLSSTAYKP
Q5DYT2_VIBF1/47-382LPLI....DKD-------------TTLGPNI..RNS-YQRLFTMAK-AYRLRDGNLENNQLMLNDIMTAMNYINQNFYFV
A0JVM2_ARTS2/50-371LS.........-------------LAKDTDL..VTT-HTRLATMAT-AWATPGSEHFADAGLLAAIRAGLADANSLCYNA
CSLA_PEDHD/26-332VP.......YK-------------DDAMTNWLPNNH-LLQLETIIQ-AYIEKDSHYYGDDKVFDQISKAFKYWYDSDPKS
Q7MP31_VIBVY/73-381LPLATATEQDK-------------KQLGDQL..YKS-YQRLFTMAQ-AYQLPKSDLYQSVELLDVITEGLAILNQHFYKV
Q8CWU3_STRR6/310-632FS........N-------------YKTSANL..TAT-YRKLEEMAK-QVTNPSSRYYQDETVVRTVRDSMEWMHKHVYNS
Q99ZX4_STRP1/77-422AK........D-------------YSASANI..TKT-YRNIEKIAK-QITNPESCYYQDSKAIAIVKDGMAFMYEHAYNL

PF09093

C6Y213_PEDHD/219-572RPVYSMNDTELVSLSPAENVKE..ANRLSGI--KRY.TQLMLQVAQ.AFHAGTDAK.EKLRLENIFMDMLDHLEDQGWAY
R5VIM9_9BACE/215-567LPIFMVRQSEAYERMIPHWNKDMFTKLGMEM--KAY.FDLMKTIAV.AYHNAQDAQ.VKQEMRQKFMAMYDHITDQGVAY
R6L6G0_9BACE/214-569LPIFMVRQSEAYERMIPDWDKDMFTKLGMEM--DEY.FKLMKRIAV.AYNNATDVA.IQNELKQKFLAMYDHITDQGVAY
E6SWL0_BACT6/213-564LPIWFVRQSEAYERMMPGWDKDMFVRLGVEI--SDY.FNLMKRISI.AYHNTTDAA.LREELKQKFLAMYNNATDQGIAY
R6L598_9BACE/204-548APLLAPDELHR.............DKGELSW--NDL.EAMLAGFAYDAYCNKS......YEAESNYFAVWEYAIDQGFAY
D4IKB3_9BACT/216-561APLLSNDECNR.............PKGELRL--DDI.ENMLNAFALNSHINKD......PQYDDDFFLVMDHAIDQGFAF
B4F1D7_PROMH/243-604RHLITDKQTIIYQPEQLNSQDKQLFDNYVIL--GNY.TTLMFNISR.AYVLEKDPT.QKEQLKQMYLLMTKHLLDQGFVK
Q0WIL0_YERPE/254-620RHIITDKQKVLYQPEFMDDIDQQRFSDYVLL--GDY.TTLMFNISR.AYQRSTSEE.VRQELADMYILMTQHLLDQGYMD
Q8A2F5_BACTN/203-547TPVVAPDEQDK.............KKGEMSW--NDI.ETMLAGFAYDAFYNQN......ETSKKNYFTVFDYAMDQGFAF
R5MQB1_9BACE/206-547APILTPDELDR.............SKGEISW--NDL.ETMLSGFAYDAYYNHS......GSSRQNYFTVWDFAINQGFSF
R6CX81_9BACE/213-568VPIFFARAAEKFERIIPNWSKDMINKQGNEL--KAY.FDLMNRIAI.AYNQTDAPE.IKAEMKDMFLKMYEHATDQGIAA
R6CKP2_9BACE/202-544APVVAPDELDR.............KKGEMSW--NNL.EEMLAGFAYDAYYNHS......EQAQKNYFLVWDYAIDQGFAF
R5IB67_9PORP/214-568MPLFFGRAVEAYERIVPNYNPNIFNDNHMEL--KEY.FNLMNKIAI.AYNNATEEK.DKLELEKMFLAMYDHVTDQGVAY
R5J7L6_9BACE/215-571LPLFYGRAAEAYERILPNWKGNLMAANNMDV--SSF.FNLMNRIAV.AYNNTTNPQ.DKAVLKQMFIAMYDHITDQGVAY
CABC2_BACTN/204-560VPIFMVRASEAYERMIPDWDKDMLTKMGIEM--RAY.FDLMKRIAV.AYNNSEAGSPVREEMKRKFLAMYDHITDQGVAY
C5B905_EDWI9/243-604RHLITDKQKILYQPEHLSAQDKAKFDRYVIL--GDY.TTLMFNISH.AYRQNSDPA.VQRQLADMYLLMTRHLLDQGFAR
F9D2N7_PREDD/212-567KGIWFVRHAEAYERMVTPWDKELLTRTGFEM--GAY.FTLMKKIAI.AYNKADNDD.DREDMADMFLKMYDHITDQGVAY
R5I8R5_9PORP/196-548PGLFPQYASTSID...........NENILRF--RDTNEKYLIQFALDYRLNHN......ETSKENYLKILDWYADQGWSC

PF04850

Q8B9K4_NPVR1/314-700LAYYESDPTNNIQAPLWTMARRIWNRRGRII---NY-NANTVSFESGIILQSLNGIMRIPSGTTSTQSFRPAIGQTAIAK
Q91F16_GVCPM/302-683LAYYEADPTNNVQGPLWAMNRRIWNRSKPVI---NY-TVNSVLFESGVLCQTPNGLLPVPSTTTSTQSFRPQIGETAIVK

PF08124

HYSA_PROAC/46-376SQD........EYG.NWWDWEDGASRAVADVMCILHDVLP...PEVMSAAAA-GIDHFIPDPWF...QQPASVKPTANPV
Q8DZB2_STRA5/347-671NKD.......IEGSANWWDFEIGVPRSITGTLALMYNYFT...DAEIKTYTD-PIEHFVPDA........GFFRKTLVN.
Q034G7_LACC3/85-397GSY........STG.NWWDWQIGSAQQLDDTLILLYNDLHRQDPEKLVKFVQ-PLLGYAKDP.............NIQW.
Q82ZM8_ENTFA/271-596GTY........YTG.NWWDWQIGSAQPLTDTLILLHDDLLNTDAEKLNKFTA-PLMLYAKDP.............NIQW.
Q7MP30_VIBVY/51-385GTA........EWG.NWWHWQLGIGRVANNTLVVLYDELP...QEIISNYVD-ASRYFVPRPTHL..SEGYGAPYSSAP.
Q8A3J0_BACTN/19-332N..............NWWYNQIAEPQKLGILLIQMRVGKRQIPEVLETKVLQ-RMRKDGGHP..................
Q837L8_ENTFA/241-573GKK........YHG.NWWDWQIGVPQKFLNILMILEDKVS...PEKQQIYTN-ALSSYVPDPFKQLYTKPQGTFVDLAFI
Q82JQ0_STRAW/45-368TTT........RYG.NWWEWQIGSPRLLMDIVAALHDRLS...AARRAAACA-AVGHFIPDD.............MLRD.
A1R957_ARTAT/40-374STK........AAG.NWWFWEIGVPRKTVDILTLLHAEVP...EALRTSLLA-AVRWFAPNPN......WRGRATSLA..
Q5DYT2_VIBF1/47-382NQL........EYG.NWWQWELAIPKDIHNILVLLFDDIKDNYQTIITNHLN-ATRYFTPDPTHL..GVSPGAAESTNP.
A0JVM2_ARTS2/50-371SKE........EQG.NWWSWEIGTPKALADTMVLLHAELT...AAERAAYCA-AIDHFVPDP.........WQQFPPKR.
CSLA_PEDHD/26-332R..............NWWHNEIATPQALGEMLILMRYGKKPLDEALVHKLTE-RMKRGEPEK..................
Q7MP31_VIBVY/73-381GVE........EWG.NWWHWQLGISRVANNILVLMYQELP...ASLVTNYID-AIEYFVPNPTHL..SEGAGASASSMP.
Q8CWU3_STRR6/310-632EKS........IVG.NWWDYEIGTPRAINNTLSLMKEYFS...DEEIKKYTD-VIEKFVPDP........EHFRKTTDN.
Q99ZX4_STRP1/77-422DRENHQTTGKENKE.NWWVYEIGTPRAINNTLSLMYPYFT...QEEILKYTA-PIEKFVPDP........TRFRVRAANF

PF09093

C6Y213_PEDHD/219-572GSG--------MGALHHHGYNL---EGYYPSCLLMKDVIKR--QGKLERTFQ-SMSWFSG..--------LGRTLQRPLP
R5VIM9_9BACE/215-567GSC--------WGNIHHYGYSV---RSLYLSYFLMKDVLRE--ENRLAEAEA-TMRWYAI..--------TNEVYPKPTG
R6L6G0_9BACE/214-569GSC--------WGNIHHYGYSM---RGLYVAYFLMKEVLNE--AGKLNEAER-TLRWYAI..--------TNEVYLKPTV
E6SWL0_BACT6/213-564GSC--------WGNVHHYGYSM---RGLFVSYFLMKDVLRE--AGRLEEAER-TLNWYAI..--------TNEVYPEPTA
R6L598_9BACE/204-548GSG--------MGTNHHYGYQI---RKIYTTAWLMRKAILK--SSRRDDILK-TLLFWSA..--------LQET.RLPCA
D4IKB3_9BACT/216-561GHG--------NGTNHHYGYNI---RKIYDAMWLMRDKIAA--RGKTDEYVK-VLAYWSG..--------LAET.RKPYV
B4F1D7_PROMH/243-604GSA--------LVTTHHWGYSS---RWWYISTLLMADALKE--ANLQTEVYD-SLLWYSREF--------KSSFDMKVGA
Q0WIL0_YERPE/254-620GSG--------LVTTHHWGYSS---RWWYISAMLMANELDK--HQLRQPVSD-ALLWYSREF--------KANFDMVPGP
Q8A2F5_BACTN/203-547GSG--------MGTNHHYGYQV---RKIYTTAWLMRDAIYK--HPHRDAYLS-TLRFWAA..--------LQET.RQPCP
R5MQB1_9BACE/206-547GSG--------MGTNHHYGYQV---RKIYTTAWLMRDAIWK--APNRDNILS-TLIFWSA..--------LQET.RQPYQ
R6CX81_9BACE/213-568GSC--------LGNFTHYGYSF---RGFYTSYFLMKDVLRQ--AGKLNEAEQ-AMLWYAI..--------TNEIYRKPTE
R6CKP2_9BACE/202-544GSG--------MGTNHHYGYQV---RKIYTTAWLMRDAIWK--APNRDNILS-ALIFWSA..--------LQET.RIPFQ
R5IB67_9PORP/214-568GSC--------LGNFTHYGYSF---RGYYTSYFLMKDVLRK--AGKLDDAEK-GMRWYSI..--------ANEVFIKPDV
R5J7L6_9BACE/215-571GSC--------LGNITHYGYSF---RTFFTAYFLMKEVFKE--IGKQEEAEK-AMLWYST..--------VNDVYNKPQT
CABC2_BACTN/204-560GSC--------WGNIHHYGYSV---RGLYPAYFLMKDVLRE--EGKLLEAER-TLRWYAI..--------TNEVYPKPEG
C5B905_EDWI9/243-604GSG--------LVTTHHWGYSA---RWWYISALLMNPVLDQ--ARLTQPVYD-ALLWYSREF--------KASFDMKVGP
F9D2N7_PREDD/212-567GSC--------WGNIHHYGYSL---REMYPAYFLMKDVLRK--AGKLAEAER-TMIWYAQ..--------TNEVYIRPVI
R5I8R5_9PORP/196-548GSA--------LGALRFEKLRS---AGYFHSLYLMKDELGD--S.RFSRELE-TLKWFSL..--------LGDIYINTDN

PF04850

Q8B9K4_NPVR1/314-700TDT--------AGAILVYAKFAEMNNLQFKSCTLFYD------HGMFQLYYNIGVEPNSLNSTNGRVVVLSRDTSVNTND
Q91F16_GVCPM/302-683TNN--------TGAMLSHSLFAELNDLQFVSCTLYYD------EGMFQLYYNMGVREGVLGNNNGRVVVLARDTAVSTPD

PF08124

HYSA_PROAC/46-376QPVVSTGANRMDLTRAVMCRSIATGDEKRLRHAVDGLPD........AWRVTTEGD------G---FRADGGFIQH....
Q8DZB2_STRA5/347-671.PFKALGGNLVDMGRVKIIEGLLRKDNTIIEKTSHSLKN........LFTTATKAE------G---FYADGSYIDH....
Q034G7_LACC3/85-397PAYTATGANLTDISISVLASGLLLEDDKRVALVQQNLPK........AMGLVTAKD------G---IYADGSFVQH....
Q82ZM8_ENTFA/271-596PIYRATGANLTDISITVLGTGLLLEDNQRLVQVQEAVPS........VLKSVSSGD------G---LYPDGSLIQH....
Q7MP30_VIBVY/51-385LMFESTGGNRTDNAQVVLIRGILDNNENEIKSAVESLSS........IIPFVTEGD------G---FYQDGSFIQH....
Q8A3J0_BACTN/19-332..ARWTGANRTDIALHWIYRACLQKNDVDLKTAVENVYS........PLSYTVK.E------G---FQHDNSYFQH....
Q837L8_ENTFA/241-573PNFVTSGANRTDLALTVLGLGILQKDSGKINQASSSIVD........VFKLVTKGD------G---FYQDGSFIQH....
Q82JQ0_STRAW/45-368YSGTSTGANRVDLCRGVALSGILGRAPDRIALARDALSP........VFPYVTQGD------G---LYADGSFVQH....
A1R957_ARTAT/40-374....ETGANRVDKSLACCMRGILDNNVGDIALGRDALSDTVRGGTNSVFTYVSSGD------G---FYADGSYVQH....
Q5DYT2_VIBF1/47-382NYRESTGGNRTDNAQVVLIRGMLENNSEEISQAIAALPA........VIEYVSEGD------G---YYTDGSFLQH....
A0JVM2_ARTS2/50-371GKITSVGANRVDLCQAVTIRSLVDEDAEKLTHAVAGLSE........VWQYVSAGN------G---FFTDGSFIQH....
CSLA_PEDHD/26-332....KTGANKTDIALHYFYRALLTSDEALLSFAVKELFY........PVQFVHYEE------G---LQYDYSYLQH....
Q7MP31_VIBVY/73-381RPFESTGANRVQNVQVVLVRALLANDQDAFQTAVDALEP........VITFVESGD------G---FYSDGSFIQH....
Q8CWU3_STRR6/310-632.PFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQ........VFKLVDQGE------G---FYQDGSYIDH....
Q99ZX4_STRP1/77-422SPFEANSGNLIDMGRVKLISGILRKDDLEISDTIKAIEK........VFTLVDEGN------G---FYQDGSLIDHVVTN

PF09093

C6Y213_PEDHD/219-572SSN...IDVFNTLLGSMLSSILIMDNSPEKLRYLHSFSN--------WLSENVKPD.HTIEGA---FKPDGAVFHH----
R5VIM9_9BACE/215-567NGID..MDSFNTQTSGRIASILMMEDTPEKLRYLRAFSR--------WIDYGCRPA.PGLAGA---FKSDGAAFHH----
R6L6G0_9BACE/214-569NGID..IDSFNTQTQGRMASILIMEDTPEKLQYLRSFSR--------WLDYGCRPA.QGLSGS---FKKDGACFHH----
E6SWL0_BACT6/213-564NGID..IDTFNTKLQGRIASILIMEDTPEKLQYLRSFTR--------WLDYGCRPA.KGLSGS---FKADGACFHH----
R6L598_9BACE/204-548EIRDEMLDSWNTLLQPKLIAAMMIPDECGRVQALRGLSR--------WVSGSVNCT.PGTIGG---IKVDGTTFHH----
D4IKB3_9BACT/216-561YGRDELLDSWHTLLIPKIVSALMLPDEAEQYRAMKSLGV--------WLSGSLDFT.PGTIGG---IKPDGTTFHH----
B4F1D7_PROMH/243-604NSSD..LDYFNTLSRQHLALLLLEPDDQKRINLVNSFSH--------YITGALTQVPPGSKDG---LRPDGTAWRH----
Q0WIL0_YERPE/254-620ESSD..LDYFNTLSRQHLALLMLESDPAKRVALLKRFGE--------YINVALSQTPPGGYDG---LRPDGTAWRH----
Q8A2F5_BACTN/203-547PERDELLDSWHTLLMAKFISAMMFPDAREQEQALNGLSR--------WLSSSLNYT.PGTLGG---IKVDGTTFHH----
R5MQB1_9BACE/206-547YGRDELLDSWHTLLMAKTVSALLFTDERERVRALKGLSR--------WVSSSLQYT.PGTIGG---IKVDGTTFHH----
R6CX81_9BACE/213-568NGID..MDSFNTQTTGRIASILIMEDTPEKMRYLRSFQR--------WIDWGCRPA.NGLQGS---FKVDGGAFHH----
R6CKP2_9BACE/202-544YGRDELLDSWHTLLMAKTVAALLFVDERERARALAGLSR--------WLSGSLQYS.PGTIGG---IKVDGTTFHH----
R5IB67_9PORP/214-568WGLD..MDSFNTTTTGRIASILMMEDSPEKVQYLKAFSR--------WINNGCLPA.DGLLGS---FKPDGGAFHH----
R5J7L6_9BACE/215-571AGID..IDFFNTLSTGRIASILFMEDTPEKVQYLKSFSR--------WIDNGCLPA.EGLNDA---FKADGSAYHH----
CABC2_BACTN/204-560NGID..MDSFNTQTTGRIASILMMEDTPEKLQYLKSFSR--------WIDYGCRPA.PGLAGS---FKVDGGAFHH----
C5B905_EDWI9/243-604ESSN..LDYFNTLSRQHLALLLLEPDPQQRIDLLNSFSH--------YISDALAQTPPGSNDG---LRPDGTAWRH----
F9D2N7_PREDD/212-567NGMD..MDTFNTAASGCMASILLMEDSPEKVQYLRSMAR--------WLDWGARPA.QGLMDS---FKSDGSAYHH----
R5I8R5_9PORP/196-548DASGETADNLRTLAIAKLYCALMLSDENAQTETLLTLKE--------YFTNALSPA.GGFRGT---FKPDFTGYHH----

PF04850

Q8B9K4_NPVR1/314-700LSFETQRINNNNSSEGTTFNGVVCHRVPITNMNVPSLTVRSPNSNVELVEQIISFQTMYTATASACYKLNVEGHSD----
Q91F16_GVCPM/302-683ATFAQQREDNGNTSDGTVYNGVVCYRVPITGLSVPSLSTRVQGS.VEIVEQVIGFDALHNKEGVCSYKLNVEGMAD----

PF08124

HYSA_PROAC/46-376.......SHIPYTGGYGDVLFSGLAMLFPLVSGMRFDIVESARKAFHDQV-------ERGFIPVMYNGQILDDVRGRSIS
Q8DZB2_STRA5/347-671.......TNVAYTGAYGNVLIDGLTQLLPIIQETDYKISNQELDMVYKWI-------NQSFLPLIVKGELMDMSRGRSIS
Q034G7_LACC3/85-397.......TFFPYNGSYGNEMIKGIARVSSTLVGTPWAISEVQFANVFNLI-------DKGFLQLMVNGRMPSMLSGRSIS
Q82ZM8_ENTFA/271-596.......GYFPYNGSYGNELLKGFGRIQTILQGSDWEMNDPNISNLFNVV-------DKGYLQLMVNGKMPSMVSGRSIS
Q7MP30_VIBVY/51-385.......KDLPYSGTYGQVMVEGLGMLMGLVANTPWQANDPNLQKIYPLL-------LEAFAPLLVDGKMMDMVNGRAIS
Q8A3J0_BACTN/19-332.......GVQLYIGGYGDEILKGVTQVALYTKGTKYALDDERIQFLRHFM-------CGTYYQVIRGQYMLFDVLGRGVS
Q837L8_ENTFA/241-573.......NNIPYTGSYGNVLVKGVGQILAITADSSFQMDATLVTEFVENV-------DRAFLPLIYKGEMLPTVNGRSIS
Q82JQ0_STRAW/45-368.......TWVAYSGTYGQVLLDGLGRLFSLFAGSTWDVTDPNRQIILDSV-------EQAYAPLIHDGLVMDSVNGRAIS
A1R957_ARTAT/40-374.......SYLPYAGTYGVVALAGIAEIIAMLGGSSWAINDPKRTVLLDAV-------EDTYAPFVWDGRIMDTIRGRAVS
Q5DYT2_VIBF1/47-382.......SDIAYNGTYGNVLLGGLGIQMNAVAGSPWSMDNQTISNVYNII-------NQSYEPLLYKGAMMDMVNGRSIS
A0JVM2_ARTS2/50-371.......STTPYTGSYGVVLLTGLSKLFALLGGTGAEVSDPSRDILFKTV-------EGSFAPFMVAGAMADSVRGRSIS
CSLA_PEDHD/26-332.......GPQLQISSYGAVFITGVLKLANYVRDTPYALSTEKLAIFSKYY-------RDSYLKAIRGSYMDFNVEGRGVS
Q7MP31_VIBVY/73-381.......TDIPYNGSYGNELLEGLGLLLGTIASAPWNEQTEQYSAIYSLL-------LEAYAPFLVDGRMMDMVNGRAVS
Q8CWU3_STRR6/310-632.......TNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWI-------DKSFAPLLVNGELMDMSRGRSIS
Q99ZX4_STRP1/77-422AQSPLYKKGIAYTGAYGNVLIDGLSQLIPIIQKTKSPIKADKMATIYHWI-------NHSFFPIIVRGEMMDMTRGRSIS

PF09093

C6Y213_PEDHD/219-572-------GNL-Y.PAYGIGGYTGISPVVFALSGTSFRMDQEAHESLRNSLLMMHYYTHPFKWPVSVAGRHPTG..SWRIA
R5VIM9_9BACE/215-567-------RNN-Y.PAYAVGGLDGATNMIYLMSGTTFAVSELAHQTVKDVLLTMRFYCNQQQFPLSMSGRHPNG..KGKLI
R6L6G0_9BACE/214-569-------RNN-Y.PAYAVGGLDGATNMIYLLSGTEFKVSELAHSTVKNVLLTMRFYCNLKQWSLSMSGRHPNG..KGELI
E6SWL0_BACT6/213-564-------CNN-Y.PAYAVGGLDGATSMIYLLSGTEFRLSEQAHETVKNVLLTMRFYCNLKQWALSMSGRHPNG..KGELI
R6L598_9BACE/204-548-------GGF-Y.PAYTTGALATVSDYIAMTGGTEFVPSLEARRLLAGAFTAMRNYSNLTEWSTGLGGRHPFG..GKMGG
D4IKB3_9BACT/216-561-------GGF-Y.PAYSTGAFAMIGYFCKATRGTDFTLSEQARRNFKLALMTMASYTDLRDWGLGLAGRHPFGKNGRIPD
B4F1D7_PROMH/243-604-------EGN-Y.PGYSFPAFKNASQLIYLLRETPFAVGESGWNNLKKAMISAWIYSNP.EVGLPLAGRHPFN..SPSLQ
Q0WIL0_YERPE/254-620-------EGN-Y.PGYSFPAFKNAGQLVYMLHGTPFAVSDEGRAALKKAMLSAWVYSNP.ATSLGLAGRHPFN..SSSVT
Q8A2F5_BACTN/203-547-------GGF-Y.PGYTTGVLATIGQFIALTNGTGFELTEEARQHIKSAFLAMRNYCNLYEWGTGISGRHPFG..GKMGS
R5MQB1_9BACE/206-547-------GGF-Y.PAYTTGVLAMVGQFISLTNKTVYEPTEEARQVLKSAFIAMRNYSNKYEWGVGISGRHPFG..GSMKA
R6CX81_9BACE/213-568-------CNN-Y.PAYAVGGLDGATNMIYLLSGTQFGVSELAHKTVKNSLLAMRFYCNTLYFPLAMSGRHPDG..KGRLI
R6CKP2_9BACE/202-544-------GGF-Y.PAYTTGVLAMAGQYIALTNNTRYVPTVEARQVLKSAFISMRNYSNIYEWGIGLGGRHPFG..FGMKE
R5IB67_9PORP/214-568-------CNN-Y.PAYAVGGLDGATNMIYLLSRTSFAVSELGHNTVKNVLLAMRFYCNKLDFPWSMSGRHPDG..KGKLV
R5J7L6_9BACE/215-571-------CNN-Y.PAYATGGLTGATNMIYLLSHTGFAVSELAHQTVKEVLLTMRFYCNKRSFPLSMSGRHPNG..KGELI
CABC2_BACTN/204-560-------RNN-Y.PAYAVGGLDGATNMIYLFSRTSLAVSELAHRTVKDVLLAMRFYCNKLNFPLSMSGRHPDG..QGKLV
C5B905_EDWI9/243-604-------EGN-Y.PGYSFPAFKNAAQLAYLLRGTPFALQQDGLDKLKQAMVAAWIYSNP.QTGISLAGRHPFN..SPSLE
F9D2N7_PREDD/212-567-------CNN-Y.PAYAVGGLNGVTQMIYMLSGTSFAVGQLAHETVKKALLAMRFYCNRNHFPLSMSGRHPDG..MGHLT
R5I8R5_9PORP/196-548-------RGV-YLGAYYPDALYIGCFLFYLLHDTPFELSESIYIQLKNSLLMLRNIAALYDVPATTCGRFPNS..NTVLD

PF04850

Q8B9K4_NPVR1/314-700-------SLRAFRVNSDENIYVNVNNGVKALFNYPWVMVKENNKVSFMSA------NEDTTIP...FSVIMNSFTSIGEP
Q91F16_GVCPM/302-683-------NLKVYML..EVGVLYAVANHTKALFRYPYVALKDGDRLAVSSV------EESLVLSEEVLNVIKNDIQERG..

PF08124

HYSA_PROAC/46-376RINES.........AA..MHGISIARAMLMMADALPTHRA..EQWRGIVHG----
Q8DZB2_STRA5/347-671REAAS.........SH..AAAVEVLRGFLRLANMSNEERN..LDLKSTIKT----
Q034G7_LACC3/85-397RAPGT.............ECGNHGV......GDWQRDVSQ..SDLDCRGNA----
Q82ZM8_ENTFA/271-596RAPETNP....FTTEF..ESGKETIANLTLIAKFAPENLR..NDIYTSIQT----
Q7MP30_VIBVY/51-385RISGQ.........NQ..KVGQAMLSSMLLYLPGAPENYK..QQLGEFLKS----
Q8A3J0_BACTN/19-332RNNAT.........QK..SHAALFAKRMLEL...APAHID...EYNAIIAR----
Q837L8_ENTFA/241-573RAPAV.........GK.TGYGSTTMYNLLIVAKFAPNNYQ..KKFQEAVKY----
Q82JQ0_STRAW/45-368RGYLKSDDLHVMRGDH..FHGQALIAAIALLAGGAGPQER..ARWHARIKG----
A1R957_ARTAT/40-374RQREP.........DY..VSGFGLISAVLLLAPGCEEPYR..SRFLALAKG----
Q5DYT2_VIBF1/47-382RSAEQ.........NH..DVGLNIVNSMLFYTNGPDSDKN..KQLSSLIKT----
A0JVM2_ARTS2/50-371RESNT.........GF..DLGASTIESILLLARAVDPVTA..RRWRSLCLA----
CSLA_PEDHD/26-332RPDIL.........NKKAEKKRLLVAKMIDL.KHTEEWADAIARTDSTVAA----
Q7MP31_VIBVY/73-381RLSGQ.........NH..KIGHAVLNSMLFFIESAPSNVK..KQLQSVIKT----
Q8CWU3_STRR6/310-632RANSE.........GH..VAAVEVLRGIHRIADMSEGETK..QRLQSLVKT----
Q99ZX4_STRP1/77-422RFNAQ.........SH..VAGIEALRAILRIADMSEEPHR..LALKTRIKT----

PF09093

C6Y213_PEDHD/219-572DL..P-------------YAYMAMAGTPDGK.NKTDSLMA--AIYLKLNEGKKNR
R5VIM9_9BACE/215-567PV..Q-------------YAMMAISGTPDGK.EKYDADMA--AAYLRLVREPAK.
R6L6G0_9BACE/214-569PI..Q-------------YATMAIAGTPDGK.QKYDTDMA--AAYLRLTAYSNTS
E6SWL0_BACT6/213-564PM..H-------------YATMAVAGTPDGR.QKYDPEMA--AAYLRLVAY....
R6L598_9BACE/204-548ADIKA-------------FAQLALSGDLSGQGGEFDHALA--ADYLRLMNGKNSP
D4IKB3_9BACT/216-561ADVNA-------------FGYLAALGDLTGSGKGADPELA--GAYLRLKGTD...
B4F1D7_PROMH/243-604SIAQG-------------YYWLAMSAQPAP.....DKQLA--SIYLAISGKSRNE
Q0WIL0_YERPE/254-620LFQDA-------------FRWLALTGDPKTG.DKVDKALA--AAYLQITETPESE
Q8A2F5_BACTN/203-547DDIEA-------------FANIALSGDLSGQGNTFDHGLA--ADYLRLIRDRNTR
R5MQB1_9BACE/206-547DDVAA-------------FAYLALSGDLSGEGNAFDHHLA--ADYLRLCEKDTPE
R6CX81_9BACE/213-568PL..H-------------YAQMALAGTPDGK.EAIDAEMA--SAYLRLAAANNGE
R6CKP2_9BACE/202-544DDVAS-------------FAYIALAGDLSGEGNTFDHHLA--ADYLRLCDKDTPE
R5IB67_9PORP/214-568PM..H-------------YAMMALAGTPDKS.QTIDKEMG--NAYLRLVTNV...
R5J7L6_9BACE/215-571PS..H-------------YAIMALAGSPDRH.QEIDTAMA--GAYLRLTEKPYKR
CABC2_BACTN/204-560PM..H-------------YAMMAIAGTPDGK.GDFDKEMA--SAYLRLVSSDSSS
C5B905_EDWI9/243-604SLTNA-------------YYWLAISYDKRP.....DATLA--AIYLRLANKTAAD
F9D2N7_PREDD/212-567PV..H-------------YALMAFSGTPDKK.STIDPEMG--AAFIRLMPEPKSA
R5I8R5_9PORP/196-548DLVAA-------------FAYLIESK......NGTDNELN--AAFGRLWKPEESP

PF04850

Q8B9K4_NPVR1/314-700ALQYS-------------PSNCFVYGNG.FRLNNSTFDLQFIFEI----------
Q91F16_GVCPM/302-683..ATT-------------PVNC.VYNSGVYTLTNNNY.LQFWFDY----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window